data_4R8A
# 
_entry.id   4R8A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4R8A         
NDB   NA3163       
RCSB  RCSB087024   
WWPDB D_1000087024 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4R89 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4R8A 
_pdbx_database_status.recvd_initial_deposition_date   2014-08-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cho, Y.'    1 
'Gwon, G.H.' 2 
'Kim, Y.R.'  3 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of a Fanconi anemia-associated nuclease homolog bound to 5' flap DNA: basis of interstrand cross-link repair by FAN1
;
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            28 
_citation.page_first                2276 
_citation.page_last                 2290 
_citation.year                      2014 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25319828 
_citation.pdbx_database_id_DOI      10.1101/gad.248492.114 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gwon, G.H.'      1  
primary 'Kim, Y.R.'       2  
primary 'Liu, Y.'         3  
primary 'Watson, A.T.'    4  
primary 'Jo, A.'          5  
primary 'Etheridge, T.J.' 6  
primary 'Yuan, F.'        7  
primary 'Zhang, Y.'       8  
primary 'Kim, Y.C.'       9  
primary 'Carr, A.M.'      10 
primary 'Cho, Y.'         11 
# 
_cell.entry_id           4R8A 
_cell.length_a           76.581 
_cell.length_b           106.663 
_cell.length_c           142.180 
_cell.angle_alpha        90.00 
_cell.angle_beta         89.97 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4R8A 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Uncharacterized protein'                                                        64610.707 2 ? ? ? ? 
2 polymer syn 
;DNA (5'-D(P*AP*CP*CP*AP*GP*AP*CP*AP*CP*AP*CP*AP*TP*TP*C)-3')
;
4506.965  2 ? ? ? ? 
3 polymer syn 
;DNA (5'-D(P*GP*TP*TP*GP*GP*GP*AP*TP*TP*G)-3')
;
3131.050  2 ? ? ? ? 
4 polymer syn 
;DNA (5'-D(P*GP*AP*AP*TP*GP*TP*GP*TP*GP*TP*CP*TP*CP*AP*AP*TP*CP*CP*CP*AP*A)-3')
;
6422.172  2 ? ? ? ? 
5 water   nat water                                                                            18.015    2 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Nuclease 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MHEQYQAPLPVNSPALPEPFYYLHNFRAVLAWIGERYADLLDDQERAFIAAFAELPEASQALLVRMVMRKGTLFREGKLA
YAEIGDTRAAVQPLLALGWVDAQPTLELAQLFGLLKKDELSQLFRDHLGRANLRKDALLERLQPLFPEARRLAEWQADFA
EPVYELRCMALCDRLRLMYFGNLWQDWSEFVLADLGIYRYESVEFSADSRGFRLRADVDAYLHLFDCRQRFDLGEPLEEL
LAGLPGEPYANPWLEGRRVKLLFQFAQHCEKQRDFDLAQRLYRQSSHPGARLRAIRSLERGERFAEAHALAREASCAPES
DAERQGLARLLPRLQGKLGLPRQARAAAPEIDRLDLCLAFPSEPCSVEWAVREHLEEPGCAVHYVENGLINSLFGLLCWE
AIFAAIPGAFFHPFHSAPADLHSADFRQRRAALFEACLGRLEDGSYRDAIRCRYRDKFGLQSPFVYWELLGEELLEQALD
CLPAAHLRAWFERLLEDIPGNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCYVRWHVDD
;
;MHEQYQAPLPVNSPALPEPFYYLHNFRAVLAWIGERYADLLDDQERAFIAAFAELPEASQALLVRMVMRKGTLFREGKLA
YAEIGDTRAAVQPLLALGWVDAQPTLELAQLFGLLKKDELSQLFRDHLGRANLRKDALLERLQPLFPEARRLAEWQADFA
EPVYELRCMALCDRLRLMYFGNLWQDWSEFVLADLGIYRYESVEFSADSRGFRLRADVDAYLHLFDCRQRFDLGEPLEEL
LAGLPGEPYANPWLEGRRVKLLFQFAQHCEKQRDFDLAQRLYRQSSHPGARLRAIRSLERGERFAEAHALAREASCAPES
DAERQGLARLLPRLQGKLGLPRQARAAAPEIDRLDLCLAFPSEPCSVEWAVREHLEEPGCAVHYVENGLINSLFGLLCWE
AIFAAIPGAFFHPFHSAPADLHSADFRQRRAALFEACLGRLEDGSYRDAIRCRYRDKFGLQSPFVYWELLGEELLEQALD
CLPAAHLRAWFERLLEDIPGNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCYVRWHVDD
;
A,F ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DC)(DA)(DG)(DA)(DC)(DA)(DC)(DA)(DC)(DA)(DT)(DT)(DC)' ACCAGACACACATTC B,G ? 
3 polydeoxyribonucleotide no no '(DG)(DT)(DT)(DG)(DG)(DG)(DA)(DT)(DT)(DG)' GTTGGGATTG C,H ? 
4 polydeoxyribonucleotide no no 
;(DG)(DA)(DA)(DT)(DG)(DT)(DG)(DT)(DG)(DT)(DC)(DT)(DC)(DA)(DA)(DT)(DC)(DC)(DC)(DA)
(DA)
;
GAATGTGTGTCTCAATCCCAA D,I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   GLU n 
1 4   GLN n 
1 5   TYR n 
1 6   GLN n 
1 7   ALA n 
1 8   PRO n 
1 9   LEU n 
1 10  PRO n 
1 11  VAL n 
1 12  ASN n 
1 13  SER n 
1 14  PRO n 
1 15  ALA n 
1 16  LEU n 
1 17  PRO n 
1 18  GLU n 
1 19  PRO n 
1 20  PHE n 
1 21  TYR n 
1 22  TYR n 
1 23  LEU n 
1 24  HIS n 
1 25  ASN n 
1 26  PHE n 
1 27  ARG n 
1 28  ALA n 
1 29  VAL n 
1 30  LEU n 
1 31  ALA n 
1 32  TRP n 
1 33  ILE n 
1 34  GLY n 
1 35  GLU n 
1 36  ARG n 
1 37  TYR n 
1 38  ALA n 
1 39  ASP n 
1 40  LEU n 
1 41  LEU n 
1 42  ASP n 
1 43  ASP n 
1 44  GLN n 
1 45  GLU n 
1 46  ARG n 
1 47  ALA n 
1 48  PHE n 
1 49  ILE n 
1 50  ALA n 
1 51  ALA n 
1 52  PHE n 
1 53  ALA n 
1 54  GLU n 
1 55  LEU n 
1 56  PRO n 
1 57  GLU n 
1 58  ALA n 
1 59  SER n 
1 60  GLN n 
1 61  ALA n 
1 62  LEU n 
1 63  LEU n 
1 64  VAL n 
1 65  ARG n 
1 66  MET n 
1 67  VAL n 
1 68  MET n 
1 69  ARG n 
1 70  LYS n 
1 71  GLY n 
1 72  THR n 
1 73  LEU n 
1 74  PHE n 
1 75  ARG n 
1 76  GLU n 
1 77  GLY n 
1 78  LYS n 
1 79  LEU n 
1 80  ALA n 
1 81  TYR n 
1 82  ALA n 
1 83  GLU n 
1 84  ILE n 
1 85  GLY n 
1 86  ASP n 
1 87  THR n 
1 88  ARG n 
1 89  ALA n 
1 90  ALA n 
1 91  VAL n 
1 92  GLN n 
1 93  PRO n 
1 94  LEU n 
1 95  LEU n 
1 96  ALA n 
1 97  LEU n 
1 98  GLY n 
1 99  TRP n 
1 100 VAL n 
1 101 ASP n 
1 102 ALA n 
1 103 GLN n 
1 104 PRO n 
1 105 THR n 
1 106 LEU n 
1 107 GLU n 
1 108 LEU n 
1 109 ALA n 
1 110 GLN n 
1 111 LEU n 
1 112 PHE n 
1 113 GLY n 
1 114 LEU n 
1 115 LEU n 
1 116 LYS n 
1 117 LYS n 
1 118 ASP n 
1 119 GLU n 
1 120 LEU n 
1 121 SER n 
1 122 GLN n 
1 123 LEU n 
1 124 PHE n 
1 125 ARG n 
1 126 ASP n 
1 127 HIS n 
1 128 LEU n 
1 129 GLY n 
1 130 ARG n 
1 131 ALA n 
1 132 ASN n 
1 133 LEU n 
1 134 ARG n 
1 135 LYS n 
1 136 ASP n 
1 137 ALA n 
1 138 LEU n 
1 139 LEU n 
1 140 GLU n 
1 141 ARG n 
1 142 LEU n 
1 143 GLN n 
1 144 PRO n 
1 145 LEU n 
1 146 PHE n 
1 147 PRO n 
1 148 GLU n 
1 149 ALA n 
1 150 ARG n 
1 151 ARG n 
1 152 LEU n 
1 153 ALA n 
1 154 GLU n 
1 155 TRP n 
1 156 GLN n 
1 157 ALA n 
1 158 ASP n 
1 159 PHE n 
1 160 ALA n 
1 161 GLU n 
1 162 PRO n 
1 163 VAL n 
1 164 TYR n 
1 165 GLU n 
1 166 LEU n 
1 167 ARG n 
1 168 CYS n 
1 169 MET n 
1 170 ALA n 
1 171 LEU n 
1 172 CYS n 
1 173 ASP n 
1 174 ARG n 
1 175 LEU n 
1 176 ARG n 
1 177 LEU n 
1 178 MET n 
1 179 TYR n 
1 180 PHE n 
1 181 GLY n 
1 182 ASN n 
1 183 LEU n 
1 184 TRP n 
1 185 GLN n 
1 186 ASP n 
1 187 TRP n 
1 188 SER n 
1 189 GLU n 
1 190 PHE n 
1 191 VAL n 
1 192 LEU n 
1 193 ALA n 
1 194 ASP n 
1 195 LEU n 
1 196 GLY n 
1 197 ILE n 
1 198 TYR n 
1 199 ARG n 
1 200 TYR n 
1 201 GLU n 
1 202 SER n 
1 203 VAL n 
1 204 GLU n 
1 205 PHE n 
1 206 SER n 
1 207 ALA n 
1 208 ASP n 
1 209 SER n 
1 210 ARG n 
1 211 GLY n 
1 212 PHE n 
1 213 ARG n 
1 214 LEU n 
1 215 ARG n 
1 216 ALA n 
1 217 ASP n 
1 218 VAL n 
1 219 ASP n 
1 220 ALA n 
1 221 TYR n 
1 222 LEU n 
1 223 HIS n 
1 224 LEU n 
1 225 PHE n 
1 226 ASP n 
1 227 CYS n 
1 228 ARG n 
1 229 GLN n 
1 230 ARG n 
1 231 PHE n 
1 232 ASP n 
1 233 LEU n 
1 234 GLY n 
1 235 GLU n 
1 236 PRO n 
1 237 LEU n 
1 238 GLU n 
1 239 GLU n 
1 240 LEU n 
1 241 LEU n 
1 242 ALA n 
1 243 GLY n 
1 244 LEU n 
1 245 PRO n 
1 246 GLY n 
1 247 GLU n 
1 248 PRO n 
1 249 TYR n 
1 250 ALA n 
1 251 ASN n 
1 252 PRO n 
1 253 TRP n 
1 254 LEU n 
1 255 GLU n 
1 256 GLY n 
1 257 ARG n 
1 258 ARG n 
1 259 VAL n 
1 260 LYS n 
1 261 LEU n 
1 262 LEU n 
1 263 PHE n 
1 264 GLN n 
1 265 PHE n 
1 266 ALA n 
1 267 GLN n 
1 268 HIS n 
1 269 CYS n 
1 270 GLU n 
1 271 LYS n 
1 272 GLN n 
1 273 ARG n 
1 274 ASP n 
1 275 PHE n 
1 276 ASP n 
1 277 LEU n 
1 278 ALA n 
1 279 GLN n 
1 280 ARG n 
1 281 LEU n 
1 282 TYR n 
1 283 ARG n 
1 284 GLN n 
1 285 SER n 
1 286 SER n 
1 287 HIS n 
1 288 PRO n 
1 289 GLY n 
1 290 ALA n 
1 291 ARG n 
1 292 LEU n 
1 293 ARG n 
1 294 ALA n 
1 295 ILE n 
1 296 ARG n 
1 297 SER n 
1 298 LEU n 
1 299 GLU n 
1 300 ARG n 
1 301 GLY n 
1 302 GLU n 
1 303 ARG n 
1 304 PHE n 
1 305 ALA n 
1 306 GLU n 
1 307 ALA n 
1 308 HIS n 
1 309 ALA n 
1 310 LEU n 
1 311 ALA n 
1 312 ARG n 
1 313 GLU n 
1 314 ALA n 
1 315 SER n 
1 316 CYS n 
1 317 ALA n 
1 318 PRO n 
1 319 GLU n 
1 320 SER n 
1 321 ASP n 
1 322 ALA n 
1 323 GLU n 
1 324 ARG n 
1 325 GLN n 
1 326 GLY n 
1 327 LEU n 
1 328 ALA n 
1 329 ARG n 
1 330 LEU n 
1 331 LEU n 
1 332 PRO n 
1 333 ARG n 
1 334 LEU n 
1 335 GLN n 
1 336 GLY n 
1 337 LYS n 
1 338 LEU n 
1 339 GLY n 
1 340 LEU n 
1 341 PRO n 
1 342 ARG n 
1 343 GLN n 
1 344 ALA n 
1 345 ARG n 
1 346 ALA n 
1 347 ALA n 
1 348 ALA n 
1 349 PRO n 
1 350 GLU n 
1 351 ILE n 
1 352 ASP n 
1 353 ARG n 
1 354 LEU n 
1 355 ASP n 
1 356 LEU n 
1 357 CYS n 
1 358 LEU n 
1 359 ALA n 
1 360 PHE n 
1 361 PRO n 
1 362 SER n 
1 363 GLU n 
1 364 PRO n 
1 365 CYS n 
1 366 SER n 
1 367 VAL n 
1 368 GLU n 
1 369 TRP n 
1 370 ALA n 
1 371 VAL n 
1 372 ARG n 
1 373 GLU n 
1 374 HIS n 
1 375 LEU n 
1 376 GLU n 
1 377 GLU n 
1 378 PRO n 
1 379 GLY n 
1 380 CYS n 
1 381 ALA n 
1 382 VAL n 
1 383 HIS n 
1 384 TYR n 
1 385 VAL n 
1 386 GLU n 
1 387 ASN n 
1 388 GLY n 
1 389 LEU n 
1 390 ILE n 
1 391 ASN n 
1 392 SER n 
1 393 LEU n 
1 394 PHE n 
1 395 GLY n 
1 396 LEU n 
1 397 LEU n 
1 398 CYS n 
1 399 TRP n 
1 400 GLU n 
1 401 ALA n 
1 402 ILE n 
1 403 PHE n 
1 404 ALA n 
1 405 ALA n 
1 406 ILE n 
1 407 PRO n 
1 408 GLY n 
1 409 ALA n 
1 410 PHE n 
1 411 PHE n 
1 412 HIS n 
1 413 PRO n 
1 414 PHE n 
1 415 HIS n 
1 416 SER n 
1 417 ALA n 
1 418 PRO n 
1 419 ALA n 
1 420 ASP n 
1 421 LEU n 
1 422 HIS n 
1 423 SER n 
1 424 ALA n 
1 425 ASP n 
1 426 PHE n 
1 427 ARG n 
1 428 GLN n 
1 429 ARG n 
1 430 ARG n 
1 431 ALA n 
1 432 ALA n 
1 433 LEU n 
1 434 PHE n 
1 435 GLU n 
1 436 ALA n 
1 437 CYS n 
1 438 LEU n 
1 439 GLY n 
1 440 ARG n 
1 441 LEU n 
1 442 GLU n 
1 443 ASP n 
1 444 GLY n 
1 445 SER n 
1 446 TYR n 
1 447 ARG n 
1 448 ASP n 
1 449 ALA n 
1 450 ILE n 
1 451 ARG n 
1 452 CYS n 
1 453 ARG n 
1 454 TYR n 
1 455 ARG n 
1 456 ASP n 
1 457 LYS n 
1 458 PHE n 
1 459 GLY n 
1 460 LEU n 
1 461 GLN n 
1 462 SER n 
1 463 PRO n 
1 464 PHE n 
1 465 VAL n 
1 466 TYR n 
1 467 TRP n 
1 468 GLU n 
1 469 LEU n 
1 470 LEU n 
1 471 GLY n 
1 472 GLU n 
1 473 GLU n 
1 474 LEU n 
1 475 LEU n 
1 476 GLU n 
1 477 GLN n 
1 478 ALA n 
1 479 LEU n 
1 480 ASP n 
1 481 CYS n 
1 482 LEU n 
1 483 PRO n 
1 484 ALA n 
1 485 ALA n 
1 486 HIS n 
1 487 LEU n 
1 488 ARG n 
1 489 ALA n 
1 490 TRP n 
1 491 PHE n 
1 492 GLU n 
1 493 ARG n 
1 494 LEU n 
1 495 LEU n 
1 496 GLU n 
1 497 ASP n 
1 498 ILE n 
1 499 PRO n 
1 500 GLY n 
1 501 ASN n 
1 502 ARG n 
1 503 ALA n 
1 504 GLY n 
1 505 LEU n 
1 506 PRO n 
1 507 ASP n 
1 508 LEU n 
1 509 ILE n 
1 510 GLN n 
1 511 PHE n 
1 512 TRP n 
1 513 PRO n 
1 514 ALA n 
1 515 GLN n 
1 516 ARG n 
1 517 ARG n 
1 518 TYR n 
1 519 ARG n 
1 520 MET n 
1 521 VAL n 
1 522 GLU n 
1 523 VAL n 
1 524 LYS n 
1 525 GLY n 
1 526 PRO n 
1 527 GLY n 
1 528 ASP n 
1 529 ARG n 
1 530 LEU n 
1 531 GLN n 
1 532 ASP n 
1 533 ASN n 
1 534 GLN n 
1 535 LEU n 
1 536 ARG n 
1 537 TRP n 
1 538 LEU n 
1 539 GLN n 
1 540 PHE n 
1 541 CYS n 
1 542 ARG n 
1 543 GLU n 
1 544 ARG n 
1 545 GLU n 
1 546 MET n 
1 547 PRO n 
1 548 VAL n 
1 549 ALA n 
1 550 VAL n 
1 551 CYS n 
1 552 TYR n 
1 553 VAL n 
1 554 ARG n 
1 555 TRP n 
1 556 HIS n 
1 557 VAL n 
1 558 ASP n 
1 559 ASP n 
2 1   DA  n 
2 2   DC  n 
2 3   DC  n 
2 4   DA  n 
2 5   DG  n 
2 6   DA  n 
2 7   DC  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DC  n 
3 1   DG  n 
3 2   DT  n 
3 3   DT  n 
3 4   DG  n 
3 5   DG  n 
3 6   DG  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DG  n 
4 1   DG  n 
4 2   DA  n 
4 3   DA  n 
4 4   DT  n 
4 5   DG  n 
4 6   DT  n 
4 7   DG  n 
4 8   DT  n 
4 9   DG  n 
4 10  DT  n 
4 11  DC  n 
4 12  DT  n 
4 13  DC  n 
4 14  DA  n 
4 15  DA  n 
4 16  DT  n 
4 17  DC  n 
4 18  DC  n 
4 19  DC  n 
4 20  DA  n 
4 21  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PA1865 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    PAO1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pseudomonas aeruginosa' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     208964 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? ? ? ? 'synthetic DNA' 
3 1 sample ? ? ? ? ? 'synthetic DNA' 
4 1 sample ? ? ? ? ? 'synthetic DNA' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q9I2N0_PSEAE Q9I2N0 1 
;MHEQYQAPLPVNSPALPEPFYYLHNFRAVLAWIGERYADLLDDQERAFIAAFAELPEASQALLVRMVMRKGTLFREGKLA
YAEIGDTRAAVQPLLALGWVDAQPTLELAQLFGLLKKDELSQLFRDHLGRANLRKDALLERLQPLFPEARRLAEWQADFA
EPVYELRCMALCDRLRLMYFGNLWQDWSEFVLADLGIYRYESVEFSADSRGFRLRADVDAYLHLFDCRQRFDLGEPLEEL
LAGLPGEPYANPWLEGRRVKLLFQFAQHCEKQRDFDLAQRLYRQSSHPGARLRAIRSLERGERFAEAHALAREASCAPES
DAERQGLARLLPRLQGKLGLPRQARAAAPEIDRLDLCLAFPSEPCSVEWAVREHLEEPGCAVHYVENGLINSLFGLLCWE
AIFAAIPGAFFHPFHSAPADLHSADFRQRRAALFEACLGRLEDGSYRDAIRCRYRDKFGLQSPFVYWELLGEELLEQALD
CLPAAHLRAWFERLLEDIPGNRAGLPDLIQFWPAQRRYRMVEVKGPGDRLQDNQLRWLQFCREREMPVAVCYVRWHVDD
;
1 ? 
2 PDB 4R8A         4R8A   2 ? ? ? 
3 PDB 4R8A         4R8A   3 ? ? ? 
4 PDB 4R8A         4R8A   4 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4R8A A 1 ? 559 ? Q9I2N0 1  ? 559 ? 1  559 
2 1 4R8A F 1 ? 559 ? Q9I2N0 1  ? 559 ? 1  559 
3 2 4R8A B 1 ? 15  ? 4R8A   -2 ? 12  ? -2 12  
4 2 4R8A G 1 ? 15  ? 4R8A   -2 ? 12  ? -2 12  
5 3 4R8A C 1 ? 10  ? 4R8A   1  ? 10  ? 1  10  
6 3 4R8A H 1 ? 10  ? 4R8A   1  ? 10  ? 1  10  
7 4 4R8A D 1 ? 21  ? 4R8A   1  ? 21  ? 1  21  
8 4 4R8A I 1 ? 21  ? 4R8A   1  ? 21  ? 1  21  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4R8A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.69 
_exptl_crystal.density_percent_sol   66.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.4 
_exptl_crystal_grow.pdbx_details    'PEG, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2013-12-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 4-crystal channel cut' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PAL/PLS BEAMLINE 5C (4A)' 
_diffrn_source.pdbx_synchrotron_site       PAL/PLS 
_diffrn_source.pdbx_synchrotron_beamline   '5C (4A)' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
# 
_reflns.entry_id                     4R8A 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            3.17 
_reflns.number_obs                   45784 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        99.120 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  3.17 
_reflns_shell.d_res_low                   ? 
_reflns_shell.percent_possible_all        99.8 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 4R8A 
_refine.ls_number_reflns_obs                     37835 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.248 
_refine.ls_d_res_high                            3.200 
_refine.ls_percent_reflns_obs                    99.81 
_refine.ls_R_factor_obs                          0.1974 
_refine.ls_R_factor_R_work                       0.1955 
_refine.ls_R_factor_R_free                       0.2337 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.98 
_refine.ls_number_reflns_R_free                  1885 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               118.6200 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.34 
_refine.overall_FOM_work_R_set                   0.8170 
_refine.B_iso_max                                303.970 
_refine.B_iso_min                                45.750 
_refine.pdbx_overall_phase_error                 25.3200 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8766 
_refine_hist.pdbx_number_atoms_nucleic_acid   1884 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               10652 
_refine_hist.d_res_high                       3.200 
_refine_hist.d_res_low                        32.248 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           11102 0.003  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          15416 0.872  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     1618  0.053  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      1716  0.004  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 4272  20.325 ? ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
1 'X-RAY DIFFRACTION' 1 1 POSITIONAL A 4383 0.005 ? ? ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 POSITIONAL F 4383 0.005 ? ? ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 2 1 POSITIONAL D 429  0.003 ? ? ? ? ? ? ? 
4 'X-RAY DIFFRACTION' 2 2 POSITIONAL I 429  0.003 ? ? ? ? ? ? ? 
5 'X-RAY DIFFRACTION' 3 1 POSITIONAL B 302  0.001 ? ? ? ? ? ? ? 
6 'X-RAY DIFFRACTION' 3 2 POSITIONAL G 302  0.001 ? ? ? ? ? ? ? 
7 'X-RAY DIFFRACTION' 4 1 POSITIONAL C 211  0.010 ? ? ? ? ? ? ? 
8 'X-RAY DIFFRACTION' 4 2 POSITIONAL H 211  0.010 ? ? ? ? ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
3.2000 3.2864  13 100.0000 2739 . 0.2815 0.3706 . 146 . 2885 . 'X-RAY DIFFRACTION' . 
3.2864 3.3831  13 100.0000 2768 . 0.2437 0.2742 . 135 . 2903 . 'X-RAY DIFFRACTION' . 
3.3831 3.4921  13 100.0000 2723 . 0.2146 0.2471 . 158 . 2881 . 'X-RAY DIFFRACTION' . 
3.4921 3.6168  13 100.0000 2757 . 0.2083 0.2660 . 137 . 2894 . 'X-RAY DIFFRACTION' . 
3.6168 3.7614  13 100.0000 2757 . 0.2047 0.2340 . 145 . 2902 . 'X-RAY DIFFRACTION' . 
3.7614 3.9323  13 100.0000 2778 . 0.1947 0.2704 . 141 . 2919 . 'X-RAY DIFFRACTION' . 
3.9323 4.1392  13 100.0000 2741 . 0.1872 0.2274 . 160 . 2901 . 'X-RAY DIFFRACTION' . 
4.1392 4.3979  13 100.0000 2763 . 0.1834 0.2160 . 133 . 2896 . 'X-RAY DIFFRACTION' . 
4.3979 4.7365  13 100.0000 2774 . 0.1892 0.2204 . 149 . 2923 . 'X-RAY DIFFRACTION' . 
4.7365 5.2114  13 100.0000 2789 . 0.1968 0.2780 . 146 . 2935 . 'X-RAY DIFFRACTION' . 
5.2114 5.9614  13 100.0000 2789 . 0.2126 0.2302 . 142 . 2931 . 'X-RAY DIFFRACTION' . 
5.9614 7.4951  13 100.0000 2774 . 0.2169 0.2605 . 151 . 2925 . 'X-RAY DIFFRACTION' . 
7.4951 32.2499 13 98.0000  2798 . 0.1624 0.1802 . 142 . 2940 . 'X-RAY DIFFRACTION' . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
1 ? 3 
2 ? 3 
1 ? 4 
2 ? 4 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN A AND (RESSEQ 16:553 )' 
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 'CHAIN F AND (RESSEQ 16:553 )' 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'CHAIN D AND (RESSEQ 1:21 )'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 'CHAIN I AND (RESSEQ 1:21 )'   
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'CHAIN B AND (RESSEQ -2:12 )'  
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 'CHAIN G AND (RESSEQ -2:12 )'  
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4 'CHAIN C AND (RESSEQ 1:10 )'   
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 4 'CHAIN H AND (RESSEQ 1:10 )'   
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
# 
_struct.entry_id                  4R8A 
_struct.title                     
;Crystal structure of paFAN1 - 5' flap DNA complex
;
_struct.pdbx_descriptor           'Uncharacterized protein, DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4R8A 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
_struct_keywords.text            
;DNA binding, metal binding nuclease, 5'flap DNA endo nuclease, fanconi anemia proteins family, Hydrolase-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PHE A 20  ? TYR A 37  ? PHE A 20  TYR A 37  1 ? 18 
HELX_P HELX_P2  2  ASP A 42  ? GLU A 54  ? ASP A 42  GLU A 54  1 ? 13 
HELX_P HELX_P3  3  PRO A 56  ? ARG A 69  ? PRO A 56  ARG A 69  1 ? 14 
HELX_P HELX_P4  4  GLY A 77  ? LEU A 79  ? GLY A 77  LEU A 79  5 ? 3  
HELX_P HELX_P5  5  ASP A 86  ? VAL A 91  ? ASP A 86  VAL A 91  1 ? 6  
HELX_P HELX_P6  6  VAL A 91  ? LEU A 97  ? VAL A 91  LEU A 97  1 ? 7  
HELX_P HELX_P7  7  GLU A 107 ? LEU A 115 ? GLU A 107 LEU A 115 1 ? 9  
HELX_P HELX_P8  8  LYS A 116 ? PHE A 124 ? LYS A 116 PHE A 124 1 ? 9  
HELX_P HELX_P9  9  ARG A 125 ? LEU A 128 ? ARG A 125 LEU A 128 5 ? 4  
HELX_P HELX_P10 10 ARG A 134 ? GLN A 143 ? ARG A 134 GLN A 143 1 ? 10 
HELX_P HELX_P11 11 LEU A 152 ? GLN A 156 ? LEU A 152 GLN A 156 1 ? 5  
HELX_P HELX_P12 12 CYS A 168 ? PHE A 180 ? CYS A 168 PHE A 180 1 ? 13 
HELX_P HELX_P13 13 TRP A 187 ? LEU A 195 ? TRP A 187 LEU A 195 1 ? 9  
HELX_P HELX_P14 14 LEU A 214 ? ASP A 232 ? LEU A 214 ASP A 232 1 ? 19 
HELX_P HELX_P15 15 PRO A 236 ? LEU A 244 ? PRO A 236 LEU A 244 1 ? 9  
HELX_P HELX_P16 16 ASN A 251 ? GLN A 272 ? ASN A 251 GLN A 272 1 ? 22 
HELX_P HELX_P17 17 ASP A 274 ? ARG A 283 ? ASP A 274 ARG A 283 1 ? 10 
HELX_P HELX_P18 18 GLY A 289 ? GLY A 301 ? GLY A 289 GLY A 301 1 ? 13 
HELX_P HELX_P19 19 ARG A 303 ? ALA A 317 ? ARG A 303 ALA A 317 1 ? 15 
HELX_P HELX_P20 20 SER A 320 ? LEU A 338 ? SER A 320 LEU A 338 1 ? 19 
HELX_P HELX_P21 21 SER A 366 ? LEU A 375 ? SER A 366 LEU A 375 1 ? 10 
HELX_P HELX_P22 22 ASN A 387 ? CYS A 398 ? ASN A 387 CYS A 398 1 ? 12 
HELX_P HELX_P23 23 CYS A 398 ? PHE A 403 ? CYS A 398 PHE A 403 1 ? 6  
HELX_P HELX_P24 24 ARG A 427 ? ARG A 429 ? ARG A 427 ARG A 429 5 ? 3  
HELX_P HELX_P25 25 ARG A 430 ? LEU A 438 ? ARG A 430 LEU A 438 1 ? 9  
HELX_P HELX_P26 26 GLY A 444 ? PHE A 458 ? GLY A 444 PHE A 458 1 ? 15 
HELX_P HELX_P27 27 GLY A 471 ? LEU A 482 ? GLY A 471 LEU A 482 1 ? 12 
HELX_P HELX_P28 28 PRO A 483 ? ASP A 497 ? PRO A 483 ASP A 497 1 ? 15 
HELX_P HELX_P29 29 GLN A 531 ? ARG A 544 ? GLN A 531 ARG A 544 1 ? 14 
HELX_P HELX_P30 30 PHE E 20  ? TYR E 37  ? PHE F 20  TYR F 37  1 ? 18 
HELX_P HELX_P31 31 ASP E 42  ? GLU E 54  ? ASP F 42  GLU F 54  1 ? 13 
HELX_P HELX_P32 32 PRO E 56  ? ARG E 69  ? PRO F 56  ARG F 69  1 ? 14 
HELX_P HELX_P33 33 GLY E 77  ? LEU E 79  ? GLY F 77  LEU F 79  5 ? 3  
HELX_P HELX_P34 34 ASP E 86  ? VAL E 91  ? ASP F 86  VAL F 91  1 ? 6  
HELX_P HELX_P35 35 VAL E 91  ? LEU E 97  ? VAL F 91  LEU F 97  1 ? 7  
HELX_P HELX_P36 36 GLU E 107 ? LEU E 115 ? GLU F 107 LEU F 115 1 ? 9  
HELX_P HELX_P37 37 LYS E 116 ? PHE E 124 ? LYS F 116 PHE F 124 1 ? 9  
HELX_P HELX_P38 38 ARG E 125 ? LEU E 128 ? ARG F 125 LEU F 128 5 ? 4  
HELX_P HELX_P39 39 ARG E 134 ? GLN E 143 ? ARG F 134 GLN F 143 1 ? 10 
HELX_P HELX_P40 40 LEU E 152 ? GLN E 156 ? LEU F 152 GLN F 156 1 ? 5  
HELX_P HELX_P41 41 CYS E 168 ? PHE E 180 ? CYS F 168 PHE F 180 1 ? 13 
HELX_P HELX_P42 42 TRP E 187 ? LEU E 195 ? TRP F 187 LEU F 195 1 ? 9  
HELX_P HELX_P43 43 LEU E 214 ? ASP E 232 ? LEU F 214 ASP F 232 1 ? 19 
HELX_P HELX_P44 44 PRO E 236 ? LEU E 244 ? PRO F 236 LEU F 244 1 ? 9  
HELX_P HELX_P45 45 ASN E 251 ? GLN E 272 ? ASN F 251 GLN F 272 1 ? 22 
HELX_P HELX_P46 46 ASP E 274 ? ARG E 283 ? ASP F 274 ARG F 283 1 ? 10 
HELX_P HELX_P47 47 GLY E 289 ? GLY E 301 ? GLY F 289 GLY F 301 1 ? 13 
HELX_P HELX_P48 48 ARG E 303 ? ALA E 317 ? ARG F 303 ALA F 317 1 ? 15 
HELX_P HELX_P49 49 SER E 320 ? LEU E 338 ? SER F 320 LEU F 338 1 ? 19 
HELX_P HELX_P50 50 SER E 366 ? LEU E 375 ? SER F 366 LEU F 375 1 ? 10 
HELX_P HELX_P51 51 ASN E 387 ? CYS E 398 ? ASN F 387 CYS F 398 1 ? 12 
HELX_P HELX_P52 52 CYS E 398 ? PHE E 403 ? CYS F 398 PHE F 403 1 ? 6  
HELX_P HELX_P53 53 ARG E 427 ? ARG E 429 ? ARG F 427 ARG F 429 5 ? 3  
HELX_P HELX_P54 54 ARG E 430 ? LEU E 438 ? ARG F 430 LEU F 438 1 ? 9  
HELX_P HELX_P55 55 GLY E 444 ? PHE E 458 ? GLY F 444 PHE F 458 1 ? 15 
HELX_P HELX_P56 56 GLY E 471 ? LEU E 482 ? GLY F 471 LEU F 482 1 ? 12 
HELX_P HELX_P57 57 PRO E 483 ? ASP E 497 ? PRO F 483 ASP F 497 1 ? 15 
HELX_P HELX_P58 58 GLN E 531 ? ARG E 544 ? GLN F 531 ARG F 544 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DG 5  N1 ? ? ? 1_555 D DC 11 O2 ? ? B DG 2  D DC 11 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog2  hydrog ? ? B DA 6  N1 ? ? ? 1_555 D DT 10 N3 ? ? B DA 3  D DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3  hydrog ? ? B DA 6  N6 ? ? ? 1_555 D DT 10 O4 ? ? B DA 3  D DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? B DC 7  N4 ? ? ? 1_555 D DT 8  O4 ? ? B DC 4  D DT 8  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? 
hydrog5  hydrog ? ? B DC 7  O2 ? ? ? 1_555 D DG 9  N2 ? ? B DC 4  D DG 9  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog6  hydrog ? ? B DA 8  N1 ? ? ? 1_555 D DT 8  N3 ? ? B DA 5  D DT 8  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog7  hydrog ? ? B DC 9  N3 ? ? ? 1_555 D DG 7  N1 ? ? B DC 6  D DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? B DC 9  N4 ? ? ? 1_555 D DG 7  O6 ? ? B DC 6  D DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9  hydrog ? ? B DC 9  O2 ? ? ? 1_555 D DG 7  N2 ? ? B DC 6  D DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? B DA 10 N1 ? ? ? 1_555 D DT 6  N3 ? ? B DA 7  D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? B DA 10 N6 ? ? ? 1_555 D DT 6  O4 ? ? B DA 7  D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12 hydrog ? ? B DC 11 N3 ? ? ? 1_555 D DG 5  N1 ? ? B DC 8  D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13 hydrog ? ? B DC 11 N4 ? ? ? 1_555 D DG 5  O6 ? ? B DC 8  D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14 hydrog ? ? B DC 11 O2 ? ? ? 1_555 D DG 5  N2 ? ? B DC 8  D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15 hydrog ? ? B DA 12 N1 ? ? ? 1_555 D DT 4  N3 ? ? B DA 9  D DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16 hydrog ? ? B DA 12 N6 ? ? ? 1_555 D DT 4  O4 ? ? B DA 9  D DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? B DT 13 N3 ? ? ? 1_555 D DA 3  N1 ? ? B DT 10 D DA 3  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog18 hydrog ? ? B DT 14 O4 ? ? ? 1_555 D DA 2  N6 ? ? B DT 11 D DA 2  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog19 hydrog ? ? B DC 15 N4 ? ? ? 1_555 D DG 1  O6 ? ? B DC 12 D DG 1  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog20 hydrog ? ? C DG 1  O6 ? ? ? 1_555 D DA 21 N6 ? ? C DG 1  D DA 21 1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ? ? 
hydrog21 hydrog ? ? C DT 2  N3 ? ? ? 1_555 D DA 21 N1 ? ? C DT 2  D DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22 hydrog ? ? C DT 2  O4 ? ? ? 1_555 D DA 21 N6 ? ? C DT 2  D DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA 20 N1 ? ? C DT 3  D DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA 20 N6 ? ? C DT 3  D DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25 hydrog ? ? C DG 4  N1 ? ? ? 1_555 D DC 19 N3 ? ? C DG 4  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? C DG 4  N2 ? ? ? 1_555 D DC 19 O2 ? ? C DG 4  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27 hydrog ? ? C DG 4  O6 ? ? ? 1_555 D DC 19 N4 ? ? C DG 4  D DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? C DG 5  N1 ? ? ? 1_555 D DC 18 N3 ? ? C DG 5  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? C DG 5  N2 ? ? ? 1_555 D DC 18 O2 ? ? C DG 5  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? C DG 5  O6 ? ? ? 1_555 D DC 18 N4 ? ? C DG 5  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31 hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 17 N3 ? ? C DG 6  D DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32 hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 17 O2 ? ? C DG 6  D DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33 hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DC 17 N4 ? ? C DG 6  D DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 16 N3 ? ? C DA 7  D DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 16 O4 ? ? C DA 7  D DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36 hydrog ? ? C DT 8  O4 ? ? ? 1_555 D DA 14 N6 ? ? C DT 8  D DA 14 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog37 hydrog ? ? C DT 9  N3 ? ? ? 1_555 D DA 14 N1 ? ? C DT 9  D DA 14 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog38 hydrog ? ? C DG 10 N1 ? ? ? 1_555 D DC 13 N3 ? ? C DG 10 D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39 hydrog ? ? C DG 10 N2 ? ? ? 1_555 D DC 13 O2 ? ? C DG 10 D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 13 N4 ? ? C DG 10 D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41 hydrog ? ? F DG 5  N1 ? ? ? 1_555 H DC 11 O2 ? ? G DG 2  I DC 11 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog42 hydrog ? ? F DA 6  N1 ? ? ? 1_555 H DT 10 N3 ? ? G DA 3  I DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43 hydrog ? ? F DA 6  N6 ? ? ? 1_555 H DT 10 O4 ? ? G DA 3  I DT 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44 hydrog ? ? F DC 7  N4 ? ? ? 1_555 H DT 8  O4 ? ? G DC 4  I DT 8  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? 
hydrog45 hydrog ? ? F DC 7  O2 ? ? ? 1_555 H DG 9  N2 ? ? G DC 4  I DG 9  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog46 hydrog ? ? F DA 8  N1 ? ? ? 1_555 H DT 8  N3 ? ? G DA 5  I DT 8  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog47 hydrog ? ? F DC 9  N3 ? ? ? 1_555 H DG 7  N1 ? ? G DC 6  I DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48 hydrog ? ? F DC 9  N4 ? ? ? 1_555 H DG 7  O6 ? ? G DC 6  I DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49 hydrog ? ? F DC 9  O2 ? ? ? 1_555 H DG 7  N2 ? ? G DC 6  I DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50 hydrog ? ? F DA 10 N1 ? ? ? 1_555 H DT 6  N3 ? ? G DA 7  I DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51 hydrog ? ? F DA 10 N6 ? ? ? 1_555 H DT 6  O4 ? ? G DA 7  I DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52 hydrog ? ? F DC 11 N3 ? ? ? 1_555 H DG 5  N1 ? ? G DC 8  I DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53 hydrog ? ? F DC 11 N4 ? ? ? 1_555 H DG 5  O6 ? ? G DC 8  I DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54 hydrog ? ? F DC 11 O2 ? ? ? 1_555 H DG 5  N2 ? ? G DC 8  I DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55 hydrog ? ? F DA 12 N1 ? ? ? 1_555 H DT 4  N3 ? ? G DA 9  I DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56 hydrog ? ? F DA 12 N6 ? ? ? 1_555 H DT 4  O4 ? ? G DA 9  I DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57 hydrog ? ? F DT 13 N3 ? ? ? 1_555 H DA 3  N1 ? ? G DT 10 I DA 3  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog58 hydrog ? ? F DT 14 O4 ? ? ? 1_555 H DA 2  N6 ? ? G DT 11 I DA 2  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog59 hydrog ? ? F DC 15 N4 ? ? ? 1_555 H DG 1  O6 ? ? G DC 12 I DG 1  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog60 hydrog ? ? G DG 1  O6 ? ? ? 1_555 H DA 21 N6 ? ? H DG 1  I DA 21 1_555 ? ? ? ? ? ? 'DG-DA MISPAIR' ? ? 
hydrog61 hydrog ? ? G DT 2  N3 ? ? ? 1_555 H DA 21 N1 ? ? H DT 2  I DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62 hydrog ? ? G DT 2  O4 ? ? ? 1_555 H DA 21 N6 ? ? H DT 2  I DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63 hydrog ? ? G DT 3  N3 ? ? ? 1_555 H DA 20 N1 ? ? H DT 3  I DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64 hydrog ? ? G DT 3  O4 ? ? ? 1_555 H DA 20 N6 ? ? H DT 3  I DA 20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65 hydrog ? ? G DG 4  N1 ? ? ? 1_555 H DC 19 N3 ? ? H DG 4  I DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66 hydrog ? ? G DG 4  N2 ? ? ? 1_555 H DC 19 O2 ? ? H DG 4  I DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67 hydrog ? ? G DG 4  O6 ? ? ? 1_555 H DC 19 N4 ? ? H DG 4  I DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68 hydrog ? ? G DG 5  N1 ? ? ? 1_555 H DC 18 N3 ? ? H DG 5  I DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69 hydrog ? ? G DG 5  N2 ? ? ? 1_555 H DC 18 O2 ? ? H DG 5  I DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70 hydrog ? ? G DG 5  O6 ? ? ? 1_555 H DC 18 N4 ? ? H DG 5  I DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71 hydrog ? ? G DG 6  N1 ? ? ? 1_555 H DC 17 N3 ? ? H DG 6  I DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72 hydrog ? ? G DG 6  N2 ? ? ? 1_555 H DC 17 O2 ? ? H DG 6  I DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73 hydrog ? ? G DG 6  O6 ? ? ? 1_555 H DC 17 N4 ? ? H DG 6  I DC 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74 hydrog ? ? G DA 7  N1 ? ? ? 1_555 H DT 16 N3 ? ? H DA 7  I DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75 hydrog ? ? G DA 7  N6 ? ? ? 1_555 H DT 16 O4 ? ? H DA 7  I DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76 hydrog ? ? G DT 8  O4 ? ? ? 1_555 H DA 14 N6 ? ? H DT 8  I DA 14 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog77 hydrog ? ? G DT 9  N3 ? ? ? 1_555 H DA 14 N1 ? ? H DT 9  I DA 14 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog78 hydrog ? ? G DG 10 N1 ? ? ? 1_555 H DC 13 N3 ? ? H DG 10 I DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79 hydrog ? ? G DG 10 N2 ? ? ? 1_555 H DC 13 O2 ? ? H DG 10 I DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80 hydrog ? ? G DG 10 O6 ? ? ? 1_555 H DC 13 N4 ? ? H DG 10 I DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 5 ? 
D ? 3 ? 
E ? 2 ? 
F ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? parallel      
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 73  ? ARG A 75  ? LEU A 73  ARG A 75  
A 2 VAL A 163 ? LEU A 166 ? VAL A 163 LEU A 166 
A 3 VAL A 100 ? ASP A 101 ? VAL A 100 ASP A 101 
B 1 THR A 105 ? LEU A 106 ? THR A 105 LEU A 106 
B 2 ARG A 150 ? ARG A 151 ? ARG A 150 ARG A 151 
C 1 ASP A 352 ? ASP A 355 ? ASP A 352 ASP A 355 
C 2 VAL A 548 ? TYR A 552 ? VAL A 548 TYR A 552 
C 3 ARG A 517 ? LYS A 524 ? ARG A 517 LYS A 524 
C 4 LEU A 508 ? TRP A 512 ? LEU A 508 TRP A 512 
C 5 ALA A 381 ? TYR A 384 ? ALA A 381 TYR A 384 
D 1 LEU E 73  ? ARG E 75  ? LEU F 73  ARG F 75  
D 2 VAL E 163 ? LEU E 166 ? VAL F 163 LEU F 166 
D 3 VAL E 100 ? ASP E 101 ? VAL F 100 ASP F 101 
E 1 THR E 105 ? LEU E 106 ? THR F 105 LEU F 106 
E 2 ARG E 150 ? ARG E 151 ? ARG F 150 ARG F 151 
F 1 ASP E 352 ? ASP E 355 ? ASP F 352 ASP F 355 
F 2 VAL E 548 ? TYR E 552 ? VAL F 548 TYR F 552 
F 3 ARG E 517 ? LYS E 524 ? ARG F 517 LYS F 524 
F 4 LEU E 508 ? TRP E 512 ? LEU F 508 TRP F 512 
F 5 ALA E 381 ? TYR E 384 ? ALA F 381 TYR F 384 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 74  ? N PHE A 74  O TYR A 164 ? O TYR A 164 
A 2 3 O GLU A 165 ? O GLU A 165 N ASP A 101 ? N ASP A 101 
B 1 2 N LEU A 106 ? N LEU A 106 O ARG A 150 ? O ARG A 150 
C 1 2 N LEU A 354 ? N LEU A 354 O TYR A 552 ? O TYR A 552 
C 2 3 O CYS A 551 ? O CYS A 551 N LYS A 524 ? N LYS A 524 
C 3 4 O VAL A 521 ? O VAL A 521 N LEU A 508 ? N LEU A 508 
C 4 5 O ILE A 509 ? O ILE A 509 N HIS A 383 ? N HIS A 383 
D 1 2 N PHE E 74  ? N PHE F 74  O TYR E 164 ? O TYR F 164 
D 2 3 O GLU E 165 ? O GLU F 165 N ASP E 101 ? N ASP F 101 
E 1 2 N LEU E 106 ? N LEU F 106 O ARG E 150 ? O ARG F 150 
F 1 2 N LEU E 354 ? N LEU F 354 O TYR E 552 ? O TYR F 552 
F 2 3 O CYS E 551 ? O CYS F 551 N LYS E 524 ? N LYS F 524 
F 3 4 O VAL E 521 ? O VAL F 521 N LEU E 508 ? N LEU F 508 
F 4 5 O ILE E 509 ? O ILE F 509 N HIS E 383 ? N HIS F 383 
# 
_database_PDB_matrix.entry_id          4R8A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4R8A 
_atom_sites.fract_transf_matrix[1][1]   0.013058 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000007 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009375 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007033 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LEU A 1 16  ? 23.395  -62.471 222.852 1.00 118.99 ? 16  LEU A N     1 
ATOM   2     C CA    . LEU A 1 16  ? 23.299  -63.780 223.498 1.00 124.96 ? 16  LEU A CA    1 
ATOM   3     C C     . LEU A 1 16  ? 24.621  -64.575 223.569 1.00 131.58 ? 16  LEU A C     1 
ATOM   4     O O     . LEU A 1 16  ? 24.981  -65.060 224.642 1.00 131.39 ? 16  LEU A O     1 
ATOM   5     C CB    . LEU A 1 16  ? 22.164  -64.621 222.882 1.00 125.28 ? 16  LEU A CB    1 
ATOM   6     C CG    . LEU A 1 16  ? 21.455  -65.610 223.818 1.00 122.97 ? 16  LEU A CG    1 
ATOM   7     C CD1   . LEU A 1 16  ? 20.040  -65.922 223.343 1.00 121.31 ? 16  LEU A CD1   1 
ATOM   8     C CD2   . LEU A 1 16  ? 22.251  -66.892 223.965 1.00 122.95 ? 16  LEU A CD2   1 
ATOM   9     N N     . PRO A 1 17  ? 25.347  -64.716 222.439 1.00 135.75 ? 17  PRO A N     1 
ATOM   10    C CA    . PRO A 1 17  ? 26.556  -65.549 222.510 1.00 134.26 ? 17  PRO A CA    1 
ATOM   11    C C     . PRO A 1 17  ? 27.683  -64.945 223.353 1.00 127.33 ? 17  PRO A C     1 
ATOM   12    O O     . PRO A 1 17  ? 28.579  -65.675 223.780 1.00 126.83 ? 17  PRO A O     1 
ATOM   13    C CB    . PRO A 1 17  ? 26.990  -65.659 221.043 1.00 135.88 ? 17  PRO A CB    1 
ATOM   14    C CG    . PRO A 1 17  ? 26.427  -64.452 220.394 1.00 134.29 ? 17  PRO A CG    1 
ATOM   15    C CD    . PRO A 1 17  ? 25.118  -64.207 221.074 1.00 135.31 ? 17  PRO A CD    1 
ATOM   16    N N     . GLU A 1 18  ? 27.636  -63.637 223.590 1.00 118.85 ? 18  GLU A N     1 
ATOM   17    C CA    . GLU A 1 18  ? 28.653  -62.965 224.394 1.00 108.98 ? 18  GLU A CA    1 
ATOM   18    C C     . GLU A 1 18  ? 28.062  -62.416 225.689 1.00 99.32  ? 18  GLU A C     1 
ATOM   19    O O     . GLU A 1 18  ? 27.218  -61.520 225.656 1.00 101.45 ? 18  GLU A O     1 
ATOM   20    C CB    . GLU A 1 18  ? 29.295  -61.827 223.601 1.00 113.77 ? 18  GLU A CB    1 
ATOM   21    C CG    . GLU A 1 18  ? 30.362  -61.065 224.370 1.00 123.93 ? 18  GLU A CG    1 
ATOM   22    C CD    . GLU A 1 18  ? 31.657  -61.845 224.504 1.00 136.56 ? 18  GLU A CD    1 
ATOM   23    O OE1   . GLU A 1 18  ? 32.112  -62.423 223.492 1.00 142.28 ? 18  GLU A OE1   1 
ATOM   24    O OE2   . GLU A 1 18  ? 32.218  -61.882 225.620 1.00 138.11 ? 18  GLU A OE2   1 
ATOM   25    N N     . PRO A 1 19  ? 28.515  -62.951 226.835 1.00 91.75  ? 19  PRO A N     1 
ATOM   26    C CA    . PRO A 1 19  ? 28.039  -62.580 228.175 1.00 92.84  ? 19  PRO A CA    1 
ATOM   27    C C     . PRO A 1 19  ? 28.197  -61.092 228.483 1.00 98.82  ? 19  PRO A C     1 
ATOM   28    O O     . PRO A 1 19  ? 27.386  -60.534 229.225 1.00 100.25 ? 19  PRO A O     1 
ATOM   29    C CB    . PRO A 1 19  ? 28.939  -63.402 229.104 1.00 90.61  ? 19  PRO A CB    1 
ATOM   30    C CG    . PRO A 1 19  ? 29.359  -64.568 228.281 1.00 93.54  ? 19  PRO A CG    1 
ATOM   31    C CD    . PRO A 1 19  ? 29.514  -64.031 226.887 1.00 92.31  ? 19  PRO A CD    1 
ATOM   32    N N     . PHE A 1 20  ? 29.225  -60.460 227.924 1.00 98.77  ? 20  PHE A N     1 
ATOM   33    C CA    . PHE A 1 20  ? 29.447  -59.034 228.144 1.00 96.65  ? 20  PHE A CA    1 
ATOM   34    C C     . PHE A 1 20  ? 28.916  -58.189 226.990 1.00 96.13  ? 20  PHE A C     1 
ATOM   35    O O     . PHE A 1 20  ? 29.532  -57.194 226.607 1.00 97.01  ? 20  PHE A O     1 
ATOM   36    C CB    . PHE A 1 20  ? 30.936  -58.750 228.351 1.00 97.12  ? 20  PHE A CB    1 
ATOM   37    C CG    . PHE A 1 20  ? 31.465  -59.224 229.674 1.00 96.36  ? 20  PHE A CG    1 
ATOM   38    C CD1   . PHE A 1 20  ? 31.323  -58.444 230.808 1.00 93.59  ? 20  PHE A CD1   1 
ATOM   39    C CD2   . PHE A 1 20  ? 32.107  -60.446 229.783 1.00 101.56 ? 20  PHE A CD2   1 
ATOM   40    C CE1   . PHE A 1 20  ? 31.806  -58.876 232.028 1.00 97.35  ? 20  PHE A CE1   1 
ATOM   41    C CE2   . PHE A 1 20  ? 32.594  -60.882 231.002 1.00 101.39 ? 20  PHE A CE2   1 
ATOM   42    C CZ    . PHE A 1 20  ? 32.443  -60.096 232.125 1.00 100.43 ? 20  PHE A CZ    1 
ATOM   43    N N     . TYR A 1 21  ? 27.767  -58.582 226.448 1.00 90.48  ? 21  TYR A N     1 
ATOM   44    C CA    . TYR A 1 21  ? 27.206  -57.919 225.274 1.00 84.76  ? 21  TYR A CA    1 
ATOM   45    C C     . TYR A 1 21  ? 26.866  -56.468 225.580 1.00 85.45  ? 21  TYR A C     1 
ATOM   46    O O     . TYR A 1 21  ? 27.057  -55.582 224.748 1.00 87.45  ? 21  TYR A O     1 
ATOM   47    C CB    . TYR A 1 21  ? 25.949  -58.649 224.792 1.00 81.80  ? 21  TYR A CB    1 
ATOM   48    C CG    . TYR A 1 21  ? 24.771  -58.514 225.731 1.00 82.58  ? 21  TYR A CG    1 
ATOM   49    C CD1   . TYR A 1 21  ? 24.647  -59.337 226.841 1.00 86.29  ? 21  TYR A CD1   1 
ATOM   50    C CD2   . TYR A 1 21  ? 23.787  -57.555 225.515 1.00 85.21  ? 21  TYR A CD2   1 
ATOM   51    C CE1   . TYR A 1 21  ? 23.573  -59.213 227.711 1.00 87.97  ? 21  TYR A CE1   1 
ATOM   52    C CE2   . TYR A 1 21  ? 22.710  -57.423 226.380 1.00 87.31  ? 21  TYR A CE2   1 
ATOM   53    C CZ    . TYR A 1 21  ? 22.609  -58.257 227.475 1.00 88.16  ? 21  TYR A CZ    1 
ATOM   54    O OH    . TYR A 1 21  ? 21.547  -58.142 228.342 1.00 88.98  ? 21  TYR A OH    1 
ATOM   55    N N     . TYR A 1 22  ? 26.365  -56.236 226.787 1.00 86.32  ? 22  TYR A N     1 
ATOM   56    C CA    . TYR A 1 22  ? 25.933  -54.909 227.200 1.00 82.51  ? 22  TYR A CA    1 
ATOM   57    C C     . TYR A 1 22  ? 27.116  -53.958 227.338 1.00 83.69  ? 22  TYR A C     1 
ATOM   58    O O     . TYR A 1 22  ? 26.993  -52.766 227.061 1.00 86.03  ? 22  TYR A O     1 
ATOM   59    C CB    . TYR A 1 22  ? 25.139  -54.982 228.509 1.00 74.38  ? 22  TYR A CB    1 
ATOM   60    C CG    . TYR A 1 22  ? 25.888  -55.626 229.654 1.00 77.35  ? 22  TYR A CG    1 
ATOM   61    C CD1   . TYR A 1 22  ? 25.987  -57.008 229.760 1.00 76.68  ? 22  TYR A CD1   1 
ATOM   62    C CD2   . TYR A 1 22  ? 26.488  -54.853 230.636 1.00 79.24  ? 22  TYR A CD2   1 
ATOM   63    C CE1   . TYR A 1 22  ? 26.673  -57.600 230.805 1.00 75.00  ? 22  TYR A CE1   1 
ATOM   64    C CE2   . TYR A 1 22  ? 27.171  -55.435 231.687 1.00 76.68  ? 22  TYR A CE2   1 
ATOM   65    C CZ    . TYR A 1 22  ? 27.261  -56.807 231.767 1.00 76.82  ? 22  TYR A CZ    1 
ATOM   66    O OH    . TYR A 1 22  ? 27.942  -57.380 232.815 1.00 81.49  ? 22  TYR A OH    1 
ATOM   67    N N     . LEU A 1 23  ? 28.261  -54.492 227.754 1.00 83.70  ? 23  LEU A N     1 
ATOM   68    C CA    . LEU A 1 23  ? 29.463  -53.682 227.923 1.00 84.35  ? 23  LEU A CA    1 
ATOM   69    C C     . LEU A 1 23  ? 30.032  -53.299 226.567 1.00 87.81  ? 23  LEU A C     1 
ATOM   70    O O     . LEU A 1 23  ? 30.478  -52.167 226.366 1.00 84.32  ? 23  LEU A O     1 
ATOM   71    C CB    . LEU A 1 23  ? 30.509  -54.433 228.748 1.00 83.76  ? 23  LEU A CB    1 
ATOM   72    C CG    . LEU A 1 23  ? 31.887  -53.781 228.885 1.00 85.37  ? 23  LEU A CG    1 
ATOM   73    C CD1   . LEU A 1 23  ? 31.766  -52.362 229.417 1.00 87.03  ? 23  LEU A CD1   1 
ATOM   74    C CD2   . LEU A 1 23  ? 32.787  -54.619 229.784 1.00 83.42  ? 23  LEU A CD2   1 
ATOM   75    N N     . HIS A 1 24  ? 30.008  -54.256 225.644 1.00 95.90  ? 24  HIS A N     1 
ATOM   76    C CA    . HIS A 1 24  ? 30.443  -54.033 224.271 1.00 100.37 ? 24  HIS A CA    1 
ATOM   77    C C     . HIS A 1 24  ? 29.595  -52.960 223.597 1.00 98.80  ? 24  HIS A C     1 
ATOM   78    O O     . HIS A 1 24  ? 30.111  -52.125 222.855 1.00 104.69 ? 24  HIS A O     1 
ATOM   79    C CB    . HIS A 1 24  ? 30.388  -55.341 223.475 1.00 105.32 ? 24  HIS A CB    1 
ATOM   80    C CG    . HIS A 1 24  ? 31.278  -56.412 224.020 1.00 114.94 ? 24  HIS A CG    1 
ATOM   81    N ND1   . HIS A 1 24  ? 32.440  -56.139 224.705 1.00 120.29 ? 24  HIS A ND1   1 
ATOM   82    C CD2   . HIS A 1 24  ? 31.173  -57.767 223.991 1.00 119.08 ? 24  HIS A CD2   1 
ATOM   83    C CE1   . HIS A 1 24  ? 33.017  -57.271 225.071 1.00 121.56 ? 24  HIS A CE1   1 
ATOM   84    N NE2   . HIS A 1 24  ? 32.263  -58.272 224.647 1.00 121.97 ? 24  HIS A NE2   1 
ATOM   85    N N     . ASN A 1 25  ? 28.292  -52.980 223.859 1.00 91.34  ? 25  ASN A N     1 
ATOM   86    C CA    . ASN A 1 25  ? 27.402  -51.956 223.317 1.00 93.61  ? 25  ASN A CA    1 
ATOM   87    C C     . ASN A 1 25  ? 27.723  -50.577 223.891 1.00 90.07  ? 25  ASN A C     1 
ATOM   88    O O     . ASN A 1 25  ? 27.706  -49.569 223.185 1.00 88.34  ? 25  ASN A O     1 
ATOM   89    C CB    . ASN A 1 25  ? 25.935  -52.316 223.564 1.00 96.95  ? 25  ASN A CB    1 
ATOM   90    C CG    . ASN A 1 25  ? 25.533  -53.613 222.886 1.00 100.62 ? 25  ASN A CG    1 
ATOM   91    O OD1   . ASN A 1 25  ? 26.114  -54.003 221.872 1.00 104.74 ? 25  ASN A OD1   1 
ATOM   92    N ND2   . ASN A 1 25  ? 24.530  -54.286 223.441 1.00 97.33  ? 25  ASN A ND2   1 
ATOM   93    N N     . PHE A 1 26  ? 28.034  -50.548 225.180 1.00 85.68  ? 26  PHE A N     1 
ATOM   94    C CA    . PHE A 1 26  ? 28.380  -49.312 225.861 1.00 82.90  ? 26  PHE A CA    1 
ATOM   95    C C     . PHE A 1 26  ? 29.721  -48.769 225.363 1.00 89.25  ? 26  PHE A C     1 
ATOM   96    O O     . PHE A 1 26  ? 29.896  -47.557 225.193 1.00 90.77  ? 26  PHE A O     1 
ATOM   97    C CB    . PHE A 1 26  ? 28.430  -49.549 227.371 1.00 78.69  ? 26  PHE A CB    1 
ATOM   98    C CG    . PHE A 1 26  ? 28.675  -48.300 228.167 1.00 80.71  ? 26  PHE A CG    1 
ATOM   99    C CD1   . PHE A 1 26  ? 27.648  -47.412 228.409 1.00 77.80  ? 26  PHE A CD1   1 
ATOM   100   C CD2   . PHE A 1 26  ? 29.928  -47.997 228.651 1.00 88.87  ? 26  PHE A CD2   1 
ATOM   101   C CE1   . PHE A 1 26  ? 27.859  -46.251 229.136 1.00 81.45  ? 26  PHE A CE1   1 
ATOM   102   C CE2   . PHE A 1 26  ? 30.137  -46.841 229.373 1.00 87.11  ? 26  PHE A CE2   1 
ATOM   103   C CZ    . PHE A 1 26  ? 29.104  -45.962 229.612 1.00 84.06  ? 26  PHE A CZ    1 
ATOM   104   N N     . ARG A 1 27  ? 30.664  -49.682 225.143 1.00 88.30  ? 27  ARG A N     1 
ATOM   105   C CA    . ARG A 1 27  ? 31.969  -49.345 224.585 1.00 84.89  ? 27  ARG A CA    1 
ATOM   106   C C     . ARG A 1 27  ? 31.820  -48.791 223.173 1.00 91.52  ? 27  ARG A C     1 
ATOM   107   O O     . ARG A 1 27  ? 32.495  -47.831 222.793 1.00 92.62  ? 27  ARG A O     1 
ATOM   108   C CB    . ARG A 1 27  ? 32.863  -50.584 224.550 1.00 82.34  ? 27  ARG A CB    1 
ATOM   109   C CG    . ARG A 1 27  ? 33.497  -50.953 225.879 1.00 83.50  ? 27  ARG A CG    1 
ATOM   110   C CD    . ARG A 1 27  ? 34.228  -52.281 225.754 1.00 87.36  ? 27  ARG A CD    1 
ATOM   111   N NE    . ARG A 1 27  ? 35.007  -52.611 226.942 1.00 92.76  ? 27  ARG A NE    1 
ATOM   112   C CZ    . ARG A 1 27  ? 35.568  -53.797 227.159 1.00 99.47  ? 27  ARG A CZ    1 
ATOM   113   N NH1   . ARG A 1 27  ? 35.429  -54.773 226.270 1.00 98.13  ? 27  ARG A NH1   1 
ATOM   114   N NH2   . ARG A 1 27  ? 36.263  -54.008 228.270 1.00 103.55 ? 27  ARG A NH2   1 
ATOM   115   N N     . ALA A 1 28  ? 30.932  -49.411 222.403 1.00 92.39  ? 28  ALA A N     1 
ATOM   116   C CA    . ALA A 1 28  ? 30.634  -48.973 221.046 1.00 91.41  ? 28  ALA A CA    1 
ATOM   117   C C     . ALA A 1 28  ? 30.130  -47.528 221.004 1.00 96.92  ? 28  ALA A C     1 
ATOM   118   O O     . ALA A 1 28  ? 30.529  -46.756 220.132 1.00 95.61  ? 28  ALA A O     1 
ATOM   119   C CB    . ALA A 1 28  ? 29.625  -49.906 220.407 1.00 86.45  ? 28  ALA A CB    1 
ATOM   120   N N     . VAL A 1 29  ? 29.256  -47.171 221.945 1.00 97.63  ? 29  VAL A N     1 
ATOM   121   C CA    . VAL A 1 29  ? 28.737  -45.805 222.041 1.00 97.14  ? 29  VAL A CA    1 
ATOM   122   C C     . VAL A 1 29  ? 29.848  -44.826 222.398 1.00 98.76  ? 29  VAL A C     1 
ATOM   123   O O     . VAL A 1 29  ? 29.941  -43.742 221.824 1.00 96.60  ? 29  VAL A O     1 
ATOM   124   C CB    . VAL A 1 29  ? 27.613  -45.687 223.095 1.00 91.24  ? 29  VAL A CB    1 
ATOM   125   C CG1   . VAL A 1 29  ? 27.248  -44.220 223.341 1.00 73.97  ? 29  VAL A CG1   1 
ATOM   126   C CG2   . VAL A 1 29  ? 26.396  -46.475 222.661 1.00 88.22  ? 29  VAL A CG2   1 
ATOM   127   N N     . LEU A 1 30  ? 30.688  -45.222 223.350 1.00 100.56 ? 30  LEU A N     1 
ATOM   128   C CA    . LEU A 1 30  ? 31.814  -44.403 223.782 1.00 101.89 ? 30  LEU A CA    1 
ATOM   129   C C     . LEU A 1 30  ? 32.775  -44.110 222.637 1.00 105.15 ? 30  LEU A C     1 
ATOM   130   O O     . LEU A 1 30  ? 33.222  -42.976 222.465 1.00 104.79 ? 30  LEU A O     1 
ATOM   131   C CB    . LEU A 1 30  ? 32.563  -45.088 224.924 1.00 101.14 ? 30  LEU A CB    1 
ATOM   132   C CG    . LEU A 1 30  ? 31.932  -44.957 226.306 1.00 100.81 ? 30  LEU A CG    1 
ATOM   133   C CD1   . LEU A 1 30  ? 32.846  -45.559 227.357 1.00 96.31  ? 30  LEU A CD1   1 
ATOM   134   C CD2   . LEU A 1 30  ? 31.664  -43.497 226.602 1.00 104.48 ? 30  LEU A CD2   1 
ATOM   135   N N     . ALA A 1 31  ? 33.092  -45.137 221.856 1.00 105.96 ? 31  ALA A N     1 
ATOM   136   C CA    . ALA A 1 31  ? 34.005  -44.970 220.734 1.00 108.10 ? 31  ALA A CA    1 
ATOM   137   C C     . ALA A 1 31  ? 33.378  -44.099 219.649 1.00 110.13 ? 31  ALA A C     1 
ATOM   138   O O     . ALA A 1 31  ? 34.037  -43.225 219.089 1.00 117.54 ? 31  ALA A O     1 
ATOM   139   C CB    . ALA A 1 31  ? 34.419  -46.320 220.174 1.00 108.32 ? 31  ALA A CB    1 
ATOM   140   N N     . TRP A 1 32  ? 32.101  -44.341 219.366 1.00 105.77 ? 32  TRP A N     1 
ATOM   141   C CA    . TRP A 1 32  ? 31.342  -43.529 218.418 1.00 104.84 ? 32  TRP A CA    1 
ATOM   142   C C     . TRP A 1 32  ? 31.357  -42.058 218.826 1.00 102.84 ? 32  TRP A C     1 
ATOM   143   O O     . TRP A 1 32  ? 31.474  -41.172 217.980 1.00 104.87 ? 32  TRP A O     1 
ATOM   144   C CB    . TRP A 1 32  ? 29.895  -44.026 218.332 1.00 104.96 ? 32  TRP A CB    1 
ATOM   145   C CG    . TRP A 1 32  ? 29.062  -43.349 217.276 1.00 110.31 ? 32  TRP A CG    1 
ATOM   146   C CD1   . TRP A 1 32  ? 28.488  -42.111 217.349 1.00 114.14 ? 32  TRP A CD1   1 
ATOM   147   C CD2   . TRP A 1 32  ? 28.691  -43.886 215.999 1.00 117.89 ? 32  TRP A CD2   1 
ATOM   148   N NE1   . TRP A 1 32  ? 27.793  -41.841 216.194 1.00 118.56 ? 32  TRP A NE1   1 
ATOM   149   C CE2   . TRP A 1 32  ? 27.902  -42.915 215.350 1.00 119.98 ? 32  TRP A CE2   1 
ATOM   150   C CE3   . TRP A 1 32  ? 28.953  -45.092 215.341 1.00 123.14 ? 32  TRP A CE3   1 
ATOM   151   C CZ2   . TRP A 1 32  ? 27.373  -43.113 214.074 1.00 122.82 ? 32  TRP A CZ2   1 
ATOM   152   C CZ3   . TRP A 1 32  ? 28.427  -45.286 214.075 1.00 125.08 ? 32  TRP A CZ3   1 
ATOM   153   C CH2   . TRP A 1 32  ? 27.646  -44.302 213.455 1.00 125.15 ? 32  TRP A CH2   1 
ATOM   154   N N     . ILE A 1 33  ? 31.227  -41.806 220.126 1.00 98.81  ? 33  ILE A N     1 
ATOM   155   C CA    . ILE A 1 33  ? 31.233  -40.444 220.647 1.00 97.53  ? 33  ILE A CA    1 
ATOM   156   C C     . ILE A 1 33  ? 32.609  -39.829 220.463 1.00 104.58 ? 33  ILE A C     1 
ATOM   157   O O     . ILE A 1 33  ? 32.740  -38.666 220.076 1.00 113.12 ? 33  ILE A O     1 
ATOM   158   C CB    . ILE A 1 33  ? 30.854  -40.405 222.141 1.00 94.77  ? 33  ILE A CB    1 
ATOM   159   C CG1   . ILE A 1 33  ? 29.377  -40.746 222.319 1.00 93.75  ? 33  ILE A CG1   1 
ATOM   160   C CG2   . ILE A 1 33  ? 31.117  -39.033 222.729 1.00 93.17  ? 33  ILE A CG2   1 
ATOM   161   C CD1   . ILE A 1 33  ? 28.459  -39.815 221.573 1.00 95.36  ? 33  ILE A CD1   1 
ATOM   162   N N     . GLY A 1 34  ? 33.633  -40.631 220.732 1.00 103.76 ? 34  GLY A N     1 
ATOM   163   C CA    . GLY A 1 34  ? 35.008  -40.206 220.562 1.00 108.83 ? 34  GLY A CA    1 
ATOM   164   C C     . GLY A 1 34  ? 35.339  -39.778 219.144 1.00 114.54 ? 34  GLY A C     1 
ATOM   165   O O     . GLY A 1 34  ? 36.122  -38.852 218.940 1.00 121.80 ? 34  GLY A O     1 
ATOM   166   N N     . GLU A 1 35  ? 34.741  -40.444 218.161 1.00 114.92 ? 35  GLU A N     1 
ATOM   167   C CA    . GLU A 1 35  ? 35.023  -40.142 216.761 1.00 120.08 ? 35  GLU A CA    1 
ATOM   168   C C     . GLU A 1 35  ? 34.286  -38.890 216.285 1.00 120.34 ? 35  GLU A C     1 
ATOM   169   O O     . GLU A 1 35  ? 34.901  -37.865 215.988 1.00 127.41 ? 35  GLU A O     1 
ATOM   170   C CB    . GLU A 1 35  ? 34.651  -41.331 215.869 1.00 128.08 ? 35  GLU A CB    1 
ATOM   171   C CG    . GLU A 1 35  ? 35.343  -42.636 216.237 1.00 135.86 ? 35  GLU A CG    1 
ATOM   172   C CD    . GLU A 1 35  ? 34.635  -43.853 215.660 1.00 143.11 ? 35  GLU A CD    1 
ATOM   173   O OE1   . GLU A 1 35  ? 33.705  -43.672 214.844 1.00 147.26 ? 35  GLU A OE1   1 
ATOM   174   O OE2   . GLU A 1 35  ? 35.003  -44.990 216.027 1.00 142.75 ? 35  GLU A OE2   1 
ATOM   175   N N     . ARG A 1 36  ? 32.962  -38.982 216.233 1.00 114.72 ? 36  ARG A N     1 
ATOM   176   C CA    . ARG A 1 36  ? 32.134  -37.956 215.603 1.00 115.58 ? 36  ARG A CA    1 
ATOM   177   C C     . ARG A 1 36  ? 31.849  -36.726 216.468 1.00 111.57 ? 36  ARG A C     1 
ATOM   178   O O     . ARG A 1 36  ? 31.611  -35.640 215.941 1.00 109.94 ? 36  ARG A O     1 
ATOM   179   C CB    . ARG A 1 36  ? 30.817  -38.569 215.119 1.00 119.96 ? 36  ARG A CB    1 
ATOM   180   C CG    . ARG A 1 36  ? 30.979  -39.543 213.967 1.00 125.29 ? 36  ARG A CG    1 
ATOM   181   C CD    . ARG A 1 36  ? 29.660  -40.204 213.616 1.00 126.58 ? 36  ARG A CD    1 
ATOM   182   N NE    . ARG A 1 36  ? 29.772  -41.029 212.418 1.00 131.36 ? 36  ARG A NE    1 
ATOM   183   C CZ    . ARG A 1 36  ? 30.217  -42.281 212.411 1.00 135.89 ? 36  ARG A CZ    1 
ATOM   184   N NH1   . ARG A 1 36  ? 30.598  -42.860 213.543 1.00 133.86 ? 36  ARG A NH1   1 
ATOM   185   N NH2   . ARG A 1 36  ? 30.282  -42.955 211.271 1.00 139.92 ? 36  ARG A NH2   1 
ATOM   186   N N     . TYR A 1 37  ? 31.870  -36.890 217.787 1.00 110.33 ? 37  TYR A N     1 
ATOM   187   C CA    . TYR A 1 37  ? 31.497  -35.795 218.681 1.00 113.03 ? 37  TYR A CA    1 
ATOM   188   C C     . TYR A 1 37  ? 32.644  -35.370 219.596 1.00 115.90 ? 37  TYR A C     1 
ATOM   189   O O     . TYR A 1 37  ? 32.420  -34.951 220.732 1.00 120.31 ? 37  TYR A O     1 
ATOM   190   C CB    . TYR A 1 37  ? 30.272  -36.178 219.517 1.00 113.93 ? 37  TYR A CB    1 
ATOM   191   C CG    . TYR A 1 37  ? 29.072  -36.615 218.701 1.00 110.16 ? 37  TYR A CG    1 
ATOM   192   C CD1   . TYR A 1 37  ? 28.961  -37.920 218.236 1.00 107.73 ? 37  TYR A CD1   1 
ATOM   193   C CD2   . TYR A 1 37  ? 28.048  -35.724 218.401 1.00 106.66 ? 37  TYR A CD2   1 
ATOM   194   C CE1   . TYR A 1 37  ? 27.869  -38.325 217.491 1.00 108.33 ? 37  TYR A CE1   1 
ATOM   195   C CE2   . TYR A 1 37  ? 26.951  -36.121 217.657 1.00 108.46 ? 37  TYR A CE2   1 
ATOM   196   C CZ    . TYR A 1 37  ? 26.866  -37.423 217.205 1.00 110.53 ? 37  TYR A CZ    1 
ATOM   197   O OH    . TYR A 1 37  ? 25.777  -37.825 216.465 1.00 111.65 ? 37  TYR A OH    1 
ATOM   198   N N     . ALA A 1 38  ? 33.869  -35.469 219.090 1.00 113.21 ? 38  ALA A N     1 
ATOM   199   C CA    . ALA A 1 38  ? 35.055  -35.161 219.884 1.00 112.94 ? 38  ALA A CA    1 
ATOM   200   C C     . ALA A 1 38  ? 35.117  -33.702 220.329 1.00 117.03 ? 38  ALA A C     1 
ATOM   201   O O     . ALA A 1 38  ? 35.491  -33.407 221.464 1.00 117.92 ? 38  ALA A O     1 
ATOM   202   C CB    . ALA A 1 38  ? 36.310  -35.530 219.115 1.00 115.29 ? 38  ALA A CB    1 
ATOM   203   N N     . ASP A 1 39  ? 34.754  -32.793 219.430 1.00 122.85 ? 39  ASP A N     1 
ATOM   204   C CA    . ASP A 1 39  ? 34.826  -31.364 219.714 1.00 126.47 ? 39  ASP A CA    1 
ATOM   205   C C     . ASP A 1 39  ? 33.688  -30.901 220.619 1.00 126.01 ? 39  ASP A C     1 
ATOM   206   O O     . ASP A 1 39  ? 33.766  -29.840 221.238 1.00 128.12 ? 39  ASP A O     1 
ATOM   207   C CB    . ASP A 1 39  ? 34.828  -30.564 218.410 1.00 129.02 ? 39  ASP A CB    1 
ATOM   208   C CG    . ASP A 1 39  ? 33.861  -31.123 217.383 1.00 130.68 ? 39  ASP A CG    1 
ATOM   209   O OD1   . ASP A 1 39  ? 33.877  -32.351 217.154 1.00 127.60 ? 39  ASP A OD1   1 
ATOM   210   O OD2   . ASP A 1 39  ? 33.081  -30.334 216.809 1.00 135.15 ? 39  ASP A OD2   1 
ATOM   211   N N     . LEU A 1 40  ? 32.634  -31.706 220.697 1.00 121.06 ? 40  LEU A N     1 
ATOM   212   C CA    . LEU A 1 40  ? 31.473  -31.363 221.508 1.00 118.02 ? 40  LEU A CA    1 
ATOM   213   C C     . LEU A 1 40  ? 31.667  -31.811 222.950 1.00 113.31 ? 40  LEU A C     1 
ATOM   214   O O     . LEU A 1 40  ? 30.856  -31.501 223.822 1.00 113.02 ? 40  LEU A O     1 
ATOM   215   C CB    . LEU A 1 40  ? 30.207  -32.007 220.940 1.00 120.29 ? 40  LEU A CB    1 
ATOM   216   C CG    . LEU A 1 40  ? 29.585  -31.431 219.665 1.00 126.06 ? 40  LEU A CG    1 
ATOM   217   C CD1   . LEU A 1 40  ? 30.444  -31.694 218.425 1.00 128.54 ? 40  LEU A CD1   1 
ATOM   218   C CD2   . LEU A 1 40  ? 28.175  -31.985 219.480 1.00 126.39 ? 40  LEU A CD2   1 
ATOM   219   N N     . LEU A 1 41  ? 32.751  -32.541 223.190 1.00 111.00 ? 41  LEU A N     1 
ATOM   220   C CA    . LEU A 1 41  ? 33.016  -33.136 224.495 1.00 110.52 ? 41  LEU A CA    1 
ATOM   221   C C     . LEU A 1 41  ? 33.937  -32.251 225.339 1.00 114.83 ? 41  LEU A C     1 
ATOM   222   O O     . LEU A 1 41  ? 34.879  -31.656 224.817 1.00 119.18 ? 41  LEU A O     1 
ATOM   223   C CB    . LEU A 1 41  ? 33.642  -34.516 224.298 1.00 109.57 ? 41  LEU A CB    1 
ATOM   224   C CG    . LEU A 1 41  ? 33.479  -35.550 225.407 1.00 111.21 ? 41  LEU A CG    1 
ATOM   225   C CD1   . LEU A 1 41  ? 32.007  -35.845 225.646 1.00 108.74 ? 41  LEU A CD1   1 
ATOM   226   C CD2   . LEU A 1 41  ? 34.230  -36.815 225.035 1.00 113.45 ? 41  LEU A CD2   1 
ATOM   227   N N     . ASP A 1 42  ? 33.669  -32.170 226.642 1.00 114.97 ? 42  ASP A N     1 
ATOM   228   C CA    . ASP A 1 42  ? 34.440  -31.297 227.536 1.00 119.04 ? 42  ASP A CA    1 
ATOM   229   C C     . ASP A 1 42  ? 35.547  -32.029 228.308 1.00 121.28 ? 42  ASP A C     1 
ATOM   230   O O     . ASP A 1 42  ? 35.639  -33.256 228.262 1.00 121.33 ? 42  ASP A O     1 
ATOM   231   C CB    . ASP A 1 42  ? 33.509  -30.496 228.472 1.00 122.08 ? 42  ASP A CB    1 
ATOM   232   C CG    . ASP A 1 42  ? 33.622  -30.911 229.935 1.00 124.44 ? 42  ASP A CG    1 
ATOM   233   O OD1   . ASP A 1 42  ? 34.557  -30.444 230.621 1.00 128.95 ? 42  ASP A OD1   1 
ATOM   234   O OD2   . ASP A 1 42  ? 32.761  -31.682 230.407 1.00 122.61 ? 42  ASP A OD2   1 
ATOM   235   N N     . ASP A 1 43  ? 36.382  -31.256 229.002 1.00 125.73 ? 43  ASP A N     1 
ATOM   236   C CA    . ASP A 1 43  ? 37.567  -31.762 229.700 1.00 128.40 ? 43  ASP A CA    1 
ATOM   237   C C     . ASP A 1 43  ? 37.296  -32.949 230.625 1.00 124.72 ? 43  ASP A C     1 
ATOM   238   O O     . ASP A 1 43  ? 37.888  -34.017 230.466 1.00 124.77 ? 43  ASP A O     1 
ATOM   239   C CB    . ASP A 1 43  ? 38.228  -30.635 230.499 1.00 134.73 ? 43  ASP A CB    1 
ATOM   240   C CG    . ASP A 1 43  ? 38.181  -29.302 229.776 1.00 142.12 ? 43  ASP A CG    1 
ATOM   241   O OD1   . ASP A 1 43  ? 39.075  -29.040 228.943 1.00 149.26 ? 43  ASP A OD1   1 
ATOM   242   O OD2   . ASP A 1 43  ? 37.247  -28.516 230.043 1.00 138.95 ? 43  ASP A OD2   1 
ATOM   243   N N     . GLN A 1 44  ? 36.406  -32.753 231.592 1.00 121.53 ? 44  GLN A N     1 
ATOM   244   C CA    . GLN A 1 44  ? 36.097  -33.793 232.570 1.00 120.42 ? 44  GLN A CA    1 
ATOM   245   C C     . GLN A 1 44  ? 35.370  -34.989 231.952 1.00 113.52 ? 44  GLN A C     1 
ATOM   246   O O     . GLN A 1 44  ? 35.324  -36.068 232.543 1.00 109.72 ? 44  GLN A O     1 
ATOM   247   C CB    . GLN A 1 44  ? 35.292  -33.211 233.738 1.00 128.33 ? 44  GLN A CB    1 
ATOM   248   C CG    . GLN A 1 44  ? 34.108  -32.353 233.319 1.00 137.78 ? 44  GLN A CG    1 
ATOM   249   C CD    . GLN A 1 44  ? 32.779  -33.081 233.431 1.00 141.92 ? 44  GLN A CD    1 
ATOM   250   O OE1   . GLN A 1 44  ? 32.672  -34.106 234.105 1.00 141.58 ? 44  GLN A OE1   1 
ATOM   251   N NE2   . GLN A 1 44  ? 31.756  -32.548 232.769 1.00 142.05 ? 44  GLN A NE2   1 
ATOM   252   N N     . GLU A 1 45  ? 34.809  -34.793 230.761 1.00 113.30 ? 45  GLU A N     1 
ATOM   253   C CA    . GLU A 1 45  ? 34.108  -35.860 230.050 1.00 107.74 ? 45  GLU A CA    1 
ATOM   254   C C     . GLU A 1 45  ? 35.086  -36.720 229.255 1.00 102.60 ? 45  GLU A C     1 
ATOM   255   O O     . GLU A 1 45  ? 34.891  -37.929 229.099 1.00 94.78  ? 45  GLU A O     1 
ATOM   256   C CB    . GLU A 1 45  ? 33.034  -35.271 229.129 1.00 107.00 ? 45  GLU A CB    1 
ATOM   257   C CG    . GLU A 1 45  ? 31.847  -34.673 229.879 1.00 110.97 ? 45  GLU A CG    1 
ATOM   258   C CD    . GLU A 1 45  ? 31.034  -33.694 229.046 1.00 115.19 ? 45  GLU A CD    1 
ATOM   259   O OE1   . GLU A 1 45  ? 30.087  -33.094 229.598 1.00 112.38 ? 45  GLU A OE1   1 
ATOM   260   O OE2   . GLU A 1 45  ? 31.343  -33.514 227.849 1.00 120.78 ? 45  GLU A OE2   1 
ATOM   261   N N     . ARG A 1 46  ? 36.141  -36.087 228.754 1.00 104.25 ? 46  ARG A N     1 
ATOM   262   C CA    . ARG A 1 46  ? 37.188  -36.803 228.040 1.00 102.11 ? 46  ARG A CA    1 
ATOM   263   C C     . ARG A 1 46  ? 37.958  -37.676 229.023 1.00 99.10  ? 46  ARG A C     1 
ATOM   264   O O     . ARG A 1 46  ? 38.442  -38.757 228.676 1.00 91.85  ? 46  ARG A O     1 
ATOM   265   C CB    . ARG A 1 46  ? 38.126  -35.820 227.339 1.00 101.72 ? 46  ARG A CB    1 
ATOM   266   C CG    . ARG A 1 46  ? 37.599  -35.320 226.002 1.00 101.30 ? 46  ARG A CG    1 
ATOM   267   C CD    . ARG A 1 46  ? 38.595  -34.394 225.324 1.00 104.07 ? 46  ARG A CD    1 
ATOM   268   N NE    . ARG A 1 46  ? 38.750  -33.138 226.050 1.00 106.78 ? 46  ARG A NE    1 
ATOM   269   C CZ    . ARG A 1 46  ? 38.103  -32.016 225.749 1.00 109.08 ? 46  ARG A CZ    1 
ATOM   270   N NH1   . ARG A 1 46  ? 38.304  -30.920 226.468 1.00 106.54 ? 46  ARG A NH1   1 
ATOM   271   N NH2   . ARG A 1 46  ? 37.256  -31.990 224.727 1.00 113.04 ? 46  ARG A NH2   1 
ATOM   272   N N     . ALA A 1 47  ? 38.044  -37.189 230.258 1.00 97.03  ? 47  ALA A N     1 
ATOM   273   C CA    . ALA A 1 47  ? 38.727  -37.879 231.342 1.00 93.87  ? 47  ALA A CA    1 
ATOM   274   C C     . ALA A 1 47  ? 37.966  -39.138 231.720 1.00 96.60  ? 47  ALA A C     1 
ATOM   275   O O     . ALA A 1 47  ? 38.562  -40.174 232.015 1.00 100.87 ? 47  ALA A O     1 
ATOM   276   C CB    . ALA A 1 47  ? 38.848  -36.962 232.542 1.00 95.30  ? 47  ALA A CB    1 
ATOM   277   N N     . PHE A 1 48  ? 36.642  -39.037 231.708 1.00 95.47  ? 48  PHE A N     1 
ATOM   278   C CA    . PHE A 1 48  ? 35.782  -40.176 231.998 1.00 90.49  ? 48  PHE A CA    1 
ATOM   279   C C     . PHE A 1 48  ? 35.987  -41.325 231.014 1.00 89.32  ? 48  PHE A C     1 
ATOM   280   O O     . PHE A 1 48  ? 36.212  -42.462 231.424 1.00 90.57  ? 48  PHE A O     1 
ATOM   281   C CB    . PHE A 1 48  ? 34.315  -39.754 231.986 1.00 87.12  ? 48  PHE A CB    1 
ATOM   282   C CG    . PHE A 1 48  ? 33.361  -40.875 232.281 1.00 83.99  ? 48  PHE A CG    1 
ATOM   283   C CD1   . PHE A 1 48  ? 32.760  -41.586 231.253 1.00 86.02  ? 48  PHE A CD1   1 
ATOM   284   C CD2   . PHE A 1 48  ? 33.060  -41.213 233.588 1.00 85.97  ? 48  PHE A CD2   1 
ATOM   285   C CE1   . PHE A 1 48  ? 31.880  -42.616 231.525 1.00 88.98  ? 48  PHE A CE1   1 
ATOM   286   C CE2   . PHE A 1 48  ? 32.181  -42.241 233.868 1.00 90.82  ? 48  PHE A CE2   1 
ATOM   287   C CZ    . PHE A 1 48  ? 31.590  -42.944 232.835 1.00 89.95  ? 48  PHE A CZ    1 
ATOM   288   N N     . ILE A 1 49  ? 35.892  -41.026 229.720 1.00 85.79  ? 49  ILE A N     1 
ATOM   289   C CA    . ILE A 1 49  ? 36.024  -42.042 228.677 1.00 85.48  ? 49  ILE A CA    1 
ATOM   290   C C     . ILE A 1 49  ? 37.407  -42.709 228.708 1.00 90.20  ? 49  ILE A C     1 
ATOM   291   O O     . ILE A 1 49  ? 37.538  -43.909 228.452 1.00 87.55  ? 49  ILE A O     1 
ATOM   292   C CB    . ILE A 1 49  ? 35.751  -41.447 227.272 1.00 86.26  ? 49  ILE A CB    1 
ATOM   293   C CG1   . ILE A 1 49  ? 34.418  -40.690 227.253 1.00 78.99  ? 49  ILE A CG1   1 
ATOM   294   C CG2   . ILE A 1 49  ? 35.763  -42.534 226.210 1.00 79.37  ? 49  ILE A CG2   1 
ATOM   295   C CD1   . ILE A 1 49  ? 33.955  -40.296 225.858 1.00 93.18  ? 49  ILE A CD1   1 
ATOM   296   N N     . ALA A 1 50  ? 38.428  -41.921 229.036 1.00 93.26  ? 50  ALA A N     1 
ATOM   297   C CA    . ALA A 1 50  ? 39.794  -42.421 229.180 1.00 95.15  ? 50  ALA A CA    1 
ATOM   298   C C     . ALA A 1 50  ? 39.914  -43.326 230.401 1.00 100.42 ? 50  ALA A C     1 
ATOM   299   O O     . ALA A 1 50  ? 40.496  -44.412 230.336 1.00 103.23 ? 50  ALA A O     1 
ATOM   300   C CB    . ALA A 1 50  ? 40.764  -41.257 229.302 1.00 97.70  ? 50  ALA A CB    1 
ATOM   301   N N     . ALA A 1 51  ? 39.359  -42.855 231.514 1.00 101.31 ? 51  ALA A N     1 
ATOM   302   C CA    . ALA A 1 51  ? 39.414  -43.569 232.783 1.00 97.50  ? 51  ALA A CA    1 
ATOM   303   C C     . ALA A 1 51  ? 38.635  -44.870 232.720 1.00 97.40  ? 51  ALA A C     1 
ATOM   304   O O     . ALA A 1 51  ? 39.031  -45.873 233.316 1.00 96.23  ? 51  ALA A O     1 
ATOM   305   C CB    . ALA A 1 51  ? 38.873  -42.694 233.902 1.00 89.49  ? 51  ALA A CB    1 
ATOM   306   N N     . PHE A 1 52  ? 37.520  -44.843 231.999 1.00 99.87  ? 52  PHE A N     1 
ATOM   307   C CA    . PHE A 1 52  ? 36.655  -46.007 231.888 1.00 98.51  ? 52  PHE A CA    1 
ATOM   308   C C     . PHE A 1 52  ? 37.384  -47.170 231.215 1.00 96.95  ? 52  PHE A C     1 
ATOM   309   O O     . PHE A 1 52  ? 37.223  -48.324 231.611 1.00 91.51  ? 52  PHE A O     1 
ATOM   310   C CB    . PHE A 1 52  ? 35.378  -45.656 231.121 1.00 90.77  ? 52  PHE A CB    1 
ATOM   311   C CG    . PHE A 1 52  ? 34.431  -46.808 230.961 1.00 92.04  ? 52  PHE A CG    1 
ATOM   312   C CD1   . PHE A 1 52  ? 33.550  -47.145 231.976 1.00 94.48  ? 52  PHE A CD1   1 
ATOM   313   C CD2   . PHE A 1 52  ? 34.418  -47.554 229.795 1.00 93.79  ? 52  PHE A CD2   1 
ATOM   314   C CE1   . PHE A 1 52  ? 32.677  -48.207 231.829 1.00 93.69  ? 52  PHE A CE1   1 
ATOM   315   C CE2   . PHE A 1 52  ? 33.548  -48.614 229.643 1.00 95.36  ? 52  PHE A CE2   1 
ATOM   316   C CZ    . PHE A 1 52  ? 32.676  -48.940 230.659 1.00 93.05  ? 52  PHE A CZ    1 
ATOM   317   N N     . ALA A 1 53  ? 38.198  -46.859 230.211 1.00 95.43  ? 53  ALA A N     1 
ATOM   318   C CA    . ALA A 1 53  ? 38.902  -47.890 229.453 1.00 93.14  ? 53  ALA A CA    1 
ATOM   319   C C     . ALA A 1 53  ? 40.013  -48.539 230.275 1.00 97.63  ? 53  ALA A C     1 
ATOM   320   O O     . ALA A 1 53  ? 40.395  -49.685 230.030 1.00 93.65  ? 53  ALA A O     1 
ATOM   321   C CB    . ALA A 1 53  ? 39.458  -47.315 228.162 1.00 91.55  ? 53  ALA A CB    1 
ATOM   322   N N     . GLU A 1 54  ? 40.516  -47.797 231.256 1.00 103.34 ? 54  GLU A N     1 
ATOM   323   C CA    . GLU A 1 54  ? 41.579  -48.276 232.130 1.00 105.66 ? 54  GLU A CA    1 
ATOM   324   C C     . GLU A 1 54  ? 41.049  -49.146 233.268 1.00 106.50 ? 54  GLU A C     1 
ATOM   325   O O     . GLU A 1 54  ? 41.826  -49.743 234.010 1.00 111.20 ? 54  GLU A O     1 
ATOM   326   C CB    . GLU A 1 54  ? 42.363  -47.093 232.696 1.00 113.79 ? 54  GLU A CB    1 
ATOM   327   C CG    . GLU A 1 54  ? 43.171  -46.347 231.653 1.00 121.95 ? 54  GLU A CG    1 
ATOM   328   C CD    . GLU A 1 54  ? 44.403  -47.118 231.231 1.00 127.88 ? 54  GLU A CD    1 
ATOM   329   O OE1   . GLU A 1 54  ? 45.184  -47.508 232.125 1.00 130.22 ? 54  GLU A OE1   1 
ATOM   330   O OE2   . GLU A 1 54  ? 44.586  -47.343 230.015 1.00 129.92 ? 54  GLU A OE2   1 
ATOM   331   N N     . LEU A 1 55  ? 39.729  -49.209 233.410 1.00 105.35 ? 55  LEU A N     1 
ATOM   332   C CA    . LEU A 1 55  ? 39.112  -50.061 234.425 1.00 100.06 ? 55  LEU A CA    1 
ATOM   333   C C     . LEU A 1 55  ? 39.250  -51.533 234.056 1.00 100.05 ? 55  LEU A C     1 
ATOM   334   O O     . LEU A 1 55  ? 39.392  -51.870 232.879 1.00 103.42 ? 55  LEU A O     1 
ATOM   335   C CB    . LEU A 1 55  ? 37.628  -49.714 234.599 1.00 89.37  ? 55  LEU A CB    1 
ATOM   336   C CG    . LEU A 1 55  ? 37.250  -48.492 235.439 1.00 84.38  ? 55  LEU A CG    1 
ATOM   337   C CD1   . LEU A 1 55  ? 35.781  -48.153 235.242 1.00 84.05  ? 55  LEU A CD1   1 
ATOM   338   C CD2   . LEU A 1 55  ? 37.542  -48.741 236.909 1.00 81.28  ? 55  LEU A CD2   1 
ATOM   339   N N     . PRO A 1 56  ? 39.226  -52.417 235.067 1.00 94.50  ? 56  PRO A N     1 
ATOM   340   C CA    . PRO A 1 56  ? 39.157  -53.854 234.804 1.00 95.85  ? 56  PRO A CA    1 
ATOM   341   C C     . PRO A 1 56  ? 37.859  -54.182 234.103 1.00 98.31  ? 56  PRO A C     1 
ATOM   342   O O     . PRO A 1 56  ? 36.876  -53.453 234.254 1.00 95.99  ? 56  PRO A O     1 
ATOM   343   C CB    . PRO A 1 56  ? 39.132  -54.465 236.204 1.00 79.52  ? 56  PRO A CB    1 
ATOM   344   C CG    . PRO A 1 56  ? 39.812  -53.470 237.056 1.00 80.48  ? 56  PRO A CG    1 
ATOM   345   C CD    . PRO A 1 56  ? 39.430  -52.131 236.497 1.00 90.11  ? 56  PRO A CD    1 
ATOM   346   N N     . GLU A 1 57  ? 37.857  -55.279 233.359 1.00 102.97 ? 57  GLU A N     1 
ATOM   347   C CA    . GLU A 1 57  ? 36.692  -55.678 232.590 1.00 102.90 ? 57  GLU A CA    1 
ATOM   348   C C     . GLU A 1 57  ? 35.441  -55.857 233.454 1.00 95.36  ? 57  GLU A C     1 
ATOM   349   O O     . GLU A 1 57  ? 34.363  -55.399 233.086 1.00 97.06  ? 57  GLU A O     1 
ATOM   350   C CB    . GLU A 1 57  ? 36.994  -56.955 231.812 1.00 107.89 ? 57  GLU A CB    1 
ATOM   351   C CG    . GLU A 1 57  ? 35.893  -57.361 230.866 1.00 108.91 ? 57  GLU A CG    1 
ATOM   352   C CD    . GLU A 1 57  ? 36.283  -57.197 229.413 1.00 114.46 ? 57  GLU A CD    1 
ATOM   353   O OE1   . GLU A 1 57  ? 35.475  -57.580 228.542 1.00 120.31 ? 57  GLU A OE1   1 
ATOM   354   O OE2   . GLU A 1 57  ? 37.394  -56.692 229.140 1.00 112.06 ? 57  GLU A OE2   1 
ATOM   355   N N     . ALA A 1 58  ? 35.580  -56.504 234.607 1.00 87.71  ? 58  ALA A N     1 
ATOM   356   C CA    . ALA A 1 58  ? 34.427  -56.712 235.482 1.00 81.59  ? 58  ALA A CA    1 
ATOM   357   C C     . ALA A 1 58  ? 33.962  -55.431 236.172 1.00 79.28  ? 58  ALA A C     1 
ATOM   358   O O     . ALA A 1 58  ? 32.860  -55.378 236.717 1.00 82.57  ? 58  ALA A O     1 
ATOM   359   C CB    . ALA A 1 58  ? 34.715  -57.793 236.510 1.00 78.91  ? 58  ALA A CB    1 
ATOM   360   N N     . SER A 1 59  ? 34.800  -54.403 236.161 1.00 77.25  ? 59  SER A N     1 
ATOM   361   C CA    . SER A 1 59  ? 34.428  -53.144 236.794 1.00 78.35  ? 59  SER A CA    1 
ATOM   362   C C     . SER A 1 59  ? 33.644  -52.279 235.819 1.00 84.18  ? 59  SER A C     1 
ATOM   363   O O     . SER A 1 59  ? 32.693  -51.596 236.200 1.00 84.23  ? 59  SER A O     1 
ATOM   364   C CB    . SER A 1 59  ? 35.662  -52.409 237.311 1.00 79.43  ? 59  SER A CB    1 
ATOM   365   O OG    . SER A 1 59  ? 36.208  -53.089 238.426 1.00 81.84  ? 59  SER A OG    1 
ATOM   366   N N     . GLN A 1 60  ? 34.055  -52.316 234.557 1.00 85.76  ? 60  GLN A N     1 
ATOM   367   C CA    . GLN A 1 60  ? 33.314  -51.666 233.490 1.00 80.11  ? 60  GLN A CA    1 
ATOM   368   C C     . GLN A 1 60  ? 31.913  -52.251 233.411 1.00 86.53  ? 60  GLN A C     1 
ATOM   369   O O     . GLN A 1 60  ? 30.929  -51.521 233.278 1.00 88.19  ? 60  GLN A O     1 
ATOM   370   C CB    . GLN A 1 60  ? 34.023  -51.877 232.155 1.00 79.56  ? 60  GLN A CB    1 
ATOM   371   C CG    . GLN A 1 60  ? 35.431  -51.326 232.103 1.00 88.73  ? 60  GLN A CG    1 
ATOM   372   C CD    . GLN A 1 60  ? 36.086  -51.553 230.756 1.00 94.34  ? 60  GLN A CD    1 
ATOM   373   O OE1   . GLN A 1 60  ? 35.456  -52.048 229.822 1.00 97.34  ? 60  GLN A OE1   1 
ATOM   374   N NE2   . GLN A 1 60  ? 37.358  -51.191 230.648 1.00 99.56  ? 60  GLN A NE2   1 
ATOM   375   N N     . ALA A 1 61  ? 31.839  -53.576 233.501 1.00 86.96  ? 61  ALA A N     1 
ATOM   376   C CA    . ALA A 1 61  ? 30.579  -54.297 233.386 1.00 80.39  ? 61  ALA A CA    1 
ATOM   377   C C     . ALA A 1 61  ? 29.608  -53.908 234.495 1.00 81.36  ? 61  ALA A C     1 
ATOM   378   O O     . ALA A 1 61  ? 28.437  -53.631 234.233 1.00 83.03  ? 61  ALA A O     1 
ATOM   379   C CB    . ALA A 1 61  ? 30.829  -55.796 233.395 1.00 72.93  ? 61  ALA A CB    1 
ATOM   380   N N     . LEU A 1 62  ? 30.101  -53.878 235.729 1.00 83.41  ? 62  LEU A N     1 
ATOM   381   C CA    . LEU A 1 62  ? 29.261  -53.563 236.880 1.00 83.17  ? 62  LEU A CA    1 
ATOM   382   C C     . LEU A 1 62  ? 28.698  -52.147 236.799 1.00 84.02  ? 62  LEU A C     1 
ATOM   383   O O     . LEU A 1 62  ? 27.537  -51.903 237.141 1.00 85.24  ? 62  LEU A O     1 
ATOM   384   C CB    . LEU A 1 62  ? 30.044  -53.749 238.179 1.00 76.87  ? 62  LEU A CB    1 
ATOM   385   C CG    . LEU A 1 62  ? 29.275  -53.433 239.461 1.00 73.93  ? 62  LEU A CG    1 
ATOM   386   C CD1   . LEU A 1 62  ? 28.042  -54.325 239.612 1.00 70.49  ? 62  LEU A CD1   1 
ATOM   387   C CD2   . LEU A 1 62  ? 30.198  -53.541 240.670 1.00 75.75  ? 62  LEU A CD2   1 
ATOM   388   N N     . LEU A 1 63  ? 29.530  -51.222 236.334 1.00 81.26  ? 63  LEU A N     1 
ATOM   389   C CA    . LEU A 1 63  ? 29.122  -49.835 236.165 1.00 81.40  ? 63  LEU A CA    1 
ATOM   390   C C     . LEU A 1 63  ? 27.991  -49.718 235.147 1.00 83.69  ? 63  LEU A C     1 
ATOM   391   O O     . LEU A 1 63  ? 26.956  -49.106 235.420 1.00 91.45  ? 63  LEU A O     1 
ATOM   392   C CB    . LEU A 1 63  ? 30.309  -48.988 235.717 1.00 69.76  ? 63  LEU A CB    1 
ATOM   393   C CG    . LEU A 1 63  ? 30.050  -47.486 235.622 1.00 82.65  ? 63  LEU A CG    1 
ATOM   394   C CD1   . LEU A 1 63  ? 29.870  -46.884 237.000 1.00 70.14  ? 63  LEU A CD1   1 
ATOM   395   C CD2   . LEU A 1 63  ? 31.177  -46.807 234.881 1.00 71.17  ? 63  LEU A CD2   1 
ATOM   396   N N     . VAL A 1 64  ? 28.197  -50.316 233.978 1.00 79.16  ? 64  VAL A N     1 
ATOM   397   C CA    . VAL A 1 64  ? 27.197  -50.319 232.916 1.00 74.91  ? 64  VAL A CA    1 
ATOM   398   C C     . VAL A 1 64  ? 25.854  -50.869 233.409 1.00 73.69  ? 64  VAL A C     1 
ATOM   399   O O     . VAL A 1 64  ? 24.797  -50.353 233.046 1.00 83.63  ? 64  VAL A O     1 
ATOM   400   C CB    . VAL A 1 64  ? 27.690  -51.122 231.687 1.00 76.51  ? 64  VAL A CB    1 
ATOM   401   C CG1   . VAL A 1 64  ? 26.588  -51.270 230.664 1.00 78.98  ? 64  VAL A CG1   1 
ATOM   402   C CG2   . VAL A 1 64  ? 28.910  -50.449 231.063 1.00 75.24  ? 64  VAL A CG2   1 
ATOM   403   N N     . ARG A 1 65  ? 25.901  -51.899 234.251 1.00 70.52  ? 65  ARG A N     1 
ATOM   404   C CA    . ARG A 1 65  ? 24.685  -52.495 234.812 1.00 73.55  ? 65  ARG A CA    1 
ATOM   405   C C     . ARG A 1 65  ? 23.838  -51.487 235.577 1.00 75.89  ? 65  ARG A C     1 
ATOM   406   O O     . ARG A 1 65  ? 22.624  -51.423 235.408 1.00 77.09  ? 65  ARG A O     1 
ATOM   407   C CB    . ARG A 1 65  ? 25.037  -53.659 235.736 1.00 70.78  ? 65  ARG A CB    1 
ATOM   408   C CG    . ARG A 1 65  ? 25.472  -54.915 235.006 1.00 70.01  ? 65  ARG A CG    1 
ATOM   409   C CD    . ARG A 1 65  ? 24.361  -55.465 234.128 1.00 70.35  ? 65  ARG A CD    1 
ATOM   410   N NE    . ARG A 1 65  ? 24.676  -56.816 233.674 1.00 74.61  ? 65  ARG A NE    1 
ATOM   411   C CZ    . ARG A 1 65  ? 23.865  -57.574 232.943 1.00 79.97  ? 65  ARG A CZ    1 
ATOM   412   N NH1   . ARG A 1 65  ? 22.677  -57.118 232.575 1.00 86.55  ? 65  ARG A NH1   1 
ATOM   413   N NH2   . ARG A 1 65  ? 24.242  -58.795 232.583 1.00 78.67  ? 65  ARG A NH2   1 
ATOM   414   N N     . MET A 1 66  ? 24.498  -50.707 236.422 1.00 70.80  ? 66  MET A N     1 
ATOM   415   C CA    . MET A 1 66  ? 23.842  -49.678 237.217 1.00 70.07  ? 66  MET A CA    1 
ATOM   416   C C     . MET A 1 66  ? 23.341  -48.532 236.342 1.00 77.17  ? 66  MET A C     1 
ATOM   417   O O     . MET A 1 66  ? 22.305  -47.930 236.626 1.00 87.22  ? 66  MET A O     1 
ATOM   418   C CB    . MET A 1 66  ? 24.810  -49.162 238.290 1.00 66.22  ? 66  MET A CB    1 
ATOM   419   C CG    . MET A 1 66  ? 25.408  -50.280 239.156 1.00 80.77  ? 66  MET A CG    1 
ATOM   420   S SD    . MET A 1 66  ? 26.866  -49.844 240.114 1.00 100.05 ? 66  MET A SD    1 
ATOM   421   C CE    . MET A 1 66  ? 26.224  -48.698 241.341 1.00 70.21  ? 66  MET A CE    1 
ATOM   422   N N     . VAL A 1 67  ? 24.076  -48.243 235.275 1.00 73.73  ? 67  VAL A N     1 
ATOM   423   C CA    . VAL A 1 67  ? 23.716  -47.156 234.380 1.00 77.74  ? 67  VAL A CA    1 
ATOM   424   C C     . VAL A 1 67  ? 22.453  -47.529 233.610 1.00 77.42  ? 67  VAL A C     1 
ATOM   425   O O     . VAL A 1 67  ? 21.514  -46.734 233.503 1.00 81.24  ? 67  VAL A O     1 
ATOM   426   C CB    . VAL A 1 67  ? 24.864  -46.833 233.403 1.00 72.80  ? 67  VAL A CB    1 
ATOM   427   C CG1   . VAL A 1 67  ? 24.406  -45.817 232.370 1.00 70.58  ? 67  VAL A CG1   1 
ATOM   428   C CG2   . VAL A 1 67  ? 26.082  -46.321 234.155 1.00 70.15  ? 67  VAL A CG2   1 
ATOM   429   N N     . MET A 1 68  ? 22.434  -48.757 233.104 1.00 68.89  ? 68  MET A N     1 
ATOM   430   C CA    . MET A 1 68  ? 21.315  -49.264 232.325 1.00 69.83  ? 68  MET A CA    1 
ATOM   431   C C     . MET A 1 68  ? 20.034  -49.473 233.141 1.00 65.17  ? 68  MET A C     1 
ATOM   432   O O     . MET A 1 68  ? 18.930  -49.228 232.649 1.00 68.04  ? 68  MET A O     1 
ATOM   433   C CB    . MET A 1 68  ? 21.723  -50.567 231.646 1.00 65.63  ? 68  MET A CB    1 
ATOM   434   C CG    . MET A 1 68  ? 22.665  -50.383 230.472 1.00 66.31  ? 68  MET A CG    1 
ATOM   435   S SD    . MET A 1 68  ? 22.939  -51.939 229.615 1.00 90.48  ? 68  MET A SD    1 
ATOM   436   C CE    . MET A 1 68  ? 23.993  -51.415 228.267 1.00 98.42  ? 68  MET A CE    1 
ATOM   437   N N     . ARG A 1 69  ? 20.185  -49.924 234.383 1.00 64.78  ? 69  ARG A N     1 
ATOM   438   C CA    . ARG A 1 69  ? 19.042  -50.184 235.250 1.00 64.41  ? 69  ARG A CA    1 
ATOM   439   C C     . ARG A 1 69  ? 18.403  -48.896 235.753 1.00 78.55  ? 69  ARG A C     1 
ATOM   440   O O     . ARG A 1 69  ? 19.039  -47.840 235.774 1.00 89.05  ? 69  ARG A O     1 
ATOM   441   C CB    . ARG A 1 69  ? 19.439  -51.091 236.415 1.00 76.99  ? 69  ARG A CB    1 
ATOM   442   C CG    . ARG A 1 69  ? 19.586  -52.542 236.005 1.00 63.96  ? 69  ARG A CG    1 
ATOM   443   C CD    . ARG A 1 69  ? 20.180  -53.387 237.107 1.00 68.91  ? 69  ARG A CD    1 
ATOM   444   N NE    . ARG A 1 69  ? 19.333  -53.425 238.293 1.00 70.71  ? 69  ARG A NE    1 
ATOM   445   C CZ    . ARG A 1 69  ? 19.492  -54.291 239.287 1.00 74.14  ? 69  ARG A CZ    1 
ATOM   446   N NH1   . ARG A 1 69  ? 20.458  -55.193 239.228 1.00 64.02  ? 69  ARG A NH1   1 
ATOM   447   N NH2   . ARG A 1 69  ? 18.681  -54.265 240.335 1.00 78.79  ? 69  ARG A NH2   1 
ATOM   448   N N     . LYS A 1 70  ? 17.146  -49.020 236.175 1.00 73.11  ? 70  LYS A N     1 
ATOM   449   C CA    . LYS A 1 70  ? 16.256  -47.898 236.482 1.00 78.67  ? 70  LYS A CA    1 
ATOM   450   C C     . LYS A 1 70  ? 16.816  -46.882 237.461 1.00 81.05  ? 70  LYS A C     1 
ATOM   451   O O     . LYS A 1 70  ? 16.879  -45.698 237.165 1.00 88.24  ? 70  LYS A O     1 
ATOM   452   C CB    . LYS A 1 70  ? 14.922  -48.421 237.030 1.00 90.10  ? 70  LYS A CB    1 
ATOM   453   C CG    . LYS A 1 70  ? 13.905  -47.343 237.396 1.00 99.66  ? 70  LYS A CG    1 
ATOM   454   C CD    . LYS A 1 70  ? 13.245  -46.758 236.158 1.00 106.90 ? 70  LYS A CD    1 
ATOM   455   C CE    . LYS A 1 70  ? 11.798  -46.361 236.431 1.00 113.57 ? 70  LYS A CE    1 
ATOM   456   N NZ    . LYS A 1 70  ? 11.104  -45.959 235.175 1.00 118.86 ? 70  LYS A NZ    1 
ATOM   457   N N     . GLY A 1 71  ? 17.195  -47.343 238.643 1.00 77.31  ? 71  GLY A N     1 
ATOM   458   C CA    . GLY A 1 71  ? 17.618  -46.437 239.693 1.00 82.67  ? 71  GLY A CA    1 
ATOM   459   C C     . GLY A 1 71  ? 19.003  -45.831 239.531 1.00 87.77  ? 71  GLY A C     1 
ATOM   460   O O     . GLY A 1 71  ? 19.602  -45.846 238.448 1.00 83.31  ? 71  GLY A O     1 
ATOM   461   N N     . THR A 1 72  ? 19.488  -45.267 240.631 1.00 89.52  ? 72  THR A N     1 
ATOM   462   C CA    . THR A 1 72  ? 20.837  -44.755 240.751 1.00 75.98  ? 72  THR A CA    1 
ATOM   463   C C     . THR A 1 72  ? 21.296  -45.281 242.115 1.00 75.75  ? 72  THR A C     1 
ATOM   464   O O     . THR A 1 72  ? 22.502  -45.322 242.410 1.00 77.71  ? 72  THR A O     1 
ATOM   465   C CB    . THR A 1 72  ? 20.863  -43.202 240.662 1.00 78.88  ? 72  THR A CB    1 
ATOM   466   O OG1   . THR A 1 72  ? 21.855  -42.777 239.718 1.00 92.66  ? 72  THR A OG1   1 
ATOM   467   C CG2   . THR A 1 72  ? 21.160  -42.575 242.008 1.00 68.89  ? 72  THR A CG2   1 
ATOM   468   N N     . LEU A 1 73  ? 20.323  -45.704 242.930 1.00 78.06  ? 73  LEU A N     1 
ATOM   469   C CA    . LEU A 1 73  ? 20.607  -46.416 244.179 1.00 81.46  ? 73  LEU A CA    1 
ATOM   470   C C     . LEU A 1 73  ? 20.513  -47.929 243.945 1.00 84.15  ? 73  LEU A C     1 
ATOM   471   O O     . LEU A 1 73  ? 19.626  -48.396 243.232 1.00 85.62  ? 73  LEU A O     1 
ATOM   472   C CB    . LEU A 1 73  ? 19.634  -46.001 245.290 1.00 82.71  ? 73  LEU A CB    1 
ATOM   473   C CG    . LEU A 1 73  ? 19.820  -44.712 246.101 1.00 85.16  ? 73  LEU A CG    1 
ATOM   474   C CD1   . LEU A 1 73  ? 20.033  -43.511 245.207 1.00 83.93  ? 73  LEU A CD1   1 
ATOM   475   C CD2   . LEU A 1 73  ? 18.602  -44.479 246.982 1.00 89.15  ? 73  LEU A CD2   1 
ATOM   476   N N     . PHE A 1 74  ? 21.429  -48.692 244.536 1.00 86.76  ? 74  PHE A N     1 
ATOM   477   C CA    . PHE A 1 74  ? 21.418  -50.148 244.391 1.00 80.95  ? 74  PHE A CA    1 
ATOM   478   C C     . PHE A 1 74  ? 21.852  -50.853 245.670 1.00 87.58  ? 74  PHE A C     1 
ATOM   479   O O     . PHE A 1 74  ? 22.851  -50.491 246.286 1.00 91.26  ? 74  PHE A O     1 
ATOM   480   C CB    . PHE A 1 74  ? 22.312  -50.596 243.228 1.00 71.98  ? 74  PHE A CB    1 
ATOM   481   C CG    . PHE A 1 74  ? 21.795  -50.198 241.877 1.00 75.07  ? 74  PHE A CG    1 
ATOM   482   C CD1   . PHE A 1 74  ? 22.146  -48.978 241.328 1.00 74.13  ? 74  PHE A CD1   1 
ATOM   483   C CD2   . PHE A 1 74  ? 20.963  -51.046 241.158 1.00 75.21  ? 74  PHE A CD2   1 
ATOM   484   C CE1   . PHE A 1 74  ? 21.679  -48.600 240.094 1.00 70.78  ? 74  PHE A CE1   1 
ATOM   485   C CE2   . PHE A 1 74  ? 20.485  -50.682 239.920 1.00 73.42  ? 74  PHE A CE2   1 
ATOM   486   C CZ    . PHE A 1 74  ? 20.843  -49.455 239.379 1.00 72.01  ? 74  PHE A CZ    1 
ATOM   487   N N     . ARG A 1 75  ? 21.081  -51.852 246.078 1.00 85.86  ? 75  ARG A N     1 
ATOM   488   C CA    . ARG A 1 75  ? 21.502  -52.733 247.157 1.00 82.29  ? 75  ARG A CA    1 
ATOM   489   C C     . ARG A 1 75  ? 22.488  -53.736 246.587 1.00 86.38  ? 75  ARG A C     1 
ATOM   490   O O     . ARG A 1 75  ? 22.346  -54.161 245.440 1.00 89.82  ? 75  ARG A O     1 
ATOM   491   C CB    . ARG A 1 75  ? 20.306  -53.465 247.766 1.00 79.24  ? 75  ARG A CB    1 
ATOM   492   C CG    . ARG A 1 75  ? 19.339  -52.564 248.499 1.00 86.66  ? 75  ARG A CG    1 
ATOM   493   C CD    . ARG A 1 75  ? 18.226  -53.366 249.150 1.00 89.69  ? 75  ARG A CD    1 
ATOM   494   N NE    . ARG A 1 75  ? 18.690  -54.152 250.290 1.00 89.89  ? 75  ARG A NE    1 
ATOM   495   C CZ    . ARG A 1 75  ? 17.882  -54.709 251.187 1.00 95.39  ? 75  ARG A CZ    1 
ATOM   496   N NH1   . ARG A 1 75  ? 16.567  -54.564 251.080 1.00 96.33  ? 75  ARG A NH1   1 
ATOM   497   N NH2   . ARG A 1 75  ? 18.386  -55.405 252.197 1.00 98.73  ? 75  ARG A NH2   1 
ATOM   498   N N     . GLU A 1 76  ? 23.490  -54.106 247.379 1.00 85.03  ? 76  GLU A N     1 
ATOM   499   C CA    . GLU A 1 76  ? 24.512  -55.040 246.919 1.00 83.67  ? 76  GLU A CA    1 
ATOM   500   C C     . GLU A 1 76  ? 23.911  -56.387 246.517 1.00 84.37  ? 76  GLU A C     1 
ATOM   501   O O     . GLU A 1 76  ? 24.359  -57.015 245.557 1.00 87.72  ? 76  GLU A O     1 
ATOM   502   C CB    . GLU A 1 76  ? 25.602  -55.226 247.980 1.00 85.01  ? 76  GLU A CB    1 
ATOM   503   C CG    . GLU A 1 76  ? 26.571  -56.364 247.687 1.00 89.58  ? 76  GLU A CG    1 
ATOM   504   C CD    . GLU A 1 76  ? 27.851  -56.281 248.500 1.00 93.40  ? 76  GLU A CD    1 
ATOM   505   O OE1   . GLU A 1 76  ? 28.023  -57.094 249.432 1.00 95.79  ? 76  GLU A OE1   1 
ATOM   506   O OE2   . GLU A 1 76  ? 28.692  -55.409 248.196 1.00 95.96  ? 76  GLU A OE2   1 
ATOM   507   N N     . GLY A 1 77  ? 22.886  -56.815 247.249 1.00 78.64  ? 77  GLY A N     1 
ATOM   508   C CA    . GLY A 1 77  ? 22.211  -58.069 246.965 1.00 76.53  ? 77  GLY A CA    1 
ATOM   509   C C     . GLY A 1 77  ? 21.544  -58.073 245.603 1.00 83.45  ? 77  GLY A C     1 
ATOM   510   O O     . GLY A 1 77  ? 21.419  -59.119 244.961 1.00 86.67  ? 77  GLY A O     1 
ATOM   511   N N     . LYS A 1 78  ? 21.119  -56.896 245.156 1.00 85.93  ? 78  LYS A N     1 
ATOM   512   C CA    . LYS A 1 78  ? 20.470  -56.765 243.860 1.00 83.03  ? 78  LYS A CA    1 
ATOM   513   C C     . LYS A 1 78  ? 21.482  -56.519 242.744 1.00 83.31  ? 78  LYS A C     1 
ATOM   514   O O     . LYS A 1 78  ? 21.112  -56.122 241.639 1.00 85.86  ? 78  LYS A O     1 
ATOM   515   C CB    . LYS A 1 78  ? 19.429  -55.644 243.893 1.00 79.43  ? 78  LYS A CB    1 
ATOM   516   C CG    . LYS A 1 78  ? 18.272  -55.908 244.841 1.00 75.11  ? 78  LYS A CG    1 
ATOM   517   C CD    . LYS A 1 78  ? 17.597  -57.229 244.512 1.00 80.06  ? 78  LYS A CD    1 
ATOM   518   C CE    . LYS A 1 78  ? 16.285  -57.390 245.263 1.00 85.62  ? 78  LYS A CE    1 
ATOM   519   N NZ    . LYS A 1 78  ? 15.265  -56.410 244.798 1.00 86.19  ? 78  LYS A NZ    1 
ATOM   520   N N     . LEU A 1 79  ? 22.759  -56.757 243.035 1.00 78.10  ? 79  LEU A N     1 
ATOM   521   C CA    . LEU A 1 79  ? 23.811  -56.609 242.031 1.00 71.93  ? 79  LEU A CA    1 
ATOM   522   C C     . LEU A 1 79  ? 24.629  -57.883 241.873 1.00 78.20  ? 79  LEU A C     1 
ATOM   523   O O     . LEU A 1 79  ? 25.859  -57.850 241.855 1.00 87.03  ? 79  LEU A O     1 
ATOM   524   C CB    . LEU A 1 79  ? 24.734  -55.444 242.375 1.00 68.18  ? 79  LEU A CB    1 
ATOM   525   C CG    . LEU A 1 79  ? 24.154  -54.048 242.165 1.00 72.15  ? 79  LEU A CG    1 
ATOM   526   C CD1   . LEU A 1 79  ? 25.209  -53.010 242.495 1.00 69.11  ? 79  LEU A CD1   1 
ATOM   527   C CD2   . LEU A 1 79  ? 23.653  -53.869 240.740 1.00 69.89  ? 79  LEU A CD2   1 
ATOM   528   N N     . ALA A 1 80  ? 23.932  -59.005 241.745 1.00 77.36  ? 80  ALA A N     1 
ATOM   529   C CA    . ALA A 1 80  ? 24.576  -60.301 241.590 1.00 71.96  ? 80  ALA A CA    1 
ATOM   530   C C     . ALA A 1 80  ? 24.639  -60.707 240.122 1.00 75.68  ? 80  ALA A C     1 
ATOM   531   O O     . ALA A 1 80  ? 23.627  -61.070 239.530 1.00 80.55  ? 80  ALA A O     1 
ATOM   532   C CB    . ALA A 1 80  ? 23.830  -61.347 242.389 1.00 67.85  ? 80  ALA A CB    1 
ATOM   533   N N     . TYR A 1 81  ? 25.828  -60.643 239.534 1.00 80.73  ? 81  TYR A N     1 
ATOM   534   C CA    . TYR A 1 81  ? 26.011  -61.042 238.141 1.00 81.87  ? 81  TYR A CA    1 
ATOM   535   C C     . TYR A 1 81  ? 27.152  -62.046 238.013 1.00 88.85  ? 81  TYR A C     1 
ATOM   536   O O     . TYR A 1 81  ? 28.278  -61.769 238.426 1.00 96.89  ? 81  TYR A O     1 
ATOM   537   C CB    . TYR A 1 81  ? 26.288  -59.820 237.265 1.00 82.29  ? 81  TYR A CB    1 
ATOM   538   C CG    . TYR A 1 81  ? 25.146  -58.834 237.206 1.00 83.53  ? 81  TYR A CG    1 
ATOM   539   C CD1   . TYR A 1 81  ? 25.064  -57.785 238.112 1.00 88.57  ? 81  TYR A CD1   1 
ATOM   540   C CD2   . TYR A 1 81  ? 24.152  -58.949 236.244 1.00 83.41  ? 81  TYR A CD2   1 
ATOM   541   C CE1   . TYR A 1 81  ? 24.025  -56.879 238.065 1.00 90.06  ? 81  TYR A CE1   1 
ATOM   542   C CE2   . TYR A 1 81  ? 23.107  -58.043 236.187 1.00 85.29  ? 81  TYR A CE2   1 
ATOM   543   C CZ    . TYR A 1 81  ? 23.049  -57.012 237.101 1.00 89.02  ? 81  TYR A CZ    1 
ATOM   544   O OH    . TYR A 1 81  ? 22.013  -56.108 237.054 1.00 92.04  ? 81  TYR A OH    1 
ATOM   545   N N     . ALA A 1 82  ? 26.857  -63.205 237.431 1.00 86.52  ? 82  ALA A N     1 
ATOM   546   C CA    . ALA A 1 82  ? 27.825  -64.299 237.358 1.00 85.31  ? 82  ALA A CA    1 
ATOM   547   C C     . ALA A 1 82  ? 29.049  -63.956 236.513 1.00 92.07  ? 82  ALA A C     1 
ATOM   548   O O     . ALA A 1 82  ? 30.165  -64.384 236.816 1.00 100.13 ? 82  ALA A O     1 
ATOM   549   C CB    . ALA A 1 82  ? 27.159  -65.563 236.836 1.00 82.96  ? 82  ALA A CB    1 
ATOM   550   N N     . GLU A 1 83  ? 28.837  -63.183 235.454 1.00 91.63  ? 83  GLU A N     1 
ATOM   551   C CA    . GLU A 1 83  ? 29.920  -62.840 234.541 1.00 98.24  ? 83  GLU A CA    1 
ATOM   552   C C     . GLU A 1 83  ? 30.911  -61.854 235.153 1.00 95.81  ? 83  GLU A C     1 
ATOM   553   O O     . GLU A 1 83  ? 32.060  -61.772 234.719 1.00 99.80  ? 83  GLU A O     1 
ATOM   554   C CB    . GLU A 1 83  ? 29.358  -62.284 233.232 1.00 101.10 ? 83  GLU A CB    1 
ATOM   555   C CG    . GLU A 1 83  ? 27.848  -62.392 233.122 1.00 104.85 ? 83  GLU A CG    1 
ATOM   556   C CD    . GLU A 1 83  ? 27.140  -61.192 233.717 1.00 107.66 ? 83  GLU A CD    1 
ATOM   557   O OE1   . GLU A 1 83  ? 26.183  -61.387 234.497 1.00 115.90 ? 83  GLU A OE1   1 
ATOM   558   O OE2   . GLU A 1 83  ? 27.544  -60.053 233.398 1.00 98.13  ? 83  GLU A OE2   1 
ATOM   559   N N     . ILE A 1 84  ? 30.469  -61.108 236.160 1.00 86.83  ? 84  ILE A N     1 
ATOM   560   C CA    . ILE A 1 84  ? 31.339  -60.129 236.799 1.00 90.61  ? 84  ILE A CA    1 
ATOM   561   C C     . ILE A 1 84  ? 31.943  -60.673 238.092 1.00 91.20  ? 84  ILE A C     1 
ATOM   562   O O     . ILE A 1 84  ? 32.953  -60.165 238.575 1.00 95.53  ? 84  ILE A O     1 
ATOM   563   C CB    . ILE A 1 84  ? 30.610  -58.794 237.069 1.00 89.77  ? 84  ILE A CB    1 
ATOM   564   C CG1   . ILE A 1 84  ? 29.834  -58.851 238.386 1.00 101.48 ? 84  ILE A CG1   1 
ATOM   565   C CG2   . ILE A 1 84  ? 29.713  -58.427 235.895 1.00 79.80  ? 84  ILE A CG2   1 
ATOM   566   C CD1   . ILE A 1 84  ? 30.123  -57.680 239.300 1.00 109.06 ? 84  ILE A CD1   1 
ATOM   567   N N     . GLY A 1 85  ? 31.324  -61.711 238.643 1.00 85.12  ? 85  GLY A N     1 
ATOM   568   C CA    . GLY A 1 85  ? 31.821  -62.335 239.855 1.00 86.40  ? 85  GLY A CA    1 
ATOM   569   C C     . GLY A 1 85  ? 31.474  -61.578 241.123 1.00 86.17  ? 85  GLY A C     1 
ATOM   570   O O     . GLY A 1 85  ? 30.341  -61.121 241.299 1.00 90.52  ? 85  GLY A O     1 
ATOM   571   N N     . ASP A 1 86  ? 32.458  -61.457 242.012 1.00 79.69  ? 86  ASP A N     1 
ATOM   572   C CA    . ASP A 1 86  ? 32.287  -60.754 243.279 1.00 79.77  ? 86  ASP A CA    1 
ATOM   573   C C     . ASP A 1 86  ? 31.984  -59.290 243.009 1.00 85.93  ? 86  ASP A C     1 
ATOM   574   O O     . ASP A 1 86  ? 32.752  -58.600 242.340 1.00 87.82  ? 86  ASP A O     1 
ATOM   575   C CB    . ASP A 1 86  ? 33.553  -60.875 244.129 1.00 81.44  ? 86  ASP A CB    1 
ATOM   576   C CG    . ASP A 1 86  ? 33.343  -60.433 245.569 1.00 89.88  ? 86  ASP A CG    1 
ATOM   577   O OD1   . ASP A 1 86  ? 32.405  -59.655 245.839 1.00 94.95  ? 86  ASP A OD1   1 
ATOM   578   O OD2   . ASP A 1 86  ? 34.130  -60.864 246.437 1.00 91.98  ? 86  ASP A OD2   1 
ATOM   579   N N     . THR A 1 87  ? 30.864  -58.816 243.537 1.00 88.08  ? 87  THR A N     1 
ATOM   580   C CA    . THR A 1 87  ? 30.431  -57.452 243.273 1.00 85.36  ? 87  THR A CA    1 
ATOM   581   C C     . THR A 1 87  ? 31.137  -56.451 244.179 1.00 83.43  ? 87  THR A C     1 
ATOM   582   O O     . THR A 1 87  ? 31.574  -55.395 243.725 1.00 85.65  ? 87  THR A O     1 
ATOM   583   C CB    . THR A 1 87  ? 28.905  -57.312 243.403 1.00 79.42  ? 87  THR A CB    1 
ATOM   584   O OG1   . THR A 1 87  ? 28.275  -58.010 242.321 1.00 83.99  ? 87  THR A OG1   1 
ATOM   585   C CG2   . THR A 1 87  ? 28.496  -55.850 243.356 1.00 73.57  ? 87  THR A CG2   1 
ATOM   586   N N     . ARG A 1 88  ? 31.264  -56.798 245.454 1.00 77.72  ? 88  ARG A N     1 
ATOM   587   C CA    . ARG A 1 88  ? 31.913  -55.925 246.424 1.00 77.33  ? 88  ARG A CA    1 
ATOM   588   C C     . ARG A 1 88  ? 33.364  -55.653 246.038 1.00 85.63  ? 88  ARG A C     1 
ATOM   589   O O     . ARG A 1 88  ? 33.928  -54.612 246.375 1.00 87.41  ? 88  ARG A O     1 
ATOM   590   C CB    . ARG A 1 88  ? 31.843  -56.541 247.819 1.00 75.22  ? 88  ARG A CB    1 
ATOM   591   C CG    . ARG A 1 88  ? 32.374  -55.639 248.910 1.00 76.37  ? 88  ARG A CG    1 
ATOM   592   C CD    . ARG A 1 88  ? 32.112  -56.222 250.283 1.00 100.00 ? 88  ARG A CD    1 
ATOM   593   N NE    . ARG A 1 88  ? 30.694  -56.207 250.632 1.00 99.74  ? 88  ARG A NE    1 
ATOM   594   C CZ    . ARG A 1 88  ? 30.211  -56.655 251.786 1.00 104.76 ? 88  ARG A CZ    1 
ATOM   595   N NH1   . ARG A 1 88  ? 31.034  -57.154 252.699 1.00 106.34 ? 88  ARG A NH1   1 
ATOM   596   N NH2   . ARG A 1 88  ? 28.908  -56.606 252.029 1.00 108.53 ? 88  ARG A NH2   1 
ATOM   597   N N     . ALA A 1 89  ? 33.958  -56.598 245.319 1.00 88.77  ? 89  ALA A N     1 
ATOM   598   C CA    . ALA A 1 89  ? 35.320  -56.454 244.830 1.00 77.68  ? 89  ALA A CA    1 
ATOM   599   C C     . ALA A 1 89  ? 35.364  -55.602 243.563 1.00 76.88  ? 89  ALA A C     1 
ATOM   600   O O     . ALA A 1 89  ? 36.127  -54.641 243.472 1.00 118.24 ? 89  ALA A O     1 
ATOM   601   C CB    . ALA A 1 89  ? 35.920  -57.822 244.570 1.00 84.81  ? 89  ALA A CB    1 
ATOM   602   N N     . ALA A 1 90  ? 34.535  -55.965 242.589 1.00 83.34  ? 90  ALA A N     1 
ATOM   603   C CA    . ALA A 1 90  ? 34.439  -55.241 241.324 1.00 83.25  ? 90  ALA A CA    1 
ATOM   604   C C     . ALA A 1 90  ? 34.001  -53.782 241.478 1.00 88.29  ? 90  ALA A C     1 
ATOM   605   O O     . ALA A 1 90  ? 34.266  -52.957 240.602 1.00 89.88  ? 90  ALA A O     1 
ATOM   606   C CB    . ALA A 1 90  ? 33.495  -55.967 240.382 1.00 78.63  ? 90  ALA A CB    1 
ATOM   607   N N     . VAL A 1 91  ? 33.322  -53.470 242.579 1.00 92.59  ? 91  VAL A N     1 
ATOM   608   C CA    . VAL A 1 91  ? 32.823  -52.114 242.813 1.00 95.33  ? 91  VAL A CA    1 
ATOM   609   C C     . VAL A 1 91  ? 33.906  -51.207 243.391 1.00 102.12 ? 91  VAL A C     1 
ATOM   610   O O     . VAL A 1 91  ? 33.754  -49.988 243.432 1.00 110.38 ? 91  VAL A O     1 
ATOM   611   C CB    . VAL A 1 91  ? 31.615  -52.105 243.775 1.00 93.50  ? 91  VAL A CB    1 
ATOM   612   C CG1   . VAL A 1 91  ? 32.086  -52.187 245.228 1.00 95.27  ? 91  VAL A CG1   1 
ATOM   613   C CG2   . VAL A 1 91  ? 30.765  -50.856 243.556 1.00 71.47  ? 91  VAL A CG2   1 
ATOM   614   N N     . GLN A 1 92  ? 35.000  -51.810 243.840 1.00 95.74  ? 92  GLN A N     1 
ATOM   615   C CA    . GLN A 1 92  ? 36.074  -51.064 244.492 1.00 91.23  ? 92  GLN A CA    1 
ATOM   616   C C     . GLN A 1 92  ? 36.763  -50.016 243.615 1.00 91.52  ? 92  GLN A C     1 
ATOM   617   O O     . GLN A 1 92  ? 36.961  -48.886 244.064 1.00 99.45  ? 92  GLN A O     1 
ATOM   618   C CB    . GLN A 1 92  ? 37.105  -52.008 245.121 1.00 79.64  ? 92  GLN A CB    1 
ATOM   619   C CG    . GLN A 1 92  ? 36.566  -52.830 246.270 1.00 79.60  ? 92  GLN A CG    1 
ATOM   620   C CD    . GLN A 1 92  ? 36.053  -51.975 247.408 1.00 79.64  ? 92  GLN A CD    1 
ATOM   621   O OE1   . GLN A 1 92  ? 36.560  -50.883 247.653 1.00 94.79  ? 92  GLN A OE1   1 
ATOM   622   N NE2   . GLN A 1 92  ? 35.035  -52.466 248.109 1.00 78.78  ? 92  GLN A NE2   1 
ATOM   623   N N     . PRO A 1 93  ? 37.141  -50.376 242.371 1.00 91.43  ? 93  PRO A N     1 
ATOM   624   C CA    . PRO A 1 93  ? 37.754  -49.339 241.533 1.00 96.20  ? 93  PRO A CA    1 
ATOM   625   C C     . PRO A 1 93  ? 36.776  -48.222 241.200 1.00 93.43  ? 93  PRO A C     1 
ATOM   626   O O     . PRO A 1 93  ? 37.190  -47.148 240.768 1.00 78.50  ? 93  PRO A O     1 
ATOM   627   C CB    . PRO A 1 93  ? 38.114  -50.091 240.248 1.00 78.90  ? 93  PRO A CB    1 
ATOM   628   C CG    . PRO A 1 93  ? 38.188  -51.515 240.641 1.00 79.28  ? 93  PRO A CG    1 
ATOM   629   C CD    . PRO A 1 93  ? 37.144  -51.686 241.693 1.00 78.00  ? 93  PRO A CD    1 
ATOM   630   N N     . LEU A 1 94  ? 35.489  -48.480 241.388 1.00 90.55  ? 94  LEU A N     1 
ATOM   631   C CA    . LEU A 1 94  ? 34.480  -47.474 241.110 1.00 89.16  ? 94  LEU A CA    1 
ATOM   632   C C     . LEU A 1 94  ? 34.297  -46.566 242.323 1.00 89.86  ? 94  LEU A C     1 
ATOM   633   O O     . LEU A 1 94  ? 34.018  -45.376 242.188 1.00 86.00  ? 94  LEU A O     1 
ATOM   634   C CB    . LEU A 1 94  ? 33.161  -48.133 240.709 1.00 85.06  ? 94  LEU A CB    1 
ATOM   635   C CG    . LEU A 1 94  ? 33.230  -49.196 239.608 1.00 86.30  ? 94  LEU A CG    1 
ATOM   636   C CD1   . LEU A 1 94  ? 31.838  -49.701 239.290 1.00 89.65  ? 94  LEU A CD1   1 
ATOM   637   C CD2   . LEU A 1 94  ? 33.894  -48.661 238.354 1.00 73.48  ? 94  LEU A CD2   1 
ATOM   638   N N     . LEU A 1 95  ? 34.474  -47.127 243.512 1.00 92.33  ? 95  LEU A N     1 
ATOM   639   C CA    . LEU A 1 95  ? 34.423  -46.327 244.725 1.00 88.74  ? 95  LEU A CA    1 
ATOM   640   C C     . LEU A 1 95  ? 35.668  -45.458 244.789 1.00 89.53  ? 95  LEU A C     1 
ATOM   641   O O     . LEU A 1 95  ? 35.647  -44.362 245.346 1.00 88.59  ? 95  LEU A O     1 
ATOM   642   C CB    . LEU A 1 95  ? 34.336  -47.223 245.959 1.00 82.12  ? 95  LEU A CB    1 
ATOM   643   C CG    . LEU A 1 95  ? 33.142  -48.176 246.017 1.00 75.77  ? 95  LEU A CG    1 
ATOM   644   C CD1   . LEU A 1 95  ? 33.158  -48.942 247.319 1.00 82.29  ? 95  LEU A CD1   1 
ATOM   645   C CD2   . LEU A 1 95  ? 31.846  -47.405 245.874 1.00 74.55  ? 95  LEU A CD2   1 
ATOM   646   N N     . ALA A 1 96  ? 36.753  -45.957 244.204 1.00 91.55  ? 96  ALA A N     1 
ATOM   647   C CA    . ALA A 1 96  ? 38.025  -45.244 244.204 1.00 81.97  ? 96  ALA A CA    1 
ATOM   648   C C     . ALA A 1 96  ? 37.951  -43.997 243.331 1.00 91.13  ? 96  ALA A C     1 
ATOM   649   O O     . ALA A 1 96  ? 38.478  -42.945 243.686 1.00 92.68  ? 96  ALA A O     1 
ATOM   650   C CB    . ALA A 1 96  ? 39.145  -46.158 243.738 1.00 82.92  ? 96  ALA A CB    1 
ATOM   651   N N     . LEU A 1 97  ? 37.282  -44.126 242.190 1.00 80.52  ? 97  LEU A N     1 
ATOM   652   C CA    . LEU A 1 97  ? 37.062  -43.005 241.283 1.00 84.57  ? 97  LEU A CA    1 
ATOM   653   C C     . LEU A 1 97  ? 35.953  -42.067 241.760 1.00 87.01  ? 97  LEU A C     1 
ATOM   654   O O     . LEU A 1 97  ? 35.834  -40.941 241.270 1.00 93.54  ? 97  LEU A O     1 
ATOM   655   C CB    . LEU A 1 97  ? 36.723  -43.519 239.882 1.00 81.37  ? 97  LEU A CB    1 
ATOM   656   C CG    . LEU A 1 97  ? 37.897  -44.095 239.092 1.00 80.18  ? 97  LEU A CG    1 
ATOM   657   C CD1   . LEU A 1 97  ? 37.433  -44.765 237.809 1.00 78.92  ? 97  LEU A CD1   1 
ATOM   658   C CD2   . LEU A 1 97  ? 38.871  -42.985 238.785 1.00 82.01  ? 97  LEU A CD2   1 
ATOM   659   N N     . GLY A 1 98  ? 35.136  -42.536 242.701 1.00 82.02  ? 98  GLY A N     1 
ATOM   660   C CA    . GLY A 1 98  ? 34.031  -41.741 243.207 1.00 84.83  ? 98  GLY A CA    1 
ATOM   661   C C     . GLY A 1 98  ? 32.837  -41.752 242.263 1.00 90.03  ? 98  GLY A C     1 
ATOM   662   O O     . GLY A 1 98  ? 31.878  -40.997 242.452 1.00 91.24  ? 98  GLY A O     1 
ATOM   663   N N     . TRP A 1 99  ? 32.904  -42.606 241.242 1.00 92.30  ? 99  TRP A N     1 
ATOM   664   C CA    . TRP A 1 99  ? 31.801  -42.801 240.305 1.00 88.29  ? 99  TRP A CA    1 
ATOM   665   C C     . TRP A 1 99  ? 30.636  -43.489 241.002 1.00 86.92  ? 99  TRP A C     1 
ATOM   666   O O     . TRP A 1 99  ? 29.484  -43.292 240.641 1.00 95.13  ? 99  TRP A O     1 
ATOM   667   C CB    . TRP A 1 99  ? 32.255  -43.624 239.092 1.00 87.54  ? 99  TRP A CB    1 
ATOM   668   C CG    . TRP A 1 99  ? 33.264  -42.932 238.234 1.00 90.75  ? 99  TRP A CG    1 
ATOM   669   C CD1   . TRP A 1 99  ? 33.795  -41.695 238.440 1.00 90.35  ? 99  TRP A CD1   1 
ATOM   670   C CD2   . TRP A 1 99  ? 33.877  -43.438 237.038 1.00 91.38  ? 99  TRP A CD2   1 
ATOM   671   N NE1   . TRP A 1 99  ? 34.695  -41.395 237.449 1.00 89.83  ? 99  TRP A NE1   1 
ATOM   672   C CE2   . TRP A 1 99  ? 34.764  -42.447 236.576 1.00 87.28  ? 99  TRP A CE2   1 
ATOM   673   C CE3   . TRP A 1 99  ? 33.762  -44.630 236.314 1.00 93.36  ? 99  TRP A CE3   1 
ATOM   674   C CZ2   . TRP A 1 99  ? 35.532  -42.609 235.427 1.00 89.10  ? 99  TRP A CZ2   1 
ATOM   675   C CZ3   . TRP A 1 99  ? 34.529  -44.786 235.171 1.00 90.32  ? 99  TRP A CZ3   1 
ATOM   676   C CH2   . TRP A 1 99  ? 35.400  -43.781 234.740 1.00 89.03  ? 99  TRP A CH2   1 
ATOM   677   N N     . VAL A 1 100 ? 30.953  -44.307 241.998 1.00 79.77  ? 100 VAL A N     1 
ATOM   678   C CA    . VAL A 1 100 ? 29.944  -44.954 242.821 1.00 78.84  ? 100 VAL A CA    1 
ATOM   679   C C     . VAL A 1 100 ? 30.185  -44.560 244.270 1.00 80.31  ? 100 VAL A C     1 
ATOM   680   O O     . VAL A 1 100 ? 31.306  -44.307 244.666 1.00 74.83  ? 100 VAL A O     1 
ATOM   681   C CB    . VAL A 1 100 ? 29.992  -46.488 242.651 1.00 80.75  ? 100 VAL A CB    1 
ATOM   682   C CG1   . VAL A 1 100 ? 28.895  -47.164 243.455 1.00 74.94  ? 100 VAL A CG1   1 
ATOM   683   C CG2   . VAL A 1 100 ? 29.878  -46.845 241.173 1.00 83.43  ? 100 VAL A CG2   1 
ATOM   684   N N     . ASP A 1 101 ? 29.126  -44.498 245.066 1.00 81.06  ? 101 ASP A N     1 
ATOM   685   C CA    . ASP A 1 101 ? 29.249  -44.051 246.458 1.00 74.09  ? 101 ASP A CA    1 
ATOM   686   C C     . ASP A 1 101 ? 28.545  -44.917 247.480 1.00 89.00  ? 101 ASP A C     1 
ATOM   687   O O     . ASP A 1 101 ? 27.338  -44.802 247.653 1.00 91.34  ? 101 ASP A O     1 
ATOM   688   C CB    . ASP A 1 101 ? 28.734  -42.611 246.602 1.00 74.71  ? 101 ASP A CB    1 
ATOM   689   C CG    . ASP A 1 101 ? 28.893  -42.072 248.006 1.00 101.52 ? 101 ASP A CG    1 
ATOM   690   O OD1   . ASP A 1 101 ? 29.937  -42.342 248.622 1.00 106.37 ? 101 ASP A OD1   1 
ATOM   691   O OD2   . ASP A 1 101 ? 27.967  -41.402 248.506 1.00 102.32 ? 101 ASP A OD2   1 
ATOM   692   N N     . ALA A 1 102 ? 29.297  -45.782 248.150 1.00 86.90  ? 102 ALA A N     1 
ATOM   693   C CA    . ALA A 1 102 ? 28.779  -46.428 249.341 1.00 85.25  ? 102 ALA A CA    1 
ATOM   694   C C     . ALA A 1 102 ? 28.636  -45.344 250.397 1.00 89.29  ? 102 ALA A C     1 
ATOM   695   O O     . ALA A 1 102 ? 29.289  -44.314 250.310 1.00 101.08 ? 102 ALA A O     1 
ATOM   696   C CB    . ALA A 1 102 ? 29.706  -47.531 249.811 1.00 74.95  ? 102 ALA A CB    1 
ATOM   697   N N     . GLN A 1 103 ? 27.794  -45.584 251.394 1.00 83.41  ? 103 GLN A N     1 
ATOM   698   C CA    . GLN A 1 103 ? 27.392  -44.544 252.344 1.00 92.45  ? 103 GLN A CA    1 
ATOM   699   C C     . GLN A 1 103 ? 26.825  -43.294 251.657 1.00 89.98  ? 103 GLN A C     1 
ATOM   700   O O     . GLN A 1 103 ? 27.374  -42.203 251.814 1.00 88.65  ? 103 GLN A O     1 
ATOM   701   C CB    . GLN A 1 103 ? 28.565  -44.130 253.241 1.00 92.37  ? 103 GLN A CB    1 
ATOM   702   C CG    . GLN A 1 103 ? 29.277  -45.275 253.934 1.00 100.24 ? 103 GLN A CG    1 
ATOM   703   C CD    . GLN A 1 103 ? 30.618  -44.847 254.500 1.00 118.37 ? 103 GLN A CD    1 
ATOM   704   O OE1   . GLN A 1 103 ? 31.241  -43.907 254.002 1.00 126.69 ? 103 GLN A OE1   1 
ATOM   705   N NE2   . GLN A 1 103 ? 31.067  -45.529 255.547 1.00 123.20 ? 103 GLN A NE2   1 
ATOM   706   N N     . PRO A 1 104 ? 25.736  -43.441 250.881 1.00 89.58  ? 104 PRO A N     1 
ATOM   707   C CA    . PRO A 1 104 ? 25.096  -42.213 250.411 1.00 91.16  ? 104 PRO A CA    1 
ATOM   708   C C     . PRO A 1 104 ? 24.053  -41.762 251.422 1.00 97.05  ? 104 PRO A C     1 
ATOM   709   O O     . PRO A 1 104 ? 23.620  -42.564 252.251 1.00 100.23 ? 104 PRO A O     1 
ATOM   710   C CB    . PRO A 1 104 ? 24.409  -42.661 249.124 1.00 85.33  ? 104 PRO A CB    1 
ATOM   711   C CG    . PRO A 1 104 ? 24.027  -44.069 249.397 1.00 84.09  ? 104 PRO A CG    1 
ATOM   712   C CD    . PRO A 1 104 ? 25.113  -44.639 250.285 1.00 87.65  ? 104 PRO A CD    1 
ATOM   713   N N     . THR A 1 105 ? 23.662  -40.496 251.362 1.00 98.11  ? 105 THR A N     1 
ATOM   714   C CA    . THR A 1 105 ? 22.602  -40.003 252.227 1.00 100.59 ? 105 THR A CA    1 
ATOM   715   C C     . THR A 1 105 ? 21.263  -40.184 251.531 1.00 100.89 ? 105 THR A C     1 
ATOM   716   O O     . THR A 1 105 ? 21.106  -39.831 250.361 1.00 100.75 ? 105 THR A O     1 
ATOM   717   C CB    . THR A 1 105 ? 22.787  -38.526 252.567 1.00 101.36 ? 105 THR A CB    1 
ATOM   718   O OG1   . THR A 1 105 ? 22.548  -37.737 251.397 1.00 104.81 ? 105 THR A OG1   1 
ATOM   719   C CG2   . THR A 1 105 ? 24.197  -38.272 253.078 1.00 97.20  ? 105 THR A CG2   1 
ATOM   720   N N     . LEU A 1 106 ? 20.299  -40.724 252.268 1.00 100.22 ? 106 LEU A N     1 
ATOM   721   C CA    . LEU A 1 106 ? 19.021  -41.119 251.699 1.00 93.42  ? 106 LEU A CA    1 
ATOM   722   C C     . LEU A 1 106 ? 17.850  -40.398 252.354 1.00 92.67  ? 106 LEU A C     1 
ATOM   723   O O     . LEU A 1 106 ? 17.731  -40.372 253.581 1.00 89.49  ? 106 LEU A O     1 
ATOM   724   C CB    . LEU A 1 106 ? 18.833  -42.626 251.859 1.00 91.72  ? 106 LEU A CB    1 
ATOM   725   C CG    . LEU A 1 106 ? 19.994  -43.499 251.388 1.00 88.18  ? 106 LEU A CG    1 
ATOM   726   C CD1   . LEU A 1 106 ? 19.677  -44.962 251.636 1.00 85.69  ? 106 LEU A CD1   1 
ATOM   727   C CD2   . LEU A 1 106 ? 20.273  -43.243 249.920 1.00 87.01  ? 106 LEU A CD2   1 
ATOM   728   N N     . GLU A 1 107 ? 16.995  -39.810 251.523 1.00 95.70  ? 107 GLU A N     1 
ATOM   729   C CA    . GLU A 1 107 ? 15.720  -39.273 251.971 1.00 102.37 ? 107 GLU A CA    1 
ATOM   730   C C     . GLU A 1 107 ? 14.845  -40.442 252.401 1.00 102.55 ? 107 GLU A C     1 
ATOM   731   O O     . GLU A 1 107 ? 15.021  -41.561 251.918 1.00 102.23 ? 107 GLU A O     1 
ATOM   732   C CB    . GLU A 1 107 ? 15.037  -38.530 250.825 1.00 109.11 ? 107 GLU A CB    1 
ATOM   733   C CG    . GLU A 1 107 ? 15.850  -37.395 250.234 1.00 115.78 ? 107 GLU A CG    1 
ATOM   734   C CD    . GLU A 1 107 ? 15.567  -36.070 250.910 1.00 124.54 ? 107 GLU A CD    1 
ATOM   735   O OE1   . GLU A 1 107 ? 15.436  -35.055 250.192 1.00 127.12 ? 107 GLU A OE1   1 
ATOM   736   O OE2   . GLU A 1 107 ? 15.471  -36.045 252.156 1.00 128.89 ? 107 GLU A OE2   1 
ATOM   737   N N     . LEU A 1 108 ? 13.898  -40.184 253.299 1.00 99.27  ? 108 LEU A N     1 
ATOM   738   C CA    . LEU A 1 108 ? 12.999  -41.227 253.788 1.00 92.82  ? 108 LEU A CA    1 
ATOM   739   C C     . LEU A 1 108 ? 12.187  -41.819 252.640 1.00 89.62  ? 108 LEU A C     1 
ATOM   740   O O     . LEU A 1 108 ? 11.772  -42.976 252.689 1.00 90.25  ? 108 LEU A O     1 
ATOM   741   C CB    . LEU A 1 108 ? 12.075  -40.666 254.878 1.00 95.07  ? 108 LEU A CB    1 
ATOM   742   C CG    . LEU A 1 108 ? 11.141  -41.586 255.680 1.00 88.34  ? 108 LEU A CG    1 
ATOM   743   C CD1   . LEU A 1 108 ? 9.758   -41.671 255.055 1.00 82.38  ? 108 LEU A CD1   1 
ATOM   744   C CD2   . LEU A 1 108 ? 11.734  -42.977 255.864 1.00 91.83  ? 108 LEU A CD2   1 
ATOM   745   N N     . ALA A 1 109 ? 11.984  -41.021 251.598 1.00 90.99  ? 109 ALA A N     1 
ATOM   746   C CA    . ALA A 1 109 ? 11.205  -41.453 250.447 1.00 93.63  ? 109 ALA A CA    1 
ATOM   747   C C     . ALA A 1 109 ? 11.953  -42.458 249.575 1.00 89.36  ? 109 ALA A C     1 
ATOM   748   O O     . ALA A 1 109 ? 11.341  -43.351 248.989 1.00 86.75  ? 109 ALA A O     1 
ATOM   749   C CB    . ALA A 1 109 ? 10.771  -40.255 249.622 1.00 104.04 ? 109 ALA A CB    1 
ATOM   750   N N     . GLN A 1 110 ? 13.273  -42.311 249.487 1.00 93.23  ? 110 GLN A N     1 
ATOM   751   C CA    . GLN A 1 110 ? 14.075  -43.200 248.649 1.00 93.94  ? 110 GLN A CA    1 
ATOM   752   C C     . GLN A 1 110 ? 14.626  -44.402 249.412 1.00 96.15  ? 110 GLN A C     1 
ATOM   753   O O     . GLN A 1 110 ? 15.025  -45.400 248.809 1.00 98.80  ? 110 GLN A O     1 
ATOM   754   C CB    . GLN A 1 110 ? 15.198  -42.438 247.939 1.00 90.86  ? 110 GLN A CB    1 
ATOM   755   C CG    . GLN A 1 110 ? 16.035  -41.532 248.824 1.00 92.88  ? 110 GLN A CG    1 
ATOM   756   C CD    . GLN A 1 110 ? 17.001  -40.692 248.009 1.00 94.34  ? 110 GLN A CD    1 
ATOM   757   O OE1   . GLN A 1 110 ? 16.986  -40.736 246.778 1.00 90.06  ? 110 GLN A OE1   1 
ATOM   758   N NE2   . GLN A 1 110 ? 17.847  -39.924 248.688 1.00 94.63  ? 110 GLN A NE2   1 
ATOM   759   N N     . LEU A 1 111 ? 14.647  -44.302 250.737 1.00 94.10  ? 111 LEU A N     1 
ATOM   760   C CA    . LEU A 1 111 ? 14.964  -45.446 251.579 1.00 87.59  ? 111 LEU A CA    1 
ATOM   761   C C     . LEU A 1 111 ? 13.840  -46.462 251.439 1.00 86.15  ? 111 LEU A C     1 
ATOM   762   O O     . LEU A 1 111 ? 14.072  -47.674 251.436 1.00 84.37  ? 111 LEU A O     1 
ATOM   763   C CB    . LEU A 1 111 ? 15.095  -45.017 253.039 1.00 83.60  ? 111 LEU A CB    1 
ATOM   764   C CG    . LEU A 1 111 ? 15.140  -46.146 254.070 1.00 77.71  ? 111 LEU A CG    1 
ATOM   765   C CD1   . LEU A 1 111 ? 16.418  -46.944 253.920 1.00 81.59  ? 111 LEU A CD1   1 
ATOM   766   C CD2   . LEU A 1 111 ? 15.005  -45.599 255.478 1.00 75.09  ? 111 LEU A CD2   1 
ATOM   767   N N     . PHE A 1 112 ? 12.619  -45.949 251.315 1.00 86.16  ? 112 PHE A N     1 
ATOM   768   C CA    . PHE A 1 112 ? 11.446  -46.779 251.079 1.00 85.13  ? 112 PHE A CA    1 
ATOM   769   C C     . PHE A 1 112 ? 11.547  -47.549 249.772 1.00 84.52  ? 112 PHE A C     1 
ATOM   770   O O     . PHE A 1 112 ? 10.978  -48.631 249.635 1.00 82.87  ? 112 PHE A O     1 
ATOM   771   C CB    . PHE A 1 112 ? 10.186  -45.921 251.071 1.00 78.82  ? 112 PHE A CB    1 
ATOM   772   C CG    . PHE A 1 112 ? 9.379   -46.048 252.317 1.00 78.83  ? 112 PHE A CG    1 
ATOM   773   C CD1   . PHE A 1 112 ? 9.831   -45.498 253.503 1.00 81.94  ? 112 PHE A CD1   1 
ATOM   774   C CD2   . PHE A 1 112 ? 8.176   -46.730 252.313 1.00 79.30  ? 112 PHE A CD2   1 
ATOM   775   C CE1   . PHE A 1 112 ? 9.095   -45.620 254.662 1.00 87.22  ? 112 PHE A CE1   1 
ATOM   776   C CE2   . PHE A 1 112 ? 7.436   -46.853 253.472 1.00 80.04  ? 112 PHE A CE2   1 
ATOM   777   C CZ    . PHE A 1 112 ? 7.897   -46.298 254.646 1.00 84.90  ? 112 PHE A CZ    1 
ATOM   778   N N     . GLY A 1 113 ? 12.266  -46.979 248.812 1.00 80.85  ? 113 GLY A N     1 
ATOM   779   C CA    . GLY A 1 113 ? 12.445  -47.616 247.523 1.00 78.39  ? 113 GLY A CA    1 
ATOM   780   C C     . GLY A 1 113 ? 13.425  -48.770 247.589 1.00 79.73  ? 113 GLY A C     1 
ATOM   781   O O     . GLY A 1 113 ? 13.321  -49.725 246.821 1.00 87.01  ? 113 GLY A O     1 
ATOM   782   N N     . LEU A 1 114 ? 14.377  -48.683 248.513 1.00 75.98  ? 114 LEU A N     1 
ATOM   783   C CA    . LEU A 1 114 ? 15.418  -49.696 248.634 1.00 76.11  ? 114 LEU A CA    1 
ATOM   784   C C     . LEU A 1 114 ? 14.964  -50.877 249.472 1.00 80.69  ? 114 LEU A C     1 
ATOM   785   O O     . LEU A 1 114 ? 15.328  -52.022 249.196 1.00 85.91  ? 114 LEU A O     1 
ATOM   786   C CB    . LEU A 1 114 ? 16.687  -49.098 249.247 1.00 76.33  ? 114 LEU A CB    1 
ATOM   787   C CG    . LEU A 1 114 ? 17.496  -48.147 248.366 1.00 79.77  ? 114 LEU A CG    1 
ATOM   788   C CD1   . LEU A 1 114 ? 18.537  -47.426 249.203 1.00 86.39  ? 114 LEU A CD1   1 
ATOM   789   C CD2   . LEU A 1 114 ? 18.155  -48.898 247.220 1.00 78.96  ? 114 LEU A CD2   1 
ATOM   790   N N     . LEU A 1 115 ? 14.164  -50.603 250.496 1.00 79.57  ? 115 LEU A N     1 
ATOM   791   C CA    . LEU A 1 115 ? 13.765  -51.657 251.417 1.00 79.88  ? 115 LEU A CA    1 
ATOM   792   C C     . LEU A 1 115 ? 12.377  -52.218 251.147 1.00 86.45  ? 115 LEU A C     1 
ATOM   793   O O     . LEU A 1 115 ? 11.508  -51.547 250.581 1.00 86.23  ? 115 LEU A O     1 
ATOM   794   C CB    . LEU A 1 115 ? 13.849  -51.174 252.862 1.00 74.07  ? 115 LEU A CB    1 
ATOM   795   C CG    . LEU A 1 115 ? 15.166  -50.518 253.257 1.00 74.87  ? 115 LEU A CG    1 
ATOM   796   C CD1   . LEU A 1 115 ? 15.216  -50.331 254.759 1.00 73.61  ? 115 LEU A CD1   1 
ATOM   797   C CD2   . LEU A 1 115 ? 16.346  -51.344 252.771 1.00 77.43  ? 115 LEU A CD2   1 
ATOM   798   N N     . LYS A 1 116 ? 12.194  -53.465 251.571 1.00 84.96  ? 116 LYS A N     1 
ATOM   799   C CA    . LYS A 1 116 ? 10.912  -54.144 251.526 1.00 81.97  ? 116 LYS A CA    1 
ATOM   800   C C     . LYS A 1 116 ? 9.989   -53.593 252.607 1.00 89.25  ? 116 LYS A C     1 
ATOM   801   O O     . LYS A 1 116 ? 10.447  -52.965 253.561 1.00 90.05  ? 116 LYS A O     1 
ATOM   802   C CB    . LYS A 1 116 ? 11.119  -55.643 251.733 1.00 79.82  ? 116 LYS A CB    1 
ATOM   803   C CG    . LYS A 1 116 ? 12.009  -56.276 250.683 1.00 82.12  ? 116 LYS A CG    1 
ATOM   804   C CD    . LYS A 1 116 ? 12.520  -57.631 251.120 1.00 87.84  ? 116 LYS A CD    1 
ATOM   805   C CE    . LYS A 1 116 ? 11.625  -58.750 250.623 1.00 96.60  ? 116 LYS A CE    1 
ATOM   806   N NZ    . LYS A 1 116 ? 12.225  -60.066 250.965 1.00 104.07 ? 116 LYS A NZ    1 
ATOM   807   N N     . LYS A 1 117 ? 8.690   -53.835 252.455 1.00 92.24  ? 117 LYS A N     1 
ATOM   808   C CA    . LYS A 1 117 ? 7.693   -53.307 253.386 1.00 91.81  ? 117 LYS A CA    1 
ATOM   809   C C     . LYS A 1 117 ? 7.890   -53.842 254.804 1.00 93.97  ? 117 LYS A C     1 
ATOM   810   O O     . LYS A 1 117 ? 7.794   -53.091 255.772 1.00 94.48  ? 117 LYS A O     1 
ATOM   811   C CB    . LYS A 1 117 ? 6.266   -53.589 252.876 1.00 88.24  ? 117 LYS A CB    1 
ATOM   812   C CG    . LYS A 1 117 ? 5.114   -53.138 253.795 1.00 80.69  ? 117 LYS A CG    1 
ATOM   813   C CD    . LYS A 1 117 ? 3.801   -53.010 253.005 1.00 80.72  ? 117 LYS A CD    1 
ATOM   814   C CE    . LYS A 1 117 ? 2.593   -53.567 253.763 1.00 87.10  ? 117 LYS A CE    1 
ATOM   815   N NZ    . LYS A 1 117 ? 1.501   -54.014 252.826 1.00 84.14  ? 117 LYS A NZ    1 
ATOM   816   N N     . ASP A 1 118 ? 8.180   -55.134 254.921 1.00 96.88  ? 118 ASP A N     1 
ATOM   817   C CA    . ASP A 1 118 ? 8.347   -55.757 256.231 1.00 103.11 ? 118 ASP A CA    1 
ATOM   818   C C     . ASP A 1 118 ? 9.574   -55.224 256.966 1.00 101.48 ? 118 ASP A C     1 
ATOM   819   O O     . ASP A 1 118 ? 9.553   -55.063 258.187 1.00 103.42 ? 118 ASP A O     1 
ATOM   820   C CB    . ASP A 1 118 ? 8.413   -57.281 256.103 1.00 114.69 ? 118 ASP A CB    1 
ATOM   821   C CG    . ASP A 1 118 ? 7.056   -57.901 255.821 1.00 131.88 ? 118 ASP A CG    1 
ATOM   822   O OD1   . ASP A 1 118 ? 6.207   -57.224 255.202 1.00 137.10 ? 118 ASP A OD1   1 
ATOM   823   O OD2   . ASP A 1 118 ? 6.837   -59.064 256.224 1.00 137.93 ? 118 ASP A OD2   1 
ATOM   824   N N     . GLU A 1 119 ? 10.634  -54.948 256.212 1.00 99.62  ? 119 GLU A N     1 
ATOM   825   C CA    . GLU A 1 119 ? 11.858  -54.377 256.767 1.00 96.84  ? 119 GLU A CA    1 
ATOM   826   C C     . GLU A 1 119 ? 11.604  -52.974 257.314 1.00 96.87  ? 119 GLU A C     1 
ATOM   827   O O     . GLU A 1 119 ? 12.109  -52.608 258.375 1.00 99.03  ? 119 GLU A O     1 
ATOM   828   C CB    . GLU A 1 119 ? 12.964  -54.325 255.705 1.00 97.59  ? 119 GLU A CB    1 
ATOM   829   C CG    . GLU A 1 119 ? 13.554  -55.675 255.317 1.00 101.95 ? 119 GLU A CG    1 
ATOM   830   C CD    . GLU A 1 119 ? 14.589  -55.562 254.203 1.00 108.26 ? 119 GLU A CD    1 
ATOM   831   O OE1   . GLU A 1 119 ? 14.400  -54.718 253.301 1.00 109.86 ? 119 GLU A OE1   1 
ATOM   832   O OE2   . GLU A 1 119 ? 15.590  -56.314 254.232 1.00 107.57 ? 119 GLU A OE2   1 
ATOM   833   N N     . LEU A 1 120 ? 10.815  -52.196 256.581 1.00 95.87  ? 120 LEU A N     1 
ATOM   834   C CA    . LEU A 1 120 ? 10.492  -50.831 256.978 1.00 94.13  ? 120 LEU A CA    1 
ATOM   835   C C     . LEU A 1 120 ? 9.535   -50.782 258.165 1.00 96.08  ? 120 LEU A C     1 
ATOM   836   O O     . LEU A 1 120 ? 9.571   -49.843 258.961 1.00 99.06  ? 120 LEU A O     1 
ATOM   837   C CB    . LEU A 1 120 ? 9.904   -50.061 255.798 1.00 86.66  ? 120 LEU A CB    1 
ATOM   838   C CG    . LEU A 1 120 ? 10.912  -49.720 254.704 1.00 83.02  ? 120 LEU A CG    1 
ATOM   839   C CD1   . LEU A 1 120 ? 10.219  -49.636 253.362 1.00 86.49  ? 120 LEU A CD1   1 
ATOM   840   C CD2   . LEU A 1 120 ? 11.610  -48.410 255.026 1.00 86.28  ? 120 LEU A CD2   1 
ATOM   841   N N     . SER A 1 121 ? 8.674   -51.788 258.282 1.00 89.31  ? 121 SER A N     1 
ATOM   842   C CA    . SER A 1 121 ? 7.752   -51.848 259.408 1.00 91.30  ? 121 SER A CA    1 
ATOM   843   C C     . SER A 1 121 ? 8.511   -52.161 260.688 1.00 101.38 ? 121 SER A C     1 
ATOM   844   O O     . SER A 1 121 ? 8.163   -51.675 261.763 1.00 106.99 ? 121 SER A O     1 
ATOM   845   C CB    . SER A 1 121 ? 6.669   -52.900 259.172 1.00 89.50  ? 121 SER A CB    1 
ATOM   846   O OG    . SER A 1 121 ? 5.892   -52.586 258.030 1.00 91.00  ? 121 SER A OG    1 
ATOM   847   N N     . GLN A 1 122 ? 9.549   -52.981 260.566 1.00 103.04 ? 122 GLN A N     1 
ATOM   848   C CA    . GLN A 1 122 ? 10.379  -53.326 261.712 1.00 106.56 ? 122 GLN A CA    1 
ATOM   849   C C     . GLN A 1 122 ? 11.129  -52.100 262.201 1.00 103.84 ? 122 GLN A C     1 
ATOM   850   O O     . GLN A 1 122 ? 11.218  -51.848 263.403 1.00 106.68 ? 122 GLN A O     1 
ATOM   851   C CB    . GLN A 1 122 ? 11.376  -54.424 261.342 1.00 114.15 ? 122 GLN A CB    1 
ATOM   852   C CG    . GLN A 1 122 ? 11.008  -55.803 261.865 1.00 122.67 ? 122 GLN A CG    1 
ATOM   853   C CD    . GLN A 1 122 ? 11.236  -55.944 263.359 1.00 127.67 ? 122 GLN A CD    1 
ATOM   854   O OE1   . GLN A 1 122 ? 10.448  -56.578 264.062 1.00 133.63 ? 122 GLN A OE1   1 
ATOM   855   N NE2   . GLN A 1 122 ? 12.325  -55.361 263.850 1.00 122.26 ? 122 GLN A NE2   1 
ATOM   856   N N     . LEU A 1 123 ? 11.657  -51.336 261.253 1.00 98.81  ? 123 LEU A N     1 
ATOM   857   C CA    . LEU A 1 123 ? 12.515  -50.202 261.563 1.00 98.34  ? 123 LEU A CA    1 
ATOM   858   C C     . LEU A 1 123 ? 11.738  -49.078 262.240 1.00 103.76 ? 123 LEU A C     1 
ATOM   859   O O     . LEU A 1 123 ? 12.148  -48.568 263.282 1.00 108.35 ? 123 LEU A O     1 
ATOM   860   C CB    . LEU A 1 123 ? 13.198  -49.696 260.291 1.00 94.32  ? 123 LEU A CB    1 
ATOM   861   C CG    . LEU A 1 123 ? 14.250  -48.598 260.448 1.00 94.49  ? 123 LEU A CG    1 
ATOM   862   C CD1   . LEU A 1 123 ? 15.311  -49.006 261.457 1.00 98.27  ? 123 LEU A CD1   1 
ATOM   863   C CD2   . LEU A 1 123 ? 14.884  -48.285 259.103 1.00 91.72  ? 123 LEU A CD2   1 
ATOM   864   N N     . PHE A 1 124 ? 10.608  -48.704 261.650 1.00 102.53 ? 124 PHE A N     1 
ATOM   865   C CA    . PHE A 1 124 ? 9.793   -47.623 262.189 1.00 103.94 ? 124 PHE A CA    1 
ATOM   866   C C     . PHE A 1 124 ? 8.675   -48.171 263.071 1.00 107.04 ? 124 PHE A C     1 
ATOM   867   O O     . PHE A 1 124 ? 7.572   -47.627 263.111 1.00 106.57 ? 124 PHE A O     1 
ATOM   868   C CB    . PHE A 1 124 ? 9.233   -46.771 261.049 1.00 102.83 ? 124 PHE A CB    1 
ATOM   869   C CG    . PHE A 1 124 ? 10.296  -46.199 260.155 1.00 104.85 ? 124 PHE A CG    1 
ATOM   870   C CD1   . PHE A 1 124 ? 10.987  -45.057 260.525 1.00 104.97 ? 124 PHE A CD1   1 
ATOM   871   C CD2   . PHE A 1 124 ? 10.616  -46.809 258.952 1.00 104.30 ? 124 PHE A CD2   1 
ATOM   872   C CE1   . PHE A 1 124 ? 11.970  -44.530 259.712 1.00 102.04 ? 124 PHE A CE1   1 
ATOM   873   C CE2   . PHE A 1 124 ? 11.600  -46.286 258.134 1.00 101.31 ? 124 PHE A CE2   1 
ATOM   874   C CZ    . PHE A 1 124 ? 12.279  -45.146 258.516 1.00 98.83  ? 124 PHE A CZ    1 
ATOM   875   N N     . ARG A 1 125 ? 8.989   -49.248 263.785 1.00 109.62 ? 125 ARG A N     1 
ATOM   876   C CA    . ARG A 1 125 ? 8.025   -49.961 264.617 1.00 110.50 ? 125 ARG A CA    1 
ATOM   877   C C     . ARG A 1 125 ? 7.362   -49.054 265.653 1.00 109.88 ? 125 ARG A C     1 
ATOM   878   O O     . ARG A 1 125 ? 6.139   -49.049 265.799 1.00 108.04 ? 125 ARG A O     1 
ATOM   879   C CB    . ARG A 1 125 ? 8.720   -51.136 265.309 1.00 113.87 ? 125 ARG A CB    1 
ATOM   880   C CG    . ARG A 1 125 ? 7.801   -52.069 266.081 1.00 120.20 ? 125 ARG A CG    1 
ATOM   881   C CD    . ARG A 1 125 ? 8.593   -53.197 266.736 1.00 127.02 ? 125 ARG A CD    1 
ATOM   882   N NE    . ARG A 1 125 ? 9.581   -52.692 267.687 1.00 133.98 ? 125 ARG A NE    1 
ATOM   883   C CZ    . ARG A 1 125 ? 10.882  -52.579 267.431 1.00 138.77 ? 125 ARG A CZ    1 
ATOM   884   N NH1   . ARG A 1 125 ? 11.363  -52.944 266.249 1.00 136.63 ? 125 ARG A NH1   1 
ATOM   885   N NH2   . ARG A 1 125 ? 11.703  -52.103 268.358 1.00 142.86 ? 125 ARG A NH2   1 
ATOM   886   N N     . ASP A 1 126 ? 8.177   -48.273 266.356 1.00 112.89 ? 126 ASP A N     1 
ATOM   887   C CA    . ASP A 1 126 ? 7.693   -47.413 267.432 1.00 114.56 ? 126 ASP A CA    1 
ATOM   888   C C     . ASP A 1 126 ? 7.039   -46.124 266.924 1.00 108.98 ? 126 ASP A C     1 
ATOM   889   O O     . ASP A 1 126 ? 6.986   -45.126 267.644 1.00 107.56 ? 126 ASP A O     1 
ATOM   890   C CB    . ASP A 1 126 ? 8.841   -47.072 268.388 1.00 121.90 ? 126 ASP A CB    1 
ATOM   891   C CG    . ASP A 1 126 ? 9.385   -48.293 269.111 1.00 125.18 ? 126 ASP A CG    1 
ATOM   892   O OD1   . ASP A 1 126 ? 9.141   -49.427 268.646 1.00 124.30 ? 126 ASP A OD1   1 
ATOM   893   O OD2   . ASP A 1 126 ? 10.062  -48.117 270.146 1.00 128.12 ? 126 ASP A OD2   1 
ATOM   894   N N     . HIS A 1 127 ? 6.545   -46.147 265.690 1.00 106.50 ? 127 HIS A N     1 
ATOM   895   C CA    . HIS A 1 127 ? 5.886   -44.982 265.103 1.00 107.44 ? 127 HIS A CA    1 
ATOM   896   C C     . HIS A 1 127 ? 4.684   -45.392 264.262 1.00 103.73 ? 127 HIS A C     1 
ATOM   897   O O     . HIS A 1 127 ? 4.058   -44.559 263.601 1.00 100.28 ? 127 HIS A O     1 
ATOM   898   C CB    . HIS A 1 127 ? 6.871   -44.184 264.248 1.00 111.89 ? 127 HIS A CB    1 
ATOM   899   C CG    . HIS A 1 127 ? 8.058   -43.690 265.005 1.00 116.94 ? 127 HIS A CG    1 
ATOM   900   N ND1   . HIS A 1 127 ? 8.093   -42.457 265.615 1.00 117.94 ? 127 HIS A ND1   1 
ATOM   901   C CD2   . HIS A 1 127 ? 9.262   -44.267 265.266 1.00 116.73 ? 127 HIS A CD2   1 
ATOM   902   C CE1   . HIS A 1 127 ? 9.263   -42.288 266.215 1.00 120.60 ? 127 HIS A CE1   1 
ATOM   903   N NE2   . HIS A 1 127 ? 9.983   -43.384 266.010 1.00 118.78 ? 127 HIS A NE2   1 
ATOM   904   N N     . LEU A 1 128 ? 4.370   -46.683 264.294 1.00 100.22 ? 128 LEU A N     1 
ATOM   905   C CA    . LEU A 1 128 ? 3.283   -47.237 263.499 1.00 93.26  ? 128 LEU A CA    1 
ATOM   906   C C     . LEU A 1 128 ? 2.269   -47.943 264.393 1.00 95.36  ? 128 LEU A C     1 
ATOM   907   O O     . LEU A 1 128 ? 2.599   -48.377 265.497 1.00 98.94  ? 128 LEU A O     1 
ATOM   908   C CB    . LEU A 1 128 ? 3.839   -48.212 262.457 1.00 89.81  ? 128 LEU A CB    1 
ATOM   909   C CG    . LEU A 1 128 ? 4.868   -47.645 261.472 1.00 88.02  ? 128 LEU A CG    1 
ATOM   910   C CD1   . LEU A 1 128 ? 5.340   -48.713 260.492 1.00 77.69  ? 128 LEU A CD1   1 
ATOM   911   C CD2   . LEU A 1 128 ? 4.313   -46.436 260.731 1.00 87.68  ? 128 LEU A CD2   1 
ATOM   912   N N     . GLY A 1 129 ? 1.033   -48.047 263.913 1.00 95.75  ? 129 GLY A N     1 
ATOM   913   C CA    . GLY A 1 129 ? -0.014  -48.741 264.642 1.00 97.82  ? 129 GLY A CA    1 
ATOM   914   C C     . GLY A 1 129 ? -0.009  -50.229 264.350 1.00 98.83  ? 129 GLY A C     1 
ATOM   915   O O     . GLY A 1 129 ? 0.949   -50.755 263.789 1.00 103.92 ? 129 GLY A O     1 
ATOM   916   N N     . ARG A 1 130 ? -1.082  -50.912 264.733 1.00 99.23  ? 130 ARG A N     1 
ATOM   917   C CA    . ARG A 1 130 ? -1.196  -52.347 264.502 1.00 100.13 ? 130 ARG A CA    1 
ATOM   918   C C     . ARG A 1 130 ? -1.854  -52.611 263.153 1.00 100.05 ? 130 ARG A C     1 
ATOM   919   O O     . ARG A 1 130 ? -1.848  -53.736 262.655 1.00 103.56 ? 130 ARG A O     1 
ATOM   920   C CB    . ARG A 1 130 ? -2.003  -53.008 265.625 1.00 105.72 ? 130 ARG A CB    1 
ATOM   921   C CG    . ARG A 1 130 ? -1.382  -52.877 267.011 1.00 115.72 ? 130 ARG A CG    1 
ATOM   922   C CD    . ARG A 1 130 ? -2.447  -52.756 268.103 1.00 128.57 ? 130 ARG A CD    1 
ATOM   923   N NE    . ARG A 1 130 ? -1.865  -52.771 269.445 1.00 137.77 ? 130 ARG A NE    1 
ATOM   924   C CZ    . ARG A 1 130 ? -2.539  -52.509 270.562 1.00 144.47 ? 130 ARG A CZ    1 
ATOM   925   N NH1   . ARG A 1 130 ? -3.828  -52.201 270.507 1.00 145.40 ? 130 ARG A NH1   1 
ATOM   926   N NH2   . ARG A 1 130 ? -1.921  -52.550 271.735 1.00 147.83 ? 130 ARG A NH2   1 
ATOM   927   N N     . ALA A 1 131 ? -2.419  -51.562 262.565 1.00 96.35  ? 131 ALA A N     1 
ATOM   928   C CA    . ALA A 1 131 ? -3.155  -51.684 261.314 1.00 89.77  ? 131 ALA A CA    1 
ATOM   929   C C     . ALA A 1 131 ? -2.221  -51.875 260.132 1.00 84.93  ? 131 ALA A C     1 
ATOM   930   O O     . ALA A 1 131 ? -1.193  -51.215 260.025 1.00 84.33  ? 131 ALA A O     1 
ATOM   931   C CB    . ALA A 1 131 ? -4.027  -50.464 261.096 1.00 94.47  ? 131 ALA A CB    1 
ATOM   932   N N     . ASN A 1 132 ? -2.596  -52.781 259.240 1.00 88.28  ? 132 ASN A N     1 
ATOM   933   C CA    . ASN A 1 132 ? -1.840  -53.012 258.019 1.00 88.81  ? 132 ASN A CA    1 
ATOM   934   C C     . ASN A 1 132 ? -2.135  -51.926 256.994 1.00 96.30  ? 132 ASN A C     1 
ATOM   935   O O     . ASN A 1 132 ? -3.215  -51.895 256.407 1.00 100.50 ? 132 ASN A O     1 
ATOM   936   C CB    . ASN A 1 132 ? -2.184  -54.387 257.439 1.00 88.63  ? 132 ASN A CB    1 
ATOM   937   C CG    . ASN A 1 132 ? -1.277  -54.787 256.289 1.00 94.73  ? 132 ASN A CG    1 
ATOM   938   O OD1   . ASN A 1 132 ? -1.089  -54.038 255.330 1.00 100.26 ? 132 ASN A OD1   1 
ATOM   939   N ND2   . ASN A 1 132 ? -0.713  -55.985 256.380 1.00 99.80  ? 132 ASN A ND2   1 
ATOM   940   N N     . LEU A 1 133 ? -1.172  -51.036 256.784 1.00 99.88  ? 133 LEU A N     1 
ATOM   941   C CA    . LEU A 1 133 ? -1.282  -50.029 255.735 1.00 99.71  ? 133 LEU A CA    1 
ATOM   942   C C     . LEU A 1 133 ? -0.451  -50.431 254.528 1.00 100.54 ? 133 LEU A C     1 
ATOM   943   O O     . LEU A 1 133 ? 0.491   -51.217 254.645 1.00 101.13 ? 133 LEU A O     1 
ATOM   944   C CB    . LEU A 1 133 ? -0.806  -48.666 256.237 1.00 98.25  ? 133 LEU A CB    1 
ATOM   945   C CG    . LEU A 1 133 ? -1.393  -48.201 257.568 1.00 98.70  ? 133 LEU A CG    1 
ATOM   946   C CD1   . LEU A 1 133 ? -0.946  -46.779 257.890 1.00 96.96  ? 133 LEU A CD1   1 
ATOM   947   C CD2   . LEU A 1 133 ? -2.913  -48.315 257.556 1.00 96.39  ? 133 LEU A CD2   1 
ATOM   948   N N     . ARG A 1 134 ? -0.803  -49.882 253.370 1.00 99.64  ? 134 ARG A N     1 
ATOM   949   C CA    . ARG A 1 134 ? 0.006   -50.060 252.172 1.00 97.08  ? 134 ARG A CA    1 
ATOM   950   C C     . ARG A 1 134 ? 1.336   -49.328 252.333 1.00 90.87  ? 134 ARG A C     1 
ATOM   951   O O     . ARG A 1 134 ? 1.480   -48.466 253.203 1.00 86.35  ? 134 ARG A O     1 
ATOM   952   C CB    . ARG A 1 134 ? -0.729  -49.552 250.930 1.00 98.65  ? 134 ARG A CB    1 
ATOM   953   C CG    . ARG A 1 134 ? -2.034  -50.268 250.633 1.00 95.66  ? 134 ARG A CG    1 
ATOM   954   C CD    . ARG A 1 134 ? -2.427  -50.115 249.171 1.00 94.70  ? 134 ARG A CD    1 
ATOM   955   N NE    . ARG A 1 134 ? -3.871  -50.236 248.990 1.00 108.48 ? 134 ARG A NE    1 
ATOM   956   C CZ    . ARG A 1 134 ? -4.456  -50.853 247.968 1.00 121.26 ? 134 ARG A CZ    1 
ATOM   957   N NH1   . ARG A 1 134 ? -3.722  -51.423 247.019 1.00 125.04 ? 134 ARG A NH1   1 
ATOM   958   N NH2   . ARG A 1 134 ? -5.780  -50.903 247.899 1.00 121.91 ? 134 ARG A NH2   1 
ATOM   959   N N     . LYS A 1 135 ? 2.301   -49.672 251.487 1.00 85.30  ? 135 LYS A N     1 
ATOM   960   C CA    . LYS A 1 135 ? 3.647   -49.116 251.584 1.00 81.07  ? 135 LYS A CA    1 
ATOM   961   C C     . LYS A 1 135 ? 3.679   -47.598 251.382 1.00 82.17  ? 135 LYS A C     1 
ATOM   962   O O     . LYS A 1 135 ? 4.359   -46.884 252.118 1.00 82.33  ? 135 LYS A O     1 
ATOM   963   C CB    . LYS A 1 135 ? 4.573   -49.812 250.585 1.00 70.56  ? 135 LYS A CB    1 
ATOM   964   C CG    . LYS A 1 135 ? 6.055   -49.588 250.834 1.00 82.12  ? 135 LYS A CG    1 
ATOM   965   C CD    . LYS A 1 135 ? 6.881   -50.623 250.085 1.00 81.53  ? 135 LYS A CD    1 
ATOM   966   C CE    . LYS A 1 135 ? 8.367   -50.347 250.198 1.00 79.46  ? 135 LYS A CE    1 
ATOM   967   N NZ    . LYS A 1 135 ? 9.004   -50.293 248.853 1.00 77.38  ? 135 LYS A NZ    1 
ATOM   968   N N     . ASP A 1 136 ? 2.944   -47.112 250.386 1.00 85.51  ? 136 ASP A N     1 
ATOM   969   C CA    . ASP A 1 136 ? 2.872   -45.679 250.106 1.00 89.36  ? 136 ASP A CA    1 
ATOM   970   C C     . ASP A 1 136 ? 2.189   -44.919 251.241 1.00 92.41  ? 136 ASP A C     1 
ATOM   971   O O     . ASP A 1 136 ? 2.516   -43.761 251.512 1.00 100.08 ? 136 ASP A O     1 
ATOM   972   C CB    . ASP A 1 136 ? 2.143   -45.428 248.783 1.00 101.57 ? 136 ASP A CB    1 
ATOM   973   C CG    . ASP A 1 136 ? 1.310   -46.620 248.340 1.00 116.33 ? 136 ASP A CG    1 
ATOM   974   O OD1   . ASP A 1 136 ? 1.803   -47.765 248.445 1.00 116.12 ? 136 ASP A OD1   1 
ATOM   975   O OD2   . ASP A 1 136 ? 0.160   -46.413 247.894 1.00 121.73 ? 136 ASP A OD2   1 
ATOM   976   N N     . ALA A 1 137 ? 1.245   -45.583 251.901 1.00 88.37  ? 137 ALA A N     1 
ATOM   977   C CA    . ALA A 1 137 ? 0.559   -45.017 253.056 1.00 84.25  ? 137 ALA A CA    1 
ATOM   978   C C     . ALA A 1 137 ? 1.531   -44.818 254.212 1.00 91.28  ? 137 ALA A C     1 
ATOM   979   O O     . ALA A 1 137 ? 1.528   -43.774 254.863 1.00 93.27  ? 137 ALA A O     1 
ATOM   980   C CB    . ALA A 1 137 ? -0.585  -45.916 253.480 1.00 85.18  ? 137 ALA A CB    1 
ATOM   981   N N     . LEU A 1 138 ? 2.354   -45.832 254.464 1.00 95.63  ? 138 LEU A N     1 
ATOM   982   C CA    . LEU A 1 138 ? 3.406   -45.735 255.469 1.00 94.67  ? 138 LEU A CA    1 
ATOM   983   C C     . LEU A 1 138 ? 4.324   -44.560 255.169 1.00 96.26  ? 138 LEU A C     1 
ATOM   984   O O     . LEU A 1 138 ? 4.713   -43.818 256.071 1.00 96.92  ? 138 LEU A O     1 
ATOM   985   C CB    . LEU A 1 138 ? 4.234   -47.020 255.512 1.00 90.12  ? 138 LEU A CB    1 
ATOM   986   C CG    . LEU A 1 138 ? 3.582   -48.249 256.143 1.00 87.79  ? 138 LEU A CG    1 
ATOM   987   C CD1   . LEU A 1 138 ? 4.501   -49.461 256.055 1.00 80.57  ? 138 LEU A CD1   1 
ATOM   988   C CD2   . LEU A 1 138 ? 3.213   -47.953 257.587 1.00 92.29  ? 138 LEU A CD2   1 
ATOM   989   N N     . LEU A 1 139 ? 4.665   -44.400 253.892 1.00 94.87  ? 139 LEU A N     1 
ATOM   990   C CA    . LEU A 1 139 ? 5.576   -43.347 253.464 1.00 93.97  ? 139 LEU A CA    1 
ATOM   991   C C     . LEU A 1 139 ? 4.983   -41.986 253.775 1.00 97.99  ? 139 LEU A C     1 
ATOM   992   O O     . LEU A 1 139 ? 5.689   -41.064 254.183 1.00 92.05  ? 139 LEU A O     1 
ATOM   993   C CB    . LEU A 1 139 ? 5.847   -43.455 251.964 1.00 88.15  ? 139 LEU A CB    1 
ATOM   994   C CG    . LEU A 1 139 ? 6.841   -42.458 251.371 1.00 82.27  ? 139 LEU A CG    1 
ATOM   995   C CD1   . LEU A 1 139 ? 8.183   -42.621 252.034 1.00 74.11  ? 139 LEU A CD1   1 
ATOM   996   C CD2   . LEU A 1 139 ? 6.970   -42.660 249.874 1.00 80.36  ? 139 LEU A CD2   1 
ATOM   997   N N     . GLU A 1 140 ? 3.675   -41.875 253.583 1.00 102.37 ? 140 GLU A N     1 
ATOM   998   C CA    . GLU A 1 140 ? 2.970   -40.632 253.841 1.00 106.65 ? 140 GLU A CA    1 
ATOM   999   C C     . GLU A 1 140 ? 2.895   -40.319 255.336 1.00 107.71 ? 140 GLU A C     1 
ATOM   1000  O O     . GLU A 1 140 ? 3.086   -39.173 255.743 1.00 109.23 ? 140 GLU A O     1 
ATOM   1001  C CB    . GLU A 1 140 ? 1.572   -40.688 253.236 1.00 110.24 ? 140 GLU A CB    1 
ATOM   1002  C CG    . GLU A 1 140 ? 0.791   -39.409 253.409 1.00 123.42 ? 140 GLU A CG    1 
ATOM   1003  C CD    . GLU A 1 140 ? -0.505  -39.409 252.630 1.00 136.68 ? 140 GLU A CD    1 
ATOM   1004  O OE1   . GLU A 1 140 ? -0.802  -40.422 251.960 1.00 140.31 ? 140 GLU A OE1   1 
ATOM   1005  O OE2   . GLU A 1 140 ? -1.226  -38.391 252.688 1.00 143.16 ? 140 GLU A OE2   1 
ATOM   1006  N N     . ARG A 1 141 ? 2.618   -41.338 256.147 1.00 108.31 ? 141 ARG A N     1 
ATOM   1007  C CA    . ARG A 1 141 ? 2.534   -41.164 257.596 1.00 113.10 ? 141 ARG A CA    1 
ATOM   1008  C C     . ARG A 1 141 ? 3.884   -40.775 258.190 1.00 118.31 ? 141 ARG A C     1 
ATOM   1009  O O     . ARG A 1 141 ? 3.965   -39.916 259.069 1.00 122.63 ? 141 ARG A O     1 
ATOM   1010  C CB    . ARG A 1 141 ? 2.053   -42.451 258.276 1.00 113.34 ? 141 ARG A CB    1 
ATOM   1011  C CG    . ARG A 1 141 ? 0.702   -42.976 257.808 1.00 118.53 ? 141 ARG A CG    1 
ATOM   1012  C CD    . ARG A 1 141 ? -0.461  -42.156 258.345 1.00 123.44 ? 141 ARG A CD    1 
ATOM   1013  N NE    . ARG A 1 141 ? -1.747  -42.706 257.920 1.00 124.16 ? 141 ARG A NE    1 
ATOM   1014  C CZ    . ARG A 1 141 ? -2.429  -43.624 258.600 1.00 123.26 ? 141 ARG A CZ    1 
ATOM   1015  N NH1   . ARG A 1 141 ? -1.949  -44.095 259.744 1.00 122.75 ? 141 ARG A NH1   1 
ATOM   1016  N NH2   . ARG A 1 141 ? -3.590  -44.070 258.138 1.00 121.03 ? 141 ARG A NH2   1 
ATOM   1017  N N     . LEU A 1 142 ? 4.941   -41.419 257.706 1.00 115.32 ? 142 LEU A N     1 
ATOM   1018  C CA    . LEU A 1 142 ? 6.272   -41.267 258.286 1.00 107.11 ? 142 LEU A CA    1 
ATOM   1019  C C     . LEU A 1 142 ? 7.068   -40.104 257.702 1.00 109.83 ? 142 LEU A C     1 
ATOM   1020  O O     . LEU A 1 142 ? 8.018   -39.630 258.327 1.00 111.18 ? 142 LEU A O     1 
ATOM   1021  C CB    . LEU A 1 142 ? 7.068   -42.563 258.131 1.00 92.91  ? 142 LEU A CB    1 
ATOM   1022  C CG    . LEU A 1 142 ? 6.527   -43.784 258.876 1.00 87.36  ? 142 LEU A CG    1 
ATOM   1023  C CD1   . LEU A 1 142 ? 7.256   -45.046 258.439 1.00 86.76  ? 142 LEU A CD1   1 
ATOM   1024  C CD2   . LEU A 1 142 ? 6.642   -43.592 260.381 1.00 83.52  ? 142 LEU A CD2   1 
ATOM   1025  N N     . GLN A 1 143 ? 6.691   -39.656 256.506 1.00 112.26 ? 143 GLN A N     1 
ATOM   1026  C CA    . GLN A 1 143 ? 7.399   -38.560 255.834 1.00 114.68 ? 143 GLN A CA    1 
ATOM   1027  C C     . GLN A 1 143 ? 7.619   -37.300 256.687 1.00 114.22 ? 143 GLN A C     1 
ATOM   1028  O O     . GLN A 1 143 ? 8.727   -36.759 256.699 1.00 114.85 ? 143 GLN A O     1 
ATOM   1029  C CB    . GLN A 1 143 ? 6.725   -38.181 254.512 1.00 120.69 ? 143 GLN A CB    1 
ATOM   1030  C CG    . GLN A 1 143 ? 7.542   -37.221 253.667 1.00 128.22 ? 143 GLN A CG    1 
ATOM   1031  C CD    . GLN A 1 143 ? 8.347   -37.934 252.601 1.00 133.91 ? 143 GLN A CD    1 
ATOM   1032  O OE1   . GLN A 1 143 ? 9.573   -37.822 252.548 1.00 135.39 ? 143 GLN A OE1   1 
ATOM   1033  N NE2   . GLN A 1 143 ? 7.657   -38.672 251.738 1.00 134.69 ? 143 GLN A NE2   1 
ATOM   1034  N N     . PRO A 1 144 ? 6.571   -36.819 257.391 1.00 108.74 ? 144 PRO A N     1 
ATOM   1035  C CA    . PRO A 1 144 ? 6.787   -35.634 258.228 1.00 105.71 ? 144 PRO A CA    1 
ATOM   1036  C C     . PRO A 1 144 ? 7.637   -35.918 259.462 1.00 114.18 ? 144 PRO A C     1 
ATOM   1037  O O     . PRO A 1 144 ? 8.370   -35.032 259.897 1.00 124.30 ? 144 PRO A O     1 
ATOM   1038  C CB    . PRO A 1 144 ? 5.369   -35.242 258.649 1.00 99.34  ? 144 PRO A CB    1 
ATOM   1039  C CG    . PRO A 1 144 ? 4.605   -36.508 258.591 1.00 102.87 ? 144 PRO A CG    1 
ATOM   1040  C CD    . PRO A 1 144 ? 5.155   -37.233 257.408 1.00 104.36 ? 144 PRO A CD    1 
ATOM   1041  N N     . LEU A 1 145 ? 7.545   -37.124 260.018 1.00 111.71 ? 145 LEU A N     1 
ATOM   1042  C CA    . LEU A 1 145 ? 8.359   -37.475 261.181 1.00 112.38 ? 145 LEU A CA    1 
ATOM   1043  C C     . LEU A 1 145 ? 9.845   -37.569 260.860 1.00 112.54 ? 145 LEU A C     1 
ATOM   1044  O O     . LEU A 1 145 ? 10.680  -37.493 261.758 1.00 117.22 ? 145 LEU A O     1 
ATOM   1045  C CB    . LEU A 1 145 ? 7.902   -38.788 261.815 1.00 112.29 ? 145 LEU A CB    1 
ATOM   1046  C CG    . LEU A 1 145 ? 6.635   -38.731 262.661 1.00 112.49 ? 145 LEU A CG    1 
ATOM   1047  C CD1   . LEU A 1 145 ? 5.421   -38.971 261.785 1.00 111.07 ? 145 LEU A CD1   1 
ATOM   1048  C CD2   . LEU A 1 145 ? 6.710   -39.738 263.801 1.00 110.85 ? 145 LEU A CD2   1 
ATOM   1049  N N     . PHE A 1 146 ? 10.179  -37.756 259.587 1.00 109.82 ? 146 PHE A N     1 
ATOM   1050  C CA    . PHE A 1 146 ? 11.582  -37.846 259.190 1.00 112.11 ? 146 PHE A CA    1 
ATOM   1051  C C     . PHE A 1 146 ? 11.849  -37.110 257.875 1.00 118.13 ? 146 PHE A C     1 
ATOM   1052  O O     . PHE A 1 146 ? 12.166  -37.739 256.864 1.00 121.10 ? 146 PHE A O     1 
ATOM   1053  C CB    . PHE A 1 146 ? 12.015  -39.313 259.055 1.00 106.42 ? 146 PHE A CB    1 
ATOM   1054  C CG    . PHE A 1 146 ? 11.783  -40.145 260.294 1.00 103.23 ? 146 PHE A CG    1 
ATOM   1055  C CD1   . PHE A 1 146 ? 12.779  -40.298 261.244 1.00 105.20 ? 146 PHE A CD1   1 
ATOM   1056  C CD2   . PHE A 1 146 ? 10.573  -40.791 260.494 1.00 106.59 ? 146 PHE A CD2   1 
ATOM   1057  C CE1   . PHE A 1 146 ? 12.568  -41.068 262.378 1.00 108.44 ? 146 PHE A CE1   1 
ATOM   1058  C CE2   . PHE A 1 146 ? 10.355  -41.561 261.625 1.00 108.05 ? 146 PHE A CE2   1 
ATOM   1059  C CZ    . PHE A 1 146 ? 11.353  -41.701 262.568 1.00 108.94 ? 146 PHE A CZ    1 
ATOM   1060  N N     . PRO A 1 147 ? 11.739  -35.770 257.887 1.00 117.63 ? 147 PRO A N     1 
ATOM   1061  C CA    . PRO A 1 147 ? 11.847  -35.004 256.641 1.00 117.15 ? 147 PRO A CA    1 
ATOM   1062  C C     . PRO A 1 147 ? 13.281  -34.895 256.125 1.00 118.29 ? 147 PRO A C     1 
ATOM   1063  O O     . PRO A 1 147 ? 13.486  -34.720 254.923 1.00 117.71 ? 147 PRO A O     1 
ATOM   1064  C CB    . PRO A 1 147 ? 11.323  -33.625 257.042 1.00 115.71 ? 147 PRO A CB    1 
ATOM   1065  C CG    . PRO A 1 147 ? 11.678  -33.508 258.484 1.00 117.35 ? 147 PRO A CG    1 
ATOM   1066  C CD    . PRO A 1 147 ? 11.552  -34.895 259.060 1.00 117.37 ? 147 PRO A CD    1 
ATOM   1067  N N     . GLU A 1 148 ? 14.255  -35.004 257.023 1.00 120.49 ? 148 GLU A N     1 
ATOM   1068  C CA    . GLU A 1 148 ? 15.662  -34.853 256.663 1.00 122.48 ? 148 GLU A CA    1 
ATOM   1069  C C     . GLU A 1 148 ? 16.256  -36.138 256.086 1.00 116.87 ? 148 GLU A C     1 
ATOM   1070  O O     . GLU A 1 148 ? 15.853  -37.242 256.454 1.00 122.82 ? 148 GLU A O     1 
ATOM   1071  C CB    . GLU A 1 148 ? 16.478  -34.399 257.879 1.00 130.87 ? 148 GLU A CB    1 
ATOM   1072  C CG    . GLU A 1 148 ? 16.886  -35.521 258.832 1.00 137.75 ? 148 GLU A CG    1 
ATOM   1073  C CD    . GLU A 1 148 ? 15.699  -36.273 259.411 1.00 141.19 ? 148 GLU A CD    1 
ATOM   1074  O OE1   . GLU A 1 148 ? 14.688  -35.625 259.755 1.00 143.98 ? 148 GLU A OE1   1 
ATOM   1075  O OE2   . GLU A 1 148 ? 15.777  -37.517 259.517 1.00 138.07 ? 148 GLU A OE2   1 
ATOM   1076  N N     . ALA A 1 149 ? 17.212  -35.985 255.174 1.00 105.28 ? 149 ALA A N     1 
ATOM   1077  C CA    . ALA A 1 149 ? 17.930  -37.124 254.616 1.00 96.88  ? 149 ALA A CA    1 
ATOM   1078  C C     . ALA A 1 149 ? 19.081  -37.502 255.537 1.00 102.51 ? 149 ALA A C     1 
ATOM   1079  O O     . ALA A 1 149 ? 19.548  -36.678 256.323 1.00 109.96 ? 149 ALA A O     1 
ATOM   1080  C CB    . ALA A 1 149 ? 18.454  -36.795 253.229 1.00 93.91  ? 149 ALA A CB    1 
ATOM   1081  N N     . ARG A 1 150 ? 19.539  -38.745 255.433 1.00 102.29 ? 150 ARG A N     1 
ATOM   1082  C CA    . ARG A 1 150 ? 20.631  -39.228 256.269 1.00 105.17 ? 150 ARG A CA    1 
ATOM   1083  C C     . ARG A 1 150 ? 21.234  -40.512 255.710 1.00 105.46 ? 150 ARG A C     1 
ATOM   1084  O O     . ARG A 1 150 ? 20.640  -41.166 254.853 1.00 101.06 ? 150 ARG A O     1 
ATOM   1085  C CB    . ARG A 1 150 ? 20.148  -39.452 257.704 1.00 104.48 ? 150 ARG A CB    1 
ATOM   1086  C CG    . ARG A 1 150 ? 18.871  -40.263 257.808 1.00 103.41 ? 150 ARG A CG    1 
ATOM   1087  C CD    . ARG A 1 150 ? 18.569  -40.646 259.250 1.00 106.69 ? 150 ARG A CD    1 
ATOM   1088  N NE    . ARG A 1 150 ? 17.456  -39.890 259.818 1.00 109.07 ? 150 ARG A NE    1 
ATOM   1089  C CZ    . ARG A 1 150 ? 16.967  -40.092 261.038 1.00 106.09 ? 150 ARG A CZ    1 
ATOM   1090  N NH1   . ARG A 1 150 ? 17.497  -41.027 261.817 1.00 103.43 ? 150 ARG A NH1   1 
ATOM   1091  N NH2   . ARG A 1 150 ? 15.950  -39.363 261.481 1.00 103.74 ? 150 ARG A NH2   1 
ATOM   1092  N N     . ARG A 1 151 ? 22.420  -40.863 256.200 1.00 108.87 ? 151 ARG A N     1 
ATOM   1093  C CA    . ARG A 1 151 ? 23.103  -42.077 255.769 1.00 105.64 ? 151 ARG A CA    1 
ATOM   1094  C C     . ARG A 1 151 ? 22.300  -43.304 256.183 1.00 97.94  ? 151 ARG A C     1 
ATOM   1095  O O     . ARG A 1 151 ? 21.484  -43.234 257.102 1.00 97.32  ? 151 ARG A O     1 
ATOM   1096  C CB    . ARG A 1 151 ? 24.508  -42.145 256.376 1.00 110.36 ? 151 ARG A CB    1 
ATOM   1097  C CG    . ARG A 1 151 ? 25.425  -40.976 256.023 1.00 115.00 ? 151 ARG A CG    1 
ATOM   1098  C CD    . ARG A 1 151 ? 26.641  -41.456 255.241 1.00 119.21 ? 151 ARG A CD    1 
ATOM   1099  N NE    . ARG A 1 151 ? 27.863  -40.726 255.575 1.00 126.05 ? 151 ARG A NE    1 
ATOM   1100  C CZ    . ARG A 1 151 ? 28.288  -39.638 254.939 1.00 131.91 ? 151 ARG A CZ    1 
ATOM   1101  N NH1   . ARG A 1 151 ? 27.585  -39.138 253.932 1.00 134.39 ? 151 ARG A NH1   1 
ATOM   1102  N NH2   . ARG A 1 151 ? 29.415  -39.046 255.313 1.00 133.39 ? 151 ARG A NH2   1 
ATOM   1103  N N     . LEU A 1 152 ? 22.531  -44.424 255.503 1.00 94.95  ? 152 LEU A N     1 
ATOM   1104  C CA    . LEU A 1 152 ? 21.841  -45.670 255.822 1.00 89.32  ? 152 LEU A CA    1 
ATOM   1105  C C     . LEU A 1 152 ? 22.159  -46.077 257.250 1.00 94.71  ? 152 LEU A C     1 
ATOM   1106  O O     . LEU A 1 152 ? 21.311  -46.615 257.961 1.00 97.75  ? 152 LEU A O     1 
ATOM   1107  C CB    . LEU A 1 152 ? 22.271  -46.782 254.867 1.00 83.84  ? 152 LEU A CB    1 
ATOM   1108  C CG    . LEU A 1 152 ? 21.180  -47.742 254.382 1.00 85.81  ? 152 LEU A CG    1 
ATOM   1109  C CD1   . LEU A 1 152 ? 21.770  -48.746 253.419 1.00 71.59  ? 152 LEU A CD1   1 
ATOM   1110  C CD2   . LEU A 1 152 ? 20.477  -48.459 255.529 1.00 92.13  ? 152 LEU A CD2   1 
ATOM   1111  N N     . ALA A 1 153 ? 23.391  -45.810 257.664 1.00 103.57 ? 153 ALA A N     1 
ATOM   1112  C CA    . ALA A 1 153 ? 23.829  -46.149 259.007 1.00 108.78 ? 153 ALA A CA    1 
ATOM   1113  C C     . ALA A 1 153 ? 23.047  -45.342 260.036 1.00 114.68 ? 153 ALA A C     1 
ATOM   1114  O O     . ALA A 1 153 ? 22.825  -45.798 261.157 1.00 121.95 ? 153 ALA A O     1 
ATOM   1115  C CB    . ALA A 1 153 ? 25.320  -45.907 259.152 1.00 107.07 ? 153 ALA A CB    1 
ATOM   1116  N N     . GLU A 1 154 ? 22.622  -44.146 259.641 1.00 113.39 ? 154 GLU A N     1 
ATOM   1117  C CA    . GLU A 1 154 ? 21.838  -43.283 260.515 1.00 116.03 ? 154 GLU A CA    1 
ATOM   1118  C C     . GLU A 1 154 ? 20.360  -43.669 260.514 1.00 111.64 ? 154 GLU A C     1 
ATOM   1119  O O     . GLU A 1 154 ? 19.640  -43.397 261.474 1.00 111.34 ? 154 GLU A O     1 
ATOM   1120  C CB    . GLU A 1 154 ? 22.026  -41.816 260.122 1.00 121.66 ? 154 GLU A CB    1 
ATOM   1121  C CG    . GLU A 1 154 ? 23.446  -41.315 260.345 1.00 126.53 ? 154 GLU A CG    1 
ATOM   1122  C CD    . GLU A 1 154 ? 23.659  -39.902 259.843 1.00 133.31 ? 154 GLU A CD    1 
ATOM   1123  O OE1   . GLU A 1 154 ? 23.165  -39.581 258.743 1.00 133.92 ? 154 GLU A OE1   1 
ATOM   1124  O OE2   . GLU A 1 154 ? 24.323  -39.112 260.548 1.00 137.84 ? 154 GLU A OE2   1 
ATOM   1125  N N     . TRP A 1 155 ? 19.911  -44.305 259.436 1.00 109.03 ? 155 TRP A N     1 
ATOM   1126  C CA    . TRP A 1 155 ? 18.553  -44.834 259.380 1.00 102.37 ? 155 TRP A CA    1 
ATOM   1127  C C     . TRP A 1 155 ? 18.477  -46.098 260.220 1.00 103.82 ? 155 TRP A C     1 
ATOM   1128  O O     . TRP A 1 155 ? 17.678  -46.198 261.153 1.00 97.69  ? 155 TRP A O     1 
ATOM   1129  C CB    . TRP A 1 155 ? 18.148  -45.158 257.940 1.00 90.45  ? 155 TRP A CB    1 
ATOM   1130  C CG    . TRP A 1 155 ? 17.697  -43.972 257.149 1.00 84.26  ? 155 TRP A CG    1 
ATOM   1131  C CD1   . TRP A 1 155 ? 18.279  -43.468 256.024 1.00 81.98  ? 155 TRP A CD1   1 
ATOM   1132  C CD2   . TRP A 1 155 ? 16.566  -43.136 257.425 1.00 83.46  ? 155 TRP A CD2   1 
ATOM   1133  N NE1   . TRP A 1 155 ? 17.580  -42.372 255.579 1.00 82.05  ? 155 TRP A NE1   1 
ATOM   1134  C CE2   . TRP A 1 155 ? 16.522  -42.149 256.421 1.00 83.27  ? 155 TRP A CE2   1 
ATOM   1135  C CE3   . TRP A 1 155 ? 15.584  -43.132 258.420 1.00 85.13  ? 155 TRP A CE3   1 
ATOM   1136  C CZ2   . TRP A 1 155 ? 15.538  -41.162 256.387 1.00 85.78  ? 155 TRP A CZ2   1 
ATOM   1137  C CZ3   . TRP A 1 155 ? 14.606  -42.153 258.384 1.00 89.27  ? 155 TRP A CZ3   1 
ATOM   1138  C CH2   . TRP A 1 155 ? 14.591  -41.182 257.374 1.00 89.35  ? 155 TRP A CH2   1 
ATOM   1139  N N     . GLN A 1 156 ? 19.324  -47.059 259.868 1.00 113.37 ? 156 GLN A N     1 
ATOM   1140  C CA    . GLN A 1 156 ? 19.408  -48.333 260.565 1.00 121.46 ? 156 GLN A CA    1 
ATOM   1141  C C     . GLN A 1 156 ? 20.867  -48.751 260.700 1.00 129.96 ? 156 GLN A C     1 
ATOM   1142  O O     . GLN A 1 156 ? 21.496  -49.160 259.723 1.00 133.26 ? 156 GLN A O     1 
ATOM   1143  C CB    . GLN A 1 156 ? 18.631  -49.410 259.803 1.00 120.13 ? 156 GLN A CB    1 
ATOM   1144  C CG    . GLN A 1 156 ? 18.787  -50.817 260.366 1.00 124.52 ? 156 GLN A CG    1 
ATOM   1145  C CD    . GLN A 1 156 ? 18.049  -51.862 259.545 1.00 129.59 ? 156 GLN A CD    1 
ATOM   1146  O OE1   . GLN A 1 156 ? 17.034  -51.568 258.913 1.00 131.59 ? 156 GLN A OE1   1 
ATOM   1147  N NE2   . GLN A 1 156 ? 18.561  -53.089 259.549 1.00 130.60 ? 156 GLN A NE2   1 
ATOM   1148  N N     . ALA A 1 157 ? 21.402  -48.643 261.913 1.00 133.43 ? 157 ALA A N     1 
ATOM   1149  C CA    . ALA A 1 157 ? 22.779  -49.044 262.187 1.00 136.82 ? 157 ALA A CA    1 
ATOM   1150  C C     . ALA A 1 157 ? 22.960  -50.552 262.031 1.00 140.30 ? 157 ALA A C     1 
ATOM   1151  O O     . ALA A 1 157 ? 24.071  -51.036 261.805 1.00 140.00 ? 157 ALA A O     1 
ATOM   1152  C CB    . ALA A 1 157 ? 23.189  -48.602 263.587 1.00 138.22 ? 157 ALA A CB    1 
ATOM   1153  N N     . ASP A 1 158 ? 21.858  -51.288 262.145 1.00 143.76 ? 158 ASP A N     1 
ATOM   1154  C CA    . ASP A 1 158 ? 21.886  -52.746 262.096 1.00 145.95 ? 158 ASP A CA    1 
ATOM   1155  C C     . ASP A 1 158 ? 21.957  -53.271 260.662 1.00 142.62 ? 158 ASP A C     1 
ATOM   1156  O O     . ASP A 1 158 ? 22.094  -54.474 260.440 1.00 143.89 ? 158 ASP A O     1 
ATOM   1157  C CB    . ASP A 1 158 ? 20.655  -53.321 262.806 1.00 149.66 ? 158 ASP A CB    1 
ATOM   1158  C CG    . ASP A 1 158 ? 20.848  -54.763 263.241 1.00 154.76 ? 158 ASP A CG    1 
ATOM   1159  O OD1   . ASP A 1 158 ? 21.331  -54.982 264.372 1.00 156.33 ? 158 ASP A OD1   1 
ATOM   1160  O OD2   . ASP A 1 158 ? 20.514  -55.676 262.456 1.00 156.19 ? 158 ASP A OD2   1 
ATOM   1161  N N     . PHE A 1 159 ? 21.865  -52.365 259.692 1.00 136.10 ? 159 PHE A N     1 
ATOM   1162  C CA    . PHE A 1 159 ? 21.861  -52.746 258.283 1.00 127.47 ? 159 PHE A CA    1 
ATOM   1163  C C     . PHE A 1 159 ? 23.227  -53.287 257.872 1.00 123.19 ? 159 PHE A C     1 
ATOM   1164  O O     . PHE A 1 159 ? 24.249  -52.638 258.085 1.00 122.17 ? 159 PHE A O     1 
ATOM   1165  C CB    . PHE A 1 159 ? 21.468  -51.553 257.409 1.00 128.38 ? 159 PHE A CB    1 
ATOM   1166  C CG    . PHE A 1 159 ? 20.800  -51.940 256.121 1.00 130.68 ? 159 PHE A CG    1 
ATOM   1167  C CD1   . PHE A 1 159 ? 19.465  -52.310 256.103 1.00 131.49 ? 159 PHE A CD1   1 
ATOM   1168  C CD2   . PHE A 1 159 ? 21.502  -51.931 254.929 1.00 129.15 ? 159 PHE A CD2   1 
ATOM   1169  C CE1   . PHE A 1 159 ? 18.846  -52.668 254.921 1.00 127.31 ? 159 PHE A CE1   1 
ATOM   1170  C CE2   . PHE A 1 159 ? 20.888  -52.286 253.743 1.00 126.88 ? 159 PHE A CE2   1 
ATOM   1171  C CZ    . PHE A 1 159 ? 19.558  -52.656 253.740 1.00 126.08 ? 159 PHE A CZ    1 
ATOM   1172  N N     . ALA A 1 160 ? 23.237  -54.480 257.285 1.00 124.10 ? 160 ALA A N     1 
ATOM   1173  C CA    . ALA A 1 160 ? 24.486  -55.169 256.972 1.00 124.82 ? 160 ALA A CA    1 
ATOM   1174  C C     . ALA A 1 160 ? 24.811  -55.160 255.481 1.00 120.31 ? 160 ALA A C     1 
ATOM   1175  O O     . ALA A 1 160 ? 25.916  -55.520 255.074 1.00 126.91 ? 160 ALA A O     1 
ATOM   1176  C CB    . ALA A 1 160 ? 24.449  -56.596 257.502 1.00 127.62 ? 160 ALA A CB    1 
ATOM   1177  N N     . GLU A 1 161 ? 23.846  -54.753 254.666 1.00 111.82 ? 161 GLU A N     1 
ATOM   1178  C CA    . GLU A 1 161 ? 24.083  -54.619 253.236 1.00 107.43 ? 161 GLU A CA    1 
ATOM   1179  C C     . GLU A 1 161 ? 24.600  -53.235 252.889 1.00 102.92 ? 161 GLU A C     1 
ATOM   1180  O O     . GLU A 1 161 ? 24.058  -52.231 253.345 1.00 108.22 ? 161 GLU A O     1 
ATOM   1181  C CB    . GLU A 1 161 ? 22.808  -54.884 252.438 1.00 110.26 ? 161 GLU A CB    1 
ATOM   1182  C CG    . GLU A 1 161 ? 22.616  -56.327 252.030 1.00 114.66 ? 161 GLU A CG    1 
ATOM   1183  C CD    . GLU A 1 161 ? 21.732  -56.457 250.809 1.00 116.01 ? 161 GLU A CD    1 
ATOM   1184  O OE1   . GLU A 1 161 ? 20.931  -57.411 250.753 1.00 122.93 ? 161 GLU A OE1   1 
ATOM   1185  O OE2   . GLU A 1 161 ? 21.844  -55.606 249.902 1.00 111.66 ? 161 GLU A OE2   1 
ATOM   1186  N N     . PRO A 1 162 ? 25.656  -53.173 252.072 1.00 92.36  ? 162 PRO A N     1 
ATOM   1187  C CA    . PRO A 1 162 ? 26.016  -51.860 251.539 1.00 89.98  ? 162 PRO A CA    1 
ATOM   1188  C C     . PRO A 1 162 ? 25.050  -51.457 250.425 1.00 89.32  ? 162 PRO A C     1 
ATOM   1189  O O     . PRO A 1 162 ? 24.601  -52.312 249.653 1.00 81.75  ? 162 PRO A O     1 
ATOM   1190  C CB    . PRO A 1 162 ? 27.413  -52.093 250.966 1.00 88.04  ? 162 PRO A CB    1 
ATOM   1191  C CG    . PRO A 1 162 ? 27.412  -53.534 250.582 1.00 83.86  ? 162 PRO A CG    1 
ATOM   1192  C CD    . PRO A 1 162 ? 26.587  -54.228 251.633 1.00 84.58  ? 162 PRO A CD    1 
ATOM   1193  N N     . VAL A 1 163 ? 24.723  -50.168 250.363 1.00 92.81  ? 163 VAL A N     1 
ATOM   1194  C CA    . VAL A 1 163 ? 23.924  -49.618 249.271 1.00 85.75  ? 163 VAL A CA    1 
ATOM   1195  C C     . VAL A 1 163 ? 24.764  -48.649 248.445 1.00 86.63  ? 163 VAL A C     1 
ATOM   1196  O O     . VAL A 1 163 ? 25.263  -47.644 248.960 1.00 95.67  ? 163 VAL A O     1 
ATOM   1197  C CB    . VAL A 1 163 ? 22.652  -48.912 249.783 1.00 81.07  ? 163 VAL A CB    1 
ATOM   1198  C CG1   . VAL A 1 163 ? 22.132  -47.916 248.762 1.00 82.36  ? 163 VAL A CG1   1 
ATOM   1199  C CG2   . VAL A 1 163 ? 21.580  -49.935 250.100 1.00 84.41  ? 163 VAL A CG2   1 
ATOM   1200  N N     . TYR A 1 164 ? 24.927  -48.965 247.163 1.00 79.81  ? 164 TYR A N     1 
ATOM   1201  C CA    . TYR A 1 164 ? 25.787  -48.182 246.275 1.00 79.00  ? 164 TYR A CA    1 
ATOM   1202  C C     . TYR A 1 164 ? 25.008  -47.142 245.461 1.00 81.84  ? 164 TYR A C     1 
ATOM   1203  O O     . TYR A 1 164 ? 23.981  -47.475 244.845 1.00 76.42  ? 164 TYR A O     1 
ATOM   1204  C CB    . TYR A 1 164 ? 26.557  -49.115 245.333 1.00 74.70  ? 164 TYR A CB    1 
ATOM   1205  C CG    . TYR A 1 164 ? 27.390  -50.150 246.051 1.00 75.56  ? 164 TYR A CG    1 
ATOM   1206  C CD1   . TYR A 1 164 ? 28.456  -49.772 246.856 1.00 82.09  ? 164 TYR A CD1   1 
ATOM   1207  C CD2   . TYR A 1 164 ? 27.115  -51.505 245.922 1.00 73.57  ? 164 TYR A CD2   1 
ATOM   1208  C CE1   . TYR A 1 164 ? 29.222  -50.715 247.516 1.00 81.95  ? 164 TYR A CE1   1 
ATOM   1209  C CE2   . TYR A 1 164 ? 27.874  -52.455 246.578 1.00 75.31  ? 164 TYR A CE2   1 
ATOM   1210  C CZ    . TYR A 1 164 ? 28.927  -52.055 247.373 1.00 79.77  ? 164 TYR A CZ    1 
ATOM   1211  O OH    . TYR A 1 164 ? 29.688  -52.994 248.029 1.00 81.26  ? 164 TYR A OH    1 
ATOM   1212  N N     . GLU A 1 165 ? 25.494  -45.898 245.463 1.00 86.00  ? 165 GLU A N     1 
ATOM   1213  C CA    . GLU A 1 165 ? 24.868  -44.834 244.695 1.00 90.35  ? 165 GLU A CA    1 
ATOM   1214  C C     . GLU A 1 165 ? 25.685  -44.485 243.466 1.00 89.07  ? 165 GLU A C     1 
ATOM   1215  O O     . GLU A 1 165 ? 26.867  -44.181 243.566 1.00 93.31  ? 165 GLU A O     1 
ATOM   1216  C CB    . GLU A 1 165 ? 24.673  -43.595 245.563 1.00 99.41  ? 165 GLU A CB    1 
ATOM   1217  C CG    . GLU A 1 165 ? 24.331  -42.337 244.762 1.00 104.58 ? 165 GLU A CG    1 
ATOM   1218  C CD    . GLU A 1 165 ? 23.872  -41.191 245.638 1.00 107.47 ? 165 GLU A CD    1 
ATOM   1219  O OE1   . GLU A 1 165 ? 22.707  -40.765 245.491 1.00 107.01 ? 165 GLU A OE1   1 
ATOM   1220  O OE2   . GLU A 1 165 ? 24.670  -40.724 246.478 1.00 106.73 ? 165 GLU A OE2   1 
ATOM   1221  N N     . LEU A 1 166 ? 25.044  -44.522 242.305 1.00 79.87  ? 166 LEU A N     1 
ATOM   1222  C CA    . LEU A 1 166 ? 25.713  -44.185 241.058 1.00 74.66  ? 166 LEU A CA    1 
ATOM   1223  C C     . LEU A 1 166 ? 25.793  -42.677 240.925 1.00 79.38  ? 166 LEU A C     1 
ATOM   1224  O O     . LEU A 1 166 ? 24.766  -41.997 240.992 1.00 74.55  ? 166 LEU A O     1 
ATOM   1225  C CB    . LEU A 1 166 ? 24.967  -44.789 239.874 1.00 69.38  ? 166 LEU A CB    1 
ATOM   1226  C CG    . LEU A 1 166 ? 25.646  -44.584 238.524 1.00 77.23  ? 166 LEU A CG    1 
ATOM   1227  C CD1   . LEU A 1 166 ? 27.103  -45.059 238.543 1.00 79.73  ? 166 LEU A CD1   1 
ATOM   1228  C CD2   . LEU A 1 166 ? 24.843  -45.292 237.447 1.00 74.40  ? 166 LEU A CD2   1 
ATOM   1229  N N     . ARG A 1 167 ? 27.003  -42.155 240.741 1.00 83.93  ? 167 ARG A N     1 
ATOM   1230  C CA    . ARG A 1 167 ? 27.200  -40.716 240.825 1.00 81.43  ? 167 ARG A CA    1 
ATOM   1231  C C     . ARG A 1 167 ? 27.594  -40.085 239.493 1.00 81.76  ? 167 ARG A C     1 
ATOM   1232  O O     . ARG A 1 167 ? 27.875  -38.890 239.421 1.00 81.83  ? 167 ARG A O     1 
ATOM   1233  C CB    . ARG A 1 167 ? 28.228  -40.398 241.906 1.00 79.82  ? 167 ARG A CB    1 
ATOM   1234  C CG    . ARG A 1 167 ? 27.701  -39.517 243.028 1.00 95.78  ? 167 ARG A CG    1 
ATOM   1235  C CD    . ARG A 1 167 ? 28.679  -39.472 244.189 1.00 114.67 ? 167 ARG A CD    1 
ATOM   1236  N NE    . ARG A 1 167 ? 28.531  -38.265 245.000 1.00 129.90 ? 167 ARG A NE    1 
ATOM   1237  C CZ    . ARG A 1 167 ? 27.604  -38.097 245.938 1.00 138.33 ? 167 ARG A CZ    1 
ATOM   1238  N NH1   . ARG A 1 167 ? 26.718  -39.053 246.184 1.00 134.72 ? 167 ARG A NH1   1 
ATOM   1239  N NH2   . ARG A 1 167 ? 27.557  -36.965 246.627 1.00 144.18 ? 167 ARG A NH2   1 
ATOM   1240  N N     . CYS A 1 168 ? 27.594  -40.891 238.436 1.00 84.18  ? 168 CYS A N     1 
ATOM   1241  C CA    . CYS A 1 168 ? 27.978  -40.410 237.115 1.00 85.74  ? 168 CYS A CA    1 
ATOM   1242  C C     . CYS A 1 168 ? 26.862  -40.598 236.082 1.00 90.44  ? 168 CYS A C     1 
ATOM   1243  O O     . CYS A 1 168 ? 27.124  -40.811 234.900 1.00 91.21  ? 168 CYS A O     1 
ATOM   1244  C CB    . CYS A 1 168 ? 29.255  -41.112 236.653 1.00 81.46  ? 168 CYS A CB    1 
ATOM   1245  S SG    . CYS A 1 168 ? 29.057  -42.877 236.352 1.00 109.41 ? 168 CYS A SG    1 
ATOM   1246  N N     . MET A 1 169 ? 25.617  -40.498 236.533 1.00 93.14  ? 169 MET A N     1 
ATOM   1247  C CA    . MET A 1 169 ? 24.467  -40.739 235.666 1.00 92.26  ? 169 MET A CA    1 
ATOM   1248  C C     . MET A 1 169 ? 24.219  -39.602 234.669 1.00 91.05  ? 169 MET A C     1 
ATOM   1249  O O     . MET A 1 169 ? 23.832  -39.847 233.527 1.00 89.69  ? 169 MET A O     1 
ATOM   1250  C CB    . MET A 1 169 ? 23.214  -41.004 236.507 1.00 90.89  ? 169 MET A CB    1 
ATOM   1251  C CG    . MET A 1 169 ? 22.069  -41.619 235.726 1.00 90.00  ? 169 MET A CG    1 
ATOM   1252  S SD    . MET A 1 169 ? 22.557  -43.142 234.900 1.00 85.81  ? 169 MET A SD    1 
ATOM   1253  C CE    . MET A 1 169 ? 21.495  -44.332 235.721 1.00 188.70 ? 169 MET A CE    1 
ATOM   1254  N N     . ALA A 1 170 ? 24.444  -38.365 235.101 1.00 91.16  ? 170 ALA A N     1 
ATOM   1255  C CA    . ALA A 1 170 ? 24.245  -37.203 234.235 1.00 84.93  ? 170 ALA A CA    1 
ATOM   1256  C C     . ALA A 1 170 ? 25.163  -37.218 233.013 1.00 85.19  ? 170 ALA A C     1 
ATOM   1257  O O     . ALA A 1 170 ? 24.737  -36.900 231.903 1.00 83.89  ? 170 ALA A O     1 
ATOM   1258  C CB    . ALA A 1 170 ? 24.434  -35.917 235.022 1.00 75.85  ? 170 ALA A CB    1 
ATOM   1259  N N     . LEU A 1 171 ? 26.422  -37.586 233.226 1.00 91.07  ? 171 LEU A N     1 
ATOM   1260  C CA    . LEU A 1 171 ? 27.402  -37.656 232.146 1.00 94.14  ? 171 LEU A CA    1 
ATOM   1261  C C     . LEU A 1 171 ? 26.980  -38.713 231.135 1.00 95.92  ? 171 LEU A C     1 
ATOM   1262  O O     . LEU A 1 171 ? 27.151  -38.539 229.928 1.00 97.34  ? 171 LEU A O     1 
ATOM   1263  C CB    . LEU A 1 171 ? 28.789  -37.991 232.708 1.00 93.84  ? 171 LEU A CB    1 
ATOM   1264  C CG    . LEU A 1 171 ? 30.057  -37.699 231.894 1.00 93.70  ? 171 LEU A CG    1 
ATOM   1265  C CD1   . LEU A 1 171 ? 31.251  -37.584 232.831 1.00 96.76  ? 171 LEU A CD1   1 
ATOM   1266  C CD2   . LEU A 1 171 ? 30.326  -38.761 230.836 1.00 87.64  ? 171 LEU A CD2   1 
ATOM   1267  N N     . CYS A 1 172 ? 26.426  -39.809 231.639 1.00 94.16  ? 172 CYS A N     1 
ATOM   1268  C CA    . CYS A 1 172 ? 26.021  -40.916 230.788 1.00 97.13  ? 172 CYS A CA    1 
ATOM   1269  C C     . CYS A 1 172 ? 24.811  -40.559 229.931 1.00 98.38  ? 172 CYS A C     1 
ATOM   1270  O O     . CYS A 1 172 ? 24.717  -40.985 228.780 1.00 100.85 ? 172 CYS A O     1 
ATOM   1271  C CB    . CYS A 1 172 ? 25.747  -42.163 231.627 1.00 99.13  ? 172 CYS A CB    1 
ATOM   1272  S SG    . CYS A 1 172 ? 27.218  -42.811 232.447 1.00 94.05  ? 172 CYS A SG    1 
ATOM   1273  N N     . ASP A 1 173 ? 23.893  -39.772 230.487 1.00 96.57  ? 173 ASP A N     1 
ATOM   1274  C CA    . ASP A 1 173 ? 22.727  -39.322 229.732 1.00 93.74  ? 173 ASP A CA    1 
ATOM   1275  C C     . ASP A 1 173 ? 23.149  -38.443 228.564 1.00 95.48  ? 173 ASP A C     1 
ATOM   1276  O O     . ASP A 1 173 ? 22.620  -38.563 227.460 1.00 98.40  ? 173 ASP A O     1 
ATOM   1277  C CB    . ASP A 1 173 ? 21.741  -38.571 230.630 1.00 92.36  ? 173 ASP A CB    1 
ATOM   1278  C CG    . ASP A 1 173 ? 20.979  -39.496 231.557 1.00 97.89  ? 173 ASP A CG    1 
ATOM   1279  O OD1   . ASP A 1 173 ? 20.821  -40.684 231.204 1.00 100.15 ? 173 ASP A OD1   1 
ATOM   1280  O OD2   . ASP A 1 173 ? 20.539  -39.040 232.634 1.00 99.22  ? 173 ASP A OD2   1 
ATOM   1281  N N     . ARG A 1 174 ? 24.107  -37.560 228.818 1.00 93.70  ? 174 ARG A N     1 
ATOM   1282  C CA    . ARG A 1 174 ? 24.642  -36.695 227.778 1.00 93.75  ? 174 ARG A CA    1 
ATOM   1283  C C     . ARG A 1 174 ? 25.298  -37.517 226.675 1.00 95.15  ? 174 ARG A C     1 
ATOM   1284  O O     . ARG A 1 174 ? 25.156  -37.211 225.490 1.00 99.46  ? 174 ARG A O     1 
ATOM   1285  C CB    . ARG A 1 174 ? 25.653  -35.723 228.375 1.00 93.04  ? 174 ARG A CB    1 
ATOM   1286  C CG    . ARG A 1 174 ? 26.430  -34.939 227.342 1.00 94.42  ? 174 ARG A CG    1 
ATOM   1287  C CD    . ARG A 1 174 ? 27.406  -34.006 228.015 1.00 96.30  ? 174 ARG A CD    1 
ATOM   1288  N NE    . ARG A 1 174 ? 26.713  -32.920 228.698 1.00 99.62  ? 174 ARG A NE    1 
ATOM   1289  C CZ    . ARG A 1 174 ? 26.478  -31.733 228.150 1.00 101.55 ? 174 ARG A CZ    1 
ATOM   1290  N NH1   . ARG A 1 174 ? 26.891  -31.482 226.914 1.00 100.02 ? 174 ARG A NH1   1 
ATOM   1291  N NH2   . ARG A 1 174 ? 25.837  -30.797 228.838 1.00 100.13 ? 174 ARG A NH2   1 
ATOM   1292  N N     . LEU A 1 175 ? 26.020  -38.558 227.078 1.00 92.15  ? 175 LEU A N     1 
ATOM   1293  C CA    . LEU A 1 175 ? 26.639  -39.486 226.140 1.00 90.54  ? 175 LEU A CA    1 
ATOM   1294  C C     . LEU A 1 175 ? 25.580  -40.141 225.266 1.00 89.91  ? 175 LEU A C     1 
ATOM   1295  O O     . LEU A 1 175 ? 25.736  -40.250 224.049 1.00 90.74  ? 175 LEU A O     1 
ATOM   1296  C CB    . LEU A 1 175 ? 27.410  -40.562 226.904 1.00 86.56  ? 175 LEU A CB    1 
ATOM   1297  C CG    . LEU A 1 175 ? 28.934  -40.463 226.920 1.00 88.29  ? 175 LEU A CG    1 
ATOM   1298  C CD1   . LEU A 1 175 ? 29.380  -39.020 226.845 1.00 94.20  ? 175 LEU A CD1   1 
ATOM   1299  C CD2   . LEU A 1 175 ? 29.464  -41.109 228.183 1.00 85.96  ? 175 LEU A CD2   1 
ATOM   1300  N N     . ARG A 1 176 ? 24.497  -40.571 225.905 1.00 87.20  ? 176 ARG A N     1 
ATOM   1301  C CA    . ARG A 1 176 ? 23.395  -41.223 225.212 1.00 87.61  ? 176 ARG A CA    1 
ATOM   1302  C C     . ARG A 1 176 ? 22.649  -40.229 224.321 1.00 96.95  ? 176 ARG A C     1 
ATOM   1303  O O     . ARG A 1 176 ? 22.260  -40.558 223.200 1.00 98.85  ? 176 ARG A O     1 
ATOM   1304  C CB    . ARG A 1 176 ? 22.448  -41.884 226.226 1.00 82.43  ? 176 ARG A CB    1 
ATOM   1305  C CG    . ARG A 1 176 ? 21.314  -42.698 225.606 1.00 87.64  ? 176 ARG A CG    1 
ATOM   1306  C CD    . ARG A 1 176 ? 20.602  -43.577 226.639 1.00 85.56  ? 176 ARG A CD    1 
ATOM   1307  N NE    . ARG A 1 176 ? 20.227  -42.843 227.846 1.00 83.20  ? 176 ARG A NE    1 
ATOM   1308  C CZ    . ARG A 1 176 ? 19.058  -42.233 228.024 1.00 78.38  ? 176 ARG A CZ    1 
ATOM   1309  N NH1   . ARG A 1 176 ? 18.137  -42.260 227.070 1.00 77.19  ? 176 ARG A NH1   1 
ATOM   1310  N NH2   . ARG A 1 176 ? 18.811  -41.590 229.158 1.00 76.48  ? 176 ARG A NH2   1 
ATOM   1311  N N     . LEU A 1 177 ? 22.471  -39.008 224.822 1.00 98.30  ? 177 LEU A N     1 
ATOM   1312  C CA    . LEU A 1 177 ? 21.767  -37.957 224.089 1.00 92.19  ? 177 LEU A CA    1 
ATOM   1313  C C     . LEU A 1 177 ? 22.546  -37.532 222.847 1.00 90.51  ? 177 LEU A C     1 
ATOM   1314  O O     . LEU A 1 177 ? 21.978  -37.015 221.884 1.00 93.78  ? 177 LEU A O     1 
ATOM   1315  C CB    . LEU A 1 177 ? 21.521  -36.753 225.004 1.00 92.05  ? 177 LEU A CB    1 
ATOM   1316  C CG    . LEU A 1 177 ? 20.987  -35.468 224.367 1.00 94.47  ? 177 LEU A CG    1 
ATOM   1317  C CD1   . LEU A 1 177 ? 19.621  -35.696 223.736 1.00 95.29  ? 177 LEU A CD1   1 
ATOM   1318  C CD2   . LEU A 1 177 ? 20.937  -34.341 225.384 1.00 95.54  ? 177 LEU A CD2   1 
ATOM   1319  N N     . MET A 1 178 ? 23.856  -37.757 222.880 1.00 90.43  ? 178 MET A N     1 
ATOM   1320  C CA    . MET A 1 178 ? 24.718  -37.446 221.747 1.00 93.34  ? 178 MET A CA    1 
ATOM   1321  C C     . MET A 1 178 ? 24.732  -38.582 220.725 1.00 93.41  ? 178 MET A C     1 
ATOM   1322  O O     . MET A 1 178 ? 24.876  -38.342 219.525 1.00 95.14  ? 178 MET A O     1 
ATOM   1323  C CB    . MET A 1 178 ? 26.143  -37.126 222.216 1.00 96.55  ? 178 MET A CB    1 
ATOM   1324  C CG    . MET A 1 178 ? 26.305  -35.756 222.870 1.00 99.34  ? 178 MET A CG    1 
ATOM   1325  S SD    . MET A 1 178 ? 27.994  -35.427 223.428 1.00 107.14 ? 178 MET A SD    1 
ATOM   1326  C CE    . MET A 1 178 ? 27.848  -33.721 223.964 1.00 111.78 ? 178 MET A CE    1 
ATOM   1327  N N     . TYR A 1 179 ? 24.577  -39.817 221.200 1.00 93.23  ? 179 TYR A N     1 
ATOM   1328  C CA    . TYR A 1 179 ? 24.528  -40.974 220.307 1.00 94.03  ? 179 TYR A CA    1 
ATOM   1329  C C     . TYR A 1 179 ? 23.253  -40.978 219.458 1.00 97.31  ? 179 TYR A C     1 
ATOM   1330  O O     . TYR A 1 179 ? 23.293  -40.620 218.280 1.00 103.63 ? 179 TYR A O     1 
ATOM   1331  C CB    . TYR A 1 179 ? 24.665  -42.284 221.083 1.00 89.06  ? 179 TYR A CB    1 
ATOM   1332  C CG    . TYR A 1 179 ? 24.857  -43.475 220.178 1.00 86.76  ? 179 TYR A CG    1 
ATOM   1333  C CD1   . TYR A 1 179 ? 26.087  -43.728 219.589 1.00 90.10  ? 179 TYR A CD1   1 
ATOM   1334  C CD2   . TYR A 1 179 ? 23.806  -44.337 219.902 1.00 87.04  ? 179 TYR A CD2   1 
ATOM   1335  C CE1   . TYR A 1 179 ? 26.268  -44.812 218.752 1.00 96.87  ? 179 TYR A CE1   1 
ATOM   1336  C CE2   . TYR A 1 179 ? 23.976  -45.424 219.069 1.00 91.30  ? 179 TYR A CE2   1 
ATOM   1337  C CZ    . TYR A 1 179 ? 25.208  -45.657 218.495 1.00 96.21  ? 179 TYR A CZ    1 
ATOM   1338  O OH    . TYR A 1 179 ? 25.380  -46.739 217.663 1.00 98.74  ? 179 TYR A OH    1 
ATOM   1339  N N     . PHE A 1 180 ? 22.133  -41.396 220.047 1.00 94.39  ? 180 PHE A N     1 
ATOM   1340  C CA    . PHE A 1 180 ? 20.827  -41.159 219.439 1.00 96.69  ? 180 PHE A CA    1 
ATOM   1341  C C     . PHE A 1 180 ? 20.582  -39.670 219.563 1.00 99.37  ? 180 PHE A C     1 
ATOM   1342  O O     . PHE A 1 180 ? 20.997  -39.072 220.546 1.00 109.10 ? 180 PHE A O     1 
ATOM   1343  C CB    . PHE A 1 180 ? 19.714  -41.872 220.206 1.00 99.59  ? 180 PHE A CB    1 
ATOM   1344  C CG    . PHE A 1 180 ? 20.080  -43.238 220.699 1.00 96.70  ? 180 PHE A CG    1 
ATOM   1345  C CD1   . PHE A 1 180 ? 20.090  -44.317 219.835 1.00 91.96  ? 180 PHE A CD1   1 
ATOM   1346  C CD2   . PHE A 1 180 ? 20.385  -43.448 222.034 1.00 95.30  ? 180 PHE A CD2   1 
ATOM   1347  C CE1   . PHE A 1 180 ? 20.417  -45.577 220.285 1.00 88.86  ? 180 PHE A CE1   1 
ATOM   1348  C CE2   . PHE A 1 180 ? 20.710  -44.707 222.492 1.00 93.22  ? 180 PHE A CE2   1 
ATOM   1349  C CZ    . PHE A 1 180 ? 20.724  -45.774 221.615 1.00 91.83  ? 180 PHE A CZ    1 
ATOM   1350  N N     . GLY A 1 181 ? 19.888  -39.063 218.608 1.00 95.24  ? 181 GLY A N     1 
ATOM   1351  C CA    . GLY A 1 181 ? 19.634  -37.633 218.685 1.00 103.53 ? 181 GLY A CA    1 
ATOM   1352  C C     . GLY A 1 181 ? 18.591  -37.237 219.721 1.00 107.59 ? 181 GLY A C     1 
ATOM   1353  O O     . GLY A 1 181 ? 17.935  -36.206 219.585 1.00 113.26 ? 181 GLY A O     1 
ATOM   1354  N N     . ASN A 1 182 ? 18.447  -38.051 220.765 1.00 102.46 ? 182 ASN A N     1 
ATOM   1355  C CA    . ASN A 1 182 ? 17.398  -37.866 221.764 1.00 95.59  ? 182 ASN A CA    1 
ATOM   1356  C C     . ASN A 1 182 ? 17.699  -38.609 223.069 1.00 92.73  ? 182 ASN A C     1 
ATOM   1357  O O     . ASN A 1 182 ? 18.805  -39.112 223.262 1.00 101.02 ? 182 ASN A O     1 
ATOM   1358  C CB    . ASN A 1 182 ? 16.061  -38.343 221.201 1.00 87.77  ? 182 ASN A CB    1 
ATOM   1359  C CG    . ASN A 1 182 ? 16.064  -39.825 220.882 1.00 82.84  ? 182 ASN A CG    1 
ATOM   1360  O OD1   . ASN A 1 182 ? 15.811  -40.657 221.753 1.00 81.06  ? 182 ASN A OD1   1 
ATOM   1361  N ND2   . ASN A 1 182 ? 16.352  -40.164 219.630 1.00 82.56  ? 182 ASN A ND2   1 
ATOM   1362  N N     . LEU A 1 183 ? 16.714  -38.680 223.961 1.00 82.22  ? 183 LEU A N     1 
ATOM   1363  C CA    . LEU A 1 183 ? 16.874  -39.398 225.227 1.00 82.38  ? 183 LEU A CA    1 
ATOM   1364  C C     . LEU A 1 183 ? 15.800  -40.456 225.440 1.00 86.43  ? 183 LEU A C     1 
ATOM   1365  O O     . LEU A 1 183 ? 15.794  -41.137 226.466 1.00 87.86  ? 183 LEU A O     1 
ATOM   1366  C CB    . LEU A 1 183 ? 16.866  -38.433 226.415 1.00 83.43  ? 183 LEU A CB    1 
ATOM   1367  C CG    . LEU A 1 183 ? 18.153  -37.688 226.759 1.00 86.01  ? 183 LEU A CG    1 
ATOM   1368  C CD1   . LEU A 1 183 ? 17.855  -36.548 227.721 1.00 82.49  ? 183 LEU A CD1   1 
ATOM   1369  C CD2   . LEU A 1 183 ? 19.170  -38.645 227.357 1.00 84.69  ? 183 LEU A CD2   1 
ATOM   1370  N N     . TRP A 1 184 ? 14.885  -40.585 224.484 1.00 89.02  ? 184 TRP A N     1 
ATOM   1371  C CA    . TRP A 1 184 ? 13.817  -41.571 224.610 1.00 90.44  ? 184 TRP A CA    1 
ATOM   1372  C C     . TRP A 1 184 ? 14.295  -42.973 224.234 1.00 92.32  ? 184 TRP A C     1 
ATOM   1373  O O     . TRP A 1 184 ? 13.764  -43.972 224.722 1.00 97.55  ? 184 TRP A O     1 
ATOM   1374  C CB    . TRP A 1 184 ? 12.561  -41.155 223.829 1.00 99.04  ? 184 TRP A CB    1 
ATOM   1375  C CG    . TRP A 1 184 ? 12.701  -41.076 222.329 1.00 110.17 ? 184 TRP A CG    1 
ATOM   1376  C CD1   . TRP A 1 184 ? 12.919  -39.953 221.579 1.00 116.29 ? 184 TRP A CD1   1 
ATOM   1377  C CD2   . TRP A 1 184 ? 12.583  -42.161 221.399 1.00 113.94 ? 184 TRP A CD2   1 
ATOM   1378  N NE1   . TRP A 1 184 ? 12.965  -40.277 220.242 1.00 118.52 ? 184 TRP A NE1   1 
ATOM   1379  C CE2   . TRP A 1 184 ? 12.762  -41.625 220.105 1.00 116.76 ? 184 TRP A CE2   1 
ATOM   1380  C CE3   . TRP A 1 184 ? 12.353  -43.534 221.535 1.00 110.48 ? 184 TRP A CE3   1 
ATOM   1381  C CZ2   . TRP A 1 184 ? 12.719  -42.416 218.957 1.00 113.64 ? 184 TRP A CZ2   1 
ATOM   1382  C CZ3   . TRP A 1 184 ? 12.311  -44.316 220.396 1.00 110.75 ? 184 TRP A CZ3   1 
ATOM   1383  C CH2   . TRP A 1 184 ? 12.493  -43.755 219.122 1.00 112.14 ? 184 TRP A CH2   1 
ATOM   1384  N N     . GLN A 1 185 ? 15.311  -43.039 223.378 1.00 88.76  ? 185 GLN A N     1 
ATOM   1385  C CA    . GLN A 1 185 ? 15.957  -44.305 223.062 1.00 86.46  ? 185 GLN A CA    1 
ATOM   1386  C C     . GLN A 1 185 ? 17.011  -44.600 224.120 1.00 92.40  ? 185 GLN A C     1 
ATOM   1387  O O     . GLN A 1 185 ? 17.694  -43.691 224.588 1.00 100.65 ? 185 GLN A O     1 
ATOM   1388  C CB    . GLN A 1 185 ? 16.619  -44.254 221.682 1.00 83.23  ? 185 GLN A CB    1 
ATOM   1389  C CG    . GLN A 1 185 ? 15.729  -43.733 220.566 1.00 86.79  ? 185 GLN A CG    1 
ATOM   1390  C CD    . GLN A 1 185 ? 16.235  -44.133 219.192 1.00 87.43  ? 185 GLN A CD    1 
ATOM   1391  O OE1   . GLN A 1 185 ? 16.704  -43.297 218.420 1.00 89.29  ? 185 GLN A OE1   1 
ATOM   1392  N NE2   . GLN A 1 185 ? 16.143  -45.422 218.880 1.00 83.60  ? 185 GLN A NE2   1 
ATOM   1393  N N     . ASP A 1 186 ? 17.145  -45.865 224.504 1.00 94.25  ? 186 ASP A N     1 
ATOM   1394  C CA    . ASP A 1 186 ? 18.186  -46.244 225.454 1.00 98.97  ? 186 ASP A CA    1 
ATOM   1395  C C     . ASP A 1 186 ? 19.028  -47.401 224.931 1.00 100.74 ? 186 ASP A C     1 
ATOM   1396  O O     . ASP A 1 186 ? 18.943  -47.762 223.758 1.00 100.29 ? 186 ASP A O     1 
ATOM   1397  C CB    . ASP A 1 186 ? 17.599  -46.575 226.830 1.00 99.46  ? 186 ASP A CB    1 
ATOM   1398  C CG    . ASP A 1 186 ? 16.678  -47.778 226.801 1.00 105.10 ? 186 ASP A CG    1 
ATOM   1399  O OD1   . ASP A 1 186 ? 17.188  -48.919 226.804 1.00 102.21 ? 186 ASP A OD1   1 
ATOM   1400  O OD2   . ASP A 1 186 ? 15.444  -47.582 226.791 1.00 114.77 ? 186 ASP A OD2   1 
ATOM   1401  N N     . TRP A 1 187 ? 19.833  -47.989 225.808 1.00 102.39 ? 187 TRP A N     1 
ATOM   1402  C CA    . TRP A 1 187 ? 20.821  -48.977 225.386 1.00 97.33  ? 187 TRP A CA    1 
ATOM   1403  C C     . TRP A 1 187 ? 20.217  -50.324 224.981 1.00 91.44  ? 187 TRP A C     1 
ATOM   1404  O O     . TRP A 1 187 ? 20.942  -51.234 224.578 1.00 97.20  ? 187 TRP A O     1 
ATOM   1405  C CB    . TRP A 1 187 ? 21.875  -49.181 226.477 1.00 92.16  ? 187 TRP A CB    1 
ATOM   1406  C CG    . TRP A 1 187 ? 22.694  -47.960 226.779 1.00 98.86  ? 187 TRP A CG    1 
ATOM   1407  C CD1   . TRP A 1 187 ? 23.841  -47.561 226.150 1.00 105.33 ? 187 TRP A CD1   1 
ATOM   1408  C CD2   . TRP A 1 187 ? 22.435  -46.987 227.796 1.00 101.29 ? 187 TRP A CD2   1 
ATOM   1409  N NE1   . TRP A 1 187 ? 24.308  -46.396 226.711 1.00 101.19 ? 187 TRP A NE1   1 
ATOM   1410  C CE2   . TRP A 1 187 ? 23.463  -46.022 227.723 1.00 106.09 ? 187 TRP A CE2   1 
ATOM   1411  C CE3   . TRP A 1 187 ? 21.433  -46.834 228.760 1.00 100.43 ? 187 TRP A CE3   1 
ATOM   1412  C CZ2   . TRP A 1 187 ? 23.517  -44.923 228.578 1.00 112.05 ? 187 TRP A CZ2   1 
ATOM   1413  C CZ3   . TRP A 1 187 ? 21.490  -45.741 229.608 1.00 107.17 ? 187 TRP A CZ3   1 
ATOM   1414  C CH2   . TRP A 1 187 ? 22.524  -44.799 229.510 1.00 112.85 ? 187 TRP A CH2   1 
ATOM   1415  N N     . SER A 1 188 ? 18.898  -50.453 225.083 1.00 78.54  ? 188 SER A N     1 
ATOM   1416  C CA    . SER A 1 188 ? 18.241  -51.709 224.737 1.00 81.01  ? 188 SER A CA    1 
ATOM   1417  C C     . SER A 1 188 ? 17.999  -51.826 223.232 1.00 84.47  ? 188 SER A C     1 
ATOM   1418  O O     . SER A 1 188 ? 17.594  -52.879 222.738 1.00 87.28  ? 188 SER A O     1 
ATOM   1419  C CB    . SER A 1 188 ? 16.933  -51.877 225.518 1.00 82.43  ? 188 SER A CB    1 
ATOM   1420  O OG    . SER A 1 188 ? 15.929  -50.993 225.052 1.00 88.21  ? 188 SER A OG    1 
ATOM   1421  N N     . GLU A 1 189 ? 18.256  -50.742 222.505 1.00 85.51  ? 189 GLU A N     1 
ATOM   1422  C CA    . GLU A 1 189 ? 18.141  -50.754 221.050 1.00 88.74  ? 189 GLU A CA    1 
ATOM   1423  C C     . GLU A 1 189 ? 19.133  -51.746 220.457 1.00 97.06  ? 189 GLU A C     1 
ATOM   1424  O O     . GLU A 1 189 ? 18.804  -52.499 219.543 1.00 100.84 ? 189 GLU A O     1 
ATOM   1425  C CB    . GLU A 1 189 ? 18.409  -49.362 220.475 1.00 83.44  ? 189 GLU A CB    1 
ATOM   1426  C CG    . GLU A 1 189 ? 17.486  -48.277 221.002 1.00 87.29  ? 189 GLU A CG    1 
ATOM   1427  C CD    . GLU A 1 189 ? 16.118  -48.275 220.339 1.00 90.83  ? 189 GLU A CD    1 
ATOM   1428  O OE1   . GLU A 1 189 ? 16.042  -48.483 219.107 1.00 84.91  ? 189 GLU A OE1   1 
ATOM   1429  O OE2   . GLU A 1 189 ? 15.116  -48.056 221.055 1.00 96.30  ? 189 GLU A OE2   1 
ATOM   1430  N N     . PHE A 1 190 ? 20.349  -51.734 220.995 1.00 97.87  ? 190 PHE A N     1 
ATOM   1431  C CA    . PHE A 1 190 ? 21.410  -52.631 220.554 1.00 97.30  ? 190 PHE A CA    1 
ATOM   1432  C C     . PHE A 1 190 ? 20.999  -54.090 220.671 1.00 96.57  ? 190 PHE A C     1 
ATOM   1433  O O     . PHE A 1 190 ? 21.182  -54.870 219.737 1.00 98.88  ? 190 PHE A O     1 
ATOM   1434  C CB    . PHE A 1 190 ? 22.679  -52.395 221.368 1.00 94.77  ? 190 PHE A CB    1 
ATOM   1435  C CG    . PHE A 1 190 ? 23.379  -51.114 221.037 1.00 94.15  ? 190 PHE A CG    1 
ATOM   1436  C CD1   . PHE A 1 190 ? 24.322  -51.069 220.026 1.00 96.86  ? 190 PHE A CD1   1 
ATOM   1437  C CD2   . PHE A 1 190 ? 23.096  -49.954 221.738 1.00 92.53  ? 190 PHE A CD2   1 
ATOM   1438  C CE1   . PHE A 1 190 ? 24.972  -49.890 219.717 1.00 96.10  ? 190 PHE A CE1   1 
ATOM   1439  C CE2   . PHE A 1 190 ? 23.742  -48.771 221.436 1.00 92.96  ? 190 PHE A CE2   1 
ATOM   1440  C CZ    . PHE A 1 190 ? 24.681  -48.739 220.423 1.00 93.19  ? 190 PHE A CZ    1 
ATOM   1441  N N     . VAL A 1 191 ? 20.446  -54.458 221.821 1.00 89.07  ? 191 VAL A N     1 
ATOM   1442  C CA    . VAL A 1 191 ? 20.002  -55.828 222.032 1.00 85.65  ? 191 VAL A CA    1 
ATOM   1443  C C     . VAL A 1 191 ? 18.859  -56.167 221.086 1.00 83.82  ? 191 VAL A C     1 
ATOM   1444  O O     . VAL A 1 191 ? 18.912  -57.159 220.360 1.00 82.87  ? 191 VAL A O     1 
ATOM   1445  C CB    . VAL A 1 191 ? 19.518  -56.059 223.472 1.00 81.01  ? 191 VAL A CB    1 
ATOM   1446  C CG1   . VAL A 1 191 ? 19.269  -57.546 223.705 1.00 78.74  ? 191 VAL A CG1   1 
ATOM   1447  C CG2   . VAL A 1 191 ? 20.523  -55.509 224.471 1.00 81.81  ? 191 VAL A CG2   1 
ATOM   1448  N N     . LEU A 1 192 ? 17.829  -55.327 221.096 1.00 80.32  ? 192 LEU A N     1 
ATOM   1449  C CA    . LEU A 1 192 ? 16.619  -55.569 220.318 1.00 81.98  ? 192 LEU A CA    1 
ATOM   1450  C C     . LEU A 1 192 ? 16.890  -55.638 218.824 1.00 84.52  ? 192 LEU A C     1 
ATOM   1451  O O     . LEU A 1 192 ? 16.169  -56.311 218.085 1.00 75.52  ? 192 LEU A O     1 
ATOM   1452  C CB    . LEU A 1 192 ? 15.594  -54.480 220.601 1.00 84.57  ? 192 LEU A CB    1 
ATOM   1453  C CG    . LEU A 1 192 ? 14.864  -54.596 221.935 1.00 86.34  ? 192 LEU A CG    1 
ATOM   1454  C CD1   . LEU A 1 192 ? 14.282  -53.250 222.323 1.00 90.27  ? 192 LEU A CD1   1 
ATOM   1455  C CD2   . LEU A 1 192 ? 13.774  -55.646 221.834 1.00 83.95  ? 192 LEU A CD2   1 
ATOM   1456  N N     . ALA A 1 193 ? 17.925  -54.927 218.388 1.00 87.13  ? 193 ALA A N     1 
ATOM   1457  C CA    . ALA A 1 193 ? 18.355  -54.963 216.997 1.00 87.35  ? 193 ALA A CA    1 
ATOM   1458  C C     . ALA A 1 193 ? 19.142  -56.239 216.707 1.00 94.90  ? 193 ALA A C     1 
ATOM   1459  O O     . ALA A 1 193 ? 18.968  -56.851 215.653 1.00 96.66  ? 193 ALA A O     1 
ATOM   1460  C CB    . ALA A 1 193 ? 19.185  -53.733 216.660 1.00 79.17  ? 193 ALA A CB    1 
ATOM   1461  N N     . ASP A 1 194 ? 20.003  -56.634 217.645 1.00 96.91  ? 194 ASP A N     1 
ATOM   1462  C CA    . ASP A 1 194 ? 20.787  -57.861 217.509 1.00 98.41  ? 194 ASP A CA    1 
ATOM   1463  C C     . ASP A 1 194 ? 19.901  -59.100 217.534 1.00 97.87  ? 194 ASP A C     1 
ATOM   1464  O O     . ASP A 1 194 ? 20.194  -60.099 216.876 1.00 100.22 ? 194 ASP A O     1 
ATOM   1465  C CB    . ASP A 1 194 ? 21.831  -57.972 218.623 1.00 107.89 ? 194 ASP A CB    1 
ATOM   1466  C CG    . ASP A 1 194 ? 22.972  -56.989 218.457 1.00 122.19 ? 194 ASP A CG    1 
ATOM   1467  O OD1   . ASP A 1 194 ? 23.228  -56.559 217.313 1.00 131.29 ? 194 ASP A OD1   1 
ATOM   1468  O OD2   . ASP A 1 194 ? 23.619  -56.653 219.473 1.00 122.32 ? 194 ASP A OD2   1 
ATOM   1469  N N     . LEU A 1 195 ? 18.821  -59.033 218.306 1.00 95.75  ? 195 LEU A N     1 
ATOM   1470  C CA    . LEU A 1 195 ? 17.898  -60.155 218.425 1.00 91.87  ? 195 LEU A CA    1 
ATOM   1471  C C     . LEU A 1 195 ? 16.899  -60.206 217.275 1.00 87.64  ? 195 LEU A C     1 
ATOM   1472  O O     . LEU A 1 195 ? 16.034  -61.079 217.241 1.00 95.89  ? 195 LEU A O     1 
ATOM   1473  C CB    . LEU A 1 195 ? 17.149  -60.100 219.757 1.00 93.88  ? 195 LEU A CB    1 
ATOM   1474  C CG    . LEU A 1 195 ? 18.010  -60.142 221.018 1.00 95.54  ? 195 LEU A CG    1 
ATOM   1475  C CD1   . LEU A 1 195 ? 17.135  -60.205 222.260 1.00 96.87  ? 195 LEU A CD1   1 
ATOM   1476  C CD2   . LEU A 1 195 ? 18.966  -61.319 220.964 1.00 95.51  ? 195 LEU A CD2   1 
ATOM   1477  N N     . GLY A 1 196 ? 17.006  -59.266 216.343 1.00 80.36  ? 196 GLY A N     1 
ATOM   1478  C CA    . GLY A 1 196 ? 16.141  -59.268 215.176 1.00 86.61  ? 196 GLY A CA    1 
ATOM   1479  C C     . GLY A 1 196 ? 14.705  -58.887 215.488 1.00 88.18  ? 196 GLY A C     1 
ATOM   1480  O O     . GLY A 1 196 ? 13.813  -59.036 214.651 1.00 86.29  ? 196 GLY A O     1 
ATOM   1481  N N     . ILE A 1 197 ? 14.488  -58.399 216.705 1.00 86.49  ? 197 ILE A N     1 
ATOM   1482  C CA    . ILE A 1 197 ? 13.196  -57.878 217.131 1.00 82.45  ? 197 ILE A CA    1 
ATOM   1483  C C     . ILE A 1 197 ? 12.955  -56.497 216.505 1.00 85.33  ? 197 ILE A C     1 
ATOM   1484  O O     . ILE A 1 197 ? 11.819  -56.128 216.209 1.00 88.84  ? 197 ILE A O     1 
ATOM   1485  C CB    . ILE A 1 197 ? 13.123  -57.799 218.675 1.00 79.42  ? 197 ILE A CB    1 
ATOM   1486  C CG1   . ILE A 1 197 ? 13.577  -59.125 219.297 1.00 78.56  ? 197 ILE A CG1   1 
ATOM   1487  C CG2   . ILE A 1 197 ? 11.723  -57.413 219.143 1.00 76.34  ? 197 ILE A CG2   1 
ATOM   1488  C CD1   . ILE A 1 197 ? 13.596  -59.120 220.814 1.00 74.17  ? 197 ILE A CD1   1 
ATOM   1489  N N     . TYR A 1 198 ? 14.031  -55.740 216.303 1.00 83.60  ? 198 TYR A N     1 
ATOM   1490  C CA    . TYR A 1 198 ? 13.958  -54.487 215.555 1.00 91.67  ? 198 TYR A CA    1 
ATOM   1491  C C     . TYR A 1 198 ? 14.948  -54.482 214.391 1.00 95.83  ? 198 TYR A C     1 
ATOM   1492  O O     . TYR A 1 198 ? 16.162  -54.519 214.592 1.00 98.65  ? 198 TYR A O     1 
ATOM   1493  C CB    . TYR A 1 198 ? 14.188  -53.268 216.461 1.00 99.11  ? 198 TYR A CB    1 
ATOM   1494  C CG    . TYR A 1 198 ? 13.030  -52.961 217.386 1.00 106.05 ? 198 TYR A CG    1 
ATOM   1495  C CD1   . TYR A 1 198 ? 11.758  -52.728 216.882 1.00 109.03 ? 198 TYR A CD1   1 
ATOM   1496  C CD2   . TYR A 1 198 ? 13.211  -52.894 218.761 1.00 111.82 ? 198 TYR A CD2   1 
ATOM   1497  C CE1   . TYR A 1 198 ? 10.697  -52.450 217.722 1.00 116.31 ? 198 TYR A CE1   1 
ATOM   1498  C CE2   . TYR A 1 198 ? 12.156  -52.615 219.610 1.00 115.59 ? 198 TYR A CE2   1 
ATOM   1499  C CZ    . TYR A 1 198 ? 10.901  -52.395 219.084 1.00 121.10 ? 198 TYR A CZ    1 
ATOM   1500  O OH    . TYR A 1 198 ? 9.844   -52.117 219.920 1.00 127.35 ? 198 TYR A OH    1 
ATOM   1501  N N     . ARG A 1 199 ? 14.421  -54.450 213.173 1.00 101.14 ? 199 ARG A N     1 
ATOM   1502  C CA    . ARG A 1 199 ? 15.261  -54.384 211.984 1.00 101.98 ? 199 ARG A CA    1 
ATOM   1503  C C     . ARG A 1 199 ? 15.098  -53.032 211.304 1.00 102.33 ? 199 ARG A C     1 
ATOM   1504  O O     . ARG A 1 199 ? 14.013  -52.686 210.838 1.00 112.03 ? 199 ARG A O     1 
ATOM   1505  C CB    . ARG A 1 199 ? 14.926  -55.520 211.012 1.00 102.78 ? 199 ARG A CB    1 
ATOM   1506  C CG    . ARG A 1 199 ? 15.132  -56.917 211.588 1.00 103.38 ? 199 ARG A CG    1 
ATOM   1507  C CD    . ARG A 1 199 ? 14.848  -57.997 210.555 1.00 105.75 ? 199 ARG A CD    1 
ATOM   1508  N NE    . ARG A 1 199 ? 15.604  -57.778 209.327 1.00 107.15 ? 199 ARG A NE    1 
ATOM   1509  C CZ    . ARG A 1 199 ? 15.052  -57.520 208.145 1.00 111.71 ? 199 ARG A CZ    1 
ATOM   1510  N NH1   . ARG A 1 199 ? 13.731  -57.462 208.025 1.00 111.42 ? 199 ARG A NH1   1 
ATOM   1511  N NH2   . ARG A 1 199 ? 15.821  -57.329 207.082 1.00 114.04 ? 199 ARG A NH2   1 
ATOM   1512  N N     . TYR A 1 200 ? 16.180  -52.264 211.260 1.00 98.31  ? 200 TYR A N     1 
ATOM   1513  C CA    . TYR A 1 200 ? 16.144  -50.937 210.664 1.00 102.44 ? 200 TYR A CA    1 
ATOM   1514  C C     . TYR A 1 200 ? 16.735  -50.952 209.264 1.00 107.10 ? 200 TYR A C     1 
ATOM   1515  O O     . TYR A 1 200 ? 17.568  -51.799 208.941 1.00 109.07 ? 200 TYR A O     1 
ATOM   1516  C CB    . TYR A 1 200 ? 16.927  -49.944 211.523 1.00 99.27  ? 200 TYR A CB    1 
ATOM   1517  C CG    . TYR A 1 200 ? 16.430  -49.814 212.941 1.00 82.09  ? 200 TYR A CG    1 
ATOM   1518  C CD1   . TYR A 1 200 ? 16.936  -50.622 213.950 1.00 80.38  ? 200 TYR A CD1   1 
ATOM   1519  C CD2   . TYR A 1 200 ? 15.461  -48.877 213.274 1.00 89.44  ? 200 TYR A CD2   1 
ATOM   1520  C CE1   . TYR A 1 200 ? 16.489  -50.504 215.249 1.00 89.17  ? 200 TYR A CE1   1 
ATOM   1521  C CE2   . TYR A 1 200 ? 15.007  -48.751 214.571 1.00 87.65  ? 200 TYR A CE2   1 
ATOM   1522  C CZ    . TYR A 1 200 ? 15.525  -49.567 215.555 1.00 88.90  ? 200 TYR A CZ    1 
ATOM   1523  O OH    . TYR A 1 200 ? 15.079  -49.448 216.851 1.00 92.45  ? 200 TYR A OH    1 
ATOM   1524  N N     . GLU A 1 201 ? 16.299  -50.013 208.433 1.00 106.73 ? 201 GLU A N     1 
ATOM   1525  C CA    . GLU A 1 201 ? 16.929  -49.812 207.139 1.00 105.32 ? 201 GLU A CA    1 
ATOM   1526  C C     . GLU A 1 201 ? 18.345  -49.305 207.383 1.00 103.47 ? 201 GLU A C     1 
ATOM   1527  O O     . GLU A 1 201 ? 18.577  -48.502 208.290 1.00 101.64 ? 201 GLU A O     1 
ATOM   1528  C CB    . GLU A 1 201 ? 16.132  -48.810 206.304 1.00 106.03 ? 201 GLU A CB    1 
ATOM   1529  C CG    . GLU A 1 201 ? 16.801  -48.404 205.002 1.00 108.33 ? 201 GLU A CG    1 
ATOM   1530  C CD    . GLU A 1 201 ? 17.191  -49.594 204.150 1.00 110.86 ? 201 GLU A CD    1 
ATOM   1531  O OE1   . GLU A 1 201 ? 16.310  -50.147 203.458 1.00 111.79 ? 201 GLU A OE1   1 
ATOM   1532  O OE2   . GLU A 1 201 ? 18.380  -49.976 204.174 1.00 111.60 ? 201 GLU A OE2   1 
ATOM   1533  N N     . SER A 1 202 ? 19.294  -49.792 206.592 1.00 105.89 ? 202 SER A N     1 
ATOM   1534  C CA    . SER A 1 202 ? 20.684  -49.384 206.740 1.00 111.91 ? 202 SER A CA    1 
ATOM   1535  C C     . SER A 1 202 ? 21.030  -48.292 205.736 1.00 111.82 ? 202 SER A C     1 
ATOM   1536  O O     . SER A 1 202 ? 21.290  -48.571 204.566 1.00 114.77 ? 202 SER A O     1 
ATOM   1537  C CB    . SER A 1 202 ? 21.621  -50.581 206.562 1.00 115.47 ? 202 SER A CB    1 
ATOM   1538  O OG    . SER A 1 202 ? 21.632  -51.019 205.215 1.00 121.15 ? 202 SER A OG    1 
ATOM   1539  N N     . VAL A 1 203 ? 21.018  -47.046 206.194 1.00 110.45 ? 203 VAL A N     1 
ATOM   1540  C CA    . VAL A 1 203 ? 21.397  -45.926 205.345 1.00 116.28 ? 203 VAL A CA    1 
ATOM   1541  C C     . VAL A 1 203 ? 22.897  -45.689 205.441 1.00 120.45 ? 203 VAL A C     1 
ATOM   1542  O O     . VAL A 1 203 ? 23.435  -45.522 206.534 1.00 121.57 ? 203 VAL A O     1 
ATOM   1543  C CB    . VAL A 1 203 ? 20.660  -44.637 205.741 1.00 116.19 ? 203 VAL A CB    1 
ATOM   1544  C CG1   . VAL A 1 203 ? 21.084  -43.490 204.837 1.00 117.74 ? 203 VAL A CG1   1 
ATOM   1545  C CG2   . VAL A 1 203 ? 19.155  -44.848 205.679 1.00 117.18 ? 203 VAL A CG2   1 
ATOM   1546  N N     . GLU A 1 204 ? 23.572  -45.685 204.297 1.00 125.01 ? 204 GLU A N     1 
ATOM   1547  C CA    . GLU A 1 204 ? 25.006  -45.436 204.274 1.00 128.62 ? 204 GLU A CA    1 
ATOM   1548  C C     . GLU A 1 204 ? 25.291  -43.938 204.347 1.00 129.46 ? 204 GLU A C     1 
ATOM   1549  O O     . GLU A 1 204 ? 25.359  -43.258 203.323 1.00 130.94 ? 204 GLU A O     1 
ATOM   1550  C CB    . GLU A 1 204 ? 25.638  -46.040 203.019 1.00 136.27 ? 204 GLU A CB    1 
ATOM   1551  C CG    . GLU A 1 204 ? 27.145  -45.856 202.935 1.00 146.34 ? 204 GLU A CG    1 
ATOM   1552  C CD    . GLU A 1 204 ? 27.698  -46.223 201.571 1.00 155.21 ? 204 GLU A CD    1 
ATOM   1553  O OE1   . GLU A 1 204 ? 26.986  -46.909 200.806 1.00 159.18 ? 204 GLU A OE1   1 
ATOM   1554  O OE2   . GLU A 1 204 ? 28.839  -45.819 201.261 1.00 155.31 ? 204 GLU A OE2   1 
ATOM   1555  N N     . PHE A 1 205 ? 25.451  -43.429 205.565 1.00 127.86 ? 205 PHE A N     1 
ATOM   1556  C CA    . PHE A 1 205 ? 25.717  -42.007 205.770 1.00 128.31 ? 205 PHE A CA    1 
ATOM   1557  C C     . PHE A 1 205 ? 27.203  -41.723 205.971 1.00 130.43 ? 205 PHE A C     1 
ATOM   1558  O O     . PHE A 1 205 ? 28.001  -42.640 206.168 1.00 126.32 ? 205 PHE A O     1 
ATOM   1559  C CB    . PHE A 1 205 ? 24.893  -41.448 206.937 1.00 123.71 ? 205 PHE A CB    1 
ATOM   1560  C CG    . PHE A 1 205 ? 25.042  -42.219 208.218 1.00 119.22 ? 205 PHE A CG    1 
ATOM   1561  C CD1   . PHE A 1 205 ? 24.194  -43.274 208.508 1.00 117.54 ? 205 PHE A CD1   1 
ATOM   1562  C CD2   . PHE A 1 205 ? 26.018  -41.879 209.141 1.00 119.92 ? 205 PHE A CD2   1 
ATOM   1563  C CE1   . PHE A 1 205 ? 24.322  -43.983 209.685 1.00 114.16 ? 205 PHE A CE1   1 
ATOM   1564  C CE2   . PHE A 1 205 ? 26.151  -42.586 210.324 1.00 117.26 ? 205 PHE A CE2   1 
ATOM   1565  C CZ    . PHE A 1 205 ? 25.301  -43.639 210.595 1.00 112.54 ? 205 PHE A CZ    1 
ATOM   1566  N N     . SER A 1 206 ? 27.561  -40.443 205.921 1.00 139.50 ? 206 SER A N     1 
ATOM   1567  C CA    . SER A 1 206 ? 28.957  -40.017 205.964 1.00 147.59 ? 206 SER A CA    1 
ATOM   1568  C C     . SER A 1 206 ? 29.641  -40.377 207.278 1.00 149.33 ? 206 SER A C     1 
ATOM   1569  O O     . SER A 1 206 ? 28.983  -40.728 208.256 1.00 149.95 ? 206 SER A O     1 
ATOM   1570  C CB    . SER A 1 206 ? 29.059  -38.508 205.723 1.00 152.85 ? 206 SER A CB    1 
ATOM   1571  O OG    . SER A 1 206 ? 28.315  -37.783 206.689 1.00 153.61 ? 206 SER A OG    1 
ATOM   1572  N N     . ALA A 1 207 ? 30.967  -40.290 207.292 1.00 150.59 ? 207 ALA A N     1 
ATOM   1573  C CA    . ALA A 1 207 ? 31.727  -40.551 208.507 1.00 150.90 ? 207 ALA A CA    1 
ATOM   1574  C C     . ALA A 1 207 ? 31.596  -39.378 209.471 1.00 155.52 ? 207 ALA A C     1 
ATOM   1575  O O     . ALA A 1 207 ? 31.874  -39.507 210.664 1.00 157.70 ? 207 ALA A O     1 
ATOM   1576  C CB    . ALA A 1 207 ? 33.188  -40.813 208.177 1.00 148.80 ? 207 ALA A CB    1 
ATOM   1577  N N     . ASP A 1 208 ? 31.165  -38.234 208.947 1.00 156.97 ? 208 ASP A N     1 
ATOM   1578  C CA    . ASP A 1 208 ? 30.990  -37.036 209.760 1.00 157.52 ? 208 ASP A CA    1 
ATOM   1579  C C     . ASP A 1 208 ? 29.533  -36.577 209.824 1.00 155.21 ? 208 ASP A C     1 
ATOM   1580  O O     . ASP A 1 208 ? 29.251  -35.377 209.836 1.00 154.58 ? 208 ASP A O     1 
ATOM   1581  C CB    . ASP A 1 208 ? 31.894  -35.902 209.264 1.00 161.54 ? 208 ASP A CB    1 
ATOM   1582  C CG    . ASP A 1 208 ? 31.790  -35.680 207.765 1.00 164.58 ? 208 ASP A CG    1 
ATOM   1583  O OD1   . ASP A 1 208 ? 30.714  -35.945 207.189 1.00 165.95 ? 208 ASP A OD1   1 
ATOM   1584  O OD2   . ASP A 1 208 ? 32.790  -35.237 207.162 1.00 165.64 ? 208 ASP A OD2   1 
ATOM   1585  N N     . SER A 1 209 ? 28.613  -37.538 209.856 1.00 151.47 ? 209 SER A N     1 
ATOM   1586  C CA    . SER A 1 209 ? 27.202  -37.240 210.076 1.00 145.33 ? 209 SER A CA    1 
ATOM   1587  C C     . SER A 1 209 ? 26.959  -37.027 211.565 1.00 141.48 ? 209 SER A C     1 
ATOM   1588  O O     . SER A 1 209 ? 27.501  -37.751 212.401 1.00 137.82 ? 209 SER A O     1 
ATOM   1589  C CB    . SER A 1 209 ? 26.311  -38.359 209.536 1.00 140.96 ? 209 SER A CB    1 
ATOM   1590  O OG    . SER A 1 209 ? 26.155  -38.254 208.129 1.00 140.53 ? 209 SER A OG    1 
ATOM   1591  N N     . ARG A 1 210 ? 26.139  -36.033 211.890 1.00 143.22 ? 210 ARG A N     1 
ATOM   1592  C CA    . ARG A 1 210 ? 26.032  -35.546 213.260 1.00 144.24 ? 210 ARG A CA    1 
ATOM   1593  C C     . ARG A 1 210 ? 24.606  -35.496 213.788 1.00 135.17 ? 210 ARG A C     1 
ATOM   1594  O O     . ARG A 1 210 ? 23.669  -35.191 213.053 1.00 133.69 ? 210 ARG A O     1 
ATOM   1595  C CB    . ARG A 1 210 ? 26.646  -34.146 213.355 1.00 158.12 ? 210 ARG A CB    1 
ATOM   1596  C CG    . ARG A 1 210 ? 26.320  -33.247 212.163 1.00 170.22 ? 210 ARG A CG    1 
ATOM   1597  C CD    . ARG A 1 210 ? 25.529  -32.005 212.561 1.00 175.51 ? 210 ARG A CD    1 
ATOM   1598  N NE    . ARG A 1 210 ? 24.157  -32.307 212.963 1.00 175.68 ? 210 ARG A NE    1 
ATOM   1599  C CZ    . ARG A 1 210 ? 23.092  -31.616 212.566 1.00 175.54 ? 210 ARG A CZ    1 
ATOM   1600  N NH1   . ARG A 1 210 ? 23.235  -30.579 211.751 1.00 176.83 ? 210 ARG A NH1   1 
ATOM   1601  N NH2   . ARG A 1 210 ? 21.882  -31.963 212.983 1.00 173.57 ? 210 ARG A NH2   1 
ATOM   1602  N N     . GLY A 1 211 ? 24.455  -35.796 215.074 1.00 132.06 ? 211 GLY A N     1 
ATOM   1603  C CA    . GLY A 1 211 ? 23.213  -35.533 215.774 1.00 132.32 ? 211 GLY A CA    1 
ATOM   1604  C C     . GLY A 1 211 ? 23.206  -34.066 216.155 1.00 133.11 ? 211 GLY A C     1 
ATOM   1605  O O     . GLY A 1 211 ? 22.419  -33.277 215.633 1.00 139.38 ? 211 GLY A O     1 
ATOM   1606  N N     . PHE A 1 212 ? 24.099  -33.702 217.068 1.00 125.09 ? 212 PHE A N     1 
ATOM   1607  C CA    . PHE A 1 212 ? 24.356  -32.300 217.367 1.00 120.67 ? 212 PHE A CA    1 
ATOM   1608  C C     . PHE A 1 212 ? 25.663  -31.891 216.699 1.00 127.14 ? 212 PHE A C     1 
ATOM   1609  O O     . PHE A 1 212 ? 26.591  -32.694 216.589 1.00 123.85 ? 212 PHE A O     1 
ATOM   1610  C CB    . PHE A 1 212 ? 24.448  -32.070 218.876 1.00 109.37 ? 212 PHE A CB    1 
ATOM   1611  C CG    . PHE A 1 212 ? 23.180  -32.375 219.617 1.00 100.17 ? 212 PHE A CG    1 
ATOM   1612  C CD1   . PHE A 1 212 ? 22.267  -31.372 219.896 1.00 104.97 ? 212 PHE A CD1   1 
ATOM   1613  C CD2   . PHE A 1 212 ? 22.905  -33.661 220.046 1.00 90.72  ? 212 PHE A CD2   1 
ATOM   1614  C CE1   . PHE A 1 212 ? 21.098  -31.648 220.582 1.00 100.20 ? 212 PHE A CE1   1 
ATOM   1615  C CE2   . PHE A 1 212 ? 21.738  -33.943 220.732 1.00 89.60  ? 212 PHE A CE2   1 
ATOM   1616  C CZ    . PHE A 1 212 ? 20.834  -32.936 221.000 1.00 91.56  ? 212 PHE A CZ    1 
ATOM   1617  N N     . ARG A 1 213 ? 25.736  -30.643 216.251 1.00 135.78 ? 213 ARG A N     1 
ATOM   1618  C CA    . ARG A 1 213 ? 26.933  -30.146 215.585 1.00 143.10 ? 213 ARG A CA    1 
ATOM   1619  C C     . ARG A 1 213 ? 27.810  -29.378 216.562 1.00 148.94 ? 213 ARG A C     1 
ATOM   1620  O O     . ARG A 1 213 ? 29.011  -29.221 216.351 1.00 146.82 ? 213 ARG A O     1 
ATOM   1621  C CB    . ARG A 1 213 ? 26.554  -29.248 214.406 1.00 148.95 ? 213 ARG A CB    1 
ATOM   1622  C CG    . ARG A 1 213 ? 27.718  -28.917 213.484 1.00 157.01 ? 213 ARG A CG    1 
ATOM   1623  C CD    . ARG A 1 213 ? 27.269  -28.105 212.280 1.00 164.09 ? 213 ARG A CD    1 
ATOM   1624  N NE    . ARG A 1 213 ? 26.520  -26.914 212.668 1.00 165.67 ? 213 ARG A NE    1 
ATOM   1625  C CZ    . ARG A 1 213 ? 27.078  -25.763 213.030 1.00 163.87 ? 213 ARG A CZ    1 
ATOM   1626  N NH1   . ARG A 1 213 ? 28.398  -25.643 213.062 1.00 162.86 ? 213 ARG A NH1   1 
ATOM   1627  N NH2   . ARG A 1 213 ? 26.313  -24.732 213.365 1.00 163.54 ? 213 ARG A NH2   1 
ATOM   1628  N N     . LEU A 1 214 ? 27.200  -28.909 217.643 1.00 160.00 ? 214 LEU A N     1 
ATOM   1629  C CA    . LEU A 1 214 ? 27.886  -28.042 218.589 1.00 81.05  ? 214 LEU A CA    1 
ATOM   1630  C C     . LEU A 1 214 ? 27.358  -28.267 220.008 1.00 81.72  ? 214 LEU A C     1 
ATOM   1631  O O     . LEU A 1 214 ? 26.153  -28.429 220.208 1.00 93.46  ? 214 LEU A O     1 
ATOM   1632  C CB    . LEU A 1 214 ? 27.711  -26.585 218.156 1.00 98.10  ? 214 LEU A CB    1 
ATOM   1633  C CG    . LEU A 1 214 ? 27.596  -25.495 219.220 1.00 110.97 ? 214 LEU A CG    1 
ATOM   1634  C CD1   . LEU A 1 214 ? 28.956  -25.158 219.830 1.00 116.54 ? 214 LEU A CD1   1 
ATOM   1635  C CD2   . LEU A 1 214 ? 26.938  -24.264 218.617 1.00 110.91 ? 214 LEU A CD2   1 
ATOM   1636  N N     . ARG A 1 215 ? 28.263  -28.277 220.987 1.00 153.23 ? 215 ARG A N     1 
ATOM   1637  C CA    . ARG A 1 215 ? 27.910  -28.619 222.369 1.00 134.06 ? 215 ARG A CA    1 
ATOM   1638  C C     . ARG A 1 215 ? 26.831  -27.726 222.969 1.00 126.54 ? 215 ARG A C     1 
ATOM   1639  O O     . ARG A 1 215 ? 25.968  -28.204 223.701 1.00 126.75 ? 215 ARG A O     1 
ATOM   1640  C CB    . ARG A 1 215 ? 29.142  -28.612 223.280 1.00 129.15 ? 215 ARG A CB    1 
ATOM   1641  C CG    . ARG A 1 215 ? 28.824  -28.850 224.761 1.00 121.92 ? 215 ARG A CG    1 
ATOM   1642  C CD    . ARG A 1 215 ? 30.043  -28.573 225.629 1.00 115.93 ? 215 ARG A CD    1 
ATOM   1643  N NE    . ARG A 1 215 ? 29.743  -28.556 227.059 1.00 113.34 ? 215 ARG A NE    1 
ATOM   1644  C CZ    . ARG A 1 215 ? 29.819  -29.620 227.855 1.00 116.53 ? 215 ARG A CZ    1 
ATOM   1645  N NH1   . ARG A 1 215 ? 29.532  -29.504 229.144 1.00 117.36 ? 215 ARG A NH1   1 
ATOM   1646  N NH2   . ARG A 1 215 ? 30.180  -30.800 227.365 1.00 96.29  ? 215 ARG A NH2   1 
ATOM   1647  N N     . ALA A 1 216 ? 26.875  -26.435 222.659 1.00 126.14 ? 216 ALA A N     1 
ATOM   1648  C CA    . ALA A 1 216 ? 25.914  -25.491 223.226 1.00 126.47 ? 216 ALA A CA    1 
ATOM   1649  C C     . ALA A 1 216 ? 24.457  -25.890 222.969 1.00 119.35 ? 216 ALA A C     1 
ATOM   1650  O O     . ALA A 1 216 ? 23.566  -25.532 223.736 1.00 119.81 ? 216 ALA A O     1 
ATOM   1651  C CB    . ALA A 1 216 ? 26.185  -24.078 222.724 1.00 129.53 ? 216 ALA A CB    1 
ATOM   1652  N N     . ASP A 1 217 ? 24.221  -26.646 221.902 1.00 111.06 ? 217 ASP A N     1 
ATOM   1653  C CA    . ASP A 1 217 ? 22.876  -27.117 221.586 1.00 109.58 ? 217 ASP A CA    1 
ATOM   1654  C C     . ASP A 1 217 ? 22.473  -28.330 222.420 1.00 107.67 ? 217 ASP A C     1 
ATOM   1655  O O     . ASP A 1 217 ? 21.288  -28.560 222.673 1.00 105.83 ? 217 ASP A O     1 
ATOM   1656  C CB    . ASP A 1 217 ? 22.759  -27.425 220.096 1.00 116.61 ? 217 ASP A CB    1 
ATOM   1657  C CG    . ASP A 1 217 ? 22.500  -26.185 219.274 1.00 123.45 ? 217 ASP A CG    1 
ATOM   1658  O OD1   . ASP A 1 217 ? 22.668  -25.071 219.814 1.00 130.67 ? 217 ASP A OD1   1 
ATOM   1659  O OD2   . ASP A 1 217 ? 22.124  -26.324 218.092 1.00 121.83 ? 217 ASP A OD2   1 
ATOM   1660  N N     . VAL A 1 218 ? 23.467  -29.101 222.842 1.00 106.16 ? 218 VAL A N     1 
ATOM   1661  C CA    . VAL A 1 218 ? 23.231  -30.252 223.701 1.00 98.57  ? 218 VAL A CA    1 
ATOM   1662  C C     . VAL A 1 218 ? 22.738  -29.787 225.067 1.00 103.73 ? 218 VAL A C     1 
ATOM   1663  O O     . VAL A 1 218 ? 21.819  -30.373 225.641 1.00 107.07 ? 218 VAL A O     1 
ATOM   1664  C CB    . VAL A 1 218 ? 24.508  -31.096 223.872 1.00 91.68  ? 218 VAL A CB    1 
ATOM   1665  C CG1   . VAL A 1 218 ? 24.264  -32.244 224.833 1.00 86.73  ? 218 VAL A CG1   1 
ATOM   1666  C CG2   . VAL A 1 218 ? 24.977  -31.618 222.527 1.00 92.42  ? 218 VAL A CG2   1 
ATOM   1667  N N     . ASP A 1 219 ? 23.346  -28.721 225.577 1.00 105.39 ? 219 ASP A N     1 
ATOM   1668  C CA    . ASP A 1 219 ? 22.962  -28.170 226.870 1.00 103.60 ? 219 ASP A CA    1 
ATOM   1669  C C     . ASP A 1 219 ? 21.541  -27.622 226.810 1.00 97.66  ? 219 ASP A C     1 
ATOM   1670  O O     . ASP A 1 219 ? 20.800  -27.687 227.790 1.00 93.65  ? 219 ASP A O     1 
ATOM   1671  C CB    . ASP A 1 219 ? 23.936  -27.070 227.293 1.00 110.29 ? 219 ASP A CB    1 
ATOM   1672  C CG    . ASP A 1 219 ? 25.381  -27.526 227.249 1.00 117.90 ? 219 ASP A CG    1 
ATOM   1673  O OD1   . ASP A 1 219 ? 25.650  -28.696 227.598 1.00 119.28 ? 219 ASP A OD1   1 
ATOM   1674  O OD2   . ASP A 1 219 ? 26.248  -26.717 226.859 1.00 122.37 ? 219 ASP A OD2   1 
ATOM   1675  N N     . ALA A 1 220 ? 21.167  -27.093 225.649 1.00 98.84  ? 220 ALA A N     1 
ATOM   1676  C CA    . ALA A 1 220 ? 19.834  -26.534 225.451 1.00 102.89 ? 220 ALA A CA    1 
ATOM   1677  C C     . ALA A 1 220 ? 18.779  -27.633 225.471 1.00 104.86 ? 220 ALA A C     1 
ATOM   1678  O O     . ALA A 1 220 ? 17.682  -27.447 225.999 1.00 101.86 ? 220 ALA A O     1 
ATOM   1679  C CB    . ALA A 1 220 ? 19.774  -25.765 224.143 1.00 101.35 ? 220 ALA A CB    1 
ATOM   1680  N N     . TYR A 1 221 ? 19.124  -28.777 224.887 1.00 105.63 ? 221 TYR A N     1 
ATOM   1681  C CA    . TYR A 1 221 ? 18.247  -29.939 224.869 1.00 98.93  ? 221 TYR A CA    1 
ATOM   1682  C C     . TYR A 1 221 ? 18.000  -30.432 226.290 1.00 92.94  ? 221 TYR A C     1 
ATOM   1683  O O     . TYR A 1 221 ? 16.859  -30.673 226.683 1.00 90.11  ? 221 TYR A O     1 
ATOM   1684  C CB    . TYR A 1 221 ? 18.876  -31.055 224.033 1.00 99.23  ? 221 TYR A CB    1 
ATOM   1685  C CG    . TYR A 1 221 ? 17.901  -32.109 223.558 1.00 99.57  ? 221 TYR A CG    1 
ATOM   1686  C CD1   . TYR A 1 221 ? 17.368  -33.041 224.439 1.00 98.04  ? 221 TYR A CD1   1 
ATOM   1687  C CD2   . TYR A 1 221 ? 17.529  -32.182 222.223 1.00 102.60 ? 221 TYR A CD2   1 
ATOM   1688  C CE1   . TYR A 1 221 ? 16.483  -34.007 224.005 1.00 100.69 ? 221 TYR A CE1   1 
ATOM   1689  C CE2   . TYR A 1 221 ? 16.646  -33.144 221.780 1.00 105.58 ? 221 TYR A CE2   1 
ATOM   1690  C CZ    . TYR A 1 221 ? 16.126  -34.055 222.674 1.00 109.18 ? 221 TYR A CZ    1 
ATOM   1691  O OH    . TYR A 1 221 ? 15.246  -35.015 222.229 1.00 117.55 ? 221 TYR A OH    1 
ATOM   1692  N N     . LEU A 1 222 ? 19.077  -30.584 227.054 1.00 92.72  ? 222 LEU A N     1 
ATOM   1693  C CA    . LEU A 1 222 ? 18.982  -31.047 228.433 1.00 85.06  ? 222 LEU A CA    1 
ATOM   1694  C C     . LEU A 1 222 ? 18.180  -30.089 229.302 1.00 92.91  ? 222 LEU A C     1 
ATOM   1695  O O     . LEU A 1 222 ? 17.510  -30.510 230.243 1.00 92.23  ? 222 LEU A O     1 
ATOM   1696  C CB    . LEU A 1 222 ? 20.374  -31.237 229.033 1.00 86.61  ? 222 LEU A CB    1 
ATOM   1697  C CG    . LEU A 1 222 ? 21.209  -32.374 228.450 1.00 92.41  ? 222 LEU A CG    1 
ATOM   1698  C CD1   . LEU A 1 222 ? 22.658  -32.220 228.863 1.00 95.47  ? 222 LEU A CD1   1 
ATOM   1699  C CD2   . LEU A 1 222 ? 20.662  -33.723 228.896 1.00 94.92  ? 222 LEU A CD2   1 
ATOM   1700  N N     . HIS A 1 223 ? 18.251  -28.800 228.988 1.00 95.70  ? 223 HIS A N     1 
ATOM   1701  C CA    . HIS A 1 223 ? 17.572  -27.791 229.792 1.00 101.98 ? 223 HIS A CA    1 
ATOM   1702  C C     . HIS A 1 223 ? 16.068  -27.855 229.583 1.00 107.69 ? 223 HIS A C     1 
ATOM   1703  O O     . HIS A 1 223 ? 15.297  -27.821 230.542 1.00 109.88 ? 223 HIS A O     1 
ATOM   1704  C CB    . HIS A 1 223 ? 18.078  -26.393 229.449 1.00 105.60 ? 223 HIS A CB    1 
ATOM   1705  C CG    . HIS A 1 223 ? 17.698  -25.353 230.458 1.00 117.66 ? 223 HIS A CG    1 
ATOM   1706  N ND1   . HIS A 1 223 ? 16.519  -24.642 230.388 1.00 120.24 ? 223 HIS A ND1   1 
ATOM   1707  C CD2   . HIS A 1 223 ? 18.341  -24.908 231.561 1.00 124.99 ? 223 HIS A CD2   1 
ATOM   1708  C CE1   . HIS A 1 223 ? 16.454  -23.801 231.404 1.00 124.13 ? 223 HIS A CE1   1 
ATOM   1709  N NE2   . HIS A 1 223 ? 17.548  -23.942 232.132 1.00 127.18 ? 223 HIS A NE2   1 
ATOM   1710  N N     . LEU A 1 224 ? 15.662  -27.940 228.320 1.00 107.04 ? 224 LEU A N     1 
ATOM   1711  C CA    . LEU A 1 224 ? 14.255  -28.063 227.964 1.00 99.34  ? 224 LEU A CA    1 
ATOM   1712  C C     . LEU A 1 224 ? 13.703  -29.375 228.505 1.00 100.01 ? 224 LEU A C     1 
ATOM   1713  O O     . LEU A 1 224 ? 12.538  -29.462 228.892 1.00 103.66 ? 224 LEU A O     1 
ATOM   1714  C CB    . LEU A 1 224 ? 14.082  -28.018 226.445 1.00 93.59  ? 224 LEU A CB    1 
ATOM   1715  C CG    . LEU A 1 224 ? 14.486  -26.742 225.702 1.00 93.45  ? 224 LEU A CG    1 
ATOM   1716  C CD1   . LEU A 1 224 ? 14.180  -26.878 224.220 1.00 90.39  ? 224 LEU A CD1   1 
ATOM   1717  C CD2   . LEU A 1 224 ? 13.790  -25.523 226.285 1.00 94.41  ? 224 LEU A CD2   1 
ATOM   1718  N N     . PHE A 1 225 ? 14.559  -30.391 228.522 1.00 98.29  ? 225 PHE A N     1 
ATOM   1719  C CA    . PHE A 1 225 ? 14.209  -31.708 229.037 1.00 96.88  ? 225 PHE A CA    1 
ATOM   1720  C C     . PHE A 1 225 ? 13.877  -31.639 230.522 1.00 98.90  ? 225 PHE A C     1 
ATOM   1721  O O     . PHE A 1 225 ? 12.907  -32.245 230.981 1.00 101.51 ? 225 PHE A O     1 
ATOM   1722  C CB    . PHE A 1 225 ? 15.373  -32.675 228.813 1.00 97.39  ? 225 PHE A CB    1 
ATOM   1723  C CG    . PHE A 1 225 ? 15.058  -34.100 229.165 1.00 99.91  ? 225 PHE A CG    1 
ATOM   1724  C CD1   . PHE A 1 225 ? 15.304  -34.589 230.438 1.00 101.49 ? 225 PHE A CD1   1 
ATOM   1725  C CD2   . PHE A 1 225 ? 14.522  -34.955 228.216 1.00 100.30 ? 225 PHE A CD2   1 
ATOM   1726  C CE1   . PHE A 1 225 ? 15.016  -35.902 230.760 1.00 101.85 ? 225 PHE A CE1   1 
ATOM   1727  C CE2   . PHE A 1 225 ? 14.231  -36.268 228.532 1.00 101.69 ? 225 PHE A CE2   1 
ATOM   1728  C CZ    . PHE A 1 225 ? 14.479  -36.742 229.806 1.00 103.95 ? 225 PHE A CZ    1 
ATOM   1729  N N     . ASP A 1 226 ? 14.691  -30.901 231.269 1.00 96.96  ? 226 ASP A N     1 
ATOM   1730  C CA    . ASP A 1 226 ? 14.497  -30.775 232.706 1.00 99.71  ? 226 ASP A CA    1 
ATOM   1731  C C     . ASP A 1 226 ? 13.398  -29.774 233.032 1.00 103.95 ? 226 ASP A C     1 
ATOM   1732  O O     . ASP A 1 226 ? 12.764  -29.863 234.082 1.00 107.53 ? 226 ASP A O     1 
ATOM   1733  C CB    . ASP A 1 226 ? 15.797  -30.370 233.399 1.00 110.09 ? 226 ASP A CB    1 
ATOM   1734  C CG    . ASP A 1 226 ? 15.747  -30.588 234.899 1.00 125.34 ? 226 ASP A CG    1 
ATOM   1735  O OD1   . ASP A 1 226 ? 16.155  -31.679 235.355 1.00 130.67 ? 226 ASP A OD1   1 
ATOM   1736  O OD2   . ASP A 1 226 ? 15.291  -29.676 235.622 1.00 130.18 ? 226 ASP A OD2   1 
ATOM   1737  N N     . CYS A 1 227 ? 13.181  -28.814 232.140 1.00 105.81 ? 227 CYS A N     1 
ATOM   1738  C CA    . CYS A 1 227 ? 12.070  -27.889 232.307 1.00 102.68 ? 227 CYS A CA    1 
ATOM   1739  C C     . CYS A 1 227 ? 10.768  -28.670 232.229 1.00 103.66 ? 227 CYS A C     1 
ATOM   1740  O O     . CYS A 1 227 ? 9.852   -28.456 233.020 1.00 109.56 ? 227 CYS A O     1 
ATOM   1741  C CB    . CYS A 1 227 ? 12.097  -26.790 231.244 1.00 95.05  ? 227 CYS A CB    1 
ATOM   1742  S SG    . CYS A 1 227 ? 13.385  -25.550 231.495 1.00 204.73 ? 227 CYS A SG    1 
ATOM   1743  N N     . ARG A 1 228 ? 10.704  -29.591 231.276 1.00 100.61 ? 228 ARG A N     1 
ATOM   1744  C CA    . ARG A 1 228 ? 9.545   -30.457 231.119 1.00 105.11 ? 228 ARG A CA    1 
ATOM   1745  C C     . ARG A 1 228 ? 9.426   -31.399 232.313 1.00 113.79 ? 228 ARG A C     1 
ATOM   1746  O O     . ARG A 1 228 ? 8.324   -31.712 232.769 1.00 115.04 ? 228 ARG A O     1 
ATOM   1747  C CB    . ARG A 1 228 ? 9.664   -31.247 229.816 1.00 103.74 ? 228 ARG A CB    1 
ATOM   1748  C CG    . ARG A 1 228 ? 8.751   -32.447 229.709 1.00 104.62 ? 228 ARG A CG    1 
ATOM   1749  C CD    . ARG A 1 228 ? 7.288   -32.056 229.713 1.00 113.49 ? 228 ARG A CD    1 
ATOM   1750  N NE    . ARG A 1 228 ? 6.458   -33.197 229.347 1.00 125.89 ? 228 ARG A NE    1 
ATOM   1751  C CZ    . ARG A 1 228 ? 5.131   -33.208 229.389 1.00 136.08 ? 228 ARG A CZ    1 
ATOM   1752  N NH1   . ARG A 1 228 ? 4.465   -32.135 229.793 1.00 137.95 ? 228 ARG A NH1   1 
ATOM   1753  N NH2   . ARG A 1 228 ? 4.471   -34.300 229.031 1.00 140.07 ? 228 ARG A NH2   1 
ATOM   1754  N N     . GLN A 1 229 ? 10.577  -31.830 232.822 1.00 117.33 ? 229 GLN A N     1 
ATOM   1755  C CA    . GLN A 1 229 ? 10.645  -32.759 233.943 1.00 116.11 ? 229 GLN A CA    1 
ATOM   1756  C C     . GLN A 1 229 ? 10.029  -32.159 235.203 1.00 113.90 ? 229 GLN A C     1 
ATOM   1757  O O     . GLN A 1 229 ? 9.175   -32.773 235.840 1.00 112.53 ? 229 GLN A O     1 
ATOM   1758  C CB    . GLN A 1 229 ? 12.101  -33.142 234.214 1.00 122.92 ? 229 GLN A CB    1 
ATOM   1759  C CG    . GLN A 1 229 ? 12.277  -34.449 234.962 1.00 129.69 ? 229 GLN A CG    1 
ATOM   1760  C CD    . GLN A 1 229 ? 12.164  -35.653 234.050 1.00 133.26 ? 229 GLN A CD    1 
ATOM   1761  O OE1   . GLN A 1 229 ? 12.557  -35.601 232.884 1.00 129.97 ? 229 GLN A OE1   1 
ATOM   1762  N NE2   . GLN A 1 229 ? 11.623  -36.746 234.576 1.00 137.73 ? 229 GLN A NE2   1 
ATOM   1763  N N     . ARG A 1 230 ? 10.468  -30.955 235.556 1.00 116.64 ? 230 ARG A N     1 
ATOM   1764  C CA    . ARG A 1 230 ? 9.956   -30.269 236.736 1.00 124.93 ? 230 ARG A CA    1 
ATOM   1765  C C     . ARG A 1 230 ? 8.485   -29.892 236.570 1.00 126.54 ? 230 ARG A C     1 
ATOM   1766  O O     . ARG A 1 230 ? 7.756   -29.766 237.553 1.00 127.45 ? 230 ARG A O     1 
ATOM   1767  C CB    . ARG A 1 230 ? 10.797  -29.027 237.044 1.00 131.80 ? 230 ARG A CB    1 
ATOM   1768  C CG    . ARG A 1 230 ? 12.268  -29.327 237.303 1.00 135.89 ? 230 ARG A CG    1 
ATOM   1769  C CD    . ARG A 1 230 ? 13.080  -28.052 237.458 1.00 141.14 ? 230 ARG A CD    1 
ATOM   1770  N NE    . ARG A 1 230 ? 14.511  -28.326 237.574 1.00 147.42 ? 230 ARG A NE    1 
ATOM   1771  C CZ    . ARG A 1 230 ? 15.179  -28.358 238.723 1.00 151.99 ? 230 ARG A CZ    1 
ATOM   1772  N NH1   . ARG A 1 230 ? 14.549  -28.125 239.867 1.00 155.89 ? 230 ARG A NH1   1 
ATOM   1773  N NH2   . ARG A 1 230 ? 16.480  -28.617 238.727 1.00 150.77 ? 230 ARG A NH2   1 
ATOM   1774  N N     . PHE A 1 231 ? 8.054   -29.719 235.323 1.00 127.99 ? 231 PHE A N     1 
ATOM   1775  C CA    . PHE A 1 231 ? 6.658   -29.399 235.033 1.00 127.90 ? 231 PHE A CA    1 
ATOM   1776  C C     . PHE A 1 231 ? 5.747   -30.572 235.361 1.00 130.65 ? 231 PHE A C     1 
ATOM   1777  O O     . PHE A 1 231 ? 4.655   -30.393 235.898 1.00 135.58 ? 231 PHE A O     1 
ATOM   1778  C CB    . PHE A 1 231 ? 6.480   -28.993 233.568 1.00 125.49 ? 231 PHE A CB    1 
ATOM   1779  C CG    . PHE A 1 231 ? 5.043   -28.783 233.168 1.00 123.77 ? 231 PHE A CG    1 
ATOM   1780  C CD1   . PHE A 1 231 ? 4.369   -27.627 233.530 1.00 122.45 ? 231 PHE A CD1   1 
ATOM   1781  C CD2   . PHE A 1 231 ? 4.368   -29.741 232.428 1.00 120.31 ? 231 PHE A CD2   1 
ATOM   1782  C CE1   . PHE A 1 231 ? 3.048   -27.432 233.162 1.00 116.61 ? 231 PHE A CE1   1 
ATOM   1783  C CE2   . PHE A 1 231 ? 3.048   -29.552 232.059 1.00 115.85 ? 231 PHE A CE2   1 
ATOM   1784  C CZ    . PHE A 1 231 ? 2.388   -28.396 232.426 1.00 114.05 ? 231 PHE A CZ    1 
ATOM   1785  N N     . ASP A 1 232 ? 6.203   -31.775 235.029 1.00 127.36 ? 232 ASP A N     1 
ATOM   1786  C CA    . ASP A 1 232 ? 5.466   -32.988 235.355 1.00 127.12 ? 232 ASP A CA    1 
ATOM   1787  C C     . ASP A 1 232 ? 5.558   -33.292 236.849 1.00 130.20 ? 232 ASP A C     1 
ATOM   1788  O O     . ASP A 1 232 ? 4.855   -34.163 237.358 1.00 131.23 ? 232 ASP A O     1 
ATOM   1789  C CB    . ASP A 1 232 ? 5.988   -34.172 234.538 1.00 126.56 ? 232 ASP A CB    1 
ATOM   1790  C CG    . ASP A 1 232 ? 5.759   -34.002 233.046 1.00 126.12 ? 232 ASP A CG    1 
ATOM   1791  O OD1   . ASP A 1 232 ? 5.414   -32.880 232.617 1.00 127.50 ? 232 ASP A OD1   1 
ATOM   1792  O OD2   . ASP A 1 232 ? 5.931   -34.989 232.299 1.00 123.83 ? 232 ASP A OD2   1 
ATOM   1793  N N     . LEU A 1 233 ? 6.428   -32.568 237.548 1.00 134.62 ? 233 LEU A N     1 
ATOM   1794  C CA    . LEU A 1 233 ? 6.594   -32.751 238.986 1.00 139.47 ? 233 LEU A CA    1 
ATOM   1795  C C     . LEU A 1 233 ? 5.799   -31.713 239.779 1.00 142.16 ? 233 LEU A C     1 
ATOM   1796  O O     . LEU A 1 233 ? 5.992   -31.554 240.985 1.00 145.09 ? 233 LEU A O     1 
ATOM   1797  C CB    . LEU A 1 233 ? 8.077   -32.711 239.371 1.00 138.95 ? 233 LEU A CB    1 
ATOM   1798  C CG    . LEU A 1 233 ? 8.821   -34.050 239.460 1.00 133.77 ? 233 LEU A CG    1 
ATOM   1799  C CD1   . LEU A 1 233 ? 8.650   -34.886 238.197 1.00 129.84 ? 233 LEU A CD1   1 
ATOM   1800  C CD2   . LEU A 1 233 ? 10.298  -33.819 239.751 1.00 132.58 ? 233 LEU A CD2   1 
ATOM   1801  N N     . GLY A 1 234 ? 4.907   -31.007 239.088 1.00 140.92 ? 234 GLY A N     1 
ATOM   1802  C CA    . GLY A 1 234 ? 4.005   -30.069 239.730 1.00 143.46 ? 234 GLY A CA    1 
ATOM   1803  C C     . GLY A 1 234 ? 4.667   -28.808 240.251 1.00 147.30 ? 234 GLY A C     1 
ATOM   1804  O O     . GLY A 1 234 ? 4.124   -28.129 241.124 1.00 151.06 ? 234 GLY A O     1 
ATOM   1805  N N     . GLU A 1 235 ? 5.843   -28.493 239.721 1.00 147.59 ? 235 GLU A N     1 
ATOM   1806  C CA    . GLU A 1 235 ? 6.546   -27.275 240.104 1.00 151.13 ? 235 GLU A CA    1 
ATOM   1807  C C     . GLU A 1 235 ? 5.823   -26.062 239.525 1.00 154.62 ? 235 GLU A C     1 
ATOM   1808  O O     . GLU A 1 235 ? 5.423   -26.078 238.361 1.00 157.82 ? 235 GLU A O     1 
ATOM   1809  C CB    . GLU A 1 235 ? 7.999   -27.325 239.623 1.00 151.08 ? 235 GLU A CB    1 
ATOM   1810  C CG    . GLU A 1 235 ? 8.814   -26.080 239.934 1.00 153.43 ? 235 GLU A CG    1 
ATOM   1811  C CD    . GLU A 1 235 ? 10.287  -26.253 239.624 1.00 153.72 ? 235 GLU A CD    1 
ATOM   1812  O OE1   . GLU A 1 235 ? 10.811  -27.369 239.827 1.00 150.52 ? 235 GLU A OE1   1 
ATOM   1813  O OE2   . GLU A 1 235 ? 10.919  -25.273 239.175 1.00 154.36 ? 235 GLU A OE2   1 
ATOM   1814  N N     . PRO A 1 236 ? 5.638   -25.013 240.346 1.00 153.69 ? 236 PRO A N     1 
ATOM   1815  C CA    . PRO A 1 236 ? 4.946   -23.782 239.940 1.00 152.17 ? 236 PRO A CA    1 
ATOM   1816  C C     . PRO A 1 236 ? 5.470   -23.197 238.629 1.00 150.16 ? 236 PRO A C     1 
ATOM   1817  O O     . PRO A 1 236 ? 6.675   -22.994 238.480 1.00 148.74 ? 236 PRO A O     1 
ATOM   1818  C CB    . PRO A 1 236 ? 5.224   -22.819 241.106 1.00 153.82 ? 236 PRO A CB    1 
ATOM   1819  C CG    . PRO A 1 236 ? 6.294   -23.482 241.938 1.00 155.94 ? 236 PRO A CG    1 
ATOM   1820  C CD    . PRO A 1 236 ? 6.079   -24.943 241.747 1.00 155.74 ? 236 PRO A CD    1 
ATOM   1821  N N     . LEU A 1 237 ? 4.558   -22.937 237.695 1.00 149.92 ? 237 LEU A N     1 
ATOM   1822  C CA    . LEU A 1 237 ? 4.911   -22.413 236.377 1.00 148.86 ? 237 LEU A CA    1 
ATOM   1823  C C     . LEU A 1 237 ? 5.638   -21.077 236.443 1.00 146.88 ? 237 LEU A C     1 
ATOM   1824  O O     . LEU A 1 237 ? 6.492   -20.788 235.604 1.00 144.60 ? 237 LEU A O     1 
ATOM   1825  C CB    . LEU A 1 237 ? 3.661   -22.253 235.507 1.00 149.61 ? 237 LEU A CB    1 
ATOM   1826  C CG    . LEU A 1 237 ? 3.500   -23.219 234.330 1.00 148.46 ? 237 LEU A CG    1 
ATOM   1827  C CD1   . LEU A 1 237 ? 2.586   -22.619 233.272 1.00 144.49 ? 237 LEU A CD1   1 
ATOM   1828  C CD2   . LEU A 1 237 ? 4.851   -23.594 233.734 1.00 149.10 ? 237 LEU A CD2   1 
ATOM   1829  N N     . GLU A 1 238 ? 5.282   -20.266 237.435 1.00 148.84 ? 238 GLU A N     1 
ATOM   1830  C CA    . GLU A 1 238 ? 5.834   -18.924 237.588 1.00 153.56 ? 238 GLU A CA    1 
ATOM   1831  C C     . GLU A 1 238 ? 7.359   -18.941 237.608 1.00 154.85 ? 238 GLU A C     1 
ATOM   1832  O O     . GLU A 1 238 ? 8.009   -18.146 236.928 1.00 154.50 ? 238 GLU A O     1 
ATOM   1833  C CB    . GLU A 1 238 ? 5.301   -18.285 238.869 1.00 158.67 ? 238 GLU A CB    1 
ATOM   1834  C CG    . GLU A 1 238 ? 5.859   -16.908 239.163 1.00 163.71 ? 238 GLU A CG    1 
ATOM   1835  C CD    . GLU A 1 238 ? 5.548   -16.459 240.575 1.00 169.66 ? 238 GLU A CD    1 
ATOM   1836  O OE1   . GLU A 1 238 ? 5.210   -17.327 241.409 1.00 171.93 ? 238 GLU A OE1   1 
ATOM   1837  O OE2   . GLU A 1 238 ? 5.636   -15.245 240.852 1.00 171.12 ? 238 GLU A OE2   1 
ATOM   1838  N N     . GLU A 1 239 ? 7.917   -19.860 238.389 1.00 154.85 ? 239 GLU A N     1 
ATOM   1839  C CA    . GLU A 1 239 ? 9.359   -20.050 238.463 1.00 153.76 ? 239 GLU A CA    1 
ATOM   1840  C C     . GLU A 1 239 ? 9.852   -20.720 237.190 1.00 146.75 ? 239 GLU A C     1 
ATOM   1841  O O     . GLU A 1 239 ? 10.870  -20.327 236.613 1.00 144.66 ? 239 GLU A O     1 
ATOM   1842  C CB    . GLU A 1 239 ? 9.701   -20.945 239.652 1.00 157.46 ? 239 GLU A CB    1 
ATOM   1843  C CG    . GLU A 1 239 ? 9.126   -20.480 240.976 1.00 159.24 ? 239 GLU A CG    1 
ATOM   1844  C CD    . GLU A 1 239 ? 9.241   -21.538 242.056 1.00 159.86 ? 239 GLU A CD    1 
ATOM   1845  O OE1   . GLU A 1 239 ? 9.523   -22.707 241.714 1.00 159.24 ? 239 GLU A OE1   1 
ATOM   1846  O OE2   . GLU A 1 239 ? 9.050   -21.202 243.244 1.00 160.70 ? 239 GLU A OE2   1 
ATOM   1847  N N     . LEU A 1 240 ? 9.109   -21.740 236.773 1.00 141.57 ? 240 LEU A N     1 
ATOM   1848  C CA    . LEU A 1 240 ? 9.444   -22.557 235.615 1.00 135.25 ? 240 LEU A CA    1 
ATOM   1849  C C     . LEU A 1 240 ? 9.627   -21.727 234.346 1.00 135.01 ? 240 LEU A C     1 
ATOM   1850  O O     . LEU A 1 240 ? 10.546  -21.975 233.564 1.00 134.17 ? 240 LEU A O     1 
ATOM   1851  C CB    . LEU A 1 240 ? 8.351   -23.604 235.401 1.00 131.44 ? 240 LEU A CB    1 
ATOM   1852  C CG    . LEU A 1 240 ? 8.785   -25.034 235.087 1.00 131.84 ? 240 LEU A CG    1 
ATOM   1853  C CD1   . LEU A 1 240 ? 9.889   -25.477 236.027 1.00 134.75 ? 240 LEU A CD1   1 
ATOM   1854  C CD2   . LEU A 1 240 ? 7.589   -25.953 235.210 1.00 132.07 ? 240 LEU A CD2   1 
ATOM   1855  N N     . LEU A 1 241 ? 8.753   -20.744 234.148 1.00 135.35 ? 241 LEU A N     1 
ATOM   1856  C CA    . LEU A 1 241 ? 8.816   -19.890 232.965 1.00 132.77 ? 241 LEU A CA    1 
ATOM   1857  C C     . LEU A 1 241 ? 10.100  -19.071 232.908 1.00 134.70 ? 241 LEU A C     1 
ATOM   1858  O O     . LEU A 1 241 ? 10.651  -18.844 231.830 1.00 132.19 ? 241 LEU A O     1 
ATOM   1859  C CB    . LEU A 1 241 ? 7.604   -18.958 232.893 1.00 128.35 ? 241 LEU A CB    1 
ATOM   1860  C CG    . LEU A 1 241 ? 6.326   -19.538 232.285 1.00 121.90 ? 241 LEU A CG    1 
ATOM   1861  C CD1   . LEU A 1 241 ? 5.279   -18.450 232.094 1.00 118.48 ? 241 LEU A CD1   1 
ATOM   1862  C CD2   . LEU A 1 241 ? 6.631   -20.229 230.966 1.00 120.10 ? 241 LEU A CD2   1 
ATOM   1863  N N     . ALA A 1 242 ? 10.574  -18.633 234.070 1.00 138.96 ? 242 ALA A N     1 
ATOM   1864  C CA    . ALA A 1 242 ? 11.800  -17.845 234.144 1.00 140.02 ? 242 ALA A CA    1 
ATOM   1865  C C     . ALA A 1 242 ? 13.013  -18.664 233.706 1.00 139.48 ? 242 ALA A C     1 
ATOM   1866  O O     . ALA A 1 242 ? 14.066  -18.111 233.390 1.00 139.35 ? 242 ALA A O     1 
ATOM   1867  C CB    . ALA A 1 242 ? 11.999  -17.297 235.549 1.00 140.26 ? 242 ALA A CB    1 
ATOM   1868  N N     . GLY A 1 243 ? 12.852  -19.984 233.691 1.00 137.92 ? 243 GLY A N     1 
ATOM   1869  C CA    . GLY A 1 243 ? 13.891  -20.883 233.226 1.00 138.78 ? 243 GLY A CA    1 
ATOM   1870  C C     . GLY A 1 243 ? 14.000  -20.893 231.713 1.00 137.92 ? 243 GLY A C     1 
ATOM   1871  O O     . GLY A 1 243 ? 15.097  -20.969 231.163 1.00 139.07 ? 243 GLY A O     1 
ATOM   1872  N N     . LEU A 1 244 ? 12.856  -20.816 231.041 1.00 135.35 ? 244 LEU A N     1 
ATOM   1873  C CA    . LEU A 1 244 ? 12.818  -20.762 229.582 1.00 131.93 ? 244 LEU A CA    1 
ATOM   1874  C C     . LEU A 1 244 ? 13.444  -19.480 229.041 1.00 130.20 ? 244 LEU A C     1 
ATOM   1875  O O     . LEU A 1 244 ? 13.311  -18.418 229.649 1.00 128.61 ? 244 LEU A O     1 
ATOM   1876  C CB    . LEU A 1 244 ? 11.378  -20.885 229.080 1.00 131.95 ? 244 LEU A CB    1 
ATOM   1877  C CG    . LEU A 1 244 ? 10.802  -22.299 229.071 1.00 132.15 ? 244 LEU A CG    1 
ATOM   1878  C CD1   . LEU A 1 244 ? 9.425   -22.308 228.424 1.00 128.95 ? 244 LEU A CD1   1 
ATOM   1879  C CD2   . LEU A 1 244 ? 11.753  -23.239 228.348 1.00 132.30 ? 244 LEU A CD2   1 
ATOM   1880  N N     . PRO A 1 245 ? 14.131  -19.580 227.890 1.00 130.97 ? 245 PRO A N     1 
ATOM   1881  C CA    . PRO A 1 245 ? 14.775  -18.433 227.239 1.00 132.91 ? 245 PRO A CA    1 
ATOM   1882  C C     . PRO A 1 245 ? 13.764  -17.433 226.689 1.00 132.36 ? 245 PRO A C     1 
ATOM   1883  O O     . PRO A 1 245 ? 12.664  -17.818 226.292 1.00 132.52 ? 245 PRO A O     1 
ATOM   1884  C CB    . PRO A 1 245 ? 15.541  -19.073 226.073 1.00 130.12 ? 245 PRO A CB    1 
ATOM   1885  C CG    . PRO A 1 245 ? 15.639  -20.519 226.410 1.00 128.95 ? 245 PRO A CG    1 
ATOM   1886  C CD    . PRO A 1 245 ? 14.398  -20.837 227.173 1.00 128.77 ? 245 PRO A CD    1 
ATOM   1887  N N     . GLY A 1 246 ? 14.143  -16.159 226.659 1.00 131.31 ? 246 GLY A N     1 
ATOM   1888  C CA    . GLY A 1 246 ? 13.288  -15.125 226.109 1.00 132.87 ? 246 GLY A CA    1 
ATOM   1889  C C     . GLY A 1 246 ? 13.227  -15.194 224.596 1.00 130.25 ? 246 GLY A C     1 
ATOM   1890  O O     . GLY A 1 246 ? 12.178  -15.479 224.019 1.00 124.16 ? 246 GLY A O     1 
ATOM   1891  N N     . GLU A 1 247 ? 14.361  -14.933 223.953 1.00 132.94 ? 247 GLU A N     1 
ATOM   1892  C CA    . GLU A 1 247 ? 14.452  -15.006 222.499 1.00 133.01 ? 247 GLU A CA    1 
ATOM   1893  C C     . GLU A 1 247 ? 14.491  -16.461 222.037 1.00 123.55 ? 247 GLU A C     1 
ATOM   1894  O O     . GLU A 1 247 ? 15.003  -17.327 222.748 1.00 125.14 ? 247 GLU A O     1 
ATOM   1895  C CB    . GLU A 1 247 ? 15.686  -14.249 221.991 1.00 143.94 ? 247 GLU A CB    1 
ATOM   1896  C CG    . GLU A 1 247 ? 17.021  -14.917 222.299 1.00 151.09 ? 247 GLU A CG    1 
ATOM   1897  C CD    . GLU A 1 247 ? 17.427  -14.781 223.753 1.00 156.49 ? 247 GLU A CD    1 
ATOM   1898  O OE1   . GLU A 1 247 ? 16.954  -13.834 224.418 1.00 158.95 ? 247 GLU A OE1   1 
ATOM   1899  O OE2   . GLU A 1 247 ? 18.216  -15.622 224.232 1.00 156.93 ? 247 GLU A OE2   1 
ATOM   1900  N N     . PRO A 1 248 ? 13.933  -16.733 220.847 1.00 115.06 ? 248 PRO A N     1 
ATOM   1901  C CA    . PRO A 1 248 ? 13.904  -18.080 220.267 1.00 113.26 ? 248 PRO A CA    1 
ATOM   1902  C C     . PRO A 1 248 ? 15.293  -18.675 220.077 1.00 115.31 ? 248 PRO A C     1 
ATOM   1903  O O     . PRO A 1 248 ? 16.274  -17.942 219.939 1.00 118.63 ? 248 PRO A O     1 
ATOM   1904  C CB    . PRO A 1 248 ? 13.259  -17.853 218.897 1.00 110.32 ? 248 PRO A CB    1 
ATOM   1905  C CG    . PRO A 1 248 ? 12.431  -16.641 219.070 1.00 111.15 ? 248 PRO A CG    1 
ATOM   1906  C CD    . PRO A 1 248 ? 13.201  -15.765 220.012 1.00 113.13 ? 248 PRO A CD    1 
ATOM   1907  N N     . TYR A 1 249 ? 15.365  -20.001 220.070 1.00 113.61 ? 249 TYR A N     1 
ATOM   1908  C CA    . TYR A 1 249 ? 16.608  -20.697 219.772 1.00 115.20 ? 249 TYR A CA    1 
ATOM   1909  C C     . TYR A 1 249 ? 16.957  -20.539 218.293 1.00 119.26 ? 249 TYR A C     1 
ATOM   1910  O O     . TYR A 1 249 ? 16.072  -20.504 217.436 1.00 118.46 ? 249 TYR A O     1 
ATOM   1911  C CB    . TYR A 1 249 ? 16.494  -22.184 220.125 1.00 107.95 ? 249 TYR A CB    1 
ATOM   1912  C CG    . TYR A 1 249 ? 16.572  -22.502 221.606 1.00 103.79 ? 249 TYR A CG    1 
ATOM   1913  C CD1   . TYR A 1 249 ? 17.794  -22.542 222.263 1.00 104.75 ? 249 TYR A CD1   1 
ATOM   1914  C CD2   . TYR A 1 249 ? 15.427  -22.788 222.340 1.00 104.68 ? 249 TYR A CD2   1 
ATOM   1915  C CE1   . TYR A 1 249 ? 17.874  -22.842 223.611 1.00 107.45 ? 249 TYR A CE1   1 
ATOM   1916  C CE2   . TYR A 1 249 ? 15.499  -23.091 223.692 1.00 105.81 ? 249 TYR A CE2   1 
ATOM   1917  C CZ    . TYR A 1 249 ? 16.726  -23.116 224.320 1.00 108.59 ? 249 TYR A CZ    1 
ATOM   1918  O OH    . TYR A 1 249 ? 16.809  -23.417 225.662 1.00 112.07 ? 249 TYR A OH    1 
ATOM   1919  N N     . ALA A 1 250 ? 18.251  -20.442 218.005 1.00 120.51 ? 250 ALA A N     1 
ATOM   1920  C CA    . ALA A 1 250 ? 18.731  -20.347 216.631 1.00 113.92 ? 250 ALA A CA    1 
ATOM   1921  C C     . ALA A 1 250 ? 18.576  -21.680 215.911 1.00 114.25 ? 250 ALA A C     1 
ATOM   1922  O O     . ALA A 1 250 ? 18.469  -21.729 214.686 1.00 112.23 ? 250 ALA A O     1 
ATOM   1923  C CB    . ALA A 1 250 ? 20.183  -19.908 216.613 1.00 108.77 ? 250 ALA A CB    1 
ATOM   1924  N N     . ASN A 1 251 ? 18.569  -22.763 216.679 1.00 119.40 ? 251 ASN A N     1 
ATOM   1925  C CA    . ASN A 1 251 ? 18.492  -24.094 216.100 1.00 124.23 ? 251 ASN A CA    1 
ATOM   1926  C C     . ASN A 1 251 ? 17.051  -24.553 215.892 1.00 131.20 ? 251 ASN A C     1 
ATOM   1927  O O     . ASN A 1 251 ? 16.228  -24.459 216.804 1.00 134.72 ? 251 ASN A O     1 
ATOM   1928  C CB    . ASN A 1 251 ? 19.262  -25.098 216.959 1.00 122.45 ? 251 ASN A CB    1 
ATOM   1929  C CG    . ASN A 1 251 ? 19.282  -26.483 216.352 1.00 119.37 ? 251 ASN A CG    1 
ATOM   1930  O OD1   . ASN A 1 251 ? 20.164  -26.814 215.560 1.00 124.88 ? 251 ASN A OD1   1 
ATOM   1931  N ND2   . ASN A 1 251 ? 18.304  -27.302 216.718 1.00 111.71 ? 251 ASN A ND2   1 
ATOM   1932  N N     . PRO A 1 252 ? 16.747  -25.041 214.678 1.00 132.68 ? 252 PRO A N     1 
ATOM   1933  C CA    . PRO A 1 252 ? 15.416  -25.502 214.259 1.00 128.77 ? 252 PRO A CA    1 
ATOM   1934  C C     . PRO A 1 252 ? 14.757  -26.482 215.231 1.00 124.49 ? 252 PRO A C     1 
ATOM   1935  O O     . PRO A 1 252 ? 13.661  -26.185 215.711 1.00 119.10 ? 252 PRO A O     1 
ATOM   1936  C CB    . PRO A 1 252 ? 15.697  -26.191 212.923 1.00 131.69 ? 252 PRO A CB    1 
ATOM   1937  C CG    . PRO A 1 252 ? 16.875  -25.460 212.380 1.00 133.77 ? 252 PRO A CG    1 
ATOM   1938  C CD    . PRO A 1 252 ? 17.719  -25.088 213.569 1.00 134.10 ? 252 PRO A CD    1 
ATOM   1939  N N     . TRP A 1 253 ? 15.404  -27.619 215.501 1.00 129.77 ? 253 TRP A N     1 
ATOM   1940  C CA    . TRP A 1 253 ? 14.874  -28.623 216.427 1.00 133.89 ? 253 TRP A CA    1 
ATOM   1941  C C     . TRP A 1 253 ? 14.542  -27.974 217.760 1.00 127.29 ? 253 TRP A C     1 
ATOM   1942  O O     . TRP A 1 253 ? 13.426  -28.088 218.269 1.00 124.39 ? 253 TRP A O     1 
ATOM   1943  C CB    . TRP A 1 253 ? 15.898  -29.734 216.704 1.00 144.69 ? 253 TRP A CB    1 
ATOM   1944  C CG    . TRP A 1 253 ? 16.355  -30.541 215.520 1.00 156.35 ? 253 TRP A CG    1 
ATOM   1945  C CD1   . TRP A 1 253 ? 15.848  -30.511 214.254 1.00 160.26 ? 253 TRP A CD1   1 
ATOM   1946  C CD2   . TRP A 1 253 ? 17.422  -31.503 215.502 1.00 162.89 ? 253 TRP A CD2   1 
ATOM   1947  N NE1   . TRP A 1 253 ? 16.532  -31.392 213.449 1.00 162.69 ? 253 TRP A NE1   1 
ATOM   1948  C CE2   . TRP A 1 253 ? 17.503  -32.013 214.191 1.00 164.21 ? 253 TRP A CE2   1 
ATOM   1949  C CE3   . TRP A 1 253 ? 18.317  -31.980 216.468 1.00 163.90 ? 253 TRP A CE3   1 
ATOM   1950  C CZ2   . TRP A 1 253 ? 18.442  -32.976 213.818 1.00 163.86 ? 253 TRP A CZ2   1 
ATOM   1951  C CZ3   . TRP A 1 253 ? 19.249  -32.938 216.097 1.00 163.51 ? 253 TRP A CZ3   1 
ATOM   1952  C CH2   . TRP A 1 253 ? 19.304  -33.424 214.783 1.00 163.76 ? 253 TRP A CH2   1 
ATOM   1953  N N     . LEU A 1 254 ? 15.537  -27.291 218.316 1.00 123.61 ? 254 LEU A N     1 
ATOM   1954  C CA    . LEU A 1 254 ? 15.449  -26.730 219.656 1.00 118.13 ? 254 LEU A CA    1 
ATOM   1955  C C     . LEU A 1 254 ? 14.354  -25.683 219.795 1.00 115.51 ? 254 LEU A C     1 
ATOM   1956  O O     . LEU A 1 254 ? 13.739  -25.560 220.854 1.00 113.48 ? 254 LEU A O     1 
ATOM   1957  C CB    . LEU A 1 254 ? 16.797  -26.142 220.072 1.00 112.63 ? 254 LEU A CB    1 
ATOM   1958  C CG    . LEU A 1 254 ? 17.843  -27.168 220.504 1.00 105.47 ? 254 LEU A CG    1 
ATOM   1959  C CD1   . LEU A 1 254 ? 19.214  -26.528 220.547 1.00 109.16 ? 254 LEU A CD1   1 
ATOM   1960  C CD2   . LEU A 1 254 ? 17.480  -27.751 221.864 1.00 100.85 ? 254 LEU A CD2   1 
ATOM   1961  N N     . GLU A 1 255 ? 14.108  -24.931 218.729 1.00 113.07 ? 255 GLU A N     1 
ATOM   1962  C CA    . GLU A 1 255 ? 13.073  -23.909 218.772 1.00 111.58 ? 255 GLU A CA    1 
ATOM   1963  C C     . GLU A 1 255 ? 11.686  -24.533 218.831 1.00 110.79 ? 255 GLU A C     1 
ATOM   1964  O O     . GLU A 1 255 ? 10.844  -24.112 219.623 1.00 114.05 ? 255 GLU A O     1 
ATOM   1965  C CB    . GLU A 1 255 ? 13.186  -22.951 217.585 1.00 113.73 ? 255 GLU A CB    1 
ATOM   1966  C CG    . GLU A 1 255 ? 11.998  -22.005 217.432 1.00 116.24 ? 255 GLU A CG    1 
ATOM   1967  C CD    . GLU A 1 255 ? 11.867  -21.002 218.570 1.00 114.81 ? 255 GLU A CD    1 
ATOM   1968  O OE1   . GLU A 1 255 ? 12.764  -20.943 219.437 1.00 116.75 ? 255 GLU A OE1   1 
ATOM   1969  O OE2   . GLU A 1 255 ? 10.859  -20.263 218.591 1.00 111.49 ? 255 GLU A OE2   1 
ATOM   1970  N N     . GLY A 1 256 ? 11.461  -25.545 217.999 1.00 104.91 ? 256 GLY A N     1 
ATOM   1971  C CA    . GLY A 1 256 ? 10.208  -26.275 218.007 1.00 101.66 ? 256 GLY A CA    1 
ATOM   1972  C C     . GLY A 1 256 ? 9.918   -26.922 219.348 1.00 98.55  ? 256 GLY A C     1 
ATOM   1973  O O     . GLY A 1 256 ? 8.761   -27.058 219.738 1.00 96.99  ? 256 GLY A O     1 
ATOM   1974  N N     . ARG A 1 257 ? 10.968  -27.320 220.059 1.00 99.55  ? 257 ARG A N     1 
ATOM   1975  C CA    . ARG A 1 257 ? 10.805  -27.940 221.369 1.00 106.03 ? 257 ARG A CA    1 
ATOM   1976  C C     . ARG A 1 257 ? 10.507  -26.896 222.440 1.00 104.49 ? 257 ARG A C     1 
ATOM   1977  O O     . ARG A 1 257 ? 9.657   -27.108 223.306 1.00 104.09 ? 257 ARG A O     1 
ATOM   1978  C CB    . ARG A 1 257 ? 12.045  -28.752 221.743 1.00 114.42 ? 257 ARG A CB    1 
ATOM   1979  C CG    . ARG A 1 257 ? 12.347  -29.885 220.777 1.00 119.88 ? 257 ARG A CG    1 
ATOM   1980  C CD    . ARG A 1 257 ? 13.499  -30.743 221.267 1.00 124.59 ? 257 ARG A CD    1 
ATOM   1981  N NE    . ARG A 1 257 ? 13.195  -31.407 222.532 1.00 131.59 ? 257 ARG A NE    1 
ATOM   1982  C CZ    . ARG A 1 257 ? 12.619  -32.602 222.629 1.00 137.80 ? 257 ARG A CZ    1 
ATOM   1983  N NH1   . ARG A 1 257 ? 12.279  -33.266 221.533 1.00 139.48 ? 257 ARG A NH1   1 
ATOM   1984  N NH2   . ARG A 1 257 ? 12.382  -33.133 223.822 1.00 138.92 ? 257 ARG A NH2   1 
ATOM   1985  N N     . ARG A 1 258 ? 11.212  -25.770 222.371 1.00 102.41 ? 258 ARG A N     1 
ATOM   1986  C CA    . ARG A 1 258 ? 10.993  -24.665 223.297 1.00 101.55 ? 258 ARG A CA    1 
ATOM   1987  C C     . ARG A 1 258 ? 9.580   -24.140 223.137 1.00 101.24 ? 258 ARG A C     1 
ATOM   1988  O O     . ARG A 1 258 ? 8.939   -23.705 224.095 1.00 99.27  ? 258 ARG A O     1 
ATOM   1989  C CB    . ARG A 1 258 ? 11.969  -23.528 223.008 1.00 102.41 ? 258 ARG A CB    1 
ATOM   1990  C CG    . ARG A 1 258 ? 11.783  -22.329 223.922 1.00 109.04 ? 258 ARG A CG    1 
ATOM   1991  C CD    . ARG A 1 258 ? 12.516  -21.105 223.405 1.00 116.56 ? 258 ARG A CD    1 
ATOM   1992  N NE    . ARG A 1 258 ? 11.857  -20.518 222.242 1.00 121.03 ? 258 ARG A NE    1 
ATOM   1993  C CZ    . ARG A 1 258 ? 10.938  -19.561 222.310 1.00 120.31 ? 258 ARG A CZ    1 
ATOM   1994  N NH1   . ARG A 1 258 ? 10.392  -19.082 221.201 1.00 115.95 ? 258 ARG A NH1   1 
ATOM   1995  N NH2   . ARG A 1 258 ? 10.564  -19.080 223.488 1.00 123.03 ? 258 ARG A NH2   1 
ATOM   1996  N N     . VAL A 1 259 ? 9.108   -24.192 221.900 1.00 103.15 ? 259 VAL A N     1 
ATOM   1997  C CA    . VAL A 1 259 ? 7.816   -23.648 221.533 1.00 102.18 ? 259 VAL A CA    1 
ATOM   1998  C C     . VAL A 1 259 ? 6.701   -24.665 221.789 1.00 103.47 ? 259 VAL A C     1 
ATOM   1999  O O     . VAL A 1 259 ? 5.559   -24.291 222.064 1.00 100.35 ? 259 VAL A O     1 
ATOM   2000  C CB    . VAL A 1 259 ? 7.845   -23.169 220.063 1.00 99.38  ? 259 VAL A CB    1 
ATOM   2001  C CG1   . VAL A 1 259 ? 6.837   -23.916 219.210 1.00 100.02 ? 259 VAL A CG1   1 
ATOM   2002  C CG2   . VAL A 1 259 ? 7.642   -21.666 219.994 1.00 101.05 ? 259 VAL A CG2   1 
ATOM   2003  N N     . LYS A 1 260 ? 7.044   -25.949 221.720 1.00 104.24 ? 260 LYS A N     1 
ATOM   2004  C CA    . LYS A 1 260 ? 6.098   -27.012 222.044 1.00 100.44 ? 260 LYS A CA    1 
ATOM   2005  C C     . LYS A 1 260 ? 5.900   -27.053 223.553 1.00 94.38  ? 260 LYS A C     1 
ATOM   2006  O O     . LYS A 1 260 ? 4.824   -27.388 224.044 1.00 91.10  ? 260 LYS A O     1 
ATOM   2007  C CB    . LYS A 1 260 ? 6.611   -28.361 221.528 1.00 99.19  ? 260 LYS A CB    1 
ATOM   2008  C CG    . LYS A 1 260 ? 5.682   -29.555 221.736 1.00 94.29  ? 260 LYS A CG    1 
ATOM   2009  C CD    . LYS A 1 260 ? 5.825   -30.548 220.581 1.00 98.18  ? 260 LYS A CD    1 
ATOM   2010  C CE    . LYS A 1 260 ? 5.342   -31.945 220.945 1.00 104.37 ? 260 LYS A CE    1 
ATOM   2011  N NZ    . LYS A 1 260 ? 6.282   -32.661 221.855 1.00 108.36 ? 260 LYS A NZ    1 
ATOM   2012  N N     . LEU A 1 261 ? 6.949   -26.694 224.283 1.00 92.41  ? 261 LEU A N     1 
ATOM   2013  C CA    . LEU A 1 261 ? 6.901   -26.680 225.738 1.00 95.26  ? 261 LEU A CA    1 
ATOM   2014  C C     . LEU A 1 261 ? 6.016   -25.533 226.215 1.00 99.40  ? 261 LEU A C     1 
ATOM   2015  O O     . LEU A 1 261 ? 5.212   -25.693 227.138 1.00 93.22  ? 261 LEU A O     1 
ATOM   2016  C CB    . LEU A 1 261 ? 8.312   -26.538 226.308 1.00 95.97  ? 261 LEU A CB    1 
ATOM   2017  C CG    . LEU A 1 261 ? 8.513   -26.799 227.800 1.00 96.89  ? 261 LEU A CG    1 
ATOM   2018  C CD1   . LEU A 1 261 ? 8.116   -28.223 228.150 1.00 99.89  ? 261 LEU A CD1   1 
ATOM   2019  C CD2   . LEU A 1 261 ? 9.960   -26.531 228.188 1.00 98.28  ? 261 LEU A CD2   1 
ATOM   2020  N N     . LEU A 1 262 ? 6.173   -24.378 225.572 1.00 105.50 ? 262 LEU A N     1 
ATOM   2021  C CA    . LEU A 1 262 ? 5.353   -23.205 225.853 1.00 102.96 ? 262 LEU A CA    1 
ATOM   2022  C C     . LEU A 1 262 ? 3.885   -23.499 225.581 1.00 103.04 ? 262 LEU A C     1 
ATOM   2023  O O     . LEU A 1 262 ? 3.004   -23.040 226.308 1.00 105.11 ? 262 LEU A O     1 
ATOM   2024  C CB    . LEU A 1 262 ? 5.802   -22.024 224.991 1.00 99.55  ? 262 LEU A CB    1 
ATOM   2025  C CG    . LEU A 1 262 ? 6.952   -21.154 225.498 1.00 101.55 ? 262 LEU A CG    1 
ATOM   2026  C CD1   . LEU A 1 262 ? 7.338   -20.126 224.446 1.00 103.00 ? 262 LEU A CD1   1 
ATOM   2027  C CD2   . LEU A 1 262 ? 6.562   -20.468 226.793 1.00 102.06 ? 262 LEU A CD2   1 
ATOM   2028  N N     . PHE A 1 263 ? 3.636   -24.265 224.524 1.00 100.71 ? 263 PHE A N     1 
ATOM   2029  C CA    . PHE A 1 263 ? 2.283   -24.644 224.133 1.00 102.95 ? 263 PHE A CA    1 
ATOM   2030  C C     . PHE A 1 263 ? 1.605   -25.467 225.220 1.00 106.85 ? 263 PHE A C     1 
ATOM   2031  O O     . PHE A 1 263 ? 0.409   -25.315 225.473 1.00 106.68 ? 263 PHE A O     1 
ATOM   2032  C CB    . PHE A 1 263 ? 2.319   -25.438 222.823 1.00 102.57 ? 263 PHE A CB    1 
ATOM   2033  C CG    . PHE A 1 263 ? 0.963   -25.871 222.330 1.00 102.51 ? 263 PHE A CG    1 
ATOM   2034  C CD1   . PHE A 1 263 ? 0.188   -25.021 221.557 1.00 105.03 ? 263 PHE A CD1   1 
ATOM   2035  C CD2   . PHE A 1 263 ? 0.473   -27.137 222.619 1.00 100.41 ? 263 PHE A CD2   1 
ATOM   2036  C CE1   . PHE A 1 263 ? -1.054  -25.419 221.094 1.00 105.92 ? 263 PHE A CE1   1 
ATOM   2037  C CE2   . PHE A 1 263 ? -0.769  -27.539 222.159 1.00 100.29 ? 263 PHE A CE2   1 
ATOM   2038  C CZ    . PHE A 1 263 ? -1.532  -26.679 221.395 1.00 102.10 ? 263 PHE A CZ    1 
ATOM   2039  N N     . GLN A 1 264 ? 2.374   -26.340 225.861 1.00 107.97 ? 264 GLN A N     1 
ATOM   2040  C CA    . GLN A 1 264 ? 1.825   -27.235 226.870 1.00 106.59 ? 264 GLN A CA    1 
ATOM   2041  C C     . GLN A 1 264 ? 1.583   -26.511 228.189 1.00 103.18 ? 264 GLN A C     1 
ATOM   2042  O O     . GLN A 1 264 ? 0.642   -26.835 228.916 1.00 100.56 ? 264 GLN A O     1 
ATOM   2043  C CB    . GLN A 1 264 ? 2.745   -28.436 227.071 1.00 110.32 ? 264 GLN A CB    1 
ATOM   2044  C CG    . GLN A 1 264 ? 2.937   -29.263 225.814 1.00 113.12 ? 264 GLN A CG    1 
ATOM   2045  C CD    . GLN A 1 264 ? 4.079   -30.243 225.940 1.00 115.31 ? 264 GLN A CD    1 
ATOM   2046  O OE1   . GLN A 1 264 ? 4.869   -30.418 225.012 1.00 120.71 ? 264 GLN A OE1   1 
ATOM   2047  N NE2   . GLN A 1 264 ? 4.177   -30.889 227.096 1.00 110.74 ? 264 GLN A NE2   1 
ATOM   2048  N N     . PHE A 1 265 ? 2.430   -25.533 228.494 1.00 104.61 ? 265 PHE A N     1 
ATOM   2049  C CA    . PHE A 1 265 ? 2.248   -24.723 229.694 1.00 109.94 ? 265 PHE A CA    1 
ATOM   2050  C C     . PHE A 1 265 ? 0.929   -23.969 229.602 1.00 111.69 ? 265 PHE A C     1 
ATOM   2051  O O     . PHE A 1 265 ? 0.224   -23.798 230.597 1.00 109.89 ? 265 PHE A O     1 
ATOM   2052  C CB    . PHE A 1 265 ? 3.400   -23.732 229.871 1.00 112.01 ? 265 PHE A CB    1 
ATOM   2053  C CG    . PHE A 1 265 ? 4.716   -24.377 230.203 1.00 115.07 ? 265 PHE A CG    1 
ATOM   2054  C CD1   . PHE A 1 265 ? 4.788   -25.725 230.515 1.00 116.91 ? 265 PHE A CD1   1 
ATOM   2055  C CD2   . PHE A 1 265 ? 5.882   -23.630 230.212 1.00 116.31 ? 265 PHE A CD2   1 
ATOM   2056  C CE1   . PHE A 1 265 ? 5.999   -26.317 230.819 1.00 116.05 ? 265 PHE A CE1   1 
ATOM   2057  C CE2   . PHE A 1 265 ? 7.095   -24.215 230.518 1.00 117.81 ? 265 PHE A CE2   1 
ATOM   2058  C CZ    . PHE A 1 265 ? 7.153   -25.561 230.823 1.00 116.68 ? 265 PHE A CZ    1 
ATOM   2059  N N     . ALA A 1 266 ? 0.603   -23.525 228.392 1.00 113.52 ? 266 ALA A N     1 
ATOM   2060  C CA    . ALA A 1 266 ? -0.630  -22.791 228.149 1.00 110.16 ? 266 ALA A CA    1 
ATOM   2061  C C     . ALA A 1 266 ? -1.828  -23.731 228.182 1.00 111.05 ? 266 ALA A C     1 
ATOM   2062  O O     . ALA A 1 266 ? -2.925  -23.336 228.580 1.00 110.72 ? 266 ALA A O     1 
ATOM   2063  C CB    . ALA A 1 266 ? -0.559  -22.063 226.823 1.00 104.26 ? 266 ALA A CB    1 
ATOM   2064  N N     . GLN A 1 267 ? -1.613  -24.974 227.762 1.00 109.54 ? 267 GLN A N     1 
ATOM   2065  C CA    . GLN A 1 267 ? -2.646  -25.997 227.857 1.00 106.93 ? 267 GLN A CA    1 
ATOM   2066  C C     . GLN A 1 267 ? -3.011  -26.258 229.311 1.00 106.45 ? 267 GLN A C     1 
ATOM   2067  O O     . GLN A 1 267 ? -4.188  -26.367 229.653 1.00 106.03 ? 267 GLN A O     1 
ATOM   2068  C CB    . GLN A 1 267 ? -2.189  -27.297 227.200 1.00 108.40 ? 267 GLN A CB    1 
ATOM   2069  C CG    . GLN A 1 267 ? -2.366  -27.326 225.698 1.00 112.34 ? 267 GLN A CG    1 
ATOM   2070  C CD    . GLN A 1 267 ? -2.195  -28.718 225.130 1.00 118.75 ? 267 GLN A CD    1 
ATOM   2071  O OE1   . GLN A 1 267 ? -1.125  -29.317 225.236 1.00 124.36 ? 267 GLN A OE1   1 
ATOM   2072  N NE2   . GLN A 1 267 ? -3.257  -29.247 224.534 1.00 116.43 ? 267 GLN A NE2   1 
ATOM   2073  N N     . HIS A 1 268 ? -1.996  -26.359 230.164 1.00 108.38 ? 268 HIS A N     1 
ATOM   2074  C CA    . HIS A 1 268 ? -2.213  -26.564 231.591 1.00 112.59 ? 268 HIS A CA    1 
ATOM   2075  C C     . HIS A 1 268 ? -2.885  -25.349 232.221 1.00 113.68 ? 268 HIS A C     1 
ATOM   2076  O O     . HIS A 1 268 ? -3.803  -25.489 233.030 1.00 116.77 ? 268 HIS A O     1 
ATOM   2077  C CB    . HIS A 1 268 ? -0.891  -26.862 232.301 1.00 116.82 ? 268 HIS A CB    1 
ATOM   2078  C CG    . HIS A 1 268 ? -1.016  -26.985 233.786 1.00 120.69 ? 268 HIS A CG    1 
ATOM   2079  N ND1   . HIS A 1 268 ? -1.425  -28.141 234.414 1.00 122.56 ? 268 HIS A ND1   1 
ATOM   2080  C CD2   . HIS A 1 268 ? -0.777  -26.085 234.776 1.00 121.72 ? 268 HIS A CD2   1 
ATOM   2081  C CE1   . HIS A 1 268 ? -1.434  -27.954 235.717 1.00 124.74 ? 268 HIS A CE1   1 
ATOM   2082  N NE2   . HIS A 1 268 ? -1.049  -26.721 235.969 1.00 124.68 ? 268 HIS A NE2   1 
ATOM   2083  N N     . CYS A 1 269 ? -2.419  -24.160 231.846 1.00 109.46 ? 269 CYS A N     1 
ATOM   2084  C CA    . CYS A 1 269 ? -3.008  -22.911 232.322 1.00 104.71 ? 269 CYS A CA    1 
ATOM   2085  C C     . CYS A 1 269 ? -4.476  -22.807 231.932 1.00 102.17 ? 269 CYS A C     1 
ATOM   2086  O O     . CYS A 1 269 ? -5.311  -22.369 232.723 1.00 98.83  ? 269 CYS A O     1 
ATOM   2087  C CB    . CYS A 1 269 ? -2.252  -21.706 231.757 1.00 100.83 ? 269 CYS A CB    1 
ATOM   2088  S SG    . CYS A 1 269 ? -0.661  -21.361 232.534 1.00 161.37 ? 269 CYS A SG    1 
ATOM   2089  N N     . GLU A 1 270 ? -4.781  -23.210 230.704 1.00 106.00 ? 270 GLU A N     1 
ATOM   2090  C CA    . GLU A 1 270 ? -6.138  -23.110 230.185 1.00 115.81 ? 270 GLU A CA    1 
ATOM   2091  C C     . GLU A 1 270 ? -7.070  -24.088 230.892 1.00 123.70 ? 270 GLU A C     1 
ATOM   2092  O O     . GLU A 1 270 ? -8.215  -23.755 231.198 1.00 130.44 ? 270 GLU A O     1 
ATOM   2093  C CB    . GLU A 1 270 ? -6.151  -23.358 228.677 1.00 117.77 ? 270 GLU A CB    1 
ATOM   2094  C CG    . GLU A 1 270 ? -7.488  -23.085 228.012 1.00 120.15 ? 270 GLU A CG    1 
ATOM   2095  C CD    . GLU A 1 270 ? -7.442  -23.327 226.517 1.00 119.15 ? 270 GLU A CD    1 
ATOM   2096  O OE1   . GLU A 1 270 ? -6.371  -23.727 226.012 1.00 115.82 ? 270 GLU A OE1   1 
ATOM   2097  O OE2   . GLU A 1 270 ? -8.474  -23.119 225.845 1.00 120.19 ? 270 GLU A OE2   1 
ATOM   2098  N N     . LYS A 1 271 ? -6.573  -25.294 231.151 1.00 120.80 ? 271 LYS A N     1 
ATOM   2099  C CA    . LYS A 1 271 ? -7.361  -26.309 231.845 1.00 118.85 ? 271 LYS A CA    1 
ATOM   2100  C C     . LYS A 1 271 ? -7.621  -25.921 233.300 1.00 121.17 ? 271 LYS A C     1 
ATOM   2101  O O     . LYS A 1 271 ? -8.667  -26.252 233.860 1.00 123.26 ? 271 LYS A O     1 
ATOM   2102  C CB    . LYS A 1 271 ? -6.689  -27.685 231.755 1.00 116.81 ? 271 LYS A CB    1 
ATOM   2103  C CG    . LYS A 1 271 ? -7.126  -28.506 230.545 1.00 116.02 ? 271 LYS A CG    1 
ATOM   2104  C CD    . LYS A 1 271 ? -6.474  -29.887 230.503 1.00 116.70 ? 271 LYS A CD    1 
ATOM   2105  C CE    . LYS A 1 271 ? -5.024  -29.815 230.038 1.00 117.50 ? 271 LYS A CE    1 
ATOM   2106  N NZ    . LYS A 1 271 ? -4.432  -31.165 229.800 1.00 116.97 ? 271 LYS A NZ    1 
ATOM   2107  N N     . GLN A 1 272 ? -6.673  -25.208 233.902 1.00 121.20 ? 272 GLN A N     1 
ATOM   2108  C CA    . GLN A 1 272 ? -6.825  -24.735 235.275 1.00 122.92 ? 272 GLN A CA    1 
ATOM   2109  C C     . GLN A 1 272 ? -7.567  -23.400 235.331 1.00 120.96 ? 272 GLN A C     1 
ATOM   2110  O O     . GLN A 1 272 ? -7.469  -22.662 236.314 1.00 120.38 ? 272 GLN A O     1 
ATOM   2111  C CB    . GLN A 1 272 ? -5.463  -24.629 235.964 1.00 129.68 ? 272 GLN A CB    1 
ATOM   2112  C CG    . GLN A 1 272 ? -4.908  -25.963 236.441 1.00 137.47 ? 272 GLN A CG    1 
ATOM   2113  C CD    . GLN A 1 272 ? -5.596  -26.463 237.698 1.00 144.05 ? 272 GLN A CD    1 
ATOM   2114  O OE1   . GLN A 1 272 ? -6.043  -25.672 238.529 1.00 147.80 ? 272 GLN A OE1   1 
ATOM   2115  N NE2   . GLN A 1 272 ? -5.687  -27.781 237.841 1.00 142.28 ? 272 GLN A NE2   1 
ATOM   2116  N N     . ARG A 1 273 ? -8.296  -23.103 234.257 1.00 121.15 ? 273 ARG A N     1 
ATOM   2117  C CA    . ARG A 1 273 ? -9.198  -21.953 234.180 1.00 125.16 ? 273 ARG A CA    1 
ATOM   2118  C C     . ARG A 1 273 ? -8.487  -20.595 234.237 1.00 125.18 ? 273 ARG A C     1 
ATOM   2119  O O     . ARG A 1 273 ? -9.112  -19.562 234.477 1.00 125.19 ? 273 ARG A O     1 
ATOM   2120  C CB    . ARG A 1 273 ? -10.296 -22.058 235.250 1.00 128.62 ? 273 ARG A CB    1 
ATOM   2121  C CG    . ARG A 1 273 ? -11.553 -21.251 234.957 1.00 129.97 ? 273 ARG A CG    1 
ATOM   2122  C CD    . ARG A 1 273 ? -12.799 -21.972 235.429 1.00 135.11 ? 273 ARG A CD    1 
ATOM   2123  N NE    . ARG A 1 273 ? -13.146 -23.083 234.548 1.00 138.85 ? 273 ARG A NE    1 
ATOM   2124  C CZ    . ARG A 1 273 ? -13.836 -22.949 233.419 1.00 139.46 ? 273 ARG A CZ    1 
ATOM   2125  N NH1   . ARG A 1 273 ? -14.248 -21.750 233.032 1.00 137.01 ? 273 ARG A NH1   1 
ATOM   2126  N NH2   . ARG A 1 273 ? -14.110 -24.013 232.676 1.00 141.12 ? 273 ARG A NH2   1 
ATOM   2127  N N     . ASP A 1 274 ? -7.180  -20.591 234.002 1.00 124.45 ? 274 ASP A N     1 
ATOM   2128  C CA    . ASP A 1 274 ? -6.446  -19.334 233.933 1.00 126.20 ? 274 ASP A CA    1 
ATOM   2129  C C     . ASP A 1 274 ? -6.227  -18.959 232.477 1.00 125.55 ? 274 ASP A C     1 
ATOM   2130  O O     . ASP A 1 274 ? -5.146  -19.169 231.927 1.00 126.57 ? 274 ASP A O     1 
ATOM   2131  C CB    . ASP A 1 274 ? -5.109  -19.433 234.662 1.00 131.05 ? 274 ASP A CB    1 
ATOM   2132  C CG    . ASP A 1 274 ? -4.400  -18.096 234.757 1.00 139.22 ? 274 ASP A CG    1 
ATOM   2133  O OD1   . ASP A 1 274 ? -5.039  -17.059 234.476 1.00 140.61 ? 274 ASP A OD1   1 
ATOM   2134  O OD2   . ASP A 1 274 ? -3.208  -18.081 235.124 1.00 144.51 ? 274 ASP A OD2   1 
ATOM   2135  N N     . PHE A 1 275 ? -7.261  -18.401 231.857 1.00 122.79 ? 275 PHE A N     1 
ATOM   2136  C CA    . PHE A 1 275 ? -7.243  -18.156 230.422 1.00 113.75 ? 275 PHE A CA    1 
ATOM   2137  C C     . PHE A 1 275 ? -6.395  -16.948 230.061 1.00 114.33 ? 275 PHE A C     1 
ATOM   2138  O O     . PHE A 1 275 ? -5.917  -16.834 228.934 1.00 116.57 ? 275 PHE A O     1 
ATOM   2139  C CB    . PHE A 1 275 ? -8.666  -17.977 229.888 1.00 106.87 ? 275 PHE A CB    1 
ATOM   2140  C CG    . PHE A 1 275 ? -9.616  -19.048 230.333 1.00 104.87 ? 275 PHE A CG    1 
ATOM   2141  C CD1   . PHE A 1 275 ? -9.433  -20.363 229.938 1.00 103.84 ? 275 PHE A CD1   1 
ATOM   2142  C CD2   . PHE A 1 275 ? -10.695 -18.740 231.145 1.00 103.51 ? 275 PHE A CD2   1 
ATOM   2143  C CE1   . PHE A 1 275 ? -10.306 -21.352 230.348 1.00 101.64 ? 275 PHE A CE1   1 
ATOM   2144  C CE2   . PHE A 1 275 ? -11.571 -19.725 231.558 1.00 103.75 ? 275 PHE A CE2   1 
ATOM   2145  C CZ    . PHE A 1 275 ? -11.376 -21.032 231.158 1.00 102.50 ? 275 PHE A CZ    1 
ATOM   2146  N N     . ASP A 1 276 ? -6.209  -16.046 231.018 1.00 114.62 ? 276 ASP A N     1 
ATOM   2147  C CA    . ASP A 1 276 ? -5.456  -14.826 230.760 1.00 113.66 ? 276 ASP A CA    1 
ATOM   2148  C C     . ASP A 1 276 ? -3.969  -15.098 230.590 1.00 112.34 ? 276 ASP A C     1 
ATOM   2149  O O     . ASP A 1 276 ? -3.300  -14.458 229.778 1.00 111.50 ? 276 ASP A O     1 
ATOM   2150  C CB    . ASP A 1 276 ? -5.700  -13.795 231.861 1.00 115.55 ? 276 ASP A CB    1 
ATOM   2151  C CG    . ASP A 1 276 ? -6.756  -12.782 231.476 1.00 118.91 ? 276 ASP A CG    1 
ATOM   2152  O OD1   . ASP A 1 276 ? -7.642  -13.129 230.666 1.00 114.19 ? 276 ASP A OD1   1 
ATOM   2153  O OD2   . ASP A 1 276 ? -6.694  -11.638 231.972 1.00 125.63 ? 276 ASP A OD2   1 
ATOM   2154  N N     . LEU A 1 277 ? -3.458  -16.054 231.357 1.00 112.76 ? 277 LEU A N     1 
ATOM   2155  C CA    . LEU A 1 277 ? -2.068  -16.465 231.233 1.00 109.17 ? 277 LEU A CA    1 
ATOM   2156  C C     . LEU A 1 277 ? -1.924  -17.394 230.034 1.00 105.37 ? 277 LEU A C     1 
ATOM   2157  O O     . LEU A 1 277 ? -0.961  -17.293 229.270 1.00 103.06 ? 277 LEU A O     1 
ATOM   2158  C CB    . LEU A 1 277 ? -1.616  -17.185 232.503 1.00 109.08 ? 277 LEU A CB    1 
ATOM   2159  C CG    . LEU A 1 277 ? -0.186  -16.972 233.006 1.00 108.07 ? 277 LEU A CG    1 
ATOM   2160  C CD1   . LEU A 1 277 ? 0.130   -17.978 234.101 1.00 105.87 ? 277 LEU A CD1   1 
ATOM   2161  C CD2   . LEU A 1 277 ? 0.840   -17.060 231.887 1.00 107.33 ? 277 LEU A CD2   1 
ATOM   2162  N N     . ALA A 1 278 ? -2.889  -18.298 229.882 1.00 101.83 ? 278 ALA A N     1 
ATOM   2163  C CA    . ALA A 1 278 ? -2.892  -19.266 228.790 1.00 95.86  ? 278 ALA A CA    1 
ATOM   2164  C C     . ALA A 1 278 ? -2.802  -18.563 227.443 1.00 97.09  ? 278 ALA A C     1 
ATOM   2165  O O     . ALA A 1 278 ? -2.052  -18.981 226.562 1.00 93.93  ? 278 ALA A O     1 
ATOM   2166  C CB    . ALA A 1 278 ? -4.141  -20.129 228.854 1.00 92.48  ? 278 ALA A CB    1 
ATOM   2167  N N     . GLN A 1 279 ? -3.566  -17.485 227.301 1.00 100.90 ? 279 GLN A N     1 
ATOM   2168  C CA    . GLN A 1 279 ? -3.535  -16.668 226.096 1.00 100.26 ? 279 GLN A CA    1 
ATOM   2169  C C     . GLN A 1 279 ? -2.141  -16.108 225.852 1.00 101.13 ? 279 GLN A C     1 
ATOM   2170  O O     . GLN A 1 279 ? -1.553  -16.330 224.796 1.00 103.98 ? 279 GLN A O     1 
ATOM   2171  C CB    . GLN A 1 279 ? -4.550  -15.529 226.199 1.00 104.15 ? 279 GLN A CB    1 
ATOM   2172  C CG    . GLN A 1 279 ? -4.378  -14.447 225.146 1.00 109.63 ? 279 GLN A CG    1 
ATOM   2173  C CD    . GLN A 1 279 ? -3.658  -13.219 225.673 1.00 111.62 ? 279 GLN A CD    1 
ATOM   2174  O OE1   . GLN A 1 279 ? -3.544  -13.021 226.883 1.00 114.08 ? 279 GLN A OE1   1 
ATOM   2175  N NE2   . GLN A 1 279 ? -3.167  -12.387 224.761 1.00 108.81 ? 279 GLN A NE2   1 
ATOM   2176  N N     . ARG A 1 280 ? -1.613  -15.394 226.841 1.00 101.09 ? 280 ARG A N     1 
ATOM   2177  C CA    . ARG A 1 280 ? -0.295  -14.779 226.728 1.00 108.40 ? 280 ARG A CA    1 
ATOM   2178  C C     . ARG A 1 280 ? 0.796   -15.798 226.388 1.00 112.30 ? 280 ARG A C     1 
ATOM   2179  O O     . ARG A 1 280 ? 1.770   -15.473 225.709 1.00 117.39 ? 280 ARG A O     1 
ATOM   2180  C CB    . ARG A 1 280 ? 0.058   -14.039 228.018 1.00 111.64 ? 280 ARG A CB    1 
ATOM   2181  C CG    . ARG A 1 280 ? 1.300   -13.178 227.911 1.00 116.54 ? 280 ARG A CG    1 
ATOM   2182  C CD    . ARG A 1 280 ? 1.736   -12.692 229.275 1.00 124.62 ? 280 ARG A CD    1 
ATOM   2183  N NE    . ARG A 1 280 ? 0.830   -11.681 229.807 1.00 129.28 ? 280 ARG A NE    1 
ATOM   2184  C CZ    . ARG A 1 280 ? 1.058   -10.374 229.739 1.00 132.06 ? 280 ARG A CZ    1 
ATOM   2185  N NH1   . ARG A 1 280 ? 2.166   -9.925  229.165 1.00 130.35 ? 280 ARG A NH1   1 
ATOM   2186  N NH2   . ARG A 1 280 ? 0.183   -9.518  230.248 1.00 135.19 ? 280 ARG A NH2   1 
ATOM   2187  N N     . LEU A 1 281 ? 0.622   -17.032 226.853 1.00 106.28 ? 281 LEU A N     1 
ATOM   2188  C CA    . LEU A 1 281 ? 1.587   -18.092 226.577 1.00 102.60 ? 281 LEU A CA    1 
ATOM   2189  C C     . LEU A 1 281 ? 1.448   -18.661 225.166 1.00 102.96 ? 281 LEU A C     1 
ATOM   2190  O O     . LEU A 1 281 ? 2.448   -18.894 224.483 1.00 105.03 ? 281 LEU A O     1 
ATOM   2191  C CB    . LEU A 1 281 ? 1.461   -19.213 227.609 1.00 97.37  ? 281 LEU A CB    1 
ATOM   2192  C CG    . LEU A 1 281 ? 2.144   -18.966 228.953 1.00 92.51  ? 281 LEU A CG    1 
ATOM   2193  C CD1   . LEU A 1 281 ? 1.939   -20.150 229.879 1.00 94.24  ? 281 LEU A CD1   1 
ATOM   2194  C CD2   . LEU A 1 281 ? 3.624   -18.702 228.745 1.00 84.07  ? 281 LEU A CD2   1 
ATOM   2195  N N     . TYR A 1 282 ? 0.208   -18.887 224.741 1.00 96.77  ? 282 TYR A N     1 
ATOM   2196  C CA    . TYR A 1 282 ? -0.075  -19.439 223.419 1.00 87.02  ? 282 TYR A CA    1 
ATOM   2197  C C     . TYR A 1 282 ? 0.501   -18.556 222.320 1.00 90.31  ? 282 TYR A C     1 
ATOM   2198  O O     . TYR A 1 282 ? 0.896   -19.041 221.258 1.00 95.64  ? 282 TYR A O     1 
ATOM   2199  C CB    . TYR A 1 282 ? -1.585  -19.574 223.213 1.00 82.21  ? 282 TYR A CB    1 
ATOM   2200  C CG    . TYR A 1 282 ? -2.199  -20.840 223.770 1.00 81.88  ? 282 TYR A CG    1 
ATOM   2201  C CD1   . TYR A 1 282 ? -1.647  -22.087 223.501 1.00 82.53  ? 282 TYR A CD1   1 
ATOM   2202  C CD2   . TYR A 1 282 ? -3.342  -20.786 224.557 1.00 83.68  ? 282 TYR A CD2   1 
ATOM   2203  C CE1   . TYR A 1 282 ? -2.218  -23.244 224.006 1.00 88.70  ? 282 TYR A CE1   1 
ATOM   2204  C CE2   . TYR A 1 282 ? -3.915  -21.932 225.069 1.00 85.87  ? 282 TYR A CE2   1 
ATOM   2205  C CZ    . TYR A 1 282 ? -3.352  -23.157 224.792 1.00 90.58  ? 282 TYR A CZ    1 
ATOM   2206  O OH    . TYR A 1 282 ? -3.932  -24.295 225.302 1.00 93.47  ? 282 TYR A OH    1 
ATOM   2207  N N     . ARG A 1 283 ? 0.547   -17.256 222.587 1.00 89.02  ? 283 ARG A N     1 
ATOM   2208  C CA    . ARG A 1 283 ? 1.002   -16.289 221.600 1.00 88.77  ? 283 ARG A CA    1 
ATOM   2209  C C     . ARG A 1 283 ? 2.522   -16.171 221.561 1.00 89.38  ? 283 ARG A C     1 
ATOM   2210  O O     . ARG A 1 283 ? 3.079   -15.611 220.619 1.00 87.14  ? 283 ARG A O     1 
ATOM   2211  C CB    . ARG A 1 283 ? 0.361   -14.927 221.860 1.00 87.32  ? 283 ARG A CB    1 
ATOM   2212  C CG    . ARG A 1 283 ? -1.149  -15.001 221.994 1.00 89.87  ? 283 ARG A CG    1 
ATOM   2213  C CD    . ARG A 1 283 ? -1.840  -13.983 221.113 1.00 97.50  ? 283 ARG A CD    1 
ATOM   2214  N NE    . ARG A 1 283 ? -2.129  -12.748 221.831 1.00 104.79 ? 283 ARG A NE    1 
ATOM   2215  C CZ    . ARG A 1 283 ? -2.131  -11.545 221.269 1.00 110.44 ? 283 ARG A CZ    1 
ATOM   2216  N NH1   . ARG A 1 283 ? -1.847  -11.414 219.980 1.00 109.18 ? 283 ARG A NH1   1 
ATOM   2217  N NH2   . ARG A 1 283 ? -2.409  -10.472 221.997 1.00 114.64 ? 283 ARG A NH2   1 
ATOM   2218  N N     . GLN A 1 284 ? 3.192   -16.694 222.584 1.00 91.32  ? 284 GLN A N     1 
ATOM   2219  C CA    . GLN A 1 284 ? 4.649   -16.742 222.581 1.00 92.72  ? 284 GLN A CA    1 
ATOM   2220  C C     . GLN A 1 284 ? 5.105   -17.968 221.800 1.00 91.59  ? 284 GLN A C     1 
ATOM   2221  O O     . GLN A 1 284 ? 6.276   -18.097 221.438 1.00 92.21  ? 284 GLN A O     1 
ATOM   2222  C CB    . GLN A 1 284 ? 5.201   -16.791 224.007 1.00 98.46  ? 284 GLN A CB    1 
ATOM   2223  C CG    . GLN A 1 284 ? 4.927   -15.549 224.844 1.00 104.20 ? 284 GLN A CG    1 
ATOM   2224  C CD    . GLN A 1 284 ? 5.687   -15.569 226.159 1.00 110.92 ? 284 GLN A CD    1 
ATOM   2225  O OE1   . GLN A 1 284 ? 6.494   -16.465 226.407 1.00 112.69 ? 284 GLN A OE1   1 
ATOM   2226  N NE2   . GLN A 1 284 ? 5.435   -14.578 227.008 1.00 113.97 ? 284 GLN A NE2   1 
ATOM   2227  N N     . SER A 1 285 ? 4.153   -18.858 221.536 1.00 90.30  ? 285 SER A N     1 
ATOM   2228  C CA    . SER A 1 285 ? 4.422   -20.122 220.862 1.00 90.91  ? 285 SER A CA    1 
ATOM   2229  C C     . SER A 1 285 ? 4.091   -20.078 219.378 1.00 88.07  ? 285 SER A C     1 
ATOM   2230  O O     . SER A 1 285 ? 3.129   -19.432 218.965 1.00 95.41  ? 285 SER A O     1 
ATOM   2231  C CB    . SER A 1 285 ? 3.619   -21.246 221.511 1.00 98.10  ? 285 SER A CB    1 
ATOM   2232  O OG    . SER A 1 285 ? 3.600   -22.386 220.672 1.00 103.04 ? 285 SER A OG    1 
ATOM   2233  N N     . SER A 1 286 ? 4.886   -20.784 218.582 1.00 84.88  ? 286 SER A N     1 
ATOM   2234  C CA    . SER A 1 286 ? 4.648   -20.880 217.151 1.00 87.28  ? 286 SER A CA    1 
ATOM   2235  C C     . SER A 1 286 ? 4.280   -22.315 216.812 1.00 90.71  ? 286 SER A C     1 
ATOM   2236  O O     . SER A 1 286 ? 4.272   -22.710 215.646 1.00 93.80  ? 286 SER A O     1 
ATOM   2237  C CB    . SER A 1 286 ? 5.888   -20.456 216.364 1.00 88.83  ? 286 SER A CB    1 
ATOM   2238  O OG    . SER A 1 286 ? 6.759   -21.554 216.151 1.00 77.99  ? 286 SER A OG    1 
ATOM   2239  N N     . HIS A 1 287 ? 3.988   -23.092 217.851 1.00 90.89  ? 287 HIS A N     1 
ATOM   2240  C CA    . HIS A 1 287 ? 3.547   -24.469 217.695 1.00 98.05  ? 287 HIS A CA    1 
ATOM   2241  C C     . HIS A 1 287 ? 2.244   -24.493 216.912 1.00 103.21 ? 287 HIS A C     1 
ATOM   2242  O O     . HIS A 1 287 ? 1.384   -23.636 217.116 1.00 109.93 ? 287 HIS A O     1 
ATOM   2243  C CB    . HIS A 1 287 ? 3.346   -25.109 219.070 1.00 106.21 ? 287 HIS A CB    1 
ATOM   2244  C CG    . HIS A 1 287 ? 3.079   -26.582 219.023 1.00 110.97 ? 287 HIS A CG    1 
ATOM   2245  N ND1   . HIS A 1 287 ? 4.025   -27.495 218.604 1.00 112.82 ? 287 HIS A ND1   1 
ATOM   2246  C CD2   . HIS A 1 287 ? 1.980   -27.298 219.348 1.00 111.47 ? 287 HIS A CD2   1 
ATOM   2247  C CE1   . HIS A 1 287 ? 3.514   -28.710 218.671 1.00 111.96 ? 287 HIS A CE1   1 
ATOM   2248  N NE2   . HIS A 1 287 ? 2.277   -28.623 219.117 1.00 111.73 ? 287 HIS A NE2   1 
ATOM   2249  N N     . PRO A 1 288 ? 2.101   -25.464 215.997 1.00 100.22 ? 288 PRO A N     1 
ATOM   2250  C CA    . PRO A 1 288 ? 0.881   -25.590 215.192 1.00 99.99  ? 288 PRO A CA    1 
ATOM   2251  C C     . PRO A 1 288 ? -0.373  -25.691 216.058 1.00 95.50  ? 288 PRO A C     1 
ATOM   2252  O O     . PRO A 1 288 ? -0.514  -26.626 216.846 1.00 96.51  ? 288 PRO A O     1 
ATOM   2253  C CB    . PRO A 1 288 ? 1.111   -26.891 214.421 1.00 101.09 ? 288 PRO A CB    1 
ATOM   2254  C CG    . PRO A 1 288 ? 2.596   -26.986 214.304 1.00 98.84  ? 288 PRO A CG    1 
ATOM   2255  C CD    . PRO A 1 288 ? 3.126   -26.447 215.601 1.00 96.11  ? 288 PRO A CD    1 
ATOM   2256  N N     . GLY A 1 289 ? -1.266  -24.719 215.920 1.00 93.92  ? 289 GLY A N     1 
ATOM   2257  C CA    . GLY A 1 289 ? -2.502  -24.722 216.676 1.00 92.98  ? 289 GLY A CA    1 
ATOM   2258  C C     . GLY A 1 289 ? -2.483  -23.810 217.887 1.00 93.13  ? 289 GLY A C     1 
ATOM   2259  O O     . GLY A 1 289 ? -3.503  -23.637 218.547 1.00 94.10  ? 289 GLY A O     1 
ATOM   2260  N N     . ALA A 1 290 ? -1.326  -23.226 218.183 1.00 97.74  ? 290 ALA A N     1 
ATOM   2261  C CA    . ALA A 1 290 ? -1.204  -22.325 219.327 1.00 98.49  ? 290 ALA A CA    1 
ATOM   2262  C C     . ALA A 1 290 ? -2.030  -21.059 219.146 1.00 95.14  ? 290 ALA A C     1 
ATOM   2263  O O     . ALA A 1 290 ? -2.748  -20.643 220.055 1.00 89.21  ? 290 ALA A O     1 
ATOM   2264  C CB    . ALA A 1 290 ? 0.256   -21.970 219.586 1.00 97.80  ? 290 ALA A CB    1 
ATOM   2265  N N     . ARG A 1 291 ? -1.926  -20.447 217.971 1.00 95.58  ? 291 ARG A N     1 
ATOM   2266  C CA    . ARG A 1 291 ? -2.604  -19.182 217.721 1.00 92.20  ? 291 ARG A CA    1 
ATOM   2267  C C     . ARG A 1 291 ? -4.118  -19.351 217.808 1.00 90.34  ? 291 ARG A C     1 
ATOM   2268  O O     . ARG A 1 291 ? -4.822  -18.476 218.313 1.00 93.84  ? 291 ARG A O     1 
ATOM   2269  C CB    . ARG A 1 291 ? -2.191  -18.610 216.365 1.00 88.28  ? 291 ARG A CB    1 
ATOM   2270  C CG    . ARG A 1 291 ? -3.001  -17.416 215.915 1.00 80.90  ? 291 ARG A CG    1 
ATOM   2271  C CD    . ARG A 1 291 ? -3.199  -17.475 214.417 1.00 83.65  ? 291 ARG A CD    1 
ATOM   2272  N NE    . ARG A 1 291 ? -2.268  -16.625 213.683 1.00 89.41  ? 291 ARG A NE    1 
ATOM   2273  C CZ    . ARG A 1 291 ? -2.131  -16.647 212.361 1.00 94.02  ? 291 ARG A CZ    1 
ATOM   2274  N NH1   . ARG A 1 291 ? -2.853  -17.492 211.636 1.00 94.27  ? 291 ARG A NH1   1 
ATOM   2275  N NH2   . ARG A 1 291 ? -1.268  -15.834 211.766 1.00 94.16  ? 291 ARG A NH2   1 
ATOM   2276  N N     . LEU A 1 292 ? -4.610  -20.491 217.334 1.00 86.82  ? 292 LEU A N     1 
ATOM   2277  C CA    . LEU A 1 292 ? -6.028  -20.816 217.435 1.00 87.58  ? 292 LEU A CA    1 
ATOM   2278  C C     . LEU A 1 292 ? -6.462  -21.008 218.889 1.00 90.53  ? 292 LEU A C     1 
ATOM   2279  O O     . LEU A 1 292 ? -7.575  -20.643 219.263 1.00 92.01  ? 292 LEU A O     1 
ATOM   2280  C CB    . LEU A 1 292 ? -6.347  -22.074 216.628 1.00 85.24  ? 292 LEU A CB    1 
ATOM   2281  C CG    . LEU A 1 292 ? -7.820  -22.285 216.284 1.00 83.83  ? 292 LEU A CG    1 
ATOM   2282  C CD1   . LEU A 1 292 ? -8.297  -21.174 215.363 1.00 83.58  ? 292 LEU A CD1   1 
ATOM   2283  C CD2   . LEU A 1 292 ? -8.037  -23.649 215.648 1.00 83.62  ? 292 LEU A CD2   1 
ATOM   2284  N N     . ARG A 1 293 ? -5.587  -21.591 219.703 1.00 93.22  ? 293 ARG A N     1 
ATOM   2285  C CA    . ARG A 1 293 ? -5.884  -21.771 221.120 1.00 91.82  ? 293 ARG A CA    1 
ATOM   2286  C C     . ARG A 1 293 ? -5.863  -20.429 221.838 1.00 91.34  ? 293 ARG A C     1 
ATOM   2287  O O     . ARG A 1 293 ? -6.561  -20.232 222.833 1.00 91.94  ? 293 ARG A O     1 
ATOM   2288  C CB    . ARG A 1 293 ? -4.889  -22.729 221.779 1.00 94.07  ? 293 ARG A CB    1 
ATOM   2289  C CG    . ARG A 1 293 ? -4.970  -24.162 221.286 1.00 98.27  ? 293 ARG A CG    1 
ATOM   2290  C CD    . ARG A 1 293 ? -6.401  -24.665 221.285 1.00 97.21  ? 293 ARG A CD    1 
ATOM   2291  N NE    . ARG A 1 293 ? -7.041  -24.501 222.586 1.00 93.96  ? 293 ARG A NE    1 
ATOM   2292  C CZ    . ARG A 1 293 ? -8.291  -24.864 222.854 1.00 89.54  ? 293 ARG A CZ    1 
ATOM   2293  N NH1   . ARG A 1 293 ? -9.040  -25.419 221.910 1.00 83.86  ? 293 ARG A NH1   1 
ATOM   2294  N NH2   . ARG A 1 293 ? -8.792  -24.676 224.066 1.00 90.97  ? 293 ARG A NH2   1 
ATOM   2295  N N     . ALA A 1 294 ? -5.053  -19.510 221.324 1.00 93.36  ? 294 ALA A N     1 
ATOM   2296  C CA    . ALA A 1 294 ? -4.940  -18.177 221.901 1.00 94.04  ? 294 ALA A CA    1 
ATOM   2297  C C     . ALA A 1 294 ? -6.258  -17.425 221.760 1.00 102.92 ? 294 ALA A C     1 
ATOM   2298  O O     . ALA A 1 294 ? -6.682  -16.714 222.672 1.00 108.33 ? 294 ALA A O     1 
ATOM   2299  C CB    . ALA A 1 294 ? -3.811  -17.407 221.234 1.00 84.16  ? 294 ALA A CB    1 
ATOM   2300  N N     . ILE A 1 295 ? -6.903  -17.597 220.610 1.00 101.94 ? 295 ILE A N     1 
ATOM   2301  C CA    . ILE A 1 295 ? -8.189  -16.966 220.340 1.00 100.09 ? 295 ILE A CA    1 
ATOM   2302  C C     . ILE A 1 295 ? -9.290  -17.522 221.240 1.00 103.57 ? 295 ILE A C     1 
ATOM   2303  O O     . ILE A 1 295 ? -10.055 -16.763 221.836 1.00 105.19 ? 295 ILE A O     1 
ATOM   2304  C CB    . ILE A 1 295 ? -8.603  -17.160 218.872 1.00 94.30  ? 295 ILE A CB    1 
ATOM   2305  C CG1   . ILE A 1 295 ? -7.531  -16.596 217.939 1.00 96.82  ? 295 ILE A CG1   1 
ATOM   2306  C CG2   . ILE A 1 295 ? -9.948  -16.503 218.605 1.00 88.77  ? 295 ILE A CG2   1 
ATOM   2307  C CD1   . ILE A 1 295 ? -7.771  -16.901 216.478 1.00 100.39 ? 295 ILE A CD1   1 
ATOM   2308  N N     . ARG A 1 296 ? -9.362  -18.847 221.336 1.00 104.34 ? 296 ARG A N     1 
ATOM   2309  C CA    . ARG A 1 296 ? -10.402 -19.505 222.124 1.00 108.42 ? 296 ARG A CA    1 
ATOM   2310  C C     . ARG A 1 296 ? -10.204 -19.239 223.616 1.00 107.52 ? 296 ARG A C     1 
ATOM   2311  O O     . ARG A 1 296 ? -11.158 -19.268 224.391 1.00 109.46 ? 296 ARG A O     1 
ATOM   2312  C CB    . ARG A 1 296 ? -10.433 -21.014 221.835 1.00 115.60 ? 296 ARG A CB    1 
ATOM   2313  C CG    . ARG A 1 296 ? -11.822 -21.585 221.506 1.00 121.48 ? 296 ARG A CG    1 
ATOM   2314  C CD    . ARG A 1 296 ? -11.750 -23.039 221.004 1.00 121.50 ? 296 ARG A CD    1 
ATOM   2315  N NE    . ARG A 1 296 ? -12.024 -23.166 219.570 1.00 117.31 ? 296 ARG A NE    1 
ATOM   2316  C CZ    . ARG A 1 296 ? -11.920 -24.300 218.877 1.00 111.07 ? 296 ARG A CZ    1 
ATOM   2317  N NH1   . ARG A 1 296 ? -11.542 -25.421 219.477 1.00 108.45 ? 296 ARG A NH1   1 
ATOM   2318  N NH2   . ARG A 1 296 ? -12.192 -24.314 217.577 1.00 106.23 ? 296 ARG A NH2   1 
ATOM   2319  N N     . SER A 1 297 ? -8.960  -18.979 224.011 1.00 106.74 ? 297 SER A N     1 
ATOM   2320  C CA    . SER A 1 297 ? -8.653  -18.621 225.392 1.00 107.60 ? 297 SER A CA    1 
ATOM   2321  C C     . SER A 1 297 ? -9.092  -17.192 225.672 1.00 106.22 ? 297 SER A C     1 
ATOM   2322  O O     . SER A 1 297 ? -9.619  -16.894 226.744 1.00 108.66 ? 297 SER A O     1 
ATOM   2323  C CB    . SER A 1 297 ? -7.159  -18.777 225.680 1.00 110.01 ? 297 SER A CB    1 
ATOM   2324  O OG    . SER A 1 297 ? -6.801  -20.145 225.788 1.00 113.34 ? 297 SER A OG    1 
ATOM   2325  N N     . LEU A 1 298 ? -8.868  -16.312 224.702 1.00 102.38 ? 298 LEU A N     1 
ATOM   2326  C CA    . LEU A 1 298 ? -9.344  -14.937 224.789 1.00 98.06  ? 298 LEU A CA    1 
ATOM   2327  C C     . LEU A 1 298 ? -10.870 -14.890 224.841 1.00 103.33 ? 298 LEU A C     1 
ATOM   2328  O O     . LEU A 1 298 ? -11.447 -13.976 225.426 1.00 106.56 ? 298 LEU A O     1 
ATOM   2329  C CB    . LEU A 1 298 ? -8.834  -14.108 223.606 1.00 90.55  ? 298 LEU A CB    1 
ATOM   2330  C CG    . LEU A 1 298 ? -7.438  -13.489 223.696 1.00 85.99  ? 298 LEU A CG    1 
ATOM   2331  C CD1   . LEU A 1 298 ? -7.010  -12.921 222.352 1.00 80.39  ? 298 LEU A CD1   1 
ATOM   2332  C CD2   . LEU A 1 298 ? -7.391  -12.410 224.767 1.00 86.54  ? 298 LEU A CD2   1 
ATOM   2333  N N     . GLU A 1 299 ? -11.517 -15.879 224.232 1.00 108.04 ? 299 GLU A N     1 
ATOM   2334  C CA    . GLU A 1 299 ? -12.977 -15.945 224.211 1.00 111.89 ? 299 GLU A CA    1 
ATOM   2335  C C     . GLU A 1 299 ? -13.510 -16.382 225.571 1.00 115.17 ? 299 GLU A C     1 
ATOM   2336  O O     . GLU A 1 299 ? -14.466 -15.807 226.094 1.00 117.16 ? 299 GLU A O     1 
ATOM   2337  C CB    . GLU A 1 299 ? -13.455 -16.914 223.126 1.00 112.08 ? 299 GLU A CB    1 
ATOM   2338  C CG    . GLU A 1 299 ? -14.963 -16.920 222.894 1.00 114.90 ? 299 GLU A CG    1 
ATOM   2339  C CD    . GLU A 1 299 ? -15.419 -18.118 222.075 1.00 117.69 ? 299 GLU A CD    1 
ATOM   2340  O OE1   . GLU A 1 299 ? -14.698 -19.138 222.064 1.00 118.18 ? 299 GLU A OE1   1 
ATOM   2341  O OE2   . GLU A 1 299 ? -16.496 -18.043 221.443 1.00 118.76 ? 299 GLU A OE2   1 
ATOM   2342  N N     . ARG A 1 300 ? -12.876 -17.402 226.138 1.00 115.95 ? 300 ARG A N     1 
ATOM   2343  C CA    . ARG A 1 300 ? -13.257 -17.927 227.443 1.00 116.36 ? 300 ARG A CA    1 
ATOM   2344  C C     . ARG A 1 300 ? -12.913 -16.955 228.566 1.00 123.25 ? 300 ARG A C     1 
ATOM   2345  O O     . ARG A 1 300 ? -13.441 -17.058 229.673 1.00 129.98 ? 300 ARG A O     1 
ATOM   2346  C CB    . ARG A 1 300 ? -12.592 -19.282 227.679 1.00 110.10 ? 300 ARG A CB    1 
ATOM   2347  C CG    . ARG A 1 300 ? -13.042 -20.339 226.691 1.00 114.69 ? 300 ARG A CG    1 
ATOM   2348  C CD    . ARG A 1 300 ? -12.363 -21.667 226.937 1.00 119.27 ? 300 ARG A CD    1 
ATOM   2349  N NE    . ARG A 1 300 ? -12.851 -22.314 228.150 1.00 122.17 ? 300 ARG A NE    1 
ATOM   2350  C CZ    . ARG A 1 300 ? -12.442 -23.507 228.565 1.00 124.67 ? 300 ARG A CZ    1 
ATOM   2351  N NH1   . ARG A 1 300 ? -11.539 -24.175 227.860 1.00 121.14 ? 300 ARG A NH1   1 
ATOM   2352  N NH2   . ARG A 1 300 ? -12.933 -24.030 229.680 1.00 129.42 ? 300 ARG A NH2   1 
ATOM   2353  N N     . GLY A 1 301 ? -12.027 -16.009 228.276 1.00 120.63 ? 301 GLY A N     1 
ATOM   2354  C CA    . GLY A 1 301 ? -11.697 -14.960 229.222 1.00 123.04 ? 301 GLY A CA    1 
ATOM   2355  C C     . GLY A 1 301 ? -12.620 -13.776 229.019 1.00 126.48 ? 301 GLY A C     1 
ATOM   2356  O O     . GLY A 1 301 ? -12.476 -12.739 229.670 1.00 132.89 ? 301 GLY A O     1 
ATOM   2357  N N     . GLU A 1 302 ? -13.573 -13.948 228.106 1.00 121.54 ? 302 GLU A N     1 
ATOM   2358  C CA    . GLU A 1 302 ? -14.533 -12.907 227.744 1.00 120.19 ? 302 GLU A CA    1 
ATOM   2359  C C     . GLU A 1 302 ? -13.854 -11.618 227.297 1.00 118.21 ? 302 GLU A C     1 
ATOM   2360  O O     . GLU A 1 302 ? -14.326 -10.519 227.576 1.00 119.79 ? 302 GLU A O     1 
ATOM   2361  C CB    . GLU A 1 302 ? -15.524 -12.652 228.881 1.00 122.84 ? 302 GLU A CB    1 
ATOM   2362  C CG    . GLU A 1 302 ? -16.303 -13.894 229.267 1.00 128.41 ? 302 GLU A CG    1 
ATOM   2363  C CD    . GLU A 1 302 ? -17.394 -13.620 230.279 1.00 133.36 ? 302 GLU A CD    1 
ATOM   2364  O OE1   . GLU A 1 302 ? -17.831 -12.454 230.391 1.00 137.55 ? 302 GLU A OE1   1 
ATOM   2365  O OE2   . GLU A 1 302 ? -17.814 -14.577 230.962 1.00 131.38 ? 302 GLU A OE2   1 
ATOM   2366  N N     . ARG A 1 303 ? -12.735 -11.774 226.601 1.00 118.17 ? 303 ARG A N     1 
ATOM   2367  C CA    . ARG A 1 303 ? -12.037 -10.651 225.998 1.00 118.66 ? 303 ARG A CA    1 
ATOM   2368  C C     . ARG A 1 303 ? -12.297 -10.684 224.494 1.00 119.87 ? 303 ARG A C     1 
ATOM   2369  O O     . ARG A 1 303 ? -11.379 -10.870 223.696 1.00 118.88 ? 303 ARG A O     1 
ATOM   2370  C CB    . ARG A 1 303 ? -10.540 -10.744 226.299 1.00 115.38 ? 303 ARG A CB    1 
ATOM   2371  C CG    . ARG A 1 303 ? -10.227 -10.886 227.785 1.00 113.45 ? 303 ARG A CG    1 
ATOM   2372  C CD    . ARG A 1 303 ? -8.768  -11.238 228.039 1.00 111.09 ? 303 ARG A CD    1 
ATOM   2373  N NE    . ARG A 1 303 ? -7.860  -10.176 227.619 1.00 106.69 ? 303 ARG A NE    1 
ATOM   2374  C CZ    . ARG A 1 303 ? -6.550  -10.183 227.845 1.00 108.00 ? 303 ARG A CZ    1 
ATOM   2375  N NH1   . ARG A 1 303 ? -5.993  -11.197 228.494 1.00 107.02 ? 303 ARG A NH1   1 
ATOM   2376  N NH2   . ARG A 1 303 ? -5.797  -9.176  227.426 1.00 112.06 ? 303 ARG A NH2   1 
ATOM   2377  N N     . PHE A 1 304 ? -13.561 -10.497 224.120 1.00 117.63 ? 304 PHE A N     1 
ATOM   2378  C CA    . PHE A 1 304 ? -14.024 -10.742 222.754 1.00 110.34 ? 304 PHE A CA    1 
ATOM   2379  C C     . PHE A 1 304 ? -13.395 -9.846  221.695 1.00 110.18 ? 304 PHE A C     1 
ATOM   2380  O O     . PHE A 1 304 ? -13.047 -10.316 220.613 1.00 115.47 ? 304 PHE A O     1 
ATOM   2381  C CB    . PHE A 1 304 ? -15.548 -10.636 222.681 1.00 104.98 ? 304 PHE A CB    1 
ATOM   2382  C CG    . PHE A 1 304 ? -16.254 -11.448 223.719 1.00 105.31 ? 304 PHE A CG    1 
ATOM   2383  C CD1   . PHE A 1 304 ? -16.443 -12.808 223.543 1.00 105.45 ? 304 PHE A CD1   1 
ATOM   2384  C CD2   . PHE A 1 304 ? -16.719 -10.854 224.877 1.00 106.98 ? 304 PHE A CD2   1 
ATOM   2385  C CE1   . PHE A 1 304 ? -17.089 -13.557 224.504 1.00 105.84 ? 304 PHE A CE1   1 
ATOM   2386  C CE2   . PHE A 1 304 ? -17.365 -11.597 225.840 1.00 107.11 ? 304 PHE A CE2   1 
ATOM   2387  C CZ    . PHE A 1 304 ? -17.551 -12.951 225.654 1.00 106.06 ? 304 PHE A CZ    1 
ATOM   2388  N N     . ALA A 1 305 ? -13.262 -8.560  221.996 1.00 108.04 ? 305 ALA A N     1 
ATOM   2389  C CA    . ALA A 1 305 ? -12.686 -7.626  221.037 1.00 111.04 ? 305 ALA A CA    1 
ATOM   2390  C C     . ALA A 1 305 ? -11.263 -8.027  220.652 1.00 108.61 ? 305 ALA A C     1 
ATOM   2391  O O     . ALA A 1 305 ? -10.879 -7.938  219.487 1.00 104.99 ? 305 ALA A O     1 
ATOM   2392  C CB    . ALA A 1 305 ? -12.715 -6.208  221.586 1.00 115.37 ? 305 ALA A CB    1 
ATOM   2393  N N     . GLU A 1 306 ? -10.489 -8.482  221.630 1.00 110.77 ? 306 GLU A N     1 
ATOM   2394  C CA    . GLU A 1 306 ? -9.117  -8.899  221.376 1.00 108.33 ? 306 GLU A CA    1 
ATOM   2395  C C     . GLU A 1 306 ? -9.101  -10.208 220.601 1.00 101.42 ? 306 GLU A C     1 
ATOM   2396  O O     . GLU A 1 306 ? -8.296  -10.397 219.689 1.00 100.28 ? 306 GLU A O     1 
ATOM   2397  C CB    . GLU A 1 306 ? -8.364  -9.048  222.693 1.00 114.09 ? 306 GLU A CB    1 
ATOM   2398  C CG    . GLU A 1 306 ? -8.235  -7.748  223.454 1.00 121.25 ? 306 GLU A CG    1 
ATOM   2399  C CD    . GLU A 1 306 ? -7.790  -7.961  224.878 1.00 127.68 ? 306 GLU A CD    1 
ATOM   2400  O OE1   . GLU A 1 306 ? -6.572  -7.871  225.142 1.00 128.94 ? 306 GLU A OE1   1 
ATOM   2401  O OE2   . GLU A 1 306 ? -8.661  -8.224  225.733 1.00 130.51 ? 306 GLU A OE2   1 
ATOM   2402  N N     . ALA A 1 307 ? -10.012 -11.101 220.972 1.00 96.77  ? 307 ALA A N     1 
ATOM   2403  C CA    . ALA A 1 307 ? -10.144 -12.400 220.328 1.00 92.45  ? 307 ALA A CA    1 
ATOM   2404  C C     . ALA A 1 307 ? -10.549 -12.251 218.866 1.00 95.72  ? 307 ALA A C     1 
ATOM   2405  O O     . ALA A 1 307 ? -10.140 -13.039 218.013 1.00 95.80  ? 307 ALA A O     1 
ATOM   2406  C CB    . ALA A 1 307 ? -11.165 -13.243 221.072 1.00 88.00  ? 307 ALA A CB    1 
ATOM   2407  N N     . HIS A 1 308 ? -11.363 -11.236 218.594 1.00 98.48  ? 308 HIS A N     1 
ATOM   2408  C CA    . HIS A 1 308 ? -11.854 -10.966 217.250 1.00 97.10  ? 308 HIS A CA    1 
ATOM   2409  C C     . HIS A 1 308 ? -10.757 -10.358 216.394 1.00 97.25  ? 308 HIS A C     1 
ATOM   2410  O O     . HIS A 1 308 ? -10.666 -10.625 215.195 1.00 102.79 ? 308 HIS A O     1 
ATOM   2411  C CB    . HIS A 1 308 ? -13.044 -10.009 217.303 1.00 96.84  ? 308 HIS A CB    1 
ATOM   2412  C CG    . HIS A 1 308 ? -13.545 -9.599  215.947 1.00 98.92  ? 308 HIS A CG    1 
ATOM   2413  N ND1   . HIS A 1 308 ? -13.080 -8.469  215.308 1.00 101.00 ? 308 HIS A ND1   1 
ATOM   2414  C CD2   . HIS A 1 308 ? -14.439 -10.166 215.123 1.00 100.58 ? 308 HIS A CD2   1 
ATOM   2415  C CE1   . HIS A 1 308 ? -13.689 -8.359  214.131 1.00 102.76 ? 308 HIS A CE1   1 
ATOM   2416  N NE2   . HIS A 1 308 ? -14.519 -9.381  213.999 1.00 103.29 ? 308 HIS A NE2   1 
ATOM   2417  N N     . ALA A 1 309 ? -9.931  -9.528  217.018 1.00 93.34  ? 309 ALA A N     1 
ATOM   2418  C CA    . ALA A 1 309 ? -8.836  -8.881  216.315 1.00 91.12  ? 309 ALA A CA    1 
ATOM   2419  C C     . ALA A 1 309 ? -7.820  -9.922  215.863 1.00 88.75  ? 309 ALA A C     1 
ATOM   2420  O O     . ALA A 1 309 ? -7.329  -9.872  214.736 1.00 90.25  ? 309 ALA A O     1 
ATOM   2421  C CB    . ALA A 1 309 ? -8.182  -7.830  217.198 1.00 81.65  ? 309 ALA A CB    1 
ATOM   2422  N N     . LEU A 1 310 ? -7.521  -10.877 216.739 1.00 86.67  ? 310 LEU A N     1 
ATOM   2423  C CA    . LEU A 1 310 ? -6.555  -11.922 216.420 1.00 88.29  ? 310 LEU A CA    1 
ATOM   2424  C C     . LEU A 1 310 ? -7.133  -12.902 215.402 1.00 89.99  ? 310 LEU A C     1 
ATOM   2425  O O     . LEU A 1 310 ? -6.418  -13.399 214.531 1.00 92.40  ? 310 LEU A O     1 
ATOM   2426  C CB    . LEU A 1 310 ? -6.114  -12.661 217.687 1.00 87.23  ? 310 LEU A CB    1 
ATOM   2427  C CG    . LEU A 1 310 ? -4.981  -13.682 217.542 1.00 84.88  ? 310 LEU A CG    1 
ATOM   2428  C CD1   . LEU A 1 310 ? -3.710  -13.016 217.034 1.00 86.49  ? 310 LEU A CD1   1 
ATOM   2429  C CD2   . LEU A 1 310 ? -4.726  -14.385 218.865 1.00 84.68  ? 310 LEU A CD2   1 
ATOM   2430  N N     . ALA A 1 311 ? -8.430  -13.169 215.517 1.00 88.83  ? 311 ALA A N     1 
ATOM   2431  C CA    . ALA A 1 311 ? -9.122  -14.069 214.600 1.00 88.93  ? 311 ALA A CA    1 
ATOM   2432  C C     . ALA A 1 311 ? -9.120  -13.516 213.182 1.00 93.01  ? 311 ALA A C     1 
ATOM   2433  O O     . ALA A 1 311 ? -8.908  -14.253 212.217 1.00 95.30  ? 311 ALA A O     1 
ATOM   2434  C CB    . ALA A 1 311 ? -10.548 -14.308 215.069 1.00 87.57  ? 311 ALA A CB    1 
ATOM   2435  N N     . ARG A 1 312 ? -9.361  -12.215 213.060 1.00 95.45  ? 312 ARG A N     1 
ATOM   2436  C CA    . ARG A 1 312 ? -9.354  -11.567 211.758 1.00 94.92  ? 312 ARG A CA    1 
ATOM   2437  C C     . ARG A 1 312 ? -7.938  -11.557 211.190 1.00 93.46  ? 312 ARG A C     1 
ATOM   2438  O O     . ARG A 1 312 ? -7.741  -11.702 209.984 1.00 88.00  ? 312 ARG A O     1 
ATOM   2439  C CB    . ARG A 1 312 ? -9.902  -10.143 211.858 1.00 93.17  ? 312 ARG A CB    1 
ATOM   2440  C CG    . ARG A 1 312 ? -10.860 -9.788  210.735 1.00 102.76 ? 312 ARG A CG    1 
ATOM   2441  C CD    . ARG A 1 312 ? -11.053 -8.289  210.617 1.00 113.53 ? 312 ARG A CD    1 
ATOM   2442  N NE    . ARG A 1 312 ? -9.881  -7.636  210.041 1.00 120.75 ? 312 ARG A NE    1 
ATOM   2443  C CZ    . ARG A 1 312 ? -9.686  -7.483  208.735 1.00 124.66 ? 312 ARG A CZ    1 
ATOM   2444  N NH1   . ARG A 1 312 ? -10.587 -7.938  207.873 1.00 125.41 ? 312 ARG A NH1   1 
ATOM   2445  N NH2   . ARG A 1 312 ? -8.591  -6.878  208.289 1.00 122.37 ? 312 ARG A NH2   1 
ATOM   2446  N N     . GLU A 1 313 ? -6.958  -11.393 212.076 1.00 96.65  ? 313 GLU A N     1 
ATOM   2447  C CA    . GLU A 1 313 ? -5.550  -11.419 211.698 1.00 97.66  ? 313 GLU A CA    1 
ATOM   2448  C C     . GLU A 1 313 ? -5.180  -12.814 211.211 1.00 101.81 ? 313 GLU A C     1 
ATOM   2449  O O     . GLU A 1 313 ? -4.429  -12.971 210.245 1.00 101.05 ? 313 GLU A O     1 
ATOM   2450  C CB    . GLU A 1 313 ? -4.676  -11.035 212.895 1.00 97.63  ? 313 GLU A CB    1 
ATOM   2451  C CG    . GLU A 1 313 ? -3.216  -10.773 212.550 1.00 106.80 ? 313 GLU A CG    1 
ATOM   2452  C CD    . GLU A 1 313 ? -2.360  -10.512 213.782 1.00 117.27 ? 313 GLU A CD    1 
ATOM   2453  O OE1   . GLU A 1 313 ? -1.922  -11.493 214.422 1.00 116.02 ? 313 GLU A OE1   1 
ATOM   2454  O OE2   . GLU A 1 313 ? -2.127  -9.327  214.109 1.00 122.84 ? 313 GLU A OE2   1 
ATOM   2455  N N     . ALA A 1 314 ? -5.721  -13.821 211.890 1.00 104.07 ? 314 ALA A N     1 
ATOM   2456  C CA    . ALA A 1 314 ? -5.476  -15.217 211.552 1.00 103.22 ? 314 ALA A CA    1 
ATOM   2457  C C     . ALA A 1 314 ? -6.110  -15.584 210.217 1.00 103.36 ? 314 ALA A C     1 
ATOM   2458  O O     . ALA A 1 314 ? -5.459  -16.159 209.348 1.00 106.79 ? 314 ALA A O     1 
ATOM   2459  C CB    . ALA A 1 314 ? -6.007  -16.127 212.652 1.00 105.40 ? 314 ALA A CB    1 
ATOM   2460  N N     . SER A 1 315 ? -7.386  -15.244 210.060 1.00 102.77 ? 315 SER A N     1 
ATOM   2461  C CA    . SER A 1 315 ? -8.134  -15.621 208.863 1.00 100.67 ? 315 SER A CA    1 
ATOM   2462  C C     . SER A 1 315 ? -7.582  -14.982 207.592 1.00 98.37  ? 315 SER A C     1 
ATOM   2463  O O     . SER A 1 315 ? -7.850  -15.455 206.490 1.00 96.17  ? 315 SER A O     1 
ATOM   2464  C CB    . SER A 1 315 ? -9.625  -15.305 209.023 1.00 98.39  ? 315 SER A CB    1 
ATOM   2465  O OG    . SER A 1 315 ? -9.835  -13.944 209.354 1.00 100.50 ? 315 SER A OG    1 
ATOM   2466  N N     . CYS A 1 316 ? -6.810  -13.913 207.746 1.00 100.92 ? 316 CYS A N     1 
ATOM   2467  C CA    . CYS A 1 316 ? -6.179  -13.272 206.600 1.00 104.44 ? 316 CYS A CA    1 
ATOM   2468  C C     . CYS A 1 316 ? -4.989  -14.083 206.107 1.00 105.38 ? 316 CYS A C     1 
ATOM   2469  O O     . CYS A 1 316 ? -4.712  -14.132 204.910 1.00 110.13 ? 316 CYS A O     1 
ATOM   2470  C CB    . CYS A 1 316 ? -5.747  -11.847 206.944 1.00 104.53 ? 316 CYS A CB    1 
ATOM   2471  S SG    . CYS A 1 316 ? -7.121  -10.684 207.056 1.00 114.49 ? 316 CYS A SG    1 
ATOM   2472  N N     . ALA A 1 317 ? -4.288  -14.721 207.036 1.00 99.19  ? 317 ALA A N     1 
ATOM   2473  C CA    . ALA A 1 317 ? -3.142  -15.549 206.688 1.00 95.96  ? 317 ALA A CA    1 
ATOM   2474  C C     . ALA A 1 317 ? -3.074  -16.761 207.605 1.00 99.50  ? 317 ALA A C     1 
ATOM   2475  O O     . ALA A 1 317 ? -2.244  -16.811 208.513 1.00 106.39 ? 317 ALA A O     1 
ATOM   2476  C CB    . ALA A 1 317 ? -1.861  -14.738 206.779 1.00 92.98  ? 317 ALA A CB    1 
ATOM   2477  N N     . PRO A 1 318 ? -3.959  -17.743 207.373 1.00 95.47  ? 318 PRO A N     1 
ATOM   2478  C CA    . PRO A 1 318 ? -4.061  -18.933 208.225 1.00 93.98  ? 318 PRO A CA    1 
ATOM   2479  C C     . PRO A 1 318 ? -2.833  -19.827 208.103 1.00 90.52  ? 318 PRO A C     1 
ATOM   2480  O O     . PRO A 1 318 ? -2.207  -19.866 207.044 1.00 92.12  ? 318 PRO A O     1 
ATOM   2481  C CB    . PRO A 1 318 ? -5.300  -19.647 207.676 1.00 91.52  ? 318 PRO A CB    1 
ATOM   2482  C CG    . PRO A 1 318 ? -5.397  -19.198 206.264 1.00 88.08  ? 318 PRO A CG    1 
ATOM   2483  C CD    . PRO A 1 318 ? -4.913  -17.783 206.250 1.00 91.04  ? 318 PRO A CD    1 
ATOM   2484  N N     . GLU A 1 319 ? -2.492  -20.534 209.176 1.00 88.13  ? 319 GLU A N     1 
ATOM   2485  C CA    . GLU A 1 319 ? -1.307  -21.387 209.173 1.00 89.30  ? 319 GLU A CA    1 
ATOM   2486  C C     . GLU A 1 319 ? -1.563  -22.756 208.544 1.00 95.29  ? 319 GLU A C     1 
ATOM   2487  O O     . GLU A 1 319 ? -0.621  -23.460 208.185 1.00 101.28 ? 319 GLU A O     1 
ATOM   2488  C CB    . GLU A 1 319 ? -0.745  -21.549 210.589 1.00 83.92  ? 319 GLU A CB    1 
ATOM   2489  C CG    . GLU A 1 319 ? -1.710  -22.182 211.574 1.00 90.80  ? 319 GLU A CG    1 
ATOM   2490  C CD    . GLU A 1 319 ? -1.116  -22.338 212.962 1.00 104.06 ? 319 GLU A CD    1 
ATOM   2491  O OE1   . GLU A 1 319 ? 0.110   -22.150 213.114 1.00 106.58 ? 319 GLU A OE1   1 
ATOM   2492  O OE2   . GLU A 1 319 ? -1.875  -22.652 213.903 1.00 113.27 ? 319 GLU A OE2   1 
ATOM   2493  N N     . SER A 1 320 ? -2.833  -23.129 208.410 1.00 95.56  ? 320 SER A N     1 
ATOM   2494  C CA    . SER A 1 320 ? -3.193  -24.417 207.821 1.00 96.39  ? 320 SER A CA    1 
ATOM   2495  C C     . SER A 1 320 ? -4.675  -24.477 207.479 1.00 102.79 ? 320 SER A C     1 
ATOM   2496  O O     . SER A 1 320 ? -5.446  -23.606 207.880 1.00 111.18 ? 320 SER A O     1 
ATOM   2497  C CB    . SER A 1 320 ? -2.847  -25.557 208.780 1.00 92.32  ? 320 SER A CB    1 
ATOM   2498  O OG    . SER A 1 320 ? -3.550  -25.418 210.001 1.00 89.34  ? 320 SER A OG    1 
ATOM   2499  N N     . ASP A 1 321 ? -5.071  -25.511 206.742 1.00 100.15 ? 321 ASP A N     1 
ATOM   2500  C CA    . ASP A 1 321 ? -6.485  -25.752 206.485 1.00 103.73 ? 321 ASP A CA    1 
ATOM   2501  C C     . ASP A 1 321 ? -7.170  -26.180 207.772 1.00 101.70 ? 321 ASP A C     1 
ATOM   2502  O O     . ASP A 1 321 ? -8.389  -26.072 207.907 1.00 102.08 ? 321 ASP A O     1 
ATOM   2503  C CB    . ASP A 1 321 ? -6.677  -26.829 205.418 1.00 111.62 ? 321 ASP A CB    1 
ATOM   2504  C CG    . ASP A 1 321 ? -6.222  -26.379 204.050 1.00 118.93 ? 321 ASP A CG    1 
ATOM   2505  O OD1   . ASP A 1 321 ? -6.024  -25.161 203.864 1.00 123.77 ? 321 ASP A OD1   1 
ATOM   2506  O OD2   . ASP A 1 321 ? -6.069  -27.242 203.160 1.00 120.93 ? 321 ASP A OD2   1 
ATOM   2507  N N     . ALA A 1 322 ? -6.377  -26.678 208.715 1.00 96.76  ? 322 ALA A N     1 
ATOM   2508  C CA    . ALA A 1 322 ? -6.894  -27.060 210.018 1.00 90.11  ? 322 ALA A CA    1 
ATOM   2509  C C     . ALA A 1 322 ? -7.320  -25.818 210.794 1.00 89.74  ? 322 ALA A C     1 
ATOM   2510  O O     . ALA A 1 322 ? -8.356  -25.815 211.455 1.00 90.30  ? 322 ALA A O     1 
ATOM   2511  C CB    . ALA A 1 322 ? -5.852  -27.847 210.792 1.00 79.90  ? 322 ALA A CB    1 
ATOM   2512  N N     . GLU A 1 323 ? -6.516  -24.762 210.703 1.00 91.25  ? 323 GLU A N     1 
ATOM   2513  C CA    . GLU A 1 323 ? -6.829  -23.502 211.368 1.00 90.93  ? 323 GLU A CA    1 
ATOM   2514  C C     . GLU A 1 323 ? -8.003  -22.815 210.681 1.00 93.71  ? 323 GLU A C     1 
ATOM   2515  O O     . GLU A 1 323 ? -8.804  -22.134 211.326 1.00 101.63 ? 323 GLU A O     1 
ATOM   2516  C CB    . GLU A 1 323 ? -5.607  -22.575 211.389 1.00 93.46  ? 323 GLU A CB    1 
ATOM   2517  C CG    . GLU A 1 323 ? -5.868  -21.216 212.037 1.00 100.25 ? 323 GLU A CG    1 
ATOM   2518  C CD    . GLU A 1 323 ? -4.597  -20.434 212.328 1.00 103.47 ? 323 GLU A CD    1 
ATOM   2519  O OE1   . GLU A 1 323 ? -4.172  -20.411 213.503 1.00 106.06 ? 323 GLU A OE1   1 
ATOM   2520  O OE2   . GLU A 1 323 ? -4.029  -19.835 211.388 1.00 100.50 ? 323 GLU A OE2   1 
ATOM   2521  N N     . ARG A 1 324 ? -8.104  -23.009 209.369 1.00 90.03  ? 324 ARG A N     1 
ATOM   2522  C CA    . ARG A 1 324 ? -9.154  -22.379 208.577 1.00 90.27  ? 324 ARG A CA    1 
ATOM   2523  C C     . ARG A 1 324 ? -10.543 -22.812 209.032 1.00 94.12  ? 324 ARG A C     1 
ATOM   2524  O O     . ARG A 1 324 ? -11.462 -21.997 209.110 1.00 94.15  ? 324 ARG A O     1 
ATOM   2525  C CB    . ARG A 1 324 ? -8.974  -22.686 207.087 1.00 88.62  ? 324 ARG A CB    1 
ATOM   2526  C CG    . ARG A 1 324 ? -7.999  -21.768 206.368 1.00 97.02  ? 324 ARG A CG    1 
ATOM   2527  C CD    . ARG A 1 324 ? -8.058  -21.975 204.859 1.00 111.75 ? 324 ARG A CD    1 
ATOM   2528  N NE    . ARG A 1 324 ? -7.206  -21.035 204.132 1.00 124.92 ? 324 ARG A NE    1 
ATOM   2529  C CZ    . ARG A 1 324 ? -7.606  -19.845 203.690 1.00 131.33 ? 324 ARG A CZ    1 
ATOM   2530  N NH1   . ARG A 1 324 ? -8.852  -19.433 203.899 1.00 133.66 ? 324 ARG A NH1   1 
ATOM   2531  N NH2   . ARG A 1 324 ? -6.755  -19.061 203.038 1.00 128.41 ? 324 ARG A NH2   1 
ATOM   2532  N N     . GLN A 1 325 ? -10.685 -24.097 209.337 1.00 97.12  ? 325 GLN A N     1 
ATOM   2533  C CA    . GLN A 1 325 ? -11.973 -24.646 209.741 1.00 103.76 ? 325 GLN A CA    1 
ATOM   2534  C C     . GLN A 1 325 ? -12.221 -24.447 211.233 1.00 99.90  ? 325 GLN A C     1 
ATOM   2535  O O     . GLN A 1 325 ? -13.354 -24.551 211.703 1.00 101.51 ? 325 GLN A O     1 
ATOM   2536  C CB    . GLN A 1 325 ? -12.072 -26.125 209.362 1.00 111.87 ? 325 GLN A CB    1 
ATOM   2537  C CG    . GLN A 1 325 ? -10.968 -26.991 209.933 1.00 115.65 ? 325 GLN A CG    1 
ATOM   2538  C CD    . GLN A 1 325 ? -10.957 -28.382 209.334 1.00 118.95 ? 325 GLN A CD    1 
ATOM   2539  O OE1   . GLN A 1 325 ? -11.608 -28.640 208.322 1.00 122.69 ? 325 GLN A OE1   1 
ATOM   2540  N NE2   . GLN A 1 325 ? -10.214 -29.287 209.957 1.00 117.72 ? 325 GLN A NE2   1 
ATOM   2541  N N     . GLY A 1 326 ? -11.155 -24.158 211.973 1.00 97.99  ? 326 GLY A N     1 
ATOM   2542  C CA    . GLY A 1 326 ? -11.278 -23.779 213.368 1.00 99.79  ? 326 GLY A CA    1 
ATOM   2543  C C     . GLY A 1 326 ? -11.771 -22.348 213.467 1.00 102.94 ? 326 GLY A C     1 
ATOM   2544  O O     . GLY A 1 326 ? -12.652 -22.033 214.269 1.00 105.83 ? 326 GLY A O     1 
ATOM   2545  N N     . LEU A 1 327 ? -11.197 -21.482 212.636 1.00 99.38  ? 327 LEU A N     1 
ATOM   2546  C CA    . LEU A 1 327 ? -11.628 -20.094 212.537 1.00 100.33 ? 327 LEU A CA    1 
ATOM   2547  C C     . LEU A 1 327 ? -13.061 -19.998 212.029 1.00 111.24 ? 327 LEU A C     1 
ATOM   2548  O O     . LEU A 1 327 ? -13.801 -19.086 212.398 1.00 115.31 ? 327 LEU A O     1 
ATOM   2549  C CB    . LEU A 1 327 ? -10.705 -19.322 211.593 1.00 99.26  ? 327 LEU A CB    1 
ATOM   2550  C CG    . LEU A 1 327 ? -9.335  -18.921 212.135 1.00 105.49 ? 327 LEU A CG    1 
ATOM   2551  C CD1   . LEU A 1 327 ? -8.365  -18.658 210.992 1.00 105.89 ? 327 LEU A CD1   1 
ATOM   2552  C CD2   . LEU A 1 327 ? -9.468  -17.693 213.025 1.00 106.36 ? 327 LEU A CD2   1 
ATOM   2553  N N     . ALA A 1 328 ? -13.444 -20.945 211.178 1.00 110.62 ? 328 ALA A N     1 
ATOM   2554  C CA    . ALA A 1 328 ? -14.759 -20.927 210.550 1.00 109.29 ? 328 ALA A CA    1 
ATOM   2555  C C     . ALA A 1 328 ? -15.885 -21.017 211.576 1.00 112.34 ? 328 ALA A C     1 
ATOM   2556  O O     . ALA A 1 328 ? -17.003 -20.578 211.317 1.00 113.36 ? 328 ALA A O     1 
ATOM   2557  C CB    . ALA A 1 328 ? -14.871 -22.045 209.536 1.00 112.15 ? 328 ALA A CB    1 
ATOM   2558  N N     . ARG A 1 329 ? -15.586 -21.587 212.738 1.00 115.52 ? 329 ARG A N     1 
ATOM   2559  C CA    . ARG A 1 329 ? -16.558 -21.639 213.824 1.00 116.58 ? 329 ARG A CA    1 
ATOM   2560  C C     . ARG A 1 329 ? -16.334 -20.499 214.815 1.00 121.08 ? 329 ARG A C     1 
ATOM   2561  O O     . ARG A 1 329 ? -17.288 -19.919 215.331 1.00 124.35 ? 329 ARG A O     1 
ATOM   2562  C CB    . ARG A 1 329 ? -16.478 -22.976 214.557 1.00 111.43 ? 329 ARG A CB    1 
ATOM   2563  C CG    . ARG A 1 329 ? -16.245 -24.170 213.659 1.00 110.36 ? 329 ARG A CG    1 
ATOM   2564  C CD    . ARG A 1 329 ? -16.221 -25.436 214.487 1.00 111.98 ? 329 ARG A CD    1 
ATOM   2565  N NE    . ARG A 1 329 ? -15.687 -26.580 213.761 1.00 114.61 ? 329 ARG A NE    1 
ATOM   2566  C CZ    . ARG A 1 329 ? -14.426 -26.989 213.845 1.00 115.62 ? 329 ARG A CZ    1 
ATOM   2567  N NH1   . ARG A 1 329 ? -13.563 -26.345 214.623 1.00 117.45 ? 329 ARG A NH1   1 
ATOM   2568  N NH2   . ARG A 1 329 ? -14.029 -28.045 213.151 1.00 113.14 ? 329 ARG A NH2   1 
ATOM   2569  N N     . LEU A 1 330 ? -15.068 -20.187 215.074 1.00 119.37 ? 330 LEU A N     1 
ATOM   2570  C CA    . LEU A 1 330 ? -14.701 -19.130 216.012 1.00 117.12 ? 330 LEU A CA    1 
ATOM   2571  C C     . LEU A 1 330 ? -15.187 -17.748 215.588 1.00 115.78 ? 330 LEU A C     1 
ATOM   2572  O O     . LEU A 1 330 ? -15.742 -17.004 216.397 1.00 118.55 ? 330 LEU A O     1 
ATOM   2573  C CB    . LEU A 1 330 ? -13.185 -19.095 216.202 1.00 115.36 ? 330 LEU A CB    1 
ATOM   2574  C CG    . LEU A 1 330 ? -12.660 -19.850 217.420 1.00 115.94 ? 330 LEU A CG    1 
ATOM   2575  C CD1   . LEU A 1 330 ? -11.144 -19.920 217.388 1.00 113.35 ? 330 LEU A CD1   1 
ATOM   2576  C CD2   . LEU A 1 330 ? -13.143 -19.178 218.696 1.00 116.12 ? 330 LEU A CD2   1 
ATOM   2577  N N     . LEU A 1 331 ? -14.966 -17.405 214.323 1.00 108.55 ? 331 LEU A N     1 
ATOM   2578  C CA    . LEU A 1 331 ? -15.306 -16.074 213.820 1.00 102.40 ? 331 LEU A CA    1 
ATOM   2579  C C     . LEU A 1 331 ? -16.785 -15.676 213.942 1.00 107.73 ? 331 LEU A C     1 
ATOM   2580  O O     . LEU A 1 331 ? -17.081 -14.599 214.460 1.00 108.59 ? 331 LEU A O     1 
ATOM   2581  C CB    . LEU A 1 331 ? -14.800 -15.873 212.385 1.00 95.03  ? 331 LEU A CB    1 
ATOM   2582  C CG    . LEU A 1 331 ? -13.620 -14.917 212.220 1.00 91.51  ? 331 LEU A CG    1 
ATOM   2583  C CD1   . LEU A 1 331 ? -13.307 -14.721 210.751 1.00 91.07  ? 331 LEU A CD1   1 
ATOM   2584  C CD2   . LEU A 1 331 ? -13.915 -13.585 212.888 1.00 93.95  ? 331 LEU A CD2   1 
ATOM   2585  N N     . PRO A 1 332 ? -17.717 -16.528 213.467 1.00 110.71 ? 332 PRO A N     1 
ATOM   2586  C CA    . PRO A 1 332 ? -19.129 -16.137 213.558 1.00 112.05 ? 332 PRO A CA    1 
ATOM   2587  C C     . PRO A 1 332 ? -19.582 -15.986 215.003 1.00 118.64 ? 332 PRO A C     1 
ATOM   2588  O O     . PRO A 1 332 ? -20.338 -15.068 215.323 1.00 125.82 ? 332 PRO A O     1 
ATOM   2589  C CB    . PRO A 1 332 ? -19.859 -17.314 212.904 1.00 105.81 ? 332 PRO A CB    1 
ATOM   2590  C CG    . PRO A 1 332 ? -18.841 -17.951 212.027 1.00 104.37 ? 332 PRO A CG    1 
ATOM   2591  C CD    . PRO A 1 332 ? -17.564 -17.824 212.783 1.00 107.44 ? 332 PRO A CD    1 
ATOM   2592  N N     . ARG A 1 333 ? -19.111 -16.883 215.863 1.00 117.11 ? 333 ARG A N     1 
ATOM   2593  C CA    . ARG A 1 333 ? -19.425 -16.828 217.282 1.00 113.63 ? 333 ARG A CA    1 
ATOM   2594  C C     . ARG A 1 333 ? -18.872 -15.547 217.896 1.00 110.11 ? 333 ARG A C     1 
ATOM   2595  O O     . ARG A 1 333 ? -19.516 -14.914 218.734 1.00 108.72 ? 333 ARG A O     1 
ATOM   2596  C CB    . ARG A 1 333 ? -18.845 -18.049 217.994 1.00 109.67 ? 333 ARG A CB    1 
ATOM   2597  C CG    . ARG A 1 333 ? -19.293 -18.194 219.432 1.00 111.22 ? 333 ARG A CG    1 
ATOM   2598  C CD    . ARG A 1 333 ? -19.005 -19.587 219.961 1.00 113.76 ? 333 ARG A CD    1 
ATOM   2599  N NE    . ARG A 1 333 ? -17.575 -19.867 220.020 1.00 115.25 ? 333 ARG A NE    1 
ATOM   2600  C CZ    . ARG A 1 333 ? -16.997 -20.924 219.458 1.00 118.49 ? 333 ARG A CZ    1 
ATOM   2601  N NH1   . ARG A 1 333 ? -17.729 -21.808 218.793 1.00 120.10 ? 333 ARG A NH1   1 
ATOM   2602  N NH2   . ARG A 1 333 ? -15.687 -21.099 219.564 1.00 118.30 ? 333 ARG A NH2   1 
ATOM   2603  N N     . LEU A 1 334 ? -17.674 -15.168 217.466 1.00 107.36 ? 334 LEU A N     1 
ATOM   2604  C CA    . LEU A 1 334 ? -17.040 -13.954 217.958 1.00 106.36 ? 334 LEU A CA    1 
ATOM   2605  C C     . LEU A 1 334 ? -17.759 -12.707 217.467 1.00 109.48 ? 334 LEU A C     1 
ATOM   2606  O O     . LEU A 1 334 ? -17.928 -11.744 218.213 1.00 113.14 ? 334 LEU A O     1 
ATOM   2607  C CB    . LEU A 1 334 ? -15.570 -13.913 217.545 1.00 102.34 ? 334 LEU A CB    1 
ATOM   2608  C CG    . LEU A 1 334 ? -14.597 -14.548 218.534 1.00 96.57  ? 334 LEU A CG    1 
ATOM   2609  C CD1   . LEU A 1 334 ? -13.244 -14.741 217.876 1.00 96.92  ? 334 LEU A CD1   1 
ATOM   2610  C CD2   . LEU A 1 334 ? -14.480 -13.679 219.781 1.00 94.85  ? 334 LEU A CD2   1 
ATOM   2611  N N     . GLN A 1 335 ? -18.183 -12.725 216.208 1.00 110.95 ? 335 GLN A N     1 
ATOM   2612  C CA    . GLN A 1 335 ? -18.888 -11.586 215.636 1.00 114.12 ? 335 GLN A CA    1 
ATOM   2613  C C     . GLN A 1 335 ? -20.231 -11.394 216.324 1.00 117.68 ? 335 GLN A C     1 
ATOM   2614  O O     . GLN A 1 335 ? -20.764 -10.288 216.367 1.00 120.07 ? 335 GLN A O     1 
ATOM   2615  C CB    . GLN A 1 335 ? -19.083 -11.772 214.134 1.00 116.18 ? 335 GLN A CB    1 
ATOM   2616  C CG    . GLN A 1 335 ? -17.796 -11.721 213.339 1.00 116.50 ? 335 GLN A CG    1 
ATOM   2617  C CD    . GLN A 1 335 ? -17.912 -12.458 212.025 1.00 118.53 ? 335 GLN A CD    1 
ATOM   2618  O OE1   . GLN A 1 335 ? -18.798 -13.295 211.848 1.00 120.24 ? 335 GLN A OE1   1 
ATOM   2619  N NE2   . GLN A 1 335 ? -17.020 -12.150 211.091 1.00 117.90 ? 335 GLN A NE2   1 
ATOM   2620  N N     . GLY A 1 336 ? -20.766 -12.480 216.868 1.00 118.90 ? 336 GLY A N     1 
ATOM   2621  C CA    . GLY A 1 336 ? -22.026 -12.434 217.584 1.00 119.25 ? 336 GLY A CA    1 
ATOM   2622  C C     . GLY A 1 336 ? -21.893 -11.794 218.950 1.00 115.43 ? 336 GLY A C     1 
ATOM   2623  O O     . GLY A 1 336 ? -22.754 -11.024 219.367 1.00 116.74 ? 336 GLY A O     1 
ATOM   2624  N N     . LYS A 1 337 ? -20.814 -12.115 219.656 1.00 113.61 ? 337 LYS A N     1 
ATOM   2625  C CA    . LYS A 1 337 ? -20.578 -11.536 220.975 1.00 111.37 ? 337 LYS A CA    1 
ATOM   2626  C C     . LYS A 1 337 ? -20.234 -10.054 220.875 1.00 111.29 ? 337 LYS A C     1 
ATOM   2627  O O     . LYS A 1 337 ? -20.432 -9.297  221.823 1.00 113.58 ? 337 LYS A O     1 
ATOM   2628  C CB    . LYS A 1 337 ? -19.503 -12.313 221.740 1.00 110.64 ? 337 LYS A CB    1 
ATOM   2629  C CG    . LYS A 1 337 ? -20.076 -13.424 222.603 1.00 116.76 ? 337 LYS A CG    1 
ATOM   2630  C CD    . LYS A 1 337 ? -20.981 -12.848 223.687 1.00 122.14 ? 337 LYS A CD    1 
ATOM   2631  C CE    . LYS A 1 337 ? -21.763 -13.935 224.407 1.00 122.28 ? 337 LYS A CE    1 
ATOM   2632  N NZ    . LYS A 1 337 ? -20.872 -14.947 225.038 1.00 120.66 ? 337 LYS A NZ    1 
ATOM   2633  N N     . LEU A 1 338 ? -19.718 -9.644  219.722 1.00 111.42 ? 338 LEU A N     1 
ATOM   2634  C CA    . LEU A 1 338 ? -19.597 -8.226  219.421 1.00 114.49 ? 338 LEU A CA    1 
ATOM   2635  C C     . LEU A 1 338 ? -20.875 -7.790  218.718 1.00 119.46 ? 338 LEU A C     1 
ATOM   2636  O O     . LEU A 1 338 ? -21.813 -8.574  218.589 1.00 122.47 ? 338 LEU A O     1 
ATOM   2637  C CB    . LEU A 1 338 ? -18.374 -7.945  218.548 1.00 111.44 ? 338 LEU A CB    1 
ATOM   2638  C CG    . LEU A 1 338 ? -17.017 -8.279  219.170 1.00 111.04 ? 338 LEU A CG    1 
ATOM   2639  C CD1   . LEU A 1 338 ? -15.884 -7.749  218.299 1.00 109.82 ? 338 LEU A CD1   1 
ATOM   2640  C CD2   . LEU A 1 338 ? -16.918 -7.731  220.587 1.00 112.78 ? 338 LEU A CD2   1 
ATOM   2641  N N     . GLY A 1 339 ? -20.918 -6.546  218.261 1.00 115.31 ? 339 GLY A N     1 
ATOM   2642  C CA    . GLY A 1 339 ? -22.122 -6.030  217.638 1.00 119.42 ? 339 GLY A CA    1 
ATOM   2643  C C     . GLY A 1 339 ? -22.358 -6.537  216.227 1.00 120.32 ? 339 GLY A C     1 
ATOM   2644  O O     . GLY A 1 339 ? -23.465 -6.428  215.699 1.00 125.25 ? 339 GLY A O     1 
ATOM   2645  N N     . LEU A 1 340 ? -21.320 -7.101  215.617 1.00 112.47 ? 340 LEU A N     1 
ATOM   2646  C CA    . LEU A 1 340 ? -21.356 -7.448  214.196 1.00 104.03 ? 340 LEU A CA    1 
ATOM   2647  C C     . LEU A 1 340 ? -22.407 -8.505  213.844 1.00 105.04 ? 340 LEU A C     1 
ATOM   2648  O O     . LEU A 1 340 ? -22.771 -9.333  214.679 1.00 106.02 ? 340 LEU A O     1 
ATOM   2649  C CB    . LEU A 1 340 ? -19.970 -7.901  213.712 1.00 99.21  ? 340 LEU A CB    1 
ATOM   2650  C CG    . LEU A 1 340 ? -18.803 -6.904  213.743 1.00 98.18  ? 340 LEU A CG    1 
ATOM   2651  C CD1   . LEU A 1 340 ? -19.262 -5.481  213.445 1.00 97.23  ? 340 LEU A CD1   1 
ATOM   2652  C CD2   . LEU A 1 340 ? -18.041 -6.966  215.061 1.00 99.83  ? 340 LEU A CD2   1 
ATOM   2653  N N     . PRO A 1 341 ? -22.922 -8.454  212.605 1.00 105.42 ? 341 PRO A N     1 
ATOM   2654  C CA    . PRO A 1 341 ? -23.787 -9.516  212.082 1.00 110.24 ? 341 PRO A CA    1 
ATOM   2655  C C     . PRO A 1 341 ? -22.947 -10.646 211.495 1.00 121.02 ? 341 PRO A C     1 
ATOM   2656  O O     . PRO A 1 341 ? -21.867 -10.381 210.971 1.00 122.35 ? 341 PRO A O     1 
ATOM   2657  C CB    . PRO A 1 341 ? -24.568 -8.808  210.974 1.00 110.65 ? 341 PRO A CB    1 
ATOM   2658  C CG    . PRO A 1 341 ? -23.648 -7.735  210.499 1.00 106.39 ? 341 PRO A CG    1 
ATOM   2659  C CD    . PRO A 1 341 ? -22.873 -7.284  211.709 1.00 104.61 ? 341 PRO A CD    1 
ATOM   2660  N N     . ARG A 1 342 ? -23.423 -11.884 211.588 1.00 133.27 ? 342 ARG A N     1 
ATOM   2661  C CA    . ARG A 1 342 ? -22.691 -13.009 211.017 1.00 139.21 ? 342 ARG A CA    1 
ATOM   2662  C C     . ARG A 1 342 ? -22.868 -13.037 209.505 1.00 145.16 ? 342 ARG A C     1 
ATOM   2663  O O     . ARG A 1 342 ? -23.938 -12.710 208.990 1.00 143.57 ? 342 ARG A O     1 
ATOM   2664  C CB    . ARG A 1 342 ? -23.161 -14.337 211.615 1.00 140.25 ? 342 ARG A CB    1 
ATOM   2665  C CG    . ARG A 1 342 ? -23.090 -14.410 213.130 1.00 141.37 ? 342 ARG A CG    1 
ATOM   2666  C CD    . ARG A 1 342 ? -23.411 -15.814 213.624 1.00 145.09 ? 342 ARG A CD    1 
ATOM   2667  N NE    . ARG A 1 342 ? -23.312 -15.919 215.077 1.00 146.62 ? 342 ARG A NE    1 
ATOM   2668  C CZ    . ARG A 1 342 ? -23.294 -17.069 215.744 1.00 146.84 ? 342 ARG A CZ    1 
ATOM   2669  N NH1   . ARG A 1 342 ? -23.362 -18.220 215.089 1.00 147.27 ? 342 ARG A NH1   1 
ATOM   2670  N NH2   . ARG A 1 342 ? -23.201 -17.069 217.067 1.00 144.89 ? 342 ARG A NH2   1 
ATOM   2671  N N     . GLN A 1 343 ? -21.815 -13.428 208.796 1.00 150.61 ? 343 GLN A N     1 
ATOM   2672  C CA    . GLN A 1 343 ? -21.873 -13.527 207.344 1.00 156.46 ? 343 GLN A CA    1 
ATOM   2673  C C     . GLN A 1 343 ? -22.238 -14.946 206.913 1.00 163.12 ? 343 GLN A C     1 
ATOM   2674  O O     . GLN A 1 343 ? -21.897 -15.916 207.594 1.00 161.33 ? 343 GLN A O     1 
ATOM   2675  C CB    . GLN A 1 343 ? -20.544 -13.094 206.722 1.00 151.57 ? 343 GLN A CB    1 
ATOM   2676  C CG    . GLN A 1 343 ? -20.223 -11.620 206.924 1.00 146.85 ? 343 GLN A CG    1 
ATOM   2677  C CD    . GLN A 1 343 ? -18.963 -11.402 207.737 1.00 144.17 ? 343 GLN A CD    1 
ATOM   2678  O OE1   . GLN A 1 343 ? -18.057 -12.236 207.735 1.00 144.31 ? 343 GLN A OE1   1 
ATOM   2679  N NE2   . GLN A 1 343 ? -18.899 -10.277 208.441 1.00 142.53 ? 343 GLN A NE2   1 
ATOM   2680  N N     . ALA A 1 344 ? -22.938 -15.053 205.786 1.00 166.56 ? 344 ALA A N     1 
ATOM   2681  C CA    . ALA A 1 344 ? -23.405 -16.339 205.275 1.00 166.72 ? 344 ALA A CA    1 
ATOM   2682  C C     . ALA A 1 344 ? -22.259 -17.320 205.046 1.00 166.36 ? 344 ALA A C     1 
ATOM   2683  O O     . ALA A 1 344 ? -21.505 -17.200 204.082 1.00 164.60 ? 344 ALA A O     1 
ATOM   2684  C CB    . ALA A 1 344 ? -24.201 -16.144 203.992 1.00 166.93 ? 344 ALA A CB    1 
ATOM   2685  N N     . ARG A 1 345 ? -22.137 -18.290 205.946 1.00 168.82 ? 345 ARG A N     1 
ATOM   2686  C CA    . ARG A 1 345 ? -21.085 -19.290 205.851 1.00 170.06 ? 345 ARG A CA    1 
ATOM   2687  C C     . ARG A 1 345 ? -21.576 -20.501 205.067 1.00 173.24 ? 345 ARG A C     1 
ATOM   2688  O O     . ARG A 1 345 ? -21.697 -21.599 205.616 1.00 172.82 ? 345 ARG A O     1 
ATOM   2689  C CB    . ARG A 1 345 ? -20.634 -19.712 207.249 1.00 168.79 ? 345 ARG A CB    1 
ATOM   2690  C CG    . ARG A 1 345 ? -19.269 -20.369 207.294 1.00 167.28 ? 345 ARG A CG    1 
ATOM   2691  C CD    . ARG A 1 345 ? -18.820 -20.567 208.727 1.00 165.01 ? 345 ARG A CD    1 
ATOM   2692  N NE    . ARG A 1 345 ? -19.688 -21.493 209.447 1.00 165.86 ? 345 ARG A NE    1 
ATOM   2693  C CZ    . ARG A 1 345 ? -19.432 -22.787 209.598 1.00 167.14 ? 345 ARG A CZ    1 
ATOM   2694  N NH1   . ARG A 1 345 ? -20.275 -23.561 210.268 1.00 169.44 ? 345 ARG A NH1   1 
ATOM   2695  N NH2   . ARG A 1 345 ? -18.328 -23.309 209.080 1.00 165.78 ? 345 ARG A NH2   1 
ATOM   2696  N N     . ALA A 1 346 ? -21.866 -20.290 203.785 1.00 176.07 ? 346 ALA A N     1 
ATOM   2697  C CA    . ALA A 1 346 ? -22.355 -21.357 202.917 1.00 177.80 ? 346 ALA A CA    1 
ATOM   2698  C C     . ALA A 1 346 ? -21.350 -22.504 202.850 1.00 179.72 ? 346 ALA A C     1 
ATOM   2699  O O     . ALA A 1 346 ? -20.159 -22.285 202.632 1.00 178.81 ? 346 ALA A O     1 
ATOM   2700  C CB    . ALA A 1 346 ? -22.657 -20.819 201.524 1.00 176.18 ? 346 ALA A CB    1 
ATOM   2701  N N     . ALA A 1 347 ? -21.838 -23.725 203.043 1.00 180.98 ? 347 ALA A N     1 
ATOM   2702  C CA    . ALA A 1 347 ? -20.971 -24.894 203.175 1.00 180.85 ? 347 ALA A CA    1 
ATOM   2703  C C     . ALA A 1 347 ? -20.358 -25.370 201.856 1.00 180.63 ? 347 ALA A C     1 
ATOM   2704  O O     . ALA A 1 347 ? -20.593 -24.787 200.798 1.00 181.10 ? 347 ALA A O     1 
ATOM   2705  C CB    . ALA A 1 347 ? -21.724 -26.034 203.852 1.00 182.98 ? 347 ALA A CB    1 
ATOM   2706  N N     . ALA A 1 348 ? -19.566 -26.436 201.943 1.00 177.92 ? 348 ALA A N     1 
ATOM   2707  C CA    . ALA A 1 348 ? -18.921 -27.046 200.784 1.00 175.27 ? 348 ALA A CA    1 
ATOM   2708  C C     . ALA A 1 348 ? -19.731 -28.262 200.324 1.00 175.33 ? 348 ALA A C     1 
ATOM   2709  O O     . ALA A 1 348 ? -20.555 -28.769 201.086 1.00 175.78 ? 348 ALA A O     1 
ATOM   2710  C CB    . ALA A 1 348 ? -17.491 -27.451 201.144 1.00 170.98 ? 348 ALA A CB    1 
ATOM   2711  N N     . PRO A 1 349 ? -19.519 -28.719 199.071 1.00 173.58 ? 349 PRO A N     1 
ATOM   2712  C CA    . PRO A 1 349 ? -20.181 -29.923 198.549 1.00 172.44 ? 349 PRO A CA    1 
ATOM   2713  C C     . PRO A 1 349 ? -20.144 -31.104 199.517 1.00 168.82 ? 349 PRO A C     1 
ATOM   2714  O O     . PRO A 1 349 ? -19.173 -31.268 200.256 1.00 166.39 ? 349 PRO A O     1 
ATOM   2715  C CB    . PRO A 1 349 ? -19.363 -30.242 197.299 1.00 172.77 ? 349 PRO A CB    1 
ATOM   2716  C CG    . PRO A 1 349 ? -18.958 -28.904 196.796 1.00 173.80 ? 349 PRO A CG    1 
ATOM   2717  C CD    . PRO A 1 349 ? -18.748 -28.032 198.016 1.00 173.46 ? 349 PRO A CD    1 
ATOM   2718  N N     . GLU A 1 350 ? -21.199 -31.914 199.509 1.00 167.09 ? 350 GLU A N     1 
ATOM   2719  C CA    . GLU A 1 350 ? -21.333 -32.999 200.476 1.00 162.78 ? 350 GLU A CA    1 
ATOM   2720  C C     . GLU A 1 350 ? -20.937 -34.370 199.939 1.00 159.15 ? 350 GLU A C     1 
ATOM   2721  O O     . GLU A 1 350 ? -21.412 -34.804 198.888 1.00 163.66 ? 350 GLU A O     1 
ATOM   2722  C CB    . GLU A 1 350 ? -22.754 -33.051 201.041 1.00 165.06 ? 350 GLU A CB    1 
ATOM   2723  C CG    . GLU A 1 350 ? -22.867 -32.440 202.422 1.00 166.14 ? 350 GLU A CG    1 
ATOM   2724  C CD    . GLU A 1 350 ? -21.792 -32.950 203.364 1.00 164.31 ? 350 GLU A CD    1 
ATOM   2725  O OE1   . GLU A 1 350 ? -20.895 -32.161 203.729 1.00 157.06 ? 350 GLU A OE1   1 
ATOM   2726  O OE2   . GLU A 1 350 ? -21.841 -34.142 203.737 1.00 167.47 ? 350 GLU A OE2   1 
ATOM   2727  N N     . ILE A 1 351 ? -20.068 -35.048 200.680 1.00 150.70 ? 351 ILE A N     1 
ATOM   2728  C CA    . ILE A 1 351 ? -19.676 -36.410 200.349 1.00 146.05 ? 351 ILE A CA    1 
ATOM   2729  C C     . ILE A 1 351 ? -20.868 -37.347 200.513 1.00 146.38 ? 351 ILE A C     1 
ATOM   2730  O O     . ILE A 1 351 ? -21.812 -37.042 201.245 1.00 146.86 ? 351 ILE A O     1 
ATOM   2731  C CB    . ILE A 1 351 ? -18.497 -36.897 201.222 1.00 141.96 ? 351 ILE A CB    1 
ATOM   2732  C CG1   . ILE A 1 351 ? -18.982 -37.372 202.596 1.00 141.07 ? 351 ILE A CG1   1 
ATOM   2733  C CG2   . ILE A 1 351 ? -17.450 -35.801 201.360 1.00 138.33 ? 351 ILE A CG2   1 
ATOM   2734  C CD1   . ILE A 1 351 ? -19.352 -36.256 203.551 1.00 139.74 ? 351 ILE A CD1   1 
ATOM   2735  N N     . ASP A 1 352 ? -20.821 -38.483 199.823 1.00 144.83 ? 352 ASP A N     1 
ATOM   2736  C CA    . ASP A 1 352 ? -21.931 -39.430 199.821 1.00 142.13 ? 352 ASP A CA    1 
ATOM   2737  C C     . ASP A 1 352 ? -22.207 -39.997 201.210 1.00 137.17 ? 352 ASP A C     1 
ATOM   2738  O O     . ASP A 1 352 ? -21.286 -40.239 201.987 1.00 132.27 ? 352 ASP A O     1 
ATOM   2739  C CB    . ASP A 1 352 ? -21.662 -40.563 198.831 1.00 145.18 ? 352 ASP A CB    1 
ATOM   2740  C CG    . ASP A 1 352 ? -21.430 -40.059 197.420 1.00 148.48 ? 352 ASP A CG    1 
ATOM   2741  O OD1   . ASP A 1 352 ? -22.425 -39.792 196.712 1.00 150.95 ? 352 ASP A OD1   1 
ATOM   2742  O OD2   . ASP A 1 352 ? -20.254 -39.929 197.018 1.00 148.01 ? 352 ASP A OD2   1 
ATOM   2743  N N     . ARG A 1 353 ? -23.485 -40.201 201.513 1.00 141.99 ? 353 ARG A N     1 
ATOM   2744  C CA    . ARG A 1 353 ? -23.894 -40.720 202.813 1.00 144.99 ? 353 ARG A CA    1 
ATOM   2745  C C     . ARG A 1 353 ? -24.485 -42.122 202.677 1.00 148.05 ? 353 ARG A C     1 
ATOM   2746  O O     . ARG A 1 353 ? -25.107 -42.450 201.666 1.00 152.08 ? 353 ARG A O     1 
ATOM   2747  C CB    . ARG A 1 353 ? -24.907 -39.779 203.473 1.00 148.40 ? 353 ARG A CB    1 
ATOM   2748  C CG    . ARG A 1 353 ? -25.249 -40.133 204.914 1.00 147.91 ? 353 ARG A CG    1 
ATOM   2749  C CD    . ARG A 1 353 ? -26.477 -39.375 205.395 1.00 148.51 ? 353 ARG A CD    1 
ATOM   2750  N NE    . ARG A 1 353 ? -26.934 -39.847 206.699 1.00 146.74 ? 353 ARG A NE    1 
ATOM   2751  C CZ    . ARG A 1 353 ? -26.760 -39.187 207.839 1.00 144.92 ? 353 ARG A CZ    1 
ATOM   2752  N NH1   . ARG A 1 353 ? -27.209 -39.697 208.977 1.00 145.66 ? 353 ARG A NH1   1 
ATOM   2753  N NH2   . ARG A 1 353 ? -26.141 -38.013 207.842 1.00 141.63 ? 353 ARG A NH2   1 
ATOM   2754  N N     . LEU A 1 354 ? -24.283 -42.940 203.704 1.00 145.20 ? 354 LEU A N     1 
ATOM   2755  C CA    . LEU A 1 354 ? -24.773 -44.312 203.719 1.00 145.07 ? 354 LEU A CA    1 
ATOM   2756  C C     . LEU A 1 354 ? -25.192 -44.658 205.147 1.00 148.17 ? 354 LEU A C     1 
ATOM   2757  O O     . LEU A 1 354 ? -24.394 -44.560 206.075 1.00 146.31 ? 354 LEU A O     1 
ATOM   2758  C CB    . LEU A 1 354 ? -23.682 -45.257 203.204 1.00 142.78 ? 354 LEU A CB    1 
ATOM   2759  C CG    . LEU A 1 354 ? -23.910 -46.764 203.033 1.00 145.85 ? 354 LEU A CG    1 
ATOM   2760  C CD1   . LEU A 1 354 ? -23.284 -47.536 204.188 1.00 142.00 ? 354 LEU A CD1   1 
ATOM   2761  C CD2   . LEU A 1 354 ? -25.392 -47.118 202.872 1.00 153.52 ? 354 LEU A CD2   1 
ATOM   2762  N N     . ASP A 1 355 ? -26.450 -45.050 205.321 1.00 155.42 ? 355 ASP A N     1 
ATOM   2763  C CA    . ASP A 1 355 ? -26.997 -45.262 206.659 1.00 156.18 ? 355 ASP A CA    1 
ATOM   2764  C C     . ASP A 1 355 ? -27.321 -46.725 206.967 1.00 159.35 ? 355 ASP A C     1 
ATOM   2765  O O     . ASP A 1 355 ? -27.773 -47.472 206.097 1.00 162.84 ? 355 ASP A O     1 
ATOM   2766  C CB    . ASP A 1 355 ? -28.237 -44.386 206.875 1.00 156.50 ? 355 ASP A CB    1 
ATOM   2767  C CG    . ASP A 1 355 ? -27.923 -42.901 206.807 1.00 158.06 ? 355 ASP A CG    1 
ATOM   2768  O OD1   . ASP A 1 355 ? -27.991 -42.327 205.700 1.00 160.39 ? 355 ASP A OD1   1 
ATOM   2769  O OD2   . ASP A 1 355 ? -27.610 -42.306 207.861 1.00 156.67 ? 355 ASP A OD2   1 
ATOM   2770  N N     . LEU A 1 356 ? -27.078 -47.121 208.214 1.00 156.08 ? 356 LEU A N     1 
ATOM   2771  C CA    . LEU A 1 356 ? -27.424 -48.455 208.697 1.00 153.47 ? 356 LEU A CA    1 
ATOM   2772  C C     . LEU A 1 356 ? -28.251 -48.350 209.984 1.00 160.27 ? 356 LEU A C     1 
ATOM   2773  O O     . LEU A 1 356 ? -28.318 -47.286 210.600 1.00 163.13 ? 356 LEU A O     1 
ATOM   2774  C CB    . LEU A 1 356 ? -26.166 -49.307 208.893 1.00 145.83 ? 356 LEU A CB    1 
ATOM   2775  C CG    . LEU A 1 356 ? -25.456 -49.657 207.580 1.00 144.77 ? 356 LEU A CG    1 
ATOM   2776  C CD1   . LEU A 1 356 ? -24.169 -50.442 207.808 1.00 143.99 ? 356 LEU A CD1   1 
ATOM   2777  C CD2   . LEU A 1 356 ? -26.396 -50.429 206.672 1.00 148.23 ? 356 LEU A CD2   1 
ATOM   2778  N N     . CYS A 1 357 ? -28.870 -49.456 210.388 1.00 165.75 ? 357 CYS A N     1 
ATOM   2779  C CA    . CYS A 1 357 ? -29.939 -49.434 211.389 1.00 170.52 ? 357 CYS A CA    1 
ATOM   2780  C C     . CYS A 1 357 ? -29.506 -49.614 212.846 1.00 171.87 ? 357 CYS A C     1 
ATOM   2781  O O     . CYS A 1 357 ? -30.285 -50.128 213.654 1.00 174.89 ? 357 CYS A O     1 
ATOM   2782  C CB    . CYS A 1 357 ? -30.950 -50.528 211.054 1.00 172.76 ? 357 CYS A CB    1 
ATOM   2783  S SG    . CYS A 1 357 ? -30.205 -52.175 211.007 1.00 176.09 ? 357 CYS A SG    1 
ATOM   2784  N N     . LEU A 1 358 ? -28.293 -49.181 213.184 1.00 165.59 ? 358 LEU A N     1 
ATOM   2785  C CA    . LEU A 1 358 ? -27.720 -49.436 214.509 1.00 156.47 ? 358 LEU A CA    1 
ATOM   2786  C C     . LEU A 1 358 ? -27.843 -50.915 214.849 1.00 162.35 ? 358 LEU A C     1 
ATOM   2787  O O     . LEU A 1 358 ? -28.256 -51.267 215.954 1.00 165.05 ? 358 LEU A O     1 
ATOM   2788  C CB    . LEU A 1 358 ? -28.400 -48.594 215.597 1.00 144.25 ? 358 LEU A CB    1 
ATOM   2789  C CG    . LEU A 1 358 ? -28.204 -47.075 215.617 1.00 135.61 ? 358 LEU A CG    1 
ATOM   2790  C CD1   . LEU A 1 358 ? -29.084 -46.388 214.584 1.00 133.92 ? 358 LEU A CD1   1 
ATOM   2791  C CD2   . LEU A 1 358 ? -28.464 -46.514 217.011 1.00 134.48 ? 358 LEU A CD2   1 
ATOM   2792  N N     . ALA A 1 359 ? -27.494 -51.762 213.880 1.00 164.33 ? 359 ALA A N     1 
ATOM   2793  C CA    . ALA A 1 359 ? -27.703 -53.209 213.960 1.00 165.67 ? 359 ALA A CA    1 
ATOM   2794  C C     . ALA A 1 359 ? -27.293 -53.810 215.299 1.00 167.67 ? 359 ALA A C     1 
ATOM   2795  O O     . ALA A 1 359 ? -26.171 -53.616 215.765 1.00 171.04 ? 359 ALA A O     1 
ATOM   2796  C CB    . ALA A 1 359 ? -26.985 -53.915 212.816 1.00 164.14 ? 359 ALA A CB    1 
ATOM   2797  N N     . PHE A 1 360 ? -28.223 -54.538 215.907 1.00 165.69 ? 360 PHE A N     1 
ATOM   2798  C CA    . PHE A 1 360 ? -28.048 -55.071 217.252 1.00 162.43 ? 360 PHE A CA    1 
ATOM   2799  C C     . PHE A 1 360 ? -26.861 -56.034 217.318 1.00 161.64 ? 360 PHE A C     1 
ATOM   2800  O O     . PHE A 1 360 ? -26.892 -57.109 216.720 1.00 162.74 ? 360 PHE A O     1 
ATOM   2801  C CB    . PHE A 1 360 ? -29.346 -55.739 217.723 1.00 163.12 ? 360 PHE A CB    1 
ATOM   2802  C CG    . PHE A 1 360 ? -30.565 -54.855 217.592 1.00 161.45 ? 360 PHE A CG    1 
ATOM   2803  C CD1   . PHE A 1 360 ? -30.464 -53.480 217.755 1.00 154.92 ? 360 PHE A CD1   1 
ATOM   2804  C CD2   . PHE A 1 360 ? -31.808 -55.398 217.299 1.00 163.13 ? 360 PHE A CD2   1 
ATOM   2805  C CE1   . PHE A 1 360 ? -31.575 -52.665 217.632 1.00 153.90 ? 360 PHE A CE1   1 
ATOM   2806  C CE2   . PHE A 1 360 ? -32.925 -54.587 217.175 1.00 164.32 ? 360 PHE A CE2   1 
ATOM   2807  C CZ    . PHE A 1 360 ? -32.806 -53.219 217.342 1.00 161.42 ? 360 PHE A CZ    1 
ATOM   2808  N N     . PRO A 1 361 ? -25.805 -55.637 218.049 1.00 161.85 ? 361 PRO A N     1 
ATOM   2809  C CA    . PRO A 1 361 ? -24.508 -56.328 218.082 1.00 164.05 ? 361 PRO A CA    1 
ATOM   2810  C C     . PRO A 1 361 ? -24.564 -57.702 218.745 1.00 172.96 ? 361 PRO A C     1 
ATOM   2811  O O     . PRO A 1 361 ? -25.205 -57.871 219.784 1.00 177.11 ? 361 PRO A O     1 
ATOM   2812  C CB    . PRO A 1 361 ? -23.628 -55.377 218.900 1.00 159.15 ? 361 PRO A CB    1 
ATOM   2813  C CG    . PRO A 1 361 ? -24.584 -54.658 219.779 1.00 159.58 ? 361 PRO A CG    1 
ATOM   2814  C CD    . PRO A 1 361 ? -25.828 -54.472 218.950 1.00 161.55 ? 361 PRO A CD    1 
ATOM   2815  N N     . SER A 1 362 ? -23.883 -58.670 218.139 1.00 177.27 ? 362 SER A N     1 
ATOM   2816  C CA    . SER A 1 362 ? -23.900 -60.051 218.610 1.00 184.30 ? 362 SER A CA    1 
ATOM   2817  C C     . SER A 1 362 ? -23.262 -60.198 219.992 1.00 188.97 ? 362 SER A C     1 
ATOM   2818  O O     . SER A 1 362 ? -23.906 -60.652 220.939 1.00 189.52 ? 362 SER A O     1 
ATOM   2819  C CB    . SER A 1 362 ? -23.188 -60.956 217.602 1.00 182.67 ? 362 SER A CB    1 
ATOM   2820  O OG    . SER A 1 362 ? -23.423 -62.324 217.883 1.00 182.40 ? 362 SER A OG    1 
ATOM   2821  N N     . GLU A 1 363 ? -21.994 -59.817 220.096 1.00 192.05 ? 363 GLU A N     1 
ATOM   2822  C CA    . GLU A 1 363 ? -21.249 -59.921 221.347 1.00 193.22 ? 363 GLU A CA    1 
ATOM   2823  C C     . GLU A 1 363 ? -20.517 -58.604 221.598 1.00 192.86 ? 363 GLU A C     1 
ATOM   2824  O O     . GLU A 1 363 ? -20.693 -57.651 220.835 1.00 192.70 ? 363 GLU A O     1 
ATOM   2825  C CB    . GLU A 1 363 ? -20.247 -61.079 221.265 1.00 190.76 ? 363 GLU A CB    1 
ATOM   2826  C CG    . GLU A 1 363 ? -20.855 -62.423 220.919 1.00 190.72 ? 363 GLU A CG    1 
ATOM   2827  C CD    . GLU A 1 363 ? -20.857 -62.680 219.429 1.00 189.38 ? 363 GLU A CD    1 
ATOM   2828  O OE1   . GLU A 1 363 ? -20.201 -61.909 218.696 1.00 187.35 ? 363 GLU A OE1   1 
ATOM   2829  O OE2   . GLU A 1 363 ? -21.516 -63.645 218.988 1.00 190.60 ? 363 GLU A OE2   1 
ATOM   2830  N N     . PRO A 1 364 ? -19.720 -58.526 222.683 1.00 192.24 ? 364 PRO A N     1 
ATOM   2831  C CA    . PRO A 1 364 ? -18.796 -57.391 222.756 1.00 190.25 ? 364 PRO A CA    1 
ATOM   2832  C C     . PRO A 1 364 ? -17.920 -57.290 221.505 1.00 184.66 ? 364 PRO A C     1 
ATOM   2833  O O     . PRO A 1 364 ? -17.145 -58.199 221.203 1.00 182.04 ? 364 PRO A O     1 
ATOM   2834  C CB    . PRO A 1 364 ? -17.953 -57.720 223.986 1.00 190.28 ? 364 PRO A CB    1 
ATOM   2835  C CG    . PRO A 1 364 ? -18.906 -58.432 224.883 1.00 191.63 ? 364 PRO A CG    1 
ATOM   2836  C CD    . PRO A 1 364 ? -19.818 -59.228 223.979 1.00 192.65 ? 364 PRO A CD    1 
ATOM   2837  N N     . CYS A 1 365 ? -18.077 -56.184 220.782 1.00 180.29 ? 365 CYS A N     1 
ATOM   2838  C CA    . CYS A 1 365 ? -17.367 -55.939 219.532 1.00 172.02 ? 365 CYS A CA    1 
ATOM   2839  C C     . CYS A 1 365 ? -17.469 -54.460 219.178 1.00 164.06 ? 365 CYS A C     1 
ATOM   2840  O O     . CYS A 1 365 ? -18.224 -53.719 219.807 1.00 164.26 ? 365 CYS A O     1 
ATOM   2841  C CB    . CYS A 1 365 ? -17.959 -56.775 218.397 1.00 173.09 ? 365 CYS A CB    1 
ATOM   2842  S SG    . CYS A 1 365 ? -17.288 -56.350 216.762 1.00 168.68 ? 365 CYS A SG    1 
ATOM   2843  N N     . SER A 1 366 ? -16.721 -54.032 218.165 1.00 156.66 ? 366 SER A N     1 
ATOM   2844  C CA    . SER A 1 366 ? -16.717 -52.626 217.772 1.00 151.02 ? 366 SER A CA    1 
ATOM   2845  C C     . SER A 1 366 ? -17.585 -52.360 216.545 1.00 145.28 ? 366 SER A C     1 
ATOM   2846  O O     . SER A 1 366 ? -17.909 -53.276 215.786 1.00 145.99 ? 366 SER A O     1 
ATOM   2847  C CB    . SER A 1 366 ? -15.289 -52.132 217.526 1.00 147.56 ? 366 SER A CB    1 
ATOM   2848  O OG    . SER A 1 366 ? -14.702 -52.790 216.417 1.00 146.84 ? 366 SER A OG    1 
ATOM   2849  N N     . VAL A 1 367 ? -17.950 -51.095 216.360 1.00 136.24 ? 367 VAL A N     1 
ATOM   2850  C CA    . VAL A 1 367 ? -18.808 -50.683 215.255 1.00 131.08 ? 367 VAL A CA    1 
ATOM   2851  C C     . VAL A 1 367 ? -18.141 -50.923 213.905 1.00 127.23 ? 367 VAL A C     1 
ATOM   2852  O O     . VAL A 1 367 ? -18.734 -51.525 213.007 1.00 123.77 ? 367 VAL A O     1 
ATOM   2853  C CB    . VAL A 1 367 ? -19.183 -49.191 215.365 1.00 129.34 ? 367 VAL A CB    1 
ATOM   2854  C CG1   . VAL A 1 367 ? -20.145 -48.804 214.252 1.00 128.97 ? 367 VAL A CG1   1 
ATOM   2855  C CG2   . VAL A 1 367 ? -19.785 -48.889 216.732 1.00 130.68 ? 367 VAL A CG2   1 
ATOM   2856  N N     . GLU A 1 368 ? -16.906 -50.447 213.775 1.00 129.41 ? 368 GLU A N     1 
ATOM   2857  C CA    . GLU A 1 368 ? -16.145 -50.562 212.533 1.00 131.23 ? 368 GLU A CA    1 
ATOM   2858  C C     . GLU A 1 368 ? -16.039 -51.998 212.020 1.00 136.35 ? 368 GLU A C     1 
ATOM   2859  O O     . GLU A 1 368 ? -16.250 -52.256 210.834 1.00 135.62 ? 368 GLU A O     1 
ATOM   2860  C CB    . GLU A 1 368 ? -14.743 -49.968 212.706 1.00 125.83 ? 368 GLU A CB    1 
ATOM   2861  C CG    . GLU A 1 368 ? -14.677 -48.449 212.613 1.00 124.49 ? 368 GLU A CG    1 
ATOM   2862  C CD    . GLU A 1 368 ? -15.142 -47.750 213.879 1.00 123.93 ? 368 GLU A CD    1 
ATOM   2863  O OE1   . GLU A 1 368 ? -15.380 -48.440 214.892 1.00 126.02 ? 368 GLU A OE1   1 
ATOM   2864  O OE2   . GLU A 1 368 ? -15.263 -46.505 213.860 1.00 120.41 ? 368 GLU A OE2   1 
ATOM   2865  N N     . TRP A 1 369 ? -15.714 -52.927 212.915 1.00 139.22 ? 369 TRP A N     1 
ATOM   2866  C CA    . TRP A 1 369 ? -15.540 -54.327 212.538 1.00 139.77 ? 369 TRP A CA    1 
ATOM   2867  C C     . TRP A 1 369 ? -16.831 -54.961 212.031 1.00 144.11 ? 369 TRP A C     1 
ATOM   2868  O O     . TRP A 1 369 ? -16.802 -55.838 211.167 1.00 147.69 ? 369 TRP A O     1 
ATOM   2869  C CB    . TRP A 1 369 ? -14.984 -55.146 213.705 1.00 137.68 ? 369 TRP A CB    1 
ATOM   2870  C CG    . TRP A 1 369 ? -13.492 -55.101 213.815 1.00 137.30 ? 369 TRP A CG    1 
ATOM   2871  C CD1   . TRP A 1 369 ? -12.760 -54.614 214.858 1.00 136.52 ? 369 TRP A CD1   1 
ATOM   2872  C CD2   . TRP A 1 369 ? -12.545 -55.554 212.838 1.00 135.36 ? 369 TRP A CD2   1 
ATOM   2873  N NE1   . TRP A 1 369 ? -11.417 -54.741 214.595 1.00 133.33 ? 369 TRP A NE1   1 
ATOM   2874  C CE2   . TRP A 1 369 ? -11.259 -55.314 213.361 1.00 130.67 ? 369 TRP A CE2   1 
ATOM   2875  C CE3   . TRP A 1 369 ? -12.661 -56.142 211.574 1.00 136.19 ? 369 TRP A CE3   1 
ATOM   2876  C CZ2   . TRP A 1 369 ? -10.097 -55.640 212.664 1.00 127.28 ? 369 TRP A CZ2   1 
ATOM   2877  C CZ3   . TRP A 1 369 ? -11.506 -56.465 210.884 1.00 133.01 ? 369 TRP A CZ3   1 
ATOM   2878  C CH2   . TRP A 1 369 ? -10.241 -56.212 211.430 1.00 128.44 ? 369 TRP A CH2   1 
ATOM   2879  N N     . ALA A 1 370 ? -17.958 -54.512 212.573 1.00 142.29 ? 370 ALA A N     1 
ATOM   2880  C CA    . ALA A 1 370 ? -19.258 -55.044 212.186 1.00 141.16 ? 370 ALA A CA    1 
ATOM   2881  C C     . ALA A 1 370 ? -19.632 -54.627 210.767 1.00 142.18 ? 370 ALA A C     1 
ATOM   2882  O O     . ALA A 1 370 ? -20.103 -55.447 209.977 1.00 146.06 ? 370 ALA A O     1 
ATOM   2883  C CB    . ALA A 1 370 ? -20.328 -54.601 213.172 1.00 140.10 ? 370 ALA A CB    1 
ATOM   2884  N N     . VAL A 1 371 ? -19.419 -53.352 210.451 1.00 140.54 ? 371 VAL A N     1 
ATOM   2885  C CA    . VAL A 1 371 ? -19.728 -52.824 209.125 1.00 144.01 ? 371 VAL A CA    1 
ATOM   2886  C C     . VAL A 1 371 ? -18.973 -53.578 208.028 1.00 146.37 ? 371 VAL A C     1 
ATOM   2887  O O     . VAL A 1 371 ? -19.524 -53.850 206.961 1.00 150.92 ? 371 VAL A O     1 
ATOM   2888  C CB    . VAL A 1 371 ? -19.414 -51.314 209.023 1.00 144.47 ? 371 VAL A CB    1 
ATOM   2889  C CG1   . VAL A 1 371 ? -19.754 -50.790 207.634 1.00 145.62 ? 371 VAL A CG1   1 
ATOM   2890  C CG2   . VAL A 1 371 ? -20.176 -50.538 210.086 1.00 144.61 ? 371 VAL A CG2   1 
ATOM   2891  N N     . ARG A 1 372 ? -17.719 -53.925 208.300 1.00 144.02 ? 372 ARG A N     1 
ATOM   2892  C CA    . ARG A 1 372 ? -16.906 -54.651 207.330 1.00 143.56 ? 372 ARG A CA    1 
ATOM   2893  C C     . ARG A 1 372 ? -17.464 -56.053 207.099 1.00 149.92 ? 372 ARG A C     1 
ATOM   2894  O O     . ARG A 1 372 ? -17.443 -56.565 205.979 1.00 155.78 ? 372 ARG A O     1 
ATOM   2895  C CB    . ARG A 1 372 ? -15.454 -54.737 207.800 1.00 137.67 ? 372 ARG A CB    1 
ATOM   2896  C CG    . ARG A 1 372 ? -14.501 -55.296 206.759 1.00 135.56 ? 372 ARG A CG    1 
ATOM   2897  C CD    . ARG A 1 372 ? -13.398 -56.093 207.421 1.00 134.75 ? 372 ARG A CD    1 
ATOM   2898  N NE    . ARG A 1 372 ? -13.950 -57.170 208.236 1.00 136.76 ? 372 ARG A NE    1 
ATOM   2899  C CZ    . ARG A 1 372 ? -14.369 -58.331 207.746 1.00 141.64 ? 372 ARG A CZ    1 
ATOM   2900  N NH1   . ARG A 1 372 ? -14.296 -58.565 206.442 1.00 141.53 ? 372 ARG A NH1   1 
ATOM   2901  N NH2   . ARG A 1 372 ? -14.861 -59.258 208.556 1.00 146.44 ? 372 ARG A NH2   1 
ATOM   2902  N N     . GLU A 1 373 ? -17.957 -56.666 208.170 1.00 149.32 ? 373 GLU A N     1 
ATOM   2903  C CA    . GLU A 1 373 ? -18.596 -57.974 208.096 1.00 148.85 ? 373 GLU A CA    1 
ATOM   2904  C C     . GLU A 1 373 ? -19.885 -57.884 207.287 1.00 146.88 ? 373 GLU A C     1 
ATOM   2905  O O     . GLU A 1 373 ? -20.231 -58.801 206.542 1.00 150.05 ? 373 GLU A O     1 
ATOM   2906  C CB    . GLU A 1 373 ? -18.889 -58.492 209.509 1.00 148.95 ? 373 GLU A CB    1 
ATOM   2907  C CG    . GLU A 1 373 ? -19.946 -59.584 209.589 1.00 149.96 ? 373 GLU A CG    1 
ATOM   2908  C CD    . GLU A 1 373 ? -19.442 -60.929 209.109 1.00 148.70 ? 373 GLU A CD    1 
ATOM   2909  O OE1   . GLU A 1 373 ? -20.240 -61.687 208.519 1.00 150.42 ? 373 GLU A OE1   1 
ATOM   2910  O OE2   . GLU A 1 373 ? -18.250 -61.233 209.330 1.00 146.72 ? 373 GLU A OE2   1 
ATOM   2911  N N     . HIS A 1 374 ? -20.584 -56.763 207.427 1.00 141.24 ? 374 HIS A N     1 
ATOM   2912  C CA    . HIS A 1 374 ? -21.861 -56.564 206.754 1.00 143.04 ? 374 HIS A CA    1 
ATOM   2913  C C     . HIS A 1 374 ? -21.680 -56.232 205.276 1.00 147.76 ? 374 HIS A C     1 
ATOM   2914  O O     . HIS A 1 374 ? -22.453 -56.686 204.431 1.00 155.28 ? 374 HIS A O     1 
ATOM   2915  C CB    . HIS A 1 374 ? -22.659 -55.458 207.444 1.00 141.50 ? 374 HIS A CB    1 
ATOM   2916  C CG    . HIS A 1 374 ? -24.121 -55.486 207.122 1.00 146.31 ? 374 HIS A CG    1 
ATOM   2917  N ND1   . HIS A 1 374 ? -24.885 -56.620 207.242 1.00 148.41 ? 374 HIS A ND1   1 
ATOM   2918  C CD2   . HIS A 1 374 ? -24.955 -54.506 206.688 1.00 149.27 ? 374 HIS A CD2   1 
ATOM   2919  C CE1   . HIS A 1 374 ? -26.134 -56.347 206.892 1.00 152.32 ? 374 HIS A CE1   1 
ATOM   2920  N NE2   . HIS A 1 374 ? -26.200 -55.078 206.555 1.00 154.03 ? 374 HIS A NE2   1 
ATOM   2921  N N     . LEU A 1 375 ? -20.656 -55.441 204.969 1.00 144.22 ? 375 LEU A N     1 
ATOM   2922  C CA    . LEU A 1 375 ? -20.368 -55.053 203.590 1.00 143.40 ? 375 LEU A CA    1 
ATOM   2923  C C     . LEU A 1 375 ? -19.699 -56.181 202.811 1.00 144.50 ? 375 LEU A C     1 
ATOM   2924  O O     . LEU A 1 375 ? -19.279 -55.995 201.669 1.00 143.72 ? 375 LEU A O     1 
ATOM   2925  C CB    . LEU A 1 375 ? -19.502 -53.790 203.546 1.00 140.22 ? 375 LEU A CB    1 
ATOM   2926  C CG    . LEU A 1 375 ? -20.239 -52.451 203.443 1.00 142.56 ? 375 LEU A CG    1 
ATOM   2927  C CD1   . LEU A 1 375 ? -21.239 -52.281 204.577 1.00 142.58 ? 375 LEU A CD1   1 
ATOM   2928  C CD2   . LEU A 1 375 ? -19.252 -51.293 203.419 1.00 142.93 ? 375 LEU A CD2   1 
ATOM   2929  N N     . GLU A 1 376 ? -19.600 -57.347 203.441 1.00 147.39 ? 376 GLU A N     1 
ATOM   2930  C CA    . GLU A 1 376 ? -19.092 -58.537 202.774 1.00 154.61 ? 376 GLU A CA    1 
ATOM   2931  C C     . GLU A 1 376 ? -20.081 -58.997 201.706 1.00 162.23 ? 376 GLU A C     1 
ATOM   2932  O O     . GLU A 1 376 ? -21.295 -58.978 201.915 1.00 167.20 ? 376 GLU A O     1 
ATOM   2933  C CB    . GLU A 1 376 ? -18.803 -59.646 203.796 1.00 158.40 ? 376 GLU A CB    1 
ATOM   2934  C CG    . GLU A 1 376 ? -19.476 -60.986 203.521 1.00 164.78 ? 376 GLU A CG    1 
ATOM   2935  C CD    . GLU A 1 376 ? -20.760 -61.176 204.314 1.00 165.18 ? 376 GLU A CD    1 
ATOM   2936  O OE1   . GLU A 1 376 ? -20.986 -62.299 204.814 1.00 165.78 ? 376 GLU A OE1   1 
ATOM   2937  O OE2   . GLU A 1 376 ? -21.542 -60.210 204.435 1.00 163.00 ? 376 GLU A OE2   1 
ATOM   2938  N N     . GLU A 1 377 ? -19.550 -59.388 200.553 1.00 160.59 ? 377 GLU A N     1 
ATOM   2939  C CA    . GLU A 1 377 ? -20.362 -59.796 199.414 1.00 157.76 ? 377 GLU A CA    1 
ATOM   2940  C C     . GLU A 1 377 ? -19.456 -60.570 198.462 1.00 155.32 ? 377 GLU A C     1 
ATOM   2941  O O     . GLU A 1 377 ? -18.245 -60.351 198.460 1.00 152.06 ? 377 GLU A O     1 
ATOM   2942  C CB    . GLU A 1 377 ? -20.951 -58.563 198.716 1.00 155.86 ? 377 GLU A CB    1 
ATOM   2943  C CG    . GLU A 1 377 ? -22.456 -58.627 198.445 1.00 156.28 ? 377 GLU A CG    1 
ATOM   2944  C CD    . GLU A 1 377 ? -22.980 -57.364 197.781 1.00 154.22 ? 377 GLU A CD    1 
ATOM   2945  O OE1   . GLU A 1 377 ? -22.249 -56.351 197.777 1.00 147.10 ? 377 GLU A OE1   1 
ATOM   2946  O OE2   . GLU A 1 377 ? -24.117 -57.383 197.259 1.00 158.16 ? 377 GLU A OE2   1 
ATOM   2947  N N     . PRO A 1 378 ? -20.031 -61.493 197.669 1.00 157.52 ? 378 PRO A N     1 
ATOM   2948  C CA    . PRO A 1 378 ? -19.284 -62.305 196.699 1.00 158.40 ? 378 PRO A CA    1 
ATOM   2949  C C     . PRO A 1 378 ? -18.221 -61.532 195.918 1.00 157.45 ? 378 PRO A C     1 
ATOM   2950  O O     . PRO A 1 378 ? -17.035 -61.842 196.031 1.00 157.47 ? 378 PRO A O     1 
ATOM   2951  C CB    . PRO A 1 378 ? -20.383 -62.789 195.756 1.00 162.65 ? 378 PRO A CB    1 
ATOM   2952  C CG    . PRO A 1 378 ? -21.560 -62.959 196.653 1.00 164.42 ? 378 PRO A CG    1 
ATOM   2953  C CD    . PRO A 1 378 ? -21.451 -61.888 197.718 1.00 160.72 ? 378 PRO A CD    1 
ATOM   2954  N N     . GLY A 1 379 ? -18.640 -60.533 195.149 1.00 156.52 ? 379 GLY A N     1 
ATOM   2955  C CA    . GLY A 1 379 ? -17.712 -59.765 194.341 1.00 156.04 ? 379 GLY A CA    1 
ATOM   2956  C C     . GLY A 1 379 ? -16.954 -58.686 195.097 1.00 153.68 ? 379 GLY A C     1 
ATOM   2957  O O     . GLY A 1 379 ? -15.988 -58.126 194.577 1.00 152.66 ? 379 GLY A O     1 
ATOM   2958  N N     . CYS A 1 380 ? -17.378 -58.395 196.325 1.00 150.41 ? 380 CYS A N     1 
ATOM   2959  C CA    . CYS A 1 380 ? -16.798 -57.287 197.084 1.00 143.43 ? 380 CYS A CA    1 
ATOM   2960  C C     . CYS A 1 380 ? -16.034 -57.719 198.335 1.00 137.87 ? 380 CYS A C     1 
ATOM   2961  O O     . CYS A 1 380 ? -16.599 -58.331 199.240 1.00 136.86 ? 380 CYS A O     1 
ATOM   2962  C CB    . CYS A 1 380 ? -17.887 -56.283 197.473 1.00 142.05 ? 380 CYS A CB    1 
ATOM   2963  S SG    . CYS A 1 380 ? -17.279 -54.819 198.344 1.00 163.99 ? 380 CYS A SG    1 
ATOM   2964  N N     . ALA A 1 381 ? -14.749 -57.384 198.383 1.00 132.56 ? 381 ALA A N     1 
ATOM   2965  C CA    . ALA A 1 381 ? -13.943 -57.602 199.579 1.00 127.83 ? 381 ALA A CA    1 
ATOM   2966  C C     . ALA A 1 381 ? -13.715 -56.277 200.300 1.00 123.72 ? 381 ALA A C     1 
ATOM   2967  O O     . ALA A 1 381 ? -13.428 -55.259 199.668 1.00 123.45 ? 381 ALA A O     1 
ATOM   2968  C CB    . ALA A 1 381 ? -12.617 -58.255 199.222 1.00 127.21 ? 381 ALA A CB    1 
ATOM   2969  N N     . VAL A 1 382 ? -13.852 -56.293 201.623 1.00 122.61 ? 382 VAL A N     1 
ATOM   2970  C CA    . VAL A 1 382 ? -13.732 -55.080 202.428 1.00 121.74 ? 382 VAL A CA    1 
ATOM   2971  C C     . VAL A 1 382 ? -12.653 -55.223 203.499 1.00 121.18 ? 382 VAL A C     1 
ATOM   2972  O O     . VAL A 1 382 ? -12.559 -56.253 204.166 1.00 125.39 ? 382 VAL A O     1 
ATOM   2973  C CB    . VAL A 1 382 ? -15.066 -54.725 203.115 1.00 122.13 ? 382 VAL A CB    1 
ATOM   2974  C CG1   . VAL A 1 382 ? -15.006 -53.321 203.702 1.00 123.66 ? 382 VAL A CG1   1 
ATOM   2975  C CG2   . VAL A 1 382 ? -16.218 -54.841 202.134 1.00 124.76 ? 382 VAL A CG2   1 
ATOM   2976  N N     . HIS A 1 383 ? -11.845 -54.179 203.662 1.00 114.83 ? 383 HIS A N     1 
ATOM   2977  C CA    . HIS A 1 383 ? -10.744 -54.201 204.617 1.00 110.63 ? 383 HIS A CA    1 
ATOM   2978  C C     . HIS A 1 383 ? -10.838 -53.059 205.623 1.00 110.88 ? 383 HIS A C     1 
ATOM   2979  O O     . HIS A 1 383 ? -11.554 -52.085 205.404 1.00 114.62 ? 383 HIS A O     1 
ATOM   2980  C CB    . HIS A 1 383 ? -9.408  -54.127 203.878 1.00 112.95 ? 383 HIS A CB    1 
ATOM   2981  C CG    . HIS A 1 383 ? -9.194  -55.233 202.904 1.00 114.71 ? 383 HIS A CG    1 
ATOM   2982  N ND1   . HIS A 1 383 ? -8.348  -56.293 203.142 1.00 114.45 ? 383 HIS A ND1   1 
ATOM   2983  C CD2   . HIS A 1 383 ? -9.725  -55.458 201.666 1.00 115.64 ? 383 HIS A CD2   1 
ATOM   2984  C CE1   . HIS A 1 383 ? -8.359  -57.117 202.108 1.00 115.60 ? 383 HIS A CE1   1 
ATOM   2985  N NE2   . HIS A 1 383 ? -9.188  -56.626 201.204 1.00 117.38 ? 383 HIS A NE2   1 
ATOM   2986  N N     . TYR A 1 384 ? -10.104 -53.189 206.725 1.00 109.00 ? 384 TYR A N     1 
ATOM   2987  C CA    . TYR A 1 384 ? -10.046 -52.161 207.760 1.00 105.86 ? 384 TYR A CA    1 
ATOM   2988  C C     . TYR A 1 384 ? -8.603  -51.678 207.855 1.00 100.16 ? 384 TYR A C     1 
ATOM   2989  O O     . TYR A 1 384 ? -7.747  -52.379 208.392 1.00 98.75  ? 384 TYR A O     1 
ATOM   2990  C CB    . TYR A 1 384 ? -10.498 -52.748 209.100 1.00 107.04 ? 384 TYR A CB    1 
ATOM   2991  C CG    . TYR A 1 384 ? -10.717 -51.752 210.225 1.00 114.86 ? 384 TYR A CG    1 
ATOM   2992  C CD1   . TYR A 1 384 ? -11.317 -52.153 211.411 1.00 118.79 ? 384 TYR A CD1   1 
ATOM   2993  C CD2   . TYR A 1 384 ? -10.331 -50.422 210.105 1.00 121.98 ? 384 TYR A CD2   1 
ATOM   2994  C CE1   . TYR A 1 384 ? -11.522 -51.263 212.444 1.00 122.86 ? 384 TYR A CE1   1 
ATOM   2995  C CE2   . TYR A 1 384 ? -10.531 -49.525 211.134 1.00 125.47 ? 384 TYR A CE2   1 
ATOM   2996  C CZ    . TYR A 1 384 ? -11.129 -49.951 212.301 1.00 126.32 ? 384 TYR A CZ    1 
ATOM   2997  O OH    . TYR A 1 384 ? -11.334 -49.063 213.331 1.00 128.31 ? 384 TYR A OH    1 
ATOM   2998  N N     . VAL A 1 385 ? -8.338  -50.479 207.341 1.00 101.22 ? 385 VAL A N     1 
ATOM   2999  C CA    . VAL A 1 385 ? -6.967  -49.999 207.185 1.00 106.71 ? 385 VAL A CA    1 
ATOM   3000  C C     . VAL A 1 385 ? -6.819  -48.485 207.356 1.00 113.41 ? 385 VAL A C     1 
ATOM   3001  O O     . VAL A 1 385 ? -6.145  -47.837 206.553 1.00 121.52 ? 385 VAL A O     1 
ATOM   3002  C CB    . VAL A 1 385 ? -6.430  -50.347 205.778 1.00 104.27 ? 385 VAL A CB    1 
ATOM   3003  C CG1   . VAL A 1 385 ? -6.185  -51.836 205.639 1.00 110.17 ? 385 VAL A CG1   1 
ATOM   3004  C CG2   . VAL A 1 385 ? -7.412  -49.894 204.723 1.00 93.26  ? 385 VAL A CG2   1 
ATOM   3005  N N     . GLU A 1 386 ? -7.433  -47.918 208.392 1.00 110.17 ? 386 GLU A N     1 
ATOM   3006  C CA    . GLU A 1 386 ? -7.387  -46.468 208.576 1.00 113.39 ? 386 GLU A CA    1 
ATOM   3007  C C     . GLU A 1 386 ? -5.950  -45.941 208.613 1.00 117.13 ? 386 GLU A C     1 
ATOM   3008  O O     . GLU A 1 386 ? -5.164  -46.305 209.492 1.00 123.56 ? 386 GLU A O     1 
ATOM   3009  C CB    . GLU A 1 386 ? -8.164  -46.038 209.822 1.00 118.40 ? 386 GLU A CB    1 
ATOM   3010  C CG    . GLU A 1 386 ? -7.688  -46.669 211.114 1.00 124.09 ? 386 GLU A CG    1 
ATOM   3011  C CD    . GLU A 1 386 ? -8.208  -45.942 212.332 1.00 128.07 ? 386 GLU A CD    1 
ATOM   3012  O OE1   . GLU A 1 386 ? -9.432  -45.706 212.399 1.00 128.86 ? 386 GLU A OE1   1 
ATOM   3013  O OE2   . GLU A 1 386 ? -7.392  -45.595 213.213 1.00 129.71 ? 386 GLU A OE2   1 
ATOM   3014  N N     . ASN A 1 387 ? -5.617  -45.113 207.623 1.00 113.72 ? 387 ASN A N     1 
ATOM   3015  C CA    . ASN A 1 387 ? -4.263  -44.584 207.423 1.00 111.18 ? 387 ASN A CA    1 
ATOM   3016  C C     . ASN A 1 387 ? -3.237  -45.628 206.987 1.00 110.13 ? 387 ASN A C     1 
ATOM   3017  O O     . ASN A 1 387 ? -2.251  -45.299 206.334 1.00 111.69 ? 387 ASN A O     1 
ATOM   3018  C CB    . ASN A 1 387 ? -3.750  -43.841 208.662 1.00 106.04 ? 387 ASN A CB    1 
ATOM   3019  C CG    . ASN A 1 387 ? -4.687  -42.750 209.114 1.00 103.77 ? 387 ASN A CG    1 
ATOM   3020  O OD1   . ASN A 1 387 ? -5.025  -42.654 210.293 1.00 102.30 ? 387 ASN A OD1   1 
ATOM   3021  N ND2   . ASN A 1 387 ? -5.115  -41.917 208.178 1.00 104.42 ? 387 ASN A ND2   1 
ATOM   3022  N N     . GLY A 1 388 ? -3.472  -46.883 207.353 1.00 106.43 ? 388 GLY A N     1 
ATOM   3023  C CA    . GLY A 1 388 ? -2.531  -47.951 207.077 1.00 102.13 ? 388 GLY A CA    1 
ATOM   3024  C C     . GLY A 1 388 ? -2.250  -48.191 205.607 1.00 98.15  ? 388 GLY A C     1 
ATOM   3025  O O     . GLY A 1 388 ? -1.095  -48.350 205.214 1.00 94.74  ? 388 GLY A O     1 
ATOM   3026  N N     . LEU A 1 389 ? -3.298  -48.212 204.789 1.00 97.79  ? 389 LEU A N     1 
ATOM   3027  C CA    . LEU A 1 389 ? -3.150  -48.592 203.386 1.00 95.69  ? 389 LEU A CA    1 
ATOM   3028  C C     . LEU A 1 389 ? -2.399  -47.558 202.550 1.00 91.38  ? 389 LEU A C     1 
ATOM   3029  O O     . LEU A 1 389 ? -1.454  -47.899 201.841 1.00 89.22  ? 389 LEU A O     1 
ATOM   3030  C CB    . LEU A 1 389 ? -4.510  -48.903 202.750 1.00 102.05 ? 389 LEU A CB    1 
ATOM   3031  C CG    . LEU A 1 389 ? -4.492  -49.343 201.281 1.00 102.48 ? 389 LEU A CG    1 
ATOM   3032  C CD1   . LEU A 1 389 ? -3.622  -50.580 201.081 1.00 98.75  ? 389 LEU A CD1   1 
ATOM   3033  C CD2   . LEU A 1 389 ? -5.907  -49.591 200.770 1.00 102.68 ? 389 LEU A CD2   1 
ATOM   3034  N N     . ILE A 1 390 ? -2.814  -46.300 202.636 1.00 92.59  ? 390 ILE A N     1 
ATOM   3035  C CA    . ILE A 1 390 ? -2.253  -45.262 201.776 1.00 96.72  ? 390 ILE A CA    1 
ATOM   3036  C C     . ILE A 1 390 ? -0.855  -44.820 202.220 1.00 95.14  ? 390 ILE A C     1 
ATOM   3037  O O     . ILE A 1 390 ? 0.014   -44.560 201.387 1.00 88.52  ? 390 ILE A O     1 
ATOM   3038  C CB    . ILE A 1 390 ? -3.220  -44.064 201.632 1.00 97.97  ? 390 ILE A CB    1 
ATOM   3039  C CG1   . ILE A 1 390 ? -4.547  -44.550 201.040 1.00 99.68  ? 390 ILE A CG1   1 
ATOM   3040  C CG2   . ILE A 1 390 ? -2.612  -42.972 200.761 1.00 97.59  ? 390 ILE A CG2   1 
ATOM   3041  C CD1   . ILE A 1 390 ? -5.447  -43.449 200.530 1.00 102.63 ? 390 ILE A CD1   1 
ATOM   3042  N N     . ASN A 1 391 ? -0.636  -44.758 203.530 1.00 97.99  ? 391 ASN A N     1 
ATOM   3043  C CA    . ASN A 1 391 ? 0.691   -44.455 204.057 1.00 99.76  ? 391 ASN A CA    1 
ATOM   3044  C C     . ASN A 1 391 ? 1.718   -45.518 203.669 1.00 98.63  ? 391 ASN A C     1 
ATOM   3045  O O     . ASN A 1 391 ? 2.867   -45.199 203.365 1.00 101.62 ? 391 ASN A O     1 
ATOM   3046  C CB    . ASN A 1 391 ? 0.649   -44.272 205.576 1.00 107.81 ? 391 ASN A CB    1 
ATOM   3047  C CG    . ASN A 1 391 ? 0.121   -42.909 205.983 1.00 115.89 ? 391 ASN A CG    1 
ATOM   3048  O OD1   . ASN A 1 391 ? -1.044  -42.762 206.354 1.00 117.87 ? 391 ASN A OD1   1 
ATOM   3049  N ND2   . ASN A 1 391 ? 0.980   -41.899 205.908 1.00 117.88 ? 391 ASN A ND2   1 
ATOM   3050  N N     . SER A 1 392 ? 1.293   -46.778 203.669 1.00 97.20  ? 392 SER A N     1 
ATOM   3051  C CA    . SER A 1 392 ? 2.162   -47.879 203.261 1.00 96.23  ? 392 SER A CA    1 
ATOM   3052  C C     . SER A 1 392 ? 2.488   -47.827 201.771 1.00 101.90 ? 392 SER A C     1 
ATOM   3053  O O     . SER A 1 392 ? 3.632   -48.046 201.373 1.00 107.12 ? 392 SER A O     1 
ATOM   3054  C CB    . SER A 1 392 ? 1.532   -49.233 203.605 1.00 89.62  ? 392 SER A CB    1 
ATOM   3055  O OG    . SER A 1 392 ? 1.424   -49.414 205.008 1.00 91.61  ? 392 SER A OG    1 
ATOM   3056  N N     . LEU A 1 393 ? 1.483   -47.548 200.947 1.00 99.12  ? 393 LEU A N     1 
ATOM   3057  C CA    . LEU A 1 393 ? 1.695   -47.491 199.506 1.00 97.65  ? 393 LEU A CA    1 
ATOM   3058  C C     . LEU A 1 393 ? 2.621   -46.329 199.158 1.00 97.82  ? 393 LEU A C     1 
ATOM   3059  O O     . LEU A 1 393 ? 3.462   -46.434 198.264 1.00 95.02  ? 393 LEU A O     1 
ATOM   3060  C CB    . LEU A 1 393 ? 0.365   -47.380 198.755 1.00 98.40  ? 393 LEU A CB    1 
ATOM   3061  C CG    . LEU A 1 393 ? -0.559  -48.600 198.805 1.00 95.99  ? 393 LEU A CG    1 
ATOM   3062  C CD1   . LEU A 1 393 ? -1.758  -48.389 197.903 1.00 94.35  ? 393 LEU A CD1   1 
ATOM   3063  C CD2   . LEU A 1 393 ? 0.184   -49.864 198.412 1.00 89.55  ? 393 LEU A CD2   1 
ATOM   3064  N N     . PHE A 1 394 ? 2.475   -45.228 199.886 1.00 101.80 ? 394 PHE A N     1 
ATOM   3065  C CA    . PHE A 1 394 ? 3.359   -44.084 199.711 1.00 106.51 ? 394 PHE A CA    1 
ATOM   3066  C C     . PHE A 1 394 ? 4.750   -44.394 200.246 1.00 111.66 ? 394 PHE A C     1 
ATOM   3067  O O     . PHE A 1 394 ? 5.753   -43.946 199.690 1.00 117.45 ? 394 PHE A O     1 
ATOM   3068  C CB    . PHE A 1 394 ? 2.794   -42.858 200.422 1.00 104.99 ? 394 PHE A CB    1 
ATOM   3069  C CG    . PHE A 1 394 ? 3.750   -41.708 200.485 1.00 106.43 ? 394 PHE A CG    1 
ATOM   3070  C CD1   . PHE A 1 394 ? 4.019   -40.953 199.357 1.00 108.34 ? 394 PHE A CD1   1 
ATOM   3071  C CD2   . PHE A 1 394 ? 4.377   -41.379 201.674 1.00 109.40 ? 394 PHE A CD2   1 
ATOM   3072  C CE1   . PHE A 1 394 ? 4.899   -39.890 199.413 1.00 109.57 ? 394 PHE A CE1   1 
ATOM   3073  C CE2   . PHE A 1 394 ? 5.258   -40.319 201.736 1.00 113.56 ? 394 PHE A CE2   1 
ATOM   3074  C CZ    . PHE A 1 394 ? 5.519   -39.573 200.603 1.00 111.42 ? 394 PHE A CZ    1 
ATOM   3075  N N     . GLY A 1 395 ? 4.802   -45.161 201.330 1.00 106.49 ? 395 GLY A N     1 
ATOM   3076  C CA    . GLY A 1 395 ? 6.064   -45.532 201.943 1.00 103.19 ? 395 GLY A CA    1 
ATOM   3077  C C     . GLY A 1 395 ? 6.916   -46.433 201.069 1.00 104.54 ? 395 GLY A C     1 
ATOM   3078  O O     . GLY A 1 395 ? 8.142   -46.335 201.075 1.00 109.21 ? 395 GLY A O     1 
ATOM   3079  N N     . LEU A 1 396 ? 6.266   -47.311 200.312 1.00 101.37 ? 396 LEU A N     1 
ATOM   3080  C CA    . LEU A 1 396 ? 6.978   -48.250 199.453 1.00 101.80 ? 396 LEU A CA    1 
ATOM   3081  C C     . LEU A 1 396 ? 7.489   -47.596 198.172 1.00 110.13 ? 396 LEU A C     1 
ATOM   3082  O O     . LEU A 1 396 ? 8.609   -47.861 197.738 1.00 116.91 ? 396 LEU A O     1 
ATOM   3083  C CB    . LEU A 1 396 ? 6.086   -49.445 199.119 1.00 102.79 ? 396 LEU A CB    1 
ATOM   3084  C CG    . LEU A 1 396 ? 5.733   -50.315 200.324 1.00 106.67 ? 396 LEU A CG    1 
ATOM   3085  C CD1   . LEU A 1 396 ? 4.620   -51.283 199.978 1.00 110.11 ? 396 LEU A CD1   1 
ATOM   3086  C CD2   . LEU A 1 396 ? 6.962   -51.062 200.809 1.00 106.83 ? 396 LEU A CD2   1 
ATOM   3087  N N     . LEU A 1 397 ? 6.673   -46.740 197.568 1.00 110.18 ? 397 LEU A N     1 
ATOM   3088  C CA    . LEU A 1 397 ? 7.057   -46.112 196.308 1.00 112.97 ? 397 LEU A CA    1 
ATOM   3089  C C     . LEU A 1 397 ? 8.176   -45.093 196.503 1.00 117.79 ? 397 LEU A C     1 
ATOM   3090  O O     . LEU A 1 397 ? 9.026   -44.921 195.632 1.00 122.64 ? 397 LEU A O     1 
ATOM   3091  C CB    . LEU A 1 397 ? 5.847   -45.467 195.626 1.00 110.55 ? 397 LEU A CB    1 
ATOM   3092  C CG    . LEU A 1 397 ? 6.063   -44.924 194.212 1.00 109.33 ? 397 LEU A CG    1 
ATOM   3093  C CD1   . LEU A 1 397 ? 6.652   -45.994 193.310 1.00 108.35 ? 397 LEU A CD1   1 
ATOM   3094  C CD2   . LEU A 1 397 ? 4.757   -44.403 193.638 1.00 110.05 ? 397 LEU A CD2   1 
ATOM   3095  N N     . CYS A 1 398 ? 8.181   -44.432 197.655 1.00 117.03 ? 398 CYS A N     1 
ATOM   3096  C CA    . CYS A 1 398 ? 9.178   -43.406 197.934 1.00 119.60 ? 398 CYS A CA    1 
ATOM   3097  C C     . CYS A 1 398 ? 10.180  -43.858 198.987 1.00 119.89 ? 398 CYS A C     1 
ATOM   3098  O O     . CYS A 1 398 ? 10.683  -43.046 199.760 1.00 120.36 ? 398 CYS A O     1 
ATOM   3099  C CB    . CYS A 1 398 ? 8.499   -42.114 198.388 1.00 119.02 ? 398 CYS A CB    1 
ATOM   3100  S SG    . CYS A 1 398 ? 7.346   -41.425 197.183 1.00 100.94 ? 398 CYS A SG    1 
ATOM   3101  N N     . TRP A 1 399 ? 10.473  -45.154 199.010 1.00 117.58 ? 399 TRP A N     1 
ATOM   3102  C CA    . TRP A 1 399 ? 11.386  -45.705 200.003 1.00 115.32 ? 399 TRP A CA    1 
ATOM   3103  C C     . TRP A 1 399 ? 12.798  -45.153 199.836 1.00 119.91 ? 399 TRP A C     1 
ATOM   3104  O O     . TRP A 1 399 ? 13.431  -44.741 200.809 1.00 120.86 ? 399 TRP A O     1 
ATOM   3105  C CB    . TRP A 1 399 ? 11.406  -47.232 199.927 1.00 112.46 ? 399 TRP A CB    1 
ATOM   3106  C CG    . TRP A 1 399 ? 12.180  -47.867 201.038 1.00 107.99 ? 399 TRP A CG    1 
ATOM   3107  C CD1   . TRP A 1 399 ? 13.526  -48.088 201.078 1.00 105.98 ? 399 TRP A CD1   1 
ATOM   3108  C CD2   . TRP A 1 399 ? 11.655  -48.364 202.275 1.00 103.62 ? 399 TRP A CD2   1 
ATOM   3109  N NE1   . TRP A 1 399 ? 13.873  -48.690 202.262 1.00 101.75 ? 399 TRP A NE1   1 
ATOM   3110  C CE2   . TRP A 1 399 ? 12.743  -48.872 203.015 1.00 101.84 ? 399 TRP A CE2   1 
ATOM   3111  C CE3   . TRP A 1 399 ? 10.373  -48.429 202.828 1.00 103.36 ? 399 TRP A CE3   1 
ATOM   3112  C CZ2   . TRP A 1 399 ? 12.587  -49.438 204.278 1.00 100.73 ? 399 TRP A CZ2   1 
ATOM   3113  C CZ3   . TRP A 1 399 ? 10.220  -48.993 204.084 1.00 105.65 ? 399 TRP A CZ3   1 
ATOM   3114  C CH2   . TRP A 1 399 ? 11.322  -49.489 204.795 1.00 103.54 ? 399 TRP A CH2   1 
ATOM   3115  N N     . GLU A 1 400 ? 13.286  -45.142 198.600 1.00 123.62 ? 400 GLU A N     1 
ATOM   3116  C CA    . GLU A 1 400 ? 14.626  -44.639 198.314 1.00 124.62 ? 400 GLU A CA    1 
ATOM   3117  C C     . GLU A 1 400 ? 14.731  -43.135 198.545 1.00 119.39 ? 400 GLU A C     1 
ATOM   3118  O O     . GLU A 1 400 ? 15.828  -42.602 198.717 1.00 121.17 ? 400 GLU A O     1 
ATOM   3119  C CB    . GLU A 1 400 ? 15.044  -44.985 196.883 1.00 131.88 ? 400 GLU A CB    1 
ATOM   3120  C CG    . GLU A 1 400 ? 14.046  -44.565 195.819 1.00 139.53 ? 400 GLU A CG    1 
ATOM   3121  C CD    . GLU A 1 400 ? 13.411  -45.753 195.124 1.00 145.93 ? 400 GLU A CD    1 
ATOM   3122  O OE1   . GLU A 1 400 ? 13.584  -45.884 193.893 1.00 148.61 ? 400 GLU A OE1   1 
ATOM   3123  O OE2   . GLU A 1 400 ? 12.739  -46.555 195.808 1.00 146.29 ? 400 GLU A OE2   1 
ATOM   3124  N N     . ALA A 1 401 ? 13.588  -42.455 198.550 1.00 111.66 ? 401 ALA A N     1 
ATOM   3125  C CA    . ALA A 1 401 ? 13.556  -41.021 198.815 1.00 109.20 ? 401 ALA A CA    1 
ATOM   3126  C C     . ALA A 1 401 ? 13.552  -40.741 200.315 1.00 110.51 ? 401 ALA A C     1 
ATOM   3127  O O     . ALA A 1 401 ? 14.285  -39.877 200.795 1.00 111.48 ? 401 ALA A O     1 
ATOM   3128  C CB    . ALA A 1 401 ? 12.347  -40.378 198.145 1.00 107.76 ? 401 ALA A CB    1 
ATOM   3129  N N     . ILE A 1 402 ? 12.726  -41.479 201.048 1.00 113.43 ? 402 ILE A N     1 
ATOM   3130  C CA    . ILE A 1 402 ? 12.622  -41.311 202.494 1.00 114.33 ? 402 ILE A CA    1 
ATOM   3131  C C     . ILE A 1 402 ? 13.939  -41.673 203.171 1.00 113.82 ? 402 ILE A C     1 
ATOM   3132  O O     . ILE A 1 402 ? 14.439  -40.933 204.019 1.00 118.30 ? 402 ILE A O     1 
ATOM   3133  C CB    . ILE A 1 402 ? 11.482  -42.170 203.073 1.00 113.93 ? 402 ILE A CB    1 
ATOM   3134  C CG1   . ILE A 1 402 ? 10.134  -41.685 202.539 1.00 111.15 ? 402 ILE A CG1   1 
ATOM   3135  C CG2   . ILE A 1 402 ? 11.493  -42.125 204.593 1.00 113.98 ? 402 ILE A CG2   1 
ATOM   3136  C CD1   . ILE A 1 402 ? 9.045   -42.731 202.598 1.00 108.89 ? 402 ILE A CD1   1 
ATOM   3137  N N     . PHE A 1 403 ? 14.504  -42.809 202.775 1.00 107.70 ? 403 PHE A N     1 
ATOM   3138  C CA    . PHE A 1 403 ? 15.773  -43.268 203.327 1.00 103.51 ? 403 PHE A CA    1 
ATOM   3139  C C     . PHE A 1 403 ? 16.955  -42.846 202.464 1.00 106.67 ? 403 PHE A C     1 
ATOM   3140  O O     . PHE A 1 403 ? 17.926  -43.590 202.310 1.00 99.79  ? 403 PHE A O     1 
ATOM   3141  C CB    . PHE A 1 403 ? 15.762  -44.784 203.506 1.00 97.25  ? 403 PHE A CB    1 
ATOM   3142  C CG    . PHE A 1 403 ? 14.797  -45.257 204.548 1.00 97.56  ? 403 PHE A CG    1 
ATOM   3143  C CD1   . PHE A 1 403 ? 15.168  -45.300 205.881 1.00 100.88 ? 403 PHE A CD1   1 
ATOM   3144  C CD2   . PHE A 1 403 ? 13.517  -45.650 204.199 1.00 95.85  ? 403 PHE A CD2   1 
ATOM   3145  C CE1   . PHE A 1 403 ? 14.282  -45.731 206.847 1.00 99.32  ? 403 PHE A CE1   1 
ATOM   3146  C CE2   . PHE A 1 403 ? 12.625  -46.083 205.161 1.00 91.97  ? 403 PHE A CE2   1 
ATOM   3147  C CZ    . PHE A 1 403 ? 13.008  -46.124 206.485 1.00 95.30  ? 403 PHE A CZ    1 
ATOM   3148  N N     . ALA A 1 404 ? 16.864  -41.649 201.897 1.00 114.26 ? 404 ALA A N     1 
ATOM   3149  C CA    . ALA A 1 404 ? 17.972  -41.083 201.145 1.00 120.62 ? 404 ALA A CA    1 
ATOM   3150  C C     . ALA A 1 404 ? 19.096  -40.727 202.107 1.00 122.04 ? 404 ALA A C     1 
ATOM   3151  O O     . ALA A 1 404 ? 18.849  -40.390 203.264 1.00 122.25 ? 404 ALA A O     1 
ATOM   3152  C CB    . ALA A 1 404 ? 17.518  -39.857 200.377 1.00 122.47 ? 404 ALA A CB    1 
ATOM   3153  N N     . ALA A 1 405 ? 20.333  -40.802 201.625 1.00 122.94 ? 405 ALA A N     1 
ATOM   3154  C CA    . ALA A 1 405 ? 21.497  -40.528 202.460 1.00 124.07 ? 405 ALA A CA    1 
ATOM   3155  C C     . ALA A 1 405 ? 21.789  -39.035 202.547 1.00 124.72 ? 405 ALA A C     1 
ATOM   3156  O O     . ALA A 1 405 ? 22.946  -38.616 202.500 1.00 127.23 ? 405 ALA A O     1 
ATOM   3157  C CB    . ALA A 1 405 ? 22.712  -41.282 201.942 1.00 127.67 ? 405 ALA A CB    1 
ATOM   3158  N N     . ILE A 1 406 ? 20.729  -38.240 202.663 1.00 121.23 ? 406 ILE A N     1 
ATOM   3159  C CA    . ILE A 1 406 ? 20.852  -36.801 202.838 1.00 115.89 ? 406 ILE A CA    1 
ATOM   3160  C C     . ILE A 1 406 ? 21.653  -36.520 204.101 1.00 122.72 ? 406 ILE A C     1 
ATOM   3161  O O     . ILE A 1 406 ? 21.390  -37.114 205.147 1.00 121.99 ? 406 ILE A O     1 
ATOM   3162  C CB    . ILE A 1 406 ? 19.464  -36.141 202.958 1.00 106.09 ? 406 ILE A CB    1 
ATOM   3163  C CG1   . ILE A 1 406 ? 18.626  -36.427 201.710 1.00 103.33 ? 406 ILE A CG1   1 
ATOM   3164  C CG2   . ILE A 1 406 ? 19.590  -34.643 203.170 1.00 105.13 ? 406 ILE A CG2   1 
ATOM   3165  C CD1   . ILE A 1 406 ? 19.150  -35.762 200.455 1.00 104.48 ? 406 ILE A CD1   1 
ATOM   3166  N N     . PRO A 1 407 ? 22.654  -35.631 204.002 1.00 129.79 ? 407 PRO A N     1 
ATOM   3167  C CA    . PRO A 1 407 ? 23.452  -35.272 205.178 1.00 127.80 ? 407 PRO A CA    1 
ATOM   3168  C C     . PRO A 1 407 ? 22.588  -34.640 206.265 1.00 122.67 ? 407 PRO A C     1 
ATOM   3169  O O     . PRO A 1 407 ? 21.846  -33.694 205.999 1.00 118.35 ? 407 PRO A O     1 
ATOM   3170  C CB    . PRO A 1 407 ? 24.456  -34.253 204.624 1.00 131.12 ? 407 PRO A CB    1 
ATOM   3171  C CG    . PRO A 1 407 ? 23.835  -33.744 203.361 1.00 133.13 ? 407 PRO A CG    1 
ATOM   3172  C CD    . PRO A 1 407 ? 23.097  -34.914 202.795 1.00 133.57 ? 407 PRO A CD    1 
ATOM   3173  N N     . GLY A 1 408 ? 22.680  -35.179 207.476 1.00 121.57 ? 408 GLY A N     1 
ATOM   3174  C CA    . GLY A 1 408 ? 21.909  -34.681 208.598 1.00 120.34 ? 408 GLY A CA    1 
ATOM   3175  C C     . GLY A 1 408 ? 20.721  -35.570 208.912 1.00 119.80 ? 408 GLY A C     1 
ATOM   3176  O O     . GLY A 1 408 ? 20.227  -35.589 210.040 1.00 120.71 ? 408 GLY A O     1 
ATOM   3177  N N     . ALA A 1 409 ? 20.264  -36.315 207.911 1.00 115.59 ? 409 ALA A N     1 
ATOM   3178  C CA    . ALA A 1 409 ? 19.086  -37.158 208.065 1.00 108.04 ? 409 ALA A CA    1 
ATOM   3179  C C     . ALA A 1 409 ? 19.368  -38.341 208.982 1.00 107.03 ? 409 ALA A C     1 
ATOM   3180  O O     . ALA A 1 409 ? 18.591  -38.633 209.892 1.00 114.72 ? 409 ALA A O     1 
ATOM   3181  C CB    . ALA A 1 409 ? 18.603  -37.642 206.711 1.00 107.14 ? 409 ALA A CB    1 
ATOM   3182  N N     . PHE A 1 410 ? 20.484  -39.017 208.734 1.00 104.06 ? 410 PHE A N     1 
ATOM   3183  C CA    . PHE A 1 410 ? 20.878  -40.169 209.537 1.00 106.19 ? 410 PHE A CA    1 
ATOM   3184  C C     . PHE A 1 410 ? 22.266  -39.975 210.128 1.00 106.14 ? 410 PHE A C     1 
ATOM   3185  O O     . PHE A 1 410 ? 23.144  -39.395 209.487 1.00 111.38 ? 410 PHE A O     1 
ATOM   3186  C CB    . PHE A 1 410 ? 20.842  -41.444 208.695 1.00 104.57 ? 410 PHE A CB    1 
ATOM   3187  C CG    . PHE A 1 410 ? 19.507  -41.714 208.074 1.00 102.19 ? 410 PHE A CG    1 
ATOM   3188  C CD1   . PHE A 1 410 ? 18.558  -42.465 208.743 1.00 96.36  ? 410 PHE A CD1   1 
ATOM   3189  C CD2   . PHE A 1 410 ? 19.194  -41.203 206.827 1.00 105.11 ? 410 PHE A CD2   1 
ATOM   3190  C CE1   . PHE A 1 410 ? 17.322  -42.708 208.175 1.00 96.54  ? 410 PHE A CE1   1 
ATOM   3191  C CE2   . PHE A 1 410 ? 17.963  -41.443 206.254 1.00 104.18 ? 410 PHE A CE2   1 
ATOM   3192  C CZ    . PHE A 1 410 ? 17.025  -42.197 206.929 1.00 100.29 ? 410 PHE A CZ    1 
ATOM   3193  N N     . PHE A 1 411 ? 22.460  -40.466 211.349 1.00 97.84  ? 411 PHE A N     1 
ATOM   3194  C CA    . PHE A 1 411 ? 23.738  -40.315 212.037 1.00 93.47  ? 411 PHE A CA    1 
ATOM   3195  C C     . PHE A 1 411 ? 24.011  -41.398 213.087 1.00 93.42  ? 411 PHE A C     1 
ATOM   3196  O O     . PHE A 1 411 ? 24.912  -41.256 213.914 1.00 98.28  ? 411 PHE A O     1 
ATOM   3197  C CB    . PHE A 1 411 ? 23.858  -38.917 212.651 1.00 93.61  ? 411 PHE A CB    1 
ATOM   3198  C CG    . PHE A 1 411 ? 22.636  -38.478 213.399 1.00 92.31  ? 411 PHE A CG    1 
ATOM   3199  C CD1   . PHE A 1 411 ? 22.440  -38.862 214.713 1.00 92.04  ? 411 PHE A CD1   1 
ATOM   3200  C CD2   . PHE A 1 411 ? 21.686  -37.673 212.791 1.00 94.95  ? 411 PHE A CD2   1 
ATOM   3201  C CE1   . PHE A 1 411 ? 21.317  -38.459 215.407 1.00 95.24  ? 411 PHE A CE1   1 
ATOM   3202  C CE2   . PHE A 1 411 ? 20.560  -37.268 213.480 1.00 96.65  ? 411 PHE A CE2   1 
ATOM   3203  C CZ    . PHE A 1 411 ? 20.377  -37.662 214.789 1.00 97.55  ? 411 PHE A CZ    1 
ATOM   3204  N N     . HIS A 1 412 ? 23.227  -42.472 213.046 1.00 95.06  ? 412 HIS A N     1 
ATOM   3205  C CA    . HIS A 1 412 ? 23.488  -43.674 213.840 1.00 96.18  ? 412 HIS A CA    1 
ATOM   3206  C C     . HIS A 1 412 ? 22.653  -44.822 213.277 1.00 94.29  ? 412 HIS A C     1 
ATOM   3207  O O     . HIS A 1 412 ? 21.897  -44.623 212.330 1.00 97.34  ? 412 HIS A O     1 
ATOM   3208  C CB    . HIS A 1 412 ? 23.181  -43.440 215.327 1.00 96.58  ? 412 HIS A CB    1 
ATOM   3209  C CG    . HIS A 1 412 ? 21.794  -42.943 215.595 1.00 98.64  ? 412 HIS A CG    1 
ATOM   3210  N ND1   . HIS A 1 412 ? 20.700  -43.778 215.646 1.00 96.92  ? 412 HIS A ND1   1 
ATOM   3211  C CD2   . HIS A 1 412 ? 21.329  -41.698 215.846 1.00 104.43 ? 412 HIS A CD2   1 
ATOM   3212  C CE1   . HIS A 1 412 ? 19.616  -43.066 215.906 1.00 99.69  ? 412 HIS A CE1   1 
ATOM   3213  N NE2   . HIS A 1 412 ? 19.972  -41.799 216.031 1.00 103.37 ? 412 HIS A NE2   1 
ATOM   3214  N N     . PRO A 1 413 ? 22.804  -46.040 213.825 1.00 91.49  ? 413 PRO A N     1 
ATOM   3215  C CA    . PRO A 1 413 ? 21.804  -47.048 213.450 1.00 97.04  ? 413 PRO A CA    1 
ATOM   3216  C C     . PRO A 1 413 ? 20.468  -46.734 214.122 1.00 109.94 ? 413 PRO A C     1 
ATOM   3217  O O     . PRO A 1 413 ? 20.273  -45.613 214.582 1.00 120.79 ? 413 PRO A O     1 
ATOM   3218  C CB    . PRO A 1 413 ? 22.392  -48.347 214.006 1.00 90.12  ? 413 PRO A CB    1 
ATOM   3219  C CG    . PRO A 1 413 ? 23.856  -48.088 214.099 1.00 84.37  ? 413 PRO A CG    1 
ATOM   3220  C CD    . PRO A 1 413 ? 23.976  -46.646 214.480 1.00 84.55  ? 413 PRO A CD    1 
ATOM   3221  N N     . PHE A 1 414 ? 19.561  -47.703 214.175 1.00 107.72 ? 414 PHE A N     1 
ATOM   3222  C CA    . PHE A 1 414 ? 18.299  -47.531 214.896 1.00 109.01 ? 414 PHE A CA    1 
ATOM   3223  C C     . PHE A 1 414 ? 17.469  -46.327 214.436 1.00 110.88 ? 414 PHE A C     1 
ATOM   3224  O O     . PHE A 1 414 ? 16.807  -45.673 215.243 1.00 110.90 ? 414 PHE A O     1 
ATOM   3225  C CB    . PHE A 1 414 ? 18.556  -47.458 216.403 1.00 106.54 ? 414 PHE A CB    1 
ATOM   3226  C CG    . PHE A 1 414 ? 19.677  -48.340 216.860 1.00 105.08 ? 414 PHE A CG    1 
ATOM   3227  C CD1   . PHE A 1 414 ? 19.505  -49.711 216.934 1.00 108.56 ? 414 PHE A CD1   1 
ATOM   3228  C CD2   . PHE A 1 414 ? 20.906  -47.802 217.204 1.00 102.15 ? 414 PHE A CD2   1 
ATOM   3229  C CE1   . PHE A 1 414 ? 20.535  -50.529 217.346 1.00 108.16 ? 414 PHE A CE1   1 
ATOM   3230  C CE2   . PHE A 1 414 ? 21.942  -48.616 217.616 1.00 104.07 ? 414 PHE A CE2   1 
ATOM   3231  C CZ    . PHE A 1 414 ? 21.755  -49.983 217.688 1.00 106.28 ? 414 PHE A CZ    1 
ATOM   3232  N N     . HIS A 1 415 ? 17.509  -46.041 213.138 1.00 110.05 ? 415 HIS A N     1 
ATOM   3233  C CA    . HIS A 1 415 ? 16.679  -44.986 212.566 1.00 108.96 ? 415 HIS A CA    1 
ATOM   3234  C C     . HIS A 1 415 ? 15.409  -45.550 211.940 1.00 109.83 ? 415 HIS A C     1 
ATOM   3235  O O     . HIS A 1 415 ? 15.468  -46.397 211.050 1.00 112.12 ? 415 HIS A O     1 
ATOM   3236  C CB    . HIS A 1 415 ? 17.453  -44.196 211.511 1.00 115.03 ? 415 HIS A CB    1 
ATOM   3237  C CG    . HIS A 1 415 ? 18.323  -43.117 212.075 1.00 120.11 ? 415 HIS A CG    1 
ATOM   3238  N ND1   . HIS A 1 415 ? 17.824  -42.044 212.776 1.00 120.00 ? 415 HIS A ND1   1 
ATOM   3239  C CD2   . HIS A 1 415 ? 19.666  -42.937 212.022 1.00 117.75 ? 415 HIS A CD2   1 
ATOM   3240  C CE1   . HIS A 1 415 ? 18.818  -41.254 213.143 1.00 113.06 ? 415 HIS A CE1   1 
ATOM   3241  N NE2   . HIS A 1 415 ? 19.947  -41.778 212.698 1.00 112.80 ? 415 HIS A NE2   1 
ATOM   3242  N N     . SER A 1 416 ? 14.260  -45.075 212.407 1.00 107.97 ? 416 SER A N     1 
ATOM   3243  C CA    . SER A 1 416 ? 12.985  -45.432 211.798 1.00 100.71 ? 416 SER A CA    1 
ATOM   3244  C C     . SER A 1 416 ? 12.693  -44.500 210.632 1.00 107.04 ? 416 SER A C     1 
ATOM   3245  O O     . SER A 1 416 ? 12.097  -44.900 209.634 1.00 110.93 ? 416 SER A O     1 
ATOM   3246  C CB    . SER A 1 416 ? 11.860  -45.337 212.824 1.00 87.66  ? 416 SER A CB    1 
ATOM   3247  O OG    . SER A 1 416 ? 12.133  -46.164 213.938 1.00 95.85  ? 416 SER A OG    1 
ATOM   3248  N N     . ALA A 1 417 ? 13.129  -43.254 210.768 1.00 104.45 ? 417 ALA A N     1 
ATOM   3249  C CA    . ALA A 1 417 ? 12.884  -42.233 209.764 1.00 101.32 ? 417 ALA A CA    1 
ATOM   3250  C C     . ALA A 1 417 ? 14.028  -41.228 209.781 1.00 107.97 ? 417 ALA A C     1 
ATOM   3251  O O     . ALA A 1 417 ? 14.752  -41.138 210.773 1.00 112.09 ? 417 ALA A O     1 
ATOM   3252  C CB    . ALA A 1 417 ? 11.562  -41.537 210.052 1.00 94.65  ? 417 ALA A CB    1 
ATOM   3253  N N     . PRO A 1 418 ? 14.206  -40.478 208.680 1.00 107.39 ? 418 PRO A N     1 
ATOM   3254  C CA    . PRO A 1 418 ? 15.181  -39.383 208.700 1.00 110.71 ? 418 PRO A CA    1 
ATOM   3255  C C     . PRO A 1 418 ? 14.791  -38.335 209.737 1.00 113.26 ? 418 PRO A C     1 
ATOM   3256  O O     . PRO A 1 418 ? 13.606  -38.041 209.888 1.00 114.71 ? 418 PRO A O     1 
ATOM   3257  C CB    . PRO A 1 418 ? 15.076  -38.793 207.289 1.00 113.87 ? 418 PRO A CB    1 
ATOM   3258  C CG    . PRO A 1 418 ? 13.744  -39.244 206.778 1.00 111.02 ? 418 PRO A CG    1 
ATOM   3259  C CD    . PRO A 1 418 ? 13.558  -40.606 207.364 1.00 106.74 ? 418 PRO A CD    1 
ATOM   3260  N N     . ALA A 1 419 ? 15.780  -37.785 210.435 1.00 112.04 ? 419 ALA A N     1 
ATOM   3261  C CA    . ALA A 1 419 ? 15.535  -36.830 211.514 1.00 109.61 ? 419 ALA A CA    1 
ATOM   3262  C C     . ALA A 1 419 ? 14.853  -35.551 211.037 1.00 110.06 ? 419 ALA A C     1 
ATOM   3263  O O     . ALA A 1 419 ? 14.218  -34.848 211.823 1.00 111.95 ? 419 ALA A O     1 
ATOM   3264  C CB    . ALA A 1 419 ? 16.837  -36.496 212.226 1.00 109.71 ? 419 ALA A CB    1 
ATOM   3265  N N     . ASP A 1 420 ? 14.989  -35.249 209.751 1.00 107.50 ? 420 ASP A N     1 
ATOM   3266  C CA    . ASP A 1 420 ? 14.418  -34.027 209.201 1.00 111.37 ? 420 ASP A CA    1 
ATOM   3267  C C     . ASP A 1 420 ? 13.069  -34.299 208.555 1.00 117.60 ? 420 ASP A C     1 
ATOM   3268  O O     . ASP A 1 420 ? 12.647  -33.580 207.650 1.00 122.82 ? 420 ASP A O     1 
ATOM   3269  C CB    . ASP A 1 420 ? 15.366  -33.401 208.179 1.00 112.67 ? 420 ASP A CB    1 
ATOM   3270  C CG    . ASP A 1 420 ? 15.546  -34.265 206.947 1.00 112.55 ? 420 ASP A CG    1 
ATOM   3271  O OD1   . ASP A 1 420 ? 15.515  -35.507 207.083 1.00 113.54 ? 420 ASP A OD1   1 
ATOM   3272  O OD2   . ASP A 1 420 ? 15.714  -33.704 205.843 1.00 109.71 ? 420 ASP A OD2   1 
ATOM   3273  N N     . LEU A 1 421 ? 12.397  -35.344 209.024 1.00 117.78 ? 421 LEU A N     1 
ATOM   3274  C CA    . LEU A 1 421 ? 11.107  -35.730 208.473 1.00 117.87 ? 421 LEU A CA    1 
ATOM   3275  C C     . LEU A 1 421 ? 10.063  -34.631 208.664 1.00 117.47 ? 421 LEU A C     1 
ATOM   3276  O O     . LEU A 1 421 ? 9.229   -34.403 207.789 1.00 120.23 ? 421 LEU A O     1 
ATOM   3277  C CB    . LEU A 1 421 ? 10.622  -37.040 209.100 1.00 116.76 ? 421 LEU A CB    1 
ATOM   3278  C CG    . LEU A 1 421 ? 9.288   -37.588 208.584 1.00 110.97 ? 421 LEU A CG    1 
ATOM   3279  C CD1   . LEU A 1 421 ? 9.424   -38.101 207.157 1.00 110.40 ? 421 LEU A CD1   1 
ATOM   3280  C CD2   . LEU A 1 421 ? 8.763   -38.673 209.508 1.00 105.61 ? 421 LEU A CD2   1 
ATOM   3281  N N     . HIS A 1 422 ? 10.121  -33.940 209.800 1.00 116.03 ? 422 HIS A N     1 
ATOM   3282  C CA    . HIS A 1 422 ? 9.141   -32.899 210.105 1.00 120.82 ? 422 HIS A CA    1 
ATOM   3283  C C     . HIS A 1 422 ? 9.570   -31.506 209.669 1.00 123.87 ? 422 HIS A C     1 
ATOM   3284  O O     . HIS A 1 422 ? 8.879   -30.524 209.941 1.00 126.54 ? 422 HIS A O     1 
ATOM   3285  C CB    . HIS A 1 422 ? 8.798   -32.890 211.594 1.00 125.00 ? 422 HIS A CB    1 
ATOM   3286  C CG    . HIS A 1 422 ? 7.869   -33.979 212.001 1.00 130.46 ? 422 HIS A CG    1 
ATOM   3287  N ND1   . HIS A 1 422 ? 7.700   -35.133 211.255 1.00 131.65 ? 422 HIS A ND1   1 
ATOM   3288  C CD2   . HIS A 1 422 ? 7.037   -34.108 213.063 1.00 131.56 ? 422 HIS A CD2   1 
ATOM   3289  C CE1   . HIS A 1 422 ? 6.822   -35.915 211.842 1.00 132.71 ? 422 HIS A CE1   1 
ATOM   3290  N NE2   . HIS A 1 422 ? 6.401   -35.312 212.949 1.00 131.83 ? 422 HIS A NE2   1 
ATOM   3291  N N     . SER A 1 423 ? 10.711  -31.421 208.997 1.00 122.72 ? 423 SER A N     1 
ATOM   3292  C CA    . SER A 1 423 ? 11.194  -30.143 208.501 1.00 122.34 ? 423 SER A CA    1 
ATOM   3293  C C     . SER A 1 423 ? 10.340  -29.683 207.325 1.00 120.58 ? 423 SER A C     1 
ATOM   3294  O O     . SER A 1 423 ? 9.783   -30.503 206.594 1.00 121.05 ? 423 SER A O     1 
ATOM   3295  C CB    . SER A 1 423 ? 12.662  -30.250 208.091 1.00 127.86 ? 423 SER A CB    1 
ATOM   3296  O OG    . SER A 1 423 ? 13.163  -28.996 207.662 1.00 135.11 ? 423 SER A OG    1 
ATOM   3297  N N     . ALA A 1 424 ? 10.237  -28.370 207.148 1.00 117.72 ? 424 ALA A N     1 
ATOM   3298  C CA    . ALA A 1 424 ? 9.382   -27.802 206.111 1.00 115.57 ? 424 ALA A CA    1 
ATOM   3299  C C     . ALA A 1 424 ? 10.022  -27.868 204.726 1.00 121.51 ? 424 ALA A C     1 
ATOM   3300  O O     . ALA A 1 424 ? 9.375   -27.575 203.720 1.00 125.22 ? 424 ALA A O     1 
ATOM   3301  C CB    . ALA A 1 424 ? 9.008   -26.369 206.458 1.00 111.56 ? 424 ALA A CB    1 
ATOM   3302  N N     . ASP A 1 425 ? 11.295  -28.246 204.678 1.00 124.96 ? 425 ASP A N     1 
ATOM   3303  C CA    . ASP A 1 425 ? 11.985  -28.419 203.405 1.00 132.49 ? 425 ASP A CA    1 
ATOM   3304  C C     . ASP A 1 425 ? 12.437  -29.867 203.246 1.00 129.62 ? 425 ASP A C     1 
ATOM   3305  O O     . ASP A 1 425 ? 13.413  -30.154 202.552 1.00 129.75 ? 425 ASP A O     1 
ATOM   3306  C CB    . ASP A 1 425 ? 13.174  -27.461 203.286 1.00 142.92 ? 425 ASP A CB    1 
ATOM   3307  C CG    . ASP A 1 425 ? 14.244  -27.727 204.325 1.00 152.32 ? 425 ASP A CG    1 
ATOM   3308  O OD1   . ASP A 1 425 ? 13.899  -28.199 205.429 1.00 155.44 ? 425 ASP A OD1   1 
ATOM   3309  O OD2   . ASP A 1 425 ? 15.431  -27.464 204.038 1.00 155.81 ? 425 ASP A OD2   1 
ATOM   3310  N N     . PHE A 1 426 ? 11.713  -30.769 203.901 1.00 124.01 ? 426 PHE A N     1 
ATOM   3311  C CA    . PHE A 1 426 ? 11.976  -32.200 203.814 1.00 120.17 ? 426 PHE A CA    1 
ATOM   3312  C C     . PHE A 1 426 ? 11.841  -32.689 202.378 1.00 118.45 ? 426 PHE A C     1 
ATOM   3313  O O     . PHE A 1 426 ? 12.666  -33.466 201.895 1.00 117.26 ? 426 PHE A O     1 
ATOM   3314  C CB    . PHE A 1 426 ? 11.012  -32.967 204.723 1.00 120.45 ? 426 PHE A CB    1 
ATOM   3315  C CG    . PHE A 1 426 ? 10.971  -34.446 204.458 1.00 122.58 ? 426 PHE A CG    1 
ATOM   3316  C CD1   . PHE A 1 426 ? 11.948  -35.282 204.971 1.00 122.87 ? 426 PHE A CD1   1 
ATOM   3317  C CD2   . PHE A 1 426 ? 9.948   -35.002 203.705 1.00 121.72 ? 426 PHE A CD2   1 
ATOM   3318  C CE1   . PHE A 1 426 ? 11.912  -36.643 204.732 1.00 123.16 ? 426 PHE A CE1   1 
ATOM   3319  C CE2   . PHE A 1 426 ? 9.907   -36.361 203.460 1.00 121.03 ? 426 PHE A CE2   1 
ATOM   3320  C CZ    . PHE A 1 426 ? 10.891  -37.183 203.975 1.00 122.23 ? 426 PHE A CZ    1 
ATOM   3321  N N     . ARG A 1 427 ? 10.794  -32.226 201.701 1.00 118.96 ? 427 ARG A N     1 
ATOM   3322  C CA    . ARG A 1 427 ? 10.543  -32.618 200.321 1.00 124.10 ? 427 ARG A CA    1 
ATOM   3323  C C     . ARG A 1 427 ? 11.601  -32.064 199.367 1.00 128.24 ? 427 ARG A C     1 
ATOM   3324  O O     . ARG A 1 427 ? 12.080  -32.775 198.482 1.00 129.27 ? 427 ARG A O     1 
ATOM   3325  C CB    . ARG A 1 427 ? 9.149   -32.169 199.875 1.00 128.39 ? 427 ARG A CB    1 
ATOM   3326  C CG    . ARG A 1 427 ? 8.915   -32.333 198.383 1.00 135.61 ? 427 ARG A CG    1 
ATOM   3327  C CD    . ARG A 1 427 ? 7.458   -32.165 197.996 1.00 140.98 ? 427 ARG A CD    1 
ATOM   3328  N NE    . ARG A 1 427 ? 7.227   -32.661 196.642 1.00 146.37 ? 427 ARG A NE    1 
ATOM   3329  C CZ    . ARG A 1 427 ? 6.028   -32.820 196.091 1.00 146.39 ? 427 ARG A CZ    1 
ATOM   3330  N NH1   . ARG A 1 427 ? 4.934   -32.523 196.778 1.00 144.38 ? 427 ARG A NH1   1 
ATOM   3331  N NH2   . ARG A 1 427 ? 5.926   -33.282 194.852 1.00 145.88 ? 427 ARG A NH2   1 
ATOM   3332  N N     . GLN A 1 428 ? 11.963  -30.798 199.563 1.00 129.00 ? 428 GLN A N     1 
ATOM   3333  C CA    . GLN A 1 428 ? 12.887  -30.096 198.671 1.00 129.51 ? 428 GLN A CA    1 
ATOM   3334  C C     . GLN A 1 428 ? 14.280  -30.722 198.606 1.00 126.54 ? 428 GLN A C     1 
ATOM   3335  O O     . GLN A 1 428 ? 14.866  -30.833 197.528 1.00 126.87 ? 428 GLN A O     1 
ATOM   3336  C CB    . GLN A 1 428 ? 13.013  -28.623 199.072 1.00 132.99 ? 428 GLN A CB    1 
ATOM   3337  C CG    . GLN A 1 428 ? 13.876  -27.801 198.118 1.00 138.81 ? 428 GLN A CG    1 
ATOM   3338  C CD    . GLN A 1 428 ? 14.227  -26.426 198.662 1.00 141.99 ? 428 GLN A CD    1 
ATOM   3339  O OE1   . GLN A 1 428 ? 14.161  -26.185 199.869 1.00 143.98 ? 428 GLN A OE1   1 
ATOM   3340  N NE2   . GLN A 1 428 ? 14.604  -25.516 197.770 1.00 141.34 ? 428 GLN A NE2   1 
ATOM   3341  N N     . ARG A 1 429 ? 14.812  -31.119 199.758 1.00 120.55 ? 429 ARG A N     1 
ATOM   3342  C CA    . ARG A 1 429 ? 16.147  -31.710 199.817 1.00 116.23 ? 429 ARG A CA    1 
ATOM   3343  C C     . ARG A 1 429 ? 16.207  -33.027 199.045 1.00 114.69 ? 429 ARG A C     1 
ATOM   3344  O O     . ARG A 1 429 ? 17.286  -33.513 198.707 1.00 117.44 ? 429 ARG A O     1 
ATOM   3345  C CB    . ARG A 1 429 ? 16.574  -31.933 201.270 1.00 117.60 ? 429 ARG A CB    1 
ATOM   3346  C CG    . ARG A 1 429 ? 16.560  -30.680 202.132 1.00 120.01 ? 429 ARG A CG    1 
ATOM   3347  C CD    . ARG A 1 429 ? 16.859  -31.014 203.587 1.00 124.06 ? 429 ARG A CD    1 
ATOM   3348  N NE    . ARG A 1 429 ? 16.528  -29.910 204.485 1.00 129.39 ? 429 ARG A NE    1 
ATOM   3349  C CZ    . ARG A 1 429 ? 16.567  -29.984 205.812 1.00 131.61 ? 429 ARG A CZ    1 
ATOM   3350  N NH1   . ARG A 1 429 ? 16.923  -31.114 206.410 1.00 132.67 ? 429 ARG A NH1   1 
ATOM   3351  N NH2   . ARG A 1 429 ? 16.248  -28.926 206.545 1.00 130.34 ? 429 ARG A NH2   1 
ATOM   3352  N N     . ARG A 1 430 ? 15.037  -33.595 198.771 1.00 114.38 ? 430 ARG A N     1 
ATOM   3353  C CA    . ARG A 1 430 ? 14.935  -34.852 198.044 1.00 115.84 ? 430 ARG A CA    1 
ATOM   3354  C C     . ARG A 1 430 ? 14.021  -34.681 196.839 1.00 121.60 ? 430 ARG A C     1 
ATOM   3355  O O     . ARG A 1 430 ? 13.478  -35.658 196.319 1.00 124.16 ? 430 ARG A O     1 
ATOM   3356  C CB    . ARG A 1 430 ? 14.360  -35.934 198.954 1.00 110.80 ? 430 ARG A CB    1 
ATOM   3357  C CG    . ARG A 1 430 ? 15.088  -36.107 200.272 1.00 106.10 ? 430 ARG A CG    1 
ATOM   3358  C CD    . ARG A 1 430 ? 14.148  -36.682 201.317 1.00 104.36 ? 430 ARG A CD    1 
ATOM   3359  N NE    . ARG A 1 430 ? 14.847  -37.092 202.530 1.00 109.46 ? 430 ARG A NE    1 
ATOM   3360  C CZ    . ARG A 1 430 ? 15.137  -36.277 203.539 1.00 110.35 ? 430 ARG A CZ    1 
ATOM   3361  N NH1   . ARG A 1 430 ? 14.795  -34.996 203.479 1.00 107.36 ? 430 ARG A NH1   1 
ATOM   3362  N NH2   . ARG A 1 430 ? 15.774  -36.742 204.605 1.00 110.35 ? 430 ARG A NH2   1 
ATOM   3363  N N     . ALA A 1 431 ? 13.856  -33.433 196.406 1.00 122.31 ? 431 ALA A N     1 
ATOM   3364  C CA    . ALA A 1 431 ? 12.912  -33.085 195.346 1.00 118.75 ? 431 ALA A CA    1 
ATOM   3365  C C     . ALA A 1 431 ? 13.145  -33.873 194.064 1.00 119.96 ? 431 ALA A C     1 
ATOM   3366  O O     . ALA A 1 431 ? 12.196  -34.259 193.384 1.00 119.13 ? 431 ALA A O     1 
ATOM   3367  C CB    . ALA A 1 431 ? 12.955  -31.591 195.066 1.00 116.35 ? 431 ALA A CB    1 
ATOM   3368  N N     . ALA A 1 432 ? 14.410  -34.113 193.740 1.00 123.72 ? 432 ALA A N     1 
ATOM   3369  C CA    . ALA A 1 432 ? 14.748  -34.903 192.564 1.00 129.87 ? 432 ALA A CA    1 
ATOM   3370  C C     . ALA A 1 432 ? 14.324  -36.357 192.748 1.00 129.14 ? 432 ALA A C     1 
ATOM   3371  O O     . ALA A 1 432 ? 13.789  -36.976 191.831 1.00 127.33 ? 432 ALA A O     1 
ATOM   3372  C CB    . ALA A 1 432 ? 16.236  -34.814 192.274 1.00 132.63 ? 432 ALA A CB    1 
ATOM   3373  N N     . LEU A 1 433 ? 14.556  -36.893 193.942 1.00 129.94 ? 433 LEU A N     1 
ATOM   3374  C CA    . LEU A 1 433 ? 14.270  -38.299 194.218 1.00 131.29 ? 433 LEU A CA    1 
ATOM   3375  C C     . LEU A 1 433 ? 12.776  -38.597 194.240 1.00 133.13 ? 433 LEU A C     1 
ATOM   3376  O O     . LEU A 1 433 ? 12.344  -39.667 193.815 1.00 130.39 ? 433 LEU A O     1 
ATOM   3377  C CB    . LEU A 1 433 ? 14.898  -38.739 195.543 1.00 127.20 ? 433 LEU A CB    1 
ATOM   3378  C CG    . LEU A 1 433 ? 16.424  -38.836 195.608 1.00 125.41 ? 433 LEU A CG    1 
ATOM   3379  C CD1   . LEU A 1 433 ? 17.064  -37.460 195.773 1.00 126.55 ? 433 LEU A CD1   1 
ATOM   3380  C CD2   . LEU A 1 433 ? 16.851  -39.778 196.726 1.00 120.46 ? 433 LEU A CD2   1 
ATOM   3381  N N     . PHE A 1 434 ? 11.993  -37.650 194.744 1.00 136.71 ? 434 PHE A N     1 
ATOM   3382  C CA    . PHE A 1 434 ? 10.550  -37.835 194.841 1.00 139.29 ? 434 PHE A CA    1 
ATOM   3383  C C     . PHE A 1 434 ? 9.863   -37.813 193.483 1.00 147.08 ? 434 PHE A C     1 
ATOM   3384  O O     . PHE A 1 434 ? 8.966   -38.615 193.224 1.00 149.59 ? 434 PHE A O     1 
ATOM   3385  C CB    . PHE A 1 434 ? 9.930   -36.791 195.766 1.00 135.41 ? 434 PHE A CB    1 
ATOM   3386  C CG    . PHE A 1 434 ? 9.926   -37.196 197.207 1.00 131.60 ? 434 PHE A CG    1 
ATOM   3387  C CD1   . PHE A 1 434 ? 10.966  -36.836 198.046 1.00 130.83 ? 434 PHE A CD1   1 
ATOM   3388  C CD2   . PHE A 1 434 ? 8.886   -37.950 197.721 1.00 130.41 ? 434 PHE A CD2   1 
ATOM   3389  C CE1   . PHE A 1 434 ? 10.964  -37.213 199.374 1.00 129.70 ? 434 PHE A CE1   1 
ATOM   3390  C CE2   . PHE A 1 434 ? 8.877   -38.330 199.048 1.00 130.62 ? 434 PHE A CE2   1 
ATOM   3391  C CZ    . PHE A 1 434 ? 9.918   -37.961 199.876 1.00 130.39 ? 434 PHE A CZ    1 
ATOM   3392  N N     . GLU A 1 435 ? 10.281  -36.894 192.618 1.00 150.66 ? 435 GLU A N     1 
ATOM   3393  C CA    . GLU A 1 435 ? 9.718   -36.818 191.276 1.00 154.65 ? 435 GLU A CA    1 
ATOM   3394  C C     . GLU A 1 435 ? 10.103  -38.056 190.473 1.00 153.36 ? 435 GLU A C     1 
ATOM   3395  O O     . GLU A 1 435 ? 9.421   -38.427 189.518 1.00 157.27 ? 435 GLU A O     1 
ATOM   3396  C CB    . GLU A 1 435 ? 10.192  -35.554 190.553 1.00 160.53 ? 435 GLU A CB    1 
ATOM   3397  C CG    . GLU A 1 435 ? 9.875   -34.250 191.273 1.00 164.32 ? 435 GLU A CG    1 
ATOM   3398  C CD    . GLU A 1 435 ? 8.405   -34.102 191.618 1.00 167.39 ? 435 GLU A CD    1 
ATOM   3399  O OE1   . GLU A 1 435 ? 7.595   -33.848 190.701 1.00 170.17 ? 435 GLU A OE1   1 
ATOM   3400  O OE2   . GLU A 1 435 ? 8.061   -34.235 192.812 1.00 165.11 ? 435 GLU A OE2   1 
ATOM   3401  N N     . ALA A 1 436 ? 11.202  -38.692 190.869 1.00 147.15 ? 436 ALA A N     1 
ATOM   3402  C CA    . ALA A 1 436 ? 11.680  -39.894 190.199 1.00 142.79 ? 436 ALA A CA    1 
ATOM   3403  C C     . ALA A 1 436 ? 10.909  -41.120 190.668 1.00 139.37 ? 436 ALA A C     1 
ATOM   3404  O O     . ALA A 1 436 ? 10.819  -42.119 189.955 1.00 140.23 ? 436 ALA A O     1 
ATOM   3405  C CB    . ALA A 1 436 ? 13.166  -40.077 190.445 1.00 140.63 ? 436 ALA A CB    1 
ATOM   3406  N N     . CYS A 1 437 ? 10.359  -41.038 191.875 1.00 136.68 ? 437 CYS A N     1 
ATOM   3407  C CA    . CYS A 1 437 ? 9.570   -42.127 192.439 1.00 132.86 ? 437 CYS A CA    1 
ATOM   3408  C C     . CYS A 1 437 ? 8.106   -42.007 192.040 1.00 130.72 ? 437 CYS A C     1 
ATOM   3409  O O     . CYS A 1 437 ? 7.464   -42.997 191.692 1.00 134.60 ? 437 CYS A O     1 
ATOM   3410  C CB    . CYS A 1 437 ? 9.700   -42.154 193.962 1.00 131.13 ? 437 CYS A CB    1 
ATOM   3411  S SG    . CYS A 1 437 ? 11.342  -42.616 194.554 1.00 150.42 ? 437 CYS A SG    1 
ATOM   3412  N N     . LEU A 1 438 ? 7.577   -40.790 192.090 1.00 126.46 ? 438 LEU A N     1 
ATOM   3413  C CA    . LEU A 1 438 ? 6.209   -40.551 191.653 1.00 127.78 ? 438 LEU A CA    1 
ATOM   3414  C C     . LEU A 1 438 ? 6.146   -40.528 190.131 1.00 133.08 ? 438 LEU A C     1 
ATOM   3415  O O     . LEU A 1 438 ? 5.065   -40.507 189.544 1.00 133.05 ? 438 LEU A O     1 
ATOM   3416  C CB    . LEU A 1 438 ? 5.679   -39.238 192.225 1.00 123.71 ? 438 LEU A CB    1 
ATOM   3417  C CG    . LEU A 1 438 ? 5.728   -39.106 193.748 1.00 120.36 ? 438 LEU A CG    1 
ATOM   3418  C CD1   . LEU A 1 438 ? 5.152   -37.767 194.174 1.00 120.85 ? 438 LEU A CD1   1 
ATOM   3419  C CD2   . LEU A 1 438 ? 4.991   -40.258 194.422 1.00 119.05 ? 438 LEU A CD2   1 
ATOM   3420  N N     . GLY A 1 439 ? 7.317   -40.525 189.500 1.00 138.45 ? 439 GLY A N     1 
ATOM   3421  C CA    . GLY A 1 439 ? 7.410   -40.575 188.054 1.00 143.29 ? 439 GLY A CA    1 
ATOM   3422  C C     . GLY A 1 439 ? 7.159   -41.986 187.568 1.00 143.60 ? 439 GLY A C     1 
ATOM   3423  O O     . GLY A 1 439 ? 6.753   -42.203 186.428 1.00 145.57 ? 439 GLY A O     1 
ATOM   3424  N N     . ARG A 1 440 ? 7.401   -42.947 188.452 1.00 143.53 ? 440 ARG A N     1 
ATOM   3425  C CA    . ARG A 1 440 ? 7.128   -44.348 188.170 1.00 146.67 ? 440 ARG A CA    1 
ATOM   3426  C C     . ARG A 1 440 ? 5.624   -44.593 188.191 1.00 148.19 ? 440 ARG A C     1 
ATOM   3427  O O     . ARG A 1 440 ? 5.143   -45.622 187.720 1.00 152.17 ? 440 ARG A O     1 
ATOM   3428  C CB    . ARG A 1 440 ? 7.818   -45.238 189.206 1.00 144.56 ? 440 ARG A CB    1 
ATOM   3429  C CG    . ARG A 1 440 ? 9.308   -44.969 189.351 1.00 145.18 ? 440 ARG A CG    1 
ATOM   3430  C CD    . ARG A 1 440 ? 9.953   -45.897 190.370 1.00 144.67 ? 440 ARG A CD    1 
ATOM   3431  N NE    . ARG A 1 440 ? 9.840   -47.299 189.981 1.00 147.23 ? 440 ARG A NE    1 
ATOM   3432  C CZ    . ARG A 1 440 ? 10.676  -47.915 189.150 1.00 149.70 ? 440 ARG A CZ    1 
ATOM   3433  N NH1   . ARG A 1 440 ? 11.691  -47.250 188.611 1.00 152.24 ? 440 ARG A NH1   1 
ATOM   3434  N NH2   . ARG A 1 440 ? 10.497  -49.195 188.855 1.00 148.35 ? 440 ARG A NH2   1 
ATOM   3435  N N     . LEU A 1 441 ? 4.890   -43.629 188.738 1.00 142.84 ? 441 LEU A N     1 
ATOM   3436  C CA    . LEU A 1 441 ? 3.450   -43.746 188.913 1.00 137.30 ? 441 LEU A CA    1 
ATOM   3437  C C     . LEU A 1 441 ? 2.718   -43.360 187.633 1.00 139.90 ? 441 LEU A C     1 
ATOM   3438  O O     . LEU A 1 441 ? 1.495   -43.474 187.542 1.00 140.81 ? 441 LEU A O     1 
ATOM   3439  C CB    . LEU A 1 441 ? 3.001   -42.862 190.079 1.00 133.39 ? 441 LEU A CB    1 
ATOM   3440  C CG    . LEU A 1 441 ? 1.598   -43.043 190.661 1.00 132.48 ? 441 LEU A CG    1 
ATOM   3441  C CD1   . LEU A 1 441 ? 1.426   -44.425 191.265 1.00 129.29 ? 441 LEU A CD1   1 
ATOM   3442  C CD2   . LEU A 1 441 ? 1.329   -41.969 191.696 1.00 130.39 ? 441 LEU A CD2   1 
ATOM   3443  N N     . GLU A 1 442 ? 3.479   -42.912 186.640 1.00 146.26 ? 442 GLU A N     1 
ATOM   3444  C CA    . GLU A 1 442 ? 2.909   -42.499 185.362 1.00 151.80 ? 442 GLU A CA    1 
ATOM   3445  C C     . GLU A 1 442 ? 3.042   -43.595 184.302 1.00 153.38 ? 442 GLU A C     1 
ATOM   3446  O O     . GLU A 1 442 ? 2.073   -43.924 183.620 1.00 155.36 ? 442 GLU A O     1 
ATOM   3447  C CB    . GLU A 1 442 ? 3.537   -41.185 184.894 1.00 154.22 ? 442 GLU A CB    1 
ATOM   3448  C CG    . GLU A 1 442 ? 3.555   -40.102 185.969 1.00 153.07 ? 442 GLU A CG    1 
ATOM   3449  C CD    . GLU A 1 442 ? 2.194   -39.884 186.610 1.00 150.17 ? 442 GLU A CD    1 
ATOM   3450  O OE1   . GLU A 1 442 ? 1.173   -39.950 185.891 1.00 151.45 ? 442 GLU A OE1   1 
ATOM   3451  O OE2   . GLU A 1 442 ? 2.146   -39.651 187.838 1.00 145.16 ? 442 GLU A OE2   1 
ATOM   3452  N N     . ASP A 1 443 ? 4.239   -44.159 184.166 1.00 153.57 ? 443 ASP A N     1 
ATOM   3453  C CA    . ASP A 1 443 ? 4.412   -45.362 183.356 1.00 156.83 ? 443 ASP A CA    1 
ATOM   3454  C C     . ASP A 1 443 ? 4.105   -46.592 184.211 1.00 156.00 ? 443 ASP A C     1 
ATOM   3455  O O     . ASP A 1 443 ? 3.738   -46.462 185.377 1.00 156.55 ? 443 ASP A O     1 
ATOM   3456  C CB    . ASP A 1 443 ? 5.816   -45.437 182.751 1.00 159.48 ? 443 ASP A CB    1 
ATOM   3457  C CG    . ASP A 1 443 ? 6.905   -45.174 183.767 1.00 159.62 ? 443 ASP A CG    1 
ATOM   3458  O OD1   . ASP A 1 443 ? 6.710   -44.297 184.633 1.00 160.14 ? 443 ASP A OD1   1 
ATOM   3459  O OD2   . ASP A 1 443 ? 7.957   -45.842 183.697 1.00 159.39 ? 443 ASP A OD2   1 
ATOM   3460  N N     . GLY A 1 444 ? 4.251   -47.781 183.639 1.00 155.29 ? 444 GLY A N     1 
ATOM   3461  C CA    . GLY A 1 444 ? 3.791   -48.991 184.300 1.00 155.26 ? 444 GLY A CA    1 
ATOM   3462  C C     . GLY A 1 444 ? 4.533   -49.400 185.561 1.00 152.71 ? 444 GLY A C     1 
ATOM   3463  O O     . GLY A 1 444 ? 4.023   -50.193 186.356 1.00 152.17 ? 444 GLY A O     1 
ATOM   3464  N N     . SER A 1 445 ? 5.725   -48.842 185.752 1.00 149.55 ? 445 SER A N     1 
ATOM   3465  C CA    . SER A 1 445 ? 6.684   -49.342 186.741 1.00 145.74 ? 445 SER A CA    1 
ATOM   3466  C C     . SER A 1 445 ? 6.196   -49.408 188.190 1.00 145.60 ? 445 SER A C     1 
ATOM   3467  O O     . SER A 1 445 ? 6.630   -50.274 188.951 1.00 145.76 ? 445 SER A O     1 
ATOM   3468  C CB    . SER A 1 445 ? 7.984   -48.537 186.666 1.00 142.87 ? 445 SER A CB    1 
ATOM   3469  O OG    . SER A 1 445 ? 7.717   -47.147 186.606 1.00 142.60 ? 445 SER A OG    1 
ATOM   3470  N N     . TYR A 1 446 ? 5.296   -48.502 188.560 1.00 143.19 ? 446 TYR A N     1 
ATOM   3471  C CA    . TYR A 1 446 ? 4.854   -48.372 189.949 1.00 136.04 ? 446 TYR A CA    1 
ATOM   3472  C C     . TYR A 1 446 ? 4.279   -49.660 190.556 1.00 138.36 ? 446 TYR A C     1 
ATOM   3473  O O     . TYR A 1 446 ? 4.600   -50.001 191.693 1.00 135.94 ? 446 TYR A O     1 
ATOM   3474  C CB    . TYR A 1 446 ? 3.869   -47.203 190.100 1.00 131.98 ? 446 TYR A CB    1 
ATOM   3475  C CG    . TYR A 1 446 ? 2.418   -47.546 189.841 1.00 130.71 ? 446 TYR A CG    1 
ATOM   3476  C CD1   . TYR A 1 446 ? 1.894   -47.543 188.553 1.00 132.96 ? 446 TYR A CD1   1 
ATOM   3477  C CD2   . TYR A 1 446 ? 1.569   -47.863 190.892 1.00 130.45 ? 446 TYR A CD2   1 
ATOM   3478  C CE1   . TYR A 1 446 ? 0.563   -47.854 188.324 1.00 136.12 ? 446 TYR A CE1   1 
ATOM   3479  C CE2   . TYR A 1 446 ? 0.244   -48.173 190.674 1.00 133.44 ? 446 TYR A CE2   1 
ATOM   3480  C CZ    . TYR A 1 446 ? -0.256  -48.166 189.392 1.00 135.06 ? 446 TYR A CZ    1 
ATOM   3481  O OH    . TYR A 1 446 ? -1.580  -48.480 189.186 1.00 134.80 ? 446 TYR A OH    1 
ATOM   3482  N N     . ARG A 1 447 ? 3.445   -50.371 189.799 1.00 142.63 ? 447 ARG A N     1 
ATOM   3483  C CA    . ARG A 1 447 ? 2.822   -51.606 190.281 1.00 139.55 ? 447 ARG A CA    1 
ATOM   3484  C C     . ARG A 1 447 ? 3.873   -52.647 190.660 1.00 135.63 ? 447 ARG A C     1 
ATOM   3485  O O     . ARG A 1 447 ? 3.773   -53.303 191.699 1.00 130.94 ? 447 ARG A O     1 
ATOM   3486  C CB    . ARG A 1 447 ? 1.879   -52.188 189.220 1.00 144.35 ? 447 ARG A CB    1 
ATOM   3487  C CG    . ARG A 1 447 ? 0.570   -51.426 189.006 1.00 148.45 ? 447 ARG A CG    1 
ATOM   3488  C CD    . ARG A 1 447 ? -0.001  -51.719 187.611 1.00 155.25 ? 447 ARG A CD    1 
ATOM   3489  N NE    . ARG A 1 447 ? -1.443  -51.967 187.614 1.00 159.90 ? 447 ARG A NE    1 
ATOM   3490  C CZ    . ARG A 1 447 ? -2.362  -51.089 187.216 1.00 162.51 ? 447 ARG A CZ    1 
ATOM   3491  N NH1   . ARG A 1 447 ? -1.997  -49.892 186.779 1.00 162.79 ? 447 ARG A NH1   1 
ATOM   3492  N NH2   . ARG A 1 447 ? -3.650  -51.411 187.254 1.00 162.85 ? 447 ARG A NH2   1 
ATOM   3493  N N     . ASP A 1 448 ? 4.883   -52.788 189.807 1.00 138.21 ? 448 ASP A N     1 
ATOM   3494  C CA    . ASP A 1 448 ? 5.951   -53.756 190.025 1.00 138.27 ? 448 ASP A CA    1 
ATOM   3495  C C     . ASP A 1 448 ? 6.983   -53.236 191.024 1.00 131.16 ? 448 ASP A C     1 
ATOM   3496  O O     . ASP A 1 448 ? 7.576   -54.014 191.773 1.00 128.25 ? 448 ASP A O     1 
ATOM   3497  C CB    . ASP A 1 448 ? 6.624   -54.115 188.696 1.00 143.71 ? 448 ASP A CB    1 
ATOM   3498  C CG    . ASP A 1 448 ? 6.454   -55.580 188.332 1.00 146.00 ? 448 ASP A CG    1 
ATOM   3499  O OD1   . ASP A 1 448 ? 6.581   -56.436 189.233 1.00 144.65 ? 448 ASP A OD1   1 
ATOM   3500  O OD2   . ASP A 1 448 ? 6.193   -55.877 187.146 1.00 148.38 ? 448 ASP A OD2   1 
ATOM   3501  N N     . ALA A 1 449 ? 7.188   -51.921 191.033 1.00 124.35 ? 449 ALA A N     1 
ATOM   3502  C CA    . ALA A 1 449 ? 8.135   -51.291 191.951 1.00 114.87 ? 449 ALA A CA    1 
ATOM   3503  C C     . ALA A 1 449 ? 7.733   -51.512 193.405 1.00 111.88 ? 449 ALA A C     1 
ATOM   3504  O O     . ALA A 1 449 ? 8.581   -51.758 194.263 1.00 106.52 ? 449 ALA A O     1 
ATOM   3505  C CB    . ALA A 1 449 ? 8.254   -49.804 191.657 1.00 110.85 ? 449 ALA A CB    1 
ATOM   3506  N N     . ILE A 1 450 ? 6.434   -51.421 193.674 1.00 114.27 ? 450 ILE A N     1 
ATOM   3507  C CA    . ILE A 1 450 ? 5.907   -51.677 195.009 1.00 111.11 ? 450 ILE A CA    1 
ATOM   3508  C C     . ILE A 1 450 ? 6.128   -53.129 195.415 1.00 116.20 ? 450 ILE A C     1 
ATOM   3509  O O     . ILE A 1 450 ? 6.595   -53.405 196.520 1.00 117.67 ? 450 ILE A O     1 
ATOM   3510  C CB    . ILE A 1 450 ? 4.403   -51.355 195.100 1.00 107.63 ? 450 ILE A CB    1 
ATOM   3511  C CG1   . ILE A 1 450 ? 4.155   -49.888 194.755 1.00 107.83 ? 450 ILE A CG1   1 
ATOM   3512  C CG2   . ILE A 1 450 ? 3.874   -51.658 196.492 1.00 100.91 ? 450 ILE A CG2   1 
ATOM   3513  C CD1   . ILE A 1 450 ? 4.937   -48.937 195.612 1.00 108.69 ? 450 ILE A CD1   1 
ATOM   3514  N N     . ARG A 1 451 ? 5.801   -54.052 194.513 1.00 121.15 ? 451 ARG A N     1 
ATOM   3515  C CA    . ARG A 1 451 ? 5.917   -55.481 194.794 1.00 123.52 ? 451 ARG A CA    1 
ATOM   3516  C C     . ARG A 1 451 ? 7.345   -55.898 195.143 1.00 120.74 ? 451 ARG A C     1 
ATOM   3517  O O     . ARG A 1 451 ? 7.556   -56.891 195.839 1.00 116.62 ? 451 ARG A O     1 
ATOM   3518  C CB    . ARG A 1 451 ? 5.410   -56.311 193.611 1.00 127.82 ? 451 ARG A CB    1 
ATOM   3519  C CG    . ARG A 1 451 ? 3.903   -56.261 193.386 1.00 130.13 ? 451 ARG A CG    1 
ATOM   3520  C CD    . ARG A 1 451 ? 3.491   -57.337 192.391 1.00 135.42 ? 451 ARG A CD    1 
ATOM   3521  N NE    . ARG A 1 451 ? 2.044   -57.448 192.227 1.00 139.25 ? 451 ARG A NE    1 
ATOM   3522  C CZ    . ARG A 1 451 ? 1.349   -56.832 191.276 1.00 142.59 ? 451 ARG A CZ    1 
ATOM   3523  N NH1   . ARG A 1 451 ? 1.966   -56.050 190.399 1.00 142.07 ? 451 ARG A NH1   1 
ATOM   3524  N NH2   . ARG A 1 451 ? 0.034   -56.996 191.201 1.00 144.23 ? 451 ARG A NH2   1 
ATOM   3525  N N     . CYS A 1 452 ? 8.319   -55.135 194.657 1.00 121.42 ? 452 CYS A N     1 
ATOM   3526  C CA    . CYS A 1 452 ? 9.724   -55.429 194.915 1.00 120.99 ? 452 CYS A CA    1 
ATOM   3527  C C     . CYS A 1 452 ? 10.165  -54.887 196.271 1.00 118.86 ? 452 CYS A C     1 
ATOM   3528  O O     . CYS A 1 452 ? 10.900  -55.549 197.003 1.00 117.71 ? 452 CYS A O     1 
ATOM   3529  C CB    . CYS A 1 452 ? 10.602  -54.865 193.799 1.00 121.72 ? 452 CYS A CB    1 
ATOM   3530  S SG    . CYS A 1 452 ? 10.314  -55.635 192.190 1.00 179.98 ? 452 CYS A SG    1 
ATOM   3531  N N     . ARG A 1 453 ? 9.713   -53.679 196.595 1.00 115.88 ? 453 ARG A N     1 
ATOM   3532  C CA    . ARG A 1 453 ? 9.967   -53.090 197.902 1.00 110.43 ? 453 ARG A CA    1 
ATOM   3533  C C     . ARG A 1 453 ? 9.413   -53.993 198.989 1.00 111.39 ? 453 ARG A C     1 
ATOM   3534  O O     . ARG A 1 453 ? 10.081  -54.266 199.987 1.00 116.05 ? 453 ARG A O     1 
ATOM   3535  C CB    . ARG A 1 453 ? 9.299   -51.722 198.007 1.00 109.41 ? 453 ARG A CB    1 
ATOM   3536  C CG    . ARG A 1 453 ? 9.848   -50.693 197.053 1.00 112.56 ? 453 ARG A CG    1 
ATOM   3537  C CD    . ARG A 1 453 ? 11.292  -50.367 197.377 1.00 110.02 ? 453 ARG A CD    1 
ATOM   3538  N NE    . ARG A 1 453 ? 11.835  -49.399 196.433 1.00 114.03 ? 453 ARG A NE    1 
ATOM   3539  C CZ    . ARG A 1 453 ? 12.240  -49.710 195.207 1.00 120.69 ? 453 ARG A CZ    1 
ATOM   3540  N NH1   . ARG A 1 453 ? 12.162  -50.965 194.781 1.00 116.55 ? 453 ARG A NH1   1 
ATOM   3541  N NH2   . ARG A 1 453 ? 12.723  -48.769 194.405 1.00 127.26 ? 453 ARG A NH2   1 
ATOM   3542  N N     . TYR A 1 454 ? 8.181   -54.448 198.774 1.00 107.96 ? 454 TYR A N     1 
ATOM   3543  C CA    . TYR A 1 454 ? 7.470   -55.287 199.728 1.00 103.75 ? 454 TYR A CA    1 
ATOM   3544  C C     . TYR A 1 454 ? 8.295   -56.507 200.112 1.00 111.65 ? 454 TYR A C     1 
ATOM   3545  O O     . TYR A 1 454 ? 8.401   -56.846 201.288 1.00 115.44 ? 454 TYR A O     1 
ATOM   3546  C CB    . TYR A 1 454 ? 6.122   -55.721 199.146 1.00 98.50  ? 454 TYR A CB    1 
ATOM   3547  C CG    . TYR A 1 454 ? 5.232   -56.476 200.112 1.00 94.98  ? 454 TYR A CG    1 
ATOM   3548  C CD1   . TYR A 1 454 ? 5.247   -57.865 200.160 1.00 95.21  ? 454 TYR A CD1   1 
ATOM   3549  C CD2   . TYR A 1 454 ? 4.370   -55.801 200.966 1.00 91.59  ? 454 TYR A CD2   1 
ATOM   3550  C CE1   . TYR A 1 454 ? 4.433   -58.559 201.036 1.00 94.29  ? 454 TYR A CE1   1 
ATOM   3551  C CE2   . TYR A 1 454 ? 3.552   -56.487 201.846 1.00 91.50  ? 454 TYR A CE2   1 
ATOM   3552  C CZ    . TYR A 1 454 ? 3.588   -57.866 201.876 1.00 95.18  ? 454 TYR A CZ    1 
ATOM   3553  O OH    . TYR A 1 454 ? 2.777   -58.556 202.747 1.00 101.61 ? 454 TYR A OH    1 
ATOM   3554  N N     . ARG A 1 455 ? 8.891   -57.154 199.117 1.00 115.71 ? 455 ARG A N     1 
ATOM   3555  C CA    . ARG A 1 455 ? 9.676   -58.359 199.360 1.00 119.47 ? 455 ARG A CA    1 
ATOM   3556  C C     . ARG A 1 455 ? 11.049  -58.038 199.939 1.00 116.64 ? 455 ARG A C     1 
ATOM   3557  O O     . ARG A 1 455 ? 11.537  -58.736 200.829 1.00 117.00 ? 455 ARG A O     1 
ATOM   3558  C CB    . ARG A 1 455 ? 9.812   -59.179 198.074 1.00 121.71 ? 455 ARG A CB    1 
ATOM   3559  C CG    . ARG A 1 455 ? 8.626   -60.091 197.803 1.00 123.04 ? 455 ARG A CG    1 
ATOM   3560  C CD    . ARG A 1 455 ? 8.440   -60.345 196.315 1.00 126.60 ? 455 ARG A CD    1 
ATOM   3561  N NE    . ARG A 1 455 ? 7.351   -61.283 196.046 1.00 128.91 ? 455 ARG A NE    1 
ATOM   3562  C CZ    . ARG A 1 455 ? 6.057   -60.970 196.082 1.00 132.65 ? 455 ARG A CZ    1 
ATOM   3563  N NH1   . ARG A 1 455 ? 5.667   -59.737 196.387 1.00 129.63 ? 455 ARG A NH1   1 
ATOM   3564  N NH2   . ARG A 1 455 ? 5.147   -61.898 195.818 1.00 136.37 ? 455 ARG A NH2   1 
ATOM   3565  N N     . ASP A 1 456 ? 11.661  -56.975 199.430 1.00 112.80 ? 456 ASP A N     1 
ATOM   3566  C CA    . ASP A 1 456 ? 12.991  -56.566 199.863 1.00 108.14 ? 456 ASP A CA    1 
ATOM   3567  C C     . ASP A 1 456 ? 12.989  -55.957 201.262 1.00 101.88 ? 456 ASP A C     1 
ATOM   3568  O O     . ASP A 1 456 ? 13.726  -56.402 202.144 1.00 96.70  ? 456 ASP A O     1 
ATOM   3569  C CB    . ASP A 1 456 ? 13.588  -55.568 198.868 1.00 112.05 ? 456 ASP A CB    1 
ATOM   3570  C CG    . ASP A 1 456 ? 13.829  -56.181 197.505 1.00 119.00 ? 456 ASP A CG    1 
ATOM   3571  O OD1   . ASP A 1 456 ? 13.931  -57.423 197.426 1.00 122.15 ? 456 ASP A OD1   1 
ATOM   3572  O OD2   . ASP A 1 456 ? 13.919  -55.425 196.514 1.00 121.22 ? 456 ASP A OD2   1 
ATOM   3573  N N     . LYS A 1 457 ? 12.149  -54.946 201.461 1.00 102.74 ? 457 LYS A N     1 
ATOM   3574  C CA    . LYS A 1 457 ? 12.189  -54.130 202.672 1.00 99.52  ? 457 LYS A CA    1 
ATOM   3575  C C     . LYS A 1 457 ? 11.268  -54.599 203.806 1.00 101.49 ? 457 LYS A C     1 
ATOM   3576  O O     . LYS A 1 457 ? 11.152  -53.918 204.826 1.00 98.09  ? 457 LYS A O     1 
ATOM   3577  C CB    . LYS A 1 457 ? 11.884  -52.670 202.323 1.00 96.51  ? 457 LYS A CB    1 
ATOM   3578  C CG    . LYS A 1 457 ? 12.793  -52.085 201.254 1.00 101.45 ? 457 LYS A CG    1 
ATOM   3579  C CD    . LYS A 1 457 ? 14.221  -51.940 201.754 1.00 100.73 ? 457 LYS A CD    1 
ATOM   3580  C CE    . LYS A 1 457 ? 15.115  -51.334 200.684 1.00 99.00  ? 457 LYS A CE    1 
ATOM   3581  N NZ    . LYS A 1 457 ? 16.496  -51.115 201.192 1.00 98.00  ? 457 LYS A NZ    1 
ATOM   3582  N N     . PHE A 1 458 ? 10.631  -55.755 203.632 1.00 102.70 ? 458 PHE A N     1 
ATOM   3583  C CA    . PHE A 1 458 ? 9.681   -56.279 204.616 1.00 100.70 ? 458 PHE A CA    1 
ATOM   3584  C C     . PHE A 1 458 ? 10.242  -56.336 206.032 1.00 102.16 ? 458 PHE A C     1 
ATOM   3585  O O     . PHE A 1 458 ? 11.329  -56.868 206.257 1.00 108.22 ? 458 PHE A O     1 
ATOM   3586  C CB    . PHE A 1 458 ? 9.204   -57.677 204.219 1.00 101.93 ? 458 PHE A CB    1 
ATOM   3587  C CG    . PHE A 1 458 ? 7.952   -58.106 204.923 1.00 99.69  ? 458 PHE A CG    1 
ATOM   3588  C CD1   . PHE A 1 458 ? 6.718   -57.906 204.331 1.00 97.95  ? 458 PHE A CD1   1 
ATOM   3589  C CD2   . PHE A 1 458 ? 8.004   -58.696 206.177 1.00 95.49  ? 458 PHE A CD2   1 
ATOM   3590  C CE1   . PHE A 1 458 ? 5.560   -58.287 204.970 1.00 93.96  ? 458 PHE A CE1   1 
ATOM   3591  C CE2   . PHE A 1 458 ? 6.846   -59.080 206.820 1.00 92.64  ? 458 PHE A CE2   1 
ATOM   3592  C CZ    . PHE A 1 458 ? 5.622   -58.875 206.214 1.00 92.10  ? 458 PHE A CZ    1 
ATOM   3593  N N     . GLY A 1 459 ? 9.488   -55.790 206.982 1.00 99.12  ? 459 GLY A N     1 
ATOM   3594  C CA    . GLY A 1 459 ? 9.844   -55.867 208.387 1.00 95.82  ? 459 GLY A CA    1 
ATOM   3595  C C     . GLY A 1 459 ? 10.640  -54.677 208.887 1.00 94.16  ? 459 GLY A C     1 
ATOM   3596  O O     . GLY A 1 459 ? 10.655  -54.393 210.086 1.00 95.86  ? 459 GLY A O     1 
ATOM   3597  N N     . LEU A 1 460 ? 11.302  -53.982 207.967 1.00 88.41  ? 460 LEU A N     1 
ATOM   3598  C CA    . LEU A 1 460 ? 12.118  -52.825 208.319 1.00 81.80  ? 460 LEU A CA    1 
ATOM   3599  C C     . LEU A 1 460 ? 11.308  -51.720 208.991 1.00 89.73  ? 460 LEU A C     1 
ATOM   3600  O O     . LEU A 1 460 ? 10.211  -51.378 208.549 1.00 93.51  ? 460 LEU A O     1 
ATOM   3601  C CB    . LEU A 1 460 ? 12.835  -52.272 207.085 1.00 80.97  ? 460 LEU A CB    1 
ATOM   3602  C CG    . LEU A 1 460 ? 13.951  -53.137 206.502 1.00 76.87  ? 460 LEU A CG    1 
ATOM   3603  C CD1   . LEU A 1 460 ? 14.679  -52.403 205.390 1.00 77.67  ? 460 LEU A CD1   1 
ATOM   3604  C CD2   . LEU A 1 460 ? 14.915  -53.536 207.597 1.00 77.50  ? 460 LEU A CD2   1 
ATOM   3605  N N     . GLN A 1 461 ? 11.859  -51.170 210.068 1.00 94.07  ? 461 GLN A N     1 
ATOM   3606  C CA    . GLN A 1 461 ? 11.223  -50.069 210.778 1.00 95.54  ? 461 GLN A CA    1 
ATOM   3607  C C     . GLN A 1 461 ? 11.148  -48.839 209.878 1.00 97.20  ? 461 GLN A C     1 
ATOM   3608  O O     . GLN A 1 461 ? 12.162  -48.396 209.337 1.00 100.70 ? 461 GLN A O     1 
ATOM   3609  C CB    . GLN A 1 461 ? 12.005  -49.737 212.049 1.00 97.15  ? 461 GLN A CB    1 
ATOM   3610  C CG    . GLN A 1 461 ? 11.148  -49.180 213.165 1.00 102.69 ? 461 GLN A CG    1 
ATOM   3611  C CD    . GLN A 1 461 ? 10.243  -50.232 213.774 1.00 109.44 ? 461 GLN A CD    1 
ATOM   3612  O OE1   . GLN A 1 461 ? 10.703  -51.298 214.182 1.00 109.50 ? 461 GLN A OE1   1 
ATOM   3613  N NE2   . GLN A 1 461 ? 8.947   -49.941 213.828 1.00 111.90 ? 461 GLN A NE2   1 
ATOM   3614  N N     . SER A 1 462 ? 9.947   -48.290 209.722 1.00 98.45  ? 462 SER A N     1 
ATOM   3615  C CA    . SER A 1 462 ? 9.733   -47.130 208.861 1.00 101.92 ? 462 SER A CA    1 
ATOM   3616  C C     . SER A 1 462 ? 8.522   -46.334 209.339 1.00 104.78 ? 462 SER A C     1 
ATOM   3617  O O     . SER A 1 462 ? 7.634   -46.887 209.987 1.00 108.49 ? 462 SER A O     1 
ATOM   3618  C CB    . SER A 1 462 ? 9.492   -47.580 207.423 1.00 106.70 ? 462 SER A CB    1 
ATOM   3619  O OG    . SER A 1 462 ? 8.114   -47.841 207.220 1.00 110.41 ? 462 SER A OG    1 
ATOM   3620  N N     . PRO A 1 463 ? 8.466   -45.036 209.000 1.00 106.47 ? 463 PRO A N     1 
ATOM   3621  C CA    . PRO A 1 463 ? 7.376   -44.194 209.502 1.00 108.25 ? 463 PRO A CA    1 
ATOM   3622  C C     . PRO A 1 463 ? 6.082   -44.303 208.693 1.00 111.94 ? 463 PRO A C     1 
ATOM   3623  O O     . PRO A 1 463 ? 5.094   -43.665 209.054 1.00 115.36 ? 463 PRO A O     1 
ATOM   3624  C CB    . PRO A 1 463 ? 7.950   -42.785 209.360 1.00 105.90 ? 463 PRO A CB    1 
ATOM   3625  C CG    . PRO A 1 463 ? 8.829   -42.880 208.160 1.00 105.22 ? 463 PRO A CG    1 
ATOM   3626  C CD    . PRO A 1 463 ? 9.427   -44.263 208.191 1.00 105.57 ? 463 PRO A CD    1 
ATOM   3627  N N     . PHE A 1 464 ? 6.078   -45.095 207.626 1.00 107.31 ? 464 PHE A N     1 
ATOM   3628  C CA    . PHE A 1 464 ? 4.919   -45.125 206.738 1.00 97.48  ? 464 PHE A CA    1 
ATOM   3629  C C     . PHE A 1 464 ? 4.331   -46.515 206.495 1.00 94.46  ? 464 PHE A C     1 
ATOM   3630  O O     . PHE A 1 464 ? 3.113   -46.675 206.460 1.00 96.84  ? 464 PHE A O     1 
ATOM   3631  C CB    . PHE A 1 464 ? 5.250   -44.452 205.403 1.00 99.41  ? 464 PHE A CB    1 
ATOM   3632  C CG    . PHE A 1 464 ? 5.582   -42.993 205.529 1.00 108.07 ? 464 PHE A CG    1 
ATOM   3633  C CD1   . PHE A 1 464 ? 6.849   -42.526 205.225 1.00 110.98 ? 464 PHE A CD1   1 
ATOM   3634  C CD2   . PHE A 1 464 ? 4.626   -42.089 205.961 1.00 112.00 ? 464 PHE A CD2   1 
ATOM   3635  C CE1   . PHE A 1 464 ? 7.155   -41.182 205.341 1.00 112.63 ? 464 PHE A CE1   1 
ATOM   3636  C CE2   . PHE A 1 464 ? 4.926   -40.745 206.082 1.00 111.51 ? 464 PHE A CE2   1 
ATOM   3637  C CZ    . PHE A 1 464 ? 6.191   -40.291 205.772 1.00 111.12 ? 464 PHE A CZ    1 
ATOM   3638  N N     . VAL A 1 465 ? 5.190   -47.514 206.326 1.00 93.43  ? 465 VAL A N     1 
ATOM   3639  C CA    . VAL A 1 465 ? 4.726   -48.849 205.954 1.00 92.15  ? 465 VAL A CA    1 
ATOM   3640  C C     . VAL A 1 465 ? 4.265   -49.694 207.140 1.00 93.09  ? 465 VAL A C     1 
ATOM   3641  O O     . VAL A 1 465 ? 5.029   -49.943 208.075 1.00 97.30  ? 465 VAL A O     1 
ATOM   3642  C CB    . VAL A 1 465 ? 5.804   -49.632 205.184 1.00 93.45  ? 465 VAL A CB    1 
ATOM   3643  C CG1   . VAL A 1 465 ? 5.257   -50.988 204.752 1.00 98.03  ? 465 VAL A CG1   1 
ATOM   3644  C CG2   . VAL A 1 465 ? 6.286   -48.828 203.984 1.00 89.27  ? 465 VAL A CG2   1 
ATOM   3645  N N     . TYR A 1 466 ? 3.015   -50.143 207.077 1.00 89.27  ? 466 TYR A N     1 
ATOM   3646  C CA    . TYR A 1 466 ? 2.434   -50.999 208.106 1.00 94.17  ? 466 TYR A CA    1 
ATOM   3647  C C     . TYR A 1 466 ? 2.506   -52.465 207.674 1.00 100.66 ? 466 TYR A C     1 
ATOM   3648  O O     . TYR A 1 466 ? 1.560   -52.986 207.081 1.00 107.07 ? 466 TYR A O     1 
ATOM   3649  C CB    . TYR A 1 466 ? 0.972   -50.612 208.349 1.00 92.38  ? 466 TYR A CB    1 
ATOM   3650  C CG    . TYR A 1 466 ? 0.757   -49.222 208.917 1.00 92.55  ? 466 TYR A CG    1 
ATOM   3651  C CD1   . TYR A 1 466 ? 0.346   -49.047 210.232 1.00 96.68  ? 466 TYR A CD1   1 
ATOM   3652  C CD2   . TYR A 1 466 ? 0.952   -48.087 208.138 1.00 94.26  ? 466 TYR A CD2   1 
ATOM   3653  C CE1   . TYR A 1 466 ? 0.141   -47.782 210.758 1.00 99.23  ? 466 TYR A CE1   1 
ATOM   3654  C CE2   . TYR A 1 466 ? 0.753   -46.817 208.656 1.00 97.23  ? 466 TYR A CE2   1 
ATOM   3655  C CZ    . TYR A 1 466 ? 0.346   -46.672 209.966 1.00 99.57  ? 466 TYR A CZ    1 
ATOM   3656  O OH    . TYR A 1 466 ? 0.143   -45.414 210.487 1.00 100.23 ? 466 TYR A OH    1 
ATOM   3657  N N     . TRP A 1 467 ? 3.622   -53.128 207.974 1.00 99.08  ? 467 TRP A N     1 
ATOM   3658  C CA    . TRP A 1 467 ? 3.856   -54.493 207.498 1.00 98.27  ? 467 TRP A CA    1 
ATOM   3659  C C     . TRP A 1 467 ? 2.830   -55.495 208.019 1.00 98.76  ? 467 TRP A C     1 
ATOM   3660  O O     . TRP A 1 467 ? 2.410   -56.399 207.296 1.00 100.69 ? 467 TRP A O     1 
ATOM   3661  C CB    . TRP A 1 467 ? 5.268   -54.964 207.862 1.00 94.53  ? 467 TRP A CB    1 
ATOM   3662  C CG    . TRP A 1 467 ? 6.350   -54.100 207.303 1.00 90.66  ? 467 TRP A CG    1 
ATOM   3663  C CD1   . TRP A 1 467 ? 7.177   -53.272 207.999 1.00 93.54  ? 467 TRP A CD1   1 
ATOM   3664  C CD2   . TRP A 1 467 ? 6.717   -53.967 205.925 1.00 90.88  ? 467 TRP A CD2   1 
ATOM   3665  N NE1   . TRP A 1 467 ? 8.040   -52.635 207.143 1.00 95.66  ? 467 TRP A NE1   1 
ATOM   3666  C CE2   . TRP A 1 467 ? 7.778   -53.045 205.862 1.00 94.16  ? 467 TRP A CE2   1 
ATOM   3667  C CE3   . TRP A 1 467 ? 6.252   -54.541 204.737 1.00 93.78  ? 467 TRP A CE3   1 
ATOM   3668  C CZ2   . TRP A 1 467 ? 8.380   -52.680 204.660 1.00 95.48  ? 467 TRP A CZ2   1 
ATOM   3669  C CZ3   . TRP A 1 467 ? 6.855   -54.180 203.544 1.00 96.69  ? 467 TRP A CZ3   1 
ATOM   3670  C CH2   . TRP A 1 467 ? 7.906   -53.259 203.515 1.00 95.34  ? 467 TRP A CH2   1 
ATOM   3671  N N     . GLU A 1 468 ? 2.431   -55.323 209.275 1.00 99.86  ? 468 GLU A N     1 
ATOM   3672  C CA    . GLU A 1 468 ? 1.509   -56.243 209.934 1.00 103.10 ? 468 GLU A CA    1 
ATOM   3673  C C     . GLU A 1 468 ? 0.108   -56.196 209.334 1.00 102.75 ? 468 GLU A C     1 
ATOM   3674  O O     . GLU A 1 468 ? -0.669  -57.143 209.472 1.00 105.93 ? 468 GLU A O     1 
ATOM   3675  C CB    . GLU A 1 468 ? 1.443   -55.944 211.436 1.00 111.97 ? 468 GLU A CB    1 
ATOM   3676  C CG    . GLU A 1 468 ? 0.580   -54.736 211.821 1.00 125.20 ? 468 GLU A CG    1 
ATOM   3677  C CD    . GLU A 1 468 ? 1.109   -53.415 211.281 1.00 134.06 ? 468 GLU A CD    1 
ATOM   3678  O OE1   . GLU A 1 468 ? 2.344   -53.268 211.153 1.00 140.34 ? 468 GLU A OE1   1 
ATOM   3679  O OE2   . GLU A 1 468 ? 0.285   -52.524 210.981 1.00 130.65 ? 468 GLU A OE2   1 
ATOM   3680  N N     . LEU A 1 469 ? -0.211  -55.091 208.671 1.00 99.73  ? 469 LEU A N     1 
ATOM   3681  C CA    . LEU A 1 469 ? -1.545  -54.890 208.123 1.00 98.01  ? 469 LEU A CA    1 
ATOM   3682  C C     . LEU A 1 469 ? -1.561  -55.043 206.608 1.00 97.40  ? 469 LEU A C     1 
ATOM   3683  O O     . LEU A 1 469 ? -2.563  -55.465 206.030 1.00 95.75  ? 469 LEU A O     1 
ATOM   3684  C CB    . LEU A 1 469 ? -2.084  -53.517 208.527 1.00 96.35  ? 469 LEU A CB    1 
ATOM   3685  C CG    . LEU A 1 469 ? -3.347  -53.002 207.840 1.00 93.31  ? 469 LEU A CG    1 
ATOM   3686  C CD1   . LEU A 1 469 ? -4.319  -52.468 208.868 1.00 95.24  ? 469 LEU A CD1   1 
ATOM   3687  C CD2   . LEU A 1 469 ? -2.961  -51.911 206.869 1.00 94.73  ? 469 LEU A CD2   1 
ATOM   3688  N N     . LEU A 1 470 ? -0.451  -54.699 205.965 1.00 95.15  ? 470 LEU A N     1 
ATOM   3689  C CA    . LEU A 1 470 ? -0.369  -54.802 204.517 1.00 84.40  ? 470 LEU A CA    1 
ATOM   3690  C C     . LEU A 1 470 ? -0.110  -56.248 204.102 1.00 105.67 ? 470 LEU A C     1 
ATOM   3691  O O     . LEU A 1 470 ? 0.995   -56.605 203.691 1.00 100.44 ? 470 LEU A O     1 
ATOM   3692  C CB    . LEU A 1 470 ? 0.706   -53.865 203.965 1.00 83.87  ? 470 LEU A CB    1 
ATOM   3693  C CG    . LEU A 1 470 ? 0.736   -53.690 202.444 1.00 91.28  ? 470 LEU A CG    1 
ATOM   3694  C CD1   . LEU A 1 470 ? -0.655  -53.404 201.893 1.00 91.68  ? 470 LEU A CD1   1 
ATOM   3695  C CD2   . LEU A 1 470 ? 1.701   -52.582 202.059 1.00 92.70  ? 470 LEU A CD2   1 
ATOM   3696  N N     . GLY A 1 471 ? -1.142  -57.077 204.229 1.00 111.84 ? 471 GLY A N     1 
ATOM   3697  C CA    . GLY A 1 471 ? -1.075  -58.465 203.810 1.00 113.00 ? 471 GLY A CA    1 
ATOM   3698  C C     . GLY A 1 471 ? -0.948  -58.564 202.303 1.00 117.56 ? 471 GLY A C     1 
ATOM   3699  O O     . GLY A 1 471 ? -1.185  -57.591 201.588 1.00 119.51 ? 471 GLY A O     1 
ATOM   3700  N N     . GLU A 1 472 ? -0.580  -59.744 201.817 1.00 121.13 ? 472 GLU A N     1 
ATOM   3701  C CA    . GLU A 1 472 ? -0.306  -59.930 200.396 1.00 121.21 ? 472 GLU A CA    1 
ATOM   3702  C C     . GLU A 1 472 ? -1.543  -59.711 199.516 1.00 116.40 ? 472 GLU A C     1 
ATOM   3703  O O     . GLU A 1 472 ? -1.442  -59.148 198.426 1.00 112.23 ? 472 GLU A O     1 
ATOM   3704  C CB    . GLU A 1 472 ? 0.307   -61.312 200.146 1.00 123.67 ? 472 GLU A CB    1 
ATOM   3705  C CG    . GLU A 1 472 ? 1.515   -61.303 199.217 1.00 127.62 ? 472 GLU A CG    1 
ATOM   3706  C CD    . GLU A 1 472 ? 2.176   -62.667 199.105 1.00 135.16 ? 472 GLU A CD    1 
ATOM   3707  O OE1   . GLU A 1 472 ? 1.713   -63.612 199.779 1.00 133.37 ? 472 GLU A OE1   1 
ATOM   3708  O OE2   . GLU A 1 472 ? 3.160   -62.793 198.344 1.00 141.57 ? 472 GLU A OE2   1 
ATOM   3709  N N     . GLU A 1 473 ? -2.707  -60.143 199.994 1.00 116.27 ? 473 GLU A N     1 
ATOM   3710  C CA    . GLU A 1 473 ? -3.945  -59.976 199.235 1.00 120.84 ? 473 GLU A CA    1 
ATOM   3711  C C     . GLU A 1 473 ? -4.351  -58.507 199.131 1.00 118.56 ? 473 GLU A C     1 
ATOM   3712  O O     . GLU A 1 473 ? -4.651  -58.013 198.043 1.00 117.11 ? 473 GLU A O     1 
ATOM   3713  C CB    . GLU A 1 473 ? -5.082  -60.792 199.853 1.00 127.29 ? 473 GLU A CB    1 
ATOM   3714  C CG    . GLU A 1 473 ? -6.365  -60.765 199.036 1.00 131.33 ? 473 GLU A CG    1 
ATOM   3715  C CD    . GLU A 1 473 ? -7.521  -61.447 199.738 1.00 132.84 ? 473 GLU A CD    1 
ATOM   3716  O OE1   . GLU A 1 473 ? -7.843  -61.049 200.878 1.00 132.58 ? 473 GLU A OE1   1 
ATOM   3717  O OE2   . GLU A 1 473 ? -8.105  -62.383 199.151 1.00 133.39 ? 473 GLU A OE2   1 
ATOM   3718  N N     . LEU A 1 474 ? -4.355  -57.818 200.269 1.00 117.14 ? 474 LEU A N     1 
ATOM   3719  C CA    . LEU A 1 474 ? -4.705  -56.400 200.326 1.00 114.09 ? 474 LEU A CA    1 
ATOM   3720  C C     . LEU A 1 474 ? -3.813  -55.562 199.416 1.00 111.40 ? 474 LEU A C     1 
ATOM   3721  O O     . LEU A 1 474 ? -4.253  -54.566 198.843 1.00 110.75 ? 474 LEU A O     1 
ATOM   3722  C CB    . LEU A 1 474 ? -4.603  -55.892 201.766 1.00 111.95 ? 474 LEU A CB    1 
ATOM   3723  C CG    . LEU A 1 474 ? -4.748  -54.387 202.006 1.00 110.58 ? 474 LEU A CG    1 
ATOM   3724  C CD1   . LEU A 1 474 ? -6.157  -53.910 201.687 1.00 111.35 ? 474 LEU A CD1   1 
ATOM   3725  C CD2   . LEU A 1 474 ? -4.367  -54.042 203.437 1.00 108.95 ? 474 LEU A CD2   1 
ATOM   3726  N N     . LEU A 1 475 ? -2.558  -55.978 199.287 1.00 111.47 ? 475 LEU A N     1 
ATOM   3727  C CA    . LEU A 1 475 ? -1.593  -55.269 198.456 1.00 110.13 ? 475 LEU A CA    1 
ATOM   3728  C C     . LEU A 1 475 ? -1.964  -55.318 196.976 1.00 121.50 ? 475 LEU A C     1 
ATOM   3729  O O     . LEU A 1 475 ? -2.159  -54.281 196.341 1.00 125.68 ? 475 LEU A O     1 
ATOM   3730  C CB    . LEU A 1 475 ? -0.189  -55.840 198.665 1.00 98.55  ? 475 LEU A CB    1 
ATOM   3731  C CG    . LEU A 1 475 ? 0.912   -55.316 197.742 1.00 95.24  ? 475 LEU A CG    1 
ATOM   3732  C CD1   . LEU A 1 475 ? 1.105   -53.819 197.919 1.00 94.98  ? 475 LEU A CD1   1 
ATOM   3733  C CD2   . LEU A 1 475 ? 2.214   -56.058 197.994 1.00 92.67  ? 475 LEU A CD2   1 
ATOM   3734  N N     . GLU A 1 476 ? -2.066  -56.527 196.433 1.00 127.71 ? 476 GLU A N     1 
ATOM   3735  C CA    . GLU A 1 476 ? -2.336  -56.710 195.010 1.00 133.21 ? 476 GLU A CA    1 
ATOM   3736  C C     . GLU A 1 476 ? -3.781  -56.386 194.616 1.00 129.83 ? 476 GLU A C     1 
ATOM   3737  O O     . GLU A 1 476 ? -4.070  -56.151 193.442 1.00 130.93 ? 476 GLU A O     1 
ATOM   3738  C CB    . GLU A 1 476 ? -1.939  -58.122 194.564 1.00 140.72 ? 476 GLU A CB    1 
ATOM   3739  C CG    . GLU A 1 476 ? -0.433  -58.319 194.442 1.00 147.21 ? 476 GLU A CG    1 
ATOM   3740  C CD    . GLU A 1 476 ? 0.065   -59.542 195.188 1.00 152.46 ? 476 GLU A CD    1 
ATOM   3741  O OE1   . GLU A 1 476 ? -0.726  -60.495 195.362 1.00 155.37 ? 476 GLU A OE1   1 
ATOM   3742  O OE2   . GLU A 1 476 ? 1.245   -59.547 195.603 1.00 151.28 ? 476 GLU A OE2   1 
ATOM   3743  N N     . GLN A 1 477 ? -4.684  -56.369 195.593 1.00 124.45 ? 477 GLN A N     1 
ATOM   3744  C CA    . GLN A 1 477 ? -6.054  -55.932 195.337 1.00 121.89 ? 477 GLN A CA    1 
ATOM   3745  C C     . GLN A 1 477 ? -6.073  -54.420 195.170 1.00 117.15 ? 477 GLN A C     1 
ATOM   3746  O O     . GLN A 1 477 ? -6.826  -53.879 194.359 1.00 113.39 ? 477 GLN A O     1 
ATOM   3747  C CB    . GLN A 1 477 ? -6.992  -56.343 196.474 1.00 121.07 ? 477 GLN A CB    1 
ATOM   3748  C CG    . GLN A 1 477 ? -7.614  -57.725 196.311 1.00 122.67 ? 477 GLN A CG    1 
ATOM   3749  C CD    . GLN A 1 477 ? -8.606  -58.047 197.416 1.00 122.77 ? 477 GLN A CD    1 
ATOM   3750  O OE1   . GLN A 1 477 ? -8.839  -57.236 198.314 1.00 122.53 ? 477 GLN A OE1   1 
ATOM   3751  N NE2   . GLN A 1 477 ? -9.195  -59.236 197.356 1.00 124.31 ? 477 GLN A NE2   1 
ATOM   3752  N N     . ALA A 1 478 ? -5.230  -53.748 195.946 1.00 119.59 ? 478 ALA A N     1 
ATOM   3753  C CA    . ALA A 1 478 ? -5.099  -52.299 195.875 1.00 119.85 ? 478 ALA A CA    1 
ATOM   3754  C C     . ALA A 1 478 ? -4.401  -51.872 194.586 1.00 125.97 ? 478 ALA A C     1 
ATOM   3755  O O     . ALA A 1 478 ? -4.801  -50.898 193.948 1.00 130.61 ? 478 ALA A O     1 
ATOM   3756  C CB    . ALA A 1 478 ? -4.347  -51.775 197.091 1.00 112.24 ? 478 ALA A CB    1 
ATOM   3757  N N     . LEU A 1 479 ? -3.363  -52.611 194.202 1.00 124.32 ? 479 LEU A N     1 
ATOM   3758  C CA    . LEU A 1 479 ? -2.604  -52.310 192.988 1.00 123.98 ? 479 LEU A CA    1 
ATOM   3759  C C     . LEU A 1 479 ? -3.418  -52.421 191.698 1.00 129.22 ? 479 LEU A C     1 
ATOM   3760  O O     . LEU A 1 479 ? -3.069  -51.808 190.689 1.00 129.52 ? 479 LEU A O     1 
ATOM   3761  C CB    . LEU A 1 479 ? -1.360  -53.196 192.898 1.00 119.79 ? 479 LEU A CB    1 
ATOM   3762  C CG    . LEU A 1 479 ? -0.175  -52.729 193.742 1.00 114.80 ? 479 LEU A CG    1 
ATOM   3763  C CD1   . LEU A 1 479 ? 0.913   -53.790 193.789 1.00 116.92 ? 479 LEU A CD1   1 
ATOM   3764  C CD2   . LEU A 1 479 ? 0.375   -51.420 193.195 1.00 112.17 ? 479 LEU A CD2   1 
ATOM   3765  N N     . ASP A 1 480 ? -4.491  -53.205 191.723 1.00 133.91 ? 480 ASP A N     1 
ATOM   3766  C CA    . ASP A 1 480 ? -5.341  -53.350 190.545 1.00 141.32 ? 480 ASP A CA    1 
ATOM   3767  C C     . ASP A 1 480 ? -6.414  -52.263 190.502 1.00 137.77 ? 480 ASP A C     1 
ATOM   3768  O O     . ASP A 1 480 ? -6.617  -51.615 189.474 1.00 139.56 ? 480 ASP A O     1 
ATOM   3769  C CB    . ASP A 1 480 ? -5.996  -54.736 190.508 1.00 151.01 ? 480 ASP A CB    1 
ATOM   3770  C CG    . ASP A 1 480 ? -4.980  -55.867 190.501 1.00 157.69 ? 480 ASP A CG    1 
ATOM   3771  O OD1   . ASP A 1 480 ? -3.779  -55.595 190.285 1.00 161.57 ? 480 ASP A OD1   1 
ATOM   3772  O OD2   . ASP A 1 480 ? -5.385  -57.033 190.705 1.00 157.01 ? 480 ASP A OD2   1 
ATOM   3773  N N     . CYS A 1 481 ? -7.082  -52.063 191.636 1.00 133.71 ? 481 CYS A N     1 
ATOM   3774  C CA    . CYS A 1 481 ? -8.225  -51.156 191.732 1.00 133.48 ? 481 CYS A CA    1 
ATOM   3775  C C     . CYS A 1 481 ? -7.847  -49.674 191.780 1.00 133.83 ? 481 CYS A C     1 
ATOM   3776  O O     . CYS A 1 481 ? -8.295  -48.890 190.943 1.00 141.25 ? 481 CYS A O     1 
ATOM   3777  C CB    . CYS A 1 481 ? -9.076  -51.512 192.954 1.00 130.43 ? 481 CYS A CB    1 
ATOM   3778  S SG    . CYS A 1 481 ? -9.706  -53.207 192.955 1.00 142.71 ? 481 CYS A SG    1 
ATOM   3779  N N     . LEU A 1 482 ? -7.040  -49.295 192.768 1.00 124.51 ? 482 LEU A N     1 
ATOM   3780  C CA    . LEU A 1 482 ? -6.634  -47.902 192.952 1.00 117.01 ? 482 LEU A CA    1 
ATOM   3781  C C     . LEU A 1 482 ? -5.954  -47.325 191.713 1.00 115.68 ? 482 LEU A C     1 
ATOM   3782  O O     . LEU A 1 482 ? -4.913  -47.824 191.287 1.00 116.72 ? 482 LEU A O     1 
ATOM   3783  C CB    . LEU A 1 482 ? -5.698  -47.775 194.155 1.00 113.81 ? 482 LEU A CB    1 
ATOM   3784  C CG    . LEU A 1 482 ? -6.285  -48.154 195.515 1.00 111.43 ? 482 LEU A CG    1 
ATOM   3785  C CD1   . LEU A 1 482 ? -5.193  -48.234 196.568 1.00 103.42 ? 482 LEU A CD1   1 
ATOM   3786  C CD2   . LEU A 1 482 ? -7.356  -47.154 195.926 1.00 114.51 ? 482 LEU A CD2   1 
ATOM   3787  N N     . PRO A 1 483 ? -6.546  -46.269 191.131 1.00 116.80 ? 483 PRO A N     1 
ATOM   3788  C CA    . PRO A 1 483 ? -5.984  -45.591 189.958 1.00 115.15 ? 483 PRO A CA    1 
ATOM   3789  C C     . PRO A 1 483 ? -4.665  -44.904 190.288 1.00 112.68 ? 483 PRO A C     1 
ATOM   3790  O O     . PRO A 1 483 ? -4.523  -44.352 191.379 1.00 111.00 ? 483 PRO A O     1 
ATOM   3791  C CB    . PRO A 1 483 ? -7.039  -44.528 189.626 1.00 117.33 ? 483 PRO A CB    1 
ATOM   3792  C CG    . PRO A 1 483 ? -8.286  -44.992 190.291 1.00 119.01 ? 483 PRO A CG    1 
ATOM   3793  C CD    . PRO A 1 483 ? -7.838  -45.691 191.532 1.00 118.79 ? 483 PRO A CD    1 
ATOM   3794  N N     . ALA A 1 484 ? -3.719  -44.932 189.353 1.00 115.35 ? 484 ALA A N     1 
ATOM   3795  C CA    . ALA A 1 484 ? -2.429  -44.279 189.550 1.00 115.30 ? 484 ALA A CA    1 
ATOM   3796  C C     . ALA A 1 484 ? -2.593  -42.770 189.704 1.00 120.64 ? 484 ALA A C     1 
ATOM   3797  O O     . ALA A 1 484 ? -1.903  -42.142 190.508 1.00 119.93 ? 484 ALA A O     1 
ATOM   3798  C CB    . ALA A 1 484 ? -1.488  -44.599 188.399 1.00 113.14 ? 484 ALA A CB    1 
ATOM   3799  N N     . ALA A 1 485 ? -3.513  -42.194 188.935 1.00 126.55 ? 485 ALA A N     1 
ATOM   3800  C CA    . ALA A 1 485 ? -3.781  -40.761 189.009 1.00 127.24 ? 485 ALA A CA    1 
ATOM   3801  C C     . ALA A 1 485 ? -4.368  -40.386 190.365 1.00 125.39 ? 485 ALA A C     1 
ATOM   3802  O O     . ALA A 1 485 ? -4.175  -39.272 190.850 1.00 126.76 ? 485 ALA A O     1 
ATOM   3803  C CB    . ALA A 1 485 ? -4.711  -40.333 187.887 1.00 132.16 ? 485 ALA A CB    1 
ATOM   3804  N N     . HIS A 1 486 ? -5.089  -41.323 190.970 1.00 125.76 ? 486 HIS A N     1 
ATOM   3805  C CA    . HIS A 1 486 ? -5.601  -41.134 192.319 1.00 126.45 ? 486 HIS A CA    1 
ATOM   3806  C C     . HIS A 1 486 ? -4.476  -41.266 193.336 1.00 124.22 ? 486 HIS A C     1 
ATOM   3807  O O     . HIS A 1 486 ? -4.426  -40.527 194.320 1.00 123.20 ? 486 HIS A O     1 
ATOM   3808  C CB    . HIS A 1 486 ? -6.703  -42.145 192.625 1.00 127.19 ? 486 HIS A CB    1 
ATOM   3809  C CG    . HIS A 1 486 ? -8.058  -41.718 192.158 1.00 131.53 ? 486 HIS A CG    1 
ATOM   3810  N ND1   . HIS A 1 486 ? -9.208  -42.404 192.487 1.00 135.09 ? 486 HIS A ND1   1 
ATOM   3811  C CD2   . HIS A 1 486 ? -8.449  -40.673 191.392 1.00 134.92 ? 486 HIS A CD2   1 
ATOM   3812  C CE1   . HIS A 1 486 ? -10.248 -41.799 191.942 1.00 137.80 ? 486 HIS A CE1   1 
ATOM   3813  N NE2   . HIS A 1 486 ? -9.815  -40.747 191.272 1.00 139.17 ? 486 HIS A NE2   1 
ATOM   3814  N N     . LEU A 1 487 ? -3.574  -42.212 193.093 1.00 120.59 ? 487 LEU A N     1 
ATOM   3815  C CA    . LEU A 1 487 ? -2.452  -42.442 193.995 1.00 116.36 ? 487 LEU A CA    1 
ATOM   3816  C C     . LEU A 1 487 ? -1.543  -41.224 194.042 1.00 116.37 ? 487 LEU A C     1 
ATOM   3817  O O     . LEU A 1 487 ? -0.916  -40.946 195.064 1.00 112.88 ? 487 LEU A O     1 
ATOM   3818  C CB    . LEU A 1 487 ? -1.660  -43.682 193.580 1.00 110.81 ? 487 LEU A CB    1 
ATOM   3819  C CG    . LEU A 1 487 ? -2.331  -45.032 193.839 1.00 102.90 ? 487 LEU A CG    1 
ATOM   3820  C CD1   . LEU A 1 487 ? -1.489  -46.160 193.264 1.00 101.46 ? 487 LEU A CD1   1 
ATOM   3821  C CD2   . LEU A 1 487 ? -2.565  -45.233 195.329 1.00 98.18  ? 487 LEU A CD2   1 
ATOM   3822  N N     . ARG A 1 488 ? -1.479  -40.499 192.930 1.00 118.95 ? 488 ARG A N     1 
ATOM   3823  C CA    . ARG A 1 488 ? -0.718  -39.261 192.881 1.00 120.28 ? 488 ARG A CA    1 
ATOM   3824  C C     . ARG A 1 488 ? -1.292  -38.255 193.865 1.00 119.59 ? 488 ARG A C     1 
ATOM   3825  O O     . ARG A 1 488 ? -0.633  -37.885 194.834 1.00 121.40 ? 488 ARG A O     1 
ATOM   3826  C CB    . ARG A 1 488 ? -0.730  -38.671 191.472 1.00 121.00 ? 488 ARG A CB    1 
ATOM   3827  C CG    . ARG A 1 488 ? 0.143   -37.440 191.328 1.00 117.27 ? 488 ARG A CG    1 
ATOM   3828  C CD    . ARG A 1 488 ? 1.158   -37.624 190.219 1.00 118.24 ? 488 ARG A CD    1 
ATOM   3829  N NE    . ARG A 1 488 ? 2.403   -36.926 190.517 1.00 120.69 ? 488 ARG A NE    1 
ATOM   3830  C CZ    . ARG A 1 488 ? 3.566   -37.194 189.933 1.00 125.35 ? 488 ARG A CZ    1 
ATOM   3831  N NH1   . ARG A 1 488 ? 3.643   -38.149 189.016 1.00 126.87 ? 488 ARG A NH1   1 
ATOM   3832  N NH2   . ARG A 1 488 ? 4.652   -36.511 190.271 1.00 124.78 ? 488 ARG A NH2   1 
ATOM   3833  N N     . ALA A 1 489 ? -2.534  -37.846 193.620 1.00 115.74 ? 489 ALA A N     1 
ATOM   3834  C CA    . ALA A 1 489 ? -3.203  -36.816 194.413 1.00 115.10 ? 489 ALA A CA    1 
ATOM   3835  C C     . ALA A 1 489 ? -3.081  -37.029 195.919 1.00 115.69 ? 489 ALA A C     1 
ATOM   3836  O O     . ALA A 1 489 ? -2.974  -36.070 196.683 1.00 115.72 ? 489 ALA A O     1 
ATOM   3837  C CB    . ALA A 1 489 ? -4.668  -36.716 194.014 1.00 116.18 ? 489 ALA A CB    1 
ATOM   3838  N N     . TRP A 1 490 ? -3.097  -38.288 196.339 1.00 117.30 ? 490 TRP A N     1 
ATOM   3839  C CA    . TRP A 1 490 ? -2.962  -38.614 197.750 1.00 119.08 ? 490 TRP A CA    1 
ATOM   3840  C C     . TRP A 1 490 ? -1.536  -38.364 198.221 1.00 119.87 ? 490 TRP A C     1 
ATOM   3841  O O     . TRP A 1 490 ? -1.314  -37.691 199.229 1.00 120.90 ? 490 TRP A O     1 
ATOM   3842  C CB    . TRP A 1 490 ? -3.337  -40.073 197.991 1.00 121.95 ? 490 TRP A CB    1 
ATOM   3843  C CG    . TRP A 1 490 ? -4.797  -40.361 197.846 1.00 124.87 ? 490 TRP A CG    1 
ATOM   3844  C CD1   . TRP A 1 490 ? -5.836  -39.537 198.167 1.00 124.34 ? 490 TRP A CD1   1 
ATOM   3845  C CD2   . TRP A 1 490 ? -5.381  -41.565 197.340 1.00 129.01 ? 490 TRP A CD2   1 
ATOM   3846  N NE1   . TRP A 1 490 ? -7.033  -40.157 197.895 1.00 127.19 ? 490 TRP A NE1   1 
ATOM   3847  C CE2   . TRP A 1 490 ? -6.780  -41.403 197.386 1.00 130.19 ? 490 TRP A CE2   1 
ATOM   3848  C CE3   . TRP A 1 490 ? -4.855  -42.766 196.854 1.00 130.74 ? 490 TRP A CE3   1 
ATOM   3849  C CZ2   . TRP A 1 490 ? -7.660  -42.397 196.963 1.00 132.21 ? 490 TRP A CZ2   1 
ATOM   3850  C CZ3   . TRP A 1 490 ? -5.730  -43.751 196.436 1.00 134.21 ? 490 TRP A CZ3   1 
ATOM   3851  C CH2   . TRP A 1 490 ? -7.117  -43.561 196.492 1.00 134.30 ? 490 TRP A CH2   1 
ATOM   3852  N N     . PHE A 1 491 ? -0.577  -38.909 197.478 1.00 116.45 ? 491 PHE A N     1 
ATOM   3853  C CA    . PHE A 1 491 ? 0.837   -38.788 197.819 1.00 110.26 ? 491 PHE A CA    1 
ATOM   3854  C C     . PHE A 1 491 ? 1.279   -37.331 197.827 1.00 116.90 ? 491 PHE A C     1 
ATOM   3855  O O     . PHE A 1 491 ? 2.122   -36.935 198.633 1.00 120.22 ? 491 PHE A O     1 
ATOM   3856  C CB    . PHE A 1 491 ? 1.705   -39.575 196.834 1.00 103.90 ? 491 PHE A CB    1 
ATOM   3857  C CG    . PHE A 1 491 ? 1.458   -41.057 196.848 1.00 103.58 ? 491 PHE A CG    1 
ATOM   3858  C CD1   . PHE A 1 491 ? 0.673   -41.641 197.829 1.00 100.50 ? 491 PHE A CD1   1 
ATOM   3859  C CD2   . PHE A 1 491 ? 2.023   -41.869 195.878 1.00 103.63 ? 491 PHE A CD2   1 
ATOM   3860  C CE1   . PHE A 1 491 ? 0.449   -43.001 197.837 1.00 96.17  ? 491 PHE A CE1   1 
ATOM   3861  C CE2   . PHE A 1 491 ? 1.805   -43.232 195.884 1.00 99.93  ? 491 PHE A CE2   1 
ATOM   3862  C CZ    . PHE A 1 491 ? 1.017   -43.798 196.865 1.00 94.82  ? 491 PHE A CZ    1 
ATOM   3863  N N     . GLU A 1 492 ? 0.712   -36.538 196.923 1.00 118.38 ? 492 GLU A N     1 
ATOM   3864  C CA    . GLU A 1 492 ? 1.034   -35.118 196.852 1.00 116.91 ? 492 GLU A CA    1 
ATOM   3865  C C     . GLU A 1 492 ? 0.529   -34.401 198.098 1.00 109.94 ? 492 GLU A C     1 
ATOM   3866  O O     . GLU A 1 492 ? 1.223   -33.549 198.652 1.00 112.28 ? 492 GLU A O     1 
ATOM   3867  C CB    . GLU A 1 492 ? 0.420   -34.474 195.605 1.00 128.61 ? 492 GLU A CB    1 
ATOM   3868  C CG    . GLU A 1 492 ? 0.688   -35.205 194.296 1.00 140.11 ? 492 GLU A CG    1 
ATOM   3869  C CD    . GLU A 1 492 ? 1.990   -34.801 193.630 1.00 148.33 ? 492 GLU A CD    1 
ATOM   3870  O OE1   . GLU A 1 492 ? 2.960   -34.470 194.345 1.00 150.43 ? 492 GLU A OE1   1 
ATOM   3871  O OE2   . GLU A 1 492 ? 2.038   -34.814 192.380 1.00 152.24 ? 492 GLU A OE2   1 
ATOM   3872  N N     . ARG A 1 493 ? -0.680  -34.747 198.537 1.00 105.97 ? 493 ARG A N     1 
ATOM   3873  C CA    . ARG A 1 493 ? -1.271  -34.098 199.704 1.00 109.92 ? 493 ARG A CA    1 
ATOM   3874  C C     . ARG A 1 493 ? -0.488  -34.419 200.977 1.00 119.35 ? 493 ARG A C     1 
ATOM   3875  O O     . ARG A 1 493 ? -0.395  -33.588 201.882 1.00 126.47 ? 493 ARG A O     1 
ATOM   3876  C CB    . ARG A 1 493 ? -2.751  -34.465 199.870 1.00 110.34 ? 493 ARG A CB    1 
ATOM   3877  C CG    . ARG A 1 493 ? -3.437  -33.739 201.030 1.00 113.40 ? 493 ARG A CG    1 
ATOM   3878  C CD    . ARG A 1 493 ? -4.841  -34.267 201.295 1.00 118.53 ? 493 ARG A CD    1 
ATOM   3879  N NE    . ARG A 1 493 ? -5.205  -34.192 202.712 1.00 117.67 ? 493 ARG A NE    1 
ATOM   3880  C CZ    . ARG A 1 493 ? -5.748  -33.128 203.299 1.00 115.06 ? 493 ARG A CZ    1 
ATOM   3881  N NH1   . ARG A 1 493 ? -5.996  -32.029 202.595 1.00 116.07 ? 493 ARG A NH1   1 
ATOM   3882  N NH2   . ARG A 1 493 ? -6.043  -33.163 204.594 1.00 108.52 ? 493 ARG A NH2   1 
ATOM   3883  N N     . LEU A 1 494 ? 0.078   -35.621 201.039 1.00 116.92 ? 494 LEU A N     1 
ATOM   3884  C CA    . LEU A 1 494 ? 0.919   -36.006 202.166 1.00 111.94 ? 494 LEU A CA    1 
ATOM   3885  C C     . LEU A 1 494 ? 2.168   -35.144 202.223 1.00 114.75 ? 494 LEU A C     1 
ATOM   3886  O O     . LEU A 1 494 ? 2.639   -34.793 203.302 1.00 120.71 ? 494 LEU A O     1 
ATOM   3887  C CB    . LEU A 1 494 ? 1.319   -37.478 202.075 1.00 110.75 ? 494 LEU A CB    1 
ATOM   3888  C CG    . LEU A 1 494 ? 0.496   -38.457 202.909 1.00 110.08 ? 494 LEU A CG    1 
ATOM   3889  C CD1   . LEU A 1 494 ? -0.935  -38.490 202.413 1.00 116.71 ? 494 LEU A CD1   1 
ATOM   3890  C CD2   . LEU A 1 494 ? 1.118   -39.842 202.867 1.00 106.80 ? 494 LEU A CD2   1 
ATOM   3891  N N     . LEU A 1 495 ? 2.703   -34.801 201.057 1.00 110.44 ? 495 LEU A N     1 
ATOM   3892  C CA    . LEU A 1 495 ? 3.925   -34.010 200.998 1.00 107.21 ? 495 LEU A CA    1 
ATOM   3893  C C     . LEU A 1 495 ? 3.690   -32.517 201.228 1.00 112.41 ? 495 LEU A C     1 
ATOM   3894  O O     . LEU A 1 495 ? 4.640   -31.769 201.452 1.00 118.01 ? 495 LEU A O     1 
ATOM   3895  C CB    . LEU A 1 495 ? 4.671   -34.246 199.683 1.00 103.21 ? 495 LEU A CB    1 
ATOM   3896  C CG    . LEU A 1 495 ? 5.322   -35.623 199.525 1.00 101.02 ? 495 LEU A CG    1 
ATOM   3897  C CD1   . LEU A 1 495 ? 6.250   -35.637 198.324 1.00 99.87  ? 495 LEU A CD1   1 
ATOM   3898  C CD2   . LEU A 1 495 ? 6.073   -36.020 200.787 1.00 101.50 ? 495 LEU A CD2   1 
ATOM   3899  N N     . GLU A 1 496 ? 2.434   -32.084 201.171 1.00 114.86 ? 496 GLU A N     1 
ATOM   3900  C CA    . GLU A 1 496 ? 2.108   -30.705 201.511 1.00 120.92 ? 496 GLU A CA    1 
ATOM   3901  C C     . GLU A 1 496 ? 2.418   -30.528 202.985 1.00 121.93 ? 496 GLU A C     1 
ATOM   3902  O O     . GLU A 1 496 ? 2.980   -29.518 203.407 1.00 126.34 ? 496 GLU A O     1 
ATOM   3903  C CB    . GLU A 1 496 ? 0.625   -30.410 201.282 1.00 126.14 ? 496 GLU A CB    1 
ATOM   3904  C CG    . GLU A 1 496 ? 0.077   -30.864 199.947 1.00 134.18 ? 496 GLU A CG    1 
ATOM   3905  C CD    . GLU A 1 496 ? 0.076   -29.772 198.900 1.00 143.26 ? 496 GLU A CD    1 
ATOM   3906  O OE1   . GLU A 1 496 ? 0.979   -28.912 198.932 1.00 146.43 ? 496 GLU A OE1   1 
ATOM   3907  O OE2   . GLU A 1 496 ? -0.837  -29.773 198.046 1.00 146.83 ? 496 GLU A OE2   1 
ATOM   3908  N N     . ASP A 1 497 ? 2.049   -31.538 203.761 1.00 116.91 ? 497 ASP A N     1 
ATOM   3909  C CA    . ASP A 1 497 ? 2.206   -31.500 205.202 1.00 116.72 ? 497 ASP A CA    1 
ATOM   3910  C C     . ASP A 1 497 ? 2.109   -32.915 205.744 1.00 111.41 ? 497 ASP A C     1 
ATOM   3911  O O     . ASP A 1 497 ? 1.015   -33.423 205.978 1.00 113.10 ? 497 ASP A O     1 
ATOM   3912  C CB    . ASP A 1 497 ? 1.122   -30.618 205.821 1.00 121.09 ? 497 ASP A CB    1 
ATOM   3913  C CG    . ASP A 1 497 ? 1.210   -30.555 207.332 1.00 125.17 ? 497 ASP A CG    1 
ATOM   3914  O OD1   . ASP A 1 497 ? 2.285   -30.875 207.883 1.00 127.25 ? 497 ASP A OD1   1 
ATOM   3915  O OD2   . ASP A 1 497 ? 0.205   -30.177 207.971 1.00 125.00 ? 497 ASP A OD2   1 
ATOM   3916  N N     . ILE A 1 498 ? 3.257   -33.552 205.932 1.00 102.59 ? 498 ILE A N     1 
ATOM   3917  C CA    . ILE A 1 498 ? 3.287   -34.921 206.434 1.00 94.22  ? 498 ILE A CA    1 
ATOM   3918  C C     . ILE A 1 498 ? 2.680   -35.086 207.833 1.00 98.48  ? 498 ILE A C     1 
ATOM   3919  O O     . ILE A 1 498 ? 1.815   -35.939 208.022 1.00 101.19 ? 498 ILE A O     1 
ATOM   3920  C CB    . ILE A 1 498 ? 4.705   -35.523 206.386 1.00 86.86  ? 498 ILE A CB    1 
ATOM   3921  C CG1   . ILE A 1 498 ? 5.168   -35.675 204.937 1.00 83.83  ? 498 ILE A CG1   1 
ATOM   3922  C CG2   . ILE A 1 498 ? 4.738   -36.856 207.107 1.00 78.11  ? 498 ILE A CG2   1 
ATOM   3923  C CD1   . ILE A 1 498 ? 6.524   -36.322 204.800 1.00 85.15  ? 498 ILE A CD1   1 
ATOM   3924  N N     . PRO A 1 499 ? 3.115   -34.273 208.817 1.00 103.82 ? 499 PRO A N     1 
ATOM   3925  C CA    . PRO A 1 499 ? 2.523   -34.482 210.144 1.00 107.66 ? 499 PRO A CA    1 
ATOM   3926  C C     . PRO A 1 499 ? 1.035   -34.146 210.201 1.00 109.67 ? 499 PRO A C     1 
ATOM   3927  O O     . PRO A 1 499 ? 0.327   -34.666 211.062 1.00 111.59 ? 499 PRO A O     1 
ATOM   3928  C CB    . PRO A 1 499 ? 3.303   -33.505 211.032 1.00 108.96 ? 499 PRO A CB    1 
ATOM   3929  C CG    . PRO A 1 499 ? 4.574   -33.251 210.300 1.00 106.95 ? 499 PRO A CG    1 
ATOM   3930  C CD    . PRO A 1 499 ? 4.181   -33.256 208.859 1.00 107.23 ? 499 PRO A CD    1 
ATOM   3931  N N     . GLY A 1 500 ? 0.573   -33.289 209.297 1.00 111.34 ? 500 GLY A N     1 
ATOM   3932  C CA    . GLY A 1 500 ? -0.801  -32.824 209.325 1.00 114.04 ? 500 GLY A CA    1 
ATOM   3933  C C     . GLY A 1 500 ? -1.712  -33.646 208.441 1.00 116.98 ? 500 GLY A C     1 
ATOM   3934  O O     . GLY A 1 500 ? -2.935  -33.578 208.558 1.00 119.64 ? 500 GLY A O     1 
ATOM   3935  N N     . ASN A 1 501 ? -1.111  -34.425 207.549 1.00 116.13 ? 501 ASN A N     1 
ATOM   3936  C CA    . ASN A 1 501 ? -1.874  -35.286 206.658 1.00 111.74 ? 501 ASN A CA    1 
ATOM   3937  C C     . ASN A 1 501 ? -1.444  -36.748 206.771 1.00 113.26 ? 501 ASN A C     1 
ATOM   3938  O O     . ASN A 1 501 ? -1.668  -37.541 205.862 1.00 112.89 ? 501 ASN A O     1 
ATOM   3939  C CB    . ASN A 1 501 ? -1.770  -34.794 205.209 1.00 107.80 ? 501 ASN A CB    1 
ATOM   3940  C CG    . ASN A 1 501 ? -2.230  -33.352 205.046 1.00 102.92 ? 501 ASN A CG    1 
ATOM   3941  O OD1   . ASN A 1 501 ? -1.634  -32.577 204.295 1.00 99.53  ? 501 ASN A OD1   1 
ATOM   3942  N ND2   . ASN A 1 501 ? -3.290  -32.984 205.760 1.00 99.02  ? 501 ASN A ND2   1 
ATOM   3943  N N     . ARG A 1 502 ? -0.820  -37.101 207.891 1.00 114.77 ? 502 ARG A N     1 
ATOM   3944  C CA    . ARG A 1 502 ? -0.442  -38.488 208.137 1.00 111.43 ? 502 ARG A CA    1 
ATOM   3945  C C     . ARG A 1 502 ? -1.695  -39.292 208.451 1.00 110.54 ? 502 ARG A C     1 
ATOM   3946  O O     . ARG A 1 502 ? -1.813  -40.460 208.079 1.00 115.91 ? 502 ARG A O     1 
ATOM   3947  C CB    . ARG A 1 502 ? 0.546   -38.594 209.304 1.00 114.97 ? 502 ARG A CB    1 
ATOM   3948  C CG    . ARG A 1 502 ? 1.958   -39.000 208.903 1.00 123.05 ? 502 ARG A CG    1 
ATOM   3949  C CD    . ARG A 1 502 ? 2.636   -39.788 210.014 1.00 131.07 ? 502 ARG A CD    1 
ATOM   3950  N NE    . ARG A 1 502 ? 1.794   -40.901 210.442 1.00 141.42 ? 502 ARG A NE    1 
ATOM   3951  C CZ    . ARG A 1 502 ? 1.714   -42.065 209.805 1.00 147.01 ? 502 ARG A CZ    1 
ATOM   3952  N NH1   . ARG A 1 502 ? 2.433   -42.279 208.710 1.00 149.78 ? 502 ARG A NH1   1 
ATOM   3953  N NH2   . ARG A 1 502 ? 0.913   -43.018 210.263 1.00 146.90 ? 502 ARG A NH2   1 
ATOM   3954  N N     . ALA A 1 503 ? -2.633  -38.644 209.135 1.00 102.96 ? 503 ALA A N     1 
ATOM   3955  C CA    . ALA A 1 503 ? -3.865  -39.292 209.565 1.00 97.34  ? 503 ALA A CA    1 
ATOM   3956  C C     . ALA A 1 503 ? -5.100  -38.628 208.964 1.00 97.84  ? 503 ALA A C     1 
ATOM   3957  O O     . ALA A 1 503 ? -4.994  -37.679 208.185 1.00 100.84 ? 503 ALA A O     1 
ATOM   3958  C CB    . ALA A 1 503 ? -3.952  -39.294 211.077 1.00 79.20  ? 503 ALA A CB    1 
ATOM   3959  N N     . GLY A 1 504 ? -6.272  -39.140 209.325 1.00 98.58  ? 504 GLY A N     1 
ATOM   3960  C CA    . GLY A 1 504 ? -7.524  -38.598 208.830 1.00 104.09 ? 504 GLY A CA    1 
ATOM   3961  C C     . GLY A 1 504 ? -8.185  -39.420 207.736 1.00 112.21 ? 504 GLY A C     1 
ATOM   3962  O O     . GLY A 1 504 ? -9.202  -39.008 207.182 1.00 120.15 ? 504 GLY A O     1 
ATOM   3963  N N     . LEU A 1 505 ? -7.620  -40.582 207.420 1.00 107.81 ? 505 LEU A N     1 
ATOM   3964  C CA    . LEU A 1 505 ? -8.184  -41.439 206.376 1.00 102.57 ? 505 LEU A CA    1 
ATOM   3965  C C     . LEU A 1 505 ? -9.305  -42.330 206.909 1.00 106.06 ? 505 LEU A C     1 
ATOM   3966  O O     . LEU A 1 505 ? -9.275  -42.734 208.071 1.00 112.41 ? 505 LEU A O     1 
ATOM   3967  C CB    . LEU A 1 505 ? -7.088  -42.282 205.720 1.00 96.35  ? 505 LEU A CB    1 
ATOM   3968  C CG    . LEU A 1 505 ? -6.274  -41.538 204.663 1.00 96.80  ? 505 LEU A CG    1 
ATOM   3969  C CD1   . LEU A 1 505 ? -4.854  -42.079 204.593 1.00 97.76  ? 505 LEU A CD1   1 
ATOM   3970  C CD2   . LEU A 1 505 ? -6.959  -41.641 203.308 1.00 87.77  ? 505 LEU A CD2   1 
ATOM   3971  N N     . PRO A 1 506 ? -10.301 -42.635 206.058 1.00 103.16 ? 506 PRO A N     1 
ATOM   3972  C CA    . PRO A 1 506 ? -11.486 -43.390 206.485 1.00 104.17 ? 506 PRO A CA    1 
ATOM   3973  C C     . PRO A 1 506 ? -11.187 -44.810 206.975 1.00 103.30 ? 506 PRO A C     1 
ATOM   3974  O O     . PRO A 1 506 ? -10.178 -45.404 206.583 1.00 104.49 ? 506 PRO A O     1 
ATOM   3975  C CB    . PRO A 1 506 ? -12.348 -43.434 205.217 1.00 106.38 ? 506 PRO A CB    1 
ATOM   3976  C CG    . PRO A 1 506 ? -11.401 -43.218 204.101 1.00 106.51 ? 506 PRO A CG    1 
ATOM   3977  C CD    . PRO A 1 506 ? -10.375 -42.270 204.632 1.00 101.99 ? 506 PRO A CD    1 
ATOM   3978  N N     . ASP A 1 507 ? -12.078 -45.337 207.816 1.00 103.86 ? 507 ASP A N     1 
ATOM   3979  C CA    . ASP A 1 507 ? -11.921 -46.657 208.432 1.00 105.90 ? 507 ASP A CA    1 
ATOM   3980  C C     . ASP A 1 507 ? -11.649 -47.777 207.422 1.00 110.93 ? 507 ASP A C     1 
ATOM   3981  O O     . ASP A 1 507 ? -10.666 -48.509 207.548 1.00 113.80 ? 507 ASP A O     1 
ATOM   3982  C CB    . ASP A 1 507 ? -13.163 -47.025 209.261 1.00 108.39 ? 507 ASP A CB    1 
ATOM   3983  C CG    . ASP A 1 507 ? -13.355 -46.131 210.481 1.00 109.17 ? 507 ASP A CG    1 
ATOM   3984  O OD1   . ASP A 1 507 ? -12.357 -45.786 211.151 1.00 113.17 ? 507 ASP A OD1   1 
ATOM   3985  O OD2   . ASP A 1 507 ? -14.519 -45.784 210.776 1.00 101.65 ? 507 ASP A OD2   1 
ATOM   3986  N N     . LEU A 1 508 ? -12.523 -47.898 206.424 1.00 112.31 ? 508 LEU A N     1 
ATOM   3987  C CA    . LEU A 1 508 ? -12.528 -49.047 205.519 1.00 108.78 ? 508 LEU A CA    1 
ATOM   3988  C C     . LEU A 1 508 ? -12.318 -48.684 204.052 1.00 112.04 ? 508 LEU A C     1 
ATOM   3989  O O     . LEU A 1 508 ? -12.755 -47.631 203.592 1.00 117.55 ? 508 LEU A O     1 
ATOM   3990  C CB    . LEU A 1 508 ? -13.861 -49.790 205.637 1.00 105.56 ? 508 LEU A CB    1 
ATOM   3991  C CG    . LEU A 1 508 ? -14.415 -49.971 207.049 1.00 105.01 ? 508 LEU A CG    1 
ATOM   3992  C CD1   . LEU A 1 508 ? -15.828 -50.534 207.015 1.00 103.58 ? 508 LEU A CD1   1 
ATOM   3993  C CD2   . LEU A 1 508 ? -13.497 -50.871 207.851 1.00 106.65 ? 508 LEU A CD2   1 
ATOM   3994  N N     . ILE A 1 509 ? -11.654 -49.574 203.322 1.00 109.24 ? 509 ILE A N     1 
ATOM   3995  C CA    . ILE A 1 509 ? -11.631 -49.513 201.869 1.00 115.70 ? 509 ILE A CA    1 
ATOM   3996  C C     . ILE A 1 509 ? -12.309 -50.787 201.393 1.00 126.40 ? 509 ILE A C     1 
ATOM   3997  O O     . ILE A 1 509 ? -12.111 -51.849 201.980 1.00 135.33 ? 509 ILE A O     1 
ATOM   3998  C CB    . ILE A 1 509 ? -10.193 -49.491 201.309 1.00 119.51 ? 509 ILE A CB    1 
ATOM   3999  C CG1   . ILE A 1 509 ? -9.278  -48.612 202.165 1.00 134.00 ? 509 ILE A CG1   1 
ATOM   4000  C CG2   . ILE A 1 509 ? -10.185 -49.049 199.849 1.00 116.86 ? 509 ILE A CG2   1 
ATOM   4001  C CD1   . ILE A 1 509 ? -9.623  -47.156 202.170 1.00 138.87 ? 509 ILE A CD1   1 
ATOM   4002  N N     . GLN A 1 510 ? -13.125 -50.695 200.352 1.00 126.86 ? 510 GLN A N     1 
ATOM   4003  C CA    . GLN A 1 510 ? -13.699 -51.900 199.772 1.00 129.18 ? 510 GLN A CA    1 
ATOM   4004  C C     . GLN A 1 510 ? -13.434 -51.933 198.274 1.00 131.16 ? 510 GLN A C     1 
ATOM   4005  O O     . GLN A 1 510 ? -13.692 -50.964 197.559 1.00 129.54 ? 510 GLN A O     1 
ATOM   4006  C CB    . GLN A 1 510 ? -15.194 -52.037 200.102 1.00 132.76 ? 510 GLN A CB    1 
ATOM   4007  C CG    . GLN A 1 510 ? -16.100 -51.014 199.446 1.00 136.23 ? 510 GLN A CG    1 
ATOM   4008  C CD    . GLN A 1 510 ? -17.530 -51.091 199.938 1.00 139.27 ? 510 GLN A CD    1 
ATOM   4009  O OE1   . GLN A 1 510 ? -17.922 -52.056 200.592 1.00 142.45 ? 510 GLN A OE1   1 
ATOM   4010  N NE2   . GLN A 1 510 ? -18.318 -50.068 199.627 1.00 138.81 ? 510 GLN A NE2   1 
ATOM   4011  N N     . PHE A 1 511 ? -12.872 -53.041 197.813 1.00 134.74 ? 511 PHE A N     1 
ATOM   4012  C CA    . PHE A 1 511 ? -12.560 -53.195 196.405 1.00 135.53 ? 511 PHE A CA    1 
ATOM   4013  C C     . PHE A 1 511 ? -13.575 -54.128 195.766 1.00 139.75 ? 511 PHE A C     1 
ATOM   4014  O O     . PHE A 1 511 ? -14.053 -55.070 196.397 1.00 139.48 ? 511 PHE A O     1 
ATOM   4015  C CB    . PHE A 1 511 ? -11.151 -53.763 196.219 1.00 131.20 ? 511 PHE A CB    1 
ATOM   4016  C CG    . PHE A 1 511 ? -10.086 -53.032 196.991 1.00 125.92 ? 511 PHE A CG    1 
ATOM   4017  C CD1   . PHE A 1 511 ? -9.562  -51.839 196.521 1.00 126.42 ? 511 PHE A CD1   1 
ATOM   4018  C CD2   . PHE A 1 511 ? -9.594  -53.552 198.177 1.00 123.54 ? 511 PHE A CD2   1 
ATOM   4019  C CE1   . PHE A 1 511 ? -8.575  -51.170 197.227 1.00 124.63 ? 511 PHE A CE1   1 
ATOM   4020  C CE2   . PHE A 1 511 ? -8.608  -52.890 198.887 1.00 122.45 ? 511 PHE A CE2   1 
ATOM   4021  C CZ    . PHE A 1 511 ? -8.099  -51.697 198.412 1.00 122.13 ? 511 PHE A CZ    1 
ATOM   4022  N N     . TRP A 1 512 ? -13.907 -53.852 194.511 1.00 143.25 ? 512 TRP A N     1 
ATOM   4023  C CA    . TRP A 1 512 ? -14.729 -54.750 193.718 1.00 142.71 ? 512 TRP A CA    1 
ATOM   4024  C C     . TRP A 1 512 ? -13.832 -55.215 192.578 1.00 138.82 ? 512 TRP A C     1 
ATOM   4025  O O     . TRP A 1 512 ? -14.024 -54.815 191.431 1.00 139.50 ? 512 TRP A O     1 
ATOM   4026  C CB    . TRP A 1 512 ? -15.961 -54.019 193.176 1.00 145.99 ? 512 TRP A CB    1 
ATOM   4027  C CG    . TRP A 1 512 ? -16.616 -53.079 194.164 1.00 149.07 ? 512 TRP A CG    1 
ATOM   4028  C CD1   . TRP A 1 512 ? -16.136 -51.872 194.591 1.00 146.29 ? 512 TRP A CD1   1 
ATOM   4029  C CD2   . TRP A 1 512 ? -17.877 -53.260 194.823 1.00 153.90 ? 512 TRP A CD2   1 
ATOM   4030  N NE1   . TRP A 1 512 ? -17.007 -51.301 195.482 1.00 144.84 ? 512 TRP A NE1   1 
ATOM   4031  C CE2   . TRP A 1 512 ? -18.086 -52.129 195.641 1.00 152.60 ? 512 TRP A CE2   1 
ATOM   4032  C CE3   . TRP A 1 512 ? -18.847 -54.267 194.804 1.00 161.14 ? 512 TRP A CE3   1 
ATOM   4033  C CZ2   . TRP A 1 512 ? -19.224 -51.978 196.433 1.00 159.17 ? 512 TRP A CZ2   1 
ATOM   4034  C CZ3   . TRP A 1 512 ? -19.977 -54.115 195.592 1.00 166.83 ? 512 TRP A CZ3   1 
ATOM   4035  C CH2   . TRP A 1 512 ? -20.155 -52.979 196.394 1.00 165.69 ? 512 TRP A CH2   1 
ATOM   4036  N N     . PRO A 1 513 ? -12.843 -56.068 192.901 1.00 136.54 ? 513 PRO A N     1 
ATOM   4037  C CA    . PRO A 1 513 ? -11.680 -56.377 192.057 1.00 135.57 ? 513 PRO A CA    1 
ATOM   4038  C C     . PRO A 1 513 ? -12.027 -56.811 190.638 1.00 138.36 ? 513 PRO A C     1 
ATOM   4039  O O     . PRO A 1 513 ? -11.303 -56.460 189.704 1.00 139.52 ? 513 PRO A O     1 
ATOM   4040  C CB    . PRO A 1 513 ? -10.994 -57.527 192.807 1.00 133.87 ? 513 PRO A CB    1 
ATOM   4041  C CG    . PRO A 1 513 ? -12.049 -58.109 193.674 1.00 136.09 ? 513 PRO A CG    1 
ATOM   4042  C CD    . PRO A 1 513 ? -12.910 -56.955 194.075 1.00 136.40 ? 513 PRO A CD    1 
ATOM   4043  N N     . ALA A 1 514 ? -13.112 -57.563 190.482 1.00 137.62 ? 514 ALA A N     1 
ATOM   4044  C CA    . ALA A 1 514 ? -13.513 -58.063 189.172 1.00 136.51 ? 514 ALA A CA    1 
ATOM   4045  C C     . ALA A 1 514 ? -13.836 -56.919 188.214 1.00 139.03 ? 514 ALA A C     1 
ATOM   4046  O O     . ALA A 1 514 ? -13.454 -56.952 187.044 1.00 138.15 ? 514 ALA A O     1 
ATOM   4047  C CB    . ALA A 1 514 ? -14.696 -59.007 189.303 1.00 135.16 ? 514 ALA A CB    1 
ATOM   4048  N N     . GLN A 1 515 ? -14.535 -55.906 188.720 1.00 141.88 ? 515 GLN A N     1 
ATOM   4049  C CA    . GLN A 1 515 ? -14.870 -54.728 187.924 1.00 144.94 ? 515 GLN A CA    1 
ATOM   4050  C C     . GLN A 1 515 ? -13.873 -53.592 188.159 1.00 147.43 ? 515 GLN A C     1 
ATOM   4051  O O     . GLN A 1 515 ? -14.045 -52.486 187.645 1.00 148.50 ? 515 GLN A O     1 
ATOM   4052  C CB    . GLN A 1 515 ? -16.304 -54.268 188.211 1.00 143.43 ? 515 GLN A CB    1 
ATOM   4053  C CG    . GLN A 1 515 ? -16.578 -53.926 189.666 1.00 140.37 ? 515 GLN A CG    1 
ATOM   4054  C CD    . GLN A 1 515 ? -18.044 -54.076 190.039 1.00 141.76 ? 515 GLN A CD    1 
ATOM   4055  O OE1   . GLN A 1 515 ? -18.634 -55.143 189.864 1.00 141.59 ? 515 GLN A OE1   1 
ATOM   4056  N NE2   . GLN A 1 515 ? -18.637 -53.004 190.555 1.00 141.37 ? 515 GLN A NE2   1 
ATOM   4057  N N     . ARG A 1 516 ? -12.838 -53.880 188.946 1.00 146.56 ? 516 ARG A N     1 
ATOM   4058  C CA    . ARG A 1 516 ? -11.712 -52.967 189.158 1.00 142.66 ? 516 ARG A CA    1 
ATOM   4059  C C     . ARG A 1 516 ? -12.111 -51.561 189.625 1.00 140.72 ? 516 ARG A C     1 
ATOM   4060  O O     . ARG A 1 516 ? -11.594 -50.558 189.131 1.00 136.95 ? 516 ARG A O     1 
ATOM   4061  C CB    . ARG A 1 516 ? -10.840 -52.897 187.899 1.00 142.47 ? 516 ARG A CB    1 
ATOM   4062  C CG    . ARG A 1 516 ? -9.393  -52.521 188.167 1.00 140.21 ? 516 ARG A CG    1 
ATOM   4063  C CD    . ARG A 1 516 ? -8.443  -53.400 187.378 1.00 141.80 ? 516 ARG A CD    1 
ATOM   4064  N NE    . ARG A 1 516 ? -8.550  -53.170 185.942 1.00 146.21 ? 516 ARG A NE    1 
ATOM   4065  C CZ    . ARG A 1 516 ? -7.507  -52.986 185.140 1.00 149.31 ? 516 ARG A CZ    1 
ATOM   4066  N NH1   . ARG A 1 516 ? -6.278  -53.007 185.640 1.00 148.28 ? 516 ARG A NH1   1 
ATOM   4067  N NH2   . ARG A 1 516 ? -7.691  -52.784 183.842 1.00 150.87 ? 516 ARG A NH2   1 
ATOM   4068  N N     . ARG A 1 517 ? -13.034 -51.499 190.578 1.00 144.96 ? 517 ARG A N     1 
ATOM   4069  C CA    . ARG A 1 517 ? -13.422 -50.234 191.189 1.00 150.79 ? 517 ARG A CA    1 
ATOM   4070  C C     . ARG A 1 517 ? -13.299 -50.323 192.708 1.00 146.25 ? 517 ARG A C     1 
ATOM   4071  O O     . ARG A 1 517 ? -13.533 -51.379 193.293 1.00 141.99 ? 517 ARG A O     1 
ATOM   4072  C CB    . ARG A 1 517 ? -14.853 -49.855 190.788 1.00 162.57 ? 517 ARG A CB    1 
ATOM   4073  C CG    . ARG A 1 517 ? -15.375 -48.550 191.393 1.00 170.38 ? 517 ARG A CG    1 
ATOM   4074  C CD    . ARG A 1 517 ? -14.827 -47.314 190.681 1.00 174.95 ? 517 ARG A CD    1 
ATOM   4075  N NE    . ARG A 1 517 ? -13.413 -47.075 190.962 1.00 173.80 ? 517 ARG A NE    1 
ATOM   4076  C CZ    . ARG A 1 517 ? -12.700 -46.088 190.431 1.00 174.38 ? 517 ARG A CZ    1 
ATOM   4077  N NH1   . ARG A 1 517 ? -13.266 -45.237 189.585 1.00 176.41 ? 517 ARG A NH1   1 
ATOM   4078  N NH2   . ARG A 1 517 ? -11.419 -45.950 190.744 1.00 172.23 ? 517 ARG A NH2   1 
ATOM   4079  N N     . TYR A 1 518 ? -12.914 -49.216 193.337 1.00 146.94 ? 518 TYR A N     1 
ATOM   4080  C CA    . TYR A 1 518 ? -12.853 -49.139 194.791 1.00 143.68 ? 518 TYR A CA    1 
ATOM   4081  C C     . TYR A 1 518 ? -13.807 -48.060 195.288 1.00 144.21 ? 518 TYR A C     1 
ATOM   4082  O O     . TYR A 1 518 ? -14.136 -47.127 194.557 1.00 147.98 ? 518 TYR A O     1 
ATOM   4083  C CB    . TYR A 1 518 ? -11.432 -48.811 195.259 1.00 137.31 ? 518 TYR A CB    1 
ATOM   4084  C CG    . TYR A 1 518 ? -11.104 -47.338 195.175 1.00 132.08 ? 518 TYR A CG    1 
ATOM   4085  C CD1   . TYR A 1 518 ? -10.684 -46.770 193.980 1.00 132.02 ? 518 TYR A CD1   1 
ATOM   4086  C CD2   . TYR A 1 518 ? -11.225 -46.512 196.288 1.00 125.27 ? 518 TYR A CD2   1 
ATOM   4087  C CE1   . TYR A 1 518 ? -10.392 -45.425 193.895 1.00 127.96 ? 518 TYR A CE1   1 
ATOM   4088  C CE2   . TYR A 1 518 ? -10.938 -45.167 196.211 1.00 122.81 ? 518 TYR A CE2   1 
ATOM   4089  C CZ    . TYR A 1 518 ? -10.519 -44.630 195.013 1.00 125.83 ? 518 TYR A CZ    1 
ATOM   4090  O OH    . TYR A 1 518 ? -10.228 -43.289 194.928 1.00 130.93 ? 518 TYR A OH    1 
ATOM   4091  N N     . ARG A 1 519 ? -14.242 -48.200 196.535 1.00 139.46 ? 519 ARG A N     1 
ATOM   4092  C CA    . ARG A 1 519 ? -15.040 -47.196 197.223 1.00 140.86 ? 519 ARG A CA    1 
ATOM   4093  C C     . ARG A 1 519 ? -14.623 -47.303 198.680 1.00 135.50 ? 519 ARG A C     1 
ATOM   4094  O O     . ARG A 1 519 ? -14.541 -48.405 199.212 1.00 132.72 ? 519 ARG A O     1 
ATOM   4095  C CB    . ARG A 1 519 ? -16.539 -47.488 197.065 1.00 151.10 ? 519 ARG A CB    1 
ATOM   4096  C CG    . ARG A 1 519 ? -17.079 -47.251 195.648 1.00 163.12 ? 519 ARG A CG    1 
ATOM   4097  C CD    . ARG A 1 519 ? -18.176 -48.242 195.239 1.00 171.03 ? 519 ARG A CD    1 
ATOM   4098  N NE    . ARG A 1 519 ? -18.103 -48.572 193.812 1.00 173.34 ? 519 ARG A NE    1 
ATOM   4099  C CZ    . ARG A 1 519 ? -18.897 -49.444 193.194 1.00 170.02 ? 519 ARG A CZ    1 
ATOM   4100  N NH1   . ARG A 1 519 ? -19.842 -50.082 193.871 1.00 168.45 ? 519 ARG A NH1   1 
ATOM   4101  N NH2   . ARG A 1 519 ? -18.749 -49.679 191.896 1.00 167.05 ? 519 ARG A NH2   1 
ATOM   4102  N N     . MET A 1 520 ? -14.330 -46.179 199.324 1.00 133.09 ? 520 MET A N     1 
ATOM   4103  C CA    . MET A 1 520 ? -13.817 -46.233 200.691 1.00 124.05 ? 520 MET A CA    1 
ATOM   4104  C C     . MET A 1 520 ? -14.701 -45.497 201.700 1.00 117.34 ? 520 MET A C     1 
ATOM   4105  O O     . MET A 1 520 ? -15.210 -44.411 201.424 1.00 115.79 ? 520 MET A O     1 
ATOM   4106  C CB    . MET A 1 520 ? -12.365 -45.750 200.753 1.00 123.14 ? 520 MET A CB    1 
ATOM   4107  C CG    . MET A 1 520 ? -12.147 -44.278 200.463 1.00 126.98 ? 520 MET A CG    1 
ATOM   4108  S SD    . MET A 1 520 ? -10.444 -43.726 200.763 1.00 144.70 ? 520 MET A SD    1 
ATOM   4109  C CE    . MET A 1 520 ? -9.584  -44.409 199.337 1.00 95.66  ? 520 MET A CE    1 
ATOM   4110  N N     . VAL A 1 521 ? -14.875 -46.104 202.871 1.00 112.11 ? 521 VAL A N     1 
ATOM   4111  C CA    . VAL A 1 521 ? -15.878 -45.655 203.832 1.00 109.01 ? 521 VAL A CA    1 
ATOM   4112  C C     . VAL A 1 521 ? -15.339 -45.471 205.248 1.00 110.99 ? 521 VAL A C     1 
ATOM   4113  O O     . VAL A 1 521 ? -14.576 -46.296 205.745 1.00 110.10 ? 521 VAL A O     1 
ATOM   4114  C CB    . VAL A 1 521 ? -17.041 -46.666 203.923 1.00 108.54 ? 521 VAL A CB    1 
ATOM   4115  C CG1   . VAL A 1 521 ? -18.124 -46.151 204.853 1.00 107.90 ? 521 VAL A CG1   1 
ATOM   4116  C CG2   . VAL A 1 521 ? -17.613 -46.964 202.547 1.00 103.00 ? 521 VAL A CG2   1 
ATOM   4117  N N     . GLU A 1 522 ? -15.757 -44.387 205.893 1.00 116.53 ? 522 GLU A N     1 
ATOM   4118  C CA    . GLU A 1 522 ? -15.505 -44.174 207.312 1.00 119.03 ? 522 GLU A CA    1 
ATOM   4119  C C     . GLU A 1 522 ? -16.821 -44.312 208.065 1.00 120.58 ? 522 GLU A C     1 
ATOM   4120  O O     . GLU A 1 522 ? -17.769 -43.574 207.799 1.00 121.81 ? 522 GLU A O     1 
ATOM   4121  C CB    . GLU A 1 522 ? -14.923 -42.779 207.534 1.00 117.52 ? 522 GLU A CB    1 
ATOM   4122  C CG    . GLU A 1 522 ? -15.046 -42.262 208.954 1.00 115.03 ? 522 GLU A CG    1 
ATOM   4123  C CD    . GLU A 1 522 ? -14.061 -42.912 209.900 1.00 111.55 ? 522 GLU A CD    1 
ATOM   4124  O OE1   . GLU A 1 522 ? -12.963 -43.295 209.446 1.00 110.17 ? 522 GLU A OE1   1 
ATOM   4125  O OE2   . GLU A 1 522 ? -14.387 -43.040 211.099 1.00 109.57 ? 522 GLU A OE2   1 
ATOM   4126  N N     . VAL A 1 523 ? -16.888 -45.254 209.001 1.00 121.58 ? 523 VAL A N     1 
ATOM   4127  C CA    . VAL A 1 523 ? -18.139 -45.502 209.710 1.00 124.32 ? 523 VAL A CA    1 
ATOM   4128  C C     . VAL A 1 523 ? -18.182 -44.795 211.064 1.00 121.93 ? 523 VAL A C     1 
ATOM   4129  O O     . VAL A 1 523 ? -17.146 -44.519 211.670 1.00 115.26 ? 523 VAL A O     1 
ATOM   4130  C CB    . VAL A 1 523 ? -18.428 -47.016 209.866 1.00 124.09 ? 523 VAL A CB    1 
ATOM   4131  C CG1   . VAL A 1 523 ? -17.840 -47.785 208.693 1.00 123.16 ? 523 VAL A CG1   1 
ATOM   4132  C CG2   . VAL A 1 523 ? -17.876 -47.546 211.177 1.00 122.83 ? 523 VAL A CG2   1 
ATOM   4133  N N     . LYS A 1 524 ? -19.392 -44.482 211.517 1.00 127.39 ? 524 LYS A N     1 
ATOM   4134  C CA    . LYS A 1 524 ? -19.587 -43.815 212.797 1.00 127.52 ? 524 LYS A CA    1 
ATOM   4135  C C     . LYS A 1 524 ? -20.745 -44.459 213.552 1.00 131.76 ? 524 LYS A C     1 
ATOM   4136  O O     . LYS A 1 524 ? -21.866 -44.527 213.046 1.00 129.50 ? 524 LYS A O     1 
ATOM   4137  C CB    . LYS A 1 524 ? -19.867 -42.322 212.595 1.00 126.66 ? 524 LYS A CB    1 
ATOM   4138  C CG    . LYS A 1 524 ? -18.727 -41.535 211.959 1.00 126.54 ? 524 LYS A CG    1 
ATOM   4139  C CD    . LYS A 1 524 ? -17.490 -41.528 212.846 1.00 124.27 ? 524 LYS A CD    1 
ATOM   4140  C CE    . LYS A 1 524 ? -16.367 -40.710 212.226 1.00 116.71 ? 524 LYS A CE    1 
ATOM   4141  N NZ    . LYS A 1 524 ? -15.140 -40.706 213.067 1.00 111.99 ? 524 LYS A NZ    1 
ATOM   4142  N N     . GLY A 1 525 ? -20.470 -44.936 214.761 1.00 135.26 ? 525 GLY A N     1 
ATOM   4143  C CA    . GLY A 1 525 ? -21.509 -45.502 215.600 1.00 134.04 ? 525 GLY A CA    1 
ATOM   4144  C C     . GLY A 1 525 ? -22.376 -44.411 216.196 1.00 134.42 ? 525 GLY A C     1 
ATOM   4145  O O     . GLY A 1 525 ? -22.309 -43.258 215.770 1.00 134.10 ? 525 GLY A O     1 
ATOM   4146  N N     . PRO A 1 526 ? -23.199 -44.765 217.194 1.00 136.15 ? 526 PRO A N     1 
ATOM   4147  C CA    . PRO A 1 526 ? -24.059 -43.787 217.866 1.00 137.00 ? 526 PRO A CA    1 
ATOM   4148  C C     . PRO A 1 526 ? -23.277 -42.901 218.833 1.00 139.55 ? 526 PRO A C     1 
ATOM   4149  O O     . PRO A 1 526 ? -23.861 -42.005 219.444 1.00 143.94 ? 526 PRO A O     1 
ATOM   4150  C CB    . PRO A 1 526 ? -25.039 -44.669 218.642 1.00 137.42 ? 526 PRO A CB    1 
ATOM   4151  C CG    . PRO A 1 526 ? -24.266 -45.909 218.926 1.00 136.27 ? 526 PRO A CG    1 
ATOM   4152  C CD    . PRO A 1 526 ? -23.407 -46.130 217.709 1.00 136.60 ? 526 PRO A CD    1 
ATOM   4153  N N     . GLY A 1 527 ? -21.977 -43.147 218.967 1.00 138.64 ? 527 GLY A N     1 
ATOM   4154  C CA    . GLY A 1 527 ? -21.152 -42.374 219.878 1.00 138.25 ? 527 GLY A CA    1 
ATOM   4155  C C     . GLY A 1 527 ? -19.855 -41.842 219.291 1.00 140.18 ? 527 GLY A C     1 
ATOM   4156  O O     . GLY A 1 527 ? -18.803 -41.952 219.922 1.00 143.11 ? 527 GLY A O     1 
ATOM   4157  N N     . ASP A 1 528 ? -19.931 -41.265 218.092 1.00 137.88 ? 528 ASP A N     1 
ATOM   4158  C CA    . ASP A 1 528 ? -18.782 -40.612 217.456 1.00 135.15 ? 528 ASP A CA    1 
ATOM   4159  C C     . ASP A 1 528 ? -19.198 -39.849 216.200 1.00 131.92 ? 528 ASP A C     1 
ATOM   4160  O O     . ASP A 1 528 ? -20.066 -40.300 215.452 1.00 131.65 ? 528 ASP A O     1 
ATOM   4161  C CB    . ASP A 1 528 ? -17.696 -41.633 217.099 1.00 137.33 ? 528 ASP A CB    1 
ATOM   4162  C CG    . ASP A 1 528 ? -16.421 -40.980 216.591 1.00 137.26 ? 528 ASP A CG    1 
ATOM   4163  O OD1   . ASP A 1 528 ? -16.074 -39.879 217.071 1.00 134.51 ? 528 ASP A OD1   1 
ATOM   4164  O OD2   . ASP A 1 528 ? -15.761 -41.574 215.712 1.00 138.58 ? 528 ASP A OD2   1 
ATOM   4165  N N     . ARG A 1 529 ? -18.579 -38.693 215.976 1.00 129.65 ? 529 ARG A N     1 
ATOM   4166  C CA    . ARG A 1 529 ? -18.803 -37.930 214.752 1.00 129.44 ? 529 ARG A CA    1 
ATOM   4167  C C     . ARG A 1 529 ? -17.495 -37.776 213.984 1.00 133.05 ? 529 ARG A C     1 
ATOM   4168  O O     . ARG A 1 529 ? -16.436 -38.180 214.462 1.00 137.43 ? 529 ARG A O     1 
ATOM   4169  C CB    . ARG A 1 529 ? -19.403 -36.555 215.059 1.00 125.90 ? 529 ARG A CB    1 
ATOM   4170  C CG    . ARG A 1 529 ? -18.452 -35.597 215.759 1.00 123.50 ? 529 ARG A CG    1 
ATOM   4171  C CD    . ARG A 1 529 ? -19.064 -34.209 215.901 1.00 125.28 ? 529 ARG A CD    1 
ATOM   4172  N NE    . ARG A 1 529 ? -18.222 -33.322 216.698 1.00 124.23 ? 529 ARG A NE    1 
ATOM   4173  C CZ    . ARG A 1 529 ? -18.249 -33.268 218.026 1.00 125.69 ? 529 ARG A CZ    1 
ATOM   4174  N NH1   . ARG A 1 529 ? -19.075 -34.052 218.704 1.00 128.11 ? 529 ARG A NH1   1 
ATOM   4175  N NH2   . ARG A 1 529 ? -17.451 -32.433 218.677 1.00 126.12 ? 529 ARG A NH2   1 
ATOM   4176  N N     . LEU A 1 530 ? -17.574 -37.196 212.791 1.00 132.16 ? 530 LEU A N     1 
ATOM   4177  C CA    . LEU A 1 530 ? -16.392 -36.986 211.962 1.00 126.70 ? 530 LEU A CA    1 
ATOM   4178  C C     . LEU A 1 530 ? -15.412 -36.026 212.624 1.00 123.16 ? 530 LEU A C     1 
ATOM   4179  O O     . LEU A 1 530 ? -15.796 -34.945 213.069 1.00 125.28 ? 530 LEU A O     1 
ATOM   4180  C CB    . LEU A 1 530 ? -16.787 -36.445 210.587 1.00 128.82 ? 530 LEU A CB    1 
ATOM   4181  C CG    . LEU A 1 530 ? -17.409 -37.436 209.603 1.00 131.16 ? 530 LEU A CG    1 
ATOM   4182  C CD1   . LEU A 1 530 ? -17.827 -36.724 208.327 1.00 132.87 ? 530 LEU A CD1   1 
ATOM   4183  C CD2   . LEU A 1 530 ? -16.432 -38.558 209.294 1.00 128.59 ? 530 LEU A CD2   1 
ATOM   4184  N N     . GLN A 1 531 ? -14.147 -36.427 212.692 1.00 119.03 ? 531 GLN A N     1 
ATOM   4185  C CA    . GLN A 1 531 ? -13.107 -35.538 213.189 1.00 110.33 ? 531 GLN A CA    1 
ATOM   4186  C C     . GLN A 1 531 ? -12.802 -34.476 212.138 1.00 112.56 ? 531 GLN A C     1 
ATOM   4187  O O     . GLN A 1 531 ? -13.240 -34.582 210.993 1.00 112.52 ? 531 GLN A O     1 
ATOM   4188  C CB    . GLN A 1 531 ? -11.841 -36.320 213.548 1.00 104.23 ? 531 GLN A CB    1 
ATOM   4189  C CG    . GLN A 1 531 ? -11.978 -37.194 214.782 1.00 106.74 ? 531 GLN A CG    1 
ATOM   4190  C CD    . GLN A 1 531 ? -10.676 -37.874 215.157 1.00 108.69 ? 531 GLN A CD    1 
ATOM   4191  O OE1   . GLN A 1 531 ? -9.670  -37.739 214.458 1.00 105.62 ? 531 GLN A OE1   1 
ATOM   4192  N NE2   . GLN A 1 531 ? -10.686 -38.609 216.265 1.00 109.93 ? 531 GLN A NE2   1 
ATOM   4193  N N     . ASP A 1 532 ? -12.055 -33.451 212.534 1.00 118.37 ? 532 ASP A N     1 
ATOM   4194  C CA    . ASP A 1 532 ? -11.712 -32.355 211.633 1.00 125.58 ? 532 ASP A CA    1 
ATOM   4195  C C     . ASP A 1 532 ? -10.895 -32.817 210.429 1.00 121.04 ? 532 ASP A C     1 
ATOM   4196  O O     . ASP A 1 532 ? -11.239 -32.519 209.284 1.00 118.61 ? 532 ASP A O     1 
ATOM   4197  C CB    . ASP A 1 532 ? -10.950 -31.265 212.388 1.00 136.46 ? 532 ASP A CB    1 
ATOM   4198  C CG    . ASP A 1 532 ? -11.861 -30.386 213.217 1.00 143.01 ? 532 ASP A CG    1 
ATOM   4199  O OD1   . ASP A 1 532 ? -12.388 -29.399 212.665 1.00 143.30 ? 532 ASP A OD1   1 
ATOM   4200  O OD2   . ASP A 1 532 ? -12.046 -30.679 214.417 1.00 145.38 ? 532 ASP A OD2   1 
ATOM   4201  N N     . ASN A 1 533 ? -9.812  -33.540 210.696 1.00 116.27 ? 533 ASN A N     1 
ATOM   4202  C CA    . ASN A 1 533 ? -8.929  -34.020 209.639 1.00 114.60 ? 533 ASN A CA    1 
ATOM   4203  C C     . ASN A 1 533 ? -9.606  -35.038 208.725 1.00 115.55 ? 533 ASN A C     1 
ATOM   4204  O O     . ASN A 1 533 ? -9.338  -35.079 207.523 1.00 118.88 ? 533 ASN A O     1 
ATOM   4205  C CB    . ASN A 1 533 ? -7.648  -34.607 210.235 1.00 114.87 ? 533 ASN A CB    1 
ATOM   4206  C CG    . ASN A 1 533 ? -7.925  -35.711 211.234 1.00 117.03 ? 533 ASN A CG    1 
ATOM   4207  O OD1   . ASN A 1 533 ? -9.007  -35.778 211.816 1.00 117.35 ? 533 ASN A OD1   1 
ATOM   4208  N ND2   . ASN A 1 533 ? -6.944  -36.582 211.443 1.00 118.01 ? 533 ASN A ND2   1 
ATOM   4209  N N     . GLN A 1 534 ? -10.482 -35.857 209.303 1.00 111.79 ? 534 GLN A N     1 
ATOM   4210  C CA    . GLN A 1 534 ? -11.240 -36.839 208.535 1.00 110.58 ? 534 GLN A CA    1 
ATOM   4211  C C     . GLN A 1 534 ? -12.184 -36.135 207.572 1.00 113.57 ? 534 GLN A C     1 
ATOM   4212  O O     . GLN A 1 534 ? -12.425 -36.603 206.460 1.00 113.14 ? 534 GLN A O     1 
ATOM   4213  C CB    . GLN A 1 534 ? -12.023 -37.761 209.471 1.00 108.83 ? 534 GLN A CB    1 
ATOM   4214  C CG    . GLN A 1 534 ? -11.146 -38.716 210.262 1.00 111.52 ? 534 GLN A CG    1 
ATOM   4215  C CD    . GLN A 1 534 ? -11.932 -39.561 211.246 1.00 111.69 ? 534 GLN A CD    1 
ATOM   4216  O OE1   . GLN A 1 534 ? -13.058 -39.224 211.613 1.00 109.53 ? 534 GLN A OE1   1 
ATOM   4217  N NE2   . GLN A 1 534 ? -11.339 -40.670 211.679 1.00 110.61 ? 534 GLN A NE2   1 
ATOM   4218  N N     . LEU A 1 535 ? -12.710 -34.999 208.014 1.00 115.84 ? 535 LEU A N     1 
ATOM   4219  C CA    . LEU A 1 535 ? -13.586 -34.178 207.195 1.00 114.78 ? 535 LEU A CA    1 
ATOM   4220  C C     . LEU A 1 535 ? -12.786 -33.545 206.063 1.00 111.68 ? 535 LEU A C     1 
ATOM   4221  O O     . LEU A 1 535 ? -13.252 -33.464 204.927 1.00 112.34 ? 535 LEU A O     1 
ATOM   4222  C CB    . LEU A 1 535 ? -14.243 -33.102 208.061 1.00 114.03 ? 535 LEU A CB    1 
ATOM   4223  C CG    . LEU A 1 535 ? -15.772 -33.076 208.084 1.00 116.05 ? 535 LEU A CG    1 
ATOM   4224  C CD1   . LEU A 1 535 ? -16.284 -32.553 209.422 1.00 116.02 ? 535 LEU A CD1   1 
ATOM   4225  C CD2   . LEU A 1 535 ? -16.301 -32.229 206.934 1.00 115.69 ? 535 LEU A CD2   1 
ATOM   4226  N N     . ARG A 1 536 ? -11.569 -33.117 206.380 1.00 110.51 ? 536 ARG A N     1 
ATOM   4227  C CA    . ARG A 1 536 ? -10.685 -32.499 205.397 1.00 111.41 ? 536 ARG A CA    1 
ATOM   4228  C C     . ARG A 1 536 ? -10.339 -33.417 204.226 1.00 114.00 ? 536 ARG A C     1 
ATOM   4229  O O     . ARG A 1 536 ? -10.077 -32.947 203.119 1.00 113.79 ? 536 ARG A O     1 
ATOM   4230  C CB    . ARG A 1 536 ? -9.405  -32.001 206.070 1.00 108.82 ? 536 ARG A CB    1 
ATOM   4231  C CG    . ARG A 1 536 ? -9.621  -30.755 206.901 1.00 107.99 ? 536 ARG A CG    1 
ATOM   4232  C CD    . ARG A 1 536 ? -8.318  -30.041 207.202 1.00 107.69 ? 536 ARG A CD    1 
ATOM   4233  N NE    . ARG A 1 536 ? -7.851  -30.317 208.555 1.00 104.05 ? 536 ARG A NE    1 
ATOM   4234  C CZ    . ARG A 1 536 ? -6.807  -31.084 208.847 1.00 99.58  ? 536 ARG A CZ    1 
ATOM   4235  N NH1   . ARG A 1 536 ? -6.105  -31.651 207.876 1.00 102.67 ? 536 ARG A NH1   1 
ATOM   4236  N NH2   . ARG A 1 536 ? -6.462  -31.275 210.112 1.00 93.83  ? 536 ARG A NH2   1 
ATOM   4237  N N     . TRP A 1 537 ? -10.344 -34.724 204.468 1.00 117.51 ? 537 TRP A N     1 
ATOM   4238  C CA    . TRP A 1 537 ? -9.947  -35.677 203.439 1.00 120.68 ? 537 TRP A CA    1 
ATOM   4239  C C     . TRP A 1 537 ? -11.133 -36.134 202.597 1.00 120.86 ? 537 TRP A C     1 
ATOM   4240  O O     . TRP A 1 537 ? -10.989 -36.431 201.411 1.00 119.79 ? 537 TRP A O     1 
ATOM   4241  C CB    . TRP A 1 537 ? -9.237  -36.880 204.057 1.00 122.89 ? 537 TRP A CB    1 
ATOM   4242  C CG    . TRP A 1 537 ? -8.035  -37.289 203.278 1.00 126.36 ? 537 TRP A CG    1 
ATOM   4243  C CD1   . TRP A 1 537 ? -8.011  -37.774 202.002 1.00 133.15 ? 537 TRP A CD1   1 
ATOM   4244  C CD2   . TRP A 1 537 ? -6.673  -37.244 203.716 1.00 120.78 ? 537 TRP A CD2   1 
ATOM   4245  N NE1   . TRP A 1 537 ? -6.719  -38.036 201.619 1.00 132.06 ? 537 TRP A NE1   1 
ATOM   4246  C CE2   . TRP A 1 537 ? -5.878  -37.720 202.652 1.00 123.61 ? 537 TRP A CE2   1 
ATOM   4247  C CE3   . TRP A 1 537 ? -6.048  -36.850 204.903 1.00 118.56 ? 537 TRP A CE3   1 
ATOM   4248  C CZ2   . TRP A 1 537 ? -4.494  -37.811 202.740 1.00 121.71 ? 537 TRP A CZ2   1 
ATOM   4249  C CZ3   . TRP A 1 537 ? -4.674  -36.943 204.988 1.00 122.01 ? 537 TRP A CZ3   1 
ATOM   4250  C CH2   . TRP A 1 537 ? -3.912  -37.419 203.911 1.00 123.14 ? 537 TRP A CH2   1 
ATOM   4251  N N     . LEU A 1 538 ? -12.303 -36.193 203.222 1.00 120.40 ? 538 LEU A N     1 
ATOM   4252  C CA    . LEU A 1 538 ? -13.537 -36.478 202.506 1.00 123.89 ? 538 LEU A CA    1 
ATOM   4253  C C     . LEU A 1 538 ? -13.842 -35.341 201.535 1.00 133.08 ? 538 LEU A C     1 
ATOM   4254  O O     . LEU A 1 538 ? -14.304 -35.576 200.417 1.00 135.99 ? 538 LEU A O     1 
ATOM   4255  C CB    . LEU A 1 538 ? -14.688 -36.666 203.493 1.00 118.71 ? 538 LEU A CB    1 
ATOM   4256  C CG    . LEU A 1 538 ? -14.538 -37.860 204.437 1.00 111.53 ? 538 LEU A CG    1 
ATOM   4257  C CD1   . LEU A 1 538 ? -15.525 -37.783 205.592 1.00 108.06 ? 538 LEU A CD1   1 
ATOM   4258  C CD2   . LEU A 1 538 ? -14.705 -39.162 203.669 1.00 110.75 ? 538 LEU A CD2   1 
ATOM   4259  N N     . GLN A 1 539 ? -13.579 -34.110 201.975 1.00 135.60 ? 539 GLN A N     1 
ATOM   4260  C CA    . GLN A 1 539 ? -13.715 -32.931 201.123 1.00 136.72 ? 539 GLN A CA    1 
ATOM   4261  C C     . GLN A 1 539 ? -12.703 -33.003 199.984 1.00 133.16 ? 539 GLN A C     1 
ATOM   4262  O O     . GLN A 1 539 ? -12.999 -32.623 198.851 1.00 138.85 ? 539 GLN A O     1 
ATOM   4263  C CB    . GLN A 1 539 ? -13.491 -31.640 201.925 1.00 142.06 ? 539 GLN A CB    1 
ATOM   4264  C CG    . GLN A 1 539 ? -14.540 -31.335 202.997 1.00 148.79 ? 539 GLN A CG    1 
ATOM   4265  C CD    . GLN A 1 539 ? -14.251 -30.038 203.749 1.00 152.21 ? 539 GLN A CD    1 
ATOM   4266  O OE1   . GLN A 1 539 ? -13.687 -29.095 203.191 1.00 155.28 ? 539 GLN A OE1   1 
ATOM   4267  N NE2   . GLN A 1 539 ? -14.633 -29.991 205.023 1.00 149.13 ? 539 GLN A NE2   1 
ATOM   4268  N N     . PHE A 1 540 ? -11.508 -33.494 200.299 1.00 124.38 ? 540 PHE A N     1 
ATOM   4269  C CA    . PHE A 1 540 ? -10.434 -33.623 199.320 1.00 121.18 ? 540 PHE A CA    1 
ATOM   4270  C C     . PHE A 1 540 ? -10.812 -34.599 198.212 1.00 125.54 ? 540 PHE A C     1 
ATOM   4271  O O     . PHE A 1 540 ? -10.804 -34.248 197.032 1.00 125.42 ? 540 PHE A O     1 
ATOM   4272  C CB    . PHE A 1 540 ? -9.142  -34.086 200.002 1.00 112.26 ? 540 PHE A CB    1 
ATOM   4273  C CG    . PHE A 1 540 ? -7.970  -34.210 199.066 1.00 107.38 ? 540 PHE A CG    1 
ATOM   4274  C CD1   . PHE A 1 540 ? -7.171  -33.114 198.787 1.00 105.56 ? 540 PHE A CD1   1 
ATOM   4275  C CD2   . PHE A 1 540 ? -7.666  -35.424 198.468 1.00 104.94 ? 540 PHE A CD2   1 
ATOM   4276  C CE1   . PHE A 1 540 ? -6.093  -33.224 197.928 1.00 103.50 ? 540 PHE A CE1   1 
ATOM   4277  C CE2   . PHE A 1 540 ? -6.590  -35.539 197.606 1.00 101.92 ? 540 PHE A CE2   1 
ATOM   4278  C CZ    . PHE A 1 540 ? -5.804  -34.438 197.337 1.00 100.98 ? 540 PHE A CZ    1 
ATOM   4279  N N     . CYS A 1 541 ? -11.138 -35.825 198.605 1.00 129.57 ? 541 CYS A N     1 
ATOM   4280  C CA    . CYS A 1 541 ? -11.470 -36.880 197.656 1.00 133.45 ? 541 CYS A CA    1 
ATOM   4281  C C     . CYS A 1 541 ? -12.729 -36.552 196.859 1.00 135.47 ? 541 CYS A C     1 
ATOM   4282  O O     . CYS A 1 541 ? -12.856 -36.939 195.697 1.00 140.20 ? 541 CYS A O     1 
ATOM   4283  C CB    . CYS A 1 541 ? -11.634 -38.214 198.385 1.00 135.37 ? 541 CYS A CB    1 
ATOM   4284  S SG    . CYS A 1 541 ? -10.123 -38.833 199.167 1.00 118.20 ? 541 CYS A SG    1 
ATOM   4285  N N     . ARG A 1 542 ? -13.655 -35.837 197.491 1.00 133.37 ? 542 ARG A N     1 
ATOM   4286  C CA    . ARG A 1 542 ? -14.882 -35.401 196.832 1.00 136.28 ? 542 ARG A CA    1 
ATOM   4287  C C     . ARG A 1 542 ? -14.575 -34.491 195.649 1.00 135.91 ? 542 ARG A C     1 
ATOM   4288  O O     . ARG A 1 542 ? -15.129 -34.659 194.562 1.00 136.04 ? 542 ARG A O     1 
ATOM   4289  C CB    . ARG A 1 542 ? -15.780 -34.664 197.829 1.00 136.98 ? 542 ARG A CB    1 
ATOM   4290  C CG    . ARG A 1 542 ? -16.906 -33.855 197.203 1.00 140.24 ? 542 ARG A CG    1 
ATOM   4291  C CD    . ARG A 1 542 ? -18.097 -34.724 196.837 1.00 144.36 ? 542 ARG A CD    1 
ATOM   4292  N NE    . ARG A 1 542 ? -19.254 -33.919 196.454 1.00 147.88 ? 542 ARG A NE    1 
ATOM   4293  C CZ    . ARG A 1 542 ? -19.575 -33.615 195.200 1.00 150.97 ? 542 ARG A CZ    1 
ATOM   4294  N NH1   . ARG A 1 542 ? -18.829 -34.054 194.196 1.00 151.78 ? 542 ARG A NH1   1 
ATOM   4295  N NH2   . ARG A 1 542 ? -20.646 -32.874 194.951 1.00 153.26 ? 542 ARG A NH2   1 
ATOM   4296  N N     . GLU A 1 543 ? -13.683 -33.532 195.872 1.00 136.51 ? 543 GLU A N     1 
ATOM   4297  C CA    . GLU A 1 543 ? -13.329 -32.548 194.855 1.00 138.29 ? 543 GLU A CA    1 
ATOM   4298  C C     . GLU A 1 543 ? -12.592 -33.173 193.670 1.00 136.05 ? 543 GLU A C     1 
ATOM   4299  O O     . GLU A 1 543 ? -12.541 -32.590 192.588 1.00 138.08 ? 543 GLU A O     1 
ATOM   4300  C CB    . GLU A 1 543 ? -12.496 -31.416 195.470 1.00 138.06 ? 543 GLU A CB    1 
ATOM   4301  C CG    . GLU A 1 543 ? -13.267 -30.526 196.442 1.00 137.00 ? 543 GLU A CG    1 
ATOM   4302  C CD    . GLU A 1 543 ? -12.369 -29.560 197.201 1.00 135.64 ? 543 GLU A CD    1 
ATOM   4303  O OE1   . GLU A 1 543 ? -11.166 -29.860 197.357 1.00 134.18 ? 543 GLU A OE1   1 
ATOM   4304  O OE2   . GLU A 1 543 ? -12.867 -28.501 197.641 1.00 134.98 ? 543 GLU A OE2   1 
ATOM   4305  N N     . ARG A 1 544 ? -12.024 -34.358 193.875 1.00 131.89 ? 544 ARG A N     1 
ATOM   4306  C CA    . ARG A 1 544 ? -11.311 -35.053 192.806 1.00 131.90 ? 544 ARG A CA    1 
ATOM   4307  C C     . ARG A 1 544 ? -12.040 -36.316 192.361 1.00 132.35 ? 544 ARG A C     1 
ATOM   4308  O O     . ARG A 1 544 ? -11.430 -37.240 191.817 1.00 129.73 ? 544 ARG A O     1 
ATOM   4309  C CB    . ARG A 1 544 ? -9.873  -35.363 193.224 1.00 128.77 ? 544 ARG A CB    1 
ATOM   4310  C CG    . ARG A 1 544 ? -8.963  -34.150 193.139 1.00 130.14 ? 544 ARG A CG    1 
ATOM   4311  C CD    . ARG A 1 544 ? -7.786  -34.250 194.088 1.00 129.69 ? 544 ARG A CD    1 
ATOM   4312  N NE    . ARG A 1 544 ? -7.200  -32.938 194.342 1.00 130.12 ? 544 ARG A NE    1 
ATOM   4313  C CZ    . ARG A 1 544 ? -7.674  -32.074 195.234 1.00 130.13 ? 544 ARG A CZ    1 
ATOM   4314  N NH1   . ARG A 1 544 ? -8.742  -32.385 195.957 1.00 129.93 ? 544 ARG A NH1   1 
ATOM   4315  N NH2   . ARG A 1 544 ? -7.083  -30.899 195.404 1.00 129.87 ? 544 ARG A NH2   1 
ATOM   4316  N N     . GLU A 1 545 ? -13.349 -36.332 192.598 1.00 134.36 ? 545 GLU A N     1 
ATOM   4317  C CA    . GLU A 1 545 ? -14.230 -37.411 192.156 1.00 136.98 ? 545 GLU A CA    1 
ATOM   4318  C C     . GLU A 1 545 ? -13.751 -38.788 192.606 1.00 135.61 ? 545 GLU A C     1 
ATOM   4319  O O     . GLU A 1 545 ? -13.774 -39.748 191.834 1.00 136.29 ? 545 GLU A O     1 
ATOM   4320  C CB    . GLU A 1 545 ? -14.400 -37.372 190.636 1.00 141.77 ? 545 GLU A CB    1 
ATOM   4321  C CG    . GLU A 1 545 ? -14.912 -36.041 190.111 1.00 145.43 ? 545 GLU A CG    1 
ATOM   4322  C CD    . GLU A 1 545 ? -14.945 -35.994 188.599 1.00 150.25 ? 545 GLU A CD    1 
ATOM   4323  O OE1   . GLU A 1 545 ? -14.671 -37.037 187.970 1.00 150.01 ? 545 GLU A OE1   1 
ATOM   4324  O OE2   . GLU A 1 545 ? -15.242 -34.918 188.040 1.00 154.20 ? 545 GLU A OE2   1 
ATOM   4325  N N     . MET A 1 546 ? -13.316 -38.871 193.859 1.00 132.83 ? 546 MET A N     1 
ATOM   4326  C CA    . MET A 1 546 ? -12.856 -40.127 194.436 1.00 125.70 ? 546 MET A CA    1 
ATOM   4327  C C     . MET A 1 546 ? -13.954 -40.759 195.287 1.00 125.03 ? 546 MET A C     1 
ATOM   4328  O O     . MET A 1 546 ? -14.560 -40.088 196.124 1.00 125.28 ? 546 MET A O     1 
ATOM   4329  C CB    . MET A 1 546 ? -11.599 -39.902 195.276 1.00 117.22 ? 546 MET A CB    1 
ATOM   4330  C CG    . MET A 1 546 ? -10.403 -39.407 194.482 1.00 113.95 ? 546 MET A CG    1 
ATOM   4331  S SD    . MET A 1 546 ? -8.977  -39.043 195.520 1.00 178.10 ? 546 MET A SD    1 
ATOM   4332  C CE    . MET A 1 546 ? -7.745  -38.683 194.271 1.00 116.15 ? 546 MET A CE    1 
ATOM   4333  N N     . PRO A 1 547 ? -14.213 -42.057 195.069 1.00 121.98 ? 547 PRO A N     1 
ATOM   4334  C CA    . PRO A 1 547 ? -15.298 -42.789 195.732 1.00 120.10 ? 547 PRO A CA    1 
ATOM   4335  C C     . PRO A 1 547 ? -15.130 -42.869 197.245 1.00 117.38 ? 547 PRO A C     1 
ATOM   4336  O O     . PRO A 1 547 ? -14.513 -43.807 197.748 1.00 115.64 ? 547 PRO A O     1 
ATOM   4337  C CB    . PRO A 1 547 ? -15.192 -44.192 195.129 1.00 121.02 ? 547 PRO A CB    1 
ATOM   4338  C CG    . PRO A 1 547 ? -14.477 -44.004 193.839 1.00 123.85 ? 547 PRO A CG    1 
ATOM   4339  C CD    . PRO A 1 547 ? -13.503 -42.899 194.092 1.00 121.60 ? 547 PRO A CD    1 
ATOM   4340  N N     . VAL A 1 548 ? -15.675 -41.891 197.960 1.00 117.18 ? 548 VAL A N     1 
ATOM   4341  C CA    . VAL A 1 548 ? -15.680 -41.934 199.415 1.00 113.81 ? 548 VAL A CA    1 
ATOM   4342  C C     . VAL A 1 548 ? -17.093 -41.745 199.945 1.00 116.15 ? 548 VAL A C     1 
ATOM   4343  O O     . VAL A 1 548 ? -17.953 -41.184 199.263 1.00 118.19 ? 548 VAL A O     1 
ATOM   4344  C CB    . VAL A 1 548 ? -14.753 -40.868 200.030 1.00 108.58 ? 548 VAL A CB    1 
ATOM   4345  C CG1   . VAL A 1 548 ? -13.319 -41.117 199.614 1.00 110.54 ? 548 VAL A CG1   1 
ATOM   4346  C CG2   . VAL A 1 548 ? -15.194 -39.475 199.619 1.00 105.41 ? 548 VAL A CG2   1 
ATOM   4347  N N     . ALA A 1 549 ? -17.331 -42.222 201.161 1.00 114.81 ? 549 ALA A N     1 
ATOM   4348  C CA    . ALA A 1 549 ? -18.639 -42.084 201.786 1.00 118.11 ? 549 ALA A CA    1 
ATOM   4349  C C     . ALA A 1 549 ? -18.563 -42.280 203.294 1.00 121.60 ? 549 ALA A C     1 
ATOM   4350  O O     . ALA A 1 549 ? -17.730 -43.038 203.792 1.00 119.68 ? 549 ALA A O     1 
ATOM   4351  C CB    . ALA A 1 549 ? -19.630 -43.064 201.171 1.00 116.01 ? 549 ALA A CB    1 
ATOM   4352  N N     . VAL A 1 550 ? -19.434 -41.585 204.018 1.00 123.07 ? 550 VAL A N     1 
ATOM   4353  C CA    . VAL A 1 550 ? -19.522 -41.747 205.464 1.00 116.90 ? 550 VAL A CA    1 
ATOM   4354  C C     . VAL A 1 550 ? -20.697 -42.631 205.833 1.00 120.64 ? 550 VAL A C     1 
ATOM   4355  O O     . VAL A 1 550 ? -21.840 -42.347 205.469 1.00 119.90 ? 550 VAL A O     1 
ATOM   4356  C CB    . VAL A 1 550 ? -19.717 -40.414 206.186 1.00 108.75 ? 550 VAL A CB    1 
ATOM   4357  C CG1   . VAL A 1 550 ? -19.570 -40.615 207.688 1.00 102.59 ? 550 VAL A CG1   1 
ATOM   4358  C CG2   . VAL A 1 550 ? -18.726 -39.394 205.683 1.00 108.65 ? 550 VAL A CG2   1 
ATOM   4359  N N     . CYS A 1 551 ? -20.411 -43.695 206.573 1.00 124.86 ? 551 CYS A N     1 
ATOM   4360  C CA    . CYS A 1 551 ? -21.449 -44.614 207.006 1.00 128.13 ? 551 CYS A CA    1 
ATOM   4361  C C     . CYS A 1 551 ? -21.920 -44.308 208.419 1.00 134.54 ? 551 CYS A C     1 
ATOM   4362  O O     . CYS A 1 551 ? -21.156 -44.416 209.377 1.00 133.80 ? 551 CYS A O     1 
ATOM   4363  C CB    . CYS A 1 551 ? -20.961 -46.057 206.930 1.00 125.11 ? 551 CYS A CB    1 
ATOM   4364  S SG    . CYS A 1 551 ? -22.154 -47.252 207.561 1.00 133.09 ? 551 CYS A SG    1 
ATOM   4365  N N     . TYR A 1 552 ? -23.186 -43.930 208.542 1.00 141.50 ? 552 TYR A N     1 
ATOM   4366  C CA    . TYR A 1 552 ? -23.766 -43.658 209.847 1.00 147.50 ? 552 TYR A CA    1 
ATOM   4367  C C     . TYR A 1 552 ? -24.605 -44.840 210.312 1.00 162.36 ? 552 TYR A C     1 
ATOM   4368  O O     . TYR A 1 552 ? -25.497 -45.304 209.602 1.00 162.27 ? 552 TYR A O     1 
ATOM   4369  C CB    . TYR A 1 552 ? -24.592 -42.373 209.812 1.00 143.16 ? 552 TYR A CB    1 
ATOM   4370  C CG    . TYR A 1 552 ? -23.755 -41.131 209.601 1.00 137.47 ? 552 TYR A CG    1 
ATOM   4371  C CD1   . TYR A 1 552 ? -23.033 -40.574 210.648 1.00 133.72 ? 552 TYR A CD1   1 
ATOM   4372  C CD2   . TYR A 1 552 ? -23.684 -40.518 208.357 1.00 135.54 ? 552 TYR A CD2   1 
ATOM   4373  C CE1   . TYR A 1 552 ? -22.264 -39.441 210.463 1.00 132.13 ? 552 TYR A CE1   1 
ATOM   4374  C CE2   . TYR A 1 552 ? -22.919 -39.382 208.163 1.00 132.72 ? 552 TYR A CE2   1 
ATOM   4375  C CZ    . TYR A 1 552 ? -22.211 -38.849 209.219 1.00 132.47 ? 552 TYR A CZ    1 
ATOM   4376  O OH    . TYR A 1 552 ? -21.445 -37.719 209.034 1.00 132.48 ? 552 TYR A OH    1 
ATOM   4377  N N     . VAL A 1 553 ? -24.303 -45.325 211.510 1.00 178.19 ? 553 VAL A N     1 
ATOM   4378  C CA    . VAL A 1 553 ? -24.944 -46.518 212.044 1.00 91.63  ? 553 VAL A CA    1 
ATOM   4379  C C     . VAL A 1 553 ? -25.825 -46.195 213.248 1.00 102.83 ? 553 VAL A C     1 
ATOM   4380  O O     . VAL A 1 553 ? -25.443 -45.414 214.121 1.00 111.78 ? 553 VAL A O     1 
ATOM   4381  C CB    . VAL A 1 553 ? -23.893 -47.573 212.440 1.00 104.02 ? 553 VAL A CB    1 
ATOM   4382  C CG1   . VAL A 1 553 ? -24.453 -48.530 213.476 1.00 104.86 ? 553 VAL A CG1   1 
ATOM   4383  C CG2   . VAL A 1 553 ? -23.395 -48.322 211.209 1.00 109.48 ? 553 VAL A CG2   1 
ATOM   4384  P P     . DA  B 2 1   ? 7.031   -41.100 214.816 1.00 214.09 ? -2  DA  B P     1 
ATOM   4385  O OP1   . DA  B 2 1   ? 7.630   -40.655 216.097 1.00 216.53 ? -2  DA  B OP1   1 
ATOM   4386  O OP2   . DA  B 2 1   ? 5.618   -41.538 214.784 1.00 209.45 ? -2  DA  B OP2   1 
ATOM   4387  O "O5'" . DA  B 2 1   ? 7.207   -39.964 213.700 1.00 177.69 ? -2  DA  B "O5'" 1 
ATOM   4388  C "C5'" . DA  B 2 1   ? 8.451   -39.786 213.028 1.00 179.98 ? -2  DA  B "C5'" 1 
ATOM   4389  C "C4'" . DA  B 2 1   ? 9.472   -39.208 213.990 1.00 187.14 ? -2  DA  B "C4'" 1 
ATOM   4390  O "O4'" . DA  B 2 1   ? 10.326  -40.270 214.499 1.00 189.83 ? -2  DA  B "O4'" 1 
ATOM   4391  C "C3'" . DA  B 2 1   ? 10.421  -38.151 213.430 1.00 193.94 ? -2  DA  B "C3'" 1 
ATOM   4392  O "O3'" . DA  B 2 1   ? 10.629  -37.178 214.447 1.00 199.60 ? -2  DA  B "O3'" 1 
ATOM   4393  C "C2'" . DA  B 2 1   ? 11.692  -38.962 213.203 1.00 196.23 ? -2  DA  B "C2'" 1 
ATOM   4394  C "C1'" . DA  B 2 1   ? 11.640  -39.753 214.502 1.00 196.35 ? -2  DA  B "C1'" 1 
ATOM   4395  N N9    . DA  B 2 1   ? 12.622  -40.826 214.652 1.00 197.15 ? -2  DA  B N9    1 
ATOM   4396  C C8    . DA  B 2 1   ? 12.392  -42.173 214.623 1.00 193.68 ? -2  DA  B C8    1 
ATOM   4397  N N7    . DA  B 2 1   ? 13.473  -42.897 214.798 1.00 193.68 ? -2  DA  B N7    1 
ATOM   4398  C C5    . DA  B 2 1   ? 14.480  -41.960 214.956 1.00 198.49 ? -2  DA  B C5    1 
ATOM   4399  C C6    . DA  B 2 1   ? 15.866  -42.083 215.179 1.00 205.17 ? -2  DA  B C6    1 
ATOM   4400  N N6    . DA  B 2 1   ? 16.494  -43.257 215.284 1.00 207.82 ? -2  DA  B N6    1 
ATOM   4401  N N1    . DA  B 2 1   ? 16.588  -40.949 215.292 1.00 209.60 ? -2  DA  B N1    1 
ATOM   4402  C C2    . DA  B 2 1   ? 15.959  -39.774 215.186 1.00 209.77 ? -2  DA  B C2    1 
ATOM   4403  N N3    . DA  B 2 1   ? 14.665  -39.532 214.980 1.00 205.60 ? -2  DA  B N3    1 
ATOM   4404  C C4    . DA  B 2 1   ? 13.973  -40.678 214.872 1.00 200.14 ? -2  DA  B C4    1 
ATOM   4405  P P     . DC  B 2 2   ? 10.920  -35.642 214.074 1.00 282.41 ? -1  DC  B P     1 
ATOM   4406  O OP1   . DC  B 2 2   ? 9.669   -34.888 214.296 1.00 280.69 ? -1  DC  B OP1   1 
ATOM   4407  O OP2   . DC  B 2 2   ? 11.585  -35.598 212.752 1.00 283.33 ? -1  DC  B OP2   1 
ATOM   4408  O "O5'" . DC  B 2 2   ? 11.975  -35.173 215.183 1.00 219.46 ? -1  DC  B "O5'" 1 
ATOM   4409  C "C5'" . DC  B 2 2   ? 11.530  -34.691 216.455 1.00 222.23 ? -1  DC  B "C5'" 1 
ATOM   4410  C "C4'" . DC  B 2 2   ? 11.181  -35.811 217.425 1.00 221.62 ? -1  DC  B "C4'" 1 
ATOM   4411  O "O4'" . DC  B 2 2   ? 12.138  -36.891 217.311 1.00 221.96 ? -1  DC  B "O4'" 1 
ATOM   4412  C "C3'" . DC  B 2 2   ? 11.181  -35.400 218.897 1.00 226.19 ? -1  DC  B "C3'" 1 
ATOM   4413  O "O3'" . DC  B 2 2   ? 10.198  -36.121 219.665 1.00 222.51 ? -1  DC  B "O3'" 1 
ATOM   4414  C "C2'" . DC  B 2 2   ? 12.608  -35.740 219.337 1.00 231.03 ? -1  DC  B "C2'" 1 
ATOM   4415  C "C1'" . DC  B 2 2   ? 13.070  -36.835 218.372 1.00 228.23 ? -1  DC  B "C1'" 1 
ATOM   4416  N N1    . DC  B 2 2   ? 14.429  -36.607 217.775 1.00 234.90 ? -1  DC  B N1    1 
ATOM   4417  C C2    . DC  B 2 2   ? 15.363  -37.650 217.725 1.00 235.60 ? -1  DC  B C2    1 
ATOM   4418  O O2    . DC  B 2 2   ? 15.056  -38.758 218.178 1.00 234.38 ? -1  DC  B O2    1 
ATOM   4419  N N3    . DC  B 2 2   ? 16.583  -37.417 217.178 1.00 238.13 ? -1  DC  B N3    1 
ATOM   4420  C C4    . DC  B 2 2   ? 16.880  -36.211 216.695 1.00 242.66 ? -1  DC  B C4    1 
ATOM   4421  N N4    . DC  B 2 2   ? 18.092  -36.026 216.166 1.00 248.22 ? -1  DC  B N4    1 
ATOM   4422  C C5    . DC  B 2 2   ? 15.947  -35.136 216.735 1.00 243.31 ? -1  DC  B C5    1 
ATOM   4423  C C6    . DC  B 2 2   ? 14.751  -35.378 217.278 1.00 239.53 ? -1  DC  B C6    1 
ATOM   4424  P P     . DC  B 2 3   ? 8.635   -35.735 219.588 1.00 223.91 ? 0   DC  B P     1 
ATOM   4425  O OP1   . DC  B 2 3   ? 7.865   -36.981 219.797 1.00 218.98 ? 0   DC  B OP1   1 
ATOM   4426  O OP2   . DC  B 2 3   ? 8.397   -34.945 218.362 1.00 223.87 ? 0   DC  B OP2   1 
ATOM   4427  O "O5'" . DC  B 2 3   ? 8.399   -34.726 220.813 1.00 177.96 ? 0   DC  B "O5'" 1 
ATOM   4428  C "C5'" . DC  B 2 3   ? 8.806   -34.990 222.154 1.00 183.31 ? 0   DC  B "C5'" 1 
ATOM   4429  C "C4'" . DC  B 2 3   ? 8.044   -36.140 222.789 1.00 182.44 ? 0   DC  B "C4'" 1 
ATOM   4430  O "O4'" . DC  B 2 3   ? 8.996   -37.196 223.069 1.00 184.00 ? 0   DC  B "O4'" 1 
ATOM   4431  C "C3'" . DC  B 2 3   ? 7.425   -35.865 224.151 1.00 184.50 ? 0   DC  B "C3'" 1 
ATOM   4432  O "O3'" . DC  B 2 3   ? 6.564   -36.939 224.528 1.00 181.47 ? 0   DC  B "O3'" 1 
ATOM   4433  C "C2'" . DC  B 2 3   ? 8.683   -35.883 225.003 1.00 189.08 ? 0   DC  B "C2'" 1 
ATOM   4434  C "C1'" . DC  B 2 3   ? 9.374   -37.117 224.431 1.00 185.14 ? 0   DC  B "C1'" 1 
ATOM   4435  N N1    . DC  B 2 3   ? 10.841  -36.994 224.503 1.00 183.35 ? 0   DC  B N1    1 
ATOM   4436  C C2    . DC  B 2 3   ? 11.497  -37.301 225.698 1.00 186.32 ? 0   DC  B C2    1 
ATOM   4437  O O2    . DC  B 2 3   ? 10.833  -37.680 226.670 1.00 183.50 ? 0   DC  B O2    1 
ATOM   4438  N N3    . DC  B 2 3   ? 12.845  -37.174 225.748 1.00 193.25 ? 0   DC  B N3    1 
ATOM   4439  C C4    . DC  B 2 3   ? 13.510  -36.761 224.668 1.00 194.13 ? 0   DC  B C4    1 
ATOM   4440  N N4    . DC  B 2 3   ? 14.835  -36.646 224.754 1.00 200.41 ? 0   DC  B N4    1 
ATOM   4441  C C5    . DC  B 2 3   ? 12.855  -36.442 223.445 1.00 187.55 ? 0   DC  B C5    1 
ATOM   4442  C C6    . DC  B 2 3   ? 11.531  -36.571 223.409 1.00 181.48 ? 0   DC  B C6    1 
ATOM   4443  P P     . DA  B 2 4   ? 5.518   -36.768 225.741 1.00 190.57 ? 1   DA  B P     1 
ATOM   4444  O OP1   . DA  B 2 4   ? 6.147   -35.927 226.783 1.00 197.60 ? 1   DA  B OP1   1 
ATOM   4445  O OP2   . DA  B 2 4   ? 5.023   -38.117 226.091 1.00 186.26 ? 1   DA  B OP2   1 
ATOM   4446  O "O5'" . DA  B 2 4   ? 4.296   -35.950 225.107 1.00 200.09 ? 1   DA  B "O5'" 1 
ATOM   4447  C "C5'" . DA  B 2 4   ? 3.341   -36.597 224.272 1.00 196.10 ? 1   DA  B "C5'" 1 
ATOM   4448  C "C4'" . DA  B 2 4   ? 3.975   -36.920 222.932 1.00 196.33 ? 1   DA  B "C4'" 1 
ATOM   4449  O "O4'" . DA  B 2 4   ? 4.390   -38.309 222.915 1.00 196.27 ? 1   DA  B "O4'" 1 
ATOM   4450  C "C3'" . DA  B 2 4   ? 3.104   -36.677 221.708 1.00 193.32 ? 1   DA  B "C3'" 1 
ATOM   4451  O "O3'" . DA  B 2 4   ? 3.765   -35.694 220.911 1.00 195.90 ? 1   DA  B "O3'" 1 
ATOM   4452  C "C2'" . DA  B 2 4   ? 2.999   -38.030 221.001 1.00 190.51 ? 1   DA  B "C2'" 1 
ATOM   4453  C "C1'" . DA  B 2 4   ? 3.721   -39.030 221.903 1.00 191.83 ? 1   DA  B "C1'" 1 
ATOM   4454  N N9    . DA  B 2 4   ? 2.852   -40.005 222.561 1.00 189.72 ? 1   DA  B N9    1 
ATOM   4455  C C8    . DA  B 2 4   ? 1.940   -39.765 223.551 1.00 189.36 ? 1   DA  B C8    1 
ATOM   4456  N N7    . DA  B 2 4   ? 1.306   -40.839 223.960 1.00 187.86 ? 1   DA  B N7    1 
ATOM   4457  C C5    . DA  B 2 4   ? 1.844   -41.856 223.188 1.00 187.77 ? 1   DA  B C5    1 
ATOM   4458  C C6    . DA  B 2 4   ? 1.597   -43.242 223.135 1.00 188.72 ? 1   DA  B C6    1 
ATOM   4459  N N6    . DA  B 2 4   ? 0.702   -43.860 223.911 1.00 191.38 ? 1   DA  B N6    1 
ATOM   4460  N N1    . DA  B 2 4   ? 2.307   -43.972 222.250 1.00 187.33 ? 1   DA  B N1    1 
ATOM   4461  C C2    . DA  B 2 4   ? 3.203   -43.352 221.474 1.00 186.54 ? 1   DA  B C2    1 
ATOM   4462  N N3    . DA  B 2 4   ? 3.522   -42.059 221.433 1.00 186.93 ? 1   DA  B N3    1 
ATOM   4463  C C4    . DA  B 2 4   ? 2.800   -41.360 222.323 1.00 187.95 ? 1   DA  B C4    1 
ATOM   4464  P P     . DG  B 2 5   ? 3.155   -35.243 219.495 1.00 224.04 ? 2   DG  B P     1 
ATOM   4465  O OP1   . DG  B 2 5   ? 3.737   -36.138 218.470 1.00 222.09 ? 2   DG  B OP1   1 
ATOM   4466  O OP2   . DG  B 2 5   ? 3.337   -33.782 219.363 1.00 228.17 ? 2   DG  B OP2   1 
ATOM   4467  O "O5'" . DG  B 2 5   ? 1.585   -35.505 219.655 1.00 147.69 ? 2   DG  B "O5'" 1 
ATOM   4468  C "C5'" . DG  B 2 5   ? 0.707   -35.376 218.546 1.00 150.99 ? 2   DG  B "C5'" 1 
ATOM   4469  C "C4'" . DG  B 2 5   ? 0.799   -36.605 217.663 1.00 154.23 ? 2   DG  B "C4'" 1 
ATOM   4470  O "O4'" . DG  B 2 5   ? 0.978   -37.778 218.503 1.00 154.33 ? 2   DG  B "O4'" 1 
ATOM   4471  C "C3'" . DG  B 2 5   ? -0.446  -36.904 216.848 1.00 156.31 ? 2   DG  B "C3'" 1 
ATOM   4472  O "O3'" . DG  B 2 5   ? -0.109  -37.778 215.770 1.00 158.11 ? 2   DG  B "O3'" 1 
ATOM   4473  C "C2'" . DG  B 2 5   ? -1.256  -37.624 217.917 1.00 154.81 ? 2   DG  B "C2'" 1 
ATOM   4474  C "C1'" . DG  B 2 5   ? -0.181  -38.583 218.411 1.00 153.82 ? 2   DG  B "C1'" 1 
ATOM   4475  N N9    . DG  B 2 5   ? -0.473  -39.186 219.710 1.00 154.70 ? 2   DG  B N9    1 
ATOM   4476  C C8    . DG  B 2 5   ? -0.509  -38.550 220.928 1.00 155.82 ? 2   DG  B C8    1 
ATOM   4477  N N7    . DG  B 2 5   ? -0.800  -39.344 221.921 1.00 154.30 ? 2   DG  B N7    1 
ATOM   4478  C C5    . DG  B 2 5   ? -0.969  -40.587 221.325 1.00 153.46 ? 2   DG  B C5    1 
ATOM   4479  C C6    . DG  B 2 5   ? -1.296  -41.837 221.903 1.00 152.08 ? 2   DG  B C6    1 
ATOM   4480  O O6    . DG  B 2 5   ? -1.507  -42.100 223.095 1.00 153.16 ? 2   DG  B O6    1 
ATOM   4481  N N1    . DG  B 2 5   ? -1.371  -42.846 220.945 1.00 150.15 ? 2   DG  B N1    1 
ATOM   4482  C C2    . DG  B 2 5   ? -1.156  -42.669 219.598 1.00 149.64 ? 2   DG  B C2    1 
ATOM   4483  N N2    . DG  B 2 5   ? -1.272  -43.764 218.831 1.00 147.34 ? 2   DG  B N2    1 
ATOM   4484  N N3    . DG  B 2 5   ? -0.849  -41.502 219.044 1.00 151.51 ? 2   DG  B N3    1 
ATOM   4485  C C4    . DG  B 2 5   ? -0.772  -40.508 219.963 1.00 153.66 ? 2   DG  B C4    1 
ATOM   4486  P P     . DA  B 2 6   ? -0.745  -37.557 214.309 1.00 166.87 ? 3   DA  B P     1 
ATOM   4487  O OP1   . DA  B 2 6   ? 0.359   -37.632 213.325 1.00 167.79 ? 3   DA  B OP1   1 
ATOM   4488  O OP2   . DA  B 2 6   ? -1.597  -36.349 214.377 1.00 163.94 ? 3   DA  B OP2   1 
ATOM   4489  O "O5'" . DA  B 2 6   ? -1.701  -38.827 214.109 1.00 117.03 ? 3   DA  B "O5'" 1 
ATOM   4490  C "C5'" . DA  B 2 6   ? -2.463  -39.278 215.225 1.00 115.37 ? 3   DA  B "C5'" 1 
ATOM   4491  C "C4'" . DA  B 2 6   ? -3.406  -40.422 214.931 1.00 112.25 ? 3   DA  B "C4'" 1 
ATOM   4492  O "O4'" . DA  B 2 6   ? -3.488  -41.255 216.115 1.00 112.52 ? 3   DA  B "O4'" 1 
ATOM   4493  C "C3'" . DA  B 2 6   ? -4.826  -39.973 214.623 1.00 113.06 ? 3   DA  B "C3'" 1 
ATOM   4494  O "O3'" . DA  B 2 6   ? -5.414  -40.798 213.627 1.00 103.63 ? 3   DA  B "O3'" 1 
ATOM   4495  C "C2'" . DA  B 2 6   ? -5.558  -40.097 215.956 1.00 113.50 ? 3   DA  B "C2'" 1 
ATOM   4496  C "C1'" . DA  B 2 6   ? -4.743  -41.112 216.754 1.00 114.16 ? 3   DA  B "C1'" 1 
ATOM   4497  N N9    . DA  B 2 6   ? -4.555  -40.701 218.147 1.00 116.83 ? 3   DA  B N9    1 
ATOM   4498  C C8    . DA  B 2 6   ? -4.138  -39.478 218.598 1.00 117.60 ? 3   DA  B C8    1 
ATOM   4499  N N7    . DA  B 2 6   ? -4.065  -39.385 219.906 1.00 119.53 ? 3   DA  B N7    1 
ATOM   4500  C C5    . DA  B 2 6   ? -4.467  -40.635 220.350 1.00 119.81 ? 3   DA  B C5    1 
ATOM   4501  C C6    . DA  B 2 6   ? -4.609  -41.188 221.640 1.00 118.53 ? 3   DA  B C6    1 
ATOM   4502  N N6    . DA  B 2 6   ? -4.350  -40.514 222.765 1.00 119.38 ? 3   DA  B N6    1 
ATOM   4503  N N1    . DA  B 2 6   ? -5.030  -42.467 221.730 1.00 118.32 ? 3   DA  B N1    1 
ATOM   4504  C C2    . DA  B 2 6   ? -5.290  -43.140 220.604 1.00 115.87 ? 3   DA  B C2    1 
ATOM   4505  N N3    . DA  B 2 6   ? -5.194  -42.730 219.340 1.00 114.99 ? 3   DA  B N3    1 
ATOM   4506  C C4    . DA  B 2 6   ? -4.773  -41.457 219.279 1.00 118.31 ? 3   DA  B C4    1 
ATOM   4507  P P     . DC  B 2 7   ? -6.787  -40.349 212.924 1.00 112.21 ? 4   DC  B P     1 
ATOM   4508  O OP1   . DC  B 2 7   ? -6.821  -40.959 211.577 1.00 110.26 ? 4   DC  B OP1   1 
ATOM   4509  O OP2   . DC  B 2 7   ? -6.904  -38.879 213.063 1.00 105.21 ? 4   DC  B OP2   1 
ATOM   4510  O "O5'" . DC  B 2 7   ? -7.914  -41.031 213.827 1.00 104.65 ? 4   DC  B "O5'" 1 
ATOM   4511  C "C5'" . DC  B 2 7   ? -7.926  -42.447 213.922 1.00 115.38 ? 4   DC  B "C5'" 1 
ATOM   4512  C "C4'" . DC  B 2 7   ? -8.657  -42.927 215.160 1.00 117.40 ? 4   DC  B "C4'" 1 
ATOM   4513  O "O4'" . DC  B 2 7   ? -8.031  -42.369 216.333 1.00 118.84 ? 4   DC  B "O4'" 1 
ATOM   4514  C "C3'" . DC  B 2 7   ? -10.113 -42.491 215.265 1.00 116.46 ? 4   DC  B "C3'" 1 
ATOM   4515  O "O3'" . DC  B 2 7   ? -10.952 -43.519 214.747 1.00 113.81 ? 4   DC  B "O3'" 1 
ATOM   4516  C "C2'" . DC  B 2 7   ? -10.331 -42.261 216.765 1.00 119.35 ? 4   DC  B "C2'" 1 
ATOM   4517  C "C1'" . DC  B 2 7   ? -8.955  -42.505 217.387 1.00 121.23 ? 4   DC  B "C1'" 1 
ATOM   4518  N N1    . DC  B 2 7   ? -8.559  -41.552 218.464 1.00 123.61 ? 4   DC  B N1    1 
ATOM   4519  C C2    . DC  B 2 7   ? -8.467  -41.999 219.789 1.00 124.53 ? 4   DC  B C2    1 
ATOM   4520  O O2    . DC  B 2 7   ? -8.726  -43.180 220.046 1.00 125.45 ? 4   DC  B O2    1 
ATOM   4521  N N3    . DC  B 2 7   ? -8.100  -41.124 220.758 1.00 123.91 ? 4   DC  B N3    1 
ATOM   4522  C C4    . DC  B 2 7   ? -7.829  -39.858 220.438 1.00 122.42 ? 4   DC  B C4    1 
ATOM   4523  N N4    . DC  B 2 7   ? -7.470  -39.025 221.420 1.00 124.70 ? 4   DC  B N4    1 
ATOM   4524  C C5    . DC  B 2 7   ? -7.912  -39.384 219.096 1.00 121.93 ? 4   DC  B C5    1 
ATOM   4525  C C6    . DC  B 2 7   ? -8.277  -40.256 218.151 1.00 122.62 ? 4   DC  B C6    1 
ATOM   4526  P P     . DA  B 2 8   ? -12.514 -43.239 214.493 1.00 137.80 ? 5   DA  B P     1 
ATOM   4527  O OP1   . DA  B 2 8   ? -12.951 -44.104 213.375 1.00 135.68 ? 5   DA  B OP1   1 
ATOM   4528  O OP2   . DA  B 2 8   ? -12.707 -41.773 214.417 1.00 140.16 ? 5   DA  B OP2   1 
ATOM   4529  O "O5'" . DA  B 2 8   ? -13.210 -43.758 215.832 1.00 123.76 ? 5   DA  B "O5'" 1 
ATOM   4530  C "C5'" . DA  B 2 8   ? -12.866 -45.055 216.306 1.00 126.73 ? 5   DA  B "C5'" 1 
ATOM   4531  C "C4'" . DA  B 2 8   ? -13.353 -45.266 217.726 1.00 129.52 ? 5   DA  B "C4'" 1 
ATOM   4532  O "O4'" . DA  B 2 8   ? -12.672 -44.355 218.627 1.00 130.29 ? 5   DA  B "O4'" 1 
ATOM   4533  C "C3'" . DA  B 2 8   ? -14.843 -45.025 217.919 1.00 131.70 ? 5   DA  B "C3'" 1 
ATOM   4534  O "O3'" . DA  B 2 8   ? -15.355 -46.021 218.786 1.00 131.67 ? 5   DA  B "O3'" 1 
ATOM   4535  C "C2'" . DA  B 2 8   ? -14.906 -43.636 218.549 1.00 131.75 ? 5   DA  B "C2'" 1 
ATOM   4536  C "C1'" . DA  B 2 8   ? -13.614 -43.596 219.358 1.00 132.60 ? 5   DA  B "C1'" 1 
ATOM   4537  N N9    . DA  B 2 8   ? -13.065 -42.255 219.539 1.00 135.61 ? 5   DA  B N9    1 
ATOM   4538  C C8    . DA  B 2 8   ? -13.054 -41.233 218.630 1.00 138.38 ? 5   DA  B C8    1 
ATOM   4539  N N7    . DA  B 2 8   ? -12.484 -40.135 219.068 1.00 138.32 ? 5   DA  B N7    1 
ATOM   4540  C C5    . DA  B 2 8   ? -12.088 -40.459 220.355 1.00 137.05 ? 5   DA  B C5    1 
ATOM   4541  C C6    . DA  B 2 8   ? -11.426 -39.724 221.359 1.00 133.89 ? 5   DA  B C6    1 
ATOM   4542  N N6    . DA  B 2 8   ? -11.030 -38.456 221.206 1.00 127.91 ? 5   DA  B N6    1 
ATOM   4543  N N1    . DA  B 2 8   ? -11.184 -40.345 222.532 1.00 136.66 ? 5   DA  B N1    1 
ATOM   4544  C C2    . DA  B 2 8   ? -11.582 -41.614 222.685 1.00 135.81 ? 5   DA  B C2    1 
ATOM   4545  N N3    . DA  B 2 8   ? -12.212 -42.405 221.817 1.00 134.71 ? 5   DA  B N3    1 
ATOM   4546  C C4    . DA  B 2 8   ? -12.439 -41.761 220.661 1.00 135.86 ? 5   DA  B C4    1 
ATOM   4547  P P     . DC  B 2 9   ? -16.940 -46.195 218.958 1.00 157.22 ? 6   DC  B P     1 
ATOM   4548  O OP1   . DC  B 2 9   ? -17.207 -47.632 219.199 1.00 160.76 ? 6   DC  B OP1   1 
ATOM   4549  O OP2   . DC  B 2 9   ? -17.581 -45.509 217.814 1.00 158.33 ? 6   DC  B OP2   1 
ATOM   4550  O "O5'" . DC  B 2 9   ? -17.270 -45.367 220.288 1.00 125.75 ? 6   DC  B "O5'" 1 
ATOM   4551  C "C5'" . DC  B 2 9   ? -16.743 -45.820 221.531 1.00 126.63 ? 6   DC  B "C5'" 1 
ATOM   4552  C "C4'" . DC  B 2 9   ? -16.743 -44.734 222.594 1.00 138.51 ? 6   DC  B "C4'" 1 
ATOM   4553  O "O4'" . DC  B 2 9   ? -15.887 -43.639 222.190 1.00 135.84 ? 6   DC  B "O4'" 1 
ATOM   4554  C "C3'" . DC  B 2 9   ? -18.097 -44.106 222.925 1.00 143.21 ? 6   DC  B "C3'" 1 
ATOM   4555  O "O3'" . DC  B 2 9   ? -18.519 -44.601 224.196 1.00 149.40 ? 6   DC  B "O3'" 1 
ATOM   4556  C "C2'" . DC  B 2 9   ? -17.808 -42.603 222.951 1.00 139.67 ? 6   DC  B "C2'" 1 
ATOM   4557  C "C1'" . DC  B 2 9   ? -16.288 -42.538 222.967 1.00 137.36 ? 6   DC  B "C1'" 1 
ATOM   4558  N N1    . DC  B 2 9   ? -15.757 -41.286 222.377 1.00 140.39 ? 6   DC  B N1    1 
ATOM   4559  C C2    . DC  B 2 9   ? -15.038 -40.408 223.190 1.00 141.81 ? 6   DC  B C2    1 
ATOM   4560  O O2    . DC  B 2 9   ? -14.857 -40.705 224.378 1.00 144.92 ? 6   DC  B O2    1 
ATOM   4561  N N3    . DC  B 2 9   ? -14.558 -39.261 222.651 1.00 139.22 ? 6   DC  B N3    1 
ATOM   4562  C C4    . DC  B 2 9   ? -14.779 -38.983 221.365 1.00 137.88 ? 6   DC  B C4    1 
ATOM   4563  N N4    . DC  B 2 9   ? -14.283 -37.839 220.883 1.00 136.13 ? 6   DC  B N4    1 
ATOM   4564  C C5    . DC  B 2 9   ? -15.515 -39.867 220.520 1.00 139.88 ? 6   DC  B C5    1 
ATOM   4565  C C6    . DC  B 2 9   ? -15.982 -40.996 221.064 1.00 142.11 ? 6   DC  B C6    1 
ATOM   4566  P P     . DA  B 2 10  ? -19.972 -44.249 224.792 1.00 149.49 ? 7   DA  B P     1 
ATOM   4567  O OP1   . DA  B 2 10  ? -20.696 -45.528 224.965 1.00 152.43 ? 7   DA  B OP1   1 
ATOM   4568  O OP2   . DA  B 2 10  ? -20.593 -43.156 224.010 1.00 143.95 ? 7   DA  B OP2   1 
ATOM   4569  O "O5'" . DA  B 2 10  ? -19.642 -43.659 226.238 1.00 171.94 ? 7   DA  B "O5'" 1 
ATOM   4570  C "C5'" . DA  B 2 10  ? -18.393 -43.016 226.437 1.00 166.35 ? 7   DA  B "C5'" 1 
ATOM   4571  C "C4'" . DA  B 2 10  ? -18.588 -41.698 227.153 1.00 166.21 ? 7   DA  B "C4'" 1 
ATOM   4572  O "O4'" . DA  B 2 10  ? -17.887 -40.647 226.436 1.00 165.56 ? 7   DA  B "O4'" 1 
ATOM   4573  C "C3'" . DA  B 2 10  ? -20.037 -41.239 227.243 1.00 169.11 ? 7   DA  B "C3'" 1 
ATOM   4574  O "O3'" . DA  B 2 10  ? -20.199 -40.515 228.447 1.00 170.04 ? 7   DA  B "O3'" 1 
ATOM   4575  C "C2'" . DA  B 2 10  ? -20.150 -40.316 226.037 1.00 169.09 ? 7   DA  B "C2'" 1 
ATOM   4576  C "C1'" . DA  B 2 10  ? -18.806 -39.612 226.151 1.00 168.09 ? 7   DA  B "C1'" 1 
ATOM   4577  N N9    . DA  B 2 10  ? -18.405 -38.900 224.941 1.00 167.58 ? 7   DA  B N9    1 
ATOM   4578  C C8    . DA  B 2 10  ? -18.768 -39.179 223.652 1.00 168.25 ? 7   DA  B C8    1 
ATOM   4579  N N7    . DA  B 2 10  ? -18.252 -38.356 222.769 1.00 164.85 ? 7   DA  B N7    1 
ATOM   4580  C C5    . DA  B 2 10  ? -17.501 -37.477 223.532 1.00 165.19 ? 7   DA  B C5    1 
ATOM   4581  C C6    . DA  B 2 10  ? -16.704 -36.366 223.195 1.00 169.07 ? 7   DA  B C6    1 
ATOM   4582  N N6    . DA  B 2 10  ? -16.529 -35.939 221.939 1.00 171.40 ? 7   DA  B N6    1 
ATOM   4583  N N1    . DA  B 2 10  ? -16.091 -35.709 224.203 1.00 169.61 ? 7   DA  B N1    1 
ATOM   4584  C C2    . DA  B 2 10  ? -16.268 -36.140 225.459 1.00 168.67 ? 7   DA  B C2    1 
ATOM   4585  N N3    . DA  B 2 10  ? -16.991 -37.169 225.896 1.00 166.46 ? 7   DA  B N3    1 
ATOM   4586  C C4    . DA  B 2 10  ? -17.586 -37.799 224.873 1.00 165.12 ? 7   DA  B C4    1 
ATOM   4587  P P     . DC  B 2 11  ? -21.556 -40.641 229.298 1.00 165.25 ? 8   DC  B P     1 
ATOM   4588  O OP1   . DC  B 2 11  ? -21.302 -41.584 230.410 1.00 168.41 ? 8   DC  B OP1   1 
ATOM   4589  O OP2   . DC  B 2 11  ? -22.665 -40.902 228.354 1.00 165.14 ? 8   DC  B OP2   1 
ATOM   4590  O "O5'" . DC  B 2 11  ? -21.758 -39.173 229.897 1.00 168.58 ? 8   DC  B "O5'" 1 
ATOM   4591  C "C5'" . DC  B 2 11  ? -20.731 -38.588 230.688 1.00 167.48 ? 8   DC  B "C5'" 1 
ATOM   4592  C "C4'" . DC  B 2 11  ? -20.586 -37.105 230.388 1.00 166.29 ? 8   DC  B "C4'" 1 
ATOM   4593  O "O4'" . DC  B 2 11  ? -20.081 -36.912 229.039 1.00 164.22 ? 8   DC  B "O4'" 1 
ATOM   4594  C "C3'" . DC  B 2 11  ? -21.873 -36.282 230.470 1.00 168.22 ? 8   DC  B "C3'" 1 
ATOM   4595  O "O3'" . DC  B 2 11  ? -21.626 -35.081 231.193 1.00 168.96 ? 8   DC  B "O3'" 1 
ATOM   4596  C "C2'" . DC  B 2 11  ? -22.171 -35.978 229.005 1.00 166.23 ? 8   DC  B "C2'" 1 
ATOM   4597  C "C1'" . DC  B 2 11  ? -20.743 -35.777 228.522 1.00 164.36 ? 8   DC  B "C1'" 1 
ATOM   4598  N N1    . DC  B 2 11  ? -20.583 -35.685 227.038 1.00 162.63 ? 8   DC  B N1    1 
ATOM   4599  C C2    . DC  B 2 11  ? -20.046 -34.518 226.480 1.00 158.89 ? 8   DC  B C2    1 
ATOM   4600  O O2    . DC  B 2 11  ? -19.708 -33.589 227.224 1.00 157.89 ? 8   DC  B O2    1 
ATOM   4601  N N3    . DC  B 2 11  ? -19.906 -34.439 225.133 1.00 156.30 ? 8   DC  B N3    1 
ATOM   4602  C C4    . DC  B 2 11  ? -20.278 -35.460 224.360 1.00 156.07 ? 8   DC  B C4    1 
ATOM   4603  N N4    . DC  B 2 11  ? -20.120 -35.333 223.038 1.00 153.40 ? 8   DC  B N4    1 
ATOM   4604  C C5    . DC  B 2 11  ? -20.830 -36.656 224.909 1.00 160.32 ? 8   DC  B C5    1 
ATOM   4605  C C6    . DC  B 2 11  ? -20.964 -36.723 226.238 1.00 163.45 ? 8   DC  B C6    1 
ATOM   4606  P P     . DA  B 2 12  ? -22.848 -34.213 231.775 1.00 176.61 ? 9   DA  B P     1 
ATOM   4607  O OP1   . DA  B 2 12  ? -23.560 -35.064 232.754 1.00 180.64 ? 9   DA  B OP1   1 
ATOM   4608  O OP2   . DA  B 2 12  ? -23.589 -33.627 230.636 1.00 175.85 ? 9   DA  B OP2   1 
ATOM   4609  O "O5'" . DA  B 2 12  ? -22.130 -33.015 232.558 1.00 183.99 ? 9   DA  B "O5'" 1 
ATOM   4610  C "C5'" . DA  B 2 12  ? -22.503 -31.659 232.313 1.00 183.64 ? 9   DA  B "C5'" 1 
ATOM   4611  C "C4'" . DA  B 2 12  ? -21.460 -30.950 231.465 1.00 179.67 ? 9   DA  B "C4'" 1 
ATOM   4612  O "O4'" . DA  B 2 12  ? -21.242 -31.710 230.254 1.00 177.02 ? 9   DA  B "O4'" 1 
ATOM   4613  C "C3'" . DA  B 2 12  ? -21.837 -29.543 231.011 1.00 179.18 ? 9   DA  B "C3'" 1 
ATOM   4614  O "O3'" . DA  B 2 12  ? -21.239 -28.577 231.869 1.00 179.17 ? 9   DA  B "O3'" 1 
ATOM   4615  C "C2'" . DA  B 2 12  ? -21.268 -29.422 229.598 1.00 177.21 ? 9   DA  B "C2'" 1 
ATOM   4616  C "C1'" . DA  B 2 12  ? -20.862 -30.841 229.207 1.00 176.09 ? 9   DA  B "C1'" 1 
ATOM   4617  N N9    . DA  B 2 12  ? -21.487 -31.311 227.975 1.00 176.30 ? 9   DA  B N9    1 
ATOM   4618  C C8    . DA  B 2 12  ? -22.453 -32.271 227.856 1.00 177.42 ? 9   DA  B C8    1 
ATOM   4619  N N7    . DA  B 2 12  ? -22.828 -32.493 226.619 1.00 176.62 ? 9   DA  B N7    1 
ATOM   4620  C C5    . DA  B 2 12  ? -22.056 -31.617 225.874 1.00 174.69 ? 9   DA  B C5    1 
ATOM   4621  C C6    . DA  B 2 12  ? -21.976 -31.359 224.491 1.00 173.24 ? 9   DA  B C6    1 
ATOM   4622  N N6    . DA  B 2 12  ? -22.720 -31.995 223.579 1.00 173.20 ? 9   DA  B N6    1 
ATOM   4623  N N1    . DA  B 2 12  ? -21.098 -30.420 224.080 1.00 173.75 ? 9   DA  B N1    1 
ATOM   4624  C C2    . DA  B 2 12  ? -20.356 -29.785 224.995 1.00 174.11 ? 9   DA  B C2    1 
ATOM   4625  N N3    . DA  B 2 12  ? -20.341 -29.942 226.318 1.00 175.42 ? 9   DA  B N3    1 
ATOM   4626  C C4    . DA  B 2 12  ? -21.223 -30.881 226.695 1.00 175.51 ? 9   DA  B C4    1 
ATOM   4627  P P     . DT  B 2 13  ? -21.951 -27.157 232.115 1.00 198.22 ? 10  DT  B P     1 
ATOM   4628  O OP1   . DT  B 2 13  ? -21.089 -26.385 233.037 1.00 199.38 ? 10  DT  B OP1   1 
ATOM   4629  O OP2   . DT  B 2 13  ? -23.366 -27.407 232.468 1.00 199.60 ? 10  DT  B OP2   1 
ATOM   4630  O "O5'" . DT  B 2 13  ? -21.922 -26.450 230.680 1.00 177.39 ? 10  DT  B "O5'" 1 
ATOM   4631  C "C5'" . DT  B 2 13  ? -20.748 -25.775 230.244 1.00 172.58 ? 10  DT  B "C5'" 1 
ATOM   4632  C "C4'" . DT  B 2 13  ? -20.958 -25.142 228.880 1.00 168.05 ? 10  DT  B "C4'" 1 
ATOM   4633  O "O4'" . DT  B 2 13  ? -21.036 -26.184 227.880 1.00 162.14 ? 10  DT  B "O4'" 1 
ATOM   4634  C "C3'" . DT  B 2 13  ? -22.249 -24.347 228.702 1.00 171.88 ? 10  DT  B "C3'" 1 
ATOM   4635  O "O3'" . DT  B 2 13  ? -22.148 -22.986 229.207 1.00 176.59 ? 10  DT  B "O3'" 1 
ATOM   4636  C "C2'" . DT  B 2 13  ? -22.516 -24.446 227.200 1.00 169.13 ? 10  DT  B "C2'" 1 
ATOM   4637  C "C1'" . DT  B 2 13  ? -21.810 -25.735 226.784 1.00 164.33 ? 10  DT  B "C1'" 1 
ATOM   4638  N N1    . DT  B 2 13  ? -22.737 -26.834 226.390 1.00 166.45 ? 10  DT  B N1    1 
ATOM   4639  C C2    . DT  B 2 13  ? -23.017 -27.034 225.055 1.00 164.51 ? 10  DT  B C2    1 
ATOM   4640  O O2    . DT  B 2 13  ? -22.545 -26.350 224.164 1.00 162.04 ? 10  DT  B O2    1 
ATOM   4641  N N3    . DT  B 2 13  ? -23.876 -28.073 224.804 1.00 165.18 ? 10  DT  B N3    1 
ATOM   4642  C C4    . DT  B 2 13  ? -24.465 -28.909 225.735 1.00 166.55 ? 10  DT  B C4    1 
ATOM   4643  O O4    . DT  B 2 13  ? -25.225 -29.816 225.412 1.00 167.29 ? 10  DT  B O4    1 
ATOM   4644  C C5    . DT  B 2 13  ? -24.128 -28.643 227.111 1.00 167.40 ? 10  DT  B C5    1 
ATOM   4645  C C7    . DT  B 2 13  ? -24.709 -29.486 228.208 1.00 168.04 ? 10  DT  B C7    1 
ATOM   4646  C C6    . DT  B 2 13  ? -23.292 -27.632 227.369 1.00 168.57 ? 10  DT  B C6    1 
ATOM   4647  P P     . DT  B 2 14  ? -21.365 -21.830 228.399 1.00 190.44 ? 11  DT  B P     1 
ATOM   4648  O OP1   . DT  B 2 14  ? -20.123 -22.379 227.813 1.00 188.08 ? 11  DT  B OP1   1 
ATOM   4649  O OP2   . DT  B 2 14  ? -21.275 -20.666 229.307 1.00 193.53 ? 11  DT  B OP2   1 
ATOM   4650  O "O5'" . DT  B 2 14  ? -22.345 -21.441 227.196 1.00 190.74 ? 11  DT  B "O5'" 1 
ATOM   4651  C "C5'" . DT  B 2 14  ? -21.783 -20.970 225.975 1.00 190.86 ? 11  DT  B "C5'" 1 
ATOM   4652  C "C4'" . DT  B 2 14  ? -22.777 -21.086 224.833 1.00 191.94 ? 11  DT  B "C4'" 1 
ATOM   4653  O "O4'" . DT  B 2 14  ? -23.219 -22.457 224.675 1.00 190.37 ? 11  DT  B "O4'" 1 
ATOM   4654  C "C3'" . DT  B 2 14  ? -24.045 -20.259 225.013 1.00 195.87 ? 11  DT  B "C3'" 1 
ATOM   4655  O "O3'" . DT  B 2 14  ? -24.072 -19.233 224.034 1.00 198.85 ? 11  DT  B "O3'" 1 
ATOM   4656  C "C2'" . DT  B 2 14  ? -25.196 -21.249 224.825 1.00 195.16 ? 11  DT  B "C2'" 1 
ATOM   4657  C "C1'" . DT  B 2 14  ? -24.519 -22.422 224.127 1.00 191.89 ? 11  DT  B "C1'" 1 
ATOM   4658  N N1    . DT  B 2 14  ? -25.196 -23.733 224.359 1.00 190.52 ? 11  DT  B N1    1 
ATOM   4659  C C2    . DT  B 2 14  ? -25.358 -24.614 223.310 1.00 188.17 ? 11  DT  B C2    1 
ATOM   4660  O O2    . DT  B 2 14  ? -24.972 -24.388 222.177 1.00 187.06 ? 11  DT  B O2    1 
ATOM   4661  N N3    . DT  B 2 14  ? -25.994 -25.785 223.638 1.00 186.73 ? 11  DT  B N3    1 
ATOM   4662  C C4    . DT  B 2 14  ? -26.475 -26.154 224.882 1.00 186.93 ? 11  DT  B C4    1 
ATOM   4663  O O4    . DT  B 2 14  ? -27.033 -27.229 225.078 1.00 185.97 ? 11  DT  B O4    1 
ATOM   4664  C C5    . DT  B 2 14  ? -26.274 -25.187 225.931 1.00 189.37 ? 11  DT  B C5    1 
ATOM   4665  C C7    . DT  B 2 14  ? -26.752 -25.474 227.323 1.00 191.22 ? 11  DT  B C7    1 
ATOM   4666  C C6    . DT  B 2 14  ? -25.655 -24.040 225.623 1.00 190.67 ? 11  DT  B C6    1 
ATOM   4667  P P     . DC  B 2 15  ? -24.362 -17.714 224.468 1.00 303.97 ? 12  DC  B P     1 
ATOM   4668  O OP1   . DC  B 2 15  ? -23.064 -17.006 224.541 1.00 147.00 ? 12  DC  B OP1   1 
ATOM   4669  O OP2   . DC  B 2 15  ? -25.237 -17.765 225.661 1.00 148.85 ? 12  DC  B OP2   1 
ATOM   4670  O "O5'" . DC  B 2 15  ? -25.205 -17.120 223.244 1.00 217.63 ? 12  DC  B "O5'" 1 
ATOM   4671  C "C5'" . DC  B 2 15  ? -26.456 -17.702 222.889 1.00 216.62 ? 12  DC  B "C5'" 1 
ATOM   4672  C "C4'" . DC  B 2 15  ? -26.555 -17.924 221.389 1.00 214.37 ? 12  DC  B "C4'" 1 
ATOM   4673  O "O4'" . DC  B 2 15  ? -26.545 -19.346 221.110 1.00 212.45 ? 12  DC  B "O4'" 1 
ATOM   4674  C "C3'" . DC  B 2 15  ? -27.834 -17.412 220.744 1.00 212.94 ? 12  DC  B "C3'" 1 
ATOM   4675  O "O3'" . DC  B 2 15  ? -27.611 -17.127 219.367 1.00 211.57 ? 12  DC  B "O3'" 1 
ATOM   4676  C "C2'" . DC  B 2 15  ? -28.786 -18.591 220.927 1.00 212.13 ? 12  DC  B "C2'" 1 
ATOM   4677  C "C1'" . DC  B 2 15  ? -27.855 -19.797 220.820 1.00 210.73 ? 12  DC  B "C1'" 1 
ATOM   4678  N N1    . DC  B 2 15  ? -28.192 -20.893 221.776 1.00 207.43 ? 12  DC  B N1    1 
ATOM   4679  C C2    . DC  B 2 15  ? -28.254 -22.217 221.325 1.00 205.68 ? 12  DC  B C2    1 
ATOM   4680  O O2    . DC  B 2 15  ? -28.027 -22.462 220.133 1.00 205.10 ? 12  DC  B O2    1 
ATOM   4681  N N3    . DC  B 2 15  ? -28.561 -23.197 222.210 1.00 204.18 ? 12  DC  B N3    1 
ATOM   4682  C C4    . DC  B 2 15  ? -28.800 -22.896 223.488 1.00 202.66 ? 12  DC  B C4    1 
ATOM   4683  N N4    . DC  B 2 15  ? -29.098 -23.898 224.321 1.00 199.86 ? 12  DC  B N4    1 
ATOM   4684  C C5    . DC  B 2 15  ? -28.742 -21.555 223.966 1.00 204.42 ? 12  DC  B C5    1 
ATOM   4685  C C6    . DC  B 2 15  ? -28.439 -20.597 223.084 1.00 205.79 ? 12  DC  B C6    1 
ATOM   4686  P P     . DG  C 3 1   ? -1.655  -75.492 248.517 1.00 227.97 ? 1   DG  C P     1 
ATOM   4687  O OP1   . DG  C 3 1   ? -1.817  -76.917 248.146 1.00 231.21 ? 1   DG  C OP1   1 
ATOM   4688  O OP2   . DG  C 3 1   ? -1.542  -75.111 249.945 1.00 225.04 ? 1   DG  C OP2   1 
ATOM   4689  O "O5'" . DG  C 3 1   ? -0.410  -74.874 247.712 1.00 156.59 ? 1   DG  C "O5'" 1 
ATOM   4690  C "C5'" . DG  C 3 1   ? 0.248   -73.686 248.172 1.00 142.58 ? 1   DG  C "C5'" 1 
ATOM   4691  C "C4'" . DG  C 3 1   ? -0.675  -72.481 248.109 1.00 128.76 ? 1   DG  C "C4'" 1 
ATOM   4692  O "O4'" . DG  C 3 1   ? -0.450  -71.602 249.236 1.00 121.14 ? 1   DG  C "O4'" 1 
ATOM   4693  C "C3'" . DG  C 3 1   ? -0.470  -71.559 246.921 1.00 118.98 ? 1   DG  C "C3'" 1 
ATOM   4694  O "O3'" . DG  C 3 1   ? -1.133  -72.088 245.796 1.00 117.76 ? 1   DG  C "O3'" 1 
ATOM   4695  C "C2'" . DG  C 3 1   ? -1.152  -70.279 247.389 1.00 116.63 ? 1   DG  C "C2'" 1 
ATOM   4696  C "C1'" . DG  C 3 1   ? -1.017  -70.346 248.910 1.00 116.84 ? 1   DG  C "C1'" 1 
ATOM   4697  N N9    . DG  C 3 1   ? -0.209  -69.263 249.464 1.00 114.81 ? 1   DG  C N9    1 
ATOM   4698  C C8    . DG  C 3 1   ? 0.961   -69.359 250.178 1.00 115.84 ? 1   DG  C C8    1 
ATOM   4699  N N7    . DG  C 3 1   ? 1.443   -68.199 250.536 1.00 113.07 ? 1   DG  C N7    1 
ATOM   4700  C C5    . DG  C 3 1   ? 0.535   -67.276 250.028 1.00 112.90 ? 1   DG  C C5    1 
ATOM   4701  C C6    . DG  C 3 1   ? 0.520   -65.862 250.096 1.00 108.05 ? 1   DG  C C6    1 
ATOM   4702  O O6    . DG  C 3 1   ? 1.339   -65.110 250.641 1.00 101.19 ? 1   DG  C O6    1 
ATOM   4703  N N1    . DG  C 3 1   ? -0.586  -65.324 249.443 1.00 109.74 ? 1   DG  C N1    1 
ATOM   4704  C C2    . DG  C 3 1   ? -1.559  -66.057 248.804 1.00 111.81 ? 1   DG  C C2    1 
ATOM   4705  N N2    . DG  C 3 1   ? -2.553  -65.365 248.228 1.00 112.36 ? 1   DG  C N2    1 
ATOM   4706  N N3    . DG  C 3 1   ? -1.557  -67.379 248.733 1.00 115.94 ? 1   DG  C N3    1 
ATOM   4707  C C4    . DG  C 3 1   ? -0.486  -67.919 249.366 1.00 115.19 ? 1   DG  C C4    1 
ATOM   4708  P P     . DT  C 3 2   ? -0.764  -71.560 244.326 1.00 153.24 ? 2   DT  C P     1 
ATOM   4709  O OP1   . DT  C 3 2   ? -1.316  -72.540 243.366 1.00 160.00 ? 2   DT  C OP1   1 
ATOM   4710  O OP2   . DT  C 3 2   ? 0.682   -71.240 244.311 1.00 146.19 ? 2   DT  C OP2   1 
ATOM   4711  O "O5'" . DT  C 3 2   ? -1.576  -70.189 244.191 1.00 129.36 ? 2   DT  C "O5'" 1 
ATOM   4712  C "C5'" . DT  C 3 2   ? -2.998  -70.201 244.251 1.00 129.43 ? 2   DT  C "C5'" 1 
ATOM   4713  C "C4'" . DT  C 3 2   ? -3.556  -68.837 243.888 1.00 123.57 ? 2   DT  C "C4'" 1 
ATOM   4714  O "O4'" . DT  C 3 2   ? -3.061  -67.855 244.834 1.00 119.57 ? 2   DT  C "O4'" 1 
ATOM   4715  C "C3'" . DT  C 3 2   ? -3.184  -68.333 242.496 1.00 118.16 ? 2   DT  C "C3'" 1 
ATOM   4716  O "O3'" . DT  C 3 2   ? -4.344  -67.820 241.849 1.00 116.57 ? 2   DT  C "O3'" 1 
ATOM   4717  C "C2'" . DT  C 3 2   ? -2.140  -67.247 242.752 1.00 114.89 ? 2   DT  C "C2'" 1 
ATOM   4718  C "C1'" . DT  C 3 2   ? -2.497  -66.755 244.151 1.00 119.30 ? 2   DT  C "C1'" 1 
ATOM   4719  N N1    . DT  C 3 2   ? -1.326  -66.285 244.945 1.00 121.14 ? 2   DT  C N1    1 
ATOM   4720  C C2    . DT  C 3 2   ? -1.167  -64.939 245.198 1.00 119.16 ? 2   DT  C C2    1 
ATOM   4721  O O2    . DT  C 3 2   ? -1.940  -64.087 244.799 1.00 120.94 ? 2   DT  C O2    1 
ATOM   4722  N N3    . DT  C 3 2   ? -0.059  -64.626 245.941 1.00 116.21 ? 2   DT  C N3    1 
ATOM   4723  C C4    . DT  C 3 2   ? 0.883   -65.507 246.441 1.00 117.68 ? 2   DT  C C4    1 
ATOM   4724  O O4    . DT  C 3 2   ? 1.849   -65.134 247.098 1.00 118.03 ? 2   DT  C O4    1 
ATOM   4725  C C5    . DT  C 3 2   ? 0.654   -66.897 246.140 1.00 118.58 ? 2   DT  C C5    1 
ATOM   4726  C C7    . DT  C 3 2   ? 1.611   -67.942 246.634 1.00 117.16 ? 2   DT  C C7    1 
ATOM   4727  C C6    . DT  C 3 2   ? -0.425  -67.217 245.417 1.00 122.04 ? 2   DT  C C6    1 
ATOM   4728  P P     . DT  C 3 3   ? -4.311  -67.450 240.285 1.00 133.91 ? 3   DT  C P     1 
ATOM   4729  O OP1   . DT  C 3 3   ? -5.660  -67.727 239.741 1.00 139.99 ? 3   DT  C OP1   1 
ATOM   4730  O OP2   . DT  C 3 3   ? -3.127  -68.095 239.676 1.00 134.36 ? 3   DT  C OP2   1 
ATOM   4731  O "O5'" . DT  C 3 3   ? -4.051  -65.872 240.268 1.00 124.82 ? 3   DT  C "O5'" 1 
ATOM   4732  C "C5'" . DT  C 3 3   ? -4.912  -64.999 240.988 1.00 126.95 ? 3   DT  C "C5'" 1 
ATOM   4733  C "C4'" . DT  C 3 3   ? -4.364  -63.583 240.992 1.00 127.12 ? 3   DT  C "C4'" 1 
ATOM   4734  O "O4'" . DT  C 3 3   ? -3.268  -63.481 241.933 1.00 124.48 ? 3   DT  C "O4'" 1 
ATOM   4735  C "C3'" . DT  C 3 3   ? -3.831  -63.094 239.647 1.00 126.70 ? 3   DT  C "C3'" 1 
ATOM   4736  O "O3'" . DT  C 3 3   ? -4.573  -61.954 239.254 1.00 129.73 ? 3   DT  C "O3'" 1 
ATOM   4737  C "C2'" . DT  C 3 3   ? -2.363  -62.752 239.903 1.00 119.21 ? 3   DT  C "C2'" 1 
ATOM   4738  C "C1'" . DT  C 3 3   ? -2.319  -62.575 241.415 1.00 120.94 ? 3   DT  C "C1'" 1 
ATOM   4739  N N1    . DT  C 3 3   ? -1.003  -62.895 242.026 1.00 117.97 ? 3   DT  C N1    1 
ATOM   4740  C C2    . DT  C 3 3   ? -0.377  -61.923 242.771 1.00 115.58 ? 3   DT  C C2    1 
ATOM   4741  O O2    . DT  C 3 3   ? -0.850  -60.813 242.946 1.00 113.44 ? 3   DT  C O2    1 
ATOM   4742  N N3    . DT  C 3 3   ? 0.828   -62.303 243.300 1.00 115.07 ? 3   DT  C N3    1 
ATOM   4743  C C4    . DT  C 3 3   ? 1.451   -63.531 243.159 1.00 113.43 ? 3   DT  C C4    1 
ATOM   4744  O O4    . DT  C 3 3   ? 2.536   -63.774 243.675 1.00 110.68 ? 3   DT  C O4    1 
ATOM   4745  C C5    . DT  C 3 3   ? 0.740   -64.504 242.368 1.00 113.97 ? 3   DT  C C5    1 
ATOM   4746  C C7    . DT  C 3 3   ? 1.326   -65.869 242.154 1.00 114.60 ? 3   DT  C C7    1 
ATOM   4747  C C6    . DT  C 3 3   ? -0.440  -64.144 241.846 1.00 116.99 ? 3   DT  C C6    1 
ATOM   4748  P P     . DG  C 3 4   ? -4.407  -61.345 237.777 1.00 139.91 ? 4   DG  C P     1 
ATOM   4749  O OP1   . DG  C 3 4   ? -5.757  -60.954 237.313 1.00 142.35 ? 4   DG  C OP1   1 
ATOM   4750  O OP2   . DG  C 3 4   ? -3.593  -62.288 236.976 1.00 140.05 ? 4   DG  C OP2   1 
ATOM   4751  O "O5'" . DG  C 3 4   ? -3.549  -60.018 238.012 1.00 133.26 ? 4   DG  C "O5'" 1 
ATOM   4752  C "C5'" . DG  C 3 4   ? -3.990  -59.085 238.990 1.00 130.96 ? 4   DG  C "C5'" 1 
ATOM   4753  C "C4'" . DG  C 3 4   ? -2.986  -57.960 239.143 1.00 126.54 ? 4   DG  C "C4'" 1 
ATOM   4754  O "O4'" . DG  C 3 4   ? -1.862  -58.395 239.951 1.00 125.74 ? 4   DG  C "O4'" 1 
ATOM   4755  C "C3'" . DG  C 3 4   ? -2.420  -57.452 237.822 1.00 121.76 ? 4   DG  C "C3'" 1 
ATOM   4756  O "O3'" . DG  C 3 4   ? -2.518  -56.034 237.809 1.00 116.18 ? 4   DG  C "O3'" 1 
ATOM   4757  C "C2'" . DG  C 3 4   ? -0.978  -57.959 237.810 1.00 117.62 ? 4   DG  C "C2'" 1 
ATOM   4758  C "C1'" . DG  C 3 4   ? -0.644  -58.132 239.285 1.00 117.56 ? 4   DG  C "C1'" 1 
ATOM   4759  N N9    . DG  C 3 4   ? 0.250   -59.256 239.545 1.00 111.19 ? 4   DG  C N9    1 
ATOM   4760  C C8    . DG  C 3 4   ? 0.164   -60.526 239.029 1.00 113.32 ? 4   DG  C C8    1 
ATOM   4761  N N7    . DG  C 3 4   ? 1.107   -61.323 239.449 1.00 109.05 ? 4   DG  C N7    1 
ATOM   4762  C C5    . DG  C 3 4   ? 1.866   -60.530 240.302 1.00 104.20 ? 4   DG  C C5    1 
ATOM   4763  C C6    . DG  C 3 4   ? 3.021   -60.845 241.055 1.00 96.42  ? 4   DG  C C6    1 
ATOM   4764  O O6    . DG  C 3 4   ? 3.627   -61.924 241.124 1.00 92.94  ? 4   DG  C O6    1 
ATOM   4765  N N1    . DG  C 3 4   ? 3.472   -59.749 241.785 1.00 93.72  ? 4   DG  C N1    1 
ATOM   4766  C C2    . DG  C 3 4   ? 2.880   -58.507 241.785 1.00 98.73  ? 4   DG  C C2    1 
ATOM   4767  N N2    . DG  C 3 4   ? 3.463   -57.578 242.555 1.00 103.93 ? 4   DG  C N2    1 
ATOM   4768  N N3    . DG  C 3 4   ? 1.796   -58.197 241.086 1.00 99.79  ? 4   DG  C N3    1 
ATOM   4769  C C4    . DG  C 3 4   ? 1.348   -59.256 240.371 1.00 104.63 ? 4   DG  C C4    1 
ATOM   4770  P P     . DG  C 3 5   ? -1.914  -55.182 236.588 1.00 124.11 ? 5   DG  C P     1 
ATOM   4771  O OP1   . DG  C 3 5   ? -2.837  -54.051 236.351 1.00 126.69 ? 5   DG  C OP1   1 
ATOM   4772  O OP2   . DG  C 3 5   ? -1.584  -56.103 235.478 1.00 123.98 ? 5   DG  C OP2   1 
ATOM   4773  O "O5'" . DG  C 3 5   ? -0.562  -54.586 237.190 1.00 127.21 ? 5   DG  C "O5'" 1 
ATOM   4774  C "C5'" . DG  C 3 5   ? -0.649  -53.841 238.400 1.00 121.10 ? 5   DG  C "C5'" 1 
ATOM   4775  C "C4'" . DG  C 3 5   ? 0.696   -53.248 238.772 1.00 109.66 ? 5   DG  C "C4'" 1 
ATOM   4776  O "O4'" . DG  C 3 5   ? 1.565   -54.297 239.265 1.00 108.50 ? 5   DG  C "O4'" 1 
ATOM   4777  C "C3'" . DG  C 3 5   ? 1.427   -52.573 237.618 1.00 105.24 ? 5   DG  C "C3'" 1 
ATOM   4778  O "O3'" . DG  C 3 5   ? 2.017   -51.358 238.075 1.00 99.74  ? 5   DG  C "O3'" 1 
ATOM   4779  C "C2'" . DG  C 3 5   ? 2.469   -53.607 237.195 1.00 104.16 ? 5   DG  C "C2'" 1 
ATOM   4780  C "C1'" . DG  C 3 5   ? 2.741   -54.372 238.487 1.00 104.20 ? 5   DG  C "C1'" 1 
ATOM   4781  N N9    . DG  C 3 5   ? 3.039   -55.788 238.299 1.00 101.62 ? 5   DG  C N9    1 
ATOM   4782  C C8    . DG  C 3 5   ? 2.393   -56.667 237.464 1.00 104.33 ? 5   DG  C C8    1 
ATOM   4783  N N7    . DG  C 3 5   ? 2.875   -57.879 237.514 1.00 99.12  ? 5   DG  C N7    1 
ATOM   4784  C C5    . DG  C 3 5   ? 3.902   -57.801 238.445 1.00 95.69  ? 5   DG  C C5    1 
ATOM   4785  C C6    . DG  C 3 5   ? 4.782   -58.807 238.912 1.00 95.96  ? 5   DG  C C6    1 
ATOM   4786  O O6    . DG  C 3 5   ? 4.830   -60.001 238.583 1.00 97.10  ? 5   DG  C O6    1 
ATOM   4787  N N1    . DG  C 3 5   ? 5.676   -58.307 239.855 1.00 94.99  ? 5   DG  C N1    1 
ATOM   4788  C C2    . DG  C 3 5   ? 5.711   -57.002 240.290 1.00 99.11  ? 5   DG  C C2    1 
ATOM   4789  N N2    . DG  C 3 5   ? 6.647   -56.712 241.206 1.00 103.43 ? 5   DG  C N2    1 
ATOM   4790  N N3    . DG  C 3 5   ? 4.889   -56.051 239.861 1.00 95.53  ? 5   DG  C N3    1 
ATOM   4791  C C4    . DG  C 3 5   ? 4.013   -56.521 238.940 1.00 95.77  ? 5   DG  C C4    1 
ATOM   4792  P P     . DG  C 3 6   ? 2.614   -50.298 237.025 1.00 105.58 ? 6   DG  C P     1 
ATOM   4793  O OP1   . DG  C 3 6   ? 2.310   -48.943 237.535 1.00 99.92  ? 6   DG  C OP1   1 
ATOM   4794  O OP2   . DG  C 3 6   ? 2.168   -50.692 235.670 1.00 113.00 ? 6   DG  C OP2   1 
ATOM   4795  O "O5'" . DG  C 3 6   ? 4.191   -50.533 237.106 1.00 108.92 ? 6   DG  C "O5'" 1 
ATOM   4796  C "C5'" . DG  C 3 6   ? 4.826   -50.461 238.374 1.00 102.69 ? 6   DG  C "C5'" 1 
ATOM   4797  C "C4'" . DG  C 3 6   ? 6.122   -51.245 238.368 1.00 97.61  ? 6   DG  C "C4'" 1 
ATOM   4798  O "O4'" . DG  C 3 6   ? 5.844   -52.651 238.150 1.00 96.54  ? 6   DG  C "O4'" 1 
ATOM   4799  C "C3'" . DG  C 3 6   ? 7.127   -50.834 237.295 1.00 98.83  ? 6   DG  C "C3'" 1 
ATOM   4800  O "O3'" . DG  C 3 6   ? 8.315   -50.447 237.961 1.00 104.02 ? 6   DG  C "O3'" 1 
ATOM   4801  C "C2'" . DG  C 3 6   ? 7.325   -52.103 236.463 1.00 94.50  ? 6   DG  C "C2'" 1 
ATOM   4802  C "C1'" . DG  C 3 6   ? 6.938   -53.197 237.450 1.00 94.73  ? 6   DG  C "C1'" 1 
ATOM   4803  N N9    . DG  C 3 6   ? 6.536   -54.462 236.834 1.00 97.94  ? 6   DG  C N9    1 
ATOM   4804  C C8    . DG  C 3 6   ? 5.516   -54.668 235.934 1.00 100.51 ? 6   DG  C C8    1 
ATOM   4805  N N7    . DG  C 3 6   ? 5.391   -55.912 235.559 1.00 97.69  ? 6   DG  C N7    1 
ATOM   4806  C C5    . DG  C 3 6   ? 6.393   -56.578 236.254 1.00 94.61  ? 6   DG  C C5    1 
ATOM   4807  C C6    . DG  C 3 6   ? 6.746   -57.949 236.251 1.00 92.74  ? 6   DG  C C6    1 
ATOM   4808  O O6    . DG  C 3 6   ? 6.225   -58.876 235.612 1.00 95.63  ? 6   DG  C O6    1 
ATOM   4809  N N1    . DG  C 3 6   ? 7.822   -58.202 237.101 1.00 92.45  ? 6   DG  C N1    1 
ATOM   4810  C C2    . DG  C 3 6   ? 8.472   -57.253 237.855 1.00 94.60  ? 6   DG  C C2    1 
ATOM   4811  N N2    . DG  C 3 6   ? 9.488   -57.687 238.616 1.00 94.58  ? 6   DG  C N2    1 
ATOM   4812  N N3    . DG  C 3 6   ? 8.150   -55.966 237.865 1.00 93.10  ? 6   DG  C N3    1 
ATOM   4813  C C4    . DG  C 3 6   ? 7.105   -55.700 237.043 1.00 94.65  ? 6   DG  C C4    1 
ATOM   4814  P P     . DA  C 3 7   ? 9.439   -49.574 237.213 1.00 92.10  ? 7   DA  C P     1 
ATOM   4815  O OP1   . DA  C 3 7   ? 9.639   -48.349 238.023 1.00 89.44  ? 7   DA  C OP1   1 
ATOM   4816  O OP2   . DA  C 3 7   ? 9.091   -49.456 235.778 1.00 95.29  ? 7   DA  C OP2   1 
ATOM   4817  O "O5'" . DA  C 3 7   ? 10.749  -50.489 237.314 1.00 88.88  ? 7   DA  C "O5'" 1 
ATOM   4818  C "C5'" . DA  C 3 7   ? 11.108  -51.067 238.569 1.00 84.82  ? 7   DA  C "C5'" 1 
ATOM   4819  C "C4'" . DA  C 3 7   ? 12.038  -52.257 238.387 1.00 81.56  ? 7   DA  C "C4'" 1 
ATOM   4820  O "O4'" . DA  C 3 7   ? 11.301  -53.396 237.869 1.00 85.97  ? 7   DA  C "O4'" 1 
ATOM   4821  C "C3'" . DA  C 3 7   ? 13.199  -52.040 237.419 1.00 82.28  ? 7   DA  C "C3'" 1 
ATOM   4822  O "O3'" . DA  C 3 7   ? 14.345  -52.708 237.884 1.00 82.95  ? 7   DA  C "O3'" 1 
ATOM   4823  C "C2'" . DA  C 3 7   ? 12.698  -52.692 236.136 1.00 87.64  ? 7   DA  C "C2'" 1 
ATOM   4824  C "C1'" . DA  C 3 7   ? 11.943  -53.881 236.707 1.00 88.81  ? 7   DA  C "C1'" 1 
ATOM   4825  N N9    . DA  C 3 7   ? 10.930  -54.415 235.807 1.00 88.56  ? 7   DA  C N9    1 
ATOM   4826  C C8    . DA  C 3 7   ? 10.000  -53.715 235.092 1.00 97.00  ? 7   DA  C C8    1 
ATOM   4827  N N7    . DA  C 3 7   ? 9.210   -54.477 234.368 1.00 98.35  ? 7   DA  C N7    1 
ATOM   4828  C C5    . DA  C 3 7   ? 9.656   -55.765 234.627 1.00 91.47  ? 7   DA  C C5    1 
ATOM   4829  C C6    . DA  C 3 7   ? 9.248   -57.036 234.173 1.00 83.28  ? 7   DA  C C6    1 
ATOM   4830  N N6    . DA  C 3 7   ? 8.247   -57.231 233.311 1.00 86.10  ? 7   DA  C N6    1 
ATOM   4831  N N1    . DA  C 3 7   ? 9.921   -58.110 234.637 1.00 86.91  ? 7   DA  C N1    1 
ATOM   4832  C C2    . DA  C 3 7   ? 10.930  -57.927 235.498 1.00 83.34  ? 7   DA  C C2    1 
ATOM   4833  N N3    . DA  C 3 7   ? 11.405  -56.786 235.994 1.00 81.46  ? 7   DA  C N3    1 
ATOM   4834  C C4    . DA  C 3 7   ? 10.717  -55.739 235.514 1.00 84.06  ? 7   DA  C C4    1 
ATOM   4835  P P     . DT  C 3 8   ? 15.810  -52.170 237.500 1.00 87.04  ? 8   DT  C P     1 
ATOM   4836  O OP1   . DT  C 3 8   ? 16.321  -51.377 238.644 1.00 101.48 ? 8   DT  C OP1   1 
ATOM   4837  O OP2   . DT  C 3 8   ? 15.726  -51.573 236.146 1.00 80.98  ? 8   DT  C OP2   1 
ATOM   4838  O "O5'" . DT  C 3 8   ? 16.697  -53.494 237.381 1.00 81.15  ? 8   DT  C "O5'" 1 
ATOM   4839  C "C5'" . DT  C 3 8   ? 16.401  -54.650 238.139 1.00 94.83  ? 8   DT  C "C5'" 1 
ATOM   4840  C "C4'" . DT  C 3 8   ? 16.386  -55.834 237.198 1.00 100.03 ? 8   DT  C "C4'" 1 
ATOM   4841  O "O4'" . DT  C 3 8   ? 15.179  -55.790 236.392 1.00 92.22  ? 8   DT  C "O4'" 1 
ATOM   4842  C "C3'" . DT  C 3 8   ? 17.546  -55.891 236.196 1.00 102.37 ? 8   DT  C "C3'" 1 
ATOM   4843  O "O3'" . DT  C 3 8   ? 17.939  -57.258 236.073 1.00 97.11  ? 8   DT  C "O3'" 1 
ATOM   4844  C "C2'" . DT  C 3 8   ? 16.887  -55.414 234.905 1.00 103.08 ? 8   DT  C "C2'" 1 
ATOM   4845  C "C1'" . DT  C 3 8   ? 15.621  -56.221 235.127 1.00 97.01  ? 8   DT  C "C1'" 1 
ATOM   4846  N N1    . DT  C 3 8   ? 14.543  -56.176 234.110 1.00 102.33 ? 8   DT  C N1    1 
ATOM   4847  C C2    . DT  C 3 8   ? 14.008  -55.033 233.544 1.00 113.01 ? 8   DT  C C2    1 
ATOM   4848  O O2    . DT  C 3 8   ? 14.382  -53.907 233.816 1.00 126.80 ? 8   DT  C O2    1 
ATOM   4849  N N3    . DT  C 3 8   ? 13.005  -55.261 232.623 1.00 96.97  ? 8   DT  C N3    1 
ATOM   4850  C C4    . DT  C 3 8   ? 12.506  -56.491 232.232 1.00 89.51  ? 8   DT  C C4    1 
ATOM   4851  O O4    . DT  C 3 8   ? 11.608  -56.610 231.403 1.00 92.26  ? 8   DT  C O4    1 
ATOM   4852  C C5    . DT  C 3 8   ? 13.130  -57.615 232.887 1.00 85.11  ? 8   DT  C C5    1 
ATOM   4853  C C7    . DT  C 3 8   ? 12.760  -59.027 232.636 1.00 85.57  ? 8   DT  C C7    1 
ATOM   4854  C C6    . DT  C 3 8   ? 14.087  -57.408 233.767 1.00 91.32  ? 8   DT  C C6    1 
ATOM   4855  P P     . DT  C 3 9   ? 19.432  -57.663 235.636 1.00 100.73 ? 9   DT  C P     1 
ATOM   4856  O OP1   . DT  C 3 9   ? 20.031  -58.335 236.809 1.00 107.30 ? 9   DT  C OP1   1 
ATOM   4857  O OP2   . DT  C 3 9   ? 20.098  -56.511 234.989 1.00 94.25  ? 9   DT  C OP2   1 
ATOM   4858  O "O5'" . DT  C 3 9   ? 19.204  -58.768 234.506 1.00 95.88  ? 9   DT  C "O5'" 1 
ATOM   4859  C "C5'" . DT  C 3 9   ? 18.136  -58.627 233.580 1.00 97.99  ? 9   DT  C "C5'" 1 
ATOM   4860  C "C4'" . DT  C 3 9   ? 18.029  -59.815 232.645 1.00 86.81  ? 9   DT  C "C4'" 1 
ATOM   4861  O "O4'" . DT  C 3 9   ? 16.674  -59.882 232.145 1.00 108.37 ? 9   DT  C "O4'" 1 
ATOM   4862  C "C3'" . DT  C 3 9   ? 18.973  -59.766 231.456 1.00 89.05  ? 9   DT  C "C3'" 1 
ATOM   4863  O "O3'" . DT  C 3 9   ? 19.875  -60.859 231.463 1.00 91.67  ? 9   DT  C "O3'" 1 
ATOM   4864  C "C2'" . DT  C 3 9   ? 18.071  -59.813 230.232 1.00 108.11 ? 9   DT  C "C2'" 1 
ATOM   4865  C "C1'" . DT  C 3 9   ? 16.641  -59.728 230.745 1.00 106.68 ? 9   DT  C "C1'" 1 
ATOM   4866  N N1    . DT  C 3 9   ? 15.958  -58.446 230.377 1.00 87.37  ? 9   DT  C N1    1 
ATOM   4867  C C2    . DT  C 3 9   ? 14.837  -58.494 229.583 1.00 122.67 ? 9   DT  C C2    1 
ATOM   4868  O O2    . DT  C 3 9   ? 14.370  -59.529 229.172 1.00 126.05 ? 9   DT  C O2    1 
ATOM   4869  N N3    . DT  C 3 9   ? 14.279  -57.281 229.294 1.00 88.28  ? 9   DT  C N3    1 
ATOM   4870  C C4    . DT  C 3 9   ? 14.727  -56.044 229.715 1.00 92.15  ? 9   DT  C C4    1 
ATOM   4871  O O4    . DT  C 3 9   ? 14.161  -55.003 229.399 1.00 86.42  ? 9   DT  C O4    1 
ATOM   4872  C C5    . DT  C 3 9   ? 15.905  -56.063 230.543 1.00 88.78  ? 9   DT  C C5    1 
ATOM   4873  C C7    . DT  C 3 9   ? 16.477  -54.780 231.054 1.00 83.32  ? 9   DT  C C7    1 
ATOM   4874  C C6    . DT  C 3 9   ? 16.461  -57.244 230.835 1.00 91.75  ? 9   DT  C C6    1 
ATOM   4875  P P     . DG  C 3 10  ? 21.285  -60.746 230.670 1.00 142.28 ? 10  DG  C P     1 
ATOM   4876  O OP1   . DG  C 3 10  ? 22.125  -61.907 231.116 1.00 62.14  ? 10  DG  C OP1   1 
ATOM   4877  O OP2   . DG  C 3 10  ? 21.783  -59.328 230.757 1.00 48.02  ? 10  DG  C OP2   1 
ATOM   4878  O "O5'" . DG  C 3 10  ? 20.921  -60.995 229.111 1.00 75.54  ? 10  DG  C "O5'" 1 
ATOM   4879  C "C5'" . DG  C 3 10  ? 20.564  -62.289 228.689 1.00 80.17  ? 10  DG  C "C5'" 1 
ATOM   4880  C "C4'" . DG  C 3 10  ? 19.761  -62.227 227.408 1.00 82.61  ? 10  DG  C "C4'" 1 
ATOM   4881  O "O4'" . DG  C 3 10  ? 18.663  -61.312 227.585 1.00 90.44  ? 10  DG  C "O4'" 1 
ATOM   4882  C "C3'" . DG  C 3 10  ? 20.535  -61.685 226.221 1.00 78.56  ? 10  DG  C "C3'" 1 
ATOM   4883  O "O3'" . DG  C 3 10  ? 21.000  -62.785 225.473 1.00 80.40  ? 10  DG  C "O3'" 1 
ATOM   4884  C "C2'" . DG  C 3 10  ? 19.519  -60.870 225.428 1.00 80.30  ? 10  DG  C "C2'" 1 
ATOM   4885  C "C1'" . DG  C 3 10  ? 18.296  -60.806 226.330 1.00 88.45  ? 10  DG  C "C1'" 1 
ATOM   4886  N N9    . DG  C 3 10  ? 17.822  -59.458 226.551 1.00 90.67  ? 10  DG  C N9    1 
ATOM   4887  C C8    . DG  C 3 10  ? 18.499  -58.452 227.186 1.00 90.86  ? 10  DG  C C8    1 
ATOM   4888  N N7    . DG  C 3 10  ? 17.826  -57.326 227.239 1.00 94.48  ? 10  DG  C N7    1 
ATOM   4889  C C5    . DG  C 3 10  ? 16.628  -57.627 226.614 1.00 94.69  ? 10  DG  C C5    1 
ATOM   4890  C C6    . DG  C 3 10  ? 15.513  -56.807 226.367 1.00 99.94  ? 10  DG  C C6    1 
ATOM   4891  O O6    . DG  C 3 10  ? 15.354  -55.622 226.678 1.00 103.22 ? 10  DG  C O6    1 
ATOM   4892  N N1    . DG  C 3 10  ? 14.508  -57.494 225.688 1.00 100.88 ? 10  DG  C N1    1 
ATOM   4893  C C2    . DG  C 3 10  ? 14.577  -58.812 225.295 1.00 99.30  ? 10  DG  C C2    1 
ATOM   4894  N N2    . DG  C 3 10  ? 13.514  -59.305 224.647 1.00 102.26 ? 10  DG  C N2    1 
ATOM   4895  N N3    . DG  C 3 10  ? 15.625  -59.595 225.513 1.00 94.21  ? 10  DG  C N3    1 
ATOM   4896  C C4    . DG  C 3 10  ? 16.610  -58.933 226.175 1.00 92.76  ? 10  DG  C C4    1 
ATOM   4897  P P     . DG  D 4 1   ? -36.707 -31.901 220.350 1.00 195.33 ? 1   DG  D P     1 
ATOM   4898  O OP1   . DG  D 4 1   ? -37.702 -31.189 221.186 1.00 198.96 ? 1   DG  D OP1   1 
ATOM   4899  O OP2   . DG  D 4 1   ? -37.114 -33.092 219.571 1.00 199.42 ? 1   DG  D OP2   1 
ATOM   4900  O "O5'" . DG  D 4 1   ? -35.450 -32.308 221.254 1.00 213.22 ? 1   DG  D "O5'" 1 
ATOM   4901  C "C5'" . DG  D 4 1   ? -34.332 -32.968 220.666 1.00 211.87 ? 1   DG  D "C5'" 1 
ATOM   4902  C "C4'" . DG  D 4 1   ? -33.742 -32.144 219.536 1.00 213.01 ? 1   DG  D "C4'" 1 
ATOM   4903  O "O4'" . DG  D 4 1   ? -33.467 -30.801 220.018 1.00 211.28 ? 1   DG  D "O4'" 1 
ATOM   4904  C "C3'" . DG  D 4 1   ? -32.396 -32.628 219.012 1.00 207.80 ? 1   DG  D "C3'" 1 
ATOM   4905  O "O3'" . DG  D 4 1   ? -32.132 -32.004 217.765 1.00 209.21 ? 1   DG  D "O3'" 1 
ATOM   4906  C "C2'" . DG  D 4 1   ? -31.493 -31.995 220.056 1.00 200.70 ? 1   DG  D "C2'" 1 
ATOM   4907  C "C1'" . DG  D 4 1   ? -32.072 -30.596 219.897 1.00 203.38 ? 1   DG  D "C1'" 1 
ATOM   4908  N N9    . DG  D 4 1   ? -31.599 -29.588 220.843 1.00 198.66 ? 1   DG  D N9    1 
ATOM   4909  C C8    . DG  D 4 1   ? -31.588 -29.640 222.217 1.00 196.34 ? 1   DG  D C8    1 
ATOM   4910  N N7    . DG  D 4 1   ? -31.095 -28.565 222.769 1.00 193.57 ? 1   DG  D N7    1 
ATOM   4911  C C5    . DG  D 4 1   ? -30.759 -27.751 221.693 1.00 194.03 ? 1   DG  D C5    1 
ATOM   4912  C C6    . DG  D 4 1   ? -30.183 -26.459 221.665 1.00 193.07 ? 1   DG  D C6    1 
ATOM   4913  O O6    . DG  D 4 1   ? -29.844 -25.753 222.624 1.00 191.29 ? 1   DG  D O6    1 
ATOM   4914  N N1    . DG  D 4 1   ? -30.008 -25.996 220.362 1.00 194.27 ? 1   DG  D N1    1 
ATOM   4915  C C2    . DG  D 4 1   ? -30.349 -26.695 219.228 1.00 196.06 ? 1   DG  D C2    1 
ATOM   4916  N N2    . DG  D 4 1   ? -30.108 -26.090 218.055 1.00 196.03 ? 1   DG  D N2    1 
ATOM   4917  N N3    . DG  D 4 1   ? -30.889 -27.906 219.241 1.00 197.65 ? 1   DG  D N3    1 
ATOM   4918  C C4    . DG  D 4 1   ? -31.064 -28.368 220.503 1.00 196.61 ? 1   DG  D C4    1 
ATOM   4919  P P     . DA  D 4 2   ? -32.219 -32.835 216.394 1.00 220.24 ? 2   DA  D P     1 
ATOM   4920  O OP1   . DA  D 4 2   ? -33.623 -32.778 215.927 1.00 227.36 ? 2   DA  D OP1   1 
ATOM   4921  O OP2   . DA  D 4 2   ? -31.562 -34.142 216.613 1.00 218.52 ? 2   DA  D OP2   1 
ATOM   4922  O "O5'" . DA  D 4 2   ? -31.309 -31.993 215.381 1.00 199.33 ? 2   DA  D "O5'" 1 
ATOM   4923  C "C5'" . DA  D 4 2   ? -29.896 -31.957 215.561 1.00 192.62 ? 2   DA  D "C5'" 1 
ATOM   4924  C "C4'" . DA  D 4 2   ? -29.308 -30.640 215.088 1.00 189.45 ? 2   DA  D "C4'" 1 
ATOM   4925  O "O4'" . DA  D 4 2   ? -29.257 -29.704 216.199 1.00 185.46 ? 2   DA  D "O4'" 1 
ATOM   4926  C "C3'" . DA  D 4 2   ? -27.875 -30.734 214.571 1.00 185.59 ? 2   DA  D "C3'" 1 
ATOM   4927  O "O3'" . DA  D 4 2   ? -27.679 -29.807 213.507 1.00 187.60 ? 2   DA  D "O3'" 1 
ATOM   4928  C "C2'" . DA  D 4 2   ? -27.071 -30.338 215.802 1.00 178.77 ? 2   DA  D "C2'" 1 
ATOM   4929  C "C1'" . DA  D 4 2   ? -27.944 -29.187 216.279 1.00 180.07 ? 2   DA  D "C1'" 1 
ATOM   4930  N N9    . DA  D 4 2   ? -27.655 -28.722 217.634 1.00 176.30 ? 2   DA  D N9    1 
ATOM   4931  C C8    . DA  D 4 2   ? -27.222 -27.473 217.986 1.00 172.94 ? 2   DA  D C8    1 
ATOM   4932  N N7    . DA  D 4 2   ? -27.035 -27.316 219.275 1.00 169.86 ? 2   DA  D N7    1 
ATOM   4933  C C5    . DA  D 4 2   ? -27.366 -28.550 219.807 1.00 171.05 ? 2   DA  D C5    1 
ATOM   4934  C C6    . DA  D 4 2   ? -27.378 -29.039 221.129 1.00 168.84 ? 2   DA  D C6    1 
ATOM   4935  N N6    . DA  D 4 2   ? -27.033 -28.302 222.189 1.00 165.14 ? 2   DA  D N6    1 
ATOM   4936  N N1    . DA  D 4 2   ? -27.759 -30.318 221.320 1.00 171.13 ? 2   DA  D N1    1 
ATOM   4937  C C2    . DA  D 4 2   ? -28.102 -31.053 220.257 1.00 173.97 ? 2   DA  D C2    1 
ATOM   4938  N N3    . DA  D 4 2   ? -28.132 -30.706 218.971 1.00 175.60 ? 2   DA  D N3    1 
ATOM   4939  C C4    . DA  D 4 2   ? -27.749 -29.430 218.811 1.00 174.65 ? 2   DA  D C4    1 
ATOM   4940  P P     . DA  D 4 3   ? -26.331 -29.844 212.631 1.00 193.44 ? 3   DA  D P     1 
ATOM   4941  O OP1   . DA  D 4 3   ? -26.620 -29.177 211.343 1.00 196.60 ? 3   DA  D OP1   1 
ATOM   4942  O OP2   . DA  D 4 3   ? -25.810 -31.229 212.643 1.00 192.74 ? 3   DA  D OP2   1 
ATOM   4943  O "O5'" . DA  D 4 3   ? -25.310 -28.930 213.455 1.00 159.78 ? 3   DA  D "O5'" 1 
ATOM   4944  C "C5'" . DA  D 4 3   ? -25.533 -27.529 213.548 1.00 157.99 ? 3   DA  D "C5'" 1 
ATOM   4945  C "C4'" . DA  D 4 3   ? -24.460 -26.875 214.400 1.00 151.27 ? 3   DA  D "C4'" 1 
ATOM   4946  O "O4'" . DA  D 4 3   ? -24.753 -27.139 215.795 1.00 149.04 ? 3   DA  D "O4'" 1 
ATOM   4947  C "C3'" . DA  D 4 3   ? -23.031 -27.355 214.137 1.00 148.13 ? 3   DA  D "C3'" 1 
ATOM   4948  O "O3'" . DA  D 4 3   ? -22.255 -26.263 213.594 1.00 148.60 ? 3   DA  D "O3'" 1 
ATOM   4949  C "C2'" . DA  D 4 3   ? -22.545 -27.881 215.492 1.00 143.19 ? 3   DA  D "C2'" 1 
ATOM   4950  C "C1'" . DA  D 4 3   ? -23.554 -27.353 216.504 1.00 144.59 ? 3   DA  D "C1'" 1 
ATOM   4951  N N9    . DA  D 4 3   ? -23.826 -28.309 217.572 1.00 146.06 ? 3   DA  D N9    1 
ATOM   4952  C C8    . DA  D 4 3   ? -24.195 -29.615 217.416 1.00 148.70 ? 3   DA  D C8    1 
ATOM   4953  N N7    . DA  D 4 3   ? -24.378 -30.258 218.544 1.00 149.36 ? 3   DA  D N7    1 
ATOM   4954  C C5    . DA  D 4 3   ? -24.109 -29.305 219.510 1.00 147.61 ? 3   DA  D C5    1 
ATOM   4955  C C6    . DA  D 4 3   ? -24.124 -29.360 220.916 1.00 146.80 ? 3   DA  D C6    1 
ATOM   4956  N N6    . DA  D 4 3   ? -24.438 -30.464 221.600 1.00 145.91 ? 3   DA  D N6    1 
ATOM   4957  N N1    . DA  D 4 3   ? -23.808 -28.236 221.591 1.00 147.20 ? 3   DA  D N1    1 
ATOM   4958  C C2    . DA  D 4 3   ? -23.496 -27.135 220.897 1.00 147.77 ? 3   DA  D C2    1 
ATOM   4959  N N3    . DA  D 4 3   ? -23.447 -26.962 219.575 1.00 147.25 ? 3   DA  D N3    1 
ATOM   4960  C C4    . DA  D 4 3   ? -23.768 -28.096 218.932 1.00 146.75 ? 3   DA  D C4    1 
ATOM   4961  P P     . DT  D 4 4   ? -20.665 -26.149 213.836 1.00 142.68 ? 4   DT  D P     1 
ATOM   4962  O OP1   . DT  D 4 4   ? -20.174 -25.098 212.919 1.00 141.62 ? 4   DT  D OP1   1 
ATOM   4963  O OP2   . DT  D 4 4   ? -20.028 -27.485 213.788 1.00 137.89 ? 4   DT  D OP2   1 
ATOM   4964  O "O5'" . DT  D 4 4   ? -20.547 -25.596 215.330 1.00 134.66 ? 4   DT  D "O5'" 1 
ATOM   4965  C "C5'" . DT  D 4 4   ? -19.307 -25.701 215.986 1.00 129.85 ? 4   DT  D "C5'" 1 
ATOM   4966  C "C4'" . DT  D 4 4   ? -19.463 -25.816 217.486 1.00 130.93 ? 4   DT  D "C4'" 1 
ATOM   4967  O "O4'" . DT  D 4 4   ? -20.340 -26.907 217.846 1.00 134.49 ? 4   DT  D "O4'" 1 
ATOM   4968  C "C3'" . DT  D 4 4   ? -18.168 -26.186 218.181 1.00 130.39 ? 4   DT  D "C3'" 1 
ATOM   4969  O "O3'" . DT  D 4 4   ? -17.398 -25.021 218.386 1.00 127.01 ? 4   DT  D "O3'" 1 
ATOM   4970  C "C2'" . DT  D 4 4   ? -18.640 -26.802 219.495 1.00 133.44 ? 4   DT  D "C2'" 1 
ATOM   4971  C "C1'" . DT  D 4 4   ? -20.097 -27.178 219.214 1.00 136.08 ? 4   DT  D "C1'" 1 
ATOM   4972  N N1    . DT  D 4 4   ? -20.449 -28.598 219.550 1.00 138.25 ? 4   DT  D N1    1 
ATOM   4973  C C2    . DT  D 4 4   ? -20.480 -28.967 220.879 1.00 137.31 ? 4   DT  D C2    1 
ATOM   4974  O O2    . DT  D 4 4   ? -20.230 -28.203 221.795 1.00 135.35 ? 4   DT  D O2    1 
ATOM   4975  N N3    . DT  D 4 4   ? -20.815 -30.277 221.104 1.00 139.26 ? 4   DT  D N3    1 
ATOM   4976  C C4    . DT  D 4 4   ? -21.119 -31.236 220.158 1.00 139.41 ? 4   DT  D C4    1 
ATOM   4977  O O4    . DT  D 4 4   ? -21.408 -32.389 220.465 1.00 139.48 ? 4   DT  D O4    1 
ATOM   4978  C C5    . DT  D 4 4   ? -21.072 -30.788 218.788 1.00 140.54 ? 4   DT  D C5    1 
ATOM   4979  C C7    . DT  D 4 4   ? -21.385 -31.749 217.679 1.00 142.99 ? 4   DT  D C7    1 
ATOM   4980  C C6    . DT  D 4 4   ? -20.744 -29.508 218.551 1.00 140.50 ? 4   DT  D C6    1 
ATOM   4981  P P     . DG  D 4 5   ? -15.799 -25.126 218.442 1.00 127.39 ? 5   DG  D P     1 
ATOM   4982  O OP1   . DG  D 4 5   ? -15.245 -23.776 218.198 1.00 133.81 ? 5   DG  D OP1   1 
ATOM   4983  O OP2   . DG  D 4 5   ? -15.407 -26.258 217.574 1.00 120.34 ? 5   DG  D OP2   1 
ATOM   4984  O "O5'" . DG  D 4 5   ? -15.505 -25.556 219.951 1.00 128.42 ? 5   DG  D "O5'" 1 
ATOM   4985  C "C5'" . DG  D 4 5   ? -16.083 -24.820 221.018 1.00 119.20 ? 5   DG  D "C5'" 1 
ATOM   4986  C "C4'" . DG  D 4 5   ? -15.932 -25.616 222.296 1.00 122.27 ? 5   DG  D "C4'" 1 
ATOM   4987  O "O4'" . DG  D 4 5   ? -16.818 -26.761 222.264 1.00 125.31 ? 5   DG  D "O4'" 1 
ATOM   4988  C "C3'" . DG  D 4 5   ? -14.524 -26.159 222.500 1.00 119.16 ? 5   DG  D "C3'" 1 
ATOM   4989  O "O3'" . DG  D 4 5   ? -13.980 -25.570 223.669 1.00 120.62 ? 5   DG  D "O3'" 1 
ATOM   4990  C "C2'" . DG  D 4 5   ? -14.692 -27.673 222.633 1.00 123.93 ? 5   DG  D "C2'" 1 
ATOM   4991  C "C1'" . DG  D 4 5   ? -16.183 -27.848 222.901 1.00 128.91 ? 5   DG  D "C1'" 1 
ATOM   4992  N N9    . DG  D 4 5   ? -16.730 -29.093 222.366 1.00 136.68 ? 5   DG  D N9    1 
ATOM   4993  C C8    . DG  D 4 5   ? -16.948 -29.406 221.046 1.00 138.57 ? 5   DG  D C8    1 
ATOM   4994  N N7    . DG  D 4 5   ? -17.450 -30.596 220.866 1.00 141.35 ? 5   DG  D N7    1 
ATOM   4995  C C5    . DG  D 4 5   ? -17.574 -31.110 222.151 1.00 142.51 ? 5   DG  D C5    1 
ATOM   4996  C C6    . DG  D 4 5   ? -18.060 -32.366 222.590 1.00 145.28 ? 5   DG  D C6    1 
ATOM   4997  O O6    . DG  D 4 5   ? -18.493 -33.306 221.909 1.00 146.62 ? 5   DG  D O6    1 
ATOM   4998  N N1    . DG  D 4 5   ? -18.013 -32.479 223.977 1.00 146.90 ? 5   DG  D N1    1 
ATOM   4999  C C2    . DG  D 4 5   ? -17.556 -31.504 224.832 1.00 146.58 ? 5   DG  D C2    1 
ATOM   5000  N N2    . DG  D 4 5   ? -17.588 -31.798 226.140 1.00 148.93 ? 5   DG  D N2    1 
ATOM   5001  N N3    . DG  D 4 5   ? -17.097 -30.324 224.434 1.00 144.27 ? 5   DG  D N3    1 
ATOM   5002  C C4    . DG  D 4 5   ? -17.136 -30.196 223.085 1.00 141.18 ? 5   DG  D C4    1 
ATOM   5003  P P     . DT  D 4 6   ? -12.411 -25.695 223.989 1.00 128.37 ? 6   DT  D P     1 
ATOM   5004  O OP1   . DT  D 4 6   ? -11.989 -24.427 224.627 1.00 131.76 ? 6   DT  D OP1   1 
ATOM   5005  O OP2   . DT  D 4 6   ? -11.730 -26.173 222.764 1.00 123.79 ? 6   DT  D OP2   1 
ATOM   5006  O "O5'" . DT  D 4 6   ? -12.340 -26.872 225.066 1.00 122.91 ? 6   DT  D "O5'" 1 
ATOM   5007  C "C5'" . DT  D 4 6   ? -13.307 -26.925 226.103 1.00 125.04 ? 6   DT  D "C5'" 1 
ATOM   5008  C "C4'" . DT  D 4 6   ? -13.446 -28.343 226.625 1.00 126.46 ? 6   DT  D "C4'" 1 
ATOM   5009  O "O4'" . DT  D 4 6   ? -14.085 -29.182 225.635 1.00 127.51 ? 6   DT  D "O4'" 1 
ATOM   5010  C "C3'" . DT  D 4 6   ? -12.132 -29.043 226.965 1.00 128.02 ? 6   DT  D "C3'" 1 
ATOM   5011  O "O3'" . DT  D 4 6   ? -11.999 -29.083 228.381 1.00 131.56 ? 6   DT  D "O3'" 1 
ATOM   5012  C "C2'" . DT  D 4 6   ? -12.266 -30.444 226.361 1.00 130.61 ? 6   DT  D "C2'" 1 
ATOM   5013  C "C1'" . DT  D 4 6   ? -13.734 -30.510 225.951 1.00 129.89 ? 6   DT  D "C1'" 1 
ATOM   5014  N N1    . DT  D 4 6   ? -14.010 -31.386 224.775 1.00 132.65 ? 6   DT  D N1    1 
ATOM   5015  C C2    . DT  D 4 6   ? -14.594 -32.617 224.985 1.00 138.68 ? 6   DT  D C2    1 
ATOM   5016  O O2    . DT  D 4 6   ? -14.899 -33.033 226.089 1.00 142.53 ? 6   DT  D O2    1 
ATOM   5017  N N3    . DT  D 4 6   ? -14.813 -33.350 223.846 1.00 138.40 ? 6   DT  D N3    1 
ATOM   5018  C C4    . DT  D 4 6   ? -14.510 -32.980 222.548 1.00 134.73 ? 6   DT  D C4    1 
ATOM   5019  O O4    . DT  D 4 6   ? -14.744 -33.708 221.589 1.00 134.09 ? 6   DT  D O4    1 
ATOM   5020  C C5    . DT  D 4 6   ? -13.902 -31.682 222.400 1.00 130.92 ? 6   DT  D C5    1 
ATOM   5021  C C7    . DT  D 4 6   ? -13.533 -31.179 221.036 1.00 129.27 ? 6   DT  D C7    1 
ATOM   5022  C C6    . DT  D 4 6   ? -13.684 -30.956 223.505 1.00 130.32 ? 6   DT  D C6    1 
ATOM   5023  P P     . DG  D 4 7   ? -10.682 -29.698 229.065 1.00 231.72 ? 7   DG  D P     1 
ATOM   5024  O OP1   . DG  D 4 7   ? -10.518 -29.023 230.370 1.00 97.17  ? 7   DG  D OP1   1 
ATOM   5025  O OP2   . DG  D 4 7   ? -9.577  -29.687 228.084 1.00 104.08 ? 7   DG  D OP2   1 
ATOM   5026  O "O5'" . DG  D 4 7   ? -11.070 -31.224 229.324 1.00 132.53 ? 7   DG  D "O5'" 1 
ATOM   5027  C "C5'" . DG  D 4 7   ? -12.313 -31.540 229.935 1.00 137.07 ? 7   DG  D "C5'" 1 
ATOM   5028  C "C4'" . DG  D 4 7   ? -12.511 -33.041 229.914 1.00 139.08 ? 7   DG  D "C4'" 1 
ATOM   5029  O "O4'" . DG  D 4 7   ? -12.950 -33.444 228.592 1.00 138.93 ? 7   DG  D "O4'" 1 
ATOM   5030  C "C3'" . DG  D 4 7   ? -11.241 -33.835 230.221 1.00 140.62 ? 7   DG  D "C3'" 1 
ATOM   5031  O "O3'" . DG  D 4 7   ? -11.469 -34.765 231.277 1.00 142.70 ? 7   DG  D "O3'" 1 
ATOM   5032  C "C2'" . DG  D 4 7   ? -10.934 -34.553 228.910 1.00 139.17 ? 7   DG  D "C2'" 1 
ATOM   5033  C "C1'" . DG  D 4 7   ? -12.310 -34.657 228.269 1.00 138.75 ? 7   DG  D "C1'" 1 
ATOM   5034  N N9    . DG  D 4 7   ? -12.241 -34.797 226.820 1.00 137.85 ? 7   DG  D N9    1 
ATOM   5035  C C8    . DG  D 4 7   ? -11.786 -33.866 225.919 1.00 137.41 ? 7   DG  D C8    1 
ATOM   5036  N N7    . DG  D 4 7   ? -11.837 -34.275 224.682 1.00 137.22 ? 7   DG  D N7    1 
ATOM   5037  C C5    . DG  D 4 7   ? -12.356 -35.560 224.770 1.00 137.25 ? 7   DG  D C5    1 
ATOM   5038  C C6    . DG  D 4 7   ? -12.637 -36.500 223.752 1.00 139.59 ? 7   DG  D C6    1 
ATOM   5039  O O6    . DG  D 4 7   ? -12.477 -36.376 222.530 1.00 140.10 ? 7   DG  D O6    1 
ATOM   5040  N N1    . DG  D 4 7   ? -13.156 -37.684 224.273 1.00 142.21 ? 7   DG  D N1    1 
ATOM   5041  C C2    . DG  D 4 7   ? -13.374 -37.928 225.609 1.00 141.15 ? 7   DG  D C2    1 
ATOM   5042  N N2    . DG  D 4 7   ? -13.881 -39.130 225.919 1.00 140.01 ? 7   DG  D N2    1 
ATOM   5043  N N3    . DG  D 4 7   ? -13.115 -37.054 226.573 1.00 139.43 ? 7   DG  D N3    1 
ATOM   5044  C C4    . DG  D 4 7   ? -12.609 -35.897 226.080 1.00 137.99 ? 7   DG  D C4    1 
ATOM   5045  P P     . DT  D 4 8   ? -10.262 -35.219 232.239 1.00 161.98 ? 8   DT  D P     1 
ATOM   5046  O OP1   . DT  D 4 8   ? -10.487 -34.593 233.561 1.00 162.23 ? 8   DT  D OP1   1 
ATOM   5047  O OP2   . DT  D 4 8   ? -8.985  -34.997 231.526 1.00 160.72 ? 8   DT  D OP2   1 
ATOM   5048  O "O5'" . DT  D 4 8   ? -10.450 -36.802 232.368 1.00 133.45 ? 8   DT  D "O5'" 1 
ATOM   5049  C "C5'" . DT  D 4 8   ? -9.740  -37.677 231.497 1.00 136.72 ? 8   DT  D "C5'" 1 
ATOM   5050  C "C4'" . DT  D 4 8   ? -10.600 -38.865 231.104 1.00 141.47 ? 8   DT  D "C4'" 1 
ATOM   5051  O "O4'" . DT  D 4 8   ? -11.440 -38.486 229.981 1.00 147.48 ? 8   DT  D "O4'" 1 
ATOM   5052  C "C3'" . DT  D 4 8   ? -9.849  -40.095 230.604 1.00 140.10 ? 8   DT  D "C3'" 1 
ATOM   5053  O "O3'" . DT  D 4 8   ? -9.269  -40.851 231.704 1.00 132.56 ? 8   DT  D "O3'" 1 
ATOM   5054  C "C2'" . DT  D 4 8   ? -10.951 -40.779 229.800 1.00 144.08 ? 8   DT  D "C2'" 1 
ATOM   5055  C "C1'" . DT  D 4 8   ? -11.574 -39.580 229.091 1.00 150.43 ? 8   DT  D "C1'" 1 
ATOM   5056  N N1    . DT  D 4 8   ? -10.924 -39.234 227.783 1.00 157.20 ? 8   DT  D N1    1 
ATOM   5057  C C2    . DT  D 4 8   ? -10.968 -40.132 226.733 1.00 160.53 ? 8   DT  D C2    1 
ATOM   5058  O O2    . DT  D 4 8   ? -11.512 -41.222 226.790 1.00 158.50 ? 8   DT  D O2    1 
ATOM   5059  N N3    . DT  D 4 8   ? -10.341 -39.705 225.589 1.00 164.47 ? 8   DT  D N3    1 
ATOM   5060  C C4    . DT  D 4 8   ? -9.692  -38.501 225.389 1.00 162.72 ? 8   DT  D C4    1 
ATOM   5061  O O4    . DT  D 4 8   ? -9.161  -38.210 224.322 1.00 162.10 ? 8   DT  D O4    1 
ATOM   5062  C C5    . DT  D 4 8   ? -9.683  -37.612 226.521 1.00 161.20 ? 8   DT  D C5    1 
ATOM   5063  C C7    . DT  D 4 8   ? -9.004  -36.278 226.416 1.00 162.87 ? 8   DT  D C7    1 
ATOM   5064  C C6    . DT  D 4 8   ? -10.290 -38.014 227.646 1.00 159.27 ? 8   DT  D C6    1 
ATOM   5065  P P     . DG  D 4 9   ? -9.940  -42.207 232.262 1.00 158.61 ? 9   DG  D P     1 
ATOM   5066  O OP1   . DG  D 4 9   ? -11.364 -41.951 232.572 1.00 160.30 ? 9   DG  D OP1   1 
ATOM   5067  O OP2   . DG  D 4 9   ? -9.057  -42.704 233.341 1.00 157.76 ? 9   DG  D OP2   1 
ATOM   5068  O "O5'" . DG  D 4 9   ? -9.808  -43.250 231.054 1.00 147.80 ? 9   DG  D "O5'" 1 
ATOM   5069  C "C5'" . DG  D 4 9   ? -10.793 -44.265 230.866 1.00 147.89 ? 9   DG  D "C5'" 1 
ATOM   5070  C "C4'" . DG  D 4 9   ? -10.372 -45.222 229.764 1.00 149.97 ? 9   DG  D "C4'" 1 
ATOM   5071  O "O4'" . DG  D 4 9   ? -10.190 -44.505 228.515 1.00 154.47 ? 9   DG  D "O4'" 1 
ATOM   5072  C "C3'" . DG  D 4 9   ? -9.070  -45.963 230.040 1.00 149.05 ? 9   DG  D "C3'" 1 
ATOM   5073  O "O3'" . DG  D 4 9   ? -9.259  -47.341 229.758 1.00 145.69 ? 9   DG  D "O3'" 1 
ATOM   5074  C "C2'" . DG  D 4 9   ? -8.047  -45.318 229.107 1.00 150.90 ? 9   DG  D "C2'" 1 
ATOM   5075  C "C1'" . DG  D 4 9   ? -8.897  -44.730 227.988 1.00 155.22 ? 9   DG  D "C1'" 1 
ATOM   5076  N N9    . DG  D 4 9   ? -8.386  -43.450 227.510 1.00 160.06 ? 9   DG  D N9    1 
ATOM   5077  C C8    . DG  D 4 9   ? -7.993  -42.380 228.278 1.00 160.85 ? 9   DG  D C8    1 
ATOM   5078  N N7    . DG  D 4 9   ? -7.583  -41.360 227.576 1.00 161.31 ? 9   DG  D N7    1 
ATOM   5079  C C5    . DG  D 4 9   ? -7.715  -41.779 226.258 1.00 162.24 ? 9   DG  D C5    1 
ATOM   5080  C C6    . DG  D 4 9   ? -7.425  -41.099 225.052 1.00 164.52 ? 9   DG  D C6    1 
ATOM   5081  O O6    . DG  D 4 9   ? -6.978  -39.953 224.903 1.00 167.33 ? 9   DG  D O6    1 
ATOM   5082  N N1    . DG  D 4 9   ? -7.706  -41.889 223.938 1.00 164.26 ? 9   DG  D N1    1 
ATOM   5083  C C2    . DG  D 4 9   ? -8.203  -43.170 223.985 1.00 160.53 ? 9   DG  D C2    1 
ATOM   5084  N N2    . DG  D 4 9   ? -8.409  -43.772 222.804 1.00 158.68 ? 9   DG  D N2    1 
ATOM   5085  N N3    . DG  D 4 9   ? -8.478  -43.818 225.109 1.00 160.38 ? 9   DG  D N3    1 
ATOM   5086  C C4    . DG  D 4 9   ? -8.210  -43.063 226.202 1.00 161.56 ? 9   DG  D C4    1 
ATOM   5087  P P     . DT  D 4 10  ? -8.038  -48.372 229.913 1.00 181.85 ? 10  DT  D P     1 
ATOM   5088  O OP1   . DT  D 4 10  ? -8.613  -49.708 230.184 1.00 183.26 ? 10  DT  D OP1   1 
ATOM   5089  O OP2   . DT  D 4 10  ? -7.065  -47.784 230.861 1.00 178.32 ? 10  DT  D OP2   1 
ATOM   5090  O "O5'" . DT  D 4 10  ? -7.371  -48.389 228.461 1.00 139.74 ? 10  DT  D "O5'" 1 
ATOM   5091  C "C5'" . DT  D 4 10  ? -8.166  -48.727 227.332 1.00 142.50 ? 10  DT  D "C5'" 1 
ATOM   5092  C "C4'" . DT  D 4 10  ? -7.305  -48.795 226.085 1.00 150.97 ? 10  DT  D "C4'" 1 
ATOM   5093  O "O4'" . DT  D 4 10  ? -7.135  -47.471 225.525 1.00 157.45 ? 10  DT  D "O4'" 1 
ATOM   5094  C "C3'" . DT  D 4 10  ? -5.908  -49.353 226.329 1.00 152.06 ? 10  DT  D "C3'" 1 
ATOM   5095  O "O3'" . DT  D 4 10  ? -5.760  -50.551 225.587 1.00 155.86 ? 10  DT  D "O3'" 1 
ATOM   5096  C "C2'" . DT  D 4 10  ? -4.944  -48.266 225.853 1.00 150.99 ? 10  DT  D "C2'" 1 
ATOM   5097  C "C1'" . DT  D 4 10  ? -5.823  -47.339 225.023 1.00 155.84 ? 10  DT  D "C1'" 1 
ATOM   5098  N N1    . DT  D 4 10  ? -5.442  -45.903 225.129 1.00 158.08 ? 10  DT  D N1    1 
ATOM   5099  C C2    . DT  D 4 10  ? -5.296  -45.166 223.975 1.00 159.11 ? 10  DT  D C2    1 
ATOM   5100  O O2    . DT  D 4 10  ? -5.461  -45.631 222.860 1.00 159.22 ? 10  DT  D O2    1 
ATOM   5101  N N3    . DT  D 4 10  ? -4.946  -43.855 224.179 1.00 159.18 ? 10  DT  D N3    1 
ATOM   5102  C C4    . DT  D 4 10  ? -4.735  -43.226 225.393 1.00 156.87 ? 10  DT  D C4    1 
ATOM   5103  O O4    . DT  D 4 10  ? -4.423  -42.042 225.470 1.00 155.14 ? 10  DT  D O4    1 
ATOM   5104  C C5    . DT  D 4 10  ? -4.906  -44.055 226.559 1.00 156.21 ? 10  DT  D C5    1 
ATOM   5105  C C7    . DT  D 4 10  ? -4.701  -43.479 227.929 1.00 155.09 ? 10  DT  D C7    1 
ATOM   5106  C C6    . DT  D 4 10  ? -5.247  -45.338 226.374 1.00 156.70 ? 10  DT  D C6    1 
ATOM   5107  P P     . DC  D 4 11  ? -4.532  -51.540 225.889 1.00 149.67 ? 11  DC  D P     1 
ATOM   5108  O OP1   . DC  D 4 11  ? -4.989  -52.921 225.621 1.00 151.65 ? 11  DC  D OP1   1 
ATOM   5109  O OP2   . DC  D 4 11  ? -3.986  -51.187 227.218 1.00 142.85 ? 11  DC  D OP2   1 
ATOM   5110  O "O5'" . DC  D 4 11  ? -3.444  -51.134 224.793 1.00 162.98 ? 11  DC  D "O5'" 1 
ATOM   5111  C "C5'" . DC  D 4 11  ? -3.799  -51.083 223.417 1.00 163.87 ? 11  DC  D "C5'" 1 
ATOM   5112  C "C4'" . DC  D 4 11  ? -2.612  -50.570 222.629 1.00 165.14 ? 11  DC  D "C4'" 1 
ATOM   5113  O "O4'" . DC  D 4 11  ? -2.609  -49.124 222.671 1.00 164.47 ? 11  DC  D "O4'" 1 
ATOM   5114  C "C3'" . DC  D 4 11  ? -1.275  -51.045 223.190 1.00 164.41 ? 11  DC  D "C3'" 1 
ATOM   5115  O "O3'" . DC  D 4 11  ? -0.608  -51.889 222.250 1.00 167.54 ? 11  DC  D "O3'" 1 
ATOM   5116  C "C2'" . DC  D 4 11  ? -0.479  -49.774 223.495 1.00 164.08 ? 11  DC  D "C2'" 1 
ATOM   5117  C "C1'" . DC  D 4 11  ? -1.306  -48.636 222.905 1.00 163.33 ? 11  DC  D "C1'" 1 
ATOM   5118  N N1    . DC  D 4 11  ? -1.430  -47.461 223.812 1.00 161.43 ? 11  DC  D N1    1 
ATOM   5119  C C2    . DC  D 4 11  ? -1.723  -46.205 223.273 1.00 161.61 ? 11  DC  D C2    1 
ATOM   5120  O O2    . DC  D 4 11  ? -1.872  -46.097 222.050 1.00 161.23 ? 11  DC  D O2    1 
ATOM   5121  N N3    . DC  D 4 11  ? -1.835  -45.142 224.107 1.00 162.69 ? 11  DC  D N3    1 
ATOM   5122  C C4    . DC  D 4 11  ? -1.668  -45.305 225.420 1.00 162.19 ? 11  DC  D C4    1 
ATOM   5123  N N4    . DC  D 4 11  ? -1.787  -44.227 226.202 1.00 163.18 ? 11  DC  D N4    1 
ATOM   5124  C C5    . DC  D 4 11  ? -1.369  -46.578 225.989 1.00 160.33 ? 11  DC  D C5    1 
ATOM   5125  C C6    . DC  D 4 11  ? -1.260  -47.619 225.156 1.00 159.96 ? 11  DC  D C6    1 
ATOM   5126  P P     . DT  D 4 12  ? 0.681   -52.738 222.700 1.00 190.86 ? 12  DT  D P     1 
ATOM   5127  O OP1   . DT  D 4 12  ? 0.767   -53.934 221.834 1.00 192.86 ? 12  DT  D OP1   1 
ATOM   5128  O OP2   . DT  D 4 12  ? 0.634   -52.897 224.170 1.00 184.30 ? 12  DT  D OP2   1 
ATOM   5129  O "O5'" . DT  D 4 12  ? 1.907   -51.770 222.368 1.00 205.07 ? 12  DT  D "O5'" 1 
ATOM   5130  C "C5'" . DT  D 4 12  ? 3.130   -51.909 223.073 1.00 205.01 ? 12  DT  D "C5'" 1 
ATOM   5131  C "C4'" . DT  D 4 12  ? 4.253   -51.262 222.287 1.00 210.22 ? 12  DT  D "C4'" 1 
ATOM   5132  O "O4'" . DT  D 4 12  ? 3.917   -49.887 221.986 1.00 212.88 ? 12  DT  D "O4'" 1 
ATOM   5133  C "C3'" . DT  D 4 12  ? 5.587   -51.182 223.014 1.00 212.42 ? 12  DT  D "C3'" 1 
ATOM   5134  O "O3'" . DT  D 4 12  ? 6.295   -52.424 222.871 1.00 210.98 ? 12  DT  D "O3'" 1 
ATOM   5135  C "C2'" . DT  D 4 12  ? 6.272   -49.987 222.351 1.00 218.22 ? 12  DT  D "C2'" 1 
ATOM   5136  C "C1'" . DT  D 4 12  ? 5.108   -49.138 221.832 1.00 218.26 ? 12  DT  D "C1'" 1 
ATOM   5137  N N1    . DT  D 4 12  ? 4.935   -47.837 222.545 1.00 219.40 ? 12  DT  D N1    1 
ATOM   5138  C C2    . DT  D 4 12  ? 5.798   -46.794 222.279 1.00 220.77 ? 12  DT  D C2    1 
ATOM   5139  O O2    . DT  D 4 12  ? 6.717   -46.868 221.483 1.00 221.27 ? 12  DT  D O2    1 
ATOM   5140  N N3    . DT  D 4 12  ? 5.539   -45.650 222.992 1.00 221.66 ? 12  DT  D N3    1 
ATOM   5141  C C4    . DT  D 4 12  ? 4.530   -45.451 223.918 1.00 220.63 ? 12  DT  D C4    1 
ATOM   5142  O O4    . DT  D 4 12  ? 4.380   -44.384 224.506 1.00 222.00 ? 12  DT  D O4    1 
ATOM   5143  C C5    . DT  D 4 12  ? 3.665   -46.582 224.144 1.00 216.68 ? 12  DT  D C5    1 
ATOM   5144  C C7    . DT  D 4 12  ? 2.534   -46.487 225.125 1.00 211.02 ? 12  DT  D C7    1 
ATOM   5145  C C6    . DT  D 4 12  ? 3.906   -47.704 223.455 1.00 217.28 ? 12  DT  D C6    1 
ATOM   5146  P P     . DC  D 4 13  ? 7.175   -52.738 221.560 1.00 187.18 ? 13  DC  D P     1 
ATOM   5147  O OP1   . DC  D 4 13  ? 8.540   -52.226 221.808 1.00 187.79 ? 13  DC  D OP1   1 
ATOM   5148  O OP2   . DC  D 4 13  ? 6.439   -52.327 220.344 1.00 189.57 ? 13  DC  D OP2   1 
ATOM   5149  O "O5'" . DC  D 4 13  ? 7.266   -54.331 221.542 1.00 130.74 ? 13  DC  D "O5'" 1 
ATOM   5150  C "C5'" . DC  D 4 13  ? 7.510   -55.015 220.323 1.00 132.97 ? 13  DC  D "C5'" 1 
ATOM   5151  C "C4'" . DC  D 4 13  ? 8.011   -56.406 220.638 1.00 129.91 ? 13  DC  D "C4'" 1 
ATOM   5152  O "O4'" . DC  D 4 13  ? 9.360   -56.288 221.144 1.00 127.37 ? 13  DC  D "O4'" 1 
ATOM   5153  C "C3'" . DC  D 4 13  ? 7.188   -57.126 221.700 1.00 121.24 ? 13  DC  D "C3'" 1 
ATOM   5154  O "O3'" . DC  D 4 13  ? 6.724   -58.366 221.184 1.00 133.03 ? 13  DC  D "O3'" 1 
ATOM   5155  C "C2'" . DC  D 4 13  ? 8.138   -57.320 222.879 1.00 121.03 ? 13  DC  D "C2'" 1 
ATOM   5156  C "C1'" . DC  D 4 13  ? 9.524   -57.098 222.285 1.00 125.29 ? 13  DC  D "C1'" 1 
ATOM   5157  N N1    . DC  D 4 13  ? 10.448  -56.388 223.211 1.00 126.25 ? 13  DC  D N1    1 
ATOM   5158  C C2    . DC  D 4 13  ? 11.306  -57.134 224.020 1.00 127.02 ? 13  DC  D C2    1 
ATOM   5159  O O2    . DC  D 4 13  ? 11.279  -58.368 223.951 1.00 126.75 ? 13  DC  D O2    1 
ATOM   5160  N N3    . DC  D 4 13  ? 12.143  -56.477 224.859 1.00 134.81 ? 13  DC  D N3    1 
ATOM   5161  C C4    . DC  D 4 13  ? 12.139  -55.144 224.903 1.00 133.78 ? 13  DC  D C4    1 
ATOM   5162  N N4    . DC  D 4 13  ? 12.986  -54.544 225.748 1.00 135.83 ? 13  DC  D N4    1 
ATOM   5163  C C5    . DC  D 4 13  ? 11.270  -54.365 224.084 1.00 127.81 ? 13  DC  D C5    1 
ATOM   5164  C C6    . DC  D 4 13  ? 10.450  -55.023 223.260 1.00 126.71 ? 13  DC  D C6    1 
ATOM   5165  P P     . DA  D 4 14  ? 5.354   -59.009 221.724 1.00 150.51 ? 14  DA  D P     1 
ATOM   5166  O OP1   . DA  D 4 14  ? 4.647   -59.591 220.563 1.00 155.34 ? 14  DA  D OP1   1 
ATOM   5167  O OP2   . DA  D 4 14  ? 4.670   -58.013 222.579 1.00 144.38 ? 14  DA  D OP2   1 
ATOM   5168  O "O5'" . DA  D 4 14  ? 5.840   -60.188 222.683 1.00 115.78 ? 14  DA  D "O5'" 1 
ATOM   5169  C "C5'" . DA  D 4 14  ? 6.732   -61.186 222.212 1.00 120.80 ? 14  DA  D "C5'" 1 
ATOM   5170  C "C4'" . DA  D 4 14  ? 7.417   -61.825 223.405 1.00 122.90 ? 14  DA  D "C4'" 1 
ATOM   5171  O "O4'" . DA  D 4 14  ? 8.323   -60.863 224.010 1.00 126.14 ? 14  DA  D "O4'" 1 
ATOM   5172  C "C3'" . DA  D 4 14  ? 6.491   -62.278 224.534 1.00 117.76 ? 14  DA  D "C3'" 1 
ATOM   5173  O "O3'" . DA  D 4 14  ? 6.995   -63.493 225.081 1.00 118.51 ? 14  DA  D "O3'" 1 
ATOM   5174  C "C2'" . DA  D 4 14  ? 6.632   -61.149 225.549 1.00 117.66 ? 14  DA  D "C2'" 1 
ATOM   5175  C "C1'" . DA  D 4 14  ? 8.128   -60.904 225.410 1.00 124.25 ? 14  DA  D "C1'" 1 
ATOM   5176  N N9    . DA  D 4 14  ? 8.605   -59.653 225.993 1.00 125.28 ? 14  DA  D N9    1 
ATOM   5177  C C8    . DA  D 4 14  ? 7.943   -58.458 226.044 1.00 122.96 ? 14  DA  D C8    1 
ATOM   5178  N N7    . DA  D 4 14  ? 8.625   -57.500 226.623 1.00 122.18 ? 14  DA  D N7    1 
ATOM   5179  C C5    . DA  D 4 14  ? 9.816   -58.107 226.978 1.00 126.41 ? 14  DA  D C5    1 
ATOM   5180  C C6    . DA  D 4 14  ? 10.965  -57.623 227.631 1.00 132.91 ? 14  DA  D C6    1 
ATOM   5181  N N6    . DA  D 4 14  ? 11.090  -56.360 228.054 1.00 122.25 ? 14  DA  D N6    1 
ATOM   5182  N N1    . DA  D 4 14  ? 11.981  -58.489 227.829 1.00 139.19 ? 14  DA  D N1    1 
ATOM   5183  C C2    . DA  D 4 14  ? 11.842  -59.752 227.403 1.00 139.20 ? 14  DA  D C2    1 
ATOM   5184  N N3    . DA  D 4 14  ? 10.812  -60.322 226.779 1.00 121.97 ? 14  DA  D N3    1 
ATOM   5185  C C4    . DA  D 4 14  ? 9.823   -59.435 226.596 1.00 127.05 ? 14  DA  D C4    1 
ATOM   5186  P P     . DA  D 4 15  ? 6.037   -64.487 225.906 1.00 192.06 ? 15  DA  D P     1 
ATOM   5187  O OP1   . DA  D 4 15  ? 5.538   -65.503 224.955 1.00 89.62  ? 15  DA  D OP1   1 
ATOM   5188  O OP2   . DA  D 4 15  ? 5.097   -63.687 226.726 1.00 71.09  ? 15  DA  D OP2   1 
ATOM   5189  O "O5'" . DA  D 4 15  ? 7.033   -65.238 226.906 1.00 95.09  ? 15  DA  D "O5'" 1 
ATOM   5190  C "C5'" . DA  D 4 15  ? 8.060   -66.119 226.452 1.00 103.90 ? 15  DA  D "C5'" 1 
ATOM   5191  C "C4'" . DA  D 4 15  ? 9.160   -66.242 227.500 1.00 111.40 ? 15  DA  D "C4'" 1 
ATOM   5192  O "O4'" . DA  D 4 15  ? 9.682   -64.929 227.822 1.00 110.80 ? 15  DA  D "O4'" 1 
ATOM   5193  C "C3'" . DA  D 4 15  ? 8.746   -66.833 228.845 1.00 109.10 ? 15  DA  D "C3'" 1 
ATOM   5194  O "O3'" . DA  D 4 15  ? 9.847   -67.510 229.438 1.00 106.87 ? 15  DA  D "O3'" 1 
ATOM   5195  C "C2'" . DA  D 4 15  ? 8.356   -65.602 229.657 1.00 104.64 ? 15  DA  D "C2'" 1 
ATOM   5196  C "C1'" . DA  D 4 15  ? 9.392   -64.604 229.167 1.00 107.83 ? 15  DA  D "C1'" 1 
ATOM   5197  N N9    . DA  D 4 15  ? 8.953   -63.218 229.161 1.00 115.05 ? 15  DA  D N9    1 
ATOM   5198  C C8    . DA  D 4 15  ? 7.869   -62.660 228.540 1.00 119.65 ? 15  DA  D C8    1 
ATOM   5199  N N7    . DA  D 4 15  ? 7.769   -61.358 228.722 1.00 115.91 ? 15  DA  D N7    1 
ATOM   5200  C C5    . DA  D 4 15  ? 8.868   -61.050 229.508 1.00 113.37 ? 15  DA  D C5    1 
ATOM   5201  C C6    . DA  D 4 15  ? 9.351   -59.847 230.055 1.00 110.38 ? 15  DA  D C6    1 
ATOM   5202  N N6    . DA  D 4 15  ? 8.771   -58.653 229.897 1.00 107.99 ? 15  DA  D N6    1 
ATOM   5203  N N1    . DA  D 4 15  ? 10.478  -59.926 230.783 1.00 110.05 ? 15  DA  D N1    1 
ATOM   5204  C C2    . DA  D 4 15  ? 11.070  -61.116 230.947 1.00 111.90 ? 15  DA  D C2    1 
ATOM   5205  N N3    . DA  D 4 15  ? 10.722  -62.304 230.492 1.00 115.67 ? 15  DA  D N3    1 
ATOM   5206  C C4    . DA  D 4 15  ? 9.602   -62.190 229.777 1.00 115.88 ? 15  DA  D C4    1 
ATOM   5207  P P     . DT  D 4 16  ? 9.679   -68.220 230.870 1.00 140.46 ? 16  DT  D P     1 
ATOM   5208  O OP1   . DT  D 4 16  ? 10.543  -69.420 230.892 1.00 140.16 ? 16  DT  D OP1   1 
ATOM   5209  O OP2   . DT  D 4 16  ? 8.229   -68.360 231.126 1.00 143.18 ? 16  DT  D OP2   1 
ATOM   5210  O "O5'" . DT  D 4 16  ? 10.262  -67.147 231.904 1.00 112.51 ? 16  DT  D "O5'" 1 
ATOM   5211  C "C5'" . DT  D 4 16  ? 11.592  -66.665 231.741 1.00 105.83 ? 16  DT  D "C5'" 1 
ATOM   5212  C "C4'" . DT  D 4 16  ? 12.018  -65.805 232.918 1.00 98.18  ? 16  DT  D "C4'" 1 
ATOM   5213  O "O4'" . DT  D 4 16  ? 11.486  -64.466 232.776 1.00 101.51 ? 16  DT  D "O4'" 1 
ATOM   5214  C "C3'" . DT  D 4 16  ? 11.563  -66.307 234.286 1.00 90.82  ? 16  DT  D "C3'" 1 
ATOM   5215  O "O3'" . DT  D 4 16  ? 12.711  -66.626 235.074 1.00 92.37  ? 16  DT  D "O3'" 1 
ATOM   5216  C "C2'" . DT  D 4 16  ? 10.736  -65.157 234.870 1.00 90.50  ? 16  DT  D "C2'" 1 
ATOM   5217  C "C1'" . DT  D 4 16  ? 11.198  -63.954 234.057 1.00 96.25  ? 16  DT  D "C1'" 1 
ATOM   5218  N N1    . DT  D 4 16  ? 10.185  -62.873 233.875 1.00 102.86 ? 16  DT  D N1    1 
ATOM   5219  C C2    . DT  D 4 16  ? 10.452  -61.606 234.347 1.00 110.22 ? 16  DT  D C2    1 
ATOM   5220  O O2    . DT  D 4 16  ? 11.479  -61.311 234.929 1.00 118.22 ? 16  DT  D O2    1 
ATOM   5221  N N3    . DT  D 4 16  ? 9.463   -60.684 234.117 1.00 110.24 ? 16  DT  D N3    1 
ATOM   5222  C C4    . DT  D 4 16  ? 8.260   -60.899 233.473 1.00 112.71 ? 16  DT  D C4    1 
ATOM   5223  O O4    . DT  D 4 16  ? 7.431   -60.007 233.314 1.00 115.68 ? 16  DT  D O4    1 
ATOM   5224  C C5    . DT  D 4 16  ? 8.048   -62.244 233.000 1.00 108.56 ? 16  DT  D C5    1 
ATOM   5225  C C7    . DT  D 4 16  ? 6.779   -62.594 232.284 1.00 108.10 ? 16  DT  D C7    1 
ATOM   5226  C C6    . DT  D 4 16  ? 9.006   -63.154 233.216 1.00 105.93 ? 16  DT  D C6    1 
ATOM   5227  P P     . DC  D 4 17  ? 12.542  -67.159 236.581 1.00 116.19 ? 17  DC  D P     1 
ATOM   5228  O OP1   . DC  D 4 17  ? 13.747  -67.935 236.947 1.00 117.96 ? 17  DC  D OP1   1 
ATOM   5229  O OP2   . DC  D 4 17  ? 11.211  -67.796 236.687 1.00 116.39 ? 17  DC  D OP2   1 
ATOM   5230  O "O5'" . DC  D 4 17  ? 12.520  -65.819 237.446 1.00 107.99 ? 17  DC  D "O5'" 1 
ATOM   5231  C "C5'" . DC  D 4 17  ? 13.514  -64.830 237.222 1.00 110.98 ? 17  DC  D "C5'" 1 
ATOM   5232  C "C4'" . DC  D 4 17  ? 13.318  -63.698 238.209 1.00 116.71 ? 17  DC  D "C4'" 1 
ATOM   5233  O "O4'" . DC  D 4 17  ? 12.324  -62.767 237.705 1.00 120.78 ? 17  DC  D "O4'" 1 
ATOM   5234  C "C3'" . DC  D 4 17  ? 12.843  -64.161 239.582 1.00 118.14 ? 17  DC  D "C3'" 1 
ATOM   5235  O "O3'" . DC  D 4 17  ? 13.611  -63.505 240.582 1.00 118.88 ? 17  DC  D "O3'" 1 
ATOM   5236  C "C2'" . DC  D 4 17  ? 11.374  -63.744 239.608 1.00 119.55 ? 17  DC  D "C2'" 1 
ATOM   5237  C "C1'" . DC  D 4 17  ? 11.347  -62.523 238.696 1.00 120.54 ? 17  DC  D "C1'" 1 
ATOM   5238  N N1    . DC  D 4 17  ? 10.021  -62.329 238.031 1.00 117.78 ? 17  DC  D N1    1 
ATOM   5239  C C2    . DC  D 4 17  ? 9.514   -61.042 237.811 1.00 113.13 ? 17  DC  D C2    1 
ATOM   5240  O O2    . DC  D 4 17  ? 10.177  -60.060 238.167 1.00 107.63 ? 17  DC  D O2    1 
ATOM   5241  N N3    . DC  D 4 17  ? 8.306   -60.906 237.207 1.00 112.97 ? 17  DC  D N3    1 
ATOM   5242  C C4    . DC  D 4 17  ? 7.616   -61.985 236.834 1.00 111.92 ? 17  DC  D C4    1 
ATOM   5243  N N4    . DC  D 4 17  ? 6.431   -61.798 236.242 1.00 108.98 ? 17  DC  D N4    1 
ATOM   5244  C C5    . DC  D 4 17  ? 8.115   -63.303 237.053 1.00 117.29 ? 17  DC  D C5    1 
ATOM   5245  C C6    . DC  D 4 17  ? 9.306   -63.424 237.647 1.00 118.30 ? 17  DC  D C6    1 
ATOM   5246  P P     . DC  D 4 18  ? 13.585  -64.017 242.106 1.00 125.73 ? 18  DC  D P     1 
ATOM   5247  O OP1   . DC  D 4 18  ? 14.965  -64.422 242.453 1.00 127.32 ? 18  DC  D OP1   1 
ATOM   5248  O OP2   . DC  D 4 18  ? 12.476  -64.983 242.269 1.00 122.34 ? 18  DC  D OP2   1 
ATOM   5249  O "O5'" . DC  D 4 18  ? 13.209  -62.702 242.933 1.00 106.14 ? 18  DC  D "O5'" 1 
ATOM   5250  C "C5'" . DC  D 4 18  ? 13.972  -61.515 242.733 1.00 102.03 ? 18  DC  D "C5'" 1 
ATOM   5251  C "C4'" . DC  D 4 18  ? 13.148  -60.285 243.061 1.00 94.04  ? 18  DC  D "C4'" 1 
ATOM   5252  O "O4'" . DC  D 4 18  ? 12.047  -60.192 242.125 1.00 84.93  ? 18  DC  D "O4'" 1 
ATOM   5253  C "C3'" . DC  D 4 18  ? 12.532  -60.293 244.457 1.00 90.46  ? 18  DC  D "C3'" 1 
ATOM   5254  O "O3'" . DC  D 4 18  ? 12.838  -59.083 245.133 1.00 87.17  ? 18  DC  D "O3'" 1 
ATOM   5255  C "C2'" . DC  D 4 18  ? 11.035  -60.441 244.199 1.00 92.44  ? 18  DC  D "C2'" 1 
ATOM   5256  C "C1'" . DC  D 4 18  ? 10.891  -59.799 242.827 1.00 90.82  ? 18  DC  D "C1'" 1 
ATOM   5257  N N1    . DC  D 4 18  ? 9.731   -60.289 242.053 1.00 88.81  ? 18  DC  D N1    1 
ATOM   5258  C C2    . DC  D 4 18  ? 8.747   -59.394 241.625 1.00 87.59  ? 18  DC  D C2    1 
ATOM   5259  O O2    . DC  D 4 18  ? 8.857   -58.193 241.905 1.00 83.71  ? 18  DC  D O2    1 
ATOM   5260  N N3    . DC  D 4 18  ? 7.696   -59.873 240.913 1.00 90.23  ? 18  DC  D N3    1 
ATOM   5261  C C4    . DC  D 4 18  ? 7.610   -61.173 240.628 1.00 92.28  ? 18  DC  D C4    1 
ATOM   5262  N N4    . DC  D 4 18  ? 6.550   -61.585 239.922 1.00 91.69  ? 18  DC  D N4    1 
ATOM   5263  C C5    . DC  D 4 18  ? 8.606   -62.099 241.056 1.00 94.02  ? 18  DC  D C5    1 
ATOM   5264  C C6    . DC  D 4 18  ? 9.637   -61.616 241.758 1.00 93.05  ? 18  DC  D C6    1 
ATOM   5265  P P     . DC  D 4 19  ? 12.652  -58.984 246.725 1.00 107.62 ? 19  DC  D P     1 
ATOM   5266  O OP1   . DC  D 4 19  ? 13.729  -58.115 247.255 1.00 108.68 ? 19  DC  D OP1   1 
ATOM   5267  O OP2   . DC  D 4 19  ? 12.489  -60.364 247.233 1.00 109.65 ? 19  DC  D OP2   1 
ATOM   5268  O "O5'" . DC  D 4 19  ? 11.268  -58.206 246.899 1.00 87.32  ? 19  DC  D "O5'" 1 
ATOM   5269  C "C5'" . DC  D 4 19  ? 11.125  -56.908 246.344 1.00 95.67  ? 19  DC  D "C5'" 1 
ATOM   5270  C "C4'" . DC  D 4 19  ? 9.656   -56.545 246.244 1.00 95.55  ? 19  DC  D "C4'" 1 
ATOM   5271  O "O4'" . DC  D 4 19  ? 9.006   -57.414 245.287 1.00 96.94  ? 19  DC  D "O4'" 1 
ATOM   5272  C "C3'" . DC  D 4 19  ? 8.878   -56.690 247.550 1.00 93.07  ? 19  DC  D "C3'" 1 
ATOM   5273  O "O3'" . DC  D 4 19  ? 8.508   -55.393 248.023 1.00 90.81  ? 19  DC  D "O3'" 1 
ATOM   5274  C "C2'" . DC  D 4 19  ? 7.670   -57.559 247.192 1.00 85.72  ? 19  DC  D "C2'" 1 
ATOM   5275  C "C1'" . DC  D 4 19  ? 7.657   -57.547 245.669 1.00 97.81  ? 19  DC  D "C1'" 1 
ATOM   5276  N N1    . DC  D 4 19  ? 7.150   -58.809 245.074 1.00 95.40  ? 19  DC  D N1    1 
ATOM   5277  C C2    . DC  D 4 19  ? 6.040   -58.786 244.225 1.00 91.42  ? 19  DC  D C2    1 
ATOM   5278  O O2    . DC  D 4 19  ? 5.486   -57.709 243.978 1.00 84.53  ? 19  DC  D O2    1 
ATOM   5279  N N3    . DC  D 4 19  ? 5.603   -59.952 243.693 1.00 93.20  ? 19  DC  D N3    1 
ATOM   5280  C C4    . DC  D 4 19  ? 6.224   -61.096 243.982 1.00 96.00  ? 19  DC  D C4    1 
ATOM   5281  N N4    . DC  D 4 19  ? 5.749   -62.220 243.432 1.00 96.91  ? 19  DC  D N4    1 
ATOM   5282  C C5    . DC  D 4 19  ? 7.356   -61.138 244.847 1.00 98.22  ? 19  DC  D C5    1 
ATOM   5283  C C6    . DC  D 4 19  ? 7.780   -59.982 245.365 1.00 98.18  ? 19  DC  D C6    1 
ATOM   5284  P P     . DA  D 4 20  ? 7.645   -55.226 249.369 1.00 103.56 ? 20  DA  D P     1 
ATOM   5285  O OP1   . DA  D 4 20  ? 8.057   -53.960 250.014 1.00 103.77 ? 20  DA  D OP1   1 
ATOM   5286  O OP2   . DA  D 4 20  ? 7.697   -56.494 250.130 1.00 107.34 ? 20  DA  D OP2   1 
ATOM   5287  O "O5'" . DA  D 4 20  ? 6.160   -55.019 248.831 1.00 92.85  ? 20  DA  D "O5'" 1 
ATOM   5288  C "C5'" . DA  D 4 20  ? 5.914   -53.913 247.977 1.00 92.80  ? 20  DA  D "C5'" 1 
ATOM   5289  C "C4'" . DA  D 4 20  ? 4.506   -53.945 247.414 1.00 91.32  ? 20  DA  D "C4'" 1 
ATOM   5290  O "O4'" . DA  D 4 20  ? 4.283   -55.207 246.735 1.00 94.50  ? 20  DA  D "O4'" 1 
ATOM   5291  C "C3'" . DA  D 4 20  ? 3.389   -53.837 248.443 1.00 88.89  ? 20  DA  D "C3'" 1 
ATOM   5292  O "O3'" . DA  D 4 20  ? 2.293   -53.153 247.861 1.00 85.25  ? 20  DA  D "O3'" 1 
ATOM   5293  C "C2'" . DA  D 4 20  ? 3.056   -55.301 248.714 1.00 89.97  ? 20  DA  D "C2'" 1 
ATOM   5294  C "C1'" . DA  D 4 20  ? 3.168   -55.863 247.304 1.00 94.60  ? 20  DA  D "C1'" 1 
ATOM   5295  N N9    . DA  D 4 20  ? 3.427   -57.298 247.241 1.00 86.95  ? 20  DA  D N9    1 
ATOM   5296  C C8    . DA  D 4 20  ? 4.303   -58.006 248.013 1.00 102.23 ? 20  DA  D C8    1 
ATOM   5297  N N7    . DA  D 4 20  ? 4.341   -59.288 247.736 1.00 101.84 ? 20  DA  D N7    1 
ATOM   5298  C C5    . DA  D 4 20  ? 3.429   -59.430 246.707 1.00 88.57  ? 20  DA  D C5    1 
ATOM   5299  C C6    . DA  D 4 20  ? 3.009   -60.553 245.971 1.00 116.76 ? 20  DA  D C6    1 
ATOM   5300  N N6    . DA  D 4 20  ? 3.481   -61.787 246.178 1.00 90.79  ? 20  DA  D N6    1 
ATOM   5301  N N1    . DA  D 4 20  ? 2.081   -60.357 245.013 1.00 116.73 ? 20  DA  D N1    1 
ATOM   5302  C C2    . DA  D 4 20  ? 1.613   -59.118 244.815 1.00 89.47  ? 20  DA  D C2    1 
ATOM   5303  N N3    . DA  D 4 20  ? 1.931   -57.987 245.442 1.00 96.93  ? 20  DA  D N3    1 
ATOM   5304  C C4    . DA  D 4 20  ? 2.856   -58.213 246.387 1.00 99.13  ? 20  DA  D C4    1 
ATOM   5305  P P     . DA  D 4 21  ? 1.313   -52.270 248.778 1.00 149.41 ? 21  DA  D P     1 
ATOM   5306  O OP1   . DA  D 4 21  ? 1.207   -50.909 248.212 1.00 66.22  ? 21  DA  D OP1   1 
ATOM   5307  O OP2   . DA  D 4 21  ? 1.744   -52.464 250.178 1.00 68.01  ? 21  DA  D OP2   1 
ATOM   5308  O "O5'" . DA  D 4 21  ? -0.105  -52.972 248.606 1.00 92.43  ? 21  DA  D "O5'" 1 
ATOM   5309  C "C5'" . DA  D 4 21  ? -0.342  -54.196 249.252 1.00 99.12  ? 21  DA  D "C5'" 1 
ATOM   5310  C "C4'" . DA  D 4 21  ? -1.296  -55.000 248.402 1.00 94.58  ? 21  DA  D "C4'" 1 
ATOM   5311  O "O4'" . DA  D 4 21  ? -0.572  -56.124 247.842 1.00 87.93  ? 21  DA  D "O4'" 1 
ATOM   5312  C "C3'" . DA  D 4 21  ? -2.493  -55.540 249.171 1.00 98.81  ? 21  DA  D "C3'" 1 
ATOM   5313  O "O3'" . DA  D 4 21  ? -3.689  -54.917 248.696 1.00 105.53 ? 21  DA  D "O3'" 1 
ATOM   5314  C "C2'" . DA  D 4 21  ? -2.492  -57.043 248.899 1.00 98.03  ? 21  DA  D "C2'" 1 
ATOM   5315  C "C1'" . DA  D 4 21  ? -1.346  -57.302 247.920 1.00 91.77  ? 21  DA  D "C1'" 1 
ATOM   5316  N N9    . DA  D 4 21  ? -0.492  -58.404 248.357 1.00 89.02  ? 21  DA  D N9    1 
ATOM   5317  C C8    . DA  D 4 21  ? 0.395   -58.365 249.397 1.00 94.06  ? 21  DA  D C8    1 
ATOM   5318  N N7    . DA  D 4 21  ? 1.036   -59.495 249.591 1.00 94.70  ? 21  DA  D N7    1 
ATOM   5319  C C5    . DA  D 4 21  ? 0.529   -60.335 248.613 1.00 91.05  ? 21  DA  D C5    1 
ATOM   5320  C C6    . DA  D 4 21  ? 0.807   -61.679 248.293 1.00 93.37  ? 21  DA  D C6    1 
ATOM   5321  N N6    . DA  D 4 21  ? 1.700   -62.426 248.955 1.00 98.78  ? 21  DA  D N6    1 
ATOM   5322  N N1    . DA  D 4 21  ? 0.129   -62.223 247.263 1.00 87.83  ? 21  DA  D N1    1 
ATOM   5323  C C2    . DA  D 4 21  ? -0.759  -61.469 246.602 1.00 86.16  ? 21  DA  D C2    1 
ATOM   5324  N N3    . DA  D 4 21  ? -1.101  -60.196 246.813 1.00 83.26  ? 21  DA  D N3    1 
ATOM   5325  C C4    . DA  D 4 21  ? -0.415  -59.680 247.842 1.00 85.25  ? 21  DA  D C4    1 
ATOM   5326  N N     . LEU E 1 16  ? 15.070  1.977   151.768 1.00 129.88 ? 16  LEU F N     1 
ATOM   5327  C CA    . LEU E 1 16  ? 15.164  3.288   152.412 1.00 134.31 ? 16  LEU F CA    1 
ATOM   5328  C C     . LEU E 1 16  ? 13.842  4.083   152.483 1.00 139.08 ? 16  LEU F C     1 
ATOM   5329  O O     . LEU E 1 16  ? 13.482  4.567   153.557 1.00 139.53 ? 16  LEU F O     1 
ATOM   5330  C CB    . LEU E 1 16  ? 16.300  4.127   151.797 1.00 132.82 ? 16  LEU F CB    1 
ATOM   5331  C CG    . LEU E 1 16  ? 17.008  5.116   152.734 1.00 130.98 ? 16  LEU F CG    1 
ATOM   5332  C CD1   . LEU E 1 16  ? 18.421  5.427   152.255 1.00 130.35 ? 16  LEU F CD1   1 
ATOM   5333  C CD2   . LEU E 1 16  ? 16.211  6.398   152.877 1.00 131.49 ? 16  LEU F CD2   1 
ATOM   5334  N N     . PRO E 1 17  ? 13.116  4.226   151.354 1.00 141.07 ? 17  PRO F N     1 
ATOM   5335  C CA    . PRO E 1 17  ? 11.906  5.058   151.426 1.00 137.42 ? 17  PRO F CA    1 
ATOM   5336  C C     . PRO E 1 17  ? 10.780  4.454   152.271 1.00 127.24 ? 17  PRO F C     1 
ATOM   5337  O O     . PRO E 1 17  ? 9.885   5.184   152.699 1.00 125.78 ? 17  PRO F O     1 
ATOM   5338  C CB    . PRO E 1 17  ? 11.469  5.168   149.961 1.00 139.45 ? 17  PRO F CB    1 
ATOM   5339  C CG    . PRO E 1 17  ? 12.032  3.961   149.311 1.00 138.77 ? 17  PRO F CG    1 
ATOM   5340  C CD    . PRO E 1 17  ? 13.343  3.717   149.989 1.00 140.24 ? 17  PRO F CD    1 
ATOM   5341  N N     . GLU E 1 18  ? 10.827  3.146   152.507 1.00 117.67 ? 18  GLU F N     1 
ATOM   5342  C CA    . GLU E 1 18  ? 9.810   2.474   153.311 1.00 109.89 ? 18  GLU F CA    1 
ATOM   5343  C C     . GLU E 1 18  ? 10.400  1.924   154.605 1.00 102.30 ? 18  GLU F C     1 
ATOM   5344  O O     . GLU E 1 18  ? 11.245  1.029   154.572 1.00 105.69 ? 18  GLU F O     1 
ATOM   5345  C CB    . GLU E 1 18  ? 9.166   1.337   152.518 1.00 115.56 ? 18  GLU F CB    1 
ATOM   5346  C CG    . GLU E 1 18  ? 8.101   0.576   153.291 1.00 125.49 ? 18  GLU F CG    1 
ATOM   5347  C CD    . GLU E 1 18  ? 6.806   1.355   153.423 1.00 137.23 ? 18  GLU F CD    1 
ATOM   5348  O OE1   . GLU E 1 18  ? 6.353   1.931   152.410 1.00 141.87 ? 18  GLU F OE1   1 
ATOM   5349  O OE2   . GLU E 1 18  ? 6.244   1.393   154.539 1.00 139.22 ? 18  GLU F OE2   1 
ATOM   5350  N N     . PRO E 1 19  ? 9.947   2.456   155.752 1.00 95.54  ? 19  PRO F N     1 
ATOM   5351  C CA    . PRO E 1 19  ? 10.423  2.086   157.091 1.00 96.57  ? 19  PRO F CA    1 
ATOM   5352  C C     . PRO E 1 19  ? 10.266  0.599   157.398 1.00 101.65 ? 19  PRO F C     1 
ATOM   5353  O O     . PRO E 1 19  ? 11.075  0.041   158.138 1.00 103.29 ? 19  PRO F O     1 
ATOM   5354  C CB    . PRO E 1 19  ? 9.524   2.908   158.019 1.00 95.23  ? 19  PRO F CB    1 
ATOM   5355  C CG    . PRO E 1 19  ? 9.113   4.077   157.199 1.00 96.78  ? 19  PRO F CG    1 
ATOM   5356  C CD    . PRO E 1 19  ? 8.951   3.540   155.807 1.00 96.29  ? 19  PRO F CD    1 
ATOM   5357  N N     . PHE E 1 20  ? 9.239   -0.031  156.840 1.00 101.04 ? 20  PHE F N     1 
ATOM   5358  C CA    . PHE E 1 20  ? 9.017   -1.455  157.060 1.00 97.48  ? 20  PHE F CA    1 
ATOM   5359  C C     . PHE E 1 20  ? 9.551   -2.301  155.907 1.00 96.78  ? 20  PHE F C     1 
ATOM   5360  O O     . PHE E 1 20  ? 8.932   -3.295  155.520 1.00 98.87  ? 20  PHE F O     1 
ATOM   5361  C CB    . PHE E 1 20  ? 7.528   -1.739  157.269 1.00 97.32  ? 20  PHE F CB    1 
ATOM   5362  C CG    . PHE E 1 20  ? 7.000   -1.264  158.593 1.00 97.30  ? 20  PHE F CG    1 
ATOM   5363  C CD1   . PHE E 1 20  ? 7.141   -2.044  159.726 1.00 94.54  ? 20  PHE F CD1   1 
ATOM   5364  C CD2   . PHE E 1 20  ? 6.359   -0.042  158.704 1.00 102.65 ? 20  PHE F CD2   1 
ATOM   5365  C CE1   . PHE E 1 20  ? 6.658   -1.615  160.946 1.00 98.08  ? 20  PHE F CE1   1 
ATOM   5366  C CE2   . PHE E 1 20  ? 5.871   0.395   159.924 1.00 103.80 ? 20  PHE F CE2   1 
ATOM   5367  C CZ    . PHE E 1 20  ? 6.020   -0.395  161.047 1.00 101.77 ? 20  PHE F CZ    1 
ATOM   5368  N N     . TYR E 1 21  ? 10.702  -1.909  155.367 1.00 90.65  ? 21  TYR F N     1 
ATOM   5369  C CA    . TYR E 1 21  ? 11.259  -2.571  154.191 1.00 83.00  ? 21  TYR F CA    1 
ATOM   5370  C C     . TYR E 1 21  ? 11.597  -4.023  154.494 1.00 84.40  ? 21  TYR F C     1 
ATOM   5371  O O     . TYR E 1 21  ? 11.400  -4.910  153.664 1.00 88.62  ? 21  TYR F O     1 
ATOM   5372  C CB    . TYR E 1 21  ? 12.512  -1.840  153.706 1.00 78.86  ? 21  TYR F CB    1 
ATOM   5373  C CG    . TYR E 1 21  ? 13.691  -1.975  154.645 1.00 85.90  ? 21  TYR F CG    1 
ATOM   5374  C CD1   . TYR E 1 21  ? 13.816  -1.153  155.758 1.00 88.83  ? 21  TYR F CD1   1 
ATOM   5375  C CD2   . TYR E 1 21  ? 14.673  -2.935  154.427 1.00 87.64  ? 21  TYR F CD2   1 
ATOM   5376  C CE1   . TYR E 1 21  ? 14.889  -1.277  156.624 1.00 88.24  ? 21  TYR F CE1   1 
ATOM   5377  C CE2   . TYR E 1 21  ? 15.750  -3.068  155.291 1.00 87.07  ? 21  TYR F CE2   1 
ATOM   5378  C CZ    . TYR E 1 21  ? 15.852  -2.234  156.387 1.00 88.99  ? 21  TYR F CZ    1 
ATOM   5379  O OH    . TYR E 1 21  ? 16.917  -2.352  157.252 1.00 92.59  ? 21  TYR F OH    1 
ATOM   5380  N N     . TYR E 1 22  ? 12.102  -4.256  155.699 1.00 84.43  ? 22  TYR F N     1 
ATOM   5381  C CA    . TYR E 1 22  ? 12.531  -5.583  156.112 1.00 81.40  ? 22  TYR F CA    1 
ATOM   5382  C C     . TYR E 1 22  ? 11.349  -6.536  156.249 1.00 83.92  ? 22  TYR F C     1 
ATOM   5383  O O     . TYR E 1 22  ? 11.476  -7.730  155.974 1.00 85.71  ? 22  TYR F O     1 
ATOM   5384  C CB    . TYR E 1 22  ? 13.324  -5.508  157.422 1.00 76.93  ? 22  TYR F CB    1 
ATOM   5385  C CG    . TYR E 1 22  ? 12.575  -4.864  158.568 1.00 76.54  ? 22  TYR F CG    1 
ATOM   5386  C CD1   . TYR E 1 22  ? 12.476  -3.480  158.674 1.00 72.13  ? 22  TYR F CD1   1 
ATOM   5387  C CD2   . TYR E 1 22  ? 11.970  -5.641  159.549 1.00 77.14  ? 22  TYR F CD2   1 
ATOM   5388  C CE1   . TYR E 1 22  ? 11.790  -2.891  159.722 1.00 72.96  ? 22  TYR F CE1   1 
ATOM   5389  C CE2   . TYR E 1 22  ? 11.286  -5.063  160.600 1.00 75.45  ? 22  TYR F CE2   1 
ATOM   5390  C CZ    . TYR E 1 22  ? 11.199  -3.688  160.683 1.00 79.10  ? 22  TYR F CZ    1 
ATOM   5391  O OH    . TYR E 1 22  ? 10.516  -3.111  161.729 1.00 88.86  ? 22  TYR F OH    1 
ATOM   5392  N N     . LEU E 1 23  ? 10.203  -6.003  156.668 1.00 83.56  ? 23  LEU F N     1 
ATOM   5393  C CA    . LEU E 1 23  ? 8.998   -6.809  156.840 1.00 79.35  ? 23  LEU F CA    1 
ATOM   5394  C C     . LEU E 1 23  ? 8.428   -7.192  155.484 1.00 90.01  ? 23  LEU F C     1 
ATOM   5395  O O     . LEU E 1 23  ? 7.984   -8.325  155.282 1.00 91.99  ? 23  LEU F O     1 
ATOM   5396  C CB    . LEU E 1 23  ? 7.952   -6.053  157.663 1.00 77.81  ? 23  LEU F CB    1 
ATOM   5397  C CG    . LEU E 1 23  ? 6.574   -6.705  157.808 1.00 83.73  ? 23  LEU F CG    1 
ATOM   5398  C CD1   . LEU E 1 23  ? 6.698   -8.125  158.336 1.00 81.93  ? 23  LEU F CD1   1 
ATOM   5399  C CD2   . LEU E 1 23  ? 5.668   -5.876  158.713 1.00 73.89  ? 23  LEU F CD2   1 
ATOM   5400  N N     . HIS E 1 24  ? 8.451   -6.234  154.562 1.00 97.77  ? 24  HIS F N     1 
ATOM   5401  C CA    . HIS E 1 24  ? 8.014   -6.457  153.189 1.00 103.24 ? 24  HIS F CA    1 
ATOM   5402  C C     . HIS E 1 24  ? 8.862   -7.531  152.514 1.00 100.59 ? 24  HIS F C     1 
ATOM   5403  O O     . HIS E 1 24  ? 8.343   -8.364  151.771 1.00 105.53 ? 24  HIS F O     1 
ATOM   5404  C CB    . HIS E 1 24  ? 8.070   -5.148  152.392 1.00 110.46 ? 24  HIS F CB    1 
ATOM   5405  C CG    . HIS E 1 24  ? 7.180   -4.076  152.938 1.00 118.14 ? 24  HIS F CG    1 
ATOM   5406  N ND1   . HIS E 1 24  ? 6.020   -4.350  153.623 1.00 121.88 ? 24  HIS F ND1   1 
ATOM   5407  C CD2   . HIS E 1 24  ? 7.288   -2.722  152.908 1.00 122.30 ? 24  HIS F CD2   1 
ATOM   5408  C CE1   . HIS E 1 24  ? 5.444   -3.217  153.991 1.00 123.55 ? 24  HIS F CE1   1 
ATOM   5409  N NE2   . HIS E 1 24  ? 6.197   -2.217  153.567 1.00 125.11 ? 24  HIS F NE2   1 
ATOM   5410  N N     . ASN E 1 25  ? 10.167  -7.512  152.775 1.00 92.08  ? 25  ASN F N     1 
ATOM   5411  C CA    . ASN E 1 25  ? 11.055  -8.537  152.231 1.00 95.26  ? 25  ASN F CA    1 
ATOM   5412  C C     . ASN E 1 25  ? 10.738  -9.917  152.804 1.00 92.27  ? 25  ASN F C     1 
ATOM   5413  O O     . ASN E 1 25  ? 10.756  -10.924 152.096 1.00 89.33  ? 25  ASN F O     1 
ATOM   5414  C CB    . ASN E 1 25  ? 12.523  -8.177  152.476 1.00 101.76 ? 25  ASN F CB    1 
ATOM   5415  C CG    . ASN E 1 25  ? 12.927  -6.878  151.799 1.00 107.37 ? 25  ASN F CG    1 
ATOM   5416  O OD1   . ASN E 1 25  ? 12.346  -6.485  150.786 1.00 112.59 ? 25  ASN F OD1   1 
ATOM   5417  N ND2   . ASN E 1 25  ? 13.932  -6.209  152.355 1.00 103.52 ? 25  ASN F ND2   1 
ATOM   5418  N N     . PHE E 1 26  ? 10.435  -9.946  154.094 1.00 90.45  ? 26  PHE F N     1 
ATOM   5419  C CA    . PHE E 1 26  ? 10.082  -11.181 154.777 1.00 86.41  ? 26  PHE F CA    1 
ATOM   5420  C C     . PHE E 1 26  ? 8.739   -11.719 154.281 1.00 90.06  ? 26  PHE F C     1 
ATOM   5421  O O     . PHE E 1 26  ? 8.560   -12.931 154.113 1.00 89.26  ? 26  PHE F O     1 
ATOM   5422  C CB    . PHE E 1 26  ? 10.030  -10.943 156.287 1.00 79.86  ? 26  PHE F CB    1 
ATOM   5423  C CG    . PHE E 1 26  ? 9.785   -12.190 157.083 1.00 83.49  ? 26  PHE F CG    1 
ATOM   5424  C CD1   . PHE E 1 26  ? 10.813  -13.077 157.325 1.00 80.52  ? 26  PHE F CD1   1 
ATOM   5425  C CD2   . PHE E 1 26  ? 8.532   -12.495 157.567 1.00 89.45  ? 26  PHE F CD2   1 
ATOM   5426  C CE1   . PHE E 1 26  ? 10.604  -14.238 158.052 1.00 83.79  ? 26  PHE F CE1   1 
ATOM   5427  C CE2   . PHE E 1 26  ? 8.324   -13.652 158.291 1.00 86.76  ? 26  PHE F CE2   1 
ATOM   5428  C CZ    . PHE E 1 26  ? 9.360   -14.529 158.530 1.00 85.93  ? 26  PHE F CZ    1 
ATOM   5429  N N     . ARG E 1 27  ? 7.797   -10.805 154.062 1.00 88.24  ? 27  ARG F N     1 
ATOM   5430  C CA    . ARG E 1 27  ? 6.493   -11.145 153.503 1.00 88.22  ? 27  ARG F CA    1 
ATOM   5431  C C     . ARG E 1 27  ? 6.642   -11.701 152.092 1.00 92.43  ? 27  ARG F C     1 
ATOM   5432  O O     . ARG E 1 27  ? 5.964   -12.658 151.709 1.00 90.82  ? 27  ARG F O     1 
ATOM   5433  C CB    . ARG E 1 27  ? 5.590   -9.913  153.466 1.00 87.65  ? 27  ARG F CB    1 
ATOM   5434  C CG    . ARG E 1 27  ? 4.966   -9.534  154.797 1.00 88.36  ? 27  ARG F CG    1 
ATOM   5435  C CD    . ARG E 1 27  ? 4.236   -8.205  154.674 1.00 93.13  ? 27  ARG F CD    1 
ATOM   5436  N NE    . ARG E 1 27  ? 3.457   -7.876  155.864 1.00 101.70 ? 27  ARG F NE    1 
ATOM   5437  C CZ    . ARG E 1 27  ? 2.895   -6.691  156.082 1.00 108.54 ? 27  ARG F CZ    1 
ATOM   5438  N NH1   . ARG E 1 27  ? 3.032   -5.715  155.193 1.00 111.72 ? 27  ARG F NH1   1 
ATOM   5439  N NH2   . ARG E 1 27  ? 2.200   -6.479  157.193 1.00 106.95 ? 27  ARG F NH2   1 
ATOM   5440  N N     . ALA E 1 28  ? 7.532   -11.082 151.324 1.00 93.59  ? 28  ALA F N     1 
ATOM   5441  C CA    . ALA E 1 28  ? 7.822   -11.518 149.965 1.00 92.86  ? 28  ALA F CA    1 
ATOM   5442  C C     . ALA E 1 28  ? 8.324   -12.962 149.922 1.00 100.49 ? 28  ALA F C     1 
ATOM   5443  O O     . ALA E 1 28  ? 7.926   -13.733 149.047 1.00 102.32 ? 28  ALA F O     1 
ATOM   5444  C CB    . ALA E 1 28  ? 8.829   -10.586 149.325 1.00 86.03  ? 28  ALA F CB    1 
ATOM   5445  N N     . VAL E 1 29  ? 9.197   -13.319 150.863 1.00 100.19 ? 29  VAL F N     1 
ATOM   5446  C CA    . VAL E 1 29  ? 9.719   -14.682 150.959 1.00 97.80  ? 29  VAL F CA    1 
ATOM   5447  C C     . VAL E 1 29  ? 8.609   -15.662 151.316 1.00 97.96  ? 29  VAL F C     1 
ATOM   5448  O O     . VAL E 1 29  ? 8.514   -16.745 150.739 1.00 92.52  ? 29  VAL F O     1 
ATOM   5449  C CB    . VAL E 1 29  ? 10.844  -14.802 152.012 1.00 93.05  ? 29  VAL F CB    1 
ATOM   5450  C CG1   . VAL E 1 29  ? 11.206  -16.269 152.254 1.00 75.54  ? 29  VAL F CG1   1 
ATOM   5451  C CG2   . VAL E 1 29  ? 12.065  -14.018 151.576 1.00 89.37  ? 29  VAL F CG2   1 
ATOM   5452  N N     . LEU E 1 30  ? 7.772   -15.268 152.270 1.00 100.61 ? 30  LEU F N     1 
ATOM   5453  C CA    . LEU E 1 30  ? 6.645   -16.087 152.699 1.00 99.20  ? 30  LEU F CA    1 
ATOM   5454  C C     . LEU E 1 30  ? 5.681   -16.379 151.557 1.00 97.35  ? 30  LEU F C     1 
ATOM   5455  O O     . LEU E 1 30  ? 5.234   -17.513 151.386 1.00 98.75  ? 30  LEU F O     1 
ATOM   5456  C CB    . LEU E 1 30  ? 5.896   -15.403 153.841 1.00 99.36  ? 30  LEU F CB    1 
ATOM   5457  C CG    . LEU E 1 30  ? 6.531   -15.532 155.221 1.00 101.56 ? 30  LEU F CG    1 
ATOM   5458  C CD1   . LEU E 1 30  ? 5.619   -14.928 156.270 1.00 101.89 ? 30  LEU F CD1   1 
ATOM   5459  C CD2   . LEU E 1 30  ? 6.801   -16.992 155.517 1.00 104.70 ? 30  LEU F CD2   1 
ATOM   5460  N N     . ALA E 1 31  ? 5.362   -15.352 150.776 1.00 94.06  ? 31  ALA F N     1 
ATOM   5461  C CA    . ALA E 1 31  ? 4.449   -15.518 149.653 1.00 98.16  ? 31  ALA F CA    1 
ATOM   5462  C C     . ALA E 1 31  ? 5.075   -16.390 148.566 1.00 101.35 ? 31  ALA F C     1 
ATOM   5463  O O     . ALA E 1 31  ? 4.414   -17.265 148.010 1.00 106.84 ? 31  ALA F O     1 
ATOM   5464  C CB    . ALA E 1 31  ? 4.032   -14.167 149.095 1.00 97.71  ? 31  ALA F CB    1 
ATOM   5465  N N     . TRP E 1 32  ? 6.352   -16.148 148.281 1.00 100.72 ? 32  TRP F N     1 
ATOM   5466  C CA    . TRP E 1 32  ? 7.113   -16.961 147.334 1.00 101.32 ? 32  TRP F CA    1 
ATOM   5467  C C     . TRP E 1 32  ? 7.099   -18.434 147.741 1.00 98.75  ? 32  TRP F C     1 
ATOM   5468  O O     . TRP E 1 32  ? 6.979   -19.319 146.895 1.00 99.15  ? 32  TRP F O     1 
ATOM   5469  C CB    . TRP E 1 32  ? 8.559   -16.464 147.250 1.00 104.20 ? 32  TRP F CB    1 
ATOM   5470  C CG    . TRP E 1 32  ? 9.392   -17.142 146.193 1.00 112.39 ? 32  TRP F CG    1 
ATOM   5471  C CD1   . TRP E 1 32  ? 9.964   -18.381 146.264 1.00 116.60 ? 32  TRP F CD1   1 
ATOM   5472  C CD2   . TRP E 1 32  ? 9.761   -16.604 144.915 1.00 120.94 ? 32  TRP F CD2   1 
ATOM   5473  N NE1   . TRP E 1 32  ? 10.657  -18.650 145.108 1.00 120.32 ? 32  TRP F NE1   1 
ATOM   5474  C CE2   . TRP E 1 32  ? 10.549  -17.576 144.265 1.00 122.86 ? 32  TRP F CE2   1 
ATOM   5475  C CE3   . TRP E 1 32  ? 9.500   -15.398 144.258 1.00 126.49 ? 32  TRP F CE3   1 
ATOM   5476  C CZ2   . TRP E 1 32  ? 11.077  -17.378 142.989 1.00 126.59 ? 32  TRP F CZ2   1 
ATOM   5477  C CZ3   . TRP E 1 32  ? 10.026  -15.203 142.991 1.00 128.69 ? 32  TRP F CZ3   1 
ATOM   5478  C CH2   . TRP E 1 32  ? 10.805  -16.188 142.371 1.00 128.89 ? 32  TRP F CH2   1 
ATOM   5479  N N     . ILE E 1 33  ? 7.234   -18.687 149.040 1.00 96.59  ? 33  ILE F N     1 
ATOM   5480  C CA    . ILE E 1 33  ? 7.220   -20.048 149.564 1.00 98.21  ? 33  ILE F CA    1 
ATOM   5481  C C     . ILE E 1 33  ? 5.841   -20.658 149.379 1.00 105.89 ? 33  ILE F C     1 
ATOM   5482  O O     . ILE E 1 33  ? 5.708   -21.823 148.992 1.00 113.90 ? 33  ILE F O     1 
ATOM   5483  C CB    . ILE E 1 33  ? 7.602   -20.086 151.058 1.00 96.74  ? 33  ILE F CB    1 
ATOM   5484  C CG1   . ILE E 1 33  ? 9.079   -19.746 151.235 1.00 98.24  ? 33  ILE F CG1   1 
ATOM   5485  C CG2   . ILE E 1 33  ? 7.337   -21.459 151.648 1.00 93.05  ? 33  ILE F CG2   1 
ATOM   5486  C CD1   . ILE E 1 33  ? 10.000  -20.675 150.488 1.00 99.88  ? 33  ILE F CD1   1 
ATOM   5487  N N     . GLY E 1 34  ? 4.817   -19.855 149.649 1.00 103.13 ? 34  GLY F N     1 
ATOM   5488  C CA    . GLY E 1 34  ? 3.443   -20.285 149.479 1.00 107.38 ? 34  GLY F CA    1 
ATOM   5489  C C     . GLY E 1 34  ? 3.116   -20.713 148.061 1.00 113.75 ? 34  GLY F C     1 
ATOM   5490  O O     . GLY E 1 34  ? 2.331   -21.638 147.854 1.00 122.20 ? 34  GLY F O     1 
ATOM   5491  N N     . GLU E 1 35  ? 3.719   -20.050 147.080 1.00 113.94 ? 35  GLU F N     1 
ATOM   5492  C CA    . GLU E 1 35  ? 3.430   -20.348 145.681 1.00 117.51 ? 35  GLU F CA    1 
ATOM   5493  C C     . GLU E 1 35  ? 4.164   -21.598 145.204 1.00 116.29 ? 35  GLU F C     1 
ATOM   5494  O O     . GLU E 1 35  ? 3.548   -22.624 144.910 1.00 123.34 ? 35  GLU F O     1 
ATOM   5495  C CB    . GLU E 1 35  ? 3.801   -19.157 144.791 1.00 126.27 ? 35  GLU F CB    1 
ATOM   5496  C CG    . GLU E 1 35  ? 3.106   -17.852 145.155 1.00 135.95 ? 35  GLU F CG    1 
ATOM   5497  C CD    . GLU E 1 35  ? 3.816   -16.636 144.579 1.00 145.27 ? 35  GLU F CD    1 
ATOM   5498  O OE1   . GLU E 1 35  ? 4.746   -16.820 143.764 1.00 151.58 ? 35  GLU F OE1   1 
ATOM   5499  O OE2   . GLU E 1 35  ? 3.452   -15.497 144.946 1.00 143.88 ? 35  GLU F OE2   1 
ATOM   5500  N N     . ARG E 1 36  ? 5.488   -21.505 145.150 1.00 110.77 ? 36  ARG F N     1 
ATOM   5501  C CA    . ARG E 1 36  ? 6.315   -22.532 144.522 1.00 113.66 ? 36  ARG F CA    1 
ATOM   5502  C C     . ARG E 1 36  ? 6.600   -23.762 145.387 1.00 109.96 ? 36  ARG F C     1 
ATOM   5503  O O     . ARG E 1 36  ? 6.840   -24.848 144.861 1.00 108.49 ? 36  ARG F O     1 
ATOM   5504  C CB    . ARG E 1 36  ? 7.633   -21.921 144.038 1.00 118.86 ? 36  ARG F CB    1 
ATOM   5505  C CG    . ARG E 1 36  ? 7.471   -20.948 142.883 1.00 122.85 ? 36  ARG F CG    1 
ATOM   5506  C CD    . ARG E 1 36  ? 8.791   -20.287 142.529 1.00 124.21 ? 36  ARG F CD    1 
ATOM   5507  N NE    . ARG E 1 36  ? 8.678   -19.461 141.332 1.00 131.37 ? 36  ARG F NE    1 
ATOM   5508  C CZ    . ARG E 1 36  ? 8.232   -18.208 141.327 1.00 138.72 ? 36  ARG F CZ    1 
ATOM   5509  N NH1   . ARG E 1 36  ? 7.851   -17.630 142.459 1.00 138.01 ? 36  ARG F NH1   1 
ATOM   5510  N NH2   . ARG E 1 36  ? 8.166   -17.534 140.187 1.00 143.39 ? 36  ARG F NH2   1 
ATOM   5511  N N     . TYR E 1 37  ? 6.577   -23.600 146.706 1.00 109.16 ? 37  TYR F N     1 
ATOM   5512  C CA    . TYR E 1 37  ? 6.953   -24.696 147.598 1.00 112.02 ? 37  TYR F CA    1 
ATOM   5513  C C     . TYR E 1 37  ? 5.809   -25.121 148.514 1.00 115.83 ? 37  TYR F C     1 
ATOM   5514  O O     . TYR E 1 37  ? 6.033   -25.540 149.651 1.00 119.82 ? 37  TYR F O     1 
ATOM   5515  C CB    . TYR E 1 37  ? 8.180   -24.313 148.433 1.00 112.56 ? 37  TYR F CB    1 
ATOM   5516  C CG    . TYR E 1 37  ? 9.380   -23.875 147.615 1.00 109.54 ? 37  TYR F CG    1 
ATOM   5517  C CD1   . TYR E 1 37  ? 9.490   -22.569 147.151 1.00 108.94 ? 37  TYR F CD1   1 
ATOM   5518  C CD2   . TYR E 1 37  ? 10.405  -24.765 147.315 1.00 104.39 ? 37  TYR F CD2   1 
ATOM   5519  C CE1   . TYR E 1 37  ? 10.582  -22.164 146.406 1.00 109.12 ? 37  TYR F CE1   1 
ATOM   5520  C CE2   . TYR E 1 37  ? 11.501  -24.368 146.570 1.00 106.48 ? 37  TYR F CE2   1 
ATOM   5521  C CZ    . TYR E 1 37  ? 11.585  -23.067 146.119 1.00 109.08 ? 37  TYR F CZ    1 
ATOM   5522  O OH    . TYR E 1 37  ? 12.676  -22.667 145.380 1.00 107.97 ? 37  TYR F OH    1 
ATOM   5523  N N     . ALA E 1 38  ? 4.585   -25.023 148.008 1.00 114.69 ? 38  ALA F N     1 
ATOM   5524  C CA    . ALA E 1 38  ? 3.398   -25.325 148.802 1.00 114.56 ? 38  ALA F CA    1 
ATOM   5525  C C     . ALA E 1 38  ? 3.335   -26.785 149.247 1.00 118.82 ? 38  ALA F C     1 
ATOM   5526  O O     . ALA E 1 38  ? 2.962   -27.080 150.382 1.00 120.23 ? 38  ALA F O     1 
ATOM   5527  C CB    . ALA E 1 38  ? 2.144   -24.957 148.030 1.00 116.28 ? 38  ALA F CB    1 
ATOM   5528  N N     . ASP E 1 39  ? 3.697   -27.693 148.348 1.00 123.75 ? 39  ASP F N     1 
ATOM   5529  C CA    . ASP E 1 39  ? 3.625   -29.123 148.632 1.00 125.71 ? 39  ASP F CA    1 
ATOM   5530  C C     . ASP E 1 39  ? 4.763   -29.588 149.537 1.00 123.17 ? 39  ASP F C     1 
ATOM   5531  O O     . ASP E 1 39  ? 4.684   -30.649 150.156 1.00 122.69 ? 39  ASP F O     1 
ATOM   5532  C CB    . ASP E 1 39  ? 3.623   -29.924 147.328 1.00 128.56 ? 39  ASP F CB    1 
ATOM   5533  C CG    . ASP E 1 39  ? 4.589   -29.366 146.300 1.00 133.18 ? 39  ASP F CG    1 
ATOM   5534  O OD1   . ASP E 1 39  ? 4.574   -28.137 146.071 1.00 135.41 ? 39  ASP F OD1   1 
ATOM   5535  O OD2   . ASP E 1 39  ? 5.368   -30.155 145.725 1.00 135.20 ? 39  ASP F OD2   1 
ATOM   5536  N N     . LEU E 1 40  ? 5.818   -28.786 149.614 1.00 119.49 ? 40  LEU F N     1 
ATOM   5537  C CA    . LEU E 1 40  ? 6.981   -29.128 150.424 1.00 115.11 ? 40  LEU F CA    1 
ATOM   5538  C C     . LEU E 1 40  ? 6.788   -28.679 151.866 1.00 110.52 ? 40  LEU F C     1 
ATOM   5539  O O     . LEU E 1 40  ? 7.601   -28.989 152.737 1.00 106.84 ? 40  LEU F O     1 
ATOM   5540  C CB    . LEU E 1 40  ? 8.244   -28.479 149.854 1.00 116.79 ? 40  LEU F CB    1 
ATOM   5541  C CG    . LEU E 1 40  ? 8.866   -29.059 148.580 1.00 122.14 ? 40  LEU F CG    1 
ATOM   5542  C CD1   . LEU E 1 40  ? 8.008   -28.796 147.341 1.00 122.65 ? 40  LEU F CD1   1 
ATOM   5543  C CD2   . LEU E 1 40  ? 10.275  -28.506 148.396 1.00 124.13 ? 40  LEU F CD2   1 
ATOM   5544  N N     . LEU E 1 41  ? 5.705   -27.948 152.107 1.00 111.37 ? 41  LEU F N     1 
ATOM   5545  C CA    . LEU E 1 41  ? 5.439   -27.353 153.412 1.00 111.00 ? 41  LEU F CA    1 
ATOM   5546  C C     . LEU E 1 41  ? 4.517   -28.239 154.256 1.00 116.24 ? 41  LEU F C     1 
ATOM   5547  O O     . LEU E 1 41  ? 3.573   -28.833 153.733 1.00 115.15 ? 41  LEU F O     1 
ATOM   5548  C CB    . LEU E 1 41  ? 4.812   -25.973 153.215 1.00 109.22 ? 41  LEU F CB    1 
ATOM   5549  C CG    . LEU E 1 41  ? 4.976   -24.937 154.323 1.00 111.25 ? 41  LEU F CG    1 
ATOM   5550  C CD1   . LEU E 1 41  ? 6.448   -24.645 154.563 1.00 111.40 ? 41  LEU F CD1   1 
ATOM   5551  C CD2   . LEU E 1 41  ? 4.225   -23.667 153.957 1.00 112.47 ? 41  LEU F CD2   1 
ATOM   5552  N N     . ASP E 1 42  ? 4.788   -28.322 155.559 1.00 119.17 ? 42  ASP F N     1 
ATOM   5553  C CA    . ASP E 1 42  ? 4.016   -29.194 156.454 1.00 123.20 ? 42  ASP F CA    1 
ATOM   5554  C C     . ASP E 1 42  ? 2.910   -28.461 157.227 1.00 121.14 ? 42  ASP F C     1 
ATOM   5555  O O     . ASP E 1 42  ? 2.820   -27.233 157.181 1.00 119.50 ? 42  ASP F O     1 
ATOM   5556  C CB    . ASP E 1 42  ? 4.948   -29.993 157.390 1.00 126.86 ? 42  ASP F CB    1 
ATOM   5557  C CG    . ASP E 1 42  ? 4.835   -29.578 158.854 1.00 128.07 ? 42  ASP F CG    1 
ATOM   5558  O OD1   . ASP E 1 42  ? 3.901   -30.046 159.541 1.00 133.06 ? 42  ASP F OD1   1 
ATOM   5559  O OD2   . ASP E 1 42  ? 5.696   -28.809 159.326 1.00 123.79 ? 42  ASP F OD2   1 
ATOM   5560  N N     . ASP E 1 43  ? 2.072   -29.233 157.921 1.00 123.22 ? 43  ASP F N     1 
ATOM   5561  C CA    . ASP E 1 43  ? 0.889   -28.726 158.620 1.00 125.71 ? 43  ASP F CA    1 
ATOM   5562  C C     . ASP E 1 43  ? 1.160   -27.539 159.546 1.00 124.56 ? 43  ASP F C     1 
ATOM   5563  O O     . ASP E 1 43  ? 0.570   -26.469 159.384 1.00 127.92 ? 43  ASP F O     1 
ATOM   5564  C CB    . ASP E 1 43  ? 0.229   -29.855 159.420 1.00 130.64 ? 43  ASP F CB    1 
ATOM   5565  C CG    . ASP E 1 43  ? 0.276   -31.189 158.695 1.00 136.57 ? 43  ASP F CG    1 
ATOM   5566  O OD1   . ASP E 1 43  ? -0.619  -31.451 157.864 1.00 139.53 ? 43  ASP F OD1   1 
ATOM   5567  O OD2   . ASP E 1 43  ? 1.210   -31.976 158.962 1.00 136.14 ? 43  ASP F OD2   1 
ATOM   5568  N N     . GLN E 1 44  ? 2.049   -27.735 160.515 1.00 119.97 ? 44  GLN F N     1 
ATOM   5569  C CA    . GLN E 1 44  ? 2.363   -26.696 161.492 1.00 119.38 ? 44  GLN F CA    1 
ATOM   5570  C C     . GLN E 1 44  ? 3.093   -25.501 160.874 1.00 115.02 ? 44  GLN F C     1 
ATOM   5571  O O     . GLN E 1 44  ? 3.135   -24.420 161.462 1.00 113.80 ? 44  GLN F O     1 
ATOM   5572  C CB    . GLN E 1 44  ? 3.168   -27.282 162.658 1.00 128.48 ? 44  GLN F CB    1 
ATOM   5573  C CG    . GLN E 1 44  ? 4.352   -28.138 162.234 1.00 141.41 ? 44  GLN F CG    1 
ATOM   5574  C CD    . GLN E 1 44  ? 5.680   -27.410 162.346 1.00 146.16 ? 44  GLN F CD    1 
ATOM   5575  O OE1   . GLN E 1 44  ? 5.787   -26.385 163.021 1.00 146.73 ? 44  GLN F OE1   1 
ATOM   5576  N NE2   . GLN E 1 44  ? 6.704   -27.943 161.685 1.00 145.17 ? 44  GLN F NE2   1 
ATOM   5577  N N     . GLU E 1 45  ? 3.660   -25.700 159.687 1.00 114.93 ? 45  GLU F N     1 
ATOM   5578  C CA    . GLU E 1 45  ? 4.357   -24.635 158.968 1.00 112.02 ? 45  GLU F CA    1 
ATOM   5579  C C     . GLU E 1 45  ? 3.382   -23.769 158.170 1.00 104.79 ? 45  GLU F C     1 
ATOM   5580  O O     . GLU E 1 45  ? 3.582   -22.560 158.023 1.00 98.04  ? 45  GLU F O     1 
ATOM   5581  C CB    . GLU E 1 45  ? 5.428   -25.228 158.047 1.00 114.12 ? 45  GLU F CB    1 
ATOM   5582  C CG    . GLU E 1 45  ? 6.614   -25.816 158.798 1.00 115.47 ? 45  GLU F CG    1 
ATOM   5583  C CD    . GLU E 1 45  ? 7.422   -26.794 157.965 1.00 118.32 ? 45  GLU F CD    1 
ATOM   5584  O OE1   . GLU E 1 45  ? 8.368   -27.397 158.514 1.00 115.90 ? 45  GLU F OE1   1 
ATOM   5585  O OE2   . GLU E 1 45  ? 7.107   -26.969 156.769 1.00 121.94 ? 45  GLU F OE2   1 
ATOM   5586  N N     . ARG E 1 46  ? 2.330   -24.398 157.656 1.00 102.39 ? 46  ARG F N     1 
ATOM   5587  C CA    . ARG E 1 46  ? 1.273   -23.681 156.955 1.00 100.76 ? 46  ARG F CA    1 
ATOM   5588  C C     . ARG E 1 46  ? 0.497   -22.811 157.940 1.00 97.70  ? 46  ARG F C     1 
ATOM   5589  O O     . ARG E 1 46  ? 0.024   -21.724 157.595 1.00 89.23  ? 46  ARG F O     1 
ATOM   5590  C CB    . ARG E 1 46  ? 0.337   -24.666 156.251 1.00 104.10 ? 46  ARG F CB    1 
ATOM   5591  C CG    . ARG E 1 46  ? 0.859   -25.172 154.917 1.00 106.05 ? 46  ARG F CG    1 
ATOM   5592  C CD    . ARG E 1 46  ? -0.143  -26.096 154.247 1.00 109.66 ? 46  ARG F CD    1 
ATOM   5593  N NE    . ARG E 1 46  ? -0.297  -27.352 154.976 1.00 112.60 ? 46  ARG F NE    1 
ATOM   5594  C CZ    . ARG E 1 46  ? 0.351   -28.473 154.672 1.00 114.33 ? 46  ARG F CZ    1 
ATOM   5595  N NH1   . ARG E 1 46  ? 0.154   -29.574 155.386 1.00 112.91 ? 46  ARG F NH1   1 
ATOM   5596  N NH2   . ARG E 1 46  ? 1.195   -28.494 153.649 1.00 115.73 ? 46  ARG F NH2   1 
ATOM   5597  N N     . ALA E 1 47  ? 0.387   -23.307 159.170 1.00 99.92  ? 47  ALA F N     1 
ATOM   5598  C CA    . ALA E 1 47  ? -0.269  -22.605 160.266 1.00 99.63  ? 47  ALA F CA    1 
ATOM   5599  C C     . ALA E 1 47  ? 0.501   -21.348 160.640 1.00 101.72 ? 47  ALA F C     1 
ATOM   5600  O O     . ALA E 1 47  ? -0.089  -20.312 160.944 1.00 101.19 ? 47  ALA F O     1 
ATOM   5601  C CB    . ALA E 1 47  ? -0.381  -23.521 161.470 1.00 98.85  ? 47  ALA F CB    1 
ATOM   5602  N N     . PHE E 1 48  ? 1.824   -21.451 160.625 1.00 102.64 ? 48  PHE F N     1 
ATOM   5603  C CA    . PHE E 1 48  ? 2.678   -20.310 160.916 1.00 98.43  ? 48  PHE F CA    1 
ATOM   5604  C C     . PHE E 1 48  ? 2.467   -19.166 159.927 1.00 93.85  ? 48  PHE F C     1 
ATOM   5605  O O     . PHE E 1 48  ? 2.245   -18.028 160.333 1.00 94.90  ? 48  PHE F O     1 
ATOM   5606  C CB    . PHE E 1 48  ? 4.144   -20.732 160.909 1.00 96.57  ? 48  PHE F CB    1 
ATOM   5607  C CG    . PHE E 1 48  ? 5.098   -19.612 161.203 1.00 94.85  ? 48  PHE F CG    1 
ATOM   5608  C CD1   . PHE E 1 48  ? 5.701   -18.905 160.173 1.00 93.52  ? 48  PHE F CD1   1 
ATOM   5609  C CD2   . PHE E 1 48  ? 5.402   -19.273 162.509 1.00 97.62  ? 48  PHE F CD2   1 
ATOM   5610  C CE1   . PHE E 1 48  ? 6.585   -17.878 160.443 1.00 93.41  ? 48  PHE F CE1   1 
ATOM   5611  C CE2   . PHE E 1 48  ? 6.287   -18.248 162.786 1.00 98.25  ? 48  PHE F CE2   1 
ATOM   5612  C CZ    . PHE E 1 48  ? 6.879   -17.548 161.752 1.00 94.45  ? 48  PHE F CZ    1 
ATOM   5613  N N     . ILE E 1 49  ? 2.544   -19.470 158.635 1.00 88.55  ? 49  ILE F N     1 
ATOM   5614  C CA    . ILE E 1 49  ? 2.432   -18.446 157.597 1.00 86.81  ? 49  ILE F CA    1 
ATOM   5615  C C     . ILE E 1 49  ? 1.058   -17.777 157.629 1.00 90.05  ? 49  ILE F C     1 
ATOM   5616  O O     . ILE E 1 49  ? 0.924   -16.578 157.371 1.00 89.18  ? 49  ILE F O     1 
ATOM   5617  C CB    . ILE E 1 49  ? 2.708   -19.032 156.194 1.00 86.05  ? 49  ILE F CB    1 
ATOM   5618  C CG1   . ILE E 1 49  ? 4.045   -19.779 156.181 1.00 86.52  ? 49  ILE F CG1   1 
ATOM   5619  C CG2   . ILE E 1 49  ? 2.701   -17.934 155.140 1.00 80.98  ? 49  ILE F CG2   1 
ATOM   5620  C CD1   . ILE E 1 49  ? 4.516   -20.179 154.796 1.00 88.43  ? 49  ILE F CD1   1 
ATOM   5621  N N     . ALA E 1 50  ? 0.043   -18.566 157.967 1.00 91.50  ? 50  ALA F N     1 
ATOM   5622  C CA    . ALA E 1 50  ? -1.321  -18.070 158.100 1.00 93.06  ? 50  ALA F CA    1 
ATOM   5623  C C     . ALA E 1 50  ? -1.448  -17.166 159.322 1.00 96.54  ? 50  ALA F C     1 
ATOM   5624  O O     . ALA E 1 50  ? -2.032  -16.080 159.255 1.00 97.17  ? 50  ALA F O     1 
ATOM   5625  C CB    . ALA E 1 50  ? -2.285  -19.236 158.210 1.00 93.12  ? 50  ALA F CB    1 
ATOM   5626  N N     . ALA E 1 51  ? -0.891  -17.633 160.436 1.00 99.97  ? 51  ALA F N     1 
ATOM   5627  C CA    . ALA E 1 51  ? -0.952  -16.917 161.705 1.00 102.00 ? 51  ALA F CA    1 
ATOM   5628  C C     . ALA E 1 51  ? -0.174  -15.617 161.639 1.00 99.57  ? 51  ALA F C     1 
ATOM   5629  O O     . ALA E 1 51  ? -0.565  -14.614 162.240 1.00 97.28  ? 51  ALA F O     1 
ATOM   5630  C CB    . ALA E 1 51  ? -0.408  -17.788 162.827 1.00 82.88  ? 51  ALA F CB    1 
ATOM   5631  N N     . PHE E 1 52  ? 0.937   -15.645 160.913 1.00 101.44 ? 52  PHE F N     1 
ATOM   5632  C CA    . PHE E 1 52  ? 1.803   -14.483 160.809 1.00 100.08 ? 52  PHE F CA    1 
ATOM   5633  C C     . PHE E 1 52  ? 1.072   -13.326 160.136 1.00 99.58  ? 52  PHE F C     1 
ATOM   5634  O O     . PHE E 1 52  ? 1.235   -12.171 160.528 1.00 94.15  ? 52  PHE F O     1 
ATOM   5635  C CB    . PHE E 1 52  ? 3.080   -14.832 160.043 1.00 93.51  ? 52  PHE F CB    1 
ATOM   5636  C CG    . PHE E 1 52  ? 4.027   -13.678 159.882 1.00 95.62  ? 52  PHE F CG    1 
ATOM   5637  C CD1   . PHE E 1 52  ? 4.911   -13.343 160.895 1.00 96.16  ? 52  PHE F CD1   1 
ATOM   5638  C CD2   . PHE E 1 52  ? 4.041   -12.935 158.714 1.00 98.49  ? 52  PHE F CD2   1 
ATOM   5639  C CE1   . PHE E 1 52  ? 5.787   -12.283 160.746 1.00 94.74  ? 52  PHE F CE1   1 
ATOM   5640  C CE2   . PHE E 1 52  ? 4.915   -11.876 158.560 1.00 99.84  ? 52  PHE F CE2   1 
ATOM   5641  C CZ    . PHE E 1 52  ? 5.789   -11.551 159.575 1.00 96.61  ? 52  PHE F CZ    1 
ATOM   5642  N N     . ALA E 1 53  ? 0.256   -13.638 159.134 1.00 97.72  ? 53  ALA F N     1 
ATOM   5643  C CA    . ALA E 1 53  ? -0.438  -12.601 158.377 1.00 93.66  ? 53  ALA F CA    1 
ATOM   5644  C C     . ALA E 1 53  ? -1.546  -11.949 159.199 1.00 96.46  ? 53  ALA F C     1 
ATOM   5645  O O     . ALA E 1 53  ? -1.928  -10.804 158.950 1.00 94.30  ? 53  ALA F O     1 
ATOM   5646  C CB    . ALA E 1 53  ? -0.993  -13.169 157.083 1.00 93.56  ? 53  ALA F CB    1 
ATOM   5647  N N     . GLU E 1 54  ? -2.048  -12.689 160.184 1.00 99.98  ? 54  GLU F N     1 
ATOM   5648  C CA    . GLU E 1 54  ? -3.115  -12.213 161.056 1.00 103.57 ? 54  GLU F CA    1 
ATOM   5649  C C     . GLU E 1 54  ? -2.587  -11.342 162.193 1.00 104.75 ? 54  GLU F C     1 
ATOM   5650  O O     . GLU E 1 54  ? -3.365  -10.744 162.935 1.00 106.87 ? 54  GLU F O     1 
ATOM   5651  C CB    . GLU E 1 54  ? -3.896  -13.400 161.620 1.00 113.59 ? 54  GLU F CB    1 
ATOM   5652  C CG    . GLU E 1 54  ? -4.711  -14.144 160.577 1.00 123.52 ? 54  GLU F CG    1 
ATOM   5653  C CD    . GLU E 1 54  ? -5.943  -13.369 160.156 1.00 130.43 ? 54  GLU F CD    1 
ATOM   5654  O OE1   . GLU E 1 54  ? -6.724  -12.978 161.049 1.00 134.43 ? 54  GLU F OE1   1 
ATOM   5655  O OE2   . GLU E 1 54  ? -6.128  -13.144 158.940 1.00 131.23 ? 54  GLU F OE2   1 
ATOM   5656  N N     . LEU E 1 55  ? -1.266  -11.276 162.333 1.00 105.32 ? 55  LEU F N     1 
ATOM   5657  C CA    . LEU E 1 55  ? -0.647  -10.427 163.347 1.00 97.59  ? 55  LEU F CA    1 
ATOM   5658  C C     . LEU E 1 55  ? -0.788  -8.955  162.980 1.00 95.76  ? 55  LEU F C     1 
ATOM   5659  O O     . LEU E 1 55  ? -0.934  -8.615  161.804 1.00 96.81  ? 55  LEU F O     1 
ATOM   5660  C CB    . LEU E 1 55  ? 0.836   -10.774 163.517 1.00 87.66  ? 55  LEU F CB    1 
ATOM   5661  C CG    . LEU E 1 55  ? 1.216   -11.995 164.359 1.00 83.89  ? 55  LEU F CG    1 
ATOM   5662  C CD1   . LEU E 1 55  ? 2.684   -12.339 164.165 1.00 81.51  ? 55  LEU F CD1   1 
ATOM   5663  C CD2   . LEU E 1 55  ? 0.923   -11.751 165.831 1.00 84.68  ? 55  LEU F CD2   1 
ATOM   5664  N N     . PRO E 1 56  ? -0.764  -8.074  163.994 1.00 91.05  ? 56  PRO F N     1 
ATOM   5665  C CA    . PRO E 1 56  ? -0.688  -6.637  163.730 1.00 91.34  ? 56  PRO F CA    1 
ATOM   5666  C C     . PRO E 1 56  ? 0.611   -6.308  163.023 1.00 97.31  ? 56  PRO F C     1 
ATOM   5667  O O     . PRO E 1 56  ? 1.594   -7.035  163.166 1.00 93.85  ? 56  PRO F O     1 
ATOM   5668  C CB    . PRO E 1 56  ? -0.665  -6.024  165.130 1.00 85.14  ? 56  PRO F CB    1 
ATOM   5669  C CG    . PRO E 1 56  ? -1.330  -7.028  165.992 1.00 86.40  ? 56  PRO F CG    1 
ATOM   5670  C CD    . PRO E 1 56  ? -0.955  -8.363  165.425 1.00 87.50  ? 56  PRO F CD    1 
ATOM   5671  N N     . GLU E 1 57  ? 0.612   -5.210  162.281 1.00 104.88 ? 57  GLU F N     1 
ATOM   5672  C CA    . GLU E 1 57  ? 1.775   -4.810  161.508 1.00 106.38 ? 57  GLU F CA    1 
ATOM   5673  C C     . GLU E 1 57  ? 3.027   -4.631  162.370 1.00 99.41  ? 57  GLU F C     1 
ATOM   5674  O O     . GLU E 1 57  ? 4.105   -5.094  162.001 1.00 101.55 ? 57  GLU F O     1 
ATOM   5675  C CB    . GLU E 1 57  ? 1.471   -3.532  160.731 1.00 113.52 ? 57  GLU F CB    1 
ATOM   5676  C CG    . GLU E 1 57  ? 2.573   -3.125  159.786 1.00 116.41 ? 57  GLU F CG    1 
ATOM   5677  C CD    . GLU E 1 57  ? 2.182   -3.291  158.334 1.00 122.54 ? 57  GLU F CD    1 
ATOM   5678  O OE1   . GLU E 1 57  ? 2.988   -2.912  157.460 1.00 129.00 ? 57  GLU F OE1   1 
ATOM   5679  O OE2   . GLU E 1 57  ? 1.070   -3.796  158.066 1.00 121.68 ? 57  GLU F OE2   1 
ATOM   5680  N N     . ALA E 1 58  ? 2.890   -3.978  163.520 1.00 90.40  ? 58  ALA F N     1 
ATOM   5681  C CA    . ALA E 1 58  ? 4.040   -3.773  164.401 1.00 85.84  ? 58  ALA F CA    1 
ATOM   5682  C C     . ALA E 1 58  ? 4.508   -5.054  165.095 1.00 81.73  ? 58  ALA F C     1 
ATOM   5683  O O     . ALA E 1 58  ? 5.612   -5.105  165.633 1.00 84.51  ? 58  ALA F O     1 
ATOM   5684  C CB    . ALA E 1 58  ? 3.750   -2.689  165.428 1.00 76.04  ? 58  ALA F CB    1 
ATOM   5685  N N     . SER E 1 59  ? 3.672   -6.085  165.089 1.00 78.37  ? 59  SER F N     1 
ATOM   5686  C CA    . SER E 1 59  ? 4.045   -7.347  165.716 1.00 77.01  ? 59  SER F CA    1 
ATOM   5687  C C     . SER E 1 59  ? 4.826   -8.217  164.743 1.00 80.86  ? 59  SER F C     1 
ATOM   5688  O O     . SER E 1 59  ? 5.779   -8.898  165.127 1.00 80.20  ? 59  SER F O     1 
ATOM   5689  C CB    . SER E 1 59  ? 2.811   -8.083  166.236 1.00 76.32  ? 59  SER F CB    1 
ATOM   5690  O OG    . SER E 1 59  ? 2.265   -7.403  167.352 1.00 94.38  ? 59  SER F OG    1 
ATOM   5691  N N     . GLN E 1 60  ? 4.408   -8.189  163.482 1.00 83.04  ? 60  GLN F N     1 
ATOM   5692  C CA    . GLN E 1 60  ? 5.153   -8.828  162.406 1.00 83.05  ? 60  GLN F CA    1 
ATOM   5693  C C     . GLN E 1 60  ? 6.549   -8.237  162.327 1.00 88.79  ? 60  GLN F C     1 
ATOM   5694  O O     . GLN E 1 60  ? 7.536   -8.960  162.192 1.00 89.68  ? 60  GLN F O     1 
ATOM   5695  C CB    . GLN E 1 60  ? 4.446   -8.611  161.072 1.00 84.00  ? 60  GLN F CB    1 
ATOM   5696  C CG    . GLN E 1 60  ? 3.036   -9.160  161.020 1.00 92.68  ? 60  GLN F CG    1 
ATOM   5697  C CD    . GLN E 1 60  ? 2.377   -8.934  159.675 1.00 100.38 ? 60  GLN F CD    1 
ATOM   5698  O OE1   . GLN E 1 60  ? 3.003   -8.440  158.736 1.00 103.06 ? 60  GLN F OE1   1 
ATOM   5699  N NE2   . GLN E 1 60  ? 1.106   -9.297  159.575 1.00 107.03 ? 60  GLN F NE2   1 
ATOM   5700  N N     . ALA E 1 61  ? 6.620   -6.913  162.412 1.00 87.58  ? 61  ALA F N     1 
ATOM   5701  C CA    . ALA E 1 61  ? 7.884   -6.196  162.304 1.00 82.88  ? 61  ALA F CA    1 
ATOM   5702  C C     . ALA E 1 61  ? 8.856   -6.589  163.411 1.00 87.34  ? 61  ALA F C     1 
ATOM   5703  O O     . ALA E 1 61  ? 10.028  -6.859  163.150 1.00 93.57  ? 61  ALA F O     1 
ATOM   5704  C CB    . ALA E 1 61  ? 7.642   -4.694  162.315 1.00 74.36  ? 61  ALA F CB    1 
ATOM   5705  N N     . LEU E 1 62  ? 8.362   -6.632  164.643 1.00 85.02  ? 62  LEU F N     1 
ATOM   5706  C CA    . LEU E 1 62  ? 9.207   -6.927  165.797 1.00 81.29  ? 62  LEU F CA    1 
ATOM   5707  C C     . LEU E 1 62  ? 9.776   -8.340  165.717 1.00 82.52  ? 62  LEU F C     1 
ATOM   5708  O O     . LEU E 1 62  ? 10.934  -8.582  166.065 1.00 84.48  ? 62  LEU F O     1 
ATOM   5709  C CB    . LEU E 1 62  ? 8.420   -6.744  167.096 1.00 76.58  ? 62  LEU F CB    1 
ATOM   5710  C CG    . LEU E 1 62  ? 9.193   -7.058  168.379 1.00 75.00  ? 62  LEU F CG    1 
ATOM   5711  C CD1   . LEU E 1 62  ? 10.425  -6.166  168.536 1.00 72.13  ? 62  LEU F CD1   1 
ATOM   5712  C CD2   . LEU E 1 62  ? 8.273   -6.951  169.589 1.00 79.21  ? 62  LEU F CD2   1 
ATOM   5713  N N     . LEU E 1 63  ? 8.948   -9.264  165.244 1.00 78.71  ? 63  LEU F N     1 
ATOM   5714  C CA    . LEU E 1 63  ? 9.341   -10.656 165.083 1.00 77.22  ? 63  LEU F CA    1 
ATOM   5715  C C     . LEU E 1 63  ? 10.471  -10.776 164.063 1.00 83.14  ? 63  LEU F C     1 
ATOM   5716  O O     . LEU E 1 63  ? 11.507  -11.382 164.340 1.00 90.67  ? 63  LEU F O     1 
ATOM   5717  C CB    . LEU E 1 63  ? 8.142   -11.500 164.643 1.00 71.50  ? 63  LEU F CB    1 
ATOM   5718  C CG    . LEU E 1 63  ? 8.418   -12.999 164.534 1.00 85.85  ? 63  LEU F CG    1 
ATOM   5719  C CD1   . LEU E 1 63  ? 8.611   -13.607 165.907 1.00 71.88  ? 63  LEU F CD1   1 
ATOM   5720  C CD2   . LEU E 1 63  ? 7.303   -13.706 163.787 1.00 72.90  ? 63  LEU F CD2   1 
ATOM   5721  N N     . VAL E 1 64  ? 10.263  -10.187 162.889 1.00 79.39  ? 64  VAL F N     1 
ATOM   5722  C CA    . VAL E 1 64  ? 11.268  -10.170 161.829 1.00 75.10  ? 64  VAL F CA    1 
ATOM   5723  C C     . VAL E 1 64  ? 12.614  -9.612  162.321 1.00 71.85  ? 64  VAL F C     1 
ATOM   5724  O O     . VAL E 1 64  ? 13.670  -10.130 161.962 1.00 79.55  ? 64  VAL F O     1 
ATOM   5725  C CB    . VAL E 1 64  ? 10.772  -9.366  160.604 1.00 74.53  ? 64  VAL F CB    1 
ATOM   5726  C CG1   . VAL E 1 64  ? 11.877  -9.216  159.577 1.00 75.56  ? 64  VAL F CG1   1 
ATOM   5727  C CG2   . VAL E 1 64  ? 9.557   -10.039 159.981 1.00 71.47  ? 64  VAL F CG2   1 
ATOM   5728  N N     . ARG E 1 65  ? 12.571  -8.580  163.162 1.00 68.71  ? 65  ARG F N     1 
ATOM   5729  C CA    . ARG E 1 65  ? 13.787  -7.993  163.725 1.00 75.18  ? 65  ARG F CA    1 
ATOM   5730  C C     . ARG E 1 65  ? 14.627  -9.013  164.490 1.00 76.82  ? 65  ARG F C     1 
ATOM   5731  O O     . ARG E 1 65  ? 15.851  -9.083  164.320 1.00 79.60  ? 65  ARG F O     1 
ATOM   5732  C CB    . ARG E 1 65  ? 13.438  -6.824  164.645 1.00 76.65  ? 65  ARG F CB    1 
ATOM   5733  C CG    . ARG E 1 65  ? 12.989  -5.585  163.908 1.00 74.66  ? 65  ARG F CG    1 
ATOM   5734  C CD    . ARG E 1 65  ? 14.105  -5.018  163.056 1.00 70.55  ? 65  ARG F CD    1 
ATOM   5735  N NE    . ARG E 1 65  ? 13.783  -3.670  162.602 1.00 76.90  ? 65  ARG F NE    1 
ATOM   5736  C CZ    . ARG E 1 65  ? 14.593  -2.920  161.864 1.00 82.55  ? 65  ARG F CZ    1 
ATOM   5737  N NH1   . ARG E 1 65  ? 15.776  -3.391  161.497 1.00 88.52  ? 65  ARG F NH1   1 
ATOM   5738  N NH2   . ARG E 1 65  ? 14.224  -1.701  161.496 1.00 82.53  ? 65  ARG F NH2   1 
ATOM   5739  N N     . MET E 1 66  ? 13.959  -9.792  165.335 1.00 72.41  ? 66  MET F N     1 
ATOM   5740  C CA    . MET E 1 66  ? 14.619  -10.811 166.137 1.00 73.05  ? 66  MET F CA    1 
ATOM   5741  C C     . MET E 1 66  ? 15.127  -11.959 165.260 1.00 76.72  ? 66  MET F C     1 
ATOM   5742  O O     . MET E 1 66  ? 16.168  -12.561 165.540 1.00 80.86  ? 66  MET F O     1 
ATOM   5743  C CB    . MET E 1 66  ? 13.656  -11.324 167.207 1.00 68.07  ? 66  MET F CB    1 
ATOM   5744  C CG    . MET E 1 66  ? 13.074  -10.204 168.067 1.00 90.93  ? 66  MET F CG    1 
ATOM   5745  S SD    . MET E 1 66  ? 11.590  -10.660 169.023 1.00 92.65  ? 66  MET F SD    1 
ATOM   5746  C CE    . MET E 1 66  ? 12.249  -11.789 170.251 1.00 75.38  ? 66  MET F CE    1 
ATOM   5747  N N     . VAL E 1 67  ? 14.388  -12.254 164.195 1.00 75.02  ? 67  VAL F N     1 
ATOM   5748  C CA    . VAL E 1 67  ? 14.748  -13.342 163.295 1.00 78.09  ? 67  VAL F CA    1 
ATOM   5749  C C     . VAL E 1 67  ? 16.007  -12.967 162.519 1.00 78.39  ? 67  VAL F C     1 
ATOM   5750  O O     . VAL E 1 67  ? 16.948  -13.755 162.405 1.00 83.43  ? 67  VAL F O     1 
ATOM   5751  C CB    . VAL E 1 67  ? 13.601  -13.661 162.316 1.00 74.09  ? 67  VAL F CB    1 
ATOM   5752  C CG1   . VAL E 1 67  ? 14.056  -14.671 161.285 1.00 72.22  ? 67  VAL F CG1   1 
ATOM   5753  C CG2   . VAL E 1 67  ? 12.374  -14.171 163.073 1.00 75.91  ? 67  VAL F CG2   1 
ATOM   5754  N N     . MET E 1 68  ? 16.024  -11.740 162.011 1.00 68.40  ? 68  MET F N     1 
ATOM   5755  C CA    . MET E 1 68  ? 17.148  -11.232 161.235 1.00 67.44  ? 68  MET F CA    1 
ATOM   5756  C C     . MET E 1 68  ? 18.422  -11.025 162.058 1.00 66.97  ? 68  MET F C     1 
ATOM   5757  O O     . MET E 1 68  ? 19.528  -11.261 161.570 1.00 72.76  ? 68  MET F O     1 
ATOM   5758  C CB    . MET E 1 68  ? 16.753  -9.925  160.552 1.00 67.38  ? 68  MET F CB    1 
ATOM   5759  C CG    . MET E 1 68  ? 15.779  -10.104 159.398 1.00 68.01  ? 68  MET F CG    1 
ATOM   5760  S SD    . MET E 1 68  ? 15.517  -8.550  158.532 1.00 90.78  ? 68  MET F SD    1 
ATOM   5761  C CE    . MET E 1 68  ? 14.467  -9.080  157.179 1.00 90.75  ? 68  MET F CE    1 
ATOM   5762  N N     . ARG E 1 69  ? 18.266  -10.586 163.302 1.00 66.61  ? 69  ARG F N     1 
ATOM   5763  C CA    . ARG E 1 69  ? 19.416  -10.323 164.163 1.00 66.26  ? 69  ARG F CA    1 
ATOM   5764  C C     . ARG E 1 69  ? 20.056  -11.608 164.666 1.00 79.15  ? 69  ARG F C     1 
ATOM   5765  O O     . ARG E 1 69  ? 19.422  -12.665 164.688 1.00 91.73  ? 69  ARG F O     1 
ATOM   5766  C CB    . ARG E 1 69  ? 19.039  -9.410  165.333 1.00 66.26  ? 69  ARG F CB    1 
ATOM   5767  C CG    . ARG E 1 69  ? 18.814  -7.963  164.923 1.00 65.81  ? 69  ARG F CG    1 
ATOM   5768  C CD    . ARG E 1 69  ? 18.203  -7.141  166.045 1.00 65.79  ? 69  ARG F CD    1 
ATOM   5769  N NE    . ARG E 1 69  ? 19.063  -7.097  167.222 1.00 65.60  ? 69  ARG F NE    1 
ATOM   5770  C CZ    . ARG E 1 69  ? 18.924  -6.227  168.217 1.00 73.64  ? 69  ARG F CZ    1 
ATOM   5771  N NH1   . ARG E 1 69  ? 17.959  -5.318  168.173 1.00 70.75  ? 69  ARG F NH1   1 
ATOM   5772  N NH2   . ARG E 1 69  ? 19.754  -6.260  169.251 1.00 77.96  ? 69  ARG F NH2   1 
ATOM   5773  N N     . LYS E 1 70  ? 21.313  -11.479 165.085 1.00 76.75  ? 70  LYS F N     1 
ATOM   5774  C CA    . LYS E 1 70  ? 22.206  -12.595 165.390 1.00 81.87  ? 70  LYS F CA    1 
ATOM   5775  C C     . LYS E 1 70  ? 21.648  -13.607 166.372 1.00 80.49  ? 70  LYS F C     1 
ATOM   5776  O O     . LYS E 1 70  ? 21.583  -14.794 166.075 1.00 89.41  ? 70  LYS F O     1 
ATOM   5777  C CB    . LYS E 1 70  ? 23.538  -12.066 165.934 1.00 93.16  ? 70  LYS F CB    1 
ATOM   5778  C CG    . LYS E 1 70  ? 24.558  -13.144 166.300 1.00 100.96 ? 70  LYS F CG    1 
ATOM   5779  C CD    . LYS E 1 70  ? 25.210  -13.742 165.064 1.00 104.54 ? 70  LYS F CD    1 
ATOM   5780  C CE    . LYS E 1 70  ? 26.663  -14.134 165.336 1.00 108.63 ? 70  LYS F CE    1 
ATOM   5781  N NZ    . LYS E 1 70  ? 27.366  -14.537 164.083 1.00 111.24 ? 70  LYS F NZ    1 
ATOM   5782  N N     . GLY E 1 71  ? 21.271  -13.145 167.555 1.00 73.93  ? 71  GLY F N     1 
ATOM   5783  C CA    . GLY E 1 71  ? 20.851  -14.061 168.598 1.00 84.12  ? 71  GLY F CA    1 
ATOM   5784  C C     . GLY E 1 71  ? 19.463  -14.662 168.430 1.00 89.27  ? 71  GLY F C     1 
ATOM   5785  O O     . GLY E 1 71  ? 18.865  -14.640 167.346 1.00 82.93  ? 71  GLY F O     1 
ATOM   5786  N N     . THR E 1 72  ? 18.979  -15.226 169.531 1.00 90.76  ? 72  THR F N     1 
ATOM   5787  C CA    . THR E 1 72  ? 17.632  -15.735 169.657 1.00 77.06  ? 72  THR F CA    1 
ATOM   5788  C C     . THR E 1 72  ? 17.174  -15.212 171.023 1.00 76.00  ? 72  THR F C     1 
ATOM   5789  O O     . THR E 1 72  ? 15.970  -15.195 171.328 1.00 81.30  ? 72  THR F O     1 
ATOM   5790  C CB    . THR E 1 72  ? 17.604  -17.287 169.579 1.00 84.72  ? 72  THR F CB    1 
ATOM   5791  O OG1   . THR E 1 72  ? 16.612  -17.719 168.637 1.00 92.29  ? 72  THR F OG1   1 
ATOM   5792  C CG2   . THR E 1 72  ? 17.306  -17.903 170.931 1.00 70.57  ? 72  THR F CG2   1 
ATOM   5793  N N     . LEU E 1 73  ? 18.146  -14.779 171.836 1.00 79.12  ? 73  LEU F N     1 
ATOM   5794  C CA    . LEU E 1 73  ? 17.858  -14.081 173.092 1.00 81.06  ? 73  LEU F CA    1 
ATOM   5795  C C     . LEU E 1 73  ? 17.951  -12.570 172.861 1.00 79.82  ? 73  LEU F C     1 
ATOM   5796  O O     . LEU E 1 73  ? 18.838  -12.106 172.142 1.00 76.66  ? 73  LEU F O     1 
ATOM   5797  C CB    . LEU E 1 73  ? 18.839  -14.491 174.199 1.00 78.99  ? 73  LEU F CB    1 
ATOM   5798  C CG    . LEU E 1 73  ? 18.656  -15.779 175.013 1.00 80.30  ? 73  LEU F CG    1 
ATOM   5799  C CD1   . LEU E 1 73  ? 18.435  -16.975 174.115 1.00 77.27  ? 73  LEU F CD1   1 
ATOM   5800  C CD2   . LEU E 1 73  ? 19.869  -16.026 175.898 1.00 83.13  ? 73  LEU F CD2   1 
ATOM   5801  N N     . PHE E 1 74  ? 17.038  -11.804 173.454 1.00 81.37  ? 74  PHE F N     1 
ATOM   5802  C CA    . PHE E 1 74  ? 17.056  -10.348 173.301 1.00 76.47  ? 74  PHE F CA    1 
ATOM   5803  C C     . PHE E 1 74  ? 16.622  -9.642  174.579 1.00 85.44  ? 74  PHE F C     1 
ATOM   5804  O O     . PHE E 1 74  ? 15.619  -10.007 175.194 1.00 88.62  ? 74  PHE F O     1 
ATOM   5805  C CB    . PHE E 1 74  ? 16.163  -9.899  172.139 1.00 67.94  ? 74  PHE F CB    1 
ATOM   5806  C CG    . PHE E 1 74  ? 16.678  -10.297 170.789 1.00 75.98  ? 74  PHE F CG    1 
ATOM   5807  C CD1   . PHE E 1 74  ? 16.323  -11.516 170.241 1.00 78.41  ? 74  PHE F CD1   1 
ATOM   5808  C CD2   . PHE E 1 74  ? 17.510  -9.451  170.070 1.00 77.64  ? 74  PHE F CD2   1 
ATOM   5809  C CE1   . PHE E 1 74  ? 16.786  -11.894 169.009 1.00 76.11  ? 74  PHE F CE1   1 
ATOM   5810  C CE2   . PHE E 1 74  ? 17.984  -9.815  168.832 1.00 78.23  ? 74  PHE F CE2   1 
ATOM   5811  C CZ    . PHE E 1 74  ? 17.621  -11.042 168.293 1.00 78.92  ? 74  PHE F CZ    1 
ATOM   5812  N N     . ARG E 1 75  ? 17.396  -8.643  174.989 1.00 85.10  ? 75  ARG F N     1 
ATOM   5813  C CA    . ARG E 1 75  ? 16.972  -7.766  176.068 1.00 81.73  ? 75  ARG F CA    1 
ATOM   5814  C C     . ARG E 1 75  ? 15.981  -6.763  175.498 1.00 88.78  ? 75  ARG F C     1 
ATOM   5815  O O     . ARG E 1 75  ? 16.120  -6.334  174.350 1.00 90.37  ? 75  ARG F O     1 
ATOM   5816  C CB    . ARG E 1 75  ? 18.166  -7.034  176.675 1.00 80.71  ? 75  ARG F CB    1 
ATOM   5817  C CG    . ARG E 1 75  ? 19.134  -7.935  177.409 1.00 88.62  ? 75  ARG F CG    1 
ATOM   5818  C CD    . ARG E 1 75  ? 20.249  -7.127  178.058 1.00 90.30  ? 75  ARG F CD    1 
ATOM   5819  N NE    . ARG E 1 75  ? 19.786  -6.344  179.200 1.00 89.35  ? 75  ARG F NE    1 
ATOM   5820  C CZ    . ARG E 1 75  ? 20.593  -5.787  180.098 1.00 92.08  ? 75  ARG F CZ    1 
ATOM   5821  N NH1   . ARG E 1 75  ? 21.907  -5.932  179.991 1.00 91.14  ? 75  ARG F NH1   1 
ATOM   5822  N NH2   . ARG E 1 75  ? 20.089  -5.092  181.108 1.00 94.92  ? 75  ARG F NH2   1 
ATOM   5823  N N     . GLU E 1 76  ? 14.979  -6.395  176.292 1.00 91.24  ? 76  GLU F N     1 
ATOM   5824  C CA    . GLU E 1 76  ? 13.962  -5.452  175.836 1.00 88.69  ? 76  GLU F CA    1 
ATOM   5825  C C     . GLU E 1 76  ? 14.564  -4.104  175.435 1.00 86.99  ? 76  GLU F C     1 
ATOM   5826  O O     . GLU E 1 76  ? 14.115  -3.476  174.476 1.00 89.05  ? 76  GLU F O     1 
ATOM   5827  C CB    . GLU E 1 76  ? 12.871  -5.266  176.896 1.00 89.14  ? 76  GLU F CB    1 
ATOM   5828  C CG    . GLU E 1 76  ? 11.901  -4.128  176.602 1.00 90.92  ? 76  GLU F CG    1 
ATOM   5829  C CD    . GLU E 1 76  ? 10.624  -4.211  177.415 1.00 93.86  ? 76  GLU F CD    1 
ATOM   5830  O OE1   . GLU E 1 76  ? 10.453  -3.399  178.348 1.00 99.58  ? 76  GLU F OE1   1 
ATOM   5831  O OE2   . GLU E 1 76  ? 9.784   -5.084  177.114 1.00 92.11  ? 76  GLU F OE2   1 
ATOM   5832  N N     . GLY E 1 77  ? 15.590  -3.675  176.165 1.00 82.98  ? 77  GLY F N     1 
ATOM   5833  C CA    . GLY E 1 77  ? 16.262  -2.421  175.876 1.00 83.22  ? 77  GLY F CA    1 
ATOM   5834  C C     . GLY E 1 77  ? 16.927  -2.425  174.514 1.00 87.12  ? 77  GLY F C     1 
ATOM   5835  O O     . GLY E 1 77  ? 17.058  -1.384  173.868 1.00 88.09  ? 77  GLY F O     1 
ATOM   5836  N N     . LYS E 1 78  ? 17.347  -3.604  174.071 1.00 88.83  ? 78  LYS F N     1 
ATOM   5837  C CA    . LYS E 1 78  ? 17.998  -3.734  172.775 1.00 87.00  ? 78  LYS F CA    1 
ATOM   5838  C C     . LYS E 1 78  ? 16.987  -3.978  171.656 1.00 85.20  ? 78  LYS F C     1 
ATOM   5839  O O     . LYS E 1 78  ? 17.361  -4.377  170.554 1.00 85.41  ? 78  LYS F O     1 
ATOM   5840  C CB    . LYS E 1 78  ? 19.042  -4.852  172.806 1.00 83.28  ? 78  LYS F CB    1 
ATOM   5841  C CG    . LYS E 1 78  ? 20.203  -4.584  173.749 1.00 78.36  ? 78  LYS F CG    1 
ATOM   5842  C CD    . LYS E 1 78  ? 20.878  -3.263  173.423 1.00 80.73  ? 78  LYS F CD    1 
ATOM   5843  C CE    . LYS E 1 78  ? 22.190  -3.106  174.176 1.00 84.14  ? 78  LYS F CE    1 
ATOM   5844  N NZ    . LYS E 1 78  ? 23.206  -4.089  173.706 1.00 83.75  ? 78  LYS F NZ    1 
ATOM   5845  N N     . LEU E 1 79  ? 15.710  -3.735  171.943 1.00 80.97  ? 79  LEU F N     1 
ATOM   5846  C CA    . LEU E 1 79  ? 14.660  -3.886  170.939 1.00 75.97  ? 79  LEU F CA    1 
ATOM   5847  C C     . LEU E 1 79  ? 13.847  -2.610  170.783 1.00 80.14  ? 79  LEU F C     1 
ATOM   5848  O O     . LEU E 1 79  ? 12.617  -2.640  170.771 1.00 85.62  ? 79  LEU F O     1 
ATOM   5849  C CB    . LEU E 1 79  ? 13.737  -5.049  171.290 1.00 73.45  ? 79  LEU F CB    1 
ATOM   5850  C CG    . LEU E 1 79  ? 14.308  -6.448  171.075 1.00 80.49  ? 79  LEU F CG    1 
ATOM   5851  C CD1   . LEU E 1 79  ? 13.252  -7.486  171.424 1.00 80.67  ? 79  LEU F CD1   1 
ATOM   5852  C CD2   . LEU E 1 79  ? 14.805  -6.625  169.644 1.00 67.18  ? 79  LEU F CD2   1 
ATOM   5853  N N     . ALA E 1 80  ? 14.547  -1.489  170.652 1.00 80.83  ? 80  ALA F N     1 
ATOM   5854  C CA    . ALA E 1 80  ? 13.901  -0.193  170.507 1.00 72.17  ? 80  ALA F CA    1 
ATOM   5855  C C     . ALA E 1 80  ? 13.833  0.214   169.038 1.00 73.85  ? 80  ALA F C     1 
ATOM   5856  O O     . ALA E 1 80  ? 14.845  0.573   168.444 1.00 80.47  ? 80  ALA F O     1 
ATOM   5857  C CB    . ALA E 1 80  ? 14.652  0.852   171.310 1.00 73.56  ? 80  ALA F CB    1 
ATOM   5858  N N     . TYR E 1 81  ? 12.643  0.152   168.451 1.00 79.47  ? 81  TYR F N     1 
ATOM   5859  C CA    . TYR E 1 81  ? 12.459  0.550   167.058 1.00 78.91  ? 81  TYR F CA    1 
ATOM   5860  C C     . TYR E 1 81  ? 11.317  1.552   166.929 1.00 87.80  ? 81  TYR F C     1 
ATOM   5861  O O     . TYR E 1 81  ? 10.188  1.275   167.343 1.00 95.94  ? 81  TYR F O     1 
ATOM   5862  C CB    . TYR E 1 81  ? 12.186  -0.671  166.177 1.00 75.72  ? 81  TYR F CB    1 
ATOM   5863  C CG    . TYR E 1 81  ? 13.328  -1.656  166.117 1.00 75.86  ? 81  TYR F CG    1 
ATOM   5864  C CD1   . TYR E 1 81  ? 13.413  -2.701  167.027 1.00 80.98  ? 81  TYR F CD1   1 
ATOM   5865  C CD2   . TYR E 1 81  ? 14.319  -1.547  165.148 1.00 70.67  ? 81  TYR F CD2   1 
ATOM   5866  C CE1   . TYR E 1 81  ? 14.451  -3.606  166.979 1.00 81.36  ? 81  TYR F CE1   1 
ATOM   5867  C CE2   . TYR E 1 81  ? 15.363  -2.452  165.090 1.00 69.09  ? 81  TYR F CE2   1 
ATOM   5868  C CZ    . TYR E 1 81  ? 15.424  -3.478  166.010 1.00 76.20  ? 81  TYR F CZ    1 
ATOM   5869  O OH    . TYR E 1 81  ? 16.458  -4.385  165.968 1.00 81.53  ? 81  TYR F OH    1 
ATOM   5870  N N     . ALA E 1 82  ? 11.611  2.710   166.343 1.00 83.75  ? 82  ALA F N     1 
ATOM   5871  C CA    . ALA E 1 82  ? 10.647  3.805   166.274 1.00 82.75  ? 82  ALA F CA    1 
ATOM   5872  C C     . ALA E 1 82  ? 9.419   3.466   165.433 1.00 87.48  ? 82  ALA F C     1 
ATOM   5873  O O     . ALA E 1 82  ? 8.305   3.894   165.741 1.00 93.95  ? 82  ALA F O     1 
ATOM   5874  C CB    . ALA E 1 82  ? 11.314  5.069   165.753 1.00 83.10  ? 82  ALA F CB    1 
ATOM   5875  N N     . GLU E 1 83  ? 9.627   2.694   164.372 1.00 87.50  ? 83  GLU F N     1 
ATOM   5876  C CA    . GLU E 1 83  ? 8.545   2.349   163.459 1.00 95.22  ? 83  GLU F CA    1 
ATOM   5877  C C     . GLU E 1 83  ? 7.556   1.361   164.071 1.00 92.27  ? 83  GLU F C     1 
ATOM   5878  O O     . GLU E 1 83  ? 6.407   1.278   163.640 1.00 95.89  ? 83  GLU F O     1 
ATOM   5879  C CB    . GLU E 1 83  ? 9.109   1.794   162.150 1.00 99.74  ? 83  GLU F CB    1 
ATOM   5880  C CG    . GLU E 1 83  ? 10.619  1.900   162.038 1.00 104.11 ? 83  GLU F CG    1 
ATOM   5881  C CD    . GLU E 1 83  ? 11.328  0.699   162.633 1.00 105.70 ? 83  GLU F CD    1 
ATOM   5882  O OE1   . GLU E 1 83  ? 12.288  0.894   163.410 1.00 115.54 ? 83  GLU F OE1   1 
ATOM   5883  O OE2   . GLU E 1 83  ? 10.926  -0.441  162.314 1.00 94.50  ? 83  GLU F OE2   1 
ATOM   5884  N N     . ILE E 1 84  ? 8.002   0.613   165.075 1.00 82.16  ? 84  ILE F N     1 
ATOM   5885  C CA    . ILE E 1 84  ? 7.131   -0.362  165.715 1.00 86.54  ? 84  ILE F CA    1 
ATOM   5886  C C     . ILE E 1 84  ? 6.531   0.184   167.009 1.00 87.78  ? 84  ILE F C     1 
ATOM   5887  O O     . ILE E 1 84  ? 5.520   -0.325  167.495 1.00 91.92  ? 84  ILE F O     1 
ATOM   5888  C CB    . ILE E 1 84  ? 7.857   -1.697  165.985 1.00 89.85  ? 84  ILE F CB    1 
ATOM   5889  C CG1   . ILE E 1 84  ? 8.631   -1.640  167.302 1.00 96.84  ? 84  ILE F CG1   1 
ATOM   5890  C CG2   . ILE E 1 84  ? 8.758   -2.062  164.815 1.00 86.11  ? 84  ILE F CG2   1 
ATOM   5891  C CD1   . ILE E 1 84  ? 8.345   -2.810  168.218 1.00 101.36 ? 84  ILE F CD1   1 
ATOM   5892  N N     . GLY E 1 85  ? 7.150   1.223   167.559 1.00 82.68  ? 85  GLY F N     1 
ATOM   5893  C CA    . GLY E 1 85  ? 6.649   1.842   168.772 1.00 86.88  ? 85  GLY F CA    1 
ATOM   5894  C C     . GLY E 1 85  ? 6.997   1.085   170.040 1.00 90.86  ? 85  GLY F C     1 
ATOM   5895  O O     . GLY E 1 85  ? 8.131   0.632   170.215 1.00 93.92  ? 85  GLY F O     1 
ATOM   5896  N N     . ASP E 1 86  ? 6.014   0.961   170.929 1.00 90.68  ? 86  ASP F N     1 
ATOM   5897  C CA    . ASP E 1 86  ? 6.185   0.261   172.198 1.00 76.31  ? 86  ASP F CA    1 
ATOM   5898  C C     . ASP E 1 86  ? 6.485   -1.202  171.927 1.00 92.65  ? 86  ASP F C     1 
ATOM   5899  O O     . ASP E 1 86  ? 5.718   -1.891  171.259 1.00 92.79  ? 86  ASP F O     1 
ATOM   5900  C CB    . ASP E 1 86  ? 4.919   0.383   173.051 1.00 84.42  ? 86  ASP F CB    1 
ATOM   5901  C CG    . ASP E 1 86  ? 5.130   -0.059  174.493 1.00 92.14  ? 86  ASP F CG    1 
ATOM   5902  O OD1   . ASP E 1 86  ? 6.068   -0.836  174.766 1.00 98.83  ? 86  ASP F OD1   1 
ATOM   5903  O OD2   . ASP E 1 86  ? 4.341   0.370   175.360 1.00 96.19  ? 86  ASP F OD2   1 
ATOM   5904  N N     . THR E 1 87  ? 7.606   -1.675  172.452 1.00 89.39  ? 87  THR F N     1 
ATOM   5905  C CA    . THR E 1 87  ? 8.039   -3.039  172.192 1.00 85.87  ? 87  THR F CA    1 
ATOM   5906  C C     . THR E 1 87  ? 7.333   -4.036  173.100 1.00 82.87  ? 87  THR F C     1 
ATOM   5907  O O     . THR E 1 87  ? 6.895   -5.093  172.651 1.00 83.05  ? 87  THR F O     1 
ATOM   5908  C CB    . THR E 1 87  ? 9.566   -3.181  172.320 1.00 81.81  ? 87  THR F CB    1 
ATOM   5909  O OG1   . THR E 1 87  ? 10.193  -2.486  171.235 1.00 77.29  ? 87  THR F OG1   1 
ATOM   5910  C CG2   . THR E 1 87  ? 9.972   -4.642  172.273 1.00 71.13  ? 87  THR F CG2   1 
ATOM   5911  N N     . ARG E 1 88  ? 7.208   -3.689  174.375 1.00 82.81  ? 88  ARG F N     1 
ATOM   5912  C CA    . ARG E 1 88  ? 6.558   -4.565  175.342 1.00 81.36  ? 88  ARG F CA    1 
ATOM   5913  C C     . ARG E 1 88  ? 5.108   -4.836  174.951 1.00 84.34  ? 88  ARG F C     1 
ATOM   5914  O O     . ARG E 1 88  ? 4.542   -5.874  175.291 1.00 87.06  ? 88  ARG F O     1 
ATOM   5915  C CB    . ARG E 1 88  ? 6.631   -3.957  176.741 1.00 78.35  ? 88  ARG F CB    1 
ATOM   5916  C CG    . ARG E 1 88  ? 6.110   -4.863  177.832 1.00 77.65  ? 88  ARG F CG    1 
ATOM   5917  C CD    . ARG E 1 88  ? 6.359   -4.263  179.198 1.00 108.76 ? 88  ARG F CD    1 
ATOM   5918  N NE    . ARG E 1 88  ? 7.775   -4.281  179.549 1.00 108.55 ? 88  ARG F NE    1 
ATOM   5919  C CZ    . ARG E 1 88  ? 8.263   -3.837  180.703 1.00 114.90 ? 88  ARG F CZ    1 
ATOM   5920  N NH1   . ARG E 1 88  ? 7.448   -3.337  181.622 1.00 116.23 ? 88  ARG F NH1   1 
ATOM   5921  N NH2   . ARG E 1 88  ? 9.566   -3.893  180.938 1.00 120.37 ? 88  ARG F NH2   1 
ATOM   5922  N N     . ALA E 1 89  ? 4.517   -3.897  174.223 1.00 83.77  ? 89  ALA F N     1 
ATOM   5923  C CA    . ALA E 1 89  ? 3.148   -4.040  173.747 1.00 84.04  ? 89  ALA F CA    1 
ATOM   5924  C C     . ALA E 1 89  ? 3.104   -4.890  172.483 1.00 78.14  ? 89  ALA F C     1 
ATOM   5925  O O     . ALA E 1 89  ? 2.337   -5.849  172.387 1.00 117.23 ? 89  ALA F O     1 
ATOM   5926  C CB    . ALA E 1 89  ? 2.548   -2.676  173.484 1.00 79.92  ? 89  ALA F CB    1 
ATOM   5927  N N     . ALA E 1 90  ? 3.943   -4.533  171.518 1.00 83.46  ? 90  ALA F N     1 
ATOM   5928  C CA    . ALA E 1 90  ? 4.026   -5.251  170.251 1.00 79.59  ? 90  ALA F CA    1 
ATOM   5929  C C     . ALA E 1 90  ? 4.463   -6.708  170.405 1.00 81.94  ? 90  ALA F C     1 
ATOM   5930  O O     . ALA E 1 90  ? 4.198   -7.532  169.530 1.00 89.16  ? 90  ALA F O     1 
ATOM   5931  C CB    . ALA E 1 90  ? 4.967   -4.528  169.310 1.00 78.33  ? 90  ALA F CB    1 
ATOM   5932  N N     . VAL E 1 91  ? 5.139   -7.022  171.506 1.00 81.84  ? 91  VAL F N     1 
ATOM   5933  C CA    . VAL E 1 91  ? 5.649   -8.373  171.726 1.00 86.96  ? 91  VAL F CA    1 
ATOM   5934  C C     . VAL E 1 91  ? 4.574   -9.283  172.306 1.00 96.26  ? 91  VAL F C     1 
ATOM   5935  O O     . VAL E 1 91  ? 4.736   -10.501 172.357 1.00 105.58 ? 91  VAL F O     1 
ATOM   5936  C CB    . VAL E 1 91  ? 6.851   -8.381  172.688 1.00 86.74  ? 91  VAL F CB    1 
ATOM   5937  C CG1   . VAL E 1 91  ? 6.372   -8.313  174.135 1.00 86.25  ? 91  VAL F CG1   1 
ATOM   5938  C CG2   . VAL E 1 91  ? 7.697   -9.629  172.470 1.00 80.24  ? 91  VAL F CG2   1 
ATOM   5939  N N     . GLN E 1 92  ? 3.476   -8.680  172.748 1.00 92.23  ? 92  GLN F N     1 
ATOM   5940  C CA    . GLN E 1 92  ? 2.406   -9.424  173.409 1.00 88.31  ? 92  GLN F CA    1 
ATOM   5941  C C     . GLN E 1 92  ? 1.713   -10.472 172.532 1.00 89.89  ? 92  GLN F C     1 
ATOM   5942  O O     . GLN E 1 92  ? 1.507   -11.598 172.984 1.00 98.46  ? 92  GLN F O     1 
ATOM   5943  C CB    . GLN E 1 92  ? 1.374   -8.479  174.040 1.00 80.80  ? 92  GLN F CB    1 
ATOM   5944  C CG    . GLN E 1 92  ? 1.899   -7.660  175.205 1.00 92.85  ? 92  GLN F CG    1 
ATOM   5945  C CD    . GLN E 1 92  ? 2.429   -8.517  176.334 1.00 80.79  ? 92  GLN F CD    1 
ATOM   5946  O OE1   . GLN E 1 92  ? 1.926   -9.609  176.585 1.00 93.90  ? 92  GLN F OE1   1 
ATOM   5947  N NE2   . GLN E 1 92  ? 3.458   -8.028  177.018 1.00 79.93  ? 92  GLN F NE2   1 
ATOM   5948  N N     . PRO E 1 93  ? 1.340   -10.116 171.285 1.00 90.53  ? 93  PRO F N     1 
ATOM   5949  C CA    . PRO E 1 93  ? 0.714   -11.150 170.452 1.00 93.56  ? 93  PRO F CA    1 
ATOM   5950  C C     . PRO E 1 93  ? 1.682   -12.272 170.115 1.00 87.85  ? 93  PRO F C     1 
ATOM   5951  O O     . PRO E 1 93  ? 1.266   -13.346 169.688 1.00 82.77  ? 93  PRO F O     1 
ATOM   5952  C CB    . PRO E 1 93  ? 0.349   -10.395 169.170 1.00 80.21  ? 93  PRO F CB    1 
ATOM   5953  C CG    . PRO E 1 93  ? 0.261   -8.976  169.573 1.00 90.50  ? 93  PRO F CG    1 
ATOM   5954  C CD    . PRO E 1 93  ? 1.318   -8.803  170.615 1.00 88.01  ? 93  PRO F CD    1 
ATOM   5955  N N     . LEU E 1 94  ? 2.969   -12.012 170.294 1.00 91.05  ? 94  LEU F N     1 
ATOM   5956  C CA    . LEU E 1 94  ? 3.985   -13.014 170.024 1.00 92.66  ? 94  LEU F CA    1 
ATOM   5957  C C     . LEU E 1 94  ? 4.172   -13.923 171.236 1.00 96.26  ? 94  LEU F C     1 
ATOM   5958  O O     . LEU E 1 94  ? 4.443   -15.114 171.093 1.00 97.47  ? 94  LEU F O     1 
ATOM   5959  C CB    . LEU E 1 94  ? 5.300   -12.348 169.630 1.00 83.66  ? 94  LEU F CB    1 
ATOM   5960  C CG    . LEU E 1 94  ? 5.232   -11.291 168.527 1.00 85.18  ? 94  LEU F CG    1 
ATOM   5961  C CD1   . LEU E 1 94  ? 6.629   -10.805 168.219 1.00 92.90  ? 94  LEU F CD1   1 
ATOM   5962  C CD2   . LEU E 1 94  ? 4.574   -11.835 167.275 1.00 81.93  ? 94  LEU F CD2   1 
ATOM   5963  N N     . LEU E 1 95  ? 4.022   -13.361 172.431 1.00 94.10  ? 95  LEU F N     1 
ATOM   5964  C CA    . LEU E 1 95  ? 4.048   -14.168 173.643 1.00 92.96  ? 95  LEU F CA    1 
ATOM   5965  C C     . LEU E 1 95  ? 2.795   -15.033 173.705 1.00 96.03  ? 95  LEU F C     1 
ATOM   5966  O O     . LEU E 1 95  ? 2.808   -16.127 174.267 1.00 97.98  ? 95  LEU F O     1 
ATOM   5967  C CB    . LEU E 1 95  ? 4.136   -13.279 174.885 1.00 89.05  ? 95  LEU F CB    1 
ATOM   5968  C CG    . LEU E 1 95  ? 5.321   -12.314 174.944 1.00 83.45  ? 95  LEU F CG    1 
ATOM   5969  C CD1   . LEU E 1 95  ? 5.325   -11.534 176.243 1.00 82.62  ? 95  LEU F CD1   1 
ATOM   5970  C CD2   . LEU E 1 95  ? 6.612   -13.089 174.792 1.00 80.72  ? 95  LEU F CD2   1 
ATOM   5971  N N     . ALA E 1 96  ? 1.713   -14.536 173.115 1.00 95.04  ? 96  ALA F N     1 
ATOM   5972  C CA    . ALA E 1 96  ? 0.442   -15.251 173.126 1.00 92.05  ? 96  ALA F CA    1 
ATOM   5973  C C     . ALA E 1 96  ? 0.524   -16.493 172.252 1.00 91.53  ? 96  ALA F C     1 
ATOM   5974  O O     . ALA E 1 96  ? -0.005  -17.550 172.596 1.00 93.99  ? 96  ALA F O     1 
ATOM   5975  C CB    . ALA E 1 96  ? -0.683  -14.347 172.659 1.00 84.07  ? 96  ALA F CB    1 
ATOM   5976  N N     . LEU E 1 97  ? 1.204   -16.357 171.121 1.00 89.47  ? 97  LEU F N     1 
ATOM   5977  C CA    . LEU E 1 97  ? 1.409   -17.476 170.209 1.00 81.83  ? 97  LEU F CA    1 
ATOM   5978  C C     . LEU E 1 97  ? 2.513   -18.422 170.684 1.00 87.45  ? 97  LEU F C     1 
ATOM   5979  O O     . LEU E 1 97  ? 2.628   -19.543 170.200 1.00 91.58  ? 97  LEU F O     1 
ATOM   5980  C CB    . LEU E 1 97  ? 1.737   -16.961 168.807 1.00 88.98  ? 97  LEU F CB    1 
ATOM   5981  C CG    . LEU E 1 97  ? 0.562   -16.397 168.011 1.00 81.59  ? 97  LEU F CG    1 
ATOM   5982  C CD1   . LEU E 1 97  ? 1.036   -15.728 166.729 1.00 80.38  ? 97  LEU F CD1   1 
ATOM   5983  C CD2   . LEU E 1 97  ? -0.413  -17.505 167.697 1.00 83.38  ? 97  LEU F CD2   1 
ATOM   5984  N N     . GLY E 1 98  ? 3.325   -17.965 171.630 1.00 82.53  ? 98  GLY F N     1 
ATOM   5985  C CA    . GLY E 1 98  ? 4.439   -18.752 172.127 1.00 85.37  ? 98  GLY F CA    1 
ATOM   5986  C C     . GLY E 1 98  ? 5.629   -18.734 171.181 1.00 90.89  ? 98  GLY F C     1 
ATOM   5987  O O     . GLY E 1 98  ? 6.590   -19.491 171.368 1.00 93.54  ? 98  GLY F O     1 
ATOM   5988  N N     . TRP E 1 99  ? 5.561   -17.875 170.164 1.00 91.84  ? 99  TRP F N     1 
ATOM   5989  C CA    . TRP E 1 99  ? 6.664   -17.693 169.221 1.00 87.23  ? 99  TRP F CA    1 
ATOM   5990  C C     . TRP E 1 99  ? 7.828   -16.996 169.919 1.00 87.43  ? 99  TRP F C     1 
ATOM   5991  O O     . TRP E 1 99  ? 8.998   -17.204 169.562 1.00 100.81 ? 99  TRP F O     1 
ATOM   5992  C CB    . TRP E 1 99  ? 6.226   -16.868 168.007 1.00 86.61  ? 99  TRP F CB    1 
ATOM   5993  C CG    . TRP E 1 99  ? 5.206   -17.558 167.150 1.00 86.76  ? 99  TRP F CG    1 
ATOM   5994  C CD1   . TRP E 1 99  ? 4.675   -18.797 167.355 1.00 83.02  ? 99  TRP F CD1   1 
ATOM   5995  C CD2   . TRP E 1 99  ? 4.592   -17.054 165.952 1.00 87.04  ? 99  TRP F CD2   1 
ATOM   5996  N NE1   . TRP E 1 99  ? 3.773   -19.097 166.364 1.00 83.09  ? 99  TRP F NE1   1 
ATOM   5997  C CE2   . TRP E 1 99  ? 3.704   -18.045 165.490 1.00 82.80  ? 99  TRP F CE2   1 
ATOM   5998  C CE3   . TRP E 1 99  ? 4.705   -15.862 165.228 1.00 89.49  ? 99  TRP F CE3   1 
ATOM   5999  C CZ2   . TRP E 1 99  ? 2.936   -17.883 164.340 1.00 85.91  ? 99  TRP F CZ2   1 
ATOM   6000  C CZ3   . TRP E 1 99  ? 3.942   -15.705 164.088 1.00 89.12  ? 99  TRP F CZ3   1 
ATOM   6001  C CH2   . TRP E 1 99  ? 3.070   -16.709 163.655 1.00 87.82  ? 99  TRP F CH2   1 
ATOM   6002  N N     . VAL E 1 100 ? 7.507   -16.178 170.920 1.00 77.57  ? 100 VAL F N     1 
ATOM   6003  C CA    . VAL E 1 100 ? 8.527   -15.532 171.740 1.00 77.24  ? 100 VAL F CA    1 
ATOM   6004  C C     . VAL E 1 100 ? 8.290   -15.925 173.197 1.00 75.98  ? 100 VAL F C     1 
ATOM   6005  O O     . VAL E 1 100 ? 7.149   -16.188 173.588 1.00 76.52  ? 100 VAL F O     1 
ATOM   6006  C CB    . VAL E 1 100 ? 8.468   -14.011 171.572 1.00 77.72  ? 100 VAL F CB    1 
ATOM   6007  C CG1   . VAL E 1 100 ? 9.571   -13.327 172.371 1.00 72.42  ? 100 VAL F CG1   1 
ATOM   6008  C CG2   . VAL E 1 100 ? 8.583   -13.648 170.095 1.00 77.63  ? 100 VAL F CG2   1 
ATOM   6009  N N     . ASP E 1 101 ? 9.354   -15.994 173.994 1.00 77.10  ? 101 ASP F N     1 
ATOM   6010  C CA    . ASP E 1 101 ? 9.214   -16.456 175.364 1.00 77.63  ? 101 ASP F CA    1 
ATOM   6011  C C     . ASP E 1 101 ? 9.923   -15.577 176.388 1.00 88.80  ? 101 ASP F C     1 
ATOM   6012  O O     . ASP E 1 101 ? 11.135  -15.689 176.580 1.00 99.47  ? 101 ASP F O     1 
ATOM   6013  C CB    . ASP E 1 101 ? 9.735   -17.881 175.506 1.00 80.88  ? 101 ASP F CB    1 
ATOM   6014  C CG    . ASP E 1 101 ? 9.583   -18.408 176.922 1.00 94.62  ? 101 ASP F CG    1 
ATOM   6015  O OD1   . ASP E 1 101 ? 8.525   -18.141 177.535 1.00 108.01 ? 101 ASP F OD1   1 
ATOM   6016  O OD2   . ASP E 1 101 ? 10.505  -19.093 177.418 1.00 99.71  ? 101 ASP F OD2   1 
ATOM   6017  N N     . ALA E 1 102 ? 9.169   -14.719 177.068 1.00 89.49  ? 102 ALA F N     1 
ATOM   6018  C CA    . ALA E 1 102 ? 9.696   -14.057 178.256 1.00 91.16  ? 102 ALA F CA    1 
ATOM   6019  C C     . ALA E 1 102 ? 9.834   -15.145 179.316 1.00 97.32  ? 102 ALA F C     1 
ATOM   6020  O O     . ALA E 1 102 ? 9.178   -16.190 179.226 1.00 104.88 ? 102 ALA F O     1 
ATOM   6021  C CB    . ALA E 1 102 ? 8.769   -12.962 178.726 1.00 76.29  ? 102 ALA F CB    1 
ATOM   6022  N N     . GLN E 1 103 ? 10.683  -14.906 180.310 1.00 76.63  ? 103 GLN F N     1 
ATOM   6023  C CA    . GLN E 1 103 ? 11.080  -15.949 181.256 1.00 92.39  ? 103 GLN F CA    1 
ATOM   6024  C C     . GLN E 1 103 ? 11.644  -17.200 180.569 1.00 86.45  ? 103 GLN F C     1 
ATOM   6025  O O     . GLN E 1 103 ? 11.096  -18.291 180.733 1.00 78.66  ? 103 GLN F O     1 
ATOM   6026  C CB    . GLN E 1 103 ? 9.907   -16.358 182.157 1.00 91.63  ? 103 GLN F CB    1 
ATOM   6027  C CG    . GLN E 1 103 ? 9.197   -15.215 182.854 1.00 100.48 ? 103 GLN F CG    1 
ATOM   6028  C CD    . GLN E 1 103 ? 7.857   -15.646 183.418 1.00 116.82 ? 103 GLN F CD    1 
ATOM   6029  O OE1   . GLN E 1 103 ? 7.237   -16.587 182.918 1.00 122.95 ? 103 GLN F OE1   1 
ATOM   6030  N NE2   . GLN E 1 103 ? 7.404   -14.965 184.466 1.00 122.34 ? 103 GLN F NE2   1 
ATOM   6031  N N     . PRO E 1 104 ? 12.735  -17.055 179.792 1.00 83.45  ? 104 PRO F N     1 
ATOM   6032  C CA    . PRO E 1 104 ? 13.377  -18.283 179.322 1.00 85.71  ? 104 PRO F CA    1 
ATOM   6033  C C     . PRO E 1 104 ? 14.420  -18.728 180.336 1.00 89.61  ? 104 PRO F C     1 
ATOM   6034  O O     . PRO E 1 104 ? 14.848  -17.925 181.168 1.00 88.17  ? 104 PRO F O     1 
ATOM   6035  C CB    . PRO E 1 104 ? 14.065  -17.835 178.034 1.00 81.17  ? 104 PRO F CB    1 
ATOM   6036  C CG    . PRO E 1 104 ? 14.444  -16.426 178.309 1.00 78.78  ? 104 PRO F CG    1 
ATOM   6037  C CD    . PRO E 1 104 ? 13.359  -15.856 179.201 1.00 79.60  ? 104 PRO F CD    1 
ATOM   6038  N N     . THR E 1 105 ? 14.818  -19.993 180.273 1.00 93.36  ? 105 THR F N     1 
ATOM   6039  C CA    . THR E 1 105 ? 15.875  -20.493 181.140 1.00 96.18  ? 105 THR F CA    1 
ATOM   6040  C C     . THR E 1 105 ? 17.212  -20.314 180.444 1.00 99.10  ? 105 THR F C     1 
ATOM   6041  O O     . THR E 1 105 ? 17.366  -20.662 179.271 1.00 100.07 ? 105 THR F O     1 
ATOM   6042  C CB    . THR E 1 105 ? 15.687  -21.973 181.480 1.00 95.99  ? 105 THR F CB    1 
ATOM   6043  O OG1   . THR E 1 105 ? 15.924  -22.764 180.309 1.00 97.25  ? 105 THR F OG1   1 
ATOM   6044  C CG2   . THR E 1 105 ? 14.277  -22.221 181.990 1.00 95.23  ? 105 THR F CG2   1 
ATOM   6045  N N     . LEU E 1 106 ? 18.175  -19.774 181.180 1.00 98.66  ? 106 LEU F N     1 
ATOM   6046  C CA    . LEU E 1 106 ? 19.449  -19.378 180.607 1.00 91.37  ? 106 LEU F CA    1 
ATOM   6047  C C     . LEU E 1 106 ? 20.618  -20.102 181.262 1.00 89.92  ? 106 LEU F C     1 
ATOM   6048  O O     . LEU E 1 106 ? 20.740  -20.124 182.488 1.00 84.93  ? 106 LEU F O     1 
ATOM   6049  C CB    . LEU E 1 106 ? 19.635  -17.871 180.771 1.00 92.10  ? 106 LEU F CB    1 
ATOM   6050  C CG    . LEU E 1 106 ? 18.478  -16.993 180.298 1.00 91.44  ? 106 LEU F CG    1 
ATOM   6051  C CD1   . LEU E 1 106 ? 18.794  -15.529 180.543 1.00 89.68  ? 106 LEU F CD1   1 
ATOM   6052  C CD2   . LEU E 1 106 ? 18.197  -17.249 178.831 1.00 90.34  ? 106 LEU F CD2   1 
ATOM   6053  N N     . GLU E 1 107 ? 21.469  -20.697 180.432 1.00 93.10  ? 107 GLU F N     1 
ATOM   6054  C CA    . GLU E 1 107 ? 22.749  -21.225 180.878 1.00 100.32 ? 107 GLU F CA    1 
ATOM   6055  C C     . GLU E 1 107 ? 23.626  -20.055 181.309 1.00 102.62 ? 107 GLU F C     1 
ATOM   6056  O O     . GLU E 1 107 ? 23.451  -18.935 180.821 1.00 104.52 ? 107 GLU F O     1 
ATOM   6057  C CB    . GLU E 1 107 ? 23.433  -21.966 179.733 1.00 106.07 ? 107 GLU F CB    1 
ATOM   6058  C CG    . GLU E 1 107 ? 22.622  -23.101 179.140 1.00 111.71 ? 107 GLU F CG    1 
ATOM   6059  C CD    . GLU E 1 107 ? 22.904  -24.425 179.816 1.00 118.73 ? 107 GLU F CD    1 
ATOM   6060  O OE1   . GLU E 1 107 ? 23.033  -25.440 179.099 1.00 120.75 ? 107 GLU F OE1   1 
ATOM   6061  O OE2   . GLU E 1 107 ? 23.001  -24.451 181.062 1.00 121.95 ? 107 GLU F OE2   1 
ATOM   6062  N N     . LEU E 1 108 ? 24.573  -20.313 182.208 1.00 98.96  ? 108 LEU F N     1 
ATOM   6063  C CA    . LEU E 1 108 ? 25.476  -19.273 182.698 1.00 93.03  ? 108 LEU F CA    1 
ATOM   6064  C C     . LEU E 1 108 ? 26.288  -18.678 181.549 1.00 91.28  ? 108 LEU F C     1 
ATOM   6065  O O     . LEU E 1 108 ? 26.703  -17.519 181.600 1.00 92.57  ? 108 LEU F O     1 
ATOM   6066  C CB    . LEU E 1 108 ? 26.399  -19.835 183.788 1.00 95.54  ? 108 LEU F CB    1 
ATOM   6067  C CG    . LEU E 1 108 ? 27.335  -18.913 184.587 1.00 89.34  ? 108 LEU F CG    1 
ATOM   6068  C CD1   . LEU E 1 108 ? 28.716  -18.823 183.957 1.00 83.73  ? 108 LEU F CD1   1 
ATOM   6069  C CD2   . LEU E 1 108 ? 26.742  -17.521 184.770 1.00 91.37  ? 108 LEU F CD2   1 
ATOM   6070  N N     . ALA E 1 109 ? 26.498  -19.476 180.508 1.00 92.88  ? 109 ALA F N     1 
ATOM   6071  C CA    . ALA E 1 109 ? 27.268  -19.042 179.349 1.00 93.72  ? 109 ALA F CA    1 
ATOM   6072  C C     . ALA E 1 109 ? 26.515  -18.039 178.480 1.00 89.99  ? 109 ALA F C     1 
ATOM   6073  O O     . ALA E 1 109 ? 27.122  -17.146 177.890 1.00 86.99  ? 109 ALA F O     1 
ATOM   6074  C CB    . ALA E 1 109 ? 27.692  -20.240 178.522 1.00 100.55 ? 109 ALA F CB    1 
ATOM   6075  N N     . GLN E 1 110 ? 25.197  -18.191 178.393 1.00 96.15  ? 110 GLN F N     1 
ATOM   6076  C CA    . GLN E 1 110 ? 24.397  -17.300 177.556 1.00 96.55  ? 110 GLN F CA    1 
ATOM   6077  C C     . GLN E 1 110 ? 23.849  -16.097 178.318 1.00 95.16  ? 110 GLN F C     1 
ATOM   6078  O O     . GLN E 1 110 ? 23.449  -15.101 177.714 1.00 92.84  ? 110 GLN F O     1 
ATOM   6079  C CB    . GLN E 1 110 ? 23.275  -18.060 176.845 1.00 93.60  ? 110 GLN F CB    1 
ATOM   6080  C CG    . GLN E 1 110 ? 22.438  -18.961 177.730 1.00 91.29  ? 110 GLN F CG    1 
ATOM   6081  C CD    . GLN E 1 110 ? 21.473  -19.801 176.918 1.00 91.03  ? 110 GLN F CD    1 
ATOM   6082  O OE1   . GLN E 1 110 ? 21.488  -19.759 175.687 1.00 85.14  ? 110 GLN F OE1   1 
ATOM   6083  N NE2   . GLN E 1 110 ? 20.627  -20.567 177.598 1.00 92.74  ? 110 GLN F NE2   1 
ATOM   6084  N N     . LEU E 1 111 ? 23.832  -16.194 179.644 1.00 96.64  ? 111 LEU F N     1 
ATOM   6085  C CA    . LEU E 1 111 ? 23.514  -15.045 180.483 1.00 91.79  ? 111 LEU F CA    1 
ATOM   6086  C C     . LEU E 1 111 ? 24.639  -14.038 180.336 1.00 83.85  ? 111 LEU F C     1 
ATOM   6087  O O     . LEU E 1 111 ? 24.421  -12.825 180.351 1.00 79.58  ? 111 LEU F O     1 
ATOM   6088  C CB    . LEU E 1 111 ? 23.402  -15.464 181.946 1.00 88.66  ? 111 LEU F CB    1 
ATOM   6089  C CG    . LEU E 1 111 ? 23.332  -14.340 182.982 1.00 81.72  ? 111 LEU F CG    1 
ATOM   6090  C CD1   . LEU E 1 111 ? 22.043  -13.557 182.835 1.00 81.93  ? 111 LEU F CD1   1 
ATOM   6091  C CD2   . LEU E 1 111 ? 23.455  -14.916 184.377 1.00 78.97  ? 111 LEU F CD2   1 
ATOM   6092  N N     . PHE E 1 112 ? 25.851  -14.560 180.195 1.00 82.46  ? 112 PHE F N     1 
ATOM   6093  C CA    . PHE E 1 112 ? 27.019  -13.725 179.986 1.00 82.19  ? 112 PHE F CA    1 
ATOM   6094  C C     . PHE E 1 112 ? 26.910  -12.950 178.685 1.00 79.37  ? 112 PHE F C     1 
ATOM   6095  O O     . PHE E 1 112 ? 27.490  -11.873 178.544 1.00 76.54  ? 112 PHE F O     1 
ATOM   6096  C CB    . PHE E 1 112 ? 28.283  -14.576 179.976 1.00 77.17  ? 112 PHE F CB    1 
ATOM   6097  C CG    . PHE E 1 112 ? 29.092  -14.450 181.223 1.00 80.79  ? 112 PHE F CG    1 
ATOM   6098  C CD1   . PHE E 1 112 ? 28.643  -15.003 182.409 1.00 82.21  ? 112 PHE F CD1   1 
ATOM   6099  C CD2   . PHE E 1 112 ? 30.294  -13.768 181.217 1.00 80.08  ? 112 PHE F CD2   1 
ATOM   6100  C CE1   . PHE E 1 112 ? 29.384  -14.882 183.569 1.00 85.19  ? 112 PHE F CE1   1 
ATOM   6101  C CE2   . PHE E 1 112 ? 31.038  -13.647 182.372 1.00 78.61  ? 112 PHE F CE2   1 
ATOM   6102  C CZ    . PHE E 1 112 ? 30.583  -14.204 183.549 1.00 83.77  ? 112 PHE F CZ    1 
ATOM   6103  N N     . GLY E 1 113 ? 26.164  -13.504 177.735 1.00 76.46  ? 113 GLY F N     1 
ATOM   6104  C CA    . GLY E 1 113 ? 26.020  -12.882 176.436 1.00 75.26  ? 113 GLY F CA    1 
ATOM   6105  C C     . GLY E 1 113 ? 25.052  -11.721 176.499 1.00 78.79  ? 113 GLY F C     1 
ATOM   6106  O O     . GLY E 1 113 ? 25.155  -10.768 175.728 1.00 83.39  ? 113 GLY F O     1 
ATOM   6107  N N     . LEU E 1 114 ? 24.110  -11.804 177.431 1.00 77.73  ? 114 LEU F N     1 
ATOM   6108  C CA    . LEU E 1 114 ? 23.060  -10.805 177.541 1.00 75.95  ? 114 LEU F CA    1 
ATOM   6109  C C     . LEU E 1 114 ? 23.513  -9.624  178.378 1.00 82.31  ? 114 LEU F C     1 
ATOM   6110  O O     . LEU E 1 114 ? 23.150  -8.481  178.097 1.00 90.54  ? 114 LEU F O     1 
ATOM   6111  C CB    . LEU E 1 114 ? 21.797  -11.416 178.149 1.00 75.81  ? 114 LEU F CB    1 
ATOM   6112  C CG    . LEU E 1 114 ? 20.973  -12.355 177.269 1.00 82.80  ? 114 LEU F CG    1 
ATOM   6113  C CD1   . LEU E 1 114 ? 19.931  -13.063 178.117 1.00 89.04  ? 114 LEU F CD1   1 
ATOM   6114  C CD2   . LEU E 1 114 ? 20.310  -11.594 176.129 1.00 85.04  ? 114 LEU F CD2   1 
ATOM   6115  N N     . LEU E 1 115 ? 24.313  -9.897  179.403 1.00 81.84  ? 115 LEU F N     1 
ATOM   6116  C CA    . LEU E 1 115 ? 24.713  -8.842  180.324 1.00 82.43  ? 115 LEU F CA    1 
ATOM   6117  C C     . LEU E 1 115 ? 26.102  -8.278  180.052 1.00 86.05  ? 115 LEU F C     1 
ATOM   6118  O O     . LEU E 1 115 ? 26.971  -8.948  179.484 1.00 81.56  ? 115 LEU F O     1 
ATOM   6119  C CB    . LEU E 1 115 ? 24.628  -9.324  181.770 1.00 78.59  ? 115 LEU F CB    1 
ATOM   6120  C CG    . LEU E 1 115 ? 23.309  -9.978  182.168 1.00 75.50  ? 115 LEU F CG    1 
ATOM   6121  C CD1   . LEU E 1 115 ? 23.259  -10.166 183.671 1.00 75.24  ? 115 LEU F CD1   1 
ATOM   6122  C CD2   . LEU E 1 115 ? 22.128  -9.152  181.684 1.00 75.23  ? 115 LEU F CD2   1 
ATOM   6123  N N     . LYS E 1 116 ? 26.284  -7.032  180.476 1.00 85.98  ? 116 LYS F N     1 
ATOM   6124  C CA    . LYS E 1 116 ? 27.567  -6.353  180.433 1.00 81.45  ? 116 LYS F CA    1 
ATOM   6125  C C     . LYS E 1 116 ? 28.488  -6.905  181.514 1.00 86.82  ? 116 LYS F C     1 
ATOM   6126  O O     . LYS E 1 116 ? 28.031  -7.532  182.467 1.00 86.94  ? 116 LYS F O     1 
ATOM   6127  C CB    . LYS E 1 116 ? 27.359  -4.853  180.639 1.00 80.77  ? 116 LYS F CB    1 
ATOM   6128  C CG    . LYS E 1 116 ? 26.468  -4.222  179.590 1.00 86.83  ? 116 LYS F CG    1 
ATOM   6129  C CD    . LYS E 1 116 ? 25.957  -2.866  180.026 1.00 93.26  ? 116 LYS F CD    1 
ATOM   6130  C CE    . LYS E 1 116 ? 26.853  -1.747  179.531 1.00 99.48  ? 116 LYS F CE    1 
ATOM   6131  N NZ    . LYS E 1 116 ? 26.254  -0.429  179.872 1.00 105.69 ? 116 LYS F NZ    1 
ATOM   6132  N N     . LYS E 1 117 ? 29.787  -6.665  181.363 1.00 91.86  ? 117 LYS F N     1 
ATOM   6133  C CA    . LYS E 1 117 ? 30.786  -7.194  182.291 1.00 92.24  ? 117 LYS F CA    1 
ATOM   6134  C C     . LYS E 1 117 ? 30.588  -6.658  183.707 1.00 96.38  ? 117 LYS F C     1 
ATOM   6135  O O     . LYS E 1 117 ? 30.684  -7.408  184.677 1.00 97.52  ? 117 LYS F O     1 
ATOM   6136  C CB    . LYS E 1 117 ? 32.212  -6.910  181.780 1.00 90.11  ? 117 LYS F CB    1 
ATOM   6137  C CG    . LYS E 1 117 ? 33.363  -7.361  182.698 1.00 86.80  ? 117 LYS F CG    1 
ATOM   6138  C CD    . LYS E 1 117 ? 34.676  -7.486  181.906 1.00 85.61  ? 117 LYS F CD    1 
ATOM   6139  C CE    . LYS E 1 117 ? 35.881  -6.933  182.667 1.00 91.01  ? 117 LYS F CE    1 
ATOM   6140  N NZ    . LYS E 1 117 ? 36.975  -6.490  181.728 1.00 88.04  ? 117 LYS F NZ    1 
ATOM   6141  N N     . ASP E 1 118 ? 30.297  -5.366  183.824 1.00 99.53  ? 118 ASP F N     1 
ATOM   6142  C CA    . ASP E 1 118 ? 30.131  -4.743  185.134 1.00 104.68 ? 118 ASP F CA    1 
ATOM   6143  C C     . ASP E 1 118 ? 28.906  -5.277  185.869 1.00 101.65 ? 118 ASP F C     1 
ATOM   6144  O O     . ASP E 1 118 ? 28.926  -5.439  187.090 1.00 103.35 ? 118 ASP F O     1 
ATOM   6145  C CB    . ASP E 1 118 ? 30.065  -3.219  185.011 1.00 117.52 ? 118 ASP F CB    1 
ATOM   6146  C CG    . ASP E 1 118 ? 31.422  -2.599  184.726 1.00 136.55 ? 118 ASP F CG    1 
ATOM   6147  O OD1   . ASP E 1 118 ? 32.269  -3.277  184.105 1.00 141.66 ? 118 ASP F OD1   1 
ATOM   6148  O OD2   . ASP E 1 118 ? 31.643  -1.436  185.127 1.00 143.23 ? 118 ASP F OD2   1 
ATOM   6149  N N     . GLU E 1 119 ? 27.845  -5.553  185.115 1.00 98.72  ? 119 GLU F N     1 
ATOM   6150  C CA    . GLU E 1 119 ? 26.621  -6.121  185.673 1.00 91.98  ? 119 GLU F CA    1 
ATOM   6151  C C     . GLU E 1 119 ? 26.878  -7.522  186.220 1.00 91.62  ? 119 GLU F C     1 
ATOM   6152  O O     . GLU E 1 119 ? 26.374  -7.890  187.282 1.00 91.52  ? 119 GLU F O     1 
ATOM   6153  C CB    . GLU E 1 119 ? 25.513  -6.174  184.614 1.00 88.48  ? 119 GLU F CB    1 
ATOM   6154  C CG    . GLU E 1 119 ? 24.924  -4.825  184.226 1.00 94.59  ? 119 GLU F CG    1 
ATOM   6155  C CD    . GLU E 1 119 ? 23.889  -4.934  183.112 1.00 104.36 ? 119 GLU F CD    1 
ATOM   6156  O OE1   . GLU E 1 119 ? 24.076  -5.776  182.207 1.00 105.87 ? 119 GLU F OE1   1 
ATOM   6157  O OE2   . GLU E 1 119 ? 22.889  -4.182  183.141 1.00 106.26 ? 119 GLU F OE2   1 
ATOM   6158  N N     . LEU E 1 120 ? 27.672  -8.297  185.489 1.00 90.53  ? 120 LEU F N     1 
ATOM   6159  C CA    . LEU E 1 120 ? 27.988  -9.665  185.883 1.00 89.20  ? 120 LEU F CA    1 
ATOM   6160  C C     . LEU E 1 120 ? 28.945  -9.718  187.068 1.00 94.10  ? 120 LEU F C     1 
ATOM   6161  O O     . LEU E 1 120 ? 28.908  -10.659 187.863 1.00 95.31  ? 120 LEU F O     1 
ATOM   6162  C CB    . LEU E 1 120 ? 28.571  -10.437 184.702 1.00 82.13  ? 120 LEU F CB    1 
ATOM   6163  C CG    . LEU E 1 120 ? 27.563  -10.779 183.608 1.00 80.01  ? 120 LEU F CG    1 
ATOM   6164  C CD1   . LEU E 1 120 ? 28.260  -10.865 182.270 1.00 84.52  ? 120 LEU F CD1   1 
ATOM   6165  C CD2   . LEU E 1 120 ? 26.866  -12.090 183.928 1.00 82.53  ? 120 LEU F CD2   1 
ATOM   6166  N N     . SER E 1 121 ? 29.805  -8.712  187.185 1.00 93.96  ? 121 SER F N     1 
ATOM   6167  C CA    . SER E 1 121 ? 30.729  -8.649  188.310 1.00 94.04  ? 121 SER F CA    1 
ATOM   6168  C C     . SER E 1 121 ? 29.971  -8.336  189.593 1.00 100.78 ? 121 SER F C     1 
ATOM   6169  O O     . SER E 1 121 ? 30.320  -8.824  190.667 1.00 105.64 ? 121 SER F O     1 
ATOM   6170  C CB    . SER E 1 121 ? 31.809  -7.596  188.070 1.00 92.03  ? 121 SER F CB    1 
ATOM   6171  O OG    . SER E 1 121 ? 32.590  -7.915  186.933 1.00 93.83  ? 121 SER F OG    1 
ATOM   6172  N N     . GLN E 1 122 ? 28.933  -7.515  189.473 1.00 101.87 ? 122 GLN F N     1 
ATOM   6173  C CA    . GLN E 1 122 ? 28.102  -7.172  190.618 1.00 106.13 ? 122 GLN F CA    1 
ATOM   6174  C C     . GLN E 1 122 ? 27.351  -8.399  191.108 1.00 102.48 ? 122 GLN F C     1 
ATOM   6175  O O     . GLN E 1 122 ? 27.263  -8.652  192.310 1.00 104.00 ? 122 GLN F O     1 
ATOM   6176  C CB    . GLN E 1 122 ? 27.105  -6.073  190.248 1.00 114.36 ? 122 GLN F CB    1 
ATOM   6177  C CG    . GLN E 1 122 ? 27.473  -4.695  190.771 1.00 124.46 ? 122 GLN F CG    1 
ATOM   6178  C CD    . GLN E 1 122 ? 27.246  -4.555  192.265 1.00 131.62 ? 122 GLN F CD    1 
ATOM   6179  O OE1   . GLN E 1 122 ? 28.035  -3.922  192.968 1.00 134.28 ? 122 GLN F OE1   1 
ATOM   6180  N NE2   . GLN E 1 122 ? 26.159  -5.139  192.756 1.00 131.76 ? 122 GLN F NE2   1 
ATOM   6181  N N     . LEU E 1 123 ? 26.820  -9.161  190.159 1.00 96.76  ? 123 LEU F N     1 
ATOM   6182  C CA    . LEU E 1 123 ? 25.966  -10.297 190.469 1.00 94.49  ? 123 LEU F CA    1 
ATOM   6183  C C     . LEU E 1 123 ? 26.743  -11.422 191.146 1.00 100.94 ? 123 LEU F C     1 
ATOM   6184  O O     . LEU E 1 123 ? 26.332  -11.930 192.189 1.00 102.27 ? 123 LEU F O     1 
ATOM   6185  C CB    . LEU E 1 123 ? 25.282  -10.801 189.196 1.00 89.73  ? 123 LEU F CB    1 
ATOM   6186  C CG    . LEU E 1 123 ? 24.230  -11.899 189.355 1.00 90.77  ? 123 LEU F CG    1 
ATOM   6187  C CD1   . LEU E 1 123 ? 23.171  -11.489 190.364 1.00 93.77  ? 123 LEU F CD1   1 
ATOM   6188  C CD2   . LEU E 1 123 ? 23.595  -12.210 188.012 1.00 89.83  ? 123 LEU F CD2   1 
ATOM   6189  N N     . PHE E 1 124 ? 27.871  -11.799 190.555 1.00 103.11 ? 124 PHE F N     1 
ATOM   6190  C CA    . PHE E 1 124 ? 28.689  -12.879 191.094 1.00 104.58 ? 124 PHE F CA    1 
ATOM   6191  C C     . PHE E 1 124 ? 29.807  -12.329 191.973 1.00 109.91 ? 124 PHE F C     1 
ATOM   6192  O O     . PHE E 1 124 ? 30.910  -12.872 192.013 1.00 110.85 ? 124 PHE F O     1 
ATOM   6193  C CB    . PHE E 1 124 ? 29.247  -13.730 189.953 1.00 100.38 ? 124 PHE F CB    1 
ATOM   6194  C CG    . PHE E 1 124 ? 28.184  -14.301 189.059 1.00 101.92 ? 124 PHE F CG    1 
ATOM   6195  C CD1   . PHE E 1 124 ? 27.491  -15.441 189.431 1.00 100.21 ? 124 PHE F CD1   1 
ATOM   6196  C CD2   . PHE E 1 124 ? 27.863  -13.689 187.858 1.00 101.71 ? 124 PHE F CD2   1 
ATOM   6197  C CE1   . PHE E 1 124 ? 26.508  -15.968 188.619 1.00 98.08  ? 124 PHE F CE1   1 
ATOM   6198  C CE2   . PHE E 1 124 ? 26.877  -14.212 187.040 1.00 100.06 ? 124 PHE F CE2   1 
ATOM   6199  C CZ    . PHE E 1 124 ? 26.198  -15.352 187.423 1.00 98.16  ? 124 PHE F CZ    1 
ATOM   6200  N N     . ARG E 1 125 ? 29.494  -11.252 192.688 1.00 112.73 ? 125 ARG F N     1 
ATOM   6201  C CA    . ARG E 1 125 ? 30.457  -10.540 193.520 1.00 112.61 ? 125 ARG F CA    1 
ATOM   6202  C C     . ARG E 1 125 ? 31.120  -11.446 194.557 1.00 114.15 ? 125 ARG F C     1 
ATOM   6203  O O     . ARG E 1 125 ? 32.344  -11.450 194.702 1.00 115.65 ? 125 ARG F O     1 
ATOM   6204  C CB    . ARG E 1 125 ? 29.762  -9.364  194.211 1.00 114.47 ? 125 ARG F CB    1 
ATOM   6205  C CG    . ARG E 1 125 ? 30.681  -8.433  194.987 1.00 120.90 ? 125 ARG F CG    1 
ATOM   6206  C CD    . ARG E 1 125 ? 29.892  -7.302  195.641 1.00 128.05 ? 125 ARG F CD    1 
ATOM   6207  N NE    . ARG E 1 125 ? 28.904  -7.808  196.592 1.00 136.73 ? 125 ARG F NE    1 
ATOM   6208  C CZ    . ARG E 1 125 ? 27.604  -7.920  196.338 1.00 141.34 ? 125 ARG F CZ    1 
ATOM   6209  N NH1   . ARG E 1 125 ? 27.122  -7.554  195.157 1.00 138.28 ? 125 ARG F NH1   1 
ATOM   6210  N NH2   . ARG E 1 125 ? 26.784  -8.397  197.265 1.00 145.58 ? 125 ARG F NH2   1 
ATOM   6211  N N     . ASP E 1 126 ? 30.306  -12.227 195.260 1.00 116.72 ? 126 ASP F N     1 
ATOM   6212  C CA    . ASP E 1 126 ? 30.791  -13.088 196.335 1.00 119.33 ? 126 ASP F CA    1 
ATOM   6213  C C     . ASP E 1 126 ? 31.445  -14.377 195.827 1.00 113.68 ? 126 ASP F C     1 
ATOM   6214  O O     . ASP E 1 126 ? 31.499  -15.375 196.545 1.00 113.59 ? 126 ASP F O     1 
ATOM   6215  C CB    . ASP E 1 126 ? 29.644  -13.428 197.294 1.00 126.81 ? 126 ASP F CB    1 
ATOM   6216  C CG    . ASP E 1 126 ? 29.099  -12.206 198.017 1.00 128.87 ? 126 ASP F CG    1 
ATOM   6217  O OD1   . ASP E 1 126 ? 29.342  -11.072 197.551 1.00 128.54 ? 126 ASP F OD1   1 
ATOM   6218  O OD2   . ASP E 1 126 ? 28.421  -12.382 199.052 1.00 129.61 ? 126 ASP F OD2   1 
ATOM   6219  N N     . HIS E 1 127 ? 31.939  -14.353 194.592 1.00 108.26 ? 127 HIS F N     1 
ATOM   6220  C CA    . HIS E 1 127 ? 32.596  -15.519 194.004 1.00 106.78 ? 127 HIS F CA    1 
ATOM   6221  C C     . HIS E 1 127 ? 33.798  -15.107 193.163 1.00 103.23 ? 127 HIS F C     1 
ATOM   6222  O O     . HIS E 1 127 ? 34.425  -15.938 192.503 1.00 101.27 ? 127 HIS F O     1 
ATOM   6223  C CB    . HIS E 1 127 ? 31.610  -16.316 193.149 1.00 108.34 ? 127 HIS F CB    1 
ATOM   6224  C CG    . HIS E 1 127 ? 30.412  -16.806 193.912 1.00 113.87 ? 127 HIS F CG    1 
ATOM   6225  N ND1   . HIS E 1 127 ? 30.388  -18.050 194.523 1.00 114.88 ? 127 HIS F ND1   1 
ATOM   6226  C CD2   . HIS E 1 127 ? 29.231  -16.231 194.165 1.00 112.96 ? 127 HIS F CD2   1 
ATOM   6227  C CE1   . HIS E 1 127 ? 29.221  -18.203 195.115 1.00 116.25 ? 127 HIS F CE1   1 
ATOM   6228  N NE2   . HIS E 1 127 ? 28.491  -17.126 194.923 1.00 113.64 ? 127 HIS F NE2   1 
ATOM   6229  N N     . LEU E 1 128 ? 34.113  -13.817 193.197 1.00 99.07  ? 128 LEU F N     1 
ATOM   6230  C CA    . LEU E 1 128 ? 35.197  -13.263 192.400 1.00 92.51  ? 128 LEU F CA    1 
ATOM   6231  C C     . LEU E 1 128 ? 36.214  -12.557 193.293 1.00 97.14  ? 128 LEU F C     1 
ATOM   6232  O O     . LEU E 1 128 ? 35.887  -12.123 194.397 1.00 98.58  ? 128 LEU F O     1 
ATOM   6233  C CB    . LEU E 1 128 ? 34.640  -12.289 191.358 1.00 87.46  ? 128 LEU F CB    1 
ATOM   6234  C CG    . LEU E 1 128 ? 33.611  -12.856 190.374 1.00 85.55  ? 128 LEU F CG    1 
ATOM   6235  C CD1   . LEU E 1 128 ? 33.141  -11.785 189.396 1.00 78.95  ? 128 LEU F CD1   1 
ATOM   6236  C CD2   . LEU E 1 128 ? 34.164  -14.066 189.631 1.00 84.62  ? 128 LEU F CD2   1 
ATOM   6237  N N     . GLY E 1 129 ? 37.449  -12.453 192.813 1.00 97.54  ? 129 GLY F N     1 
ATOM   6238  C CA    . GLY E 1 129 ? 38.495  -11.762 193.543 1.00 99.40  ? 129 GLY F CA    1 
ATOM   6239  C C     . GLY E 1 129 ? 38.490  -10.274 193.251 1.00 101.53 ? 129 GLY F C     1 
ATOM   6240  O O     . GLY E 1 129 ? 37.529  -9.749  192.686 1.00 107.91 ? 129 GLY F O     1 
ATOM   6241  N N     . ARG E 1 130 ? 39.563  -9.591  193.635 1.00 100.75 ? 130 ARG F N     1 
ATOM   6242  C CA    . ARG E 1 130 ? 39.677  -8.157  193.403 1.00 101.65 ? 130 ARG F CA    1 
ATOM   6243  C C     . ARG E 1 130 ? 40.336  -7.891  192.053 1.00 100.59 ? 130 ARG F C     1 
ATOM   6244  O O     . ARG E 1 130 ? 40.329  -6.765  191.555 1.00 105.39 ? 130 ARG F O     1 
ATOM   6245  C CB    . ARG E 1 130 ? 40.486  -7.498  194.524 1.00 106.74 ? 130 ARG F CB    1 
ATOM   6246  C CG    . ARG E 1 130 ? 39.865  -7.628  195.913 1.00 114.43 ? 130 ARG F CG    1 
ATOM   6247  C CD    . ARG E 1 130 ? 40.932  -7.747  197.001 1.00 124.57 ? 130 ARG F CD    1 
ATOM   6248  N NE    . ARG E 1 130 ? 40.350  -7.732  198.342 1.00 132.78 ? 130 ARG F NE    1 
ATOM   6249  C CZ    . ARG E 1 130 ? 41.025  -7.993  199.458 1.00 139.29 ? 130 ARG F CZ    1 
ATOM   6250  N NH1   . ARG E 1 130 ? 42.314  -8.302  199.402 1.00 139.09 ? 130 ARG F NH1   1 
ATOM   6251  N NH2   . ARG E 1 130 ? 40.408  -7.953  200.632 1.00 143.60 ? 130 ARG F NH2   1 
ATOM   6252  N N     . ALA E 1 131 ? 40.902  -8.940  191.465 1.00 96.04  ? 131 ALA F N     1 
ATOM   6253  C CA    . ALA E 1 131 ? 41.637  -8.817  190.212 1.00 92.35  ? 131 ALA F CA    1 
ATOM   6254  C C     . ALA E 1 131 ? 40.704  -8.627  189.029 1.00 82.62  ? 131 ALA F C     1 
ATOM   6255  O O     . ALA E 1 131 ? 39.673  -9.289  188.923 1.00 104.29 ? 131 ALA F O     1 
ATOM   6256  C CB    . ALA E 1 131 ? 42.508  -10.038 189.990 1.00 95.11  ? 131 ALA F CB    1 
ATOM   6257  N N     . ASN E 1 132 ? 41.078  -7.719  188.137 1.00 89.70  ? 132 ASN F N     1 
ATOM   6258  C CA    . ASN E 1 132 ? 40.322  -7.490  186.917 1.00 85.31  ? 132 ASN F CA    1 
ATOM   6259  C C     . ASN E 1 132 ? 40.615  -8.575  185.892 1.00 92.05  ? 132 ASN F C     1 
ATOM   6260  O O     . ASN E 1 132 ? 41.694  -8.605  185.303 1.00 97.72  ? 132 ASN F O     1 
ATOM   6261  C CB    . ASN E 1 132 ? 40.664  -6.115  186.338 1.00 83.68  ? 132 ASN F CB    1 
ATOM   6262  C CG    . ASN E 1 132 ? 39.758  -5.716  185.189 1.00 95.65  ? 132 ASN F CG    1 
ATOM   6263  O OD1   . ASN E 1 132 ? 39.567  -6.467  184.232 1.00 103.82 ? 132 ASN F OD1   1 
ATOM   6264  N ND2   . ASN E 1 132 ? 39.194  -4.519  185.280 1.00 101.59 ? 132 ASN F ND2   1 
ATOM   6265  N N     . LEU E 1 133 ? 39.651  -9.465  185.683 1.00 95.60  ? 133 LEU F N     1 
ATOM   6266  C CA    . LEU E 1 133 ? 39.758  -10.471 184.634 1.00 98.17  ? 133 LEU F CA    1 
ATOM   6267  C C     . LEU E 1 133 ? 38.925  -10.070 183.428 1.00 101.56 ? 133 LEU F C     1 
ATOM   6268  O O     . LEU E 1 133 ? 37.983  -9.284  183.547 1.00 102.74 ? 133 LEU F O     1 
ATOM   6269  C CB    . LEU E 1 133 ? 39.285  -11.835 185.136 1.00 95.20  ? 133 LEU F CB    1 
ATOM   6270  C CG    . LEU E 1 133 ? 39.871  -12.302 186.467 1.00 96.26  ? 133 LEU F CG    1 
ATOM   6271  C CD1   . LEU E 1 133 ? 39.425  -13.724 186.786 1.00 92.15  ? 133 LEU F CD1   1 
ATOM   6272  C CD2   . LEU E 1 133 ? 41.392  -12.188 186.454 1.00 98.53  ? 133 LEU F CD2   1 
ATOM   6273  N N     . ARG E 1 134 ? 39.275  -10.619 182.269 1.00 101.90 ? 134 ARG F N     1 
ATOM   6274  C CA    . ARG E 1 134 ? 38.465  -10.441 181.073 1.00 97.93  ? 134 ARG F CA    1 
ATOM   6275  C C     . ARG E 1 134 ? 37.140  -11.178 181.233 1.00 96.50  ? 134 ARG F C     1 
ATOM   6276  O O     . ARG E 1 134 ? 36.996  -12.038 182.106 1.00 98.56  ? 134 ARG F O     1 
ATOM   6277  C CB    . ARG E 1 134 ? 39.195  -10.943 179.825 1.00 96.52  ? 134 ARG F CB    1 
ATOM   6278  C CG    . ARG E 1 134 ? 40.508  -10.238 179.532 1.00 93.57  ? 134 ARG F CG    1 
ATOM   6279  C CD    . ARG E 1 134 ? 40.899  -10.387 178.067 1.00 94.85  ? 134 ARG F CD    1 
ATOM   6280  N NE    . ARG E 1 134 ? 42.342  -10.266 177.885 1.00 108.17 ? 134 ARG F NE    1 
ATOM   6281  C CZ    . ARG E 1 134 ? 42.928  -9.648  176.864 1.00 120.09 ? 134 ARG F CZ    1 
ATOM   6282  N NH1   . ARG E 1 134 ? 42.196  -9.077  175.915 1.00 123.14 ? 134 ARG F NH1   1 
ATOM   6283  N NH2   . ARG E 1 134 ? 44.252  -9.600  176.797 1.00 122.65 ? 134 ARG F NH2   1 
ATOM   6284  N N     . LYS E 1 135 ? 36.178  -10.838 180.383 1.00 90.40  ? 135 LYS F N     1 
ATOM   6285  C CA    . LYS E 1 135 ? 34.831  -11.386 180.486 1.00 84.60  ? 135 LYS F CA    1 
ATOM   6286  C C     . LYS E 1 135 ? 34.800  -12.902 180.287 1.00 84.79  ? 135 LYS F C     1 
ATOM   6287  O O     . LYS E 1 135 ? 34.120  -13.615 181.022 1.00 82.29  ? 135 LYS F O     1 
ATOM   6288  C CB    . LYS E 1 135 ? 33.904  -10.690 179.486 1.00 79.51  ? 135 LYS F CB    1 
ATOM   6289  C CG    . LYS E 1 135 ? 32.421  -10.909 179.737 1.00 82.20  ? 135 LYS F CG    1 
ATOM   6290  C CD    . LYS E 1 135 ? 31.592  -9.871  178.991 1.00 81.81  ? 135 LYS F CD    1 
ATOM   6291  C CE    . LYS E 1 135 ? 30.105  -10.151 179.098 1.00 79.97  ? 135 LYS F CE    1 
ATOM   6292  N NZ    . LYS E 1 135 ? 29.467  -10.204 177.751 1.00 79.79  ? 135 LYS F NZ    1 
ATOM   6293  N N     . ASP E 1 136 ? 35.542  -13.388 179.296 1.00 87.35  ? 136 ASP F N     1 
ATOM   6294  C CA    . ASP E 1 136 ? 35.601  -14.819 179.009 1.00 90.47  ? 136 ASP F CA    1 
ATOM   6295  C C     . ASP E 1 136 ? 36.280  -15.581 180.141 1.00 91.59  ? 136 ASP F C     1 
ATOM   6296  O O     . ASP E 1 136 ? 35.957  -16.739 180.410 1.00 96.32  ? 136 ASP F O     1 
ATOM   6297  C CB    . ASP E 1 136 ? 36.332  -15.072 177.689 1.00 103.43 ? 136 ASP F CB    1 
ATOM   6298  C CG    . ASP E 1 136 ? 37.163  -13.881 177.243 1.00 118.82 ? 136 ASP F CG    1 
ATOM   6299  O OD1   . ASP E 1 136 ? 36.669  -12.736 177.345 1.00 121.37 ? 136 ASP F OD1   1 
ATOM   6300  O OD2   . ASP E 1 136 ? 38.311  -14.088 176.793 1.00 124.22 ? 136 ASP F OD2   1 
ATOM   6301  N N     . ALA E 1 137 ? 37.221  -14.914 180.802 1.00 89.02  ? 137 ALA F N     1 
ATOM   6302  C CA    . ALA E 1 137 ? 37.912  -15.483 181.950 1.00 84.82  ? 137 ALA F CA    1 
ATOM   6303  C C     . ALA E 1 137 ? 36.942  -15.680 183.107 1.00 90.91  ? 137 ALA F C     1 
ATOM   6304  O O     . ALA E 1 137 ? 36.943  -16.726 183.754 1.00 96.58  ? 137 ALA F O     1 
ATOM   6305  C CB    . ALA E 1 137 ? 39.057  -14.585 182.369 1.00 84.03  ? 137 ALA F CB    1 
ATOM   6306  N N     . LEU E 1 138 ? 36.119  -14.667 183.361 1.00 91.85  ? 138 LEU F N     1 
ATOM   6307  C CA    . LEU E 1 138 ? 35.070  -14.765 184.369 1.00 90.50  ? 138 LEU F CA    1 
ATOM   6308  C C     . LEU E 1 138 ? 34.150  -15.939 184.071 1.00 94.44  ? 138 LEU F C     1 
ATOM   6309  O O     . LEU E 1 138 ? 33.762  -16.680 184.974 1.00 96.91  ? 138 LEU F O     1 
ATOM   6310  C CB    . LEU E 1 138 ? 34.242  -13.480 184.415 1.00 85.44  ? 138 LEU F CB    1 
ATOM   6311  C CG    . LEU E 1 138 ? 34.894  -12.252 185.044 1.00 84.65  ? 138 LEU F CG    1 
ATOM   6312  C CD1   . LEU E 1 138 ? 33.976  -11.042 184.957 1.00 79.40  ? 138 LEU F CD1   1 
ATOM   6313  C CD2   . LEU E 1 138 ? 35.264  -12.548 186.488 1.00 89.35  ? 138 LEU F CD2   1 
ATOM   6314  N N     . LEU E 1 139 ? 33.806  -16.098 182.796 1.00 95.72  ? 139 LEU F N     1 
ATOM   6315  C CA    . LEU E 1 139 ? 32.898  -17.152 182.365 1.00 95.33  ? 139 LEU F CA    1 
ATOM   6316  C C     . LEU E 1 139 ? 33.492  -18.513 182.677 1.00 100.25 ? 139 LEU F C     1 
ATOM   6317  O O     . LEU E 1 139 ? 32.786  -19.434 183.084 1.00 95.37  ? 139 LEU F O     1 
ATOM   6318  C CB    . LEU E 1 139 ? 32.629  -17.043 180.865 1.00 88.59  ? 139 LEU F CB    1 
ATOM   6319  C CG    . LEU E 1 139 ? 31.633  -18.040 180.274 1.00 82.58  ? 139 LEU F CG    1 
ATOM   6320  C CD1   . LEU E 1 139 ? 30.290  -17.877 180.938 1.00 75.33  ? 139 LEU F CD1   1 
ATOM   6321  C CD2   . LEU E 1 139 ? 31.504  -17.842 178.776 1.00 84.19  ? 139 LEU F CD2   1 
ATOM   6322  N N     . GLU E 1 140 ? 34.799  -18.625 182.482 1.00 106.45 ? 140 GLU F N     1 
ATOM   6323  C CA    . GLU E 1 140 ? 35.503  -19.868 182.742 1.00 110.03 ? 140 GLU F CA    1 
ATOM   6324  C C     . GLU E 1 140 ? 35.579  -20.181 184.237 1.00 110.31 ? 140 GLU F C     1 
ATOM   6325  O O     . GLU E 1 140 ? 35.388  -21.327 184.645 1.00 111.96 ? 140 GLU F O     1 
ATOM   6326  C CB    . GLU E 1 140 ? 36.903  -19.813 182.137 1.00 113.63 ? 140 GLU F CB    1 
ATOM   6327  C CG    . GLU E 1 140 ? 37.683  -21.093 182.308 1.00 127.29 ? 140 GLU F CG    1 
ATOM   6328  C CD    . GLU E 1 140 ? 38.978  -21.092 181.528 1.00 138.87 ? 140 GLU F CD    1 
ATOM   6329  O OE1   . GLU E 1 140 ? 39.273  -20.079 180.858 1.00 141.34 ? 140 GLU F OE1   1 
ATOM   6330  O OE2   . GLU E 1 140 ? 39.699  -22.110 181.584 1.00 144.41 ? 140 GLU F OE2   1 
ATOM   6331  N N     . ARG E 1 141 ? 35.855  -19.162 185.048 1.00 109.82 ? 141 ARG F N     1 
ATOM   6332  C CA    . ARG E 1 141 ? 35.941  -19.336 186.497 1.00 114.21 ? 141 ARG F CA    1 
ATOM   6333  C C     . ARG E 1 141 ? 34.591  -19.725 187.091 1.00 119.76 ? 141 ARG F C     1 
ATOM   6334  O O     . ARG E 1 141 ? 34.511  -20.584 187.970 1.00 126.36 ? 141 ARG F O     1 
ATOM   6335  C CB    . ARG E 1 141 ? 36.422  -18.048 187.175 1.00 115.84 ? 141 ARG F CB    1 
ATOM   6336  C CG    . ARG E 1 141 ? 37.775  -17.524 186.709 1.00 122.32 ? 141 ARG F CG    1 
ATOM   6337  C CD    . ARG E 1 141 ? 38.938  -18.346 187.245 1.00 126.34 ? 141 ARG F CD    1 
ATOM   6338  N NE    . ARG E 1 141 ? 40.223  -17.796 186.818 1.00 127.13 ? 141 ARG F NE    1 
ATOM   6339  C CZ    . ARG E 1 141 ? 40.906  -16.878 187.497 1.00 128.48 ? 141 ARG F CZ    1 
ATOM   6340  N NH1   . ARG E 1 141 ? 40.428  -16.408 188.642 1.00 128.28 ? 141 ARG F NH1   1 
ATOM   6341  N NH2   . ARG E 1 141 ? 42.067  -16.431 187.034 1.00 127.17 ? 141 ARG F NH2   1 
ATOM   6342  N N     . LEU E 1 142 ? 33.534  -19.081 186.607 1.00 114.88 ? 142 LEU F N     1 
ATOM   6343  C CA    . LEU E 1 142 ? 32.205  -19.233 187.189 1.00 105.77 ? 142 LEU F CA    1 
ATOM   6344  C C     . LEU E 1 142 ? 31.408  -20.396 186.605 1.00 111.30 ? 142 LEU F C     1 
ATOM   6345  O O     . LEU E 1 142 ? 30.457  -20.868 187.230 1.00 113.96 ? 142 LEU F O     1 
ATOM   6346  C CB    . LEU E 1 142 ? 31.409  -17.936 187.034 1.00 91.32  ? 142 LEU F CB    1 
ATOM   6347  C CG    . LEU E 1 142 ? 31.950  -16.715 187.779 1.00 90.07  ? 142 LEU F CG    1 
ATOM   6348  C CD1   . LEU E 1 142 ? 31.223  -15.454 187.342 1.00 87.48  ? 142 LEU F CD1   1 
ATOM   6349  C CD2   . LEU E 1 142 ? 31.835  -16.907 189.284 1.00 81.34  ? 142 LEU F CD2   1 
ATOM   6350  N N     . GLN E 1 143 ? 31.786  -20.846 185.410 1.00 113.29 ? 143 GLN F N     1 
ATOM   6351  C CA    . GLN E 1 143 ? 31.075  -21.939 184.737 1.00 113.65 ? 143 GLN F CA    1 
ATOM   6352  C C     . GLN E 1 143 ? 30.855  -23.199 185.589 1.00 114.49 ? 143 GLN F C     1 
ATOM   6353  O O     . GLN E 1 143 ? 29.747  -23.741 185.600 1.00 113.91 ? 143 GLN F O     1 
ATOM   6354  C CB    . GLN E 1 143 ? 31.749  -22.321 183.414 1.00 116.72 ? 143 GLN F CB    1 
ATOM   6355  C CG    . GLN E 1 143 ? 30.931  -23.280 182.568 1.00 120.25 ? 143 GLN F CG    1 
ATOM   6356  C CD    . GLN E 1 143 ? 30.125  -22.566 181.503 1.00 123.09 ? 143 GLN F CD    1 
ATOM   6357  O OE1   . GLN E 1 143 ? 28.899  -22.678 181.451 1.00 122.07 ? 143 GLN F OE1   1 
ATOM   6358  N NE2   . GLN E 1 143 ? 30.815  -21.826 180.640 1.00 123.97 ? 143 GLN F NE2   1 
ATOM   6359  N N     . PRO E 1 144 ? 31.902  -23.679 186.294 1.00 110.67 ? 144 PRO F N     1 
ATOM   6360  C CA    . PRO E 1 144 ? 31.687  -24.865 187.129 1.00 108.33 ? 144 PRO F CA    1 
ATOM   6361  C C     . PRO E 1 144 ? 30.840  -24.580 188.366 1.00 113.16 ? 144 PRO F C     1 
ATOM   6362  O O     . PRO E 1 144 ? 30.108  -25.467 188.801 1.00 122.46 ? 144 PRO F O     1 
ATOM   6363  C CB    . PRO E 1 144 ? 33.106  -25.258 187.545 1.00 103.45 ? 144 PRO F CB    1 
ATOM   6364  C CG    . PRO E 1 144 ? 33.868  -23.991 187.492 1.00 105.75 ? 144 PRO F CG    1 
ATOM   6365  C CD    . PRO E 1 144 ? 33.318  -23.266 186.309 1.00 105.83 ? 144 PRO F CD    1 
ATOM   6366  N N     . LEU E 1 145 ? 30.933  -23.375 188.922 1.00 109.15 ? 145 LEU F N     1 
ATOM   6367  C CA    . LEU E 1 145 ? 30.118  -23.025 190.084 1.00 109.74 ? 145 LEU F CA    1 
ATOM   6368  C C     . LEU E 1 145 ? 28.632  -22.931 189.763 1.00 108.52 ? 145 LEU F C     1 
ATOM   6369  O O     . LEU E 1 145 ? 27.798  -23.004 190.662 1.00 109.80 ? 145 LEU F O     1 
ATOM   6370  C CB    . LEU E 1 145 ? 30.572  -21.711 190.718 1.00 110.11 ? 145 LEU F CB    1 
ATOM   6371  C CG    . LEU E 1 145 ? 31.840  -21.769 191.563 1.00 111.42 ? 145 LEU F CG    1 
ATOM   6372  C CD1   . LEU E 1 145 ? 33.054  -21.531 190.686 1.00 112.13 ? 145 LEU F CD1   1 
ATOM   6373  C CD2   . LEU E 1 145 ? 31.768  -20.763 192.704 1.00 110.54 ? 145 LEU F CD2   1 
ATOM   6374  N N     . PHE E 1 146 ? 28.297  -22.745 188.490 1.00 107.84 ? 146 PHE F N     1 
ATOM   6375  C CA    . PHE E 1 146 ? 26.894  -22.653 188.095 1.00 109.63 ? 146 PHE F CA    1 
ATOM   6376  C C     . PHE E 1 146 ? 26.625  -23.388 186.782 1.00 112.12 ? 146 PHE F C     1 
ATOM   6377  O O     . PHE E 1 146 ? 26.306  -22.757 185.772 1.00 112.83 ? 146 PHE F O     1 
ATOM   6378  C CB    . PHE E 1 146 ? 26.462  -21.186 187.960 1.00 107.20 ? 146 PHE F CB    1 
ATOM   6379  C CG    . PHE E 1 146 ? 26.694  -20.354 189.198 1.00 104.07 ? 146 PHE F CG    1 
ATOM   6380  C CD1   . PHE E 1 146 ? 25.697  -20.200 190.149 1.00 102.06 ? 146 PHE F CD1   1 
ATOM   6381  C CD2   . PHE E 1 146 ? 27.904  -19.709 189.398 1.00 107.04 ? 146 PHE F CD2   1 
ATOM   6382  C CE1   . PHE E 1 146 ? 25.910  -19.429 191.283 1.00 104.19 ? 146 PHE F CE1   1 
ATOM   6383  C CE2   . PHE E 1 146 ? 28.123  -18.938 190.529 1.00 106.22 ? 146 PHE F CE2   1 
ATOM   6384  C CZ    . PHE E 1 146 ? 27.125  -18.797 191.471 1.00 105.09 ? 146 PHE F CZ    1 
ATOM   6385  N N     . PRO E 1 147 ? 26.737  -24.727 186.792 1.00 111.62 ? 147 PRO F N     1 
ATOM   6386  C CA    . PRO E 1 147 ? 26.627  -25.494 185.546 1.00 112.01 ? 147 PRO F CA    1 
ATOM   6387  C C     . PRO E 1 147 ? 25.191  -25.604 185.030 1.00 112.72 ? 147 PRO F C     1 
ATOM   6388  O O     . PRO E 1 147 ? 24.985  -25.778 183.829 1.00 110.94 ? 147 PRO F O     1 
ATOM   6389  C CB    . PRO E 1 147 ? 27.154  -26.872 185.947 1.00 111.97 ? 147 PRO F CB    1 
ATOM   6390  C CG    . PRO E 1 147 ? 26.796  -26.989 187.390 1.00 113.21 ? 147 PRO F CG    1 
ATOM   6391  C CD    . PRO E 1 147 ? 26.927  -25.601 187.964 1.00 111.36 ? 147 PRO F CD    1 
ATOM   6392  N N     . GLU E 1 148 ? 24.219  -25.494 185.929 1.00 117.80 ? 148 GLU F N     1 
ATOM   6393  C CA    . GLU E 1 148 ? 22.811  -25.645 185.571 1.00 121.56 ? 148 GLU F CA    1 
ATOM   6394  C C     . GLU E 1 148 ? 22.217  -24.360 184.993 1.00 120.85 ? 148 GLU F C     1 
ATOM   6395  O O     . GLU E 1 148 ? 22.620  -23.255 185.361 1.00 124.45 ? 148 GLU F O     1 
ATOM   6396  C CB    . GLU E 1 148 ? 21.995  -26.098 186.788 1.00 127.65 ? 148 GLU F CB    1 
ATOM   6397  C CG    . GLU E 1 148 ? 21.588  -24.976 187.742 1.00 134.11 ? 148 GLU F CG    1 
ATOM   6398  C CD    . GLU E 1 148 ? 22.776  -24.223 188.319 1.00 138.70 ? 148 GLU F CD    1 
ATOM   6399  O OE1   . GLU E 1 148 ? 23.788  -24.873 188.662 1.00 142.89 ? 148 GLU F OE1   1 
ATOM   6400  O OE2   . GLU E 1 148 ? 22.699  -22.980 188.425 1.00 135.42 ? 148 GLU F OE2   1 
ATOM   6401  N N     . ALA E 1 149 ? 21.261  -24.513 184.082 1.00 114.77 ? 149 ALA F N     1 
ATOM   6402  C CA    . ALA E 1 149 ? 20.540  -23.373 183.525 1.00 106.69 ? 149 ALA F CA    1 
ATOM   6403  C C     . ALA E 1 149 ? 19.391  -22.994 184.448 1.00 108.07 ? 149 ALA F C     1 
ATOM   6404  O O     . ALA E 1 149 ? 18.923  -23.817 185.234 1.00 113.60 ? 149 ALA F O     1 
ATOM   6405  C CB    . ALA E 1 149 ? 20.015  -23.700 182.138 1.00 104.51 ? 149 ALA F CB    1 
ATOM   6406  N N     . ARG E 1 150 ? 18.938  -21.749 184.347 1.00 104.86 ? 150 ARG F N     1 
ATOM   6407  C CA    . ARG E 1 150 ? 17.842  -21.268 185.180 1.00 107.70 ? 150 ARG F CA    1 
ATOM   6408  C C     . ARG E 1 150 ? 17.237  -19.984 184.622 1.00 104.97 ? 150 ARG F C     1 
ATOM   6409  O O     . ARG E 1 150 ? 17.829  -19.328 183.765 1.00 100.75 ? 150 ARG F O     1 
ATOM   6410  C CB    . ARG E 1 150 ? 18.319  -21.043 186.616 1.00 109.65 ? 150 ARG F CB    1 
ATOM   6411  C CG    . ARG E 1 150 ? 19.604  -20.247 186.721 1.00 107.87 ? 150 ARG F CG    1 
ATOM   6412  C CD    . ARG E 1 150 ? 19.902  -19.848 188.158 1.00 108.44 ? 150 ARG F CD    1 
ATOM   6413  N NE    . ARG E 1 150 ? 21.016  -20.603 188.727 1.00 109.51 ? 150 ARG F NE    1 
ATOM   6414  C CZ    . ARG E 1 150 ? 21.509  -20.403 189.946 1.00 106.76 ? 150 ARG F CZ    1 
ATOM   6415  N NH1   . ARG E 1 150 ? 20.986  -19.469 190.730 1.00 102.86 ? 150 ARG F NH1   1 
ATOM   6416  N NH2   . ARG E 1 150 ? 22.526  -21.136 190.380 1.00 104.22 ? 150 ARG F NH2   1 
ATOM   6417  N N     . ARG E 1 151 ? 16.054  -19.633 185.115 1.00 106.19 ? 151 ARG F N     1 
ATOM   6418  C CA    . ARG E 1 151 ? 15.370  -18.421 184.684 1.00 100.46 ? 151 ARG F CA    1 
ATOM   6419  C C     . ARG E 1 151 ? 16.177  -17.192 185.093 1.00 91.45  ? 151 ARG F C     1 
ATOM   6420  O O     . ARG E 1 151 ? 16.991  -17.260 186.013 1.00 85.95  ? 151 ARG F O     1 
ATOM   6421  C CB    . ARG E 1 151 ? 13.966  -18.355 185.293 1.00 103.54 ? 151 ARG F CB    1 
ATOM   6422  C CG    . ARG E 1 151 ? 13.050  -19.523 184.932 1.00 106.73 ? 151 ARG F CG    1 
ATOM   6423  C CD    . ARG E 1 151 ? 11.833  -19.038 184.155 1.00 111.62 ? 151 ARG F CD    1 
ATOM   6424  N NE    . ARG E 1 151 ? 10.610  -19.768 184.490 1.00 120.09 ? 151 ARG F NE    1 
ATOM   6425  C CZ    . ARG E 1 151 ? 10.185  -20.857 183.854 1.00 129.96 ? 151 ARG F CZ    1 
ATOM   6426  N NH1   . ARG E 1 151 ? 10.887  -21.358 182.846 1.00 134.91 ? 151 ARG F NH1   1 
ATOM   6427  N NH2   . ARG E 1 151 ? 9.058   -21.448 184.228 1.00 131.09 ? 151 ARG F NH2   1 
ATOM   6428  N N     . LEU E 1 152 ? 15.952  -16.075 184.406 1.00 91.98  ? 152 LEU F N     1 
ATOM   6429  C CA    . LEU E 1 152 ? 16.634  -14.825 184.731 1.00 89.12  ? 152 LEU F CA    1 
ATOM   6430  C C     . LEU E 1 152 ? 16.317  -14.415 186.161 1.00 95.64  ? 152 LEU F C     1 
ATOM   6431  O O     . LEU E 1 152 ? 17.167  -13.877 186.871 1.00 95.88  ? 152 LEU F O     1 
ATOM   6432  C CB    . LEU E 1 152 ? 16.203  -13.713 183.776 1.00 82.42  ? 152 LEU F CB    1 
ATOM   6433  C CG    . LEU E 1 152 ? 17.297  -12.756 183.293 1.00 81.85  ? 152 LEU F CG    1 
ATOM   6434  C CD1   . LEU E 1 152 ? 16.710  -11.752 182.329 1.00 73.07  ? 152 LEU F CD1   1 
ATOM   6435  C CD2   . LEU E 1 152 ? 17.999  -12.040 184.442 1.00 88.21  ? 152 LEU F CD2   1 
ATOM   6436  N N     . ALA E 1 153 ? 15.085  -14.679 186.576 1.00 103.65 ? 153 ALA F N     1 
ATOM   6437  C CA    . ALA E 1 153 ? 14.647  -14.346 187.923 1.00 107.11 ? 153 ALA F CA    1 
ATOM   6438  C C     . ALA E 1 153 ? 15.430  -15.153 188.952 1.00 112.26 ? 153 ALA F C     1 
ATOM   6439  O O     . ALA E 1 153 ? 15.655  -14.698 190.073 1.00 117.21 ? 153 ALA F O     1 
ATOM   6440  C CB    . ALA E 1 153 ? 13.158  -14.592 188.068 1.00 106.17 ? 153 ALA F CB    1 
ATOM   6441  N N     . GLU E 1 154 ? 15.851  -16.350 188.557 1.00 111.56 ? 154 GLU F N     1 
ATOM   6442  C CA    . GLU E 1 154 ? 16.636  -17.215 189.428 1.00 115.25 ? 154 GLU F CA    1 
ATOM   6443  C C     . GLU E 1 154 ? 18.115  -16.828 189.425 1.00 114.03 ? 154 GLU F C     1 
ATOM   6444  O O     . GLU E 1 154 ? 18.836  -17.102 190.385 1.00 115.58 ? 154 GLU F O     1 
ATOM   6445  C CB    . GLU E 1 154 ? 16.448  -18.681 189.033 1.00 121.26 ? 154 GLU F CB    1 
ATOM   6446  C CG    . GLU E 1 154 ? 15.029  -19.182 189.258 1.00 125.59 ? 154 GLU F CG    1 
ATOM   6447  C CD    . GLU E 1 154 ? 14.817  -20.593 188.756 1.00 131.62 ? 154 GLU F CD    1 
ATOM   6448  O OE1   . GLU E 1 154 ? 15.312  -20.912 187.656 1.00 127.45 ? 154 GLU F OE1   1 
ATOM   6449  O OE2   . GLU E 1 154 ? 14.156  -21.384 189.462 1.00 140.25 ? 154 GLU F OE2   1 
ATOM   6450  N N     . TRP E 1 155 ? 18.564  -16.193 188.346 1.00 112.13 ? 155 TRP F N     1 
ATOM   6451  C CA    . TRP E 1 155 ? 19.922  -15.662 188.290 1.00 104.15 ? 155 TRP F CA    1 
ATOM   6452  C C     . TRP E 1 155 ? 20.001  -14.397 189.128 1.00 103.14 ? 155 TRP F C     1 
ATOM   6453  O O     . TRP E 1 155 ? 20.801  -14.295 190.059 1.00 96.40  ? 155 TRP F O     1 
ATOM   6454  C CB    . TRP E 1 155 ? 20.329  -15.340 186.851 1.00 91.73  ? 155 TRP F CB    1 
ATOM   6455  C CG    . TRP E 1 155 ? 20.777  -16.528 186.061 1.00 85.08  ? 155 TRP F CG    1 
ATOM   6456  C CD1   . TRP E 1 155 ? 20.193  -17.032 184.936 1.00 82.50  ? 155 TRP F CD1   1 
ATOM   6457  C CD2   . TRP E 1 155 ? 21.907  -17.363 186.335 1.00 87.22  ? 155 TRP F CD2   1 
ATOM   6458  N NE1   . TRP E 1 155 ? 20.890  -18.129 184.492 1.00 82.40  ? 155 TRP F NE1   1 
ATOM   6459  C CE2   . TRP E 1 155 ? 21.949  -18.351 185.332 1.00 86.49  ? 155 TRP F CE2   1 
ATOM   6460  C CE3   . TRP E 1 155 ? 22.891  -17.367 187.329 1.00 91.85  ? 155 TRP F CE3   1 
ATOM   6461  C CZ2   . TRP E 1 155 ? 22.931  -19.338 185.297 1.00 89.85  ? 155 TRP F CZ2   1 
ATOM   6462  C CZ3   . TRP E 1 155 ? 23.869  -18.348 187.291 1.00 93.02  ? 155 TRP F CZ3   1 
ATOM   6463  C CH2   . TRP E 1 155 ? 23.881  -19.319 186.282 1.00 92.31  ? 155 TRP F CH2   1 
ATOM   6464  N N     . GLN E 1 156 ? 19.154  -13.436 188.776 1.00 109.62 ? 156 GLN F N     1 
ATOM   6465  C CA    . GLN E 1 156 ? 19.072  -12.163 189.476 1.00 116.25 ? 156 GLN F CA    1 
ATOM   6466  C C     . GLN E 1 156 ? 17.613  -11.745 189.614 1.00 126.39 ? 156 GLN F C     1 
ATOM   6467  O O     . GLN E 1 156 ? 16.982  -11.336 188.637 1.00 129.93 ? 156 GLN F O     1 
ATOM   6468  C CB    . GLN E 1 156 ? 19.850  -11.087 188.715 1.00 111.70 ? 156 GLN F CB    1 
ATOM   6469  C CG    . GLN E 1 156 ? 19.693  -9.680  189.277 1.00 115.47 ? 156 GLN F CG    1 
ATOM   6470  C CD    . GLN E 1 156 ? 20.430  -8.636  188.456 1.00 121.24 ? 156 GLN F CD    1 
ATOM   6471  O OE1   . GLN E 1 156 ? 21.444  -8.930  187.822 1.00 123.19 ? 156 GLN F OE1   1 
ATOM   6472  N NE2   . GLN E 1 156 ? 19.918  -7.409  188.459 1.00 123.04 ? 156 GLN F NE2   1 
ATOM   6473  N N     . ALA E 1 157 ? 17.079  -11.852 190.827 1.00 129.61 ? 157 ALA F N     1 
ATOM   6474  C CA    . ALA E 1 157 ? 15.703  -11.452 191.101 1.00 131.39 ? 157 ALA F CA    1 
ATOM   6475  C C     . ALA E 1 157 ? 15.521  -9.944  190.944 1.00 137.48 ? 157 ALA F C     1 
ATOM   6476  O O     . ALA E 1 157 ? 14.410  -9.461  190.718 1.00 138.66 ? 157 ALA F O     1 
ATOM   6477  C CB    . ALA E 1 157 ? 15.291  -11.894 192.500 1.00 129.92 ? 157 ALA F CB    1 
ATOM   6478  N N     . ASP E 1 158 ? 16.624  -9.208  191.058 1.00 140.68 ? 158 ASP F N     1 
ATOM   6479  C CA    . ASP E 1 158 ? 16.596  -7.750  191.008 1.00 142.82 ? 158 ASP F CA    1 
ATOM   6480  C C     . ASP E 1 158 ? 16.525  -7.224  189.574 1.00 141.19 ? 158 ASP F C     1 
ATOM   6481  O O     . ASP E 1 158 ? 16.387  -6.021  189.353 1.00 142.88 ? 158 ASP F O     1 
ATOM   6482  C CB    . ASP E 1 158 ? 17.828  -7.176  191.717 1.00 146.48 ? 158 ASP F CB    1 
ATOM   6483  C CG    . ASP E 1 158 ? 17.635  -5.734  192.152 1.00 153.06 ? 158 ASP F CG    1 
ATOM   6484  O OD1   . ASP E 1 158 ? 17.152  -5.515  193.283 1.00 156.56 ? 158 ASP F OD1   1 
ATOM   6485  O OD2   . ASP E 1 158 ? 17.970  -4.821  191.368 1.00 154.61 ? 158 ASP F OD2   1 
ATOM   6486  N N     . PHE E 1 159 ? 16.615  -8.130  188.605 1.00 135.48 ? 159 PHE F N     1 
ATOM   6487  C CA    . PHE E 1 159 ? 16.618  -7.749  187.196 1.00 125.71 ? 159 PHE F CA    1 
ATOM   6488  C C     . PHE E 1 159 ? 15.253  -7.208  186.784 1.00 119.32 ? 159 PHE F C     1 
ATOM   6489  O O     . PHE E 1 159 ? 14.231  -7.857  186.997 1.00 116.37 ? 159 PHE F O     1 
ATOM   6490  C CB    . PHE E 1 159 ? 17.011  -8.943  186.321 1.00 125.61 ? 159 PHE F CB    1 
ATOM   6491  C CG    . PHE E 1 159 ? 17.679  -8.556  185.033 1.00 125.92 ? 159 PHE F CG    1 
ATOM   6492  C CD1   . PHE E 1 159 ? 19.013  -8.186  185.014 1.00 126.88 ? 159 PHE F CD1   1 
ATOM   6493  C CD2   . PHE E 1 159 ? 16.976  -8.563  183.842 1.00 123.90 ? 159 PHE F CD2   1 
ATOM   6494  C CE1   . PHE E 1 159 ? 19.631  -7.828  183.832 1.00 123.72 ? 159 PHE F CE1   1 
ATOM   6495  C CE2   . PHE E 1 159 ? 17.589  -8.208  182.655 1.00 121.28 ? 159 PHE F CE2   1 
ATOM   6496  C CZ    . PHE E 1 159 ? 18.918  -7.839  182.651 1.00 121.74 ? 159 PHE F CZ    1 
ATOM   6497  N N     . ALA E 1 160 ? 15.242  -6.015  186.197 1.00 122.58 ? 160 ALA F N     1 
ATOM   6498  C CA    . ALA E 1 160 ? 13.992  -5.326  185.887 1.00 124.83 ? 160 ALA F CA    1 
ATOM   6499  C C     . ALA E 1 160 ? 13.667  -5.334  184.395 1.00 119.66 ? 160 ALA F C     1 
ATOM   6500  O O     . ALA E 1 160 ? 12.562  -4.975  183.989 1.00 124.24 ? 160 ALA F O     1 
ATOM   6501  C CB    . ALA E 1 160 ? 14.033  -3.899  186.417 1.00 127.57 ? 160 ALA F CB    1 
ATOM   6502  N N     . GLU E 1 161 ? 14.633  -5.741  183.581 1.00 110.74 ? 161 GLU F N     1 
ATOM   6503  C CA    . GLU E 1 161 ? 14.396  -5.877  182.150 1.00 106.42 ? 161 GLU F CA    1 
ATOM   6504  C C     . GLU E 1 161 ? 13.877  -7.260  181.802 1.00 102.84 ? 161 GLU F C     1 
ATOM   6505  O O     . GLU E 1 161 ? 14.418  -8.266  182.258 1.00 107.05 ? 161 GLU F O     1 
ATOM   6506  C CB    . GLU E 1 161 ? 15.672  -5.610  181.352 1.00 109.18 ? 161 GLU F CB    1 
ATOM   6507  C CG    . GLU E 1 161 ? 15.862  -4.168  180.943 1.00 113.37 ? 161 GLU F CG    1 
ATOM   6508  C CD    . GLU E 1 161 ? 16.744  -4.036  179.721 1.00 114.22 ? 161 GLU F CD    1 
ATOM   6509  O OE1   . GLU E 1 161 ? 17.546  -3.083  179.665 1.00 121.46 ? 161 GLU F OE1   1 
ATOM   6510  O OE2   . GLU E 1 161 ? 16.631  -4.887  178.814 1.00 108.07 ? 161 GLU F OE2   1 
ATOM   6511  N N     . PRO E 1 162 ? 12.819  -7.321  180.985 1.00 93.19  ? 162 PRO F N     1 
ATOM   6512  C CA    . PRO E 1 162 ? 12.458  -8.634  180.453 1.00 89.83  ? 162 PRO F CA    1 
ATOM   6513  C C     . PRO E 1 162 ? 13.425  -9.036  179.342 1.00 90.28  ? 162 PRO F C     1 
ATOM   6514  O O     . PRO E 1 162 ? 13.870  -8.183  178.572 1.00 83.73  ? 162 PRO F O     1 
ATOM   6515  C CB    . PRO E 1 162 ? 11.060  -8.399  179.880 1.00 85.20  ? 162 PRO F CB    1 
ATOM   6516  C CG    . PRO E 1 162 ? 11.063  -6.959  179.498 1.00 81.01  ? 162 PRO F CG    1 
ATOM   6517  C CD    . PRO E 1 162 ? 11.885  -6.267  180.549 1.00 83.16  ? 162 PRO F CD    1 
ATOM   6518  N N     . VAL E 1 163 ? 13.751  -10.324 179.276 1.00 93.86  ? 163 VAL F N     1 
ATOM   6519  C CA    . VAL E 1 163 ? 14.550  -10.875 178.186 1.00 87.51  ? 163 VAL F CA    1 
ATOM   6520  C C     . VAL E 1 163 ? 13.706  -11.848 177.360 1.00 88.27  ? 163 VAL F C     1 
ATOM   6521  O O     . VAL E 1 163 ? 13.211  -12.846 177.874 1.00 95.31  ? 163 VAL F O     1 
ATOM   6522  C CB    . VAL E 1 163 ? 15.827  -11.580 178.700 1.00 82.74  ? 163 VAL F CB    1 
ATOM   6523  C CG1   . VAL E 1 163 ? 16.341  -12.579 177.673 1.00 80.30  ? 163 VAL F CG1   1 
ATOM   6524  C CG2   . VAL E 1 163 ? 16.897  -10.563 179.011 1.00 88.18  ? 163 VAL F CG2   1 
ATOM   6525  N N     . TYR E 1 164 ? 13.542  -11.538 176.078 1.00 82.69  ? 164 TYR F N     1 
ATOM   6526  C CA    . TYR E 1 164 ? 12.684  -12.313 175.188 1.00 81.89  ? 164 TYR F CA    1 
ATOM   6527  C C     . TYR E 1 164 ? 13.461  -13.341 174.376 1.00 86.30  ? 164 TYR F C     1 
ATOM   6528  O O     . TYR E 1 164 ? 14.477  -13.028 173.762 1.00 81.24  ? 164 TYR F O     1 
ATOM   6529  C CB    . TYR E 1 164 ? 11.914  -11.380 174.248 1.00 76.31  ? 164 TYR F CB    1 
ATOM   6530  C CG    . TYR E 1 164 ? 11.081  -10.341 174.968 1.00 77.05  ? 164 TYR F CG    1 
ATOM   6531  C CD1   . TYR E 1 164 ? 10.012  -10.717 175.771 1.00 81.87  ? 164 TYR F CD1   1 
ATOM   6532  C CD2   . TYR E 1 164 ? 11.358  -8.987  174.838 1.00 72.86  ? 164 TYR F CD2   1 
ATOM   6533  C CE1   . TYR E 1 164 ? 9.250   -9.780  176.430 1.00 78.93  ? 164 TYR F CE1   1 
ATOM   6534  C CE2   . TYR E 1 164 ? 10.599  -8.040  175.494 1.00 75.74  ? 164 TYR F CE2   1 
ATOM   6535  C CZ    . TYR E 1 164 ? 9.545   -8.442  176.289 1.00 78.69  ? 164 TYR F CZ    1 
ATOM   6536  O OH    . TYR E 1 164 ? 8.784   -7.500  176.945 1.00 81.96  ? 164 TYR F OH    1 
ATOM   6537  N N     . GLU E 1 165 ? 12.972  -14.576 174.374 1.00 86.60  ? 165 GLU F N     1 
ATOM   6538  C CA    . GLU E 1 165 ? 13.606  -15.654 173.610 1.00 85.81  ? 165 GLU F CA    1 
ATOM   6539  C C     . GLU E 1 165 ? 12.794  -16.011 172.371 1.00 83.74  ? 165 GLU F C     1 
ATOM   6540  O O     . GLU E 1 165 ? 11.591  -16.314 172.477 1.00 88.92  ? 165 GLU F O     1 
ATOM   6541  C CB    . GLU E 1 165 ? 13.794  -16.906 174.473 1.00 90.37  ? 165 GLU F CB    1 
ATOM   6542  C CG    . GLU E 1 165 ? 14.135  -18.151 173.674 1.00 95.69  ? 165 GLU F CG    1 
ATOM   6543  C CD    . GLU E 1 165 ? 14.597  -19.302 174.551 1.00 102.61 ? 165 GLU F CD    1 
ATOM   6544  O OE1   . GLU E 1 165 ? 15.764  -19.732 174.400 1.00 104.26 ? 165 GLU F OE1   1 
ATOM   6545  O OE2   . GLU E 1 165 ? 13.798  -19.773 175.393 1.00 101.56 ? 165 GLU F OE2   1 
ATOM   6546  N N     . LEU E 1 166 ? 13.439  -15.967 171.207 1.00 78.11  ? 166 LEU F N     1 
ATOM   6547  C CA    . LEU E 1 166 ? 12.755  -16.305 169.974 1.00 77.83  ? 166 LEU F CA    1 
ATOM   6548  C C     . LEU E 1 166 ? 12.672  -17.817 169.843 1.00 82.76  ? 166 LEU F C     1 
ATOM   6549  O O     . LEU E 1 166 ? 13.698  -18.503 169.906 1.00 72.10  ? 166 LEU F O     1 
ATOM   6550  C CB    . LEU E 1 166 ? 13.489  -15.698 168.791 1.00 74.65  ? 166 LEU F CB    1 
ATOM   6551  C CG    . LEU E 1 166 ? 12.821  -15.911 167.442 1.00 77.69  ? 166 LEU F CG    1 
ATOM   6552  C CD1   . LEU E 1 166 ? 11.366  -15.432 167.461 1.00 78.62  ? 166 LEU F CD1   1 
ATOM   6553  C CD2   . LEU E 1 166 ? 13.620  -15.198 166.366 1.00 72.83  ? 166 LEU F CD2   1 
ATOM   6554  N N     . ARG E 1 167 ? 11.462  -18.336 169.658 1.00 84.54  ? 167 ARG F N     1 
ATOM   6555  C CA    . ARG E 1 167 ? 11.266  -19.777 169.739 1.00 84.23  ? 167 ARG F CA    1 
ATOM   6556  C C     . ARG E 1 167 ? 10.873  -20.409 168.407 1.00 83.03  ? 167 ARG F C     1 
ATOM   6557  O O     . ARG E 1 167 ? 10.589  -21.603 168.335 1.00 83.17  ? 167 ARG F O     1 
ATOM   6558  C CB    . ARG E 1 167 ? 10.236  -20.100 170.819 1.00 85.43  ? 167 ARG F CB    1 
ATOM   6559  C CG    . ARG E 1 167 ? 10.768  -20.977 171.942 1.00 100.28 ? 167 ARG F CG    1 
ATOM   6560  C CD    . ARG E 1 167 ? 9.789   -21.022 173.105 1.00 117.84 ? 167 ARG F CD    1 
ATOM   6561  N NE    . ARG E 1 167 ? 9.936   -22.227 173.918 1.00 131.50 ? 167 ARG F NE    1 
ATOM   6562  C CZ    . ARG E 1 167 ? 10.865  -22.396 174.854 1.00 138.67 ? 167 ARG F CZ    1 
ATOM   6563  N NH1   . ARG E 1 167 ? 11.753  -21.441 175.098 1.00 135.99 ? 167 ARG F NH1   1 
ATOM   6564  N NH2   . ARG E 1 167 ? 10.910  -23.529 175.542 1.00 143.11 ? 167 ARG F NH2   1 
ATOM   6565  N N     . CYS E 1 168 ? 10.876  -19.605 167.350 1.00 83.11  ? 168 CYS F N     1 
ATOM   6566  C CA    . CYS E 1 168 ? 10.485  -20.084 166.028 1.00 86.07  ? 168 CYS F CA    1 
ATOM   6567  C C     . CYS E 1 168 ? 11.599  -19.892 164.995 1.00 92.59  ? 168 CYS F C     1 
ATOM   6568  O O     . CYS E 1 168 ? 11.336  -19.680 163.812 1.00 89.02  ? 168 CYS F O     1 
ATOM   6569  C CB    . CYS E 1 168 ? 9.205   -19.381 165.572 1.00 84.72  ? 168 CYS F CB    1 
ATOM   6570  S SG    . CYS E 1 168 ? 9.410   -17.616 165.265 1.00 110.60 ? 168 CYS F SG    1 
ATOM   6571  N N     . MET E 1 169 ? 12.844  -19.986 165.448 1.00 98.93  ? 169 MET F N     1 
ATOM   6572  C CA    . MET E 1 169 ? 13.995  -19.756 164.581 1.00 95.95  ? 169 MET F CA    1 
ATOM   6573  C C     . MET E 1 169 ? 14.240  -20.894 163.585 1.00 90.79  ? 169 MET F C     1 
ATOM   6574  O O     . MET E 1 169 ? 14.630  -20.650 162.444 1.00 86.48  ? 169 MET F O     1 
ATOM   6575  C CB    . MET E 1 169 ? 15.250  -19.494 165.419 1.00 99.52  ? 169 MET F CB    1 
ATOM   6576  C CG    . MET E 1 169 ? 16.395  -18.873 164.636 1.00 102.78 ? 169 MET F CG    1 
ATOM   6577  S SD    . MET E 1 169 ? 15.908  -17.348 163.811 1.00 84.86  ? 169 MET F SD    1 
ATOM   6578  C CE    . MET E 1 169 ? 16.968  -16.155 164.631 1.00 186.21 ? 169 MET F CE    1 
ATOM   6579  N N     . ALA E 1 170 ? 14.011  -22.132 164.014 1.00 93.83  ? 170 ALA F N     1 
ATOM   6580  C CA    . ALA E 1 170 ? 14.212  -23.290 163.144 1.00 91.86  ? 170 ALA F CA    1 
ATOM   6581  C C     . ALA E 1 170 ? 13.294  -23.272 161.924 1.00 88.74  ? 170 ALA F C     1 
ATOM   6582  O O     . ALA E 1 170 ? 13.717  -23.593 160.813 1.00 89.60  ? 170 ALA F O     1 
ATOM   6583  C CB    . ALA E 1 170 ? 14.026  -24.578 163.926 1.00 77.41  ? 170 ALA F CB    1 
ATOM   6584  N N     . LEU E 1 171 ? 12.037  -22.902 162.141 1.00 91.80  ? 171 LEU F N     1 
ATOM   6585  C CA    . LEU E 1 171 ? 11.058  -22.835 161.061 1.00 97.93  ? 171 LEU F CA    1 
ATOM   6586  C C     . LEU E 1 171 ? 11.483  -21.779 160.050 1.00 99.67  ? 171 LEU F C     1 
ATOM   6587  O O     . LEU E 1 171 ? 11.314  -21.952 158.843 1.00 99.07  ? 171 LEU F O     1 
ATOM   6588  C CB    . LEU E 1 171 ? 9.671   -22.504 161.623 1.00 95.93  ? 171 LEU F CB    1 
ATOM   6589  C CG    . LEU E 1 171 ? 8.404   -22.797 160.809 1.00 95.99  ? 171 LEU F CG    1 
ATOM   6590  C CD1   . LEU E 1 171 ? 7.214   -22.905 161.746 1.00 100.26 ? 171 LEU F CD1   1 
ATOM   6591  C CD2   . LEU E 1 171 ? 8.140   -21.732 159.757 1.00 92.26  ? 171 LEU F CD2   1 
ATOM   6592  N N     . CYS E 1 172 ? 12.041  -20.684 160.554 1.00 96.85  ? 172 CYS F N     1 
ATOM   6593  C CA    . CYS E 1 172 ? 12.443  -19.577 159.701 1.00 98.84  ? 172 CYS F CA    1 
ATOM   6594  C C     . CYS E 1 172 ? 13.649  -19.935 158.844 1.00 101.95 ? 172 CYS F C     1 
ATOM   6595  O O     . CYS E 1 172 ? 13.744  -19.511 157.693 1.00 103.09 ? 172 CYS F O     1 
ATOM   6596  C CB    . CYS E 1 172 ? 12.718  -18.331 160.540 1.00 100.28 ? 172 CYS F CB    1 
ATOM   6597  S SG    . CYS E 1 172 ? 11.238  -17.687 161.356 1.00 94.55  ? 172 CYS F SG    1 
ATOM   6598  N N     . ASP E 1 173 ? 14.566  -20.721 159.401 1.00 103.08 ? 173 ASP F N     1 
ATOM   6599  C CA    . ASP E 1 173 ? 15.731  -21.170 158.646 1.00 99.18  ? 173 ASP F CA    1 
ATOM   6600  C C     . ASP E 1 173 ? 15.308  -22.046 157.477 1.00 99.94  ? 173 ASP F C     1 
ATOM   6601  O O     . ASP E 1 173 ? 15.838  -21.927 156.374 1.00 105.31 ? 173 ASP F O     1 
ATOM   6602  C CB    . ASP E 1 173 ? 16.712  -21.924 159.544 1.00 95.49  ? 173 ASP F CB    1 
ATOM   6603  C CG    . ASP E 1 173 ? 17.479  -20.999 160.463 1.00 99.82  ? 173 ASP F CG    1 
ATOM   6604  O OD1   . ASP E 1 173 ? 17.637  -19.813 160.103 1.00 101.72 ? 173 ASP F OD1   1 
ATOM   6605  O OD2   . ASP E 1 173 ? 17.923  -21.453 161.540 1.00 100.07 ? 173 ASP F OD2   1 
ATOM   6606  N N     . ARG E 1 174 ? 14.346  -22.926 157.730 1.00 93.96  ? 174 ARG F N     1 
ATOM   6607  C CA    . ARG E 1 174 ? 13.816  -23.794 156.691 1.00 91.92  ? 174 ARG F CA    1 
ATOM   6608  C C     . ARG E 1 174 ? 13.160  -22.971 155.588 1.00 96.47  ? 174 ARG F C     1 
ATOM   6609  O O     . ARG E 1 174 ? 13.300  -23.276 154.405 1.00 98.27  ? 174 ARG F O     1 
ATOM   6610  C CB    . ARG E 1 174 ? 12.806  -24.769 157.287 1.00 88.04  ? 174 ARG F CB    1 
ATOM   6611  C CG    . ARG E 1 174 ? 12.024  -25.552 156.256 1.00 89.94  ? 174 ARG F CG    1 
ATOM   6612  C CD    . ARG E 1 174 ? 11.049  -26.487 156.930 1.00 94.62  ? 174 ARG F CD    1 
ATOM   6613  N NE    . ARG E 1 174 ? 11.742  -27.573 157.613 1.00 97.96  ? 174 ARG F NE    1 
ATOM   6614  C CZ    . ARG E 1 174 ? 11.978  -28.759 157.064 1.00 99.59  ? 174 ARG F CZ    1 
ATOM   6615  N NH1   . ARG E 1 174 ? 11.567  -29.011 155.827 1.00 97.49  ? 174 ARG F NH1   1 
ATOM   6616  N NH2   . ARG E 1 174 ? 12.621  -29.695 157.751 1.00 98.65  ? 174 ARG F NH2   1 
ATOM   6617  N N     . LEU E 1 175 ? 12.442  -21.929 155.992 1.00 96.68  ? 175 LEU F N     1 
ATOM   6618  C CA    . LEU E 1 175 ? 11.820  -21.005 155.053 1.00 91.56  ? 175 LEU F CA    1 
ATOM   6619  C C     . LEU E 1 175 ? 12.877  -20.352 154.181 1.00 88.89  ? 175 LEU F C     1 
ATOM   6620  O O     . LEU E 1 175 ? 12.720  -20.242 152.965 1.00 93.44  ? 175 LEU F O     1 
ATOM   6621  C CB    . LEU E 1 175 ? 11.049  -19.929 155.815 1.00 88.54  ? 175 LEU F CB    1 
ATOM   6622  C CG    . LEU E 1 175 ? 9.526   -20.030 155.834 1.00 90.96  ? 175 LEU F CG    1 
ATOM   6623  C CD1   . LEU E 1 175 ? 9.078   -21.473 155.759 1.00 92.97  ? 175 LEU F CD1   1 
ATOM   6624  C CD2   . LEU E 1 175 ? 9.000   -19.383 157.097 1.00 92.55  ? 175 LEU F CD2   1 
ATOM   6625  N N     . ARG E 1 176 ? 13.961  -19.926 154.819 1.00 86.01  ? 176 ARG F N     1 
ATOM   6626  C CA    . ARG E 1 176 ? 15.058  -19.272 154.122 1.00 87.30  ? 176 ARG F CA    1 
ATOM   6627  C C     . ARG E 1 176 ? 15.802  -20.267 153.231 1.00 93.13  ? 176 ARG F C     1 
ATOM   6628  O O     . ARG E 1 176 ? 16.196  -19.937 152.112 1.00 94.14  ? 176 ARG F O     1 
ATOM   6629  C CB    . ARG E 1 176 ? 16.005  -18.607 155.131 1.00 84.65  ? 176 ARG F CB    1 
ATOM   6630  C CG    . ARG E 1 176 ? 17.128  -17.784 154.513 1.00 88.09  ? 176 ARG F CG    1 
ATOM   6631  C CD    . ARG E 1 176 ? 17.857  -16.920 155.550 1.00 86.66  ? 176 ARG F CD    1 
ATOM   6632  N NE    . ARG E 1 176 ? 18.232  -17.657 156.757 1.00 84.55  ? 176 ARG F NE    1 
ATOM   6633  C CZ    . ARG E 1 176 ? 19.400  -18.268 156.936 1.00 81.06  ? 176 ARG F CZ    1 
ATOM   6634  N NH1   . ARG E 1 176 ? 20.322  -18.243 155.982 1.00 76.31  ? 176 ARG F NH1   1 
ATOM   6635  N NH2   . ARG E 1 176 ? 19.648  -18.910 158.071 1.00 80.53  ? 176 ARG F NH2   1 
ATOM   6636  N N     . LEU E 1 177 ? 15.969  -21.491 153.725 1.00 96.23  ? 177 LEU F N     1 
ATOM   6637  C CA    . LEU E 1 177 ? 16.684  -22.537 152.997 1.00 91.70  ? 177 LEU F CA    1 
ATOM   6638  C C     . LEU E 1 177 ? 15.909  -22.958 151.756 1.00 88.36  ? 177 LEU F C     1 
ATOM   6639  O O     . LEU E 1 177 ? 16.476  -23.475 150.792 1.00 91.41  ? 177 LEU F O     1 
ATOM   6640  C CB    . LEU E 1 177 ? 16.926  -23.744 153.907 1.00 92.64  ? 177 LEU F CB    1 
ATOM   6641  C CG    . LEU E 1 177 ? 17.469  -25.027 153.273 1.00 94.75  ? 177 LEU F CG    1 
ATOM   6642  C CD1   . LEU E 1 177 ? 18.838  -24.798 152.644 1.00 94.63  ? 177 LEU F CD1   1 
ATOM   6643  C CD2   . LEU E 1 177 ? 17.516  -26.149 154.295 1.00 98.13  ? 177 LEU F CD2   1 
ATOM   6644  N N     . MET E 1 178 ? 14.602  -22.729 151.790 1.00 85.49  ? 178 MET F N     1 
ATOM   6645  C CA    . MET E 1 178 ? 13.739  -23.045 150.661 1.00 91.07  ? 178 MET F CA    1 
ATOM   6646  C C     . MET E 1 178 ? 13.730  -21.908 149.641 1.00 92.92  ? 178 MET F C     1 
ATOM   6647  O O     . MET E 1 178 ? 13.581  -22.148 148.442 1.00 99.36  ? 178 MET F O     1 
ATOM   6648  C CB    . MET E 1 178 ? 12.315  -23.361 151.134 1.00 97.13  ? 178 MET F CB    1 
ATOM   6649  C CG    . MET E 1 178 ? 12.149  -24.736 151.780 1.00 101.23 ? 178 MET F CG    1 
ATOM   6650  S SD    . MET E 1 178 ? 10.460  -25.067 152.343 1.00 106.14 ? 178 MET F SD    1 
ATOM   6651  C CE    . MET E 1 178 ? 10.603  -26.772 152.882 1.00 112.51 ? 178 MET F CE    1 
ATOM   6652  N N     . TYR E 1 179 ? 13.897  -20.675 150.114 1.00 89.92  ? 179 TYR F N     1 
ATOM   6653  C CA    . TYR E 1 179 ? 13.929  -19.520 149.220 1.00 93.36  ? 179 TYR F CA    1 
ATOM   6654  C C     . TYR E 1 179 ? 15.202  -19.514 148.372 1.00 102.59 ? 179 TYR F C     1 
ATOM   6655  O O     . TYR E 1 179 ? 15.166  -19.874 147.194 1.00 110.75 ? 179 TYR F O     1 
ATOM   6656  C CB    . TYR E 1 179 ? 13.790  -18.210 149.994 1.00 89.16  ? 179 TYR F CB    1 
ATOM   6657  C CG    . TYR E 1 179 ? 13.599  -17.018 149.090 1.00 87.78  ? 179 TYR F CG    1 
ATOM   6658  C CD1   . TYR E 1 179 ? 12.368  -16.764 148.501 1.00 90.79  ? 179 TYR F CD1   1 
ATOM   6659  C CD2   . TYR E 1 179 ? 14.650  -16.155 148.814 1.00 87.94  ? 179 TYR F CD2   1 
ATOM   6660  C CE1   . TYR E 1 179 ? 12.187  -15.678 147.665 1.00 97.91  ? 179 TYR F CE1   1 
ATOM   6661  C CE2   . TYR E 1 179 ? 14.479  -15.067 147.981 1.00 92.11  ? 179 TYR F CE2   1 
ATOM   6662  C CZ    . TYR E 1 179 ? 13.246  -14.833 147.409 1.00 98.59  ? 179 TYR F CZ    1 
ATOM   6663  O OH    . TYR E 1 179 ? 13.074  -13.750 146.578 1.00 103.63 ? 179 TYR F OH    1 
ATOM   6664  N N     . PHE E 1 180 ? 16.318  -19.094 148.963 1.00 101.37 ? 180 PHE F N     1 
ATOM   6665  C CA    . PHE E 1 180 ? 17.621  -19.338 148.355 1.00 103.22 ? 180 PHE F CA    1 
ATOM   6666  C C     . PHE E 1 180 ? 17.862  -20.829 148.476 1.00 105.81 ? 180 PHE F C     1 
ATOM   6667  O O     . PHE E 1 180 ? 17.455  -21.432 149.461 1.00 114.54 ? 180 PHE F O     1 
ATOM   6668  C CB    . PHE E 1 180 ? 18.739  -18.622 149.114 1.00 103.43 ? 180 PHE F CB    1 
ATOM   6669  C CG    . PHE E 1 180 ? 18.375  -17.254 149.607 1.00 98.55  ? 180 PHE F CG    1 
ATOM   6670  C CD1   . PHE E 1 180 ? 18.368  -16.172 148.745 1.00 97.58  ? 180 PHE F CD1   1 
ATOM   6671  C CD2   . PHE E 1 180 ? 18.070  -17.045 150.942 1.00 97.08  ? 180 PHE F CD2   1 
ATOM   6672  C CE1   . PHE E 1 180 ? 18.043  -14.911 149.198 1.00 96.53  ? 180 PHE F CE1   1 
ATOM   6673  C CE2   . PHE E 1 180 ? 17.746  -15.785 151.402 1.00 97.68  ? 180 PHE F CE2   1 
ATOM   6674  C CZ    . PHE E 1 180 ? 17.734  -14.715 150.528 1.00 97.75  ? 180 PHE F CZ    1 
ATOM   6675  N N     . GLY E 1 181 ? 18.544  -21.432 147.509 1.00 101.71 ? 181 GLY F N     1 
ATOM   6676  C CA    . GLY E 1 181 ? 18.824  -22.856 147.588 1.00 108.46 ? 181 GLY F CA    1 
ATOM   6677  C C     . GLY E 1 181 ? 19.865  -23.245 148.633 1.00 111.56 ? 181 GLY F C     1 
ATOM   6678  O O     . GLY E 1 181 ? 20.515  -24.282 148.504 1.00 118.30 ? 181 GLY F O     1 
ATOM   6679  N N     . ASN E 1 182 ? 20.015  -22.429 149.674 1.00 103.00 ? 182 ASN F N     1 
ATOM   6680  C CA    . ASN E 1 182 ? 21.061  -22.631 150.674 1.00 93.21  ? 182 ASN F CA    1 
ATOM   6681  C C     . ASN E 1 182 ? 20.767  -21.883 151.975 1.00 91.78  ? 182 ASN F C     1 
ATOM   6682  O O     . ASN E 1 182 ? 19.665  -21.376 152.170 1.00 98.26  ? 182 ASN F O     1 
ATOM   6683  C CB    . ASN E 1 182 ? 22.397  -22.157 150.118 1.00 89.37  ? 182 ASN F CB    1 
ATOM   6684  C CG    . ASN E 1 182 ? 22.392  -20.678 149.795 1.00 87.51  ? 182 ASN F CG    1 
ATOM   6685  O OD1   . ASN E 1 182 ? 22.639  -19.841 150.664 1.00 78.76  ? 182 ASN F OD1   1 
ATOM   6686  N ND2   . ASN E 1 182 ? 22.102  -20.346 148.543 1.00 88.31  ? 182 ASN F ND2   1 
ATOM   6687  N N     . LEU E 1 183 ? 21.757  -21.807 152.861 1.00 84.19  ? 183 LEU F N     1 
ATOM   6688  C CA    . LEU E 1 183 ? 21.586  -21.096 154.129 1.00 84.44  ? 183 LEU F CA    1 
ATOM   6689  C C     . LEU E 1 183 ? 22.658  -20.038 154.351 1.00 90.19  ? 183 LEU F C     1 
ATOM   6690  O O     . LEU E 1 183 ? 22.658  -19.356 155.375 1.00 95.32  ? 183 LEU F O     1 
ATOM   6691  C CB    . LEU E 1 183 ? 21.586  -22.068 155.311 1.00 82.31  ? 183 LEU F CB    1 
ATOM   6692  C CG    . LEU E 1 183 ? 20.300  -22.807 155.670 1.00 83.67  ? 183 LEU F CG    1 
ATOM   6693  C CD1   . LEU E 1 183 ? 20.604  -23.946 156.635 1.00 85.14  ? 183 LEU F CD1   1 
ATOM   6694  C CD2   . LEU E 1 183 ? 19.285  -21.848 156.273 1.00 79.26  ? 183 LEU F CD2   1 
ATOM   6695  N N     . TRP E 1 184 ? 23.576  -19.909 153.399 1.00 89.25  ? 184 TRP F N     1 
ATOM   6696  C CA    . TRP E 1 184 ? 24.641  -18.922 153.519 1.00 91.44  ? 184 TRP F CA    1 
ATOM   6697  C C     . TRP E 1 184 ? 24.161  -17.522 153.139 1.00 90.00  ? 184 TRP F C     1 
ATOM   6698  O O     . TRP E 1 184 ? 24.689  -16.521 153.625 1.00 95.75  ? 184 TRP F O     1 
ATOM   6699  C CB    . TRP E 1 184 ? 25.896  -19.341 152.734 1.00 102.03 ? 184 TRP F CB    1 
ATOM   6700  C CG    . TRP E 1 184 ? 25.755  -19.420 151.234 1.00 111.51 ? 184 TRP F CG    1 
ATOM   6701  C CD1   . TRP E 1 184 ? 25.536  -20.544 150.483 1.00 116.09 ? 184 TRP F CD1   1 
ATOM   6702  C CD2   . TRP E 1 184 ? 25.874  -18.336 150.304 1.00 113.85 ? 184 TRP F CD2   1 
ATOM   6703  N NE1   . TRP E 1 184 ? 25.489  -20.219 149.146 1.00 117.41 ? 184 TRP F NE1   1 
ATOM   6704  C CE2   . TRP E 1 184 ? 25.694  -18.870 149.010 1.00 115.60 ? 184 TRP F CE2   1 
ATOM   6705  C CE3   . TRP E 1 184 ? 26.106  -16.964 150.442 1.00 110.44 ? 184 TRP F CE3   1 
ATOM   6706  C CZ2   . TRP E 1 184 ? 25.737  -18.079 147.862 1.00 112.49 ? 184 TRP F CZ2   1 
ATOM   6707  C CZ3   . TRP E 1 184 ? 26.148  -16.181 149.304 1.00 110.93 ? 184 TRP F CZ3   1 
ATOM   6708  C CH2   . TRP E 1 184 ? 25.965  -16.740 148.029 1.00 111.22 ? 184 TRP F CH2   1 
ATOM   6709  N N     . GLN E 1 185 ? 23.149  -17.457 152.280 1.00 85.72  ? 185 GLN F N     1 
ATOM   6710  C CA    . GLN E 1 185 ? 22.500  -16.189 151.970 1.00 87.55  ? 185 GLN F CA    1 
ATOM   6711  C C     . GLN E 1 185 ? 21.445  -15.895 153.029 1.00 95.67  ? 185 GLN F C     1 
ATOM   6712  O O     . GLN E 1 185 ? 20.758  -16.804 153.497 1.00 100.61 ? 185 GLN F O     1 
ATOM   6713  C CB    . GLN E 1 185 ? 21.835  -16.236 150.591 1.00 83.41  ? 185 GLN F CB    1 
ATOM   6714  C CG    . GLN E 1 185 ? 22.723  -16.756 149.478 1.00 81.55  ? 185 GLN F CG    1 
ATOM   6715  C CD    . GLN E 1 185 ? 22.225  -16.359 148.103 1.00 83.77  ? 185 GLN F CD    1 
ATOM   6716  O OE1   . GLN E 1 185 ? 21.763  -17.199 147.331 1.00 79.43  ? 185 GLN F OE1   1 
ATOM   6717  N NE2   . GLN E 1 185 ? 22.324  -15.072 147.786 1.00 77.75  ? 185 GLN F NE2   1 
ATOM   6718  N N     . ASP E 1 186 ? 21.317  -14.630 153.413 1.00 96.00  ? 186 ASP F N     1 
ATOM   6719  C CA    . ASP E 1 186 ? 20.276  -14.250 154.361 1.00 100.24 ? 186 ASP F CA    1 
ATOM   6720  C C     . ASP E 1 186 ? 19.430  -13.094 153.840 1.00 103.83 ? 186 ASP F C     1 
ATOM   6721  O O     . ASP E 1 186 ? 19.512  -12.731 152.668 1.00 105.07 ? 186 ASP F O     1 
ATOM   6722  C CB    . ASP E 1 186 ? 20.864  -13.921 155.736 1.00 100.63 ? 186 ASP F CB    1 
ATOM   6723  C CG    . ASP E 1 186 ? 21.782  -12.717 155.709 1.00 105.42 ? 186 ASP F CG    1 
ATOM   6724  O OD1   . ASP E 1 186 ? 21.270  -11.577 155.714 1.00 104.52 ? 186 ASP F OD1   1 
ATOM   6725  O OD2   . ASP E 1 186 ? 23.016  -12.908 155.698 1.00 113.96 ? 186 ASP F OD2   1 
ATOM   6726  N N     . TRP E 1 187 ? 18.619  -12.514 154.717 1.00 103.41 ? 187 TRP F N     1 
ATOM   6727  C CA    . TRP E 1 187 ? 17.637  -11.518 154.299 1.00 97.44  ? 187 TRP F CA    1 
ATOM   6728  C C     . TRP E 1 187 ? 18.239  -10.168 153.895 1.00 92.01  ? 187 TRP F C     1 
ATOM   6729  O O     . TRP E 1 187 ? 17.512  -9.263  153.489 1.00 93.77  ? 187 TRP F O     1 
ATOM   6730  C CB    . TRP E 1 187 ? 16.582  -11.314 155.390 1.00 93.48  ? 187 TRP F CB    1 
ATOM   6731  C CG    . TRP E 1 187 ? 15.765  -12.533 155.691 1.00 96.54  ? 187 TRP F CG    1 
ATOM   6732  C CD1   . TRP E 1 187 ? 14.619  -12.931 155.063 1.00 101.93 ? 187 TRP F CD1   1 
ATOM   6733  C CD2   . TRP E 1 187 ? 16.025  -13.506 156.708 1.00 98.31  ? 187 TRP F CD2   1 
ATOM   6734  N NE1   . TRP E 1 187 ? 14.152  -14.096 155.625 1.00 98.55  ? 187 TRP F NE1   1 
ATOM   6735  C CE2   . TRP E 1 187 ? 14.998  -14.470 156.636 1.00 102.59 ? 187 TRP F CE2   1 
ATOM   6736  C CE3   . TRP E 1 187 ? 17.027  -13.659 157.671 1.00 101.85 ? 187 TRP F CE3   1 
ATOM   6737  C CZ2   . TRP E 1 187 ? 14.944  -15.570 157.490 1.00 108.70 ? 187 TRP F CZ2   1 
ATOM   6738  C CZ3   . TRP E 1 187 ? 16.972  -14.751 158.518 1.00 107.84 ? 187 TRP F CZ3   1 
ATOM   6739  C CH2   . TRP E 1 187 ? 15.938  -15.693 158.421 1.00 111.87 ? 187 TRP F CH2   1 
ATOM   6740  N N     . SER E 1 188 ? 19.558  -10.034 154.000 1.00 86.12  ? 188 SER F N     1 
ATOM   6741  C CA    . SER E 1 188 ? 20.220  -8.780  153.648 1.00 86.12  ? 188 SER F CA    1 
ATOM   6742  C C     . SER E 1 188 ? 20.462  -8.662  152.142 1.00 88.89  ? 188 SER F C     1 
ATOM   6743  O O     . SER E 1 188 ? 20.868  -7.607  151.652 1.00 91.05  ? 188 SER F O     1 
ATOM   6744  C CB    . SER E 1 188 ? 21.530  -8.614  154.425 1.00 85.49  ? 188 SER F CB    1 
ATOM   6745  O OG    . SER E 1 188 ? 22.525  -9.509  153.958 1.00 93.42  ? 188 SER F OG    1 
ATOM   6746  N N     . GLU E 1 189 ? 20.207  -9.747  151.415 1.00 88.49  ? 189 GLU F N     1 
ATOM   6747  C CA    . GLU E 1 189 ? 20.315  -9.739  149.959 1.00 86.41  ? 189 GLU F CA    1 
ATOM   6748  C C     . GLU E 1 189 ? 19.321  -8.748  149.368 1.00 93.80  ? 189 GLU F C     1 
ATOM   6749  O O     . GLU E 1 189 ? 19.649  -7.994  148.451 1.00 93.96  ? 189 GLU F O     1 
ATOM   6750  C CB    . GLU E 1 189 ? 20.047  -11.133 149.387 1.00 77.15  ? 189 GLU F CB    1 
ATOM   6751  C CG    . GLU E 1 189 ? 20.969  -12.223 149.909 1.00 82.57  ? 189 GLU F CG    1 
ATOM   6752  C CD    . GLU E 1 189 ? 22.340  -12.224 149.246 1.00 86.69  ? 189 GLU F CD    1 
ATOM   6753  O OE1   . GLU E 1 189 ? 22.417  -12.016 148.014 1.00 77.06  ? 189 GLU F OE1   1 
ATOM   6754  O OE2   . GLU E 1 189 ? 23.342  -12.442 149.964 1.00 93.34  ? 189 GLU F OE2   1 
ATOM   6755  N N     . PHE E 1 190 ? 18.104  -8.762  149.905 1.00 96.93  ? 190 PHE F N     1 
ATOM   6756  C CA    . PHE E 1 190 ? 17.046  -7.858  149.468 1.00 96.36  ? 190 PHE F CA    1 
ATOM   6757  C C     . PHE E 1 190 ? 17.460  -6.398  149.585 1.00 96.94  ? 190 PHE F C     1 
ATOM   6758  O O     . PHE E 1 190 ? 17.278  -5.618  148.652 1.00 99.12  ? 190 PHE F O     1 
ATOM   6759  C CB    . PHE E 1 190 ? 15.777  -8.095  150.282 1.00 92.58  ? 190 PHE F CB    1 
ATOM   6760  C CG    . PHE E 1 190 ? 15.078  -9.378  149.951 1.00 93.49  ? 190 PHE F CG    1 
ATOM   6761  C CD1   . PHE E 1 190 ? 14.134  -9.423  148.940 1.00 93.09  ? 190 PHE F CD1   1 
ATOM   6762  C CD2   . PHE E 1 190 ? 15.361  -10.539 150.652 1.00 92.18  ? 190 PHE F CD2   1 
ATOM   6763  C CE1   . PHE E 1 190 ? 13.485  -10.602 148.630 1.00 88.27  ? 190 PHE F CE1   1 
ATOM   6764  C CE2   . PHE E 1 190 ? 14.715  -11.721 150.348 1.00 90.82  ? 190 PHE F CE2   1 
ATOM   6765  C CZ    . PHE E 1 190 ? 13.776  -11.753 149.334 1.00 87.57  ? 190 PHE F CZ    1 
ATOM   6766  N N     . VAL E 1 191 ? 18.017  -6.031  150.732 1.00 88.95  ? 191 VAL F N     1 
ATOM   6767  C CA    . VAL E 1 191 ? 18.459  -4.662  150.944 1.00 85.52  ? 191 VAL F CA    1 
ATOM   6768  C C     . VAL E 1 191 ? 19.599  -4.328  149.990 1.00 90.25  ? 191 VAL F C     1 
ATOM   6769  O O     . VAL E 1 191 ? 19.544  -3.334  149.265 1.00 91.23  ? 191 VAL F O     1 
ATOM   6770  C CB    . VAL E 1 191 ? 18.942  -4.433  152.385 1.00 82.79  ? 191 VAL F CB    1 
ATOM   6771  C CG1   . VAL E 1 191 ? 19.195  -2.948  152.624 1.00 81.34  ? 191 VAL F CG1   1 
ATOM   6772  C CG2   . VAL E 1 191 ? 17.933  -4.985  153.383 1.00 84.79  ? 191 VAL F CG2   1 
ATOM   6773  N N     . LEU E 1 192 ? 20.622  -5.177  149.989 1.00 89.87  ? 192 LEU F N     1 
ATOM   6774  C CA    . LEU E 1 192 ? 21.836  -4.926  149.223 1.00 85.02  ? 192 LEU F CA    1 
ATOM   6775  C C     . LEU E 1 192 ? 21.563  -4.857  147.731 1.00 83.79  ? 192 LEU F C     1 
ATOM   6776  O O     . LEU E 1 192 ? 22.283  -4.188  146.987 1.00 80.21  ? 192 LEU F O     1 
ATOM   6777  C CB    . LEU E 1 192 ? 22.868  -6.012  149.505 1.00 85.16  ? 192 LEU F CB    1 
ATOM   6778  C CG    . LEU E 1 192 ? 23.596  -5.903  150.841 1.00 86.39  ? 192 LEU F CG    1 
ATOM   6779  C CD1   . LEU E 1 192 ? 24.179  -7.248  151.241 1.00 87.98  ? 192 LEU F CD1   1 
ATOM   6780  C CD2   . LEU E 1 192 ? 24.686  -4.851  150.748 1.00 89.34  ? 192 LEU F CD2   1 
ATOM   6781  N N     . ALA E 1 193 ? 20.522  -5.562  147.301 1.00 84.46  ? 193 ALA F N     1 
ATOM   6782  C CA    . ALA E 1 193 ? 20.101  -5.531  145.910 1.00 84.24  ? 193 ALA F CA    1 
ATOM   6783  C C     . ALA E 1 193 ? 19.317  -4.254  145.622 1.00 91.60  ? 193 ALA F C     1 
ATOM   6784  O O     . ALA E 1 193 ? 19.490  -3.644  144.568 1.00 92.61  ? 193 ALA F O     1 
ATOM   6785  C CB    . ALA E 1 193 ? 19.272  -6.759  145.574 1.00 76.95  ? 193 ALA F CB    1 
ATOM   6786  N N     . ASP E 1 194 ? 18.464  -3.853  146.565 1.00 93.55  ? 194 ASP F N     1 
ATOM   6787  C CA    . ASP E 1 194 ? 17.671  -2.632  146.421 1.00 94.92  ? 194 ASP F CA    1 
ATOM   6788  C C     . ASP E 1 194 ? 18.557  -1.393  146.446 1.00 94.58  ? 194 ASP F C     1 
ATOM   6789  O O     . ASP E 1 194 ? 18.265  -0.394  145.787 1.00 97.93  ? 194 ASP F O     1 
ATOM   6790  C CB    . ASP E 1 194 ? 16.623  -2.519  147.532 1.00 103.07 ? 194 ASP F CB    1 
ATOM   6791  C CG    . ASP E 1 194 ? 15.481  -3.504  147.369 1.00 117.49 ? 194 ASP F CG    1 
ATOM   6792  O OD1   . ASP E 1 194 ? 15.218  -3.937  146.227 1.00 126.18 ? 194 ASP F OD1   1 
ATOM   6793  O OD2   . ASP E 1 194 ? 14.839  -3.838  148.389 1.00 118.66 ? 194 ASP F OD2   1 
ATOM   6794  N N     . LEU E 1 195 ? 19.636  -1.461  147.218 1.00 91.40  ? 195 LEU F N     1 
ATOM   6795  C CA    . LEU E 1 195 ? 20.560  -0.341  147.336 1.00 91.91  ? 195 LEU F CA    1 
ATOM   6796  C C     . LEU E 1 195 ? 21.561  -0.289  146.187 1.00 88.53  ? 195 LEU F C     1 
ATOM   6797  O O     . LEU E 1 195 ? 22.424  0.584   146.153 1.00 95.12  ? 195 LEU F O     1 
ATOM   6798  C CB    . LEU E 1 195 ? 21.307  -0.397  148.668 1.00 94.02  ? 195 LEU F CB    1 
ATOM   6799  C CG    . LEU E 1 195 ? 20.446  -0.350  149.929 1.00 92.19  ? 195 LEU F CG    1 
ATOM   6800  C CD1   . LEU E 1 195 ? 21.326  -0.286  151.165 1.00 91.96  ? 195 LEU F CD1   1 
ATOM   6801  C CD2   . LEU E 1 195 ? 19.489  0.828   149.882 1.00 92.01  ? 195 LEU F CD2   1 
ATOM   6802  N N     . GLY E 1 196 ? 21.457  -1.228  145.253 1.00 80.73  ? 196 GLY F N     1 
ATOM   6803  C CA    . GLY E 1 196 ? 22.316  -1.222  144.081 1.00 88.57  ? 196 GLY F CA    1 
ATOM   6804  C C     . GLY E 1 196 ? 23.750  -1.610  144.391 1.00 94.06  ? 196 GLY F C     1 
ATOM   6805  O O     . GLY E 1 196 ? 24.645  -1.455  143.556 1.00 81.05  ? 196 GLY F O     1 
ATOM   6806  N N     . ILE E 1 197 ? 23.961  -2.109  145.605 1.00 92.30  ? 197 ILE F N     1 
ATOM   6807  C CA    . ILE E 1 197 ? 25.256  -2.618  146.036 1.00 86.30  ? 197 ILE F CA    1 
ATOM   6808  C C     . ILE E 1 197 ? 25.498  -3.998  145.412 1.00 86.96  ? 197 ILE F C     1 
ATOM   6809  O O     . ILE E 1 197 ? 26.633  -4.365  145.112 1.00 92.35  ? 197 ILE F O     1 
ATOM   6810  C CB    . ILE E 1 197 ? 25.332  -2.696  147.583 1.00 78.30  ? 197 ILE F CB    1 
ATOM   6811  C CG1   . ILE E 1 197 ? 24.884  -1.370  148.212 1.00 77.40  ? 197 ILE F CG1   1 
ATOM   6812  C CG2   . ILE E 1 197 ? 26.731  -3.078  148.049 1.00 76.65  ? 197 ILE F CG2   1 
ATOM   6813  C CD1   . ILE E 1 197 ? 24.852  -1.383  149.734 1.00 74.74  ? 197 ILE F CD1   1 
ATOM   6814  N N     . TYR E 1 198 ? 24.423  -4.756  145.212 1.00 85.73  ? 198 TYR F N     1 
ATOM   6815  C CA    . TYR E 1 198 ? 24.498  -6.009  144.463 1.00 93.01  ? 198 TYR F CA    1 
ATOM   6816  C C     . TYR E 1 198 ? 23.508  -6.012  143.300 1.00 96.05  ? 198 TYR F C     1 
ATOM   6817  O O     . TYR E 1 198 ? 22.295  -5.974  143.500 1.00 103.12 ? 198 TYR F O     1 
ATOM   6818  C CB    . TYR E 1 198 ? 24.266  -7.225  145.369 1.00 100.46 ? 198 TYR F CB    1 
ATOM   6819  C CG    . TYR E 1 198 ? 25.425  -7.533  146.293 1.00 107.74 ? 198 TYR F CG    1 
ATOM   6820  C CD1   . TYR E 1 198 ? 26.697  -7.767  145.789 1.00 109.65 ? 198 TYR F CD1   1 
ATOM   6821  C CD2   . TYR E 1 198 ? 25.246  -7.600  147.668 1.00 112.65 ? 198 TYR F CD2   1 
ATOM   6822  C CE1   . TYR E 1 198 ? 27.759  -8.046  146.627 1.00 113.68 ? 198 TYR F CE1   1 
ATOM   6823  C CE2   . TYR E 1 198 ? 26.302  -7.880  148.515 1.00 114.87 ? 198 TYR F CE2   1 
ATOM   6824  C CZ    . TYR E 1 198 ? 27.556  -8.101  147.989 1.00 118.58 ? 198 TYR F CZ    1 
ATOM   6825  O OH    . TYR E 1 198 ? 28.610  -8.380  148.827 1.00 126.04 ? 198 TYR F OH    1 
ATOM   6826  N N     . ARG E 1 199 ? 24.035  -6.044  142.082 1.00 98.70  ? 199 ARG F N     1 
ATOM   6827  C CA    . ARG E 1 199 ? 23.194  -6.110  140.894 1.00 102.96 ? 199 ARG F CA    1 
ATOM   6828  C C     . ARG E 1 199 ? 23.354  -7.463  140.213 1.00 103.53 ? 199 ARG F C     1 
ATOM   6829  O O     . ARG E 1 199 ? 24.437  -7.811  139.747 1.00 112.26 ? 199 ARG F O     1 
ATOM   6830  C CB    . ARG E 1 199 ? 23.527  -4.972  139.922 1.00 106.35 ? 199 ARG F CB    1 
ATOM   6831  C CG    . ARG E 1 199 ? 23.322  -3.574  140.498 1.00 105.32 ? 199 ARG F CG    1 
ATOM   6832  C CD    . ARG E 1 199 ? 23.606  -2.496  139.463 1.00 105.14 ? 199 ARG F CD    1 
ATOM   6833  N NE    . ARG E 1 199 ? 22.848  -2.716  138.235 1.00 106.03 ? 199 ARG F NE    1 
ATOM   6834  C CZ    . ARG E 1 199 ? 23.399  -2.974  137.054 1.00 109.99 ? 199 ARG F CZ    1 
ATOM   6835  N NH1   . ARG E 1 199 ? 24.720  -3.031  136.933 1.00 111.74 ? 199 ARG F NH1   1 
ATOM   6836  N NH2   . ARG E 1 199 ? 22.630  -3.165  135.990 1.00 108.85 ? 199 ARG F NH2   1 
ATOM   6837  N N     . TYR E 1 200 ? 22.270  -8.228  140.167 1.00 100.34 ? 200 TYR F N     1 
ATOM   6838  C CA    . TYR E 1 200 ? 22.305  -9.555  139.572 1.00 106.18 ? 200 TYR F CA    1 
ATOM   6839  C C     . TYR E 1 200 ? 21.714  -9.542  138.172 1.00 110.83 ? 200 TYR F C     1 
ATOM   6840  O O     . TYR E 1 200 ? 20.881  -8.696  137.846 1.00 112.52 ? 200 TYR F O     1 
ATOM   6841  C CB    . TYR E 1 200 ? 21.525  -10.549 140.432 1.00 103.36 ? 200 TYR F CB    1 
ATOM   6842  C CG    . TYR E 1 200 ? 22.023  -10.680 141.850 1.00 82.35  ? 200 TYR F CG    1 
ATOM   6843  C CD1   . TYR E 1 200 ? 21.517  -9.872  142.858 1.00 80.73  ? 200 TYR F CD1   1 
ATOM   6844  C CD2   . TYR E 1 200 ? 22.993  -11.617 142.182 1.00 94.03  ? 200 TYR F CD2   1 
ATOM   6845  C CE1   . TYR E 1 200 ? 21.964  -9.990  144.157 1.00 89.43  ? 200 TYR F CE1   1 
ATOM   6846  C CE2   . TYR E 1 200 ? 23.447  -11.742 143.480 1.00 91.21  ? 200 TYR F CE2   1 
ATOM   6847  C CZ    . TYR E 1 200 ? 22.927  -10.927 144.463 1.00 91.78  ? 200 TYR F CZ    1 
ATOM   6848  O OH    . TYR E 1 200 ? 23.372  -11.044 145.759 1.00 99.01  ? 200 TYR F OH    1 
ATOM   6849  N N     . GLU E 1 201 ? 22.149  -10.483 137.343 1.00 109.32 ? 201 GLU F N     1 
ATOM   6850  C CA    . GLU E 1 201 ? 21.520  -10.682 136.050 1.00 105.98 ? 201 GLU F CA    1 
ATOM   6851  C C     . GLU E 1 201 ? 20.104  -11.186 136.297 1.00 105.92 ? 201 GLU F C     1 
ATOM   6852  O O     . GLU E 1 201 ? 19.873  -11.988 137.205 1.00 103.00 ? 201 GLU F O     1 
ATOM   6853  C CB    . GLU E 1 201 ? 22.317  -11.683 135.212 1.00 103.92 ? 201 GLU F CB    1 
ATOM   6854  C CG    . GLU E 1 201 ? 21.644  -12.089 133.911 1.00 105.17 ? 201 GLU F CG    1 
ATOM   6855  C CD    . GLU E 1 201 ? 21.255  -10.899 133.058 1.00 106.62 ? 201 GLU F CD    1 
ATOM   6856  O OE1   . GLU E 1 201 ? 22.134  -10.349 132.363 1.00 104.91 ? 201 GLU F OE1   1 
ATOM   6857  O OE2   . GLU E 1 201 ? 20.067  -10.515 133.082 1.00 110.24 ? 201 GLU F OE2   1 
ATOM   6858  N N     . SER E 1 202 ? 19.155  -10.697 135.507 1.00 108.55 ? 202 SER F N     1 
ATOM   6859  C CA    . SER E 1 202 ? 17.765  -11.108 135.651 1.00 112.69 ? 202 SER F CA    1 
ATOM   6860  C C     . SER E 1 202 ? 17.419  -12.198 134.646 1.00 113.97 ? 202 SER F C     1 
ATOM   6861  O O     . SER E 1 202 ? 17.157  -11.919 133.477 1.00 115.95 ? 202 SER F O     1 
ATOM   6862  C CB    . SER E 1 202 ? 16.827  -9.913  135.475 1.00 115.68 ? 202 SER F CB    1 
ATOM   6863  O OG    . SER E 1 202 ? 16.814  -9.473  134.128 1.00 120.07 ? 202 SER F OG    1 
ATOM   6864  N N     . VAL E 1 203 ? 17.432  -13.445 135.104 1.00 114.65 ? 203 VAL F N     1 
ATOM   6865  C CA    . VAL E 1 203 ? 17.049  -14.565 134.257 1.00 119.89 ? 203 VAL F CA    1 
ATOM   6866  C C     . VAL E 1 203 ? 15.549  -14.802 134.354 1.00 125.96 ? 203 VAL F C     1 
ATOM   6867  O O     . VAL E 1 203 ? 15.011  -14.971 135.447 1.00 127.69 ? 203 VAL F O     1 
ATOM   6868  C CB    . VAL E 1 203 ? 17.787  -15.855 134.653 1.00 118.70 ? 203 VAL F CB    1 
ATOM   6869  C CG1   . VAL E 1 203 ? 17.363  -17.000 133.749 1.00 119.79 ? 203 VAL F CG1   1 
ATOM   6870  C CG2   . VAL E 1 203 ? 19.291  -15.645 134.588 1.00 118.92 ? 203 VAL F CG2   1 
ATOM   6871  N N     . GLU E 1 204 ? 14.873  -14.804 133.211 1.00 130.50 ? 204 GLU F N     1 
ATOM   6872  C CA    . GLU E 1 204 ? 13.439  -15.055 133.187 1.00 132.14 ? 204 GLU F CA    1 
ATOM   6873  C C     . GLU E 1 204 ? 13.154  -16.553 133.261 1.00 129.41 ? 204 GLU F C     1 
ATOM   6874  O O     . GLU E 1 204 ? 13.086  -17.234 132.237 1.00 127.67 ? 204 GLU F O     1 
ATOM   6875  C CB    . GLU E 1 204 ? 12.806  -14.453 131.931 1.00 138.61 ? 204 GLU F CB    1 
ATOM   6876  C CG    . GLU E 1 204 ? 11.300  -14.633 131.850 1.00 147.91 ? 204 GLU F CG    1 
ATOM   6877  C CD    . GLU E 1 204 ? 10.747  -14.266 130.487 1.00 155.81 ? 204 GLU F CD    1 
ATOM   6878  O OE1   . GLU E 1 204 ? 11.459  -13.581 129.723 1.00 158.23 ? 204 GLU F OE1   1 
ATOM   6879  O OE2   . GLU E 1 204 ? 9.605   -14.670 130.177 1.00 157.12 ? 204 GLU F OE2   1 
ATOM   6880  N N     . PHE E 1 205 ? 12.994  -17.062 134.479 1.00 127.92 ? 205 PHE F N     1 
ATOM   6881  C CA    . PHE E 1 205 ? 12.728  -18.483 134.683 1.00 129.86 ? 205 PHE F CA    1 
ATOM   6882  C C     . PHE E 1 205 ? 11.242  -18.766 134.886 1.00 132.68 ? 205 PHE F C     1 
ATOM   6883  O O     . PHE E 1 205 ? 10.445  -17.848 135.082 1.00 128.47 ? 205 PHE F O     1 
ATOM   6884  C CB    . PHE E 1 205 ? 13.553  -19.042 135.849 1.00 128.08 ? 205 PHE F CB    1 
ATOM   6885  C CG    . PHE E 1 205 ? 13.405  -18.271 137.132 1.00 125.62 ? 205 PHE F CG    1 
ATOM   6886  C CD1   . PHE E 1 205 ? 14.253  -17.216 137.420 1.00 122.86 ? 205 PHE F CD1   1 
ATOM   6887  C CD2   . PHE E 1 205 ? 12.430  -18.612 138.056 1.00 126.71 ? 205 PHE F CD2   1 
ATOM   6888  C CE1   . PHE E 1 205 ? 14.125  -16.506 138.598 1.00 121.40 ? 205 PHE F CE1   1 
ATOM   6889  C CE2   . PHE E 1 205 ? 12.298  -17.906 139.238 1.00 124.00 ? 205 PHE F CE2   1 
ATOM   6890  C CZ    . PHE E 1 205 ? 13.147  -16.852 139.509 1.00 120.83 ? 205 PHE F CZ    1 
ATOM   6891  N N     . SER E 1 206 ? 10.884  -20.047 134.837 1.00 140.76 ? 206 SER F N     1 
ATOM   6892  C CA    . SER E 1 206 ? 9.488   -20.473 134.879 1.00 146.06 ? 206 SER F CA    1 
ATOM   6893  C C     . SER E 1 206 ? 8.804   -20.112 136.193 1.00 146.88 ? 206 SER F C     1 
ATOM   6894  O O     . SER E 1 206 ? 9.463   -19.762 137.171 1.00 147.21 ? 206 SER F O     1 
ATOM   6895  C CB    . SER E 1 206 ? 9.387   -21.982 134.638 1.00 150.58 ? 206 SER F CB    1 
ATOM   6896  O OG    . SER E 1 206 ? 10.130  -22.707 135.605 1.00 151.28 ? 206 SER F OG    1 
ATOM   6897  N N     . ALA E 1 207 ? 7.479   -20.199 136.208 1.00 148.29 ? 207 ALA F N     1 
ATOM   6898  C CA    . ALA E 1 207 ? 6.719   -19.938 137.423 1.00 148.50 ? 207 ALA F CA    1 
ATOM   6899  C C     . ALA E 1 207 ? 6.851   -21.111 138.388 1.00 149.80 ? 207 ALA F C     1 
ATOM   6900  O O     . ALA E 1 207 ? 6.573   -20.981 139.581 1.00 149.52 ? 207 ALA F O     1 
ATOM   6901  C CB    . ALA E 1 207 ? 5.258   -19.676 137.096 1.00 149.28 ? 207 ALA F CB    1 
ATOM   6902  N N     . ASP E 1 208 ? 7.281   -22.255 137.864 1.00 151.15 ? 208 ASP F N     1 
ATOM   6903  C CA    . ASP E 1 208 ? 7.457   -23.453 138.677 1.00 153.10 ? 208 ASP F CA    1 
ATOM   6904  C C     . ASP E 1 208 ? 8.914   -23.913 138.740 1.00 152.79 ? 208 ASP F C     1 
ATOM   6905  O O     . ASP E 1 208 ? 9.195   -25.114 138.751 1.00 152.99 ? 208 ASP F O     1 
ATOM   6906  C CB    . ASP E 1 208 ? 6.553   -24.587 138.181 1.00 158.60 ? 208 ASP F CB    1 
ATOM   6907  C CG    . ASP E 1 208 ? 6.655   -24.809 136.682 1.00 163.30 ? 208 ASP F CG    1 
ATOM   6908  O OD1   . ASP E 1 208 ? 7.731   -24.546 136.104 1.00 163.69 ? 208 ASP F OD1   1 
ATOM   6909  O OD2   . ASP E 1 208 ? 5.654   -25.252 136.080 1.00 166.11 ? 208 ASP F OD2   1 
ATOM   6910  N N     . SER E 1 209 ? 9.834   -22.952 138.770 1.00 150.50 ? 209 SER F N     1 
ATOM   6911  C CA    . SER E 1 209 ? 11.244  -23.250 138.990 1.00 146.77 ? 209 SER F CA    1 
ATOM   6912  C C     . SER E 1 209 ? 11.487  -23.464 140.479 1.00 142.71 ? 209 SER F C     1 
ATOM   6913  O O     . SER E 1 209 ? 10.946  -22.741 141.316 1.00 139.03 ? 209 SER F O     1 
ATOM   6914  C CB    . SER E 1 209 ? 12.134  -22.131 138.451 1.00 145.36 ? 209 SER F CB    1 
ATOM   6915  O OG    . SER E 1 209 ? 12.292  -22.237 137.045 1.00 147.30 ? 209 SER F OG    1 
ATOM   6916  N N     . ARG E 1 210 ? 12.308  -24.457 140.802 1.00 143.90 ? 210 ARG F N     1 
ATOM   6917  C CA    . ARG E 1 210 ? 12.417  -24.944 142.172 1.00 145.17 ? 210 ARG F CA    1 
ATOM   6918  C C     . ARG E 1 210 ? 13.843  -24.995 142.700 1.00 137.08 ? 210 ARG F C     1 
ATOM   6919  O O     . ARG E 1 210 ? 14.780  -25.300 141.966 1.00 134.94 ? 210 ARG F O     1 
ATOM   6920  C CB    . ARG E 1 210 ? 11.802  -26.344 142.269 1.00 158.17 ? 210 ARG F CB    1 
ATOM   6921  C CG    . ARG E 1 210 ? 12.126  -27.242 141.076 1.00 169.43 ? 210 ARG F CG    1 
ATOM   6922  C CD    . ARG E 1 210 ? 12.918  -28.485 141.474 1.00 173.87 ? 210 ARG F CD    1 
ATOM   6923  N NE    . ARG E 1 210 ? 14.290  -28.183 141.875 1.00 172.83 ? 210 ARG F NE    1 
ATOM   6924  C CZ    . ARG E 1 210 ? 15.355  -28.875 141.478 1.00 171.50 ? 210 ARG F CZ    1 
ATOM   6925  N NH1   . ARG E 1 210 ? 15.211  -29.912 140.663 1.00 172.08 ? 210 ARG F NH1   1 
ATOM   6926  N NH2   . ARG E 1 210 ? 16.566  -28.529 141.894 1.00 170.35 ? 210 ARG F NH2   1 
ATOM   6927  N N     . GLY E 1 211 ? 13.994  -24.696 143.986 1.00 134.38 ? 211 GLY F N     1 
ATOM   6928  C CA    . GLY E 1 211 ? 15.236  -24.961 144.686 1.00 132.60 ? 211 GLY F CA    1 
ATOM   6929  C C     . GLY E 1 211 ? 15.243  -26.427 145.066 1.00 133.25 ? 211 GLY F C     1 
ATOM   6930  O O     . GLY E 1 211 ? 16.029  -27.216 144.544 1.00 138.52 ? 211 GLY F O     1 
ATOM   6931  N N     . PHE E 1 212 ? 14.351  -26.791 145.979 1.00 128.27 ? 212 PHE F N     1 
ATOM   6932  C CA    . PHE E 1 212 ? 14.094  -28.192 146.278 1.00 123.41 ? 212 PHE F CA    1 
ATOM   6933  C C     . PHE E 1 212 ? 12.786  -28.600 145.612 1.00 126.64 ? 212 PHE F C     1 
ATOM   6934  O O     . PHE E 1 212 ? 11.860  -27.795 145.503 1.00 120.37 ? 212 PHE F O     1 
ATOM   6935  C CB    . PHE E 1 212 ? 14.002  -28.420 147.787 1.00 115.06 ? 212 PHE F CB    1 
ATOM   6936  C CG    . PHE E 1 212 ? 15.271  -28.116 148.528 1.00 105.55 ? 212 PHE F CG    1 
ATOM   6937  C CD1   . PHE E 1 212 ? 16.183  -29.119 148.805 1.00 108.52 ? 212 PHE F CD1   1 
ATOM   6938  C CD2   . PHE E 1 212 ? 15.546  -26.830 148.957 1.00 97.31  ? 212 PHE F CD2   1 
ATOM   6939  C CE1   . PHE E 1 212 ? 17.351  -28.844 149.491 1.00 105.69 ? 212 PHE F CE1   1 
ATOM   6940  C CE2   . PHE E 1 212 ? 16.713  -26.549 149.644 1.00 99.03  ? 212 PHE F CE2   1 
ATOM   6941  C CZ    . PHE E 1 212 ? 17.617  -27.557 149.911 1.00 100.82 ? 212 PHE F CZ    1 
ATOM   6942  N N     . ARG E 1 213 ? 12.713  -29.848 145.164 1.00 136.77 ? 213 ARG F N     1 
ATOM   6943  C CA    . ARG E 1 213 ? 11.515  -30.344 144.499 1.00 142.92 ? 213 ARG F CA    1 
ATOM   6944  C C     . ARG E 1 213 ? 10.638  -31.113 145.476 1.00 149.24 ? 213 ARG F C     1 
ATOM   6945  O O     . ARG E 1 213 ? 9.436   -31.270 145.263 1.00 148.18 ? 213 ARG F O     1 
ATOM   6946  C CB    . ARG E 1 213 ? 11.893  -31.242 143.319 1.00 146.92 ? 213 ARG F CB    1 
ATOM   6947  C CG    . ARG E 1 213 ? 10.730  -31.572 142.398 1.00 153.24 ? 213 ARG F CG    1 
ATOM   6948  C CD    . ARG E 1 213 ? 11.176  -32.384 141.195 1.00 157.62 ? 213 ARG F CD    1 
ATOM   6949  N NE    . ARG E 1 213 ? 11.925  -33.577 141.581 1.00 157.18 ? 213 ARG F NE    1 
ATOM   6950  C CZ    . ARG E 1 213 ? 11.368  -34.728 141.943 1.00 154.21 ? 213 ARG F CZ    1 
ATOM   6951  N NH1   . ARG E 1 213 ? 10.047  -34.848 141.976 1.00 153.64 ? 213 ARG F NH1   1 
ATOM   6952  N NH2   . ARG E 1 213 ? 12.133  -35.759 142.276 1.00 151.82 ? 213 ARG F NH2   1 
ATOM   6953  N N     . LEU E 1 214 ? 11.247  -31.581 146.557 1.00 161.14 ? 214 LEU F N     1 
ATOM   6954  C CA    . LEU E 1 214 ? 10.562  -32.449 147.504 1.00 83.23  ? 214 LEU F CA    1 
ATOM   6955  C C     . LEU E 1 214 ? 11.093  -32.224 148.922 1.00 86.13  ? 214 LEU F C     1 
ATOM   6956  O O     . LEU E 1 214 ? 12.301  -32.063 149.116 1.00 101.31 ? 214 LEU F O     1 
ATOM   6957  C CB    . LEU E 1 214 ? 10.738  -33.906 147.071 1.00 93.97  ? 214 LEU F CB    1 
ATOM   6958  C CG    . LEU E 1 214 ? 10.853  -34.995 148.136 1.00 105.10 ? 214 LEU F CG    1 
ATOM   6959  C CD1   . LEU E 1 214 ? 9.493   -35.334 148.745 1.00 110.58 ? 214 LEU F CD1   1 
ATOM   6960  C CD2   . LEU E 1 214 ? 11.509  -36.223 147.528 1.00 103.66 ? 214 LEU F CD2   1 
ATOM   6961  N N     . ARG E 1 215 ? 10.190  -32.215 149.903 1.00 154.53 ? 215 ARG F N     1 
ATOM   6962  C CA    . ARG E 1 215 ? 10.544  -31.871 151.283 1.00 133.32 ? 215 ARG F CA    1 
ATOM   6963  C C     . ARG E 1 215 ? 11.622  -32.765 151.881 1.00 126.15 ? 215 ARG F C     1 
ATOM   6964  O O     . ARG E 1 215 ? 12.487  -32.288 152.611 1.00 127.56 ? 215 ARG F O     1 
ATOM   6965  C CB    . ARG E 1 215 ? 9.312   -31.878 152.193 1.00 128.95 ? 215 ARG F CB    1 
ATOM   6966  C CG    . ARG E 1 215 ? 9.629   -31.642 153.675 1.00 119.89 ? 215 ARG F CG    1 
ATOM   6967  C CD    . ARG E 1 215 ? 8.408   -31.915 154.545 1.00 110.94 ? 215 ARG F CD    1 
ATOM   6968  N NE    . ARG E 1 215 ? 8.711   -31.934 155.975 1.00 106.86 ? 215 ARG F NE    1 
ATOM   6969  C CZ    . ARG E 1 215 ? 8.638   -30.870 156.771 1.00 110.42 ? 215 ARG F CZ    1 
ATOM   6970  N NH1   . ARG E 1 215 ? 8.928   -30.985 158.060 1.00 110.77 ? 215 ARG F NH1   1 
ATOM   6971  N NH2   . ARG E 1 215 ? 8.279   -29.690 156.279 1.00 97.76  ? 215 ARG F NH2   1 
ATOM   6972  N N     . ALA E 1 216 ? 11.578  -34.055 151.569 1.00 125.29 ? 216 ALA F N     1 
ATOM   6973  C CA    . ALA E 1 216 ? 12.537  -35.000 152.138 1.00 124.61 ? 216 ALA F CA    1 
ATOM   6974  C C     . ALA E 1 216 ? 13.995  -34.602 151.881 1.00 119.97 ? 216 ALA F C     1 
ATOM   6975  O O     . ALA E 1 216 ? 14.886  -34.960 152.649 1.00 120.30 ? 216 ALA F O     1 
ATOM   6976  C CB    . ALA E 1 216 ? 12.263  -36.413 151.638 1.00 126.64 ? 216 ALA F CB    1 
ATOM   6977  N N     . ASP E 1 217 ? 14.231  -33.846 150.813 1.00 114.58 ? 217 ASP F N     1 
ATOM   6978  C CA    . ASP E 1 217 ? 15.576  -33.375 150.496 1.00 114.20 ? 217 ASP F CA    1 
ATOM   6979  C C     . ASP E 1 217 ? 15.980  -32.162 151.330 1.00 113.68 ? 217 ASP F C     1 
ATOM   6980  O O     . ASP E 1 217 ? 17.165  -31.932 151.585 1.00 114.78 ? 217 ASP F O     1 
ATOM   6981  C CB    . ASP E 1 217 ? 15.690  -33.067 149.006 1.00 116.84 ? 217 ASP F CB    1 
ATOM   6982  C CG    . ASP E 1 217 ? 15.949  -34.307 148.184 1.00 121.84 ? 217 ASP F CG    1 
ATOM   6983  O OD1   . ASP E 1 217 ? 15.781  -35.421 148.725 1.00 127.18 ? 217 ASP F OD1   1 
ATOM   6984  O OD2   . ASP E 1 217 ? 16.324  -34.169 147.003 1.00 121.49 ? 217 ASP F OD2   1 
ATOM   6985  N N     . VAL E 1 218 ? 14.985  -31.389 151.750 1.00 109.13 ? 218 VAL F N     1 
ATOM   6986  C CA    . VAL E 1 218 ? 15.221  -30.239 152.612 1.00 104.14 ? 218 VAL F CA    1 
ATOM   6987  C C     . VAL E 1 218 ? 15.714  -30.704 153.979 1.00 107.33 ? 218 VAL F C     1 
ATOM   6988  O O     . VAL E 1 218 ? 16.632  -30.120 154.552 1.00 108.96 ? 218 VAL F O     1 
ATOM   6989  C CB    . VAL E 1 218 ? 13.946  -29.397 152.784 1.00 88.93  ? 218 VAL F CB    1 
ATOM   6990  C CG1   . VAL E 1 218 ? 14.192  -28.251 153.745 1.00 88.51  ? 218 VAL F CG1   1 
ATOM   6991  C CG2   . VAL E 1 218 ? 13.476  -28.873 151.439 1.00 105.34 ? 218 VAL F CG2   1 
ATOM   6992  N N     . ASP E 1 219 ? 15.105  -31.768 154.490 1.00 109.26 ? 219 ASP F N     1 
ATOM   6993  C CA    . ASP E 1 219 ? 15.492  -32.322 155.781 1.00 106.94 ? 219 ASP F CA    1 
ATOM   6994  C C     . ASP E 1 219 ? 16.912  -32.870 155.721 1.00 101.17 ? 219 ASP F C     1 
ATOM   6995  O O     . ASP E 1 219 ? 17.653  -32.807 156.701 1.00 100.35 ? 219 ASP F O     1 
ATOM   6996  C CB    . ASP E 1 219 ? 14.516  -33.421 156.205 1.00 111.92 ? 219 ASP F CB    1 
ATOM   6997  C CG    . ASP E 1 219 ? 13.070  -32.965 156.161 1.00 117.93 ? 219 ASP F CG    1 
ATOM   6998  O OD1   . ASP E 1 219 ? 12.801  -31.796 156.511 1.00 118.35 ? 219 ASP F OD1   1 
ATOM   6999  O OD2   . ASP E 1 219 ? 12.204  -33.775 155.770 1.00 121.39 ? 219 ASP F OD2   1 
ATOM   7000  N N     . ALA E 1 220 ? 17.286  -33.400 154.559 1.00 99.21  ? 220 ALA F N     1 
ATOM   7001  C CA    . ALA E 1 220 ? 18.619  -33.958 154.359 1.00 101.47 ? 220 ALA F CA    1 
ATOM   7002  C C     . ALA E 1 220 ? 19.676  -32.860 154.379 1.00 103.88 ? 220 ALA F C     1 
ATOM   7003  O O     . ALA E 1 220 ? 20.773  -33.047 154.907 1.00 102.00 ? 220 ALA F O     1 
ATOM   7004  C CB    . ALA E 1 220 ? 18.678  -34.727 153.052 1.00 99.99  ? 220 ALA F CB    1 
ATOM   7005  N N     . TYR E 1 221 ? 19.332  -31.717 153.794 1.00 106.28 ? 221 TYR F N     1 
ATOM   7006  C CA    . TYR E 1 221 ? 20.207  -30.554 153.776 1.00 101.86 ? 221 TYR F CA    1 
ATOM   7007  C C     . TYR E 1 221 ? 20.456  -30.061 155.198 1.00 97.05  ? 221 TYR F C     1 
ATOM   7008  O O     . TYR E 1 221 ? 21.597  -29.820 155.590 1.00 95.98  ? 221 TYR F O     1 
ATOM   7009  C CB    . TYR E 1 221 ? 19.576  -29.439 152.940 1.00 101.43 ? 221 TYR F CB    1 
ATOM   7010  C CG    . TYR E 1 221 ? 20.551  -28.385 152.465 1.00 101.64 ? 221 TYR F CG    1 
ATOM   7011  C CD1   . TYR E 1 221 ? 21.085  -27.453 153.346 1.00 98.93  ? 221 TYR F CD1   1 
ATOM   7012  C CD2   . TYR E 1 221 ? 20.924  -28.312 151.130 1.00 104.37 ? 221 TYR F CD2   1 
ATOM   7013  C CE1   . TYR E 1 221 ? 21.970  -26.488 152.913 1.00 101.45 ? 221 TYR F CE1   1 
ATOM   7014  C CE2   . TYR E 1 221 ? 21.807  -27.349 150.687 1.00 106.23 ? 221 TYR F CE2   1 
ATOM   7015  C CZ    . TYR E 1 221 ? 22.327  -26.439 151.581 1.00 109.05 ? 221 TYR F CZ    1 
ATOM   7016  O OH    . TYR E 1 221 ? 23.207  -25.480 151.138 1.00 117.51 ? 221 TYR F OH    1 
ATOM   7017  N N     . LEU E 1 222 ? 19.379  -29.908 155.963 1.00 92.67  ? 222 LEU F N     1 
ATOM   7018  C CA    . LEU E 1 222 ? 19.477  -29.445 157.343 1.00 91.54  ? 222 LEU F CA    1 
ATOM   7019  C C     . LEU E 1 222 ? 20.278  -30.405 158.213 1.00 94.42  ? 222 LEU F C     1 
ATOM   7020  O O     . LEU E 1 222 ? 20.948  -29.984 159.154 1.00 96.30  ? 222 LEU F O     1 
ATOM   7021  C CB    . LEU E 1 222 ? 18.084  -29.255 157.944 1.00 88.30  ? 222 LEU F CB    1 
ATOM   7022  C CG    . LEU E 1 222 ? 17.247  -28.120 157.359 1.00 95.81  ? 222 LEU F CG    1 
ATOM   7023  C CD1   . LEU E 1 222 ? 15.797  -28.273 157.772 1.00 97.87  ? 222 LEU F CD1   1 
ATOM   7024  C CD2   . LEU E 1 222 ? 17.794  -26.772 157.805 1.00 94.97  ? 222 LEU F CD2   1 
ATOM   7025  N N     . HIS E 1 223 ? 20.204  -31.694 157.899 1.00 96.82  ? 223 HIS F N     1 
ATOM   7026  C CA    . HIS E 1 223 ? 20.885  -32.704 158.700 1.00 102.41 ? 223 HIS F CA    1 
ATOM   7027  C C     . HIS E 1 223 ? 22.388  -32.641 158.490 1.00 107.60 ? 223 HIS F C     1 
ATOM   7028  O O     . HIS E 1 223 ? 23.160  -32.678 159.448 1.00 112.63 ? 223 HIS F O     1 
ATOM   7029  C CB    . HIS E 1 223 ? 20.379  -34.102 158.356 1.00 110.52 ? 223 HIS F CB    1 
ATOM   7030  C CG    . HIS E 1 223 ? 20.759  -35.141 159.363 1.00 122.35 ? 223 HIS F CG    1 
ATOM   7031  N ND1   . HIS E 1 223 ? 21.937  -35.853 159.295 1.00 122.62 ? 223 HIS F ND1   1 
ATOM   7032  C CD2   . HIS E 1 223 ? 20.114  -35.586 160.468 1.00 128.05 ? 223 HIS F CD2   1 
ATOM   7033  C CE1   . HIS E 1 223 ? 22.001  -36.693 160.312 1.00 125.29 ? 223 HIS F CE1   1 
ATOM   7034  N NE2   . HIS E 1 223 ? 20.906  -36.551 161.039 1.00 129.13 ? 223 HIS F NE2   1 
ATOM   7035  N N     . LEU E 1 224 ? 22.793  -32.554 157.226 1.00 105.64 ? 224 LEU F N     1 
ATOM   7036  C CA    . LEU E 1 224 ? 24.201  -32.432 156.871 1.00 98.62  ? 224 LEU F CA    1 
ATOM   7037  C C     . LEU E 1 224 ? 24.751  -31.121 157.411 1.00 96.74  ? 224 LEU F C     1 
ATOM   7038  O O     . LEU E 1 224 ? 25.916  -31.034 157.798 1.00 99.82  ? 224 LEU F O     1 
ATOM   7039  C CB    . LEU E 1 224 ? 24.375  -32.476 155.351 1.00 96.13  ? 224 LEU F CB    1 
ATOM   7040  C CG    . LEU E 1 224 ? 23.969  -33.751 154.608 1.00 95.82  ? 224 LEU F CG    1 
ATOM   7041  C CD1   . LEU E 1 224 ? 24.272  -33.617 153.123 1.00 90.60  ? 224 LEU F CD1   1 
ATOM   7042  C CD2   . LEU E 1 224 ? 24.664  -34.971 155.191 1.00 98.75  ? 224 LEU F CD2   1 
ATOM   7043  N N     . PHE E 1 225 ? 23.895  -30.105 157.430 1.00 94.35  ? 225 PHE F N     1 
ATOM   7044  C CA    . PHE E 1 225 ? 24.247  -28.789 157.942 1.00 95.99  ? 225 PHE F CA    1 
ATOM   7045  C C     . PHE E 1 225 ? 24.580  -28.858 159.426 1.00 97.81  ? 225 PHE F C     1 
ATOM   7046  O O     . PHE E 1 225 ? 25.550  -28.252 159.885 1.00 101.20 ? 225 PHE F O     1 
ATOM   7047  C CB    . PHE E 1 225 ? 23.085  -27.820 157.719 1.00 99.18  ? 225 PHE F CB    1 
ATOM   7048  C CG    . PHE E 1 225 ? 23.401  -26.394 158.071 1.00 100.32 ? 225 PHE F CG    1 
ATOM   7049  C CD1   . PHE E 1 225 ? 23.154  -25.905 159.345 1.00 103.24 ? 225 PHE F CD1   1 
ATOM   7050  C CD2   . PHE E 1 225 ? 23.936  -25.539 157.123 1.00 98.83  ? 225 PHE F CD2   1 
ATOM   7051  C CE1   . PHE E 1 225 ? 23.443  -24.591 159.667 1.00 103.57 ? 225 PHE F CE1   1 
ATOM   7052  C CE2   . PHE E 1 225 ? 24.227  -24.226 157.439 1.00 100.80 ? 225 PHE F CE2   1 
ATOM   7053  C CZ    . PHE E 1 225 ? 23.980  -23.751 158.712 1.00 104.90 ? 225 PHE F CZ    1 
ATOM   7054  N N     . ASP E 1 226 ? 23.765  -29.595 160.174 1.00 96.48  ? 226 ASP F N     1 
ATOM   7055  C CA    . ASP E 1 226 ? 23.960  -29.721 161.611 1.00 100.48 ? 226 ASP F CA    1 
ATOM   7056  C C     . ASP E 1 226 ? 25.059  -30.721 161.941 1.00 106.46 ? 226 ASP F C     1 
ATOM   7057  O O     . ASP E 1 226 ? 25.693  -30.628 162.989 1.00 113.19 ? 226 ASP F O     1 
ATOM   7058  C CB    . ASP E 1 226 ? 22.660  -30.123 162.305 1.00 108.95 ? 226 ASP F CB    1 
ATOM   7059  C CG    . ASP E 1 226 ? 22.714  -29.906 163.805 1.00 122.47 ? 226 ASP F CG    1 
ATOM   7060  O OD1   . ASP E 1 226 ? 22.309  -28.816 164.262 1.00 126.09 ? 226 ASP F OD1   1 
ATOM   7061  O OD2   . ASP E 1 226 ? 23.171  -30.820 164.526 1.00 127.18 ? 226 ASP F OD2   1 
ATOM   7062  N N     . CYS E 1 227 ? 25.275  -31.684 161.052 1.00 108.33 ? 227 CYS F N     1 
ATOM   7063  C CA    . CYS E 1 227 ? 26.389  -32.608 161.212 1.00 103.65 ? 227 CYS F CA    1 
ATOM   7064  C C     . CYS E 1 227 ? 27.691  -31.827 161.132 1.00 102.06 ? 227 CYS F C     1 
ATOM   7065  O O     . CYS E 1 227 ? 28.607  -32.040 161.923 1.00 108.20 ? 227 CYS F O     1 
ATOM   7066  C CB    . CYS E 1 227 ? 26.357  -33.704 160.146 1.00 95.34  ? 227 CYS F CB    1 
ATOM   7067  S SG    . CYS E 1 227 ? 25.069  -34.947 160.400 1.00 202.23 ? 227 CYS F SG    1 
ATOM   7068  N N     . ARG E 1 228 ? 27.757  -30.910 160.174 1.00 98.17  ? 228 ARG F N     1 
ATOM   7069  C CA    . ARG E 1 228 ? 28.914  -30.041 160.021 1.00 105.77 ? 228 ARG F CA    1 
ATOM   7070  C C     . ARG E 1 228 ? 29.033  -29.097 161.216 1.00 114.91 ? 228 ARG F C     1 
ATOM   7071  O O     . ARG E 1 228 ? 30.136  -28.784 161.671 1.00 116.46 ? 228 ARG F O     1 
ATOM   7072  C CB    . ARG E 1 228 ? 28.796  -29.250 158.718 1.00 104.92 ? 228 ARG F CB    1 
ATOM   7073  C CG    . ARG E 1 228 ? 29.708  -28.049 158.617 1.00 106.54 ? 228 ARG F CG    1 
ATOM   7074  C CD    . ARG E 1 228 ? 31.169  -28.443 158.615 1.00 117.69 ? 228 ARG F CD    1 
ATOM   7075  N NE    . ARG E 1 228 ? 31.998  -27.302 158.248 1.00 130.31 ? 228 ARG F NE    1 
ATOM   7076  C CZ    . ARG E 1 228 ? 33.325  -27.290 158.290 1.00 138.79 ? 228 ARG F CZ    1 
ATOM   7077  N NH1   . ARG E 1 228 ? 33.991  -28.364 158.694 1.00 140.09 ? 228 ARG F NH1   1 
ATOM   7078  N NH2   . ARG E 1 228 ? 33.984  -26.198 157.932 1.00 142.32 ? 228 ARG F NH2   1 
ATOM   7079  N N     . GLN E 1 229 ? 27.883  -28.663 161.723 1.00 118.69 ? 229 GLN F N     1 
ATOM   7080  C CA    . GLN E 1 229 ? 27.815  -27.737 162.848 1.00 117.28 ? 229 GLN F CA    1 
ATOM   7081  C C     . GLN E 1 229 ? 28.432  -28.339 164.107 1.00 114.18 ? 229 GLN F C     1 
ATOM   7082  O O     . GLN E 1 229 ? 29.285  -27.725 164.746 1.00 111.70 ? 229 GLN F O     1 
ATOM   7083  C CB    . GLN E 1 229 ? 26.359  -27.354 163.120 1.00 121.93 ? 229 GLN F CB    1 
ATOM   7084  C CG    . GLN E 1 229 ? 26.182  -26.046 163.868 1.00 127.51 ? 229 GLN F CG    1 
ATOM   7085  C CD    . GLN E 1 229 ? 26.296  -24.842 162.955 1.00 130.43 ? 229 GLN F CD    1 
ATOM   7086  O OE1   . GLN E 1 229 ? 25.904  -24.895 161.789 1.00 126.73 ? 229 GLN F OE1   1 
ATOM   7087  N NE2   . GLN E 1 229 ? 26.837  -23.749 163.481 1.00 134.64 ? 229 GLN F NE2   1 
ATOM   7088  N N     . ARG E 1 230 ? 27.993  -29.543 164.460 1.00 116.28 ? 230 ARG F N     1 
ATOM   7089  C CA    . ARG E 1 230 ? 28.505  -30.228 165.640 1.00 123.29 ? 230 ARG F CA    1 
ATOM   7090  C C     . ARG E 1 230 ? 29.975  -30.605 165.473 1.00 124.91 ? 230 ARG F C     1 
ATOM   7091  O O     . ARG E 1 230 ? 30.705  -30.733 166.455 1.00 126.81 ? 230 ARG F O     1 
ATOM   7092  C CB    . ARG E 1 230 ? 27.663  -31.470 165.948 1.00 130.26 ? 230 ARG F CB    1 
ATOM   7093  C CG    . ARG E 1 230 ? 26.194  -31.169 166.208 1.00 136.12 ? 230 ARG F CG    1 
ATOM   7094  C CD    . ARG E 1 230 ? 25.380  -32.443 166.364 1.00 143.37 ? 230 ARG F CD    1 
ATOM   7095  N NE    . ARG E 1 230 ? 23.950  -32.169 166.479 1.00 150.75 ? 230 ARG F NE    1 
ATOM   7096  C CZ    . ARG E 1 230 ? 23.282  -32.138 167.629 1.00 155.81 ? 230 ARG F CZ    1 
ATOM   7097  N NH1   . ARG E 1 230 ? 23.913  -32.370 168.772 1.00 158.46 ? 230 ARG F NH1   1 
ATOM   7098  N NH2   . ARG E 1 230 ? 21.981  -31.878 167.634 1.00 156.17 ? 230 ARG F NH2   1 
ATOM   7099  N N     . PHE E 1 231 ? 30.406  -30.777 164.225 1.00 124.80 ? 231 PHE F N     1 
ATOM   7100  C CA    . PHE E 1 231 ? 31.801  -31.098 163.935 1.00 124.67 ? 231 PHE F CA    1 
ATOM   7101  C C     . PHE E 1 231 ? 32.712  -29.926 164.261 1.00 126.29 ? 231 PHE F C     1 
ATOM   7102  O O     . PHE E 1 231 ? 33.804  -30.106 164.798 1.00 131.24 ? 231 PHE F O     1 
ATOM   7103  C CB    . PHE E 1 231 ? 31.979  -31.505 162.470 1.00 123.63 ? 231 PHE F CB    1 
ATOM   7104  C CG    . PHE E 1 231 ? 33.415  -31.715 162.068 1.00 122.47 ? 231 PHE F CG    1 
ATOM   7105  C CD1   . PHE E 1 231 ? 34.090  -32.871 162.430 1.00 119.82 ? 231 PHE F CD1   1 
ATOM   7106  C CD2   . PHE E 1 231 ? 34.090  -30.757 161.328 1.00 121.67 ? 231 PHE F CD2   1 
ATOM   7107  C CE1   . PHE E 1 231 ? 35.410  -33.066 162.061 1.00 116.29 ? 231 PHE F CE1   1 
ATOM   7108  C CE2   . PHE E 1 231 ? 35.409  -30.946 160.957 1.00 118.42 ? 231 PHE F CE2   1 
ATOM   7109  C CZ    . PHE E 1 231 ? 36.070  -32.102 161.324 1.00 116.22 ? 231 PHE F CZ    1 
ATOM   7110  N N     . ASP E 1 232 ? 32.256  -28.723 163.930 1.00 123.29 ? 232 ASP F N     1 
ATOM   7111  C CA    . ASP E 1 232 ? 32.994  -27.511 164.256 1.00 123.97 ? 232 ASP F CA    1 
ATOM   7112  C C     . ASP E 1 232 ? 32.902  -27.206 165.750 1.00 128.30 ? 232 ASP F C     1 
ATOM   7113  O O     . ASP E 1 232 ? 33.604  -26.335 166.259 1.00 129.88 ? 232 ASP F O     1 
ATOM   7114  C CB    . ASP E 1 232 ? 32.472  -26.326 163.439 1.00 124.02 ? 232 ASP F CB    1 
ATOM   7115  C CG    . ASP E 1 232 ? 32.701  -26.497 161.947 1.00 125.69 ? 232 ASP F CG    1 
ATOM   7116  O OD1   . ASP E 1 232 ? 33.045  -27.619 161.518 1.00 127.84 ? 232 ASP F OD1   1 
ATOM   7117  O OD2   . ASP E 1 232 ? 32.528  -25.509 161.201 1.00 124.14 ? 232 ASP F OD2   1 
ATOM   7118  N N     . LEU E 1 233 ? 32.033  -27.930 166.449 1.00 133.92 ? 233 LEU F N     1 
ATOM   7119  C CA    . LEU E 1 233 ? 31.868  -27.747 167.888 1.00 137.77 ? 233 LEU F CA    1 
ATOM   7120  C C     . LEU E 1 233 ? 32.664  -28.786 168.679 1.00 140.12 ? 233 LEU F C     1 
ATOM   7121  O O     . LEU E 1 233 ? 32.472  -28.944 169.885 1.00 142.25 ? 233 LEU F O     1 
ATOM   7122  C CB    . LEU E 1 233 ? 30.386  -27.787 168.274 1.00 136.95 ? 233 LEU F CB    1 
ATOM   7123  C CG    . LEU E 1 233 ? 29.642  -26.447 168.363 1.00 130.64 ? 233 LEU F CG    1 
ATOM   7124  C CD1   . LEU E 1 233 ? 29.813  -25.611 167.099 1.00 126.51 ? 233 LEU F CD1   1 
ATOM   7125  C CD2   . LEU E 1 233 ? 28.166  -26.679 168.654 1.00 127.28 ? 233 LEU F CD2   1 
ATOM   7126  N N     . GLY E 1 234 ? 33.555  -29.491 167.988 1.00 139.77 ? 234 GLY F N     1 
ATOM   7127  C CA    . GLY E 1 234 ? 34.457  -30.430 168.630 1.00 141.37 ? 234 GLY F CA    1 
ATOM   7128  C C     . GLY E 1 234 ? 33.795  -31.691 169.151 1.00 144.75 ? 234 GLY F C     1 
ATOM   7129  O O     . GLY E 1 234 ? 34.338  -32.371 170.022 1.00 147.65 ? 234 GLY F O     1 
ATOM   7130  N N     . GLU E 1 235 ? 32.618  -32.005 168.622 1.00 146.01 ? 235 GLU F N     1 
ATOM   7131  C CA    . GLU E 1 235 ? 31.916  -33.223 169.005 1.00 150.87 ? 235 GLU F CA    1 
ATOM   7132  C C     . GLU E 1 235 ? 32.638  -34.436 168.426 1.00 155.63 ? 235 GLU F C     1 
ATOM   7133  O O     . GLU E 1 235 ? 33.037  -34.420 167.261 1.00 157.62 ? 235 GLU F O     1 
ATOM   7134  C CB    . GLU E 1 235 ? 30.462  -33.174 168.525 1.00 149.33 ? 235 GLU F CB    1 
ATOM   7135  C CG    . GLU E 1 235 ? 29.648  -34.418 168.837 1.00 149.82 ? 235 GLU F CG    1 
ATOM   7136  C CD    . GLU E 1 235 ? 28.175  -34.244 168.527 1.00 148.57 ? 235 GLU F CD    1 
ATOM   7137  O OE1   . GLU E 1 235 ? 27.651  -33.128 168.730 1.00 145.43 ? 235 GLU F OE1   1 
ATOM   7138  O OE2   . GLU E 1 235 ? 27.542  -35.223 168.078 1.00 149.64 ? 235 GLU F OE2   1 
ATOM   7139  N N     . PRO E 1 236 ? 32.825  -35.485 169.246 1.00 157.51 ? 236 PRO F N     1 
ATOM   7140  C CA    . PRO E 1 236 ? 33.515  -36.717 168.840 1.00 157.91 ? 236 PRO F CA    1 
ATOM   7141  C C     . PRO E 1 236 ? 32.991  -37.301 167.529 1.00 157.23 ? 236 PRO F C     1 
ATOM   7142  O O     . PRO E 1 236 ? 31.785  -37.503 167.381 1.00 156.57 ? 236 PRO F O     1 
ATOM   7143  C CB    . PRO E 1 236 ? 33.237  -37.680 170.006 1.00 159.61 ? 236 PRO F CB    1 
ATOM   7144  C CG    . PRO E 1 236 ? 32.168  -37.017 170.838 1.00 160.67 ? 236 PRO F CG    1 
ATOM   7145  C CD    . PRO E 1 236 ? 32.382  -35.556 170.648 1.00 159.86 ? 236 PRO F CD    1 
ATOM   7146  N N     . LEU E 1 237 ? 33.901  -37.562 166.594 1.00 156.61 ? 237 LEU F N     1 
ATOM   7147  C CA    . LEU E 1 237 ? 33.547  -38.085 165.276 1.00 153.46 ? 237 LEU F CA    1 
ATOM   7148  C C     . LEU E 1 237 ? 32.820  -39.421 165.342 1.00 150.30 ? 237 LEU F C     1 
ATOM   7149  O O     . LEU E 1 237 ? 31.967  -39.709 164.502 1.00 147.96 ? 237 LEU F O     1 
ATOM   7150  C CB    . LEU E 1 237 ? 34.796  -38.245 164.406 1.00 153.78 ? 237 LEU F CB    1 
ATOM   7151  C CG    . LEU E 1 237 ? 34.958  -37.279 163.230 1.00 152.83 ? 237 LEU F CG    1 
ATOM   7152  C CD1   . LEU E 1 237 ? 35.871  -37.879 162.170 1.00 150.13 ? 237 LEU F CD1   1 
ATOM   7153  C CD2   . LEU E 1 237 ? 33.606  -36.904 162.635 1.00 152.53 ? 237 LEU F CD2   1 
ATOM   7154  N N     . GLU E 1 238 ? 33.176  -40.232 166.334 1.00 151.14 ? 238 GLU F N     1 
ATOM   7155  C CA    . GLU E 1 238 ? 32.624  -41.574 166.487 1.00 153.64 ? 238 GLU F CA    1 
ATOM   7156  C C     . GLU E 1 238 ? 31.099  -41.556 166.509 1.00 152.04 ? 238 GLU F C     1 
ATOM   7157  O O     . GLU E 1 238 ? 30.447  -42.351 165.829 1.00 152.79 ? 238 GLU F O     1 
ATOM   7158  C CB    . GLU E 1 238 ? 33.158  -42.213 167.768 1.00 159.02 ? 238 GLU F CB    1 
ATOM   7159  C CG    . GLU E 1 238 ? 32.600  -43.591 168.063 1.00 163.29 ? 238 GLU F CG    1 
ATOM   7160  C CD    . GLU E 1 238 ? 32.911  -44.040 169.476 1.00 166.70 ? 238 GLU F CD    1 
ATOM   7161  O OE1   . GLU E 1 238 ? 33.248  -43.172 170.310 1.00 168.43 ? 238 GLU F OE1   1 
ATOM   7162  O OE2   . GLU E 1 238 ? 32.822  -45.254 169.752 1.00 166.78 ? 238 GLU F OE2   1 
ATOM   7163  N N     . GLU E 1 239 ? 30.543  -40.636 167.290 1.00 148.64 ? 239 GLU F N     1 
ATOM   7164  C CA    . GLU E 1 239 ? 29.101  -40.447 167.365 1.00 147.34 ? 239 GLU F CA    1 
ATOM   7165  C C     . GLU E 1 239 ? 28.606  -39.778 166.093 1.00 136.92 ? 239 GLU F C     1 
ATOM   7166  O O     . GLU E 1 239 ? 27.588  -40.171 165.516 1.00 132.16 ? 239 GLU F O     1 
ATOM   7167  C CB    . GLU E 1 239 ? 28.759  -39.552 168.554 1.00 153.73 ? 239 GLU F CB    1 
ATOM   7168  C CG    . GLU E 1 239 ? 29.335  -40.017 169.877 1.00 157.63 ? 239 GLU F CG    1 
ATOM   7169  C CD    . GLU E 1 239 ? 29.220  -38.960 170.957 1.00 158.80 ? 239 GLU F CD    1 
ATOM   7170  O OE1   . GLU E 1 239 ? 28.938  -37.791 170.617 1.00 158.24 ? 239 GLU F OE1   1 
ATOM   7171  O OE2   . GLU E 1 239 ? 29.411  -39.297 172.145 1.00 159.38 ? 239 GLU F OE2   1 
ATOM   7172  N N     . LEU E 1 240 ? 29.350  -38.759 165.675 1.00 131.88 ? 240 LEU F N     1 
ATOM   7173  C CA    . LEU E 1 240 ? 29.014  -37.940 164.518 1.00 126.93 ? 240 LEU F CA    1 
ATOM   7174  C C     . LEU E 1 240 ? 28.829  -38.769 163.248 1.00 129.29 ? 240 LEU F C     1 
ATOM   7175  O O     . LEU E 1 240 ? 27.909  -38.520 162.467 1.00 127.21 ? 240 LEU F O     1 
ATOM   7176  C CB    . LEU E 1 240 ? 30.107  -36.893 164.305 1.00 121.68 ? 240 LEU F CB    1 
ATOM   7177  C CG    . LEU E 1 240 ? 29.673  -35.464 163.990 1.00 120.18 ? 240 LEU F CG    1 
ATOM   7178  C CD1   . LEU E 1 240 ? 28.568  -35.020 164.931 1.00 123.88 ? 240 LEU F CD1   1 
ATOM   7179  C CD2   . LEU E 1 240 ? 30.870  -34.545 164.111 1.00 118.52 ? 240 LEU F CD2   1 
ATOM   7180  N N     . LEU E 1 241 ? 29.704  -39.751 163.049 1.00 131.60 ? 241 LEU F N     1 
ATOM   7181  C CA    . LEU E 1 241 ? 29.640  -40.607 161.866 1.00 129.14 ? 241 LEU F CA    1 
ATOM   7182  C C     . LEU E 1 241 ? 28.356  -41.426 161.809 1.00 131.70 ? 241 LEU F C     1 
ATOM   7183  O O     . LEU E 1 241 ? 27.804  -41.653 160.732 1.00 130.10 ? 241 LEU F O     1 
ATOM   7184  C CB    . LEU E 1 241 ? 30.852  -41.538 161.796 1.00 125.52 ? 241 LEU F CB    1 
ATOM   7185  C CG    . LEU E 1 241 ? 32.130  -40.959 161.187 1.00 121.49 ? 241 LEU F CG    1 
ATOM   7186  C CD1   . LEU E 1 241 ? 33.177  -42.047 160.994 1.00 119.10 ? 241 LEU F CD1   1 
ATOM   7187  C CD2   . LEU E 1 241 ? 31.823  -40.270 159.868 1.00 120.77 ? 241 LEU F CD2   1 
ATOM   7188  N N     . ALA E 1 242 ? 27.883  -41.867 162.971 1.00 135.74 ? 242 ALA F N     1 
ATOM   7189  C CA    . ALA E 1 242 ? 26.655  -42.652 163.047 1.00 139.42 ? 242 ALA F CA    1 
ATOM   7190  C C     . ALA E 1 242 ? 25.443  -41.831 162.611 1.00 138.04 ? 242 ALA F C     1 
ATOM   7191  O O     . ALA E 1 242 ? 24.388  -42.383 162.295 1.00 135.61 ? 242 ALA F O     1 
ATOM   7192  C CB    . ALA E 1 242 ? 26.458  -43.200 164.454 1.00 142.91 ? 242 ALA F CB    1 
ATOM   7193  N N     . GLY E 1 243 ? 25.604  -40.510 162.597 1.00 137.14 ? 243 GLY F N     1 
ATOM   7194  C CA    . GLY E 1 243 ? 24.565  -39.611 162.131 1.00 136.62 ? 243 GLY F CA    1 
ATOM   7195  C C     . GLY E 1 243 ? 24.456  -39.601 160.617 1.00 135.97 ? 243 GLY F C     1 
ATOM   7196  O O     . GLY E 1 243 ? 23.357  -39.525 160.067 1.00 136.79 ? 243 GLY F O     1 
ATOM   7197  N N     . LEU E 1 244 ? 25.600  -39.678 159.944 1.00 133.64 ? 244 LEU F N     1 
ATOM   7198  C CA    . LEU E 1 244 ? 25.636  -39.733 158.485 1.00 128.67 ? 244 LEU F CA    1 
ATOM   7199  C C     . LEU E 1 244 ? 25.009  -41.014 157.946 1.00 127.56 ? 244 LEU F C     1 
ATOM   7200  O O     . LEU E 1 244 ? 25.142  -42.076 158.553 1.00 125.53 ? 244 LEU F O     1 
ATOM   7201  C CB    . LEU E 1 244 ? 27.075  -39.611 157.982 1.00 127.90 ? 244 LEU F CB    1 
ATOM   7202  C CG    . LEU E 1 244 ? 27.651  -38.198 157.975 1.00 126.92 ? 244 LEU F CG    1 
ATOM   7203  C CD1   . LEU E 1 244 ? 29.027  -38.190 157.328 1.00 126.38 ? 244 LEU F CD1   1 
ATOM   7204  C CD2   . LEU E 1 244 ? 26.702  -37.258 157.251 1.00 124.60 ? 244 LEU F CD2   1 
ATOM   7205  N N     . PRO E 1 245 ? 24.322  -40.915 156.795 1.00 130.07 ? 245 PRO F N     1 
ATOM   7206  C CA    . PRO E 1 245 ? 23.678  -42.062 156.143 1.00 133.18 ? 245 PRO F CA    1 
ATOM   7207  C C     . PRO E 1 245 ? 24.688  -43.063 155.592 1.00 133.80 ? 245 PRO F C     1 
ATOM   7208  O O     . PRO E 1 245 ? 25.788  -42.678 155.194 1.00 132.51 ? 245 PRO F O     1 
ATOM   7209  C CB    . PRO E 1 245 ? 22.910  -41.421 154.979 1.00 130.39 ? 245 PRO F CB    1 
ATOM   7210  C CG    . PRO E 1 245 ? 22.812  -39.974 155.317 1.00 128.68 ? 245 PRO F CG    1 
ATOM   7211  C CD    . PRO E 1 245 ? 24.055  -39.658 156.077 1.00 127.63 ? 245 PRO F CD    1 
ATOM   7212  N N     . GLY E 1 246 ? 24.307  -44.336 155.562 1.00 134.19 ? 246 GLY F N     1 
ATOM   7213  C CA    . GLY E 1 246 ? 25.163  -45.370 155.013 1.00 135.56 ? 246 GLY F CA    1 
ATOM   7214  C C     . GLY E 1 246 ? 25.222  -45.301 153.500 1.00 133.39 ? 246 GLY F C     1 
ATOM   7215  O O     . GLY E 1 246 ? 26.270  -45.017 152.921 1.00 128.87 ? 246 GLY F O     1 
ATOM   7216  N N     . GLU E 1 247 ? 24.087  -45.561 152.859 1.00 135.05 ? 247 GLU F N     1 
ATOM   7217  C CA    . GLU E 1 247 ? 23.996  -45.488 151.406 1.00 133.59 ? 247 GLU F CA    1 
ATOM   7218  C C     . GLU E 1 247 ? 23.958  -44.034 150.943 1.00 124.83 ? 247 GLU F C     1 
ATOM   7219  O O     . GLU E 1 247 ? 23.445  -43.167 151.651 1.00 124.85 ? 247 GLU F O     1 
ATOM   7220  C CB    . GLU E 1 247 ? 22.762  -46.245 150.897 1.00 142.26 ? 247 GLU F CB    1 
ATOM   7221  C CG    . GLU E 1 247 ? 21.427  -45.578 151.205 1.00 148.87 ? 247 GLU F CG    1 
ATOM   7222  C CD    . GLU E 1 247 ? 21.022  -45.714 152.659 1.00 152.11 ? 247 GLU F CD    1 
ATOM   7223  O OE1   . GLU E 1 247 ? 21.494  -46.660 153.323 1.00 153.84 ? 247 GLU F OE1   1 
ATOM   7224  O OE2   . GLU E 1 247 ? 20.234  -44.872 153.138 1.00 151.97 ? 247 GLU F OE2   1 
ATOM   7225  N N     . PRO E 1 248 ? 24.517  -43.763 149.752 1.00 117.48 ? 248 PRO F N     1 
ATOM   7226  C CA    . PRO E 1 248 ? 24.543  -42.416 149.173 1.00 114.82 ? 248 PRO F CA    1 
ATOM   7227  C C     . PRO E 1 248 ? 23.154  -41.820 148.982 1.00 116.71 ? 248 PRO F C     1 
ATOM   7228  O O     . PRO E 1 248 ? 22.174  -42.554 148.845 1.00 119.72 ? 248 PRO F O     1 
ATOM   7229  C CB    . PRO E 1 248 ? 25.189  -42.642 147.803 1.00 111.81 ? 248 PRO F CB    1 
ATOM   7230  C CG    . PRO E 1 248 ? 26.015  -43.855 147.972 1.00 112.83 ? 248 PRO F CG    1 
ATOM   7231  C CD    . PRO E 1 248 ? 25.247  -44.731 148.915 1.00 115.75 ? 248 PRO F CD    1 
ATOM   7232  N N     . TYR E 1 249 ? 23.083  -40.494 148.974 1.00 115.98 ? 249 TYR F N     1 
ATOM   7233  C CA    . TYR E 1 249 ? 21.841  -39.795 148.677 1.00 116.93 ? 249 TYR F CA    1 
ATOM   7234  C C     . TYR E 1 249 ? 21.490  -39.953 147.199 1.00 119.33 ? 249 TYR F C     1 
ATOM   7235  O O     . TYR E 1 249 ? 22.374  -39.989 146.341 1.00 117.78 ? 249 TYR F O     1 
ATOM   7236  C CB    . TYR E 1 249 ? 21.956  -38.308 149.030 1.00 109.56 ? 249 TYR F CB    1 
ATOM   7237  C CG    . TYR E 1 249 ? 21.878  -37.991 150.512 1.00 105.62 ? 249 TYR F CG    1 
ATOM   7238  C CD1   . TYR E 1 249 ? 20.655  -37.953 151.171 1.00 104.16 ? 249 TYR F CD1   1 
ATOM   7239  C CD2   . TYR E 1 249 ? 23.024  -37.704 151.246 1.00 107.22 ? 249 TYR F CD2   1 
ATOM   7240  C CE1   . TYR E 1 249 ? 20.576  -37.655 152.520 1.00 105.72 ? 249 TYR F CE1   1 
ATOM   7241  C CE2   . TYR E 1 249 ? 22.953  -37.403 152.599 1.00 105.32 ? 249 TYR F CE2   1 
ATOM   7242  C CZ    . TYR E 1 249 ? 21.726  -37.379 153.228 1.00 106.41 ? 249 TYR F CZ    1 
ATOM   7243  O OH    . TYR E 1 249 ? 21.646  -37.081 154.569 1.00 110.41 ? 249 TYR F OH    1 
ATOM   7244  N N     . ALA E 1 250 ? 20.196  -40.049 146.912 1.00 119.22 ? 250 ALA F N     1 
ATOM   7245  C CA    . ALA E 1 250 ? 19.715  -40.146 145.540 1.00 116.59 ? 250 ALA F CA    1 
ATOM   7246  C C     . ALA E 1 250 ? 19.870  -38.813 144.819 1.00 116.38 ? 250 ALA F C     1 
ATOM   7247  O O     . ALA E 1 250 ? 19.976  -38.763 143.595 1.00 115.20 ? 250 ALA F O     1 
ATOM   7248  C CB    . ALA E 1 250 ? 18.262  -40.586 145.522 1.00 115.21 ? 250 ALA F CB    1 
ATOM   7249  N N     . ASN E 1 251 ? 19.879  -37.731 145.587 1.00 119.63 ? 251 ASN F N     1 
ATOM   7250  C CA    . ASN E 1 251 ? 19.955  -36.398 145.008 1.00 124.99 ? 251 ASN F CA    1 
ATOM   7251  C C     . ASN E 1 251 ? 21.397  -35.940 144.800 1.00 132.59 ? 251 ASN F C     1 
ATOM   7252  O O     . ASN E 1 251 ? 22.221  -36.034 145.711 1.00 136.73 ? 251 ASN F O     1 
ATOM   7253  C CB    . ASN E 1 251 ? 19.183  -35.395 145.866 1.00 126.20 ? 251 ASN F CB    1 
ATOM   7254  C CG    . ASN E 1 251 ? 19.164  -34.009 145.260 1.00 125.90 ? 251 ASN F CG    1 
ATOM   7255  O OD1   . ASN E 1 251 ? 18.282  -33.675 144.469 1.00 132.81 ? 251 ASN F OD1   1 
ATOM   7256  N ND2   . ASN E 1 251 ? 20.143  -33.192 145.627 1.00 119.28 ? 251 ASN F ND2   1 
ATOM   7257  N N     . PRO E 1 252 ? 21.700  -35.452 143.585 1.00 134.39 ? 252 PRO F N     1 
ATOM   7258  C CA    . PRO E 1 252 ? 23.030  -34.991 143.165 1.00 129.12 ? 252 PRO F CA    1 
ATOM   7259  C C     . PRO E 1 252 ? 23.689  -34.011 144.137 1.00 123.08 ? 252 PRO F C     1 
ATOM   7260  O O     . PRO E 1 252 ? 24.786  -34.308 144.616 1.00 119.23 ? 252 PRO F O     1 
ATOM   7261  C CB    . PRO E 1 252 ? 22.749  -34.304 141.829 1.00 132.38 ? 252 PRO F CB    1 
ATOM   7262  C CG    . PRO E 1 252 ? 21.570  -35.033 141.287 1.00 135.58 ? 252 PRO F CG    1 
ATOM   7263  C CD    . PRO E 1 252 ? 20.728  -35.406 142.477 1.00 136.22 ? 252 PRO F CD    1 
ATOM   7264  N N     . TRP E 1 253 ? 23.041  -32.876 144.408 1.00 127.74 ? 253 TRP F N     1 
ATOM   7265  C CA    . TRP E 1 253 ? 23.573  -31.871 145.332 1.00 135.39 ? 253 TRP F CA    1 
ATOM   7266  C C     . TRP E 1 253 ? 23.907  -32.520 146.665 1.00 132.14 ? 253 TRP F C     1 
ATOM   7267  O O     . TRP E 1 253 ? 25.023  -32.406 147.172 1.00 133.59 ? 253 TRP F O     1 
ATOM   7268  C CB    . TRP E 1 253 ? 22.551  -30.759 145.611 1.00 146.98 ? 253 TRP F CB    1 
ATOM   7269  C CG    . TRP E 1 253 ? 22.094  -29.952 144.428 1.00 159.16 ? 253 TRP F CG    1 
ATOM   7270  C CD1   . TRP E 1 253 ? 22.600  -29.982 143.161 1.00 163.00 ? 253 TRP F CD1   1 
ATOM   7271  C CD2   . TRP E 1 253 ? 21.026  -28.990 144.410 1.00 165.88 ? 253 TRP F CD2   1 
ATOM   7272  N NE1   . TRP E 1 253 ? 21.915  -29.101 142.356 1.00 165.41 ? 253 TRP F NE1   1 
ATOM   7273  C CE2   . TRP E 1 253 ? 20.945  -28.480 143.098 1.00 167.57 ? 253 TRP F CE2   1 
ATOM   7274  C CE3   . TRP E 1 253 ? 20.132  -28.513 145.376 1.00 166.41 ? 253 TRP F CE3   1 
ATOM   7275  C CZ2   . TRP E 1 253 ? 20.005  -27.517 142.727 1.00 167.38 ? 253 TRP F CZ2   1 
ATOM   7276  C CZ3   . TRP E 1 253 ? 19.200  -27.556 145.005 1.00 165.80 ? 253 TRP F CZ3   1 
ATOM   7277  C CH2   . TRP E 1 253 ? 19.144  -27.070 143.692 1.00 166.37 ? 253 TRP F CH2   1 
ATOM   7278  N N     . LEU E 1 254 ? 22.914  -33.205 147.221 1.00 126.98 ? 254 LEU F N     1 
ATOM   7279  C CA    . LEU E 1 254 ? 23.002  -33.764 148.563 1.00 119.57 ? 254 LEU F CA    1 
ATOM   7280  C C     . LEU E 1 254 ? 24.096  -34.811 148.701 1.00 118.85 ? 254 LEU F C     1 
ATOM   7281  O O     . LEU E 1 254 ? 24.712  -34.935 149.760 1.00 118.91 ? 254 LEU F O     1 
ATOM   7282  C CB    . LEU E 1 254 ? 21.654  -34.351 148.979 1.00 111.59 ? 254 LEU F CB    1 
ATOM   7283  C CG    . LEU E 1 254 ? 20.607  -33.326 149.412 1.00 105.02 ? 254 LEU F CG    1 
ATOM   7284  C CD1   . LEU E 1 254 ? 19.235  -33.965 149.454 1.00 107.06 ? 254 LEU F CD1   1 
ATOM   7285  C CD2   . LEU E 1 254 ? 20.971  -32.742 150.773 1.00 104.71 ? 254 LEU F CD2   1 
ATOM   7286  N N     . GLU E 1 255 ? 24.340  -35.564 147.635 1.00 117.68 ? 255 GLU F N     1 
ATOM   7287  C CA    . GLU E 1 255 ? 25.375  -36.586 147.676 1.00 116.41 ? 255 GLU F CA    1 
ATOM   7288  C C     . GLU E 1 255 ? 26.762  -35.961 147.733 1.00 114.24 ? 255 GLU F C     1 
ATOM   7289  O O     . GLU E 1 255 ? 27.604  -36.381 148.524 1.00 116.95 ? 255 GLU F O     1 
ATOM   7290  C CB    . GLU E 1 255 ? 25.260  -37.544 146.490 1.00 118.88 ? 255 GLU F CB    1 
ATOM   7291  C CG    . GLU E 1 255 ? 26.447  -38.490 146.335 1.00 121.66 ? 255 GLU F CG    1 
ATOM   7292  C CD    . GLU E 1 255 ? 26.580  -39.492 147.473 1.00 120.13 ? 255 GLU F CD    1 
ATOM   7293  O OE1   . GLU E 1 255 ? 25.685  -39.552 148.342 1.00 119.97 ? 255 GLU F OE1   1 
ATOM   7294  O OE2   . GLU E 1 255 ? 27.588  -40.230 147.493 1.00 118.46 ? 255 GLU F OE2   1 
ATOM   7295  N N     . GLY E 1 256 ? 26.987  -34.948 146.902 1.00 109.37 ? 256 GLY F N     1 
ATOM   7296  C CA    . GLY E 1 256 ? 28.241  -34.220 146.911 1.00 107.15 ? 256 GLY F CA    1 
ATOM   7297  C C     . GLY E 1 256 ? 28.533  -33.574 148.252 1.00 105.56 ? 256 GLY F C     1 
ATOM   7298  O O     . GLY E 1 256 ? 29.692  -33.440 148.640 1.00 104.00 ? 256 GLY F O     1 
ATOM   7299  N N     . ARG E 1 257 ? 27.483  -33.176 148.964 1.00 104.68 ? 257 ARG F N     1 
ATOM   7300  C CA    . ARG E 1 257 ? 27.648  -32.556 150.274 1.00 107.18 ? 257 ARG F CA    1 
ATOM   7301  C C     . ARG E 1 257 ? 27.945  -33.601 151.344 1.00 102.28 ? 257 ARG F C     1 
ATOM   7302  O O     . ARG E 1 257 ? 28.795  -33.391 152.210 1.00 99.45  ? 257 ARG F O     1 
ATOM   7303  C CB    . ARG E 1 257 ? 26.406  -31.744 150.649 1.00 116.24 ? 257 ARG F CB    1 
ATOM   7304  C CG    . ARG E 1 257 ? 26.101  -30.611 149.681 1.00 122.54 ? 257 ARG F CG    1 
ATOM   7305  C CD    . ARG E 1 257 ? 24.950  -29.750 150.173 1.00 128.10 ? 257 ARG F CD    1 
ATOM   7306  N NE    . ARG E 1 257 ? 25.256  -29.086 151.437 1.00 134.02 ? 257 ARG F NE    1 
ATOM   7307  C CZ    . ARG E 1 257 ? 25.834  -27.892 151.535 1.00 137.92 ? 257 ARG F CZ    1 
ATOM   7308  N NH1   . ARG E 1 257 ? 26.176  -27.227 150.439 1.00 137.75 ? 257 ARG F NH1   1 
ATOM   7309  N NH2   . ARG E 1 257 ? 26.071  -27.363 152.728 1.00 138.73 ? 257 ARG F NH2   1 
ATOM   7310  N N     . ARG E 1 258 ? 27.242  -34.728 151.274 1.00 101.99 ? 258 ARG F N     1 
ATOM   7311  C CA    . ARG E 1 258 ? 27.458  -35.831 152.201 1.00 100.34 ? 258 ARG F CA    1 
ATOM   7312  C C     . ARG E 1 258 ? 28.871  -36.355 152.040 1.00 98.59  ? 258 ARG F C     1 
ATOM   7313  O O     . ARG E 1 258 ? 29.512  -36.790 152.997 1.00 98.16  ? 258 ARG F O     1 
ATOM   7314  C CB    . ARG E 1 258 ? 26.482  -36.969 151.914 1.00 100.98 ? 258 ARG F CB    1 
ATOM   7315  C CG    . ARG E 1 258 ? 26.669  -38.168 152.827 1.00 105.81 ? 258 ARG F CG    1 
ATOM   7316  C CD    . ARG E 1 258 ? 25.935  -39.391 152.310 1.00 109.32 ? 258 ARG F CD    1 
ATOM   7317  N NE    . ARG E 1 258 ? 26.593  -39.978 151.146 1.00 111.16 ? 258 ARG F NE    1 
ATOM   7318  C CZ    . ARG E 1 258 ? 27.512  -40.936 151.214 1.00 110.12 ? 258 ARG F CZ    1 
ATOM   7319  N NH1   . ARG E 1 258 ? 28.057  -41.415 150.105 1.00 104.23 ? 258 ARG F NH1   1 
ATOM   7320  N NH2   . ARG E 1 258 ? 27.886  -41.416 152.392 1.00 115.21 ? 258 ARG F NH2   1 
ATOM   7321  N N     . VAL E 1 259 ? 29.341  -36.301 150.802 1.00 100.24 ? 259 VAL F N     1 
ATOM   7322  C CA    . VAL E 1 259 ? 30.633  -36.845 150.434 1.00 101.44 ? 259 VAL F CA    1 
ATOM   7323  C C     . VAL E 1 259 ? 31.749  -35.831 150.689 1.00 103.17 ? 259 VAL F C     1 
ATOM   7324  O O     . VAL E 1 259 ? 32.890  -36.206 150.965 1.00 101.43 ? 259 VAL F O     1 
ATOM   7325  C CB    . VAL E 1 259 ? 30.602  -37.326 148.966 1.00 96.81  ? 259 VAL F CB    1 
ATOM   7326  C CG1   . VAL E 1 259 ? 31.610  -36.581 148.111 1.00 95.10  ? 259 VAL F CG1   1 
ATOM   7327  C CG2   . VAL E 1 259 ? 30.806  -38.826 148.900 1.00 97.16  ? 259 VAL F CG2   1 
ATOM   7328  N N     . LYS E 1 260 ? 31.409  -34.547 150.617 1.00 103.58 ? 260 LYS F N     1 
ATOM   7329  C CA    . LYS E 1 260 ? 32.353  -33.485 150.945 1.00 99.42  ? 260 LYS F CA    1 
ATOM   7330  C C     . LYS E 1 260 ? 32.549  -33.442 152.454 1.00 94.56  ? 260 LYS F C     1 
ATOM   7331  O O     . LYS E 1 260 ? 33.625  -33.110 152.945 1.00 95.19  ? 260 LYS F O     1 
ATOM   7332  C CB    . LYS E 1 260 ? 31.843  -32.136 150.424 1.00 96.40  ? 260 LYS F CB    1 
ATOM   7333  C CG    . LYS E 1 260 ? 32.770  -30.943 150.639 1.00 89.76  ? 260 LYS F CG    1 
ATOM   7334  C CD    . LYS E 1 260 ? 32.626  -29.952 149.484 1.00 95.80  ? 260 LYS F CD    1 
ATOM   7335  C CE    . LYS E 1 260 ? 33.111  -28.554 149.847 1.00 103.90 ? 260 LYS F CE    1 
ATOM   7336  N NZ    . LYS E 1 260 ? 32.171  -27.837 150.757 1.00 106.98 ? 260 LYS F NZ    1 
ATOM   7337  N N     . LEU E 1 261 ? 31.500  -33.797 153.186 1.00 92.09  ? 261 LEU F N     1 
ATOM   7338  C CA    . LEU E 1 261 ? 31.553  -33.817 154.641 1.00 96.08  ? 261 LEU F CA    1 
ATOM   7339  C C     . LEU E 1 261 ? 32.436  -34.966 155.116 1.00 104.86 ? 261 LEU F C     1 
ATOM   7340  O O     . LEU E 1 261 ? 33.238  -34.809 156.041 1.00 105.95 ? 261 LEU F O     1 
ATOM   7341  C CB    . LEU E 1 261 ? 30.144  -33.960 155.213 1.00 94.42  ? 261 LEU F CB    1 
ATOM   7342  C CG    . LEU E 1 261 ? 29.943  -33.697 156.704 1.00 93.64  ? 261 LEU F CG    1 
ATOM   7343  C CD1   . LEU E 1 261 ? 30.337  -32.271 157.050 1.00 95.17  ? 261 LEU F CD1   1 
ATOM   7344  C CD2   . LEU E 1 261 ? 28.497  -33.965 157.089 1.00 96.60  ? 261 LEU F CD2   1 
ATOM   7345  N N     . LEU E 1 262 ? 32.279  -36.120 154.472 1.00 109.39 ? 262 LEU F N     1 
ATOM   7346  C CA    . LEU E 1 262 ? 33.099  -37.293 154.753 1.00 105.15 ? 262 LEU F CA    1 
ATOM   7347  C C     . LEU E 1 262 ? 34.566  -36.999 154.481 1.00 102.83 ? 262 LEU F C     1 
ATOM   7348  O O     . LEU E 1 262 ? 35.447  -37.458 155.207 1.00 105.52 ? 262 LEU F O     1 
ATOM   7349  C CB    . LEU E 1 262 ? 32.650  -38.474 153.892 1.00 101.59 ? 262 LEU F CB    1 
ATOM   7350  C CG    . LEU E 1 262 ? 31.499  -39.342 154.401 1.00 103.89 ? 262 LEU F CG    1 
ATOM   7351  C CD1   . LEU E 1 262 ? 31.115  -40.368 153.349 1.00 104.73 ? 262 LEU F CD1   1 
ATOM   7352  C CD2   . LEU E 1 262 ? 31.891  -40.029 155.696 1.00 106.26 ? 262 LEU F CD2   1 
ATOM   7353  N N     . PHE E 1 263 ? 34.814  -36.231 153.424 1.00 99.97  ? 263 PHE F N     1 
ATOM   7354  C CA    . PHE E 1 263 ? 36.167  -35.853 153.032 1.00 101.39 ? 263 PHE F CA    1 
ATOM   7355  C C     . PHE E 1 263 ? 36.848  -35.031 154.118 1.00 106.24 ? 263 PHE F C     1 
ATOM   7356  O O     . PHE E 1 263 ? 38.044  -35.185 154.370 1.00 108.09 ? 263 PHE F O     1 
ATOM   7357  C CB    . PHE E 1 263 ? 36.132  -35.059 151.722 1.00 101.55 ? 263 PHE F CB    1 
ATOM   7358  C CG    . PHE E 1 263 ? 37.488  -34.626 151.227 1.00 105.28 ? 263 PHE F CG    1 
ATOM   7359  C CD1   . PHE E 1 263 ? 38.263  -35.477 150.455 1.00 107.58 ? 263 PHE F CD1   1 
ATOM   7360  C CD2   . PHE E 1 263 ? 37.979  -33.361 151.517 1.00 107.18 ? 263 PHE F CD2   1 
ATOM   7361  C CE1   . PHE E 1 263 ? 39.505  -35.079 149.992 1.00 109.60 ? 263 PHE F CE1   1 
ATOM   7362  C CE2   . PHE E 1 263 ? 39.221  -32.959 151.056 1.00 107.77 ? 263 PHE F CE2   1 
ATOM   7363  C CZ    . PHE E 1 263 ? 39.984  -33.819 150.293 1.00 108.18 ? 263 PHE F CZ    1 
ATOM   7364  N N     . GLN E 1 264 ? 36.081  -34.157 154.759 1.00 106.03 ? 264 GLN F N     1 
ATOM   7365  C CA    . GLN E 1 264 ? 36.629  -33.263 155.769 1.00 104.15 ? 264 GLN F CA    1 
ATOM   7366  C C     . GLN E 1 264 ? 36.871  -33.986 157.088 1.00 103.72 ? 264 GLN F C     1 
ATOM   7367  O O     . GLN E 1 264 ? 37.813  -33.665 157.814 1.00 103.10 ? 264 GLN F O     1 
ATOM   7368  C CB    . GLN E 1 264 ? 35.707  -32.063 155.970 1.00 105.24 ? 264 GLN F CB    1 
ATOM   7369  C CG    . GLN E 1 264 ? 35.517  -31.235 154.714 1.00 108.65 ? 264 GLN F CG    1 
ATOM   7370  C CD    . GLN E 1 264 ? 34.376  -30.254 154.840 1.00 110.68 ? 264 GLN F CD    1 
ATOM   7371  O OE1   . GLN E 1 264 ? 33.585  -30.079 153.913 1.00 112.55 ? 264 GLN F OE1   1 
ATOM   7372  N NE2   . GLN E 1 264 ? 34.281  -29.608 155.995 1.00 109.59 ? 264 GLN F NE2   1 
ATOM   7373  N N     . PHE E 1 265 ? 36.023  -34.965 157.393 1.00 104.77 ? 265 PHE F N     1 
ATOM   7374  C CA    . PHE E 1 265 ? 36.207  -35.774 158.592 1.00 111.30 ? 265 PHE F CA    1 
ATOM   7375  C C     . PHE E 1 265 ? 37.525  -36.530 158.498 1.00 113.14 ? 265 PHE F C     1 
ATOM   7376  O O     . PHE E 1 265 ? 38.230  -36.700 159.493 1.00 113.10 ? 265 PHE F O     1 
ATOM   7377  C CB    . PHE E 1 265 ? 35.056  -36.766 158.771 1.00 114.80 ? 265 PHE F CB    1 
ATOM   7378  C CG    . PHE E 1 265 ? 33.740  -36.121 159.103 1.00 116.75 ? 265 PHE F CG    1 
ATOM   7379  C CD1   . PHE E 1 265 ? 33.669  -34.773 159.415 1.00 116.28 ? 265 PHE F CD1   1 
ATOM   7380  C CD2   . PHE E 1 265 ? 32.575  -36.868 159.112 1.00 118.79 ? 265 PHE F CD2   1 
ATOM   7381  C CE1   . PHE E 1 265 ? 32.458  -34.181 159.720 1.00 116.95 ? 265 PHE F CE1   1 
ATOM   7382  C CE2   . PHE E 1 265 ? 31.363  -36.284 159.418 1.00 119.93 ? 265 PHE F CE2   1 
ATOM   7383  C CZ    . PHE E 1 265 ? 31.304  -34.937 159.724 1.00 118.68 ? 265 PHE F CZ    1 
ATOM   7384  N N     . ALA E 1 266 ? 37.850  -36.975 157.289 1.00 114.01 ? 266 ALA F N     1 
ATOM   7385  C CA    . ALA E 1 266 ? 39.084  -37.709 157.047 1.00 113.64 ? 266 ALA F CA    1 
ATOM   7386  C C     . ALA E 1 266 ? 40.282  -36.769 157.081 1.00 114.58 ? 266 ALA F C     1 
ATOM   7387  O O     . ALA E 1 266 ? 41.380  -37.164 157.473 1.00 115.44 ? 266 ALA F O     1 
ATOM   7388  C CB    . ALA E 1 266 ? 39.014  -38.434 155.721 1.00 109.85 ? 266 ALA F CB    1 
ATOM   7389  N N     . GLN E 1 267 ? 40.065  -35.525 156.663 1.00 111.08 ? 267 GLN F N     1 
ATOM   7390  C CA    . GLN E 1 267 ? 41.100  -34.504 156.753 1.00 108.29 ? 267 GLN F CA    1 
ATOM   7391  C C     . GLN E 1 267 ? 41.466  -34.243 158.207 1.00 108.56 ? 267 GLN F C     1 
ATOM   7392  O O     . GLN E 1 267 ? 42.643  -34.133 158.548 1.00 110.72 ? 267 GLN F O     1 
ATOM   7393  C CB    . GLN E 1 267 ? 40.644  -33.204 156.095 1.00 110.21 ? 267 GLN F CB    1 
ATOM   7394  C CG    . GLN E 1 267 ? 40.819  -33.174 154.591 1.00 113.39 ? 267 GLN F CG    1 
ATOM   7395  C CD    . GLN E 1 267 ? 40.649  -31.780 154.025 1.00 119.02 ? 267 GLN F CD    1 
ATOM   7396  O OE1   . GLN E 1 267 ? 39.578  -31.181 154.132 1.00 123.27 ? 267 GLN F OE1   1 
ATOM   7397  N NE2   . GLN E 1 267 ? 41.710  -31.250 153.429 1.00 117.56 ? 267 GLN F NE2   1 
ATOM   7398  N N     . HIS E 1 268 ? 40.452  -34.141 159.060 1.00 108.45 ? 268 HIS F N     1 
ATOM   7399  C CA    . HIS E 1 268 ? 40.670  -33.936 160.487 1.00 109.87 ? 268 HIS F CA    1 
ATOM   7400  C C     . HIS E 1 268 ? 41.341  -35.153 161.115 1.00 108.66 ? 268 HIS F C     1 
ATOM   7401  O O     . HIS E 1 268 ? 42.259  -35.015 161.924 1.00 110.62 ? 268 HIS F O     1 
ATOM   7402  C CB    . HIS E 1 268 ? 39.349  -33.638 161.198 1.00 114.35 ? 268 HIS F CB    1 
ATOM   7403  C CG    . HIS E 1 268 ? 39.474  -33.515 162.683 1.00 120.12 ? 268 HIS F CG    1 
ATOM   7404  N ND1   . HIS E 1 268 ? 39.884  -32.359 163.311 1.00 121.75 ? 268 HIS F ND1   1 
ATOM   7405  C CD2   . HIS E 1 268 ? 39.235  -34.415 163.674 1.00 122.34 ? 268 HIS F CD2   1 
ATOM   7406  C CE1   . HIS E 1 268 ? 39.895  -32.546 164.614 1.00 125.00 ? 268 HIS F CE1   1 
ATOM   7407  N NE2   . HIS E 1 268 ? 39.508  -33.780 164.866 1.00 125.87 ? 268 HIS F NE2   1 
ATOM   7408  N N     . CYS E 1 269 ? 40.875  -36.341 160.739 1.00 107.57 ? 269 CYS F N     1 
ATOM   7409  C CA    . CYS E 1 269 ? 41.463  -37.589 161.217 1.00 104.85 ? 269 CYS F CA    1 
ATOM   7410  C C     . CYS E 1 269 ? 42.931  -37.692 160.827 1.00 103.34 ? 269 CYS F C     1 
ATOM   7411  O O     . CYS E 1 269 ? 43.766  -38.131 161.617 1.00 102.10 ? 269 CYS F O     1 
ATOM   7412  C CB    . CYS E 1 269 ? 40.709  -38.794 160.651 1.00 101.85 ? 269 CYS F CB    1 
ATOM   7413  S SG    . CYS E 1 269 ? 39.118  -39.136 161.428 1.00 153.79 ? 269 CYS F SG    1 
ATOM   7414  N N     . GLU E 1 270 ? 43.237  -37.288 159.600 1.00 105.21 ? 270 GLU F N     1 
ATOM   7415  C CA    . GLU E 1 270 ? 44.592  -37.390 159.079 1.00 111.17 ? 270 GLU F CA    1 
ATOM   7416  C C     . GLU E 1 270 ? 45.526  -36.412 159.784 1.00 116.52 ? 270 GLU F C     1 
ATOM   7417  O O     . GLU E 1 270 ? 46.671  -36.747 160.091 1.00 121.79 ? 270 GLU F O     1 
ATOM   7418  C CB    . GLU E 1 270 ? 44.603  -37.147 157.570 1.00 113.23 ? 270 GLU F CB    1 
ATOM   7419  C CG    . GLU E 1 270 ? 45.941  -37.413 156.904 1.00 115.03 ? 270 GLU F CG    1 
ATOM   7420  C CD    . GLU E 1 270 ? 45.895  -37.173 155.408 1.00 112.40 ? 270 GLU F CD    1 
ATOM   7421  O OE1   . GLU E 1 270 ? 44.824  -36.773 154.902 1.00 106.25 ? 270 GLU F OE1   1 
ATOM   7422  O OE2   . GLU E 1 270 ? 46.928  -37.383 154.738 1.00 114.68 ? 270 GLU F OE2   1 
ATOM   7423  N N     . LYS E 1 271 ? 45.031  -35.205 160.042 1.00 114.87 ? 271 LYS F N     1 
ATOM   7424  C CA    . LYS E 1 271 ? 45.818  -34.192 160.737 1.00 113.92 ? 271 LYS F CA    1 
ATOM   7425  C C     . LYS E 1 271 ? 46.080  -34.579 162.192 1.00 117.30 ? 271 LYS F C     1 
ATOM   7426  O O     . LYS E 1 271 ? 47.127  -34.250 162.750 1.00 117.34 ? 271 LYS F O     1 
ATOM   7427  C CB    . LYS E 1 271 ? 45.145  -32.816 160.647 1.00 111.80 ? 271 LYS F CB    1 
ATOM   7428  C CG    . LYS E 1 271 ? 45.583  -31.994 159.438 1.00 112.98 ? 271 LYS F CG    1 
ATOM   7429  C CD    . LYS E 1 271 ? 44.930  -30.614 159.398 1.00 115.35 ? 271 LYS F CD    1 
ATOM   7430  C CE    . LYS E 1 271 ? 43.481  -30.687 158.932 1.00 114.67 ? 271 LYS F CE    1 
ATOM   7431  N NZ    . LYS E 1 271 ? 42.892  -29.336 158.696 1.00 114.08 ? 271 LYS F NZ    1 
ATOM   7432  N N     . GLN E 1 272 ? 45.132  -35.290 162.797 1.00 121.62 ? 272 GLN F N     1 
ATOM   7433  C CA    . GLN E 1 272 ? 45.284  -35.767 164.169 1.00 122.34 ? 272 GLN F CA    1 
ATOM   7434  C C     . GLN E 1 272 ? 46.025  -37.103 164.224 1.00 118.74 ? 272 GLN F C     1 
ATOM   7435  O O     . GLN E 1 272 ? 45.926  -37.840 165.208 1.00 118.33 ? 272 GLN F O     1 
ATOM   7436  C CB    . GLN E 1 272 ? 43.921  -35.872 164.859 1.00 126.41 ? 272 GLN F CB    1 
ATOM   7437  C CG    . GLN E 1 272 ? 43.366  -34.538 165.335 1.00 132.11 ? 272 GLN F CG    1 
ATOM   7438  C CD    . GLN E 1 272 ? 44.056  -34.038 166.592 1.00 138.92 ? 272 GLN F CD    1 
ATOM   7439  O OE1   . GLN E 1 272 ? 44.503  -34.829 167.423 1.00 142.77 ? 272 GLN F OE1   1 
ATOM   7440  N NE2   . GLN E 1 272 ? 44.148  -32.720 166.734 1.00 137.63 ? 272 GLN F NE2   1 
ATOM   7441  N N     . ARG E 1 273 ? 46.751  -37.400 163.149 1.00 117.53 ? 273 ARG F N     1 
ATOM   7442  C CA    . ARG E 1 273 ? 47.654  -38.550 163.071 1.00 122.25 ? 273 ARG F CA    1 
ATOM   7443  C C     . ARG E 1 273 ? 46.943  -39.909 163.129 1.00 122.31 ? 273 ARG F C     1 
ATOM   7444  O O     . ARG E 1 273 ? 47.570  -40.942 163.369 1.00 121.26 ? 273 ARG F O     1 
ATOM   7445  C CB    . ARG E 1 273 ? 48.754  -38.444 164.139 1.00 127.79 ? 273 ARG F CB    1 
ATOM   7446  C CG    . ARG E 1 273 ? 50.010  -39.252 163.847 1.00 131.88 ? 273 ARG F CG    1 
ATOM   7447  C CD    . ARG E 1 273 ? 51.258  -38.531 164.319 1.00 136.95 ? 273 ARG F CD    1 
ATOM   7448  N NE    . ARG E 1 273 ? 51.605  -37.420 163.438 1.00 141.26 ? 273 ARG F NE    1 
ATOM   7449  C CZ    . ARG E 1 273 ? 52.292  -37.554 162.308 1.00 143.03 ? 273 ARG F CZ    1 
ATOM   7450  N NH1   . ARG E 1 273 ? 52.705  -38.753 161.919 1.00 142.34 ? 273 ARG F NH1   1 
ATOM   7451  N NH2   . ARG E 1 273 ? 52.566  -36.490 161.565 1.00 143.68 ? 273 ARG F NH2   1 
ATOM   7452  N N     . ASP E 1 274 ? 45.636  -39.912 162.893 1.00 121.93 ? 274 ASP F N     1 
ATOM   7453  C CA    . ASP E 1 274 ? 44.902  -41.169 162.824 1.00 121.52 ? 274 ASP F CA    1 
ATOM   7454  C C     . ASP E 1 274 ? 44.681  -41.543 161.369 1.00 118.36 ? 274 ASP F C     1 
ATOM   7455  O O     . ASP E 1 274 ? 43.601  -41.333 160.820 1.00 118.55 ? 274 ASP F O     1 
ATOM   7456  C CB    . ASP E 1 274 ? 43.566  -41.067 163.554 1.00 127.77 ? 274 ASP F CB    1 
ATOM   7457  C CG    . ASP E 1 274 ? 42.857  -42.404 163.650 1.00 137.65 ? 274 ASP F CG    1 
ATOM   7458  O OD1   . ASP E 1 274 ? 43.496  -43.441 163.369 1.00 140.61 ? 274 ASP F OD1   1 
ATOM   7459  O OD2   . ASP E 1 274 ? 41.665  -42.420 164.019 1.00 142.24 ? 274 ASP F OD2   1 
ATOM   7460  N N     . PHE E 1 275 ? 45.714  -42.101 160.749 1.00 116.89 ? 275 PHE F N     1 
ATOM   7461  C CA    . PHE E 1 275 ? 45.696  -42.345 159.314 1.00 110.98 ? 275 PHE F CA    1 
ATOM   7462  C C     . PHE E 1 275 ? 44.848  -43.553 158.954 1.00 109.94 ? 275 PHE F C     1 
ATOM   7463  O O     . PHE E 1 275 ? 44.369  -43.668 157.827 1.00 111.20 ? 275 PHE F O     1 
ATOM   7464  C CB    . PHE E 1 275 ? 47.119  -42.524 158.780 1.00 107.92 ? 275 PHE F CB    1 
ATOM   7465  C CG    . PHE E 1 275 ? 48.071  -41.453 159.225 1.00 107.98 ? 275 PHE F CG    1 
ATOM   7466  C CD1   . PHE E 1 275 ? 47.888  -40.138 158.830 1.00 105.95 ? 275 PHE F CD1   1 
ATOM   7467  C CD2   . PHE E 1 275 ? 49.149  -41.761 160.036 1.00 109.13 ? 275 PHE F CD2   1 
ATOM   7468  C CE1   . PHE E 1 275 ? 48.761  -39.150 159.239 1.00 105.95 ? 275 PHE F CE1   1 
ATOM   7469  C CE2   . PHE E 1 275 ? 50.026  -40.777 160.448 1.00 110.75 ? 275 PHE F CE2   1 
ATOM   7470  C CZ    . PHE E 1 275 ? 49.832  -39.470 160.048 1.00 109.15 ? 275 PHE F CZ    1 
ATOM   7471  N N     . ASP E 1 276 ? 44.660  -44.453 159.912 1.00 109.17 ? 276 ASP F N     1 
ATOM   7472  C CA    . ASP E 1 276 ? 43.909  -45.674 159.653 1.00 109.43 ? 276 ASP F CA    1 
ATOM   7473  C C     . ASP E 1 276 ? 42.422  -45.402 159.483 1.00 110.80 ? 276 ASP F C     1 
ATOM   7474  O O     . ASP E 1 276 ? 41.753  -46.042 158.672 1.00 115.94 ? 276 ASP F O     1 
ATOM   7475  C CB    . ASP E 1 276 ? 44.152  -46.706 160.752 1.00 113.01 ? 276 ASP F CB    1 
ATOM   7476  C CG    . ASP E 1 276 ? 45.209  -47.719 160.368 1.00 117.26 ? 276 ASP F CG    1 
ATOM   7477  O OD1   . ASP E 1 276 ? 46.096  -47.374 159.558 1.00 112.80 ? 276 ASP F OD1   1 
ATOM   7478  O OD2   . ASP E 1 276 ? 45.146  -48.863 160.865 1.00 122.94 ? 276 ASP F OD2   1 
ATOM   7479  N N     . LEU E 1 277 ? 41.912  -44.444 160.248 1.00 109.02 ? 277 LEU F N     1 
ATOM   7480  C CA    . LEU E 1 277 ? 40.522  -44.036 160.127 1.00 106.06 ? 277 LEU F CA    1 
ATOM   7481  C C     . LEU E 1 277 ? 40.379  -43.106 158.928 1.00 103.93 ? 277 LEU F C     1 
ATOM   7482  O O     . LEU E 1 277 ? 39.416  -43.204 158.165 1.00 102.62 ? 277 LEU F O     1 
ATOM   7483  C CB    . LEU E 1 277 ? 40.070  -43.317 161.398 1.00 105.16 ? 277 LEU F CB    1 
ATOM   7484  C CG    . LEU E 1 277 ? 38.639  -43.527 161.903 1.00 103.38 ? 277 LEU F CG    1 
ATOM   7485  C CD1   . LEU E 1 277 ? 38.326  -42.520 163.000 1.00 102.16 ? 277 LEU F CD1   1 
ATOM   7486  C CD2   . LEU E 1 277 ? 37.609  -43.439 160.787 1.00 100.24 ? 277 LEU F CD2   1 
ATOM   7487  N N     . ALA E 1 278 ? 41.345  -42.204 158.777 1.00 102.54 ? 278 ALA F N     1 
ATOM   7488  C CA    . ALA E 1 278 ? 41.345  -41.235 157.685 1.00 97.87  ? 278 ALA F CA    1 
ATOM   7489  C C     . ALA E 1 278 ? 41.255  -41.938 156.339 1.00 96.09  ? 278 ALA F C     1 
ATOM   7490  O O     . ALA E 1 278 ? 40.504  -41.520 155.457 1.00 90.33  ? 278 ALA F O     1 
ATOM   7491  C CB    . ALA E 1 278 ? 42.591  -40.368 157.748 1.00 95.45  ? 278 ALA F CB    1 
ATOM   7492  N N     . GLN E 1 279 ? 42.020  -43.015 156.196 1.00 101.77 ? 279 GLN F N     1 
ATOM   7493  C CA    . GLN E 1 279 ? 41.987  -43.832 154.991 1.00 101.97 ? 279 GLN F CA    1 
ATOM   7494  C C     . GLN E 1 279 ? 40.592  -44.391 154.746 1.00 98.24  ? 279 GLN F C     1 
ATOM   7495  O O     . GLN E 1 279 ? 40.004  -44.168 153.690 1.00 95.87  ? 279 GLN F O     1 
ATOM   7496  C CB    . GLN E 1 279 ? 43.000  -44.972 155.093 1.00 104.12 ? 279 GLN F CB    1 
ATOM   7497  C CG    . GLN E 1 279 ? 42.826  -46.051 154.041 1.00 110.23 ? 279 GLN F CG    1 
ATOM   7498  C CD    . GLN E 1 279 ? 42.107  -47.279 154.567 1.00 116.58 ? 279 GLN F CD    1 
ATOM   7499  O OE1   . GLN E 1 279 ? 41.995  -47.479 155.777 1.00 120.99 ? 279 GLN F OE1   1 
ATOM   7500  N NE2   . GLN E 1 279 ? 41.616  -48.112 153.655 1.00 115.09 ? 279 GLN F NE2   1 
ATOM   7501  N N     . ARG E 1 280 ? 40.064  -45.106 155.735 1.00 98.27  ? 280 ARG F N     1 
ATOM   7502  C CA    . ARG E 1 280 ? 38.745  -45.720 155.625 1.00 107.07 ? 280 ARG F CA    1 
ATOM   7503  C C     . ARG E 1 280 ? 37.652  -44.703 155.286 1.00 113.14 ? 280 ARG F C     1 
ATOM   7504  O O     . ARG E 1 280 ? 36.678  -45.028 154.605 1.00 118.67 ? 280 ARG F O     1 
ATOM   7505  C CB    . ARG E 1 280 ? 38.394  -46.459 156.915 1.00 111.05 ? 280 ARG F CB    1 
ATOM   7506  C CG    . ARG E 1 280 ? 37.152  -47.319 156.807 1.00 116.98 ? 280 ARG F CG    1 
ATOM   7507  C CD    . ARG E 1 280 ? 36.716  -47.806 158.171 1.00 125.04 ? 280 ARG F CD    1 
ATOM   7508  N NE    . ARG E 1 280 ? 37.622  -48.817 158.703 1.00 129.22 ? 280 ARG F NE    1 
ATOM   7509  C CZ    . ARG E 1 280 ? 37.393  -50.124 158.635 1.00 130.26 ? 280 ARG F CZ    1 
ATOM   7510  N NH1   . ARG E 1 280 ? 36.284  -50.572 158.062 1.00 127.79 ? 280 ARG F NH1   1 
ATOM   7511  N NH2   . ARG E 1 280 ? 38.268  -50.981 159.144 1.00 132.33 ? 280 ARG F NH2   1 
ATOM   7512  N N     . LEU E 1 281 ? 37.822  -43.471 155.756 1.00 109.61 ? 281 LEU F N     1 
ATOM   7513  C CA    . LEU E 1 281 ? 36.863  -42.406 155.477 1.00 103.91 ? 281 LEU F CA    1 
ATOM   7514  C C     . LEU E 1 281 ? 37.002  -41.835 154.065 1.00 101.92 ? 281 LEU F C     1 
ATOM   7515  O O     . LEU E 1 281 ? 36.002  -41.603 153.382 1.00 100.38 ? 281 LEU F O     1 
ATOM   7516  C CB    . LEU E 1 281 ? 36.992  -41.287 156.511 1.00 98.44  ? 281 LEU F CB    1 
ATOM   7517  C CG    . LEU E 1 281 ? 36.308  -41.535 157.853 1.00 96.46  ? 281 LEU F CG    1 
ATOM   7518  C CD1   . LEU E 1 281 ? 36.516  -40.350 158.775 1.00 96.77  ? 281 LEU F CD1   1 
ATOM   7519  C CD2   . LEU E 1 281 ? 34.828  -41.797 157.644 1.00 94.66  ? 281 LEU F CD2   1 
ATOM   7520  N N     . TYR E 1 282 ? 38.243  -41.606 153.639 1.00 97.36  ? 282 TYR F N     1 
ATOM   7521  C CA    . TYR E 1 282 ? 38.525  -41.058 152.314 1.00 89.56  ? 282 TYR F CA    1 
ATOM   7522  C C     . TYR E 1 282 ? 37.948  -41.942 151.217 1.00 94.10  ? 282 TYR F C     1 
ATOM   7523  O O     . TYR E 1 282 ? 37.554  -41.460 150.153 1.00 98.55  ? 282 TYR F O     1 
ATOM   7524  C CB    . TYR E 1 282 ? 40.035  -40.925 152.106 1.00 87.26  ? 282 TYR F CB    1 
ATOM   7525  C CG    . TYR E 1 282 ? 40.652  -39.660 152.664 1.00 93.06  ? 282 TYR F CG    1 
ATOM   7526  C CD1   . TYR E 1 282 ? 40.100  -38.413 152.397 1.00 95.21  ? 282 TYR F CD1   1 
ATOM   7527  C CD2   . TYR E 1 282 ? 41.796  -39.715 153.450 1.00 96.61  ? 282 TYR F CD2   1 
ATOM   7528  C CE1   . TYR E 1 282 ? 40.670  -37.257 152.903 1.00 97.15  ? 282 TYR F CE1   1 
ATOM   7529  C CE2   . TYR E 1 282 ? 42.368  -38.568 153.964 1.00 96.17  ? 282 TYR F CE2   1 
ATOM   7530  C CZ    . TYR E 1 282 ? 41.803  -37.342 153.688 1.00 97.25  ? 282 TYR F CZ    1 
ATOM   7531  O OH    . TYR E 1 282 ? 42.379  -36.201 154.196 1.00 99.34  ? 282 TYR F OH    1 
ATOM   7532  N N     . ARG E 1 283 ? 37.899  -43.241 151.486 1.00 92.52  ? 283 ARG F N     1 
ATOM   7533  C CA    . ARG E 1 283 ? 37.444  -44.207 150.497 1.00 90.00  ? 283 ARG F CA    1 
ATOM   7534  C C     . ARG E 1 283 ? 35.925  -44.326 150.460 1.00 91.55  ? 283 ARG F C     1 
ATOM   7535  O O     . ARG E 1 283 ? 35.367  -44.887 149.518 1.00 92.53  ? 283 ARG F O     1 
ATOM   7536  C CB    . ARG E 1 283 ? 38.086  -45.570 150.754 1.00 89.66  ? 283 ARG F CB    1 
ATOM   7537  C CG    . ARG E 1 283 ? 39.596  -45.498 150.888 1.00 87.52  ? 283 ARG F CG    1 
ATOM   7538  C CD    . ARG E 1 283 ? 40.288  -46.516 150.010 1.00 93.20  ? 283 ARG F CD    1 
ATOM   7539  N NE    . ARG E 1 283 ? 40.579  -47.751 150.727 1.00 101.07 ? 283 ARG F NE    1 
ATOM   7540  C CZ    . ARG E 1 283 ? 40.579  -48.954 150.164 1.00 109.64 ? 283 ARG F CZ    1 
ATOM   7541  N NH1   . ARG E 1 283 ? 40.292  -49.084 148.875 1.00 109.92 ? 283 ARG F NH1   1 
ATOM   7542  N NH2   . ARG E 1 283 ? 40.859  -50.027 150.890 1.00 113.18 ? 283 ARG F NH2   1 
ATOM   7543  N N     . GLN E 1 284 ? 35.256  -43.805 151.484 1.00 93.51  ? 284 GLN F N     1 
ATOM   7544  C CA    . GLN E 1 284 ? 33.799  -43.758 151.482 1.00 93.05  ? 284 GLN F CA    1 
ATOM   7545  C C     . GLN E 1 284 ? 33.344  -42.531 150.702 1.00 91.66  ? 284 GLN F C     1 
ATOM   7546  O O     . GLN E 1 284 ? 32.173  -42.402 150.341 1.00 90.76  ? 284 GLN F O     1 
ATOM   7547  C CB    . GLN E 1 284 ? 33.249  -43.707 152.908 1.00 96.79  ? 284 GLN F CB    1 
ATOM   7548  C CG    . GLN E 1 284 ? 33.523  -44.949 153.743 1.00 102.71 ? 284 GLN F CG    1 
ATOM   7549  C CD    . GLN E 1 284 ? 32.763  -44.928 155.057 1.00 111.07 ? 284 GLN F CD    1 
ATOM   7550  O OE1   . GLN E 1 284 ? 31.957  -44.031 155.303 1.00 115.19 ? 284 GLN F OE1   1 
ATOM   7551  N NE2   . GLN E 1 284 ? 33.015  -45.918 155.907 1.00 114.42 ? 284 GLN F NE2   1 
ATOM   7552  N N     . SER E 1 285 ? 34.294  -41.638 150.439 1.00 92.86  ? 285 SER F N     1 
ATOM   7553  C CA    . SER E 1 285 ? 34.026  -40.375 149.762 1.00 93.74  ? 285 SER F CA    1 
ATOM   7554  C C     . SER E 1 285 ? 34.357  -40.421 148.277 1.00 91.26  ? 285 SER F C     1 
ATOM   7555  O O     . SER E 1 285 ? 35.318  -41.067 147.865 1.00 97.22  ? 285 SER F O     1 
ATOM   7556  C CB    . SER E 1 285 ? 34.830  -39.250 150.410 1.00 99.12  ? 285 SER F CB    1 
ATOM   7557  O OG    . SER E 1 285 ? 34.849  -38.110 149.571 1.00 102.94 ? 285 SER F OG    1 
ATOM   7558  N N     . SER E 1 286 ? 33.562  -39.714 147.481 1.00 85.93  ? 286 SER F N     1 
ATOM   7559  C CA    . SER E 1 286 ? 33.798  -39.616 146.048 1.00 85.62  ? 286 SER F CA    1 
ATOM   7560  C C     . SER E 1 286 ? 34.165  -38.180 145.710 1.00 89.61  ? 286 SER F C     1 
ATOM   7561  O O     . SER E 1 286 ? 34.173  -37.783 144.543 1.00 93.45  ? 286 SER F O     1 
ATOM   7562  C CB    . SER E 1 286 ? 32.556  -40.040 145.263 1.00 88.37  ? 286 SER F CB    1 
ATOM   7563  O OG    . SER E 1 286 ? 31.686  -38.941 145.050 1.00 80.50  ? 286 SER F OG    1 
ATOM   7564  N N     . HIS E 1 287 ? 34.461  -37.406 146.749 1.00 90.72  ? 287 HIS F N     1 
ATOM   7565  C CA    . HIS E 1 287 ? 34.901  -36.029 146.595 1.00 95.43  ? 287 HIS F CA    1 
ATOM   7566  C C     . HIS E 1 287 ? 36.204  -36.005 145.811 1.00 101.70 ? 287 HIS F C     1 
ATOM   7567  O O     . HIS E 1 287 ? 37.064  -36.862 146.012 1.00 107.14 ? 287 HIS F O     1 
ATOM   7568  C CB    . HIS E 1 287 ? 35.102  -35.388 147.970 1.00 101.98 ? 287 HIS F CB    1 
ATOM   7569  C CG    . HIS E 1 287 ? 35.366  -33.918 147.922 1.00 107.65 ? 287 HIS F CG    1 
ATOM   7570  N ND1   . HIS E 1 287 ? 34.424  -33.003 147.506 1.00 111.16 ? 287 HIS F ND1   1 
ATOM   7571  C CD2   . HIS E 1 287 ? 36.471  -33.197 148.245 1.00 106.74 ? 287 HIS F CD2   1 
ATOM   7572  C CE1   . HIS E 1 287 ? 34.934  -31.785 147.570 1.00 108.35 ? 287 HIS F CE1   1 
ATOM   7573  N NE2   . HIS E 1 287 ? 36.173  -31.878 148.016 1.00 105.87 ? 287 HIS F NE2   1 
ATOM   7574  N N     . PRO E 1 288 ? 36.345  -35.034 144.896 1.00 102.08 ? 288 PRO F N     1 
ATOM   7575  C CA    . PRO E 1 288 ? 37.565  -34.909 144.091 1.00 100.86 ? 288 PRO F CA    1 
ATOM   7576  C C     . PRO E 1 288 ? 38.820  -34.808 144.956 1.00 94.60  ? 288 PRO F C     1 
ATOM   7577  O O     . PRO E 1 288 ? 38.964  -33.874 145.742 1.00 95.72  ? 288 PRO F O     1 
ATOM   7578  C CB    . PRO E 1 288 ? 37.336  -33.607 143.322 1.00 101.55 ? 288 PRO F CB    1 
ATOM   7579  C CG    . PRO E 1 288 ? 35.851  -33.512 143.203 1.00 100.30 ? 288 PRO F CG    1 
ATOM   7580  C CD    . PRO E 1 288 ? 35.321  -34.050 144.502 1.00 98.67  ? 288 PRO F CD    1 
ATOM   7581  N N     . GLY E 1 289 ? 39.712  -35.781 144.819 1.00 91.85  ? 289 GLY F N     1 
ATOM   7582  C CA    . GLY E 1 289 ? 40.949  -35.776 145.573 1.00 92.31  ? 289 GLY F CA    1 
ATOM   7583  C C     . GLY E 1 289 ? 40.930  -36.687 146.783 1.00 93.53  ? 289 GLY F C     1 
ATOM   7584  O O     . GLY E 1 289 ? 41.952  -36.861 147.441 1.00 95.05  ? 289 GLY F O     1 
ATOM   7585  N N     . ALA E 1 290 ? 39.773  -37.271 147.079 1.00 96.75  ? 290 ALA F N     1 
ATOM   7586  C CA    . ALA E 1 290 ? 39.651  -38.173 148.222 1.00 98.06  ? 290 ALA F CA    1 
ATOM   7587  C C     . ALA E 1 290 ? 40.476  -39.442 148.041 1.00 96.85  ? 290 ALA F C     1 
ATOM   7588  O O     . ALA E 1 290 ? 41.195  -39.856 148.949 1.00 92.74  ? 290 ALA F O     1 
ATOM   7589  C CB    . ALA E 1 290 ? 38.189  -38.525 148.483 1.00 97.63  ? 290 ALA F CB    1 
ATOM   7590  N N     . ARG E 1 291 ? 40.369  -40.056 146.868 1.00 100.27 ? 291 ARG F N     1 
ATOM   7591  C CA    . ARG E 1 291 ? 41.052  -41.318 146.615 1.00 99.42  ? 291 ARG F CA    1 
ATOM   7592  C C     . ARG E 1 291 ? 42.567  -41.147 146.701 1.00 97.90  ? 291 ARG F C     1 
ATOM   7593  O O     . ARG E 1 291 ? 43.271  -42.020 147.206 1.00 98.71  ? 291 ARG F O     1 
ATOM   7594  C CB    . ARG E 1 291 ? 40.638  -41.888 145.258 1.00 96.82  ? 291 ARG F CB    1 
ATOM   7595  C CG    . ARG E 1 291 ? 41.448  -43.082 144.808 1.00 90.30  ? 291 ARG F CG    1 
ATOM   7596  C CD    . ARG E 1 291 ? 41.645  -43.022 143.310 1.00 90.92  ? 291 ARG F CD    1 
ATOM   7597  N NE    . ARG E 1 291 ? 40.714  -43.872 142.578 1.00 92.95  ? 291 ARG F NE    1 
ATOM   7598  C CZ    . ARG E 1 291 ? 40.575  -43.850 141.257 1.00 100.32 ? 291 ARG F CZ    1 
ATOM   7599  N NH1   . ARG E 1 291 ? 41.297  -43.006 140.530 1.00 103.34 ? 291 ARG F NH1   1 
ATOM   7600  N NH2   . ARG E 1 291 ? 39.712  -44.663 140.663 1.00 101.02 ? 291 ARG F NH2   1 
ATOM   7601  N N     . LEU E 1 292 ? 43.059  -40.007 146.226 1.00 94.08  ? 292 LEU F N     1 
ATOM   7602  C CA    . LEU E 1 292 ? 44.477  -39.684 146.329 1.00 89.49  ? 292 LEU F CA    1 
ATOM   7603  C C     . LEU E 1 292 ? 44.909  -39.493 147.783 1.00 90.85  ? 292 LEU F C     1 
ATOM   7604  O O     . LEU E 1 292 ? 46.024  -39.857 148.157 1.00 92.06  ? 292 LEU F O     1 
ATOM   7605  C CB    . LEU E 1 292 ? 44.795  -38.425 145.525 1.00 87.22  ? 292 LEU F CB    1 
ATOM   7606  C CG    . LEU E 1 292 ? 46.268  -38.216 145.177 1.00 88.36  ? 292 LEU F CG    1 
ATOM   7607  C CD1   . LEU E 1 292 ? 46.740  -39.327 144.255 1.00 82.27  ? 292 LEU F CD1   1 
ATOM   7608  C CD2   . LEU E 1 292 ? 46.480  -36.850 144.541 1.00 81.89  ? 292 LEU F CD2   1 
ATOM   7609  N N     . ARG E 1 293 ? 44.034  -38.910 148.596 1.00 90.97  ? 293 ARG F N     1 
ATOM   7610  C CA    . ARG E 1 293 ? 44.332  -38.728 150.013 1.00 89.18  ? 293 ARG F CA    1 
ATOM   7611  C C     . ARG E 1 293 ? 44.312  -40.069 150.733 1.00 89.56  ? 293 ARG F C     1 
ATOM   7612  O O     . ARG E 1 293 ? 45.012  -40.265 151.727 1.00 88.72  ? 293 ARG F O     1 
ATOM   7613  C CB    . ARG E 1 293 ? 43.338  -37.770 150.671 1.00 90.41  ? 293 ARG F CB    1 
ATOM   7614  C CG    . ARG E 1 293 ? 43.421  -36.338 150.178 1.00 93.46  ? 293 ARG F CG    1 
ATOM   7615  C CD    . ARG E 1 293 ? 44.852  -35.836 150.181 1.00 95.71  ? 293 ARG F CD    1 
ATOM   7616  N NE    . ARG E 1 293 ? 45.491  -36.000 151.482 1.00 94.22  ? 293 ARG F NE    1 
ATOM   7617  C CZ    . ARG E 1 293 ? 46.742  -35.638 151.747 1.00 92.61  ? 293 ARG F CZ    1 
ATOM   7618  N NH1   . ARG E 1 293 ? 47.489  -35.085 150.800 1.00 91.36  ? 293 ARG F NH1   1 
ATOM   7619  N NH2   . ARG E 1 293 ? 47.246  -35.824 152.958 1.00 92.40  ? 293 ARG F NH2   1 
ATOM   7620  N N     . ALA E 1 294 ? 43.502  -40.989 150.219 1.00 91.71  ? 294 ALA F N     1 
ATOM   7621  C CA    . ALA E 1 294 ? 43.389  -42.323 150.794 1.00 93.48  ? 294 ALA F CA    1 
ATOM   7622  C C     . ALA E 1 294 ? 44.706  -43.077 150.652 1.00 98.54  ? 294 ALA F C     1 
ATOM   7623  O O     . ALA E 1 294 ? 45.131  -43.786 151.564 1.00 103.06 ? 294 ALA F O     1 
ATOM   7624  C CB    . ALA E 1 294 ? 42.259  -43.092 150.127 1.00 89.33  ? 294 ALA F CB    1 
ATOM   7625  N N     . ILE E 1 295 ? 45.351  -42.906 149.502 1.00 97.10  ? 295 ILE F N     1 
ATOM   7626  C CA    . ILE E 1 295 ? 46.637  -43.536 149.232 1.00 96.83  ? 295 ILE F CA    1 
ATOM   7627  C C     . ILE E 1 295 ? 47.738  -42.979 150.132 1.00 102.20 ? 295 ILE F C     1 
ATOM   7628  O O     . ILE E 1 295 ? 48.504  -43.737 150.729 1.00 103.71 ? 295 ILE F O     1 
ATOM   7629  C CB    . ILE E 1 295 ? 47.051  -43.342 147.763 1.00 90.26  ? 295 ILE F CB    1 
ATOM   7630  C CG1   . ILE E 1 295 ? 45.974  -43.900 146.829 1.00 89.80  ? 295 ILE F CG1   1 
ATOM   7631  C CG2   . ILE E 1 295 ? 48.398  -44.000 147.497 1.00 86.38  ? 295 ILE F CG2   1 
ATOM   7632  C CD1   . ILE E 1 295 ? 46.214  -43.600 145.366 1.00 92.39  ? 295 ILE F CD1   1 
ATOM   7633  N N     . ARG E 1 296 ? 47.811  -41.653 150.227 1.00 103.80 ? 296 ARG F N     1 
ATOM   7634  C CA    . ARG E 1 296 ? 48.852  -40.996 151.014 1.00 108.43 ? 296 ARG F CA    1 
ATOM   7635  C C     . ARG E 1 296 ? 48.655  -41.261 152.506 1.00 107.99 ? 296 ARG F C     1 
ATOM   7636  O O     . ARG E 1 296 ? 49.611  -41.234 153.280 1.00 111.26 ? 296 ARG F O     1 
ATOM   7637  C CB    . ARG E 1 296 ? 48.883  -39.487 150.725 1.00 115.11 ? 296 ARG F CB    1 
ATOM   7638  C CG    . ARG E 1 296 ? 50.272  -38.917 150.394 1.00 122.12 ? 296 ARG F CG    1 
ATOM   7639  C CD    . ARG E 1 296 ? 50.198  -37.463 149.894 1.00 122.46 ? 296 ARG F CD    1 
ATOM   7640  N NE    . ARG E 1 296 ? 50.472  -37.335 148.459 1.00 116.86 ? 296 ARG F NE    1 
ATOM   7641  C CZ    . ARG E 1 296 ? 50.369  -36.202 147.767 1.00 109.71 ? 296 ARG F CZ    1 
ATOM   7642  N NH1   . ARG E 1 296 ? 49.991  -35.080 148.368 1.00 104.94 ? 296 ARG F NH1   1 
ATOM   7643  N NH2   . ARG E 1 296 ? 50.640  -36.188 146.468 1.00 107.12 ? 296 ARG F NH2   1 
ATOM   7644  N N     . SER E 1 297 ? 47.411  -41.519 152.902 1.00 104.96 ? 297 SER F N     1 
ATOM   7645  C CA    . SER E 1 297 ? 47.104  -41.879 154.283 1.00 103.70 ? 297 SER F CA    1 
ATOM   7646  C C     . SER E 1 297 ? 47.542  -43.309 154.564 1.00 105.42 ? 297 SER F C     1 
ATOM   7647  O O     . SER E 1 297 ? 48.071  -43.607 155.634 1.00 108.14 ? 297 SER F O     1 
ATOM   7648  C CB    . SER E 1 297 ? 45.610  -41.723 154.571 1.00 102.29 ? 297 SER F CB    1 
ATOM   7649  O OG    . SER E 1 297 ? 45.253  -40.357 154.684 1.00 104.18 ? 297 SER F OG    1 
ATOM   7650  N N     . LEU E 1 298 ? 47.315  -44.190 153.594 1.00 102.66 ? 298 LEU F N     1 
ATOM   7651  C CA    . LEU E 1 298 ? 47.793  -45.566 153.680 1.00 99.83  ? 298 LEU F CA    1 
ATOM   7652  C C     . LEU E 1 298 ? 49.319  -45.612 153.732 1.00 107.02 ? 298 LEU F C     1 
ATOM   7653  O O     . LEU E 1 298 ? 49.897  -46.526 154.315 1.00 110.94 ? 298 LEU F O     1 
ATOM   7654  C CB    . LEU E 1 298 ? 47.283  -46.394 152.496 1.00 97.67  ? 298 LEU F CB    1 
ATOM   7655  C CG    . LEU E 1 298 ? 45.886  -47.011 152.587 1.00 84.33  ? 298 LEU F CG    1 
ATOM   7656  C CD1   . LEU E 1 298 ? 45.456  -47.577 151.243 1.00 83.87  ? 298 LEU F CD1   1 
ATOM   7657  C CD2   . LEU E 1 298 ? 45.841  -48.090 153.658 1.00 89.61  ? 298 LEU F CD2   1 
ATOM   7658  N N     . GLU E 1 299 ? 49.965  -44.622 153.121 1.00 112.32 ? 299 GLU F N     1 
ATOM   7659  C CA    . GLU E 1 299 ? 51.425  -44.557 153.099 1.00 115.49 ? 299 GLU F CA    1 
ATOM   7660  C C     . GLU E 1 299 ? 51.960  -44.120 154.458 1.00 120.67 ? 299 GLU F C     1 
ATOM   7661  O O     . GLU E 1 299 ? 52.915  -44.697 154.981 1.00 123.40 ? 299 GLU F O     1 
ATOM   7662  C CB    . GLU E 1 299 ? 51.903  -43.589 152.012 1.00 112.32 ? 299 GLU F CB    1 
ATOM   7663  C CG    . GLU E 1 299 ? 53.414  -43.582 151.783 1.00 113.64 ? 299 GLU F CG    1 
ATOM   7664  C CD    . GLU E 1 299 ? 53.869  -42.385 150.963 1.00 116.70 ? 299 GLU F CD    1 
ATOM   7665  O OE1   . GLU E 1 299 ? 53.147  -41.365 150.952 1.00 117.29 ? 299 GLU F OE1   1 
ATOM   7666  O OE2   . GLU E 1 299 ? 54.944  -42.460 150.328 1.00 117.29 ? 299 GLU F OE2   1 
ATOM   7667  N N     . ARG E 1 300 ? 51.325  -43.100 155.026 1.00 120.82 ? 300 ARG F N     1 
ATOM   7668  C CA    . ARG E 1 300 ? 51.709  -42.576 156.331 1.00 120.54 ? 300 ARG F CA    1 
ATOM   7669  C C     . ARG E 1 300 ? 51.366  -43.548 157.455 1.00 123.32 ? 300 ARG F C     1 
ATOM   7670  O O     . ARG E 1 300 ? 51.896  -43.445 158.562 1.00 128.74 ? 300 ARG F O     1 
ATOM   7671  C CB    . ARG E 1 300 ? 51.045  -41.221 156.569 1.00 115.16 ? 300 ARG F CB    1 
ATOM   7672  C CG    . ARG E 1 300 ? 51.495  -40.164 155.581 1.00 118.66 ? 300 ARG F CG    1 
ATOM   7673  C CD    . ARG E 1 300 ? 50.817  -38.835 155.827 1.00 123.23 ? 300 ARG F CD    1 
ATOM   7674  N NE    . ARG E 1 300 ? 51.305  -38.188 157.039 1.00 125.90 ? 300 ARG F NE    1 
ATOM   7675  C CZ    . ARG E 1 300 ? 50.897  -36.995 157.454 1.00 125.49 ? 300 ARG F CZ    1 
ATOM   7676  N NH1   . ARG E 1 300 ? 49.994  -36.327 156.750 1.00 122.32 ? 300 ARG F NH1   1 
ATOM   7677  N NH2   . ARG E 1 300 ? 51.388  -36.472 158.569 1.00 127.96 ? 300 ARG F NH2   1 
ATOM   7678  N N     . GLY E 1 301 ? 50.479  -44.494 157.164 1.00 119.59 ? 301 GLY F N     1 
ATOM   7679  C CA    . GLY E 1 301 ? 50.149  -45.542 158.110 1.00 121.51 ? 301 GLY F CA    1 
ATOM   7680  C C     . GLY E 1 301 ? 51.072  -46.726 157.907 1.00 124.31 ? 301 GLY F C     1 
ATOM   7681  O O     . GLY E 1 301 ? 50.929  -47.762 158.558 1.00 128.87 ? 301 GLY F O     1 
ATOM   7682  N N     . GLU E 1 302 ? 52.024  -46.555 156.992 1.00 122.72 ? 302 GLU F N     1 
ATOM   7683  C CA    . GLU E 1 302 ? 52.984  -47.596 156.631 1.00 123.63 ? 302 GLU F CA    1 
ATOM   7684  C C     . GLU E 1 302 ? 52.303  -48.884 156.185 1.00 119.42 ? 302 GLU F C     1 
ATOM   7685  O O     . GLU E 1 302 ? 52.775  -49.984 156.463 1.00 119.50 ? 302 GLU F O     1 
ATOM   7686  C CB    . GLU E 1 302 ? 53.976  -47.851 157.768 1.00 127.52 ? 302 GLU F CB    1 
ATOM   7687  C CG    . GLU E 1 302 ? 54.756  -46.609 158.154 1.00 132.48 ? 302 GLU F CG    1 
ATOM   7688  C CD    . GLU E 1 302 ? 55.847  -46.883 159.165 1.00 137.92 ? 302 GLU F CD    1 
ATOM   7689  O OE1   . GLU E 1 302 ? 56.284  -48.049 159.278 1.00 141.46 ? 302 GLU F OE1   1 
ATOM   7690  O OE2   . GLU E 1 302 ? 56.267  -45.926 159.848 1.00 137.28 ? 302 GLU F OE2   1 
ATOM   7691  N N     . ARG E 1 303 ? 51.184  -48.728 155.489 1.00 117.08 ? 303 ARG F N     1 
ATOM   7692  C CA    . ARG E 1 303 ? 50.485  -49.851 154.887 1.00 114.27 ? 303 ARG F CA    1 
ATOM   7693  C C     . ARG E 1 303 ? 50.745  -49.818 153.383 1.00 113.48 ? 303 ARG F C     1 
ATOM   7694  O O     . ARG E 1 303 ? 49.826  -49.632 152.586 1.00 111.20 ? 303 ARG F O     1 
ATOM   7695  C CB    . ARG E 1 303 ? 48.988  -49.757 155.188 1.00 108.98 ? 303 ARG F CB    1 
ATOM   7696  C CG    . ARG E 1 303 ? 48.677  -49.616 156.674 1.00 107.87 ? 303 ARG F CG    1 
ATOM   7697  C CD    . ARG E 1 303 ? 47.219  -49.265 156.930 1.00 105.88 ? 303 ARG F CD    1 
ATOM   7698  N NE    . ARG E 1 303 ? 46.309  -50.326 156.510 1.00 104.30 ? 303 ARG F NE    1 
ATOM   7699  C CZ    . ARG E 1 303 ? 45.000  -50.317 156.736 1.00 107.81 ? 303 ARG F CZ    1 
ATOM   7700  N NH1   . ARG E 1 303 ? 44.445  -49.303 157.385 1.00 106.43 ? 303 ARG F NH1   1 
ATOM   7701  N NH2   . ARG E 1 303 ? 44.246  -51.324 156.316 1.00 111.87 ? 303 ARG F NH2   1 
ATOM   7702  N N     . PHE E 1 304 ? 52.009  -50.006 153.010 1.00 111.39 ? 304 PHE F N     1 
ATOM   7703  C CA    . PHE E 1 304 ? 52.473  -49.761 151.643 1.00 105.17 ? 304 PHE F CA    1 
ATOM   7704  C C     . PHE E 1 304 ? 51.842  -50.655 150.583 1.00 103.69 ? 304 PHE F C     1 
ATOM   7705  O O     . PHE E 1 304 ? 51.491  -50.184 149.503 1.00 105.46 ? 304 PHE F O     1 
ATOM   7706  C CB    . PHE E 1 304 ? 53.996  -49.867 151.568 1.00 103.31 ? 304 PHE F CB    1 
ATOM   7707  C CG    . PHE E 1 304 ? 54.702  -49.056 152.605 1.00 105.38 ? 304 PHE F CG    1 
ATOM   7708  C CD1   . PHE E 1 304 ? 54.892  -47.697 152.429 1.00 105.13 ? 304 PHE F CD1   1 
ATOM   7709  C CD2   . PHE E 1 304 ? 55.168  -49.651 153.763 1.00 108.31 ? 304 PHE F CD2   1 
ATOM   7710  C CE1   . PHE E 1 304 ? 55.538  -46.947 153.390 1.00 105.53 ? 304 PHE F CE1   1 
ATOM   7711  C CE2   . PHE E 1 304 ? 55.815  -48.908 154.725 1.00 109.25 ? 304 PHE F CE2   1 
ATOM   7712  C CZ    . PHE E 1 304 ? 56.001  -47.553 154.539 1.00 107.87 ? 304 PHE F CZ    1 
ATOM   7713  N N     . ALA E 1 305 ? 51.709  -51.941 150.884 1.00 105.35 ? 305 ALA F N     1 
ATOM   7714  C CA    . ALA E 1 305 ? 51.131  -52.875 149.926 1.00 111.09 ? 305 ALA F CA    1 
ATOM   7715  C C     . ALA E 1 305 ? 49.707  -52.475 149.541 1.00 109.48 ? 305 ALA F C     1 
ATOM   7716  O O     . ALA E 1 305 ? 49.322  -52.564 148.377 1.00 109.41 ? 305 ALA F O     1 
ATOM   7717  C CB    . ALA E 1 305 ? 51.162  -54.292 150.474 1.00 115.27 ? 305 ALA F CB    1 
ATOM   7718  N N     . GLU E 1 306 ? 48.933  -52.023 150.520 1.00 106.83 ? 306 GLU F N     1 
ATOM   7719  C CA    . GLU E 1 306 ? 47.562  -51.601 150.266 1.00 103.65 ? 306 GLU F CA    1 
ATOM   7720  C C     . GLU E 1 306 ? 47.549  -50.291 149.493 1.00 97.35  ? 306 GLU F C     1 
ATOM   7721  O O     . GLU E 1 306 ? 46.744  -50.099 148.580 1.00 95.28  ? 306 GLU F O     1 
ATOM   7722  C CB    . GLU E 1 306 ? 46.809  -51.450 151.582 1.00 109.15 ? 306 GLU F CB    1 
ATOM   7723  C CG    . GLU E 1 306 ? 46.683  -52.749 152.343 1.00 117.35 ? 306 GLU F CG    1 
ATOM   7724  C CD    . GLU E 1 306 ? 46.239  -52.539 153.768 1.00 125.12 ? 306 GLU F CD    1 
ATOM   7725  O OE1   . GLU E 1 306 ? 45.022  -52.631 154.031 1.00 127.05 ? 306 GLU F OE1   1 
ATOM   7726  O OE2   . GLU E 1 306 ? 47.110  -52.280 154.624 1.00 128.91 ? 306 GLU F OE2   1 
ATOM   7727  N N     . ALA E 1 307 ? 48.461  -49.401 149.865 1.00 93.98  ? 307 ALA F N     1 
ATOM   7728  C CA    . ALA E 1 307 ? 48.591  -48.102 149.220 1.00 91.27  ? 307 ALA F CA    1 
ATOM   7729  C C     . ALA E 1 307 ? 48.995  -48.253 147.759 1.00 93.51  ? 307 ALA F C     1 
ATOM   7730  O O     . ALA E 1 307 ? 48.587  -47.464 146.907 1.00 93.15  ? 307 ALA F O     1 
ATOM   7731  C CB    . ALA E 1 307 ? 49.607  -47.256 149.962 1.00 84.88  ? 307 ALA F CB    1 
ATOM   7732  N N     . HIS E 1 308 ? 49.801  -49.273 147.485 1.00 98.01  ? 308 HIS F N     1 
ATOM   7733  C CA    . HIS E 1 308 ? 50.295  -49.535 146.140 1.00 98.50  ? 308 HIS F CA    1 
ATOM   7734  C C     . HIS E 1 308 ? 49.200  -50.142 145.283 1.00 98.66  ? 308 HIS F C     1 
ATOM   7735  O O     . HIS E 1 308 ? 49.110  -49.877 144.083 1.00 102.89 ? 308 HIS F O     1 
ATOM   7736  C CB    . HIS E 1 308 ? 51.488  -50.490 146.188 1.00 97.11  ? 308 HIS F CB    1 
ATOM   7737  C CG    . HIS E 1 308 ? 51.985  -50.902 144.834 1.00 96.04  ? 308 HIS F CG    1 
ATOM   7738  N ND1   . HIS E 1 308 ? 51.524  -52.031 144.196 1.00 99.11  ? 308 HIS F ND1   1 
ATOM   7739  C CD2   . HIS E 1 308 ? 52.884  -50.336 144.004 1.00 94.69  ? 308 HIS F CD2   1 
ATOM   7740  C CE1   . HIS E 1 308 ? 52.132  -52.146 143.016 1.00 100.64 ? 308 HIS F CE1   1 
ATOM   7741  N NE2   . HIS E 1 308 ? 52.962  -51.121 142.888 1.00 98.43  ? 308 HIS F NE2   1 
ATOM   7742  N N     . ALA E 1 309 ? 48.373  -50.969 145.910 1.00 96.24  ? 309 ALA F N     1 
ATOM   7743  C CA    . ALA E 1 309 ? 47.281  -51.617 145.206 1.00 98.16  ? 309 ALA F CA    1 
ATOM   7744  C C     . ALA E 1 309 ? 46.264  -50.576 144.756 1.00 95.48  ? 309 ALA F C     1 
ATOM   7745  O O     . ALA E 1 309 ? 45.772  -50.626 143.630 1.00 100.14 ? 309 ALA F O     1 
ATOM   7746  C CB    . ALA E 1 309 ? 46.627  -52.669 146.090 1.00 84.65  ? 309 ALA F CB    1 
ATOM   7747  N N     . LEU E 1 310 ? 45.966  -49.622 145.632 1.00 89.94  ? 310 LEU F N     1 
ATOM   7748  C CA    . LEU E 1 310 ? 45.001  -48.577 145.312 1.00 87.77  ? 310 LEU F CA    1 
ATOM   7749  C C     . LEU E 1 310 ? 45.579  -47.597 144.296 1.00 89.60  ? 310 LEU F C     1 
ATOM   7750  O O     . LEU E 1 310 ? 44.865  -47.099 143.426 1.00 88.34  ? 310 LEU F O     1 
ATOM   7751  C CB    . LEU E 1 310 ? 44.559  -47.837 146.577 1.00 86.54  ? 310 LEU F CB    1 
ATOM   7752  C CG    . LEU E 1 310 ? 43.426  -46.818 146.432 1.00 87.27  ? 310 LEU F CG    1 
ATOM   7753  C CD1   . LEU E 1 310 ? 42.152  -47.482 145.928 1.00 82.40  ? 310 LEU F CD1   1 
ATOM   7754  C CD2   . LEU E 1 310 ? 43.175  -46.116 147.756 1.00 89.36  ? 310 LEU F CD2   1 
ATOM   7755  N N     . ALA E 1 311 ? 46.877  -47.332 144.410 1.00 94.25  ? 311 ALA F N     1 
ATOM   7756  C CA    . ALA E 1 311 ? 47.565  -46.432 143.491 1.00 92.90  ? 311 ALA F CA    1 
ATOM   7757  C C     . ALA E 1 311 ? 47.558  -46.986 142.073 1.00 94.90  ? 311 ALA F C     1 
ATOM   7758  O O     . ALA E 1 311 ? 47.349  -46.250 141.108 1.00 92.99  ? 311 ALA F O     1 
ATOM   7759  C CB    . ALA E 1 311 ? 48.991  -46.195 143.952 1.00 90.36  ? 311 ALA F CB    1 
ATOM   7760  N N     . ARG E 1 312 ? 47.792  -48.288 141.953 1.00 97.86  ? 312 ARG F N     1 
ATOM   7761  C CA    . ARG E 1 312 ? 47.795  -48.931 140.650 1.00 96.88  ? 312 ARG F CA    1 
ATOM   7762  C C     . ARG E 1 312 ? 46.380  -48.937 140.084 1.00 95.59  ? 312 ARG F C     1 
ATOM   7763  O O     . ARG E 1 312 ? 46.183  -48.794 138.877 1.00 93.21  ? 312 ARG F O     1 
ATOM   7764  C CB    . ARG E 1 312 ? 48.342  -50.356 140.745 1.00 93.92  ? 312 ARG F CB    1 
ATOM   7765  C CG    . ARG E 1 312 ? 49.300  -50.713 139.620 1.00 98.98  ? 312 ARG F CG    1 
ATOM   7766  C CD    . ARG E 1 312 ? 49.493  -52.213 139.506 1.00 109.94 ? 312 ARG F CD    1 
ATOM   7767  N NE    . ARG E 1 312 ? 48.321  -52.866 138.931 1.00 115.61 ? 312 ARG F NE    1 
ATOM   7768  C CZ    . ARG E 1 312 ? 48.124  -53.017 137.625 1.00 116.28 ? 312 ARG F CZ    1 
ATOM   7769  N NH1   . ARG E 1 312 ? 49.026  -52.562 136.764 1.00 115.16 ? 312 ARG F NH1   1 
ATOM   7770  N NH2   . ARG E 1 312 ? 47.030  -53.622 137.178 1.00 113.77 ? 312 ARG F NH2   1 
ATOM   7771  N N     . GLU E 1 313 ? 45.401  -49.094 140.971 1.00 94.98  ? 313 GLU F N     1 
ATOM   7772  C CA    . GLU E 1 313 ? 43.994  -49.078 140.590 1.00 92.42  ? 313 GLU F CA    1 
ATOM   7773  C C     . GLU E 1 313 ? 43.623  -47.683 140.104 1.00 97.13  ? 313 GLU F C     1 
ATOM   7774  O O     . GLU E 1 313 ? 42.873  -47.523 139.139 1.00 99.61  ? 313 GLU F O     1 
ATOM   7775  C CB    . GLU E 1 313 ? 43.117  -49.468 141.784 1.00 90.88  ? 313 GLU F CB    1 
ATOM   7776  C CG    . GLU E 1 313 ? 41.653  -49.727 141.442 1.00 102.80 ? 313 GLU F CG    1 
ATOM   7777  C CD    . GLU E 1 313 ? 40.799  -49.987 142.678 1.00 115.00 ? 313 GLU F CD    1 
ATOM   7778  O OE1   . GLU E 1 313 ? 40.363  -49.006 143.320 1.00 113.97 ? 313 GLU F OE1   1 
ATOM   7779  O OE2   . GLU E 1 313 ? 40.566  -51.172 143.008 1.00 119.58 ? 313 GLU F OE2   1 
ATOM   7780  N N     . ALA E 1 314 ? 44.170  -46.679 140.782 1.00 96.88  ? 314 ALA F N     1 
ATOM   7781  C CA    . ALA E 1 314 ? 43.919  -45.284 140.445 1.00 91.91  ? 314 ALA F CA    1 
ATOM   7782  C C     . ALA E 1 314 ? 44.553  -44.917 139.111 1.00 97.16  ? 314 ALA F C     1 
ATOM   7783  O O     . ALA E 1 314 ? 43.900  -44.341 138.242 1.00 102.23 ? 314 ALA F O     1 
ATOM   7784  C CB    . ALA E 1 314 ? 44.446  -44.375 141.544 1.00 87.34  ? 314 ALA F CB    1 
ATOM   7785  N N     . SER E 1 315 ? 45.828  -45.258 138.951 1.00 99.34  ? 315 SER F N     1 
ATOM   7786  C CA    . SER E 1 315 ? 46.574  -44.879 137.755 1.00 100.50 ? 315 SER F CA    1 
ATOM   7787  C C     . SER E 1 315 ? 46.022  -45.517 136.483 1.00 100.13 ? 315 SER F C     1 
ATOM   7788  O O     . SER E 1 315 ? 46.291  -45.044 135.381 1.00 98.63  ? 315 SER F O     1 
ATOM   7789  C CB    . SER E 1 315 ? 48.065  -45.194 137.912 1.00 100.47 ? 315 SER F CB    1 
ATOM   7790  O OG    . SER E 1 315 ? 48.274  -46.554 138.245 1.00 104.97 ? 315 SER F OG    1 
ATOM   7791  N N     . CYS E 1 316 ? 45.247  -46.585 136.638 1.00 102.66 ? 316 CYS F N     1 
ATOM   7792  C CA    . CYS E 1 316 ? 44.618  -47.227 135.492 1.00 106.23 ? 316 CYS F CA    1 
ATOM   7793  C C     . CYS E 1 316 ? 43.427  -46.415 134.999 1.00 108.12 ? 316 CYS F C     1 
ATOM   7794  O O     . CYS E 1 316 ? 43.150  -46.365 133.802 1.00 111.75 ? 316 CYS F O     1 
ATOM   7795  C CB    . CYS E 1 316 ? 44.186  -48.652 135.838 1.00 105.54 ? 316 CYS F CB    1 
ATOM   7796  S SG    . CYS E 1 316 ? 45.560  -49.818 135.947 1.00 116.62 ? 316 CYS F SG    1 
ATOM   7797  N N     . ALA E 1 317 ? 42.728  -45.776 135.930 1.00 103.48 ? 317 ALA F N     1 
ATOM   7798  C CA    . ALA E 1 317 ? 41.581  -44.948 135.584 1.00 101.26 ? 317 ALA F CA    1 
ATOM   7799  C C     . ALA E 1 317 ? 41.513  -43.736 136.501 1.00 105.73 ? 317 ALA F C     1 
ATOM   7800  O O     . ALA E 1 317 ? 40.683  -43.686 137.409 1.00 112.18 ? 317 ALA F O     1 
ATOM   7801  C CB    . ALA E 1 317 ? 40.300  -45.758 135.674 1.00 98.20  ? 317 ALA F CB    1 
ATOM   7802  N N     . PRO E 1 318 ? 42.398  -42.754 136.268 1.00 100.85 ? 318 PRO F N     1 
ATOM   7803  C CA    . PRO E 1 318 ? 42.503  -41.564 137.119 1.00 96.81  ? 318 PRO F CA    1 
ATOM   7804  C C     . PRO E 1 318 ? 41.273  -40.671 136.997 1.00 95.17  ? 318 PRO F C     1 
ATOM   7805  O O     . PRO E 1 318 ? 40.647  -40.633 135.938 1.00 98.75  ? 318 PRO F O     1 
ATOM   7806  C CB    . PRO E 1 318 ? 43.741  -40.851 136.568 1.00 96.18  ? 318 PRO F CB    1 
ATOM   7807  C CG    . PRO E 1 318 ? 43.839  -41.303 135.157 1.00 85.43  ? 318 PRO F CG    1 
ATOM   7808  C CD    . PRO E 1 318 ? 43.351  -42.715 135.144 1.00 99.16  ? 318 PRO F CD    1 
ATOM   7809  N N     . GLU E 1 319 ? 40.933  -39.963 138.070 1.00 91.35  ? 319 GLU F N     1 
ATOM   7810  C CA    . GLU E 1 319 ? 39.749  -39.110 138.067 1.00 86.91  ? 319 GLU F CA    1 
ATOM   7811  C C     . GLU E 1 319 ? 40.006  -37.742 137.439 1.00 90.03  ? 319 GLU F C     1 
ATOM   7812  O O     . GLU E 1 319 ? 39.066  -37.037 137.083 1.00 96.93  ? 319 GLU F O     1 
ATOM   7813  C CB    . GLU E 1 319 ? 39.189  -38.948 139.484 1.00 83.79  ? 319 GLU F CB    1 
ATOM   7814  C CG    . GLU E 1 319 ? 40.155  -38.314 140.469 1.00 94.20  ? 319 GLU F CG    1 
ATOM   7815  C CD    . GLU E 1 319 ? 39.560  -38.159 141.858 1.00 105.63 ? 319 GLU F CD    1 
ATOM   7816  O OE1   . GLU E 1 319 ? 38.335  -38.347 142.010 1.00 105.94 ? 319 GLU F OE1   1 
ATOM   7817  O OE2   . GLU E 1 319 ? 40.320  -37.845 142.800 1.00 112.82 ? 319 GLU F OE2   1 
ATOM   7818  N N     . SER E 1 320 ? 41.275  -37.371 137.302 1.00 90.10  ? 320 SER F N     1 
ATOM   7819  C CA    . SER E 1 320 ? 41.634  -36.083 136.716 1.00 94.88  ? 320 SER F CA    1 
ATOM   7820  C C     . SER E 1 320 ? 43.117  -36.021 136.373 1.00 102.18 ? 320 SER F C     1 
ATOM   7821  O O     . SER E 1 320 ? 43.889  -36.893 136.770 1.00 109.91 ? 320 SER F O     1 
ATOM   7822  C CB    . SER E 1 320 ? 41.288  -34.944 137.678 1.00 97.84  ? 320 SER F CB    1 
ATOM   7823  O OG    . SER E 1 320 ? 41.992  -35.078 138.900 1.00 101.12 ? 320 SER F OG    1 
ATOM   7824  N N     . ASP E 1 321 ? 43.512  -34.988 135.636 1.00 102.21 ? 321 ASP F N     1 
ATOM   7825  C CA    . ASP E 1 321 ? 44.926  -34.746 135.379 1.00 102.13 ? 321 ASP F CA    1 
ATOM   7826  C C     . ASP E 1 321 ? 45.611  -34.319 136.666 1.00 98.59  ? 321 ASP F C     1 
ATOM   7827  O O     . ASP E 1 321 ? 46.829  -34.427 136.800 1.00 99.67  ? 321 ASP F O     1 
ATOM   7828  C CB    . ASP E 1 321 ? 45.118  -33.669 134.313 1.00 108.54 ? 321 ASP F CB    1 
ATOM   7829  C CG    . ASP E 1 321 ? 44.663  -34.120 132.945 1.00 117.48 ? 321 ASP F CG    1 
ATOM   7830  O OD1   . ASP E 1 321 ? 44.465  -35.339 132.757 1.00 123.00 ? 321 ASP F OD1   1 
ATOM   7831  O OD2   . ASP E 1 321 ? 44.511  -33.256 132.055 1.00 120.57 ? 321 ASP F OD2   1 
ATOM   7832  N N     . ALA E 1 322 ? 44.819  -33.822 137.609 1.00 95.82  ? 322 ALA F N     1 
ATOM   7833  C CA    . ALA E 1 322 ? 45.339  -33.440 138.910 1.00 93.48  ? 322 ALA F CA    1 
ATOM   7834  C C     . ALA E 1 322 ? 45.764  -34.682 139.683 1.00 93.38  ? 322 ALA F C     1 
ATOM   7835  O O     . ALA E 1 322 ? 46.800  -34.684 140.347 1.00 89.97  ? 322 ALA F O     1 
ATOM   7836  C CB    . ALA E 1 322 ? 44.298  -32.656 139.686 1.00 82.21  ? 322 ALA F CB    1 
ATOM   7837  N N     . GLU E 1 323 ? 44.960  -35.738 139.591 1.00 95.19  ? 323 GLU F N     1 
ATOM   7838  C CA    . GLU E 1 323 ? 45.273  -36.996 140.260 1.00 93.75  ? 323 GLU F CA    1 
ATOM   7839  C C     . GLU E 1 323 ? 46.446  -37.684 139.572 1.00 97.27  ? 323 GLU F C     1 
ATOM   7840  O O     . GLU E 1 323 ? 47.248  -38.362 140.215 1.00 104.08 ? 323 GLU F O     1 
ATOM   7841  C CB    . GLU E 1 323 ? 44.050  -37.923 140.286 1.00 93.32  ? 323 GLU F CB    1 
ATOM   7842  C CG    . GLU E 1 323 ? 44.311  -39.285 140.930 1.00 100.62 ? 323 GLU F CG    1 
ATOM   7843  C CD    . GLU E 1 323 ? 43.039  -40.066 141.222 1.00 106.19 ? 323 GLU F CD    1 
ATOM   7844  O OE1   . GLU E 1 323 ? 42.615  -40.089 142.397 1.00 111.38 ? 323 GLU F OE1   1 
ATOM   7845  O OE2   . GLU E 1 323 ? 42.470  -40.665 140.284 1.00 104.35 ? 323 GLU F OE2   1 
ATOM   7846  N N     . ARG E 1 324 ? 46.545  -37.490 138.260 1.00 93.67  ? 324 ARG F N     1 
ATOM   7847  C CA    . ARG E 1 324 ? 47.596  -38.120 137.469 1.00 93.32  ? 324 ARG F CA    1 
ATOM   7848  C C     . ARG E 1 324 ? 48.984  -37.688 137.924 1.00 97.23  ? 324 ARG F C     1 
ATOM   7849  O O     . ARG E 1 324 ? 49.904  -38.503 137.999 1.00 101.91 ? 324 ARG F O     1 
ATOM   7850  C CB    . ARG E 1 324 ? 47.415  -37.814 135.979 1.00 92.24  ? 324 ARG F CB    1 
ATOM   7851  C CG    . ARG E 1 324 ? 46.440  -38.732 135.261 1.00 98.79  ? 324 ARG F CG    1 
ATOM   7852  C CD    . ARG E 1 324 ? 46.498  -38.524 133.753 1.00 110.72 ? 324 ARG F CD    1 
ATOM   7853  N NE    . ARG E 1 324 ? 45.645  -39.463 133.026 1.00 123.04 ? 324 ARG F NE    1 
ATOM   7854  C CZ    . ARG E 1 324 ? 46.044  -40.653 132.582 1.00 129.49 ? 324 ARG F CZ    1 
ATOM   7855  N NH1   . ARG E 1 324 ? 47.290  -41.065 132.791 1.00 133.98 ? 324 ARG F NH1   1 
ATOM   7856  N NH2   . ARG E 1 324 ? 45.193  -41.436 131.929 1.00 124.20 ? 324 ARG F NH2   1 
ATOM   7857  N N     . GLN E 1 325 ? 49.128  -36.404 138.232 1.00 99.53  ? 325 GLN F N     1 
ATOM   7858  C CA    . GLN E 1 325 ? 50.418  -35.855 138.632 1.00 106.09 ? 325 GLN F CA    1 
ATOM   7859  C C     . GLN E 1 325 ? 50.667  -36.054 140.123 1.00 104.78 ? 325 GLN F C     1 
ATOM   7860  O O     . GLN E 1 325 ? 51.800  -35.951 140.593 1.00 107.57 ? 325 GLN F O     1 
ATOM   7861  C CB    . GLN E 1 325 ? 50.515  -34.376 138.254 1.00 110.74 ? 325 GLN F CB    1 
ATOM   7862  C CG    . GLN E 1 325 ? 49.410  -33.510 138.825 1.00 113.13 ? 325 GLN F CG    1 
ATOM   7863  C CD    . GLN E 1 325 ? 49.401  -32.119 138.225 1.00 116.47 ? 325 GLN F CD    1 
ATOM   7864  O OE1   . GLN E 1 325 ? 50.055  -31.862 137.214 1.00 120.21 ? 325 GLN F OE1   1 
ATOM   7865  N NE2   . GLN E 1 325 ? 48.658  -31.212 138.847 1.00 116.79 ? 325 GLN F NE2   1 
ATOM   7866  N N     . GLY E 1 326 ? 49.601  -36.344 140.862 1.00 101.45 ? 326 GLY F N     1 
ATOM   7867  C CA    . GLY E 1 326 ? 49.723  -36.722 142.257 1.00 101.50 ? 326 GLY F CA    1 
ATOM   7868  C C     . GLY E 1 326 ? 50.216  -38.152 142.355 1.00 101.74 ? 326 GLY F C     1 
ATOM   7869  O O     . GLY E 1 326 ? 51.098  -38.468 143.156 1.00 105.02 ? 326 GLY F O     1 
ATOM   7870  N N     . LEU E 1 327 ? 49.641  -39.018 141.525 1.00 96.10  ? 327 LEU F N     1 
ATOM   7871  C CA    . LEU E 1 327 ? 50.071  -40.407 141.427 1.00 97.02  ? 327 LEU F CA    1 
ATOM   7872  C C     . LEU E 1 327 ? 51.503  -40.505 140.918 1.00 108.00 ? 327 LEU F C     1 
ATOM   7873  O O     . LEU E 1 327 ? 52.243  -41.417 141.288 1.00 112.18 ? 327 LEU F O     1 
ATOM   7874  C CB    . LEU E 1 327 ? 49.147  -41.178 140.484 1.00 96.11  ? 327 LEU F CB    1 
ATOM   7875  C CG    . LEU E 1 327 ? 47.779  -41.577 141.030 1.00 99.55  ? 327 LEU F CG    1 
ATOM   7876  C CD1   . LEU E 1 327 ? 46.813  -41.837 139.885 1.00 98.43  ? 327 LEU F CD1   1 
ATOM   7877  C CD2   . LEU E 1 327 ? 47.912  -42.807 141.916 1.00 101.70 ? 327 LEU F CD2   1 
ATOM   7878  N N     . ALA E 1 328 ? 51.886  -39.559 140.065 1.00 108.11 ? 328 ALA F N     1 
ATOM   7879  C CA    . ALA E 1 328 ? 53.202  -39.575 139.439 1.00 104.47 ? 328 ALA F CA    1 
ATOM   7880  C C     . ALA E 1 328 ? 54.327  -39.485 140.465 1.00 109.05 ? 328 ALA F C     1 
ATOM   7881  O O     . ALA E 1 328 ? 55.446  -39.922 140.205 1.00 112.47 ? 328 ALA F O     1 
ATOM   7882  C CB    . ALA E 1 328 ? 53.314  -38.456 138.425 1.00 105.82 ? 328 ALA F CB    1 
ATOM   7883  N N     . ARG E 1 329 ? 54.029  -38.915 141.628 1.00 112.21 ? 329 ARG F N     1 
ATOM   7884  C CA    . ARG E 1 329 ? 55.003  -38.863 142.712 1.00 114.88 ? 329 ARG F CA    1 
ATOM   7885  C C     . ARG E 1 329 ? 54.780  -40.003 143.702 1.00 119.00 ? 329 ARG F C     1 
ATOM   7886  O O     . ARG E 1 329 ? 55.734  -40.583 144.218 1.00 123.93 ? 329 ARG F O     1 
ATOM   7887  C CB    . ARG E 1 329 ? 54.928  -37.526 143.444 1.00 111.09 ? 329 ARG F CB    1 
ATOM   7888  C CG    . ARG E 1 329 ? 54.692  -36.332 142.546 1.00 108.46 ? 329 ARG F CG    1 
ATOM   7889  C CD    . ARG E 1 329 ? 54.667  -35.066 143.375 1.00 107.25 ? 329 ARG F CD    1 
ATOM   7890  N NE    . ARG E 1 329 ? 54.133  -33.922 142.649 1.00 109.58 ? 329 ARG F NE    1 
ATOM   7891  C CZ    . ARG E 1 329 ? 52.872  -33.512 142.734 1.00 112.35 ? 329 ARG F CZ    1 
ATOM   7892  N NH1   . ARG E 1 329 ? 52.010  -34.156 143.514 1.00 114.61 ? 329 ARG F NH1   1 
ATOM   7893  N NH2   . ARG E 1 329 ? 52.475  -32.457 142.039 1.00 111.25 ? 329 ARG F NH2   1 
ATOM   7894  N N     . LEU E 1 330 ? 53.514  -40.315 143.961 1.00 115.05 ? 330 LEU F N     1 
ATOM   7895  C CA    . LEU E 1 330 ? 53.146  -41.372 144.900 1.00 113.46 ? 330 LEU F CA    1 
ATOM   7896  C C     . LEU E 1 330 ? 53.632  -42.754 144.478 1.00 117.01 ? 330 LEU F C     1 
ATOM   7897  O O     . LEU E 1 330 ? 54.188  -43.497 145.288 1.00 120.79 ? 330 LEU F O     1 
ATOM   7898  C CB    . LEU E 1 330 ? 51.630  -41.405 145.091 1.00 109.63 ? 330 LEU F CB    1 
ATOM   7899  C CG    . LEU E 1 330 ? 51.106  -40.650 146.309 1.00 110.99 ? 330 LEU F CG    1 
ATOM   7900  C CD1   . LEU E 1 330 ? 49.590  -40.581 146.279 1.00 108.25 ? 330 LEU F CD1   1 
ATOM   7901  C CD2   . LEU E 1 330 ? 51.589  -41.323 147.584 1.00 112.52 ? 330 LEU F CD2   1 
ATOM   7902  N N     . LEU E 1 331 ? 53.409  -43.098 143.213 1.00 112.39 ? 331 LEU F N     1 
ATOM   7903  C CA    . LEU E 1 331 ? 53.749  -44.429 142.708 1.00 107.23 ? 331 LEU F CA    1 
ATOM   7904  C C     . LEU E 1 331 ? 55.229  -44.826 142.828 1.00 115.15 ? 331 LEU F C     1 
ATOM   7905  O O     . LEU E 1 331 ? 55.527  -45.902 143.347 1.00 118.00 ? 331 LEU F O     1 
ATOM   7906  C CB    . LEU E 1 331 ? 53.243  -44.627 141.272 1.00 99.85  ? 331 LEU F CB    1 
ATOM   7907  C CG    . LEU E 1 331 ? 52.064  -45.584 141.105 1.00 96.29  ? 331 LEU F CG    1 
ATOM   7908  C CD1   . LEU E 1 331 ? 51.748  -45.784 139.634 1.00 95.85  ? 331 LEU F CD1   1 
ATOM   7909  C CD2   . LEU E 1 331 ? 52.357  -46.914 141.777 1.00 99.06  ? 331 LEU F CD2   1 
ATOM   7910  N N     . PRO E 1 332 ? 56.159  -43.973 142.352 1.00 115.44 ? 332 PRO F N     1 
ATOM   7911  C CA    . PRO E 1 332 ? 57.571  -44.365 142.443 1.00 113.25 ? 332 PRO F CA    1 
ATOM   7912  C C     . PRO E 1 332 ? 58.025  -44.517 143.888 1.00 116.42 ? 332 PRO F C     1 
ATOM   7913  O O     . PRO E 1 332 ? 58.781  -45.435 144.207 1.00 121.64 ? 332 PRO F O     1 
ATOM   7914  C CB    . PRO E 1 332 ? 58.302  -43.188 141.788 1.00 108.03 ? 332 PRO F CB    1 
ATOM   7915  C CG    . PRO E 1 332 ? 57.285  -42.552 140.911 1.00 107.44 ? 332 PRO F CG    1 
ATOM   7916  C CD    . PRO E 1 332 ? 56.008  -42.675 141.670 1.00 111.33 ? 332 PRO F CD    1 
ATOM   7917  N N     . ARG E 1 333 ? 57.554  -43.622 144.749 1.00 114.52 ? 333 ARG F N     1 
ATOM   7918  C CA    . ARG E 1 333 ? 57.872  -43.676 146.168 1.00 111.48 ? 333 ARG F CA    1 
ATOM   7919  C C     . ARG E 1 333 ? 57.319  -44.957 146.780 1.00 109.43 ? 333 ARG F C     1 
ATOM   7920  O O     . ARG E 1 333 ? 57.961  -45.590 147.620 1.00 108.91 ? 333 ARG F O     1 
ATOM   7921  C CB    . ARG E 1 333 ? 57.291  -42.456 146.881 1.00 106.48 ? 333 ARG F CB    1 
ATOM   7922  C CG    . ARG E 1 333 ? 57.742  -42.310 148.319 1.00 107.96 ? 333 ARG F CG    1 
ATOM   7923  C CD    . ARG E 1 333 ? 57.452  -40.916 148.848 1.00 112.51 ? 333 ARG F CD    1 
ATOM   7924  N NE    . ARG E 1 333 ? 56.021  -40.635 148.907 1.00 115.41 ? 333 ARG F NE    1 
ATOM   7925  C CZ    . ARG E 1 333 ? 55.444  -39.578 148.345 1.00 119.05 ? 333 ARG F CZ    1 
ATOM   7926  N NH1   . ARG E 1 333 ? 56.177  -38.695 147.680 1.00 121.17 ? 333 ARG F NH1   1 
ATOM   7927  N NH2   . ARG E 1 333 ? 54.135  -39.402 148.451 1.00 119.33 ? 333 ARG F NH2   1 
ATOM   7928  N N     . LEU E 1 334 ? 56.123  -45.337 146.346 1.00 107.90 ? 334 LEU F N     1 
ATOM   7929  C CA    . LEU E 1 334 ? 55.486  -46.547 146.843 1.00 109.66 ? 334 LEU F CA    1 
ATOM   7930  C C     . LEU E 1 334 ? 56.206  -47.794 146.353 1.00 111.73 ? 334 LEU F C     1 
ATOM   7931  O O     . LEU E 1 334 ? 56.374  -48.757 147.100 1.00 112.68 ? 334 LEU F O     1 
ATOM   7932  C CB    . LEU E 1 334 ? 54.016  -46.588 146.432 1.00 107.83 ? 334 LEU F CB    1 
ATOM   7933  C CG    . LEU E 1 334 ? 53.041  -45.953 147.422 1.00 101.94 ? 334 LEU F CG    1 
ATOM   7934  C CD1   . LEU E 1 334 ? 51.688  -45.759 146.765 1.00 103.54 ? 334 LEU F CD1   1 
ATOM   7935  C CD2   . LEU E 1 334 ? 52.925  -46.821 148.670 1.00 95.43  ? 334 LEU F CD2   1 
ATOM   7936  N N     . GLN E 1 335 ? 56.632  -47.774 145.095 1.00 113.86 ? 335 GLN F N     1 
ATOM   7937  C CA    . GLN E 1 335 ? 57.332  -48.916 144.522 1.00 117.25 ? 335 GLN F CA    1 
ATOM   7938  C C     . GLN E 1 335 ? 58.675  -49.109 145.207 1.00 120.67 ? 335 GLN F C     1 
ATOM   7939  O O     . GLN E 1 335 ? 59.208  -50.215 145.250 1.00 121.47 ? 335 GLN F O     1 
ATOM   7940  C CB    . GLN E 1 335 ? 57.526  -48.733 143.018 1.00 118.19 ? 335 GLN F CB    1 
ATOM   7941  C CG    . GLN E 1 335 ? 56.238  -48.781 142.224 1.00 117.02 ? 335 GLN F CG    1 
ATOM   7942  C CD    . GLN E 1 335 ? 56.354  -48.044 140.910 1.00 120.73 ? 335 GLN F CD    1 
ATOM   7943  O OE1   . GLN E 1 335 ? 57.240  -47.208 140.734 1.00 122.44 ? 335 GLN F OE1   1 
ATOM   7944  N NE2   . GLN E 1 335 ? 55.461  -48.350 139.976 1.00 122.90 ? 335 GLN F NE2   1 
ATOM   7945  N N     . GLY E 1 336 ? 59.212  -48.022 145.751 1.00 122.55 ? 336 GLY F N     1 
ATOM   7946  C CA    . GLY E 1 336 ? 60.471  -48.070 146.466 1.00 121.64 ? 336 GLY F CA    1 
ATOM   7947  C C     . GLY E 1 336 ? 60.337  -48.711 147.833 1.00 116.77 ? 336 GLY F C     1 
ATOM   7948  O O     . GLY E 1 336 ? 61.199  -49.480 148.249 1.00 115.42 ? 336 GLY F O     1 
ATOM   7949  N N     . LYS E 1 337 ? 59.258  -48.390 148.539 1.00 115.25 ? 337 LYS F N     1 
ATOM   7950  C CA    . LYS E 1 337 ? 59.025  -48.968 149.859 1.00 111.77 ? 337 LYS F CA    1 
ATOM   7951  C C     . LYS E 1 337 ? 58.680  -50.449 149.759 1.00 109.73 ? 337 LYS F C     1 
ATOM   7952  O O     . LYS E 1 337 ? 58.879  -51.207 150.708 1.00 111.90 ? 337 LYS F O     1 
ATOM   7953  C CB    . LYS E 1 337 ? 57.952  -48.192 150.625 1.00 109.66 ? 337 LYS F CB    1 
ATOM   7954  C CG    . LYS E 1 337 ? 58.525  -47.081 151.488 1.00 115.49 ? 337 LYS F CG    1 
ATOM   7955  C CD    . LYS E 1 337 ? 59.430  -47.655 152.572 1.00 122.68 ? 337 LYS F CD    1 
ATOM   7956  C CE    . LYS E 1 337 ? 60.213  -46.567 153.290 1.00 124.76 ? 337 LYS F CE    1 
ATOM   7957  N NZ    . LYS E 1 337 ? 59.320  -45.556 153.921 1.00 124.18 ? 337 LYS F NZ    1 
ATOM   7958  N N     . LEU E 1 338 ? 58.163  -50.858 148.607 1.00 108.80 ? 338 LEU F N     1 
ATOM   7959  C CA    . LEU E 1 338 ? 58.042  -52.276 148.306 1.00 111.69 ? 338 LEU F CA    1 
ATOM   7960  C C     . LEU E 1 338 ? 59.320  -52.712 147.601 1.00 117.96 ? 338 LEU F C     1 
ATOM   7961  O O     . LEU E 1 338 ? 60.259  -51.927 147.473 1.00 120.80 ? 338 LEU F O     1 
ATOM   7962  C CB    . LEU E 1 338 ? 56.819  -52.556 147.434 1.00 108.15 ? 338 LEU F CB    1 
ATOM   7963  C CG    . LEU E 1 338 ? 55.462  -52.224 148.057 1.00 109.65 ? 338 LEU F CG    1 
ATOM   7964  C CD1   . LEU E 1 338 ? 54.332  -52.755 147.186 1.00 110.11 ? 338 LEU F CD1   1 
ATOM   7965  C CD2   . LEU E 1 338 ? 55.361  -52.773 149.473 1.00 110.02 ? 338 LEU F CD2   1 
ATOM   7966  N N     . GLY E 1 339 ? 59.361  -53.956 147.143 1.00 116.29 ? 339 GLY F N     1 
ATOM   7967  C CA    . GLY E 1 339 ? 60.564  -54.475 146.520 1.00 120.50 ? 339 GLY F CA    1 
ATOM   7968  C C     . GLY E 1 339 ? 60.800  -53.966 145.109 1.00 120.53 ? 339 GLY F C     1 
ATOM   7969  O O     . GLY E 1 339 ? 61.907  -54.072 144.583 1.00 123.56 ? 339 GLY F O     1 
ATOM   7970  N N     . LEU E 1 340 ? 59.761  -53.404 144.499 1.00 114.93 ? 340 LEU F N     1 
ATOM   7971  C CA    . LEU E 1 340 ? 59.797  -53.055 143.080 1.00 107.01 ? 340 LEU F CA    1 
ATOM   7972  C C     . LEU E 1 340 ? 60.849  -51.999 142.728 1.00 109.02 ? 340 LEU F C     1 
ATOM   7973  O O     . LEU E 1 340 ? 61.212  -51.169 143.561 1.00 109.05 ? 340 LEU F O     1 
ATOM   7974  C CB    . LEU E 1 340 ? 58.412  -52.603 142.596 1.00 99.21  ? 340 LEU F CB    1 
ATOM   7975  C CG    . LEU E 1 340 ? 57.243  -53.599 142.629 1.00 95.09  ? 340 LEU F CG    1 
ATOM   7976  C CD1   . LEU E 1 340 ? 57.701  -55.021 142.332 1.00 94.48  ? 340 LEU F CD1   1 
ATOM   7977  C CD2   . LEU E 1 340 ? 56.484  -53.538 143.947 1.00 95.02  ? 340 LEU F CD2   1 
ATOM   7978  N N     . PRO E 1 341 ? 61.363  -52.050 141.489 1.00 110.73 ? 341 PRO F N     1 
ATOM   7979  C CA    . PRO E 1 341 ? 62.228  -50.988 140.964 1.00 116.03 ? 341 PRO F CA    1 
ATOM   7980  C C     . PRO E 1 341 ? 61.388  -49.859 140.377 1.00 128.69 ? 341 PRO F C     1 
ATOM   7981  O O     . PRO E 1 341 ? 60.307  -50.125 139.853 1.00 129.89 ? 341 PRO F O     1 
ATOM   7982  C CB    . PRO E 1 341 ? 63.008  -51.697 139.855 1.00 113.75 ? 341 PRO F CB    1 
ATOM   7983  C CG    . PRO E 1 341 ? 62.088  -52.768 139.382 1.00 109.68 ? 341 PRO F CG    1 
ATOM   7984  C CD    . PRO E 1 341 ? 61.313  -53.220 140.592 1.00 109.76 ? 341 PRO F CD    1 
ATOM   7985  N N     . ARG E 1 342 ? 61.864  -48.621 140.470 1.00 140.84 ? 342 ARG F N     1 
ATOM   7986  C CA    . ARG E 1 342 ? 61.133  -47.495 139.899 1.00 145.37 ? 342 ARG F CA    1 
ATOM   7987  C C     . ARG E 1 342 ? 61.309  -47.467 138.387 1.00 151.40 ? 342 ARG F C     1 
ATOM   7988  O O     . ARG E 1 342 ? 62.379  -47.793 137.872 1.00 152.54 ? 342 ARG F O     1 
ATOM   7989  C CB    . ARG E 1 342 ? 61.605  -46.168 140.497 1.00 146.04 ? 342 ARG F CB    1 
ATOM   7990  C CG    . ARG E 1 342 ? 61.533  -46.093 142.012 1.00 145.91 ? 342 ARG F CG    1 
ATOM   7991  C CD    . ARG E 1 342 ? 61.855  -44.689 142.507 1.00 148.07 ? 342 ARG F CD    1 
ATOM   7992  N NE    . ARG E 1 342 ? 61.756  -44.584 143.960 1.00 150.16 ? 342 ARG F NE    1 
ATOM   7993  C CZ    . ARG E 1 342 ? 61.738  -43.434 144.627 1.00 151.17 ? 342 ARG F CZ    1 
ATOM   7994  N NH1   . ARG E 1 342 ? 61.807  -42.283 143.973 1.00 152.02 ? 342 ARG F NH1   1 
ATOM   7995  N NH2   . ARG E 1 342 ? 61.645  -43.436 145.950 1.00 149.75 ? 342 ARG F NH2   1 
ATOM   7996  N N     . GLN E 1 343 ? 60.255  -47.076 137.679 1.00 155.05 ? 343 GLN F N     1 
ATOM   7997  C CA    . GLN E 1 343 ? 60.312  -46.976 136.227 1.00 161.58 ? 343 GLN F CA    1 
ATOM   7998  C C     . GLN E 1 343 ? 60.678  -45.557 135.797 1.00 169.08 ? 343 GLN F C     1 
ATOM   7999  O O     . GLN E 1 343 ? 60.338  -44.586 136.478 1.00 167.58 ? 343 GLN F O     1 
ATOM   8000  C CB    . GLN E 1 343 ? 58.982  -47.407 135.607 1.00 158.05 ? 343 GLN F CB    1 
ATOM   8001  C CG    . GLN E 1 343 ? 58.661  -48.882 135.809 1.00 154.97 ? 343 GLN F CG    1 
ATOM   8002  C CD    . GLN E 1 343 ? 57.401  -49.100 136.622 1.00 152.43 ? 343 GLN F CD    1 
ATOM   8003  O OE1   . GLN E 1 343 ? 56.496  -48.266 136.621 1.00 152.33 ? 343 GLN F OE1   1 
ATOM   8004  N NE2   . GLN E 1 343 ? 57.338  -50.225 137.327 1.00 150.22 ? 343 GLN F NE2   1 
ATOM   8005  N N     . ALA E 1 344 ? 61.377  -45.449 134.669 1.00 172.53 ? 344 ALA F N     1 
ATOM   8006  C CA    . ALA E 1 344 ? 61.844  -44.163 134.157 1.00 172.11 ? 344 ALA F CA    1 
ATOM   8007  C C     . ALA E 1 344 ? 60.699  -43.183 133.930 1.00 172.99 ? 344 ALA F C     1 
ATOM   8008  O O     . ALA E 1 344 ? 59.943  -43.303 132.965 1.00 172.05 ? 344 ALA F O     1 
ATOM   8009  C CB    . ALA E 1 344 ? 62.639  -44.359 132.874 1.00 171.94 ? 344 ALA F CB    1 
ATOM   8010  N N     . ARG E 1 345 ? 60.577  -42.214 134.830 1.00 176.12 ? 345 ARG F N     1 
ATOM   8011  C CA    . ARG E 1 345 ? 59.525  -41.214 134.736 1.00 177.03 ? 345 ARG F CA    1 
ATOM   8012  C C     . ARG E 1 345 ? 60.016  -40.003 133.951 1.00 181.37 ? 345 ARG F C     1 
ATOM   8013  O O     . ARG E 1 345 ? 60.137  -38.905 134.499 1.00 182.10 ? 345 ARG F O     1 
ATOM   8014  C CB    . ARG E 1 345 ? 59.075  -40.791 136.133 1.00 174.61 ? 345 ARG F CB    1 
ATOM   8015  C CG    . ARG E 1 345 ? 57.710  -40.134 136.179 1.00 173.00 ? 345 ARG F CG    1 
ATOM   8016  C CD    . ARG E 1 345 ? 57.263  -39.936 137.612 1.00 170.34 ? 345 ARG F CD    1 
ATOM   8017  N NE    . ARG E 1 345 ? 58.132  -39.010 138.332 1.00 170.30 ? 345 ARG F NE    1 
ATOM   8018  C CZ    . ARG E 1 345 ? 57.875  -37.715 138.483 1.00 170.59 ? 345 ARG F CZ    1 
ATOM   8019  N NH1   . ARG E 1 345 ? 58.718  -36.942 139.153 1.00 172.16 ? 345 ARG F NH1   1 
ATOM   8020  N NH2   . ARG E 1 345 ? 56.771  -37.194 137.966 1.00 168.96 ? 345 ARG F NH2   1 
ATOM   8021  N N     . ALA E 1 346 ? 60.306  -40.213 132.669 1.00 183.19 ? 346 ALA F N     1 
ATOM   8022  C CA    . ALA E 1 346 ? 60.794  -39.145 131.800 1.00 182.86 ? 346 ALA F CA    1 
ATOM   8023  C C     . ALA E 1 346 ? 59.788  -37.999 131.734 1.00 182.97 ? 346 ALA F C     1 
ATOM   8024  O O     . ALA E 1 346 ? 58.597  -38.218 131.516 1.00 181.20 ? 346 ALA F O     1 
ATOM   8025  C CB    . ALA E 1 346 ? 61.094  -39.684 130.407 1.00 181.13 ? 346 ALA F CB    1 
ATOM   8026  N N     . ALA E 1 347 ? 60.277  -36.777 131.927 1.00 183.41 ? 347 ALA F N     1 
ATOM   8027  C CA    . ALA E 1 347 ? 59.410  -35.608 132.059 1.00 182.15 ? 347 ALA F CA    1 
ATOM   8028  C C     . ALA E 1 347 ? 58.797  -35.132 130.741 1.00 181.22 ? 347 ALA F C     1 
ATOM   8029  O O     . ALA E 1 347 ? 59.031  -35.715 129.682 1.00 182.02 ? 347 ALA F O     1 
ATOM   8030  C CB    . ALA E 1 347 ? 60.163  -34.469 132.737 1.00 183.47 ? 347 ALA F CB    1 
ATOM   8031  N N     . ALA E 1 348 ? 58.007  -34.065 130.829 1.00 178.11 ? 348 ALA F N     1 
ATOM   8032  C CA    . ALA E 1 348 ? 57.360  -33.455 129.670 1.00 176.25 ? 348 ALA F CA    1 
ATOM   8033  C C     . ALA E 1 348 ? 58.171  -32.240 129.209 1.00 175.07 ? 348 ALA F C     1 
ATOM   8034  O O     . ALA E 1 348 ? 58.995  -31.733 129.971 1.00 175.13 ? 348 ALA F O     1 
ATOM   8035  C CB    . ALA E 1 348 ? 55.929  -33.050 130.031 1.00 174.32 ? 348 ALA F CB    1 
ATOM   8036  N N     . PRO E 1 349 ? 57.959  -31.784 127.956 1.00 173.24 ? 349 PRO F N     1 
ATOM   8037  C CA    . PRO E 1 349 ? 58.619  -30.579 127.434 1.00 172.20 ? 349 PRO F CA    1 
ATOM   8038  C C     . PRO E 1 349 ? 58.583  -29.398 128.403 1.00 168.45 ? 349 PRO F C     1 
ATOM   8039  O O     . PRO E 1 349 ? 57.612  -29.234 129.143 1.00 166.23 ? 349 PRO F O     1 
ATOM   8040  C CB    . PRO E 1 349 ? 57.801  -30.261 126.185 1.00 172.15 ? 349 PRO F CB    1 
ATOM   8041  C CG    . PRO E 1 349 ? 57.396  -31.600 125.682 1.00 172.64 ? 349 PRO F CG    1 
ATOM   8042  C CD    . PRO E 1 349 ? 57.184  -32.470 126.903 1.00 172.36 ? 349 PRO F CD    1 
ATOM   8043  N N     . GLU E 1 350 ? 59.639  -28.589 128.395 1.00 166.88 ? 350 GLU F N     1 
ATOM   8044  C CA    . GLU E 1 350 ? 59.773  -27.503 129.361 1.00 163.45 ? 350 GLU F CA    1 
ATOM   8045  C C     . GLU E 1 350 ? 59.378  -26.132 128.825 1.00 159.82 ? 350 GLU F C     1 
ATOM   8046  O O     . GLU E 1 350 ? 59.851  -25.698 127.774 1.00 163.56 ? 350 GLU F O     1 
ATOM   8047  C CB    . GLU E 1 350 ? 61.195  -27.451 129.926 1.00 165.99 ? 350 GLU F CB    1 
ATOM   8048  C CG    . GLU E 1 350 ? 61.308  -28.064 131.306 1.00 166.83 ? 350 GLU F CG    1 
ATOM   8049  C CD    . GLU E 1 350 ? 60.233  -27.553 132.249 1.00 165.56 ? 350 GLU F CD    1 
ATOM   8050  O OE1   . GLU E 1 350 ? 59.337  -28.342 132.614 1.00 160.05 ? 350 GLU F OE1   1 
ATOM   8051  O OE2   . GLU E 1 350 ? 60.284  -26.361 132.622 1.00 167.03 ? 350 GLU F OE2   1 
ATOM   8052  N N     . ILE E 1 351 ? 58.509  -25.454 129.567 1.00 151.35 ? 351 ILE F N     1 
ATOM   8053  C CA    . ILE E 1 351 ? 58.116  -24.092 129.236 1.00 146.21 ? 351 ILE F CA    1 
ATOM   8054  C C     . ILE E 1 351 ? 59.309  -23.156 129.399 1.00 144.88 ? 351 ILE F C     1 
ATOM   8055  O O     . ILE E 1 351 ? 60.254  -23.461 130.129 1.00 143.04 ? 351 ILE F O     1 
ATOM   8056  C CB    . ILE E 1 351 ? 56.938  -23.605 130.109 1.00 144.00 ? 351 ILE F CB    1 
ATOM   8057  C CG1   . ILE E 1 351 ? 57.424  -23.129 131.482 1.00 143.36 ? 351 ILE F CG1   1 
ATOM   8058  C CG2   . ILE E 1 351 ? 55.891  -24.701 130.249 1.00 140.43 ? 351 ILE F CG2   1 
ATOM   8059  C CD1   . ILE E 1 351 ? 57.795  -24.245 132.437 1.00 140.40 ? 351 ILE F CD1   1 
ATOM   8060  N N     . ASP E 1 352 ? 59.263  -22.020 128.711 1.00 146.47 ? 352 ASP F N     1 
ATOM   8061  C CA    . ASP E 1 352 ? 60.373  -21.073 128.707 1.00 146.49 ? 352 ASP F CA    1 
ATOM   8062  C C     . ASP E 1 352 ? 60.651  -20.505 130.095 1.00 143.81 ? 352 ASP F C     1 
ATOM   8063  O O     . ASP E 1 352 ? 59.730  -20.263 130.872 1.00 139.58 ? 352 ASP F O     1 
ATOM   8064  C CB    . ASP E 1 352 ? 60.103  -19.939 127.716 1.00 148.39 ? 352 ASP F CB    1 
ATOM   8065  C CG    . ASP E 1 352 ? 59.870  -20.443 126.306 1.00 151.09 ? 352 ASP F CG    1 
ATOM   8066  O OD1   . ASP E 1 352 ? 60.864  -20.709 125.597 1.00 153.66 ? 352 ASP F OD1   1 
ATOM   8067  O OD2   . ASP E 1 352 ? 58.694  -20.573 125.905 1.00 150.72 ? 352 ASP F OD2   1 
ATOM   8068  N N     . ARG E 1 353 ? 61.929  -20.300 130.398 1.00 148.53 ? 353 ARG F N     1 
ATOM   8069  C CA    . ARG E 1 353 ? 62.338  -19.782 131.698 1.00 150.91 ? 353 ARG F CA    1 
ATOM   8070  C C     . ARG E 1 353 ? 62.929  -18.382 131.562 1.00 152.52 ? 353 ARG F C     1 
ATOM   8071  O O     . ARG E 1 353 ? 63.550  -18.053 130.551 1.00 156.14 ? 353 ARG F O     1 
ATOM   8072  C CB    . ARG E 1 353 ? 63.351  -20.725 132.356 1.00 154.60 ? 353 ARG F CB    1 
ATOM   8073  C CG    . ARG E 1 353 ? 63.695  -20.371 133.797 1.00 153.86 ? 353 ARG F CG    1 
ATOM   8074  C CD    . ARG E 1 353 ? 64.922  -21.129 134.277 1.00 153.66 ? 353 ARG F CD    1 
ATOM   8075  N NE    . ARG E 1 353 ? 65.380  -20.658 135.581 1.00 151.25 ? 353 ARG F NE    1 
ATOM   8076  C CZ    . ARG E 1 353 ? 65.205  -21.318 136.722 1.00 148.83 ? 353 ARG F CZ    1 
ATOM   8077  N NH1   . ARG E 1 353 ? 65.655  -20.807 137.860 1.00 148.30 ? 353 ARG F NH1   1 
ATOM   8078  N NH2   . ARG E 1 353 ? 64.584  -22.490 136.725 1.00 146.59 ? 353 ARG F NH2   1 
ATOM   8079  N N     . LEU E 1 354 ? 62.728  -17.562 132.588 1.00 149.63 ? 354 LEU F N     1 
ATOM   8080  C CA    . LEU E 1 354 ? 63.218  -16.191 132.602 1.00 150.98 ? 354 LEU F CA    1 
ATOM   8081  C C     . LEU E 1 354 ? 63.639  -15.845 134.030 1.00 152.85 ? 354 LEU F C     1 
ATOM   8082  O O     . LEU E 1 354 ? 62.842  -15.944 134.959 1.00 152.04 ? 354 LEU F O     1 
ATOM   8083  C CB    . LEU E 1 354 ? 62.126  -15.245 132.089 1.00 150.28 ? 354 LEU F CB    1 
ATOM   8084  C CG    . LEU E 1 354 ? 62.355  -13.739 131.917 1.00 155.10 ? 354 LEU F CG    1 
ATOM   8085  C CD1   . LEU E 1 354 ? 61.731  -12.968 133.073 1.00 150.93 ? 354 LEU F CD1   1 
ATOM   8086  C CD2   . LEU E 1 354 ? 63.837  -13.387 131.757 1.00 163.72 ? 354 LEU F CD2   1 
ATOM   8087  N N     . ASP E 1 355 ? 64.898  -15.454 134.203 1.00 157.77 ? 355 ASP F N     1 
ATOM   8088  C CA    . ASP E 1 355 ? 65.445  -15.243 135.542 1.00 158.37 ? 355 ASP F CA    1 
ATOM   8089  C C     . ASP E 1 355 ? 65.768  -13.779 135.850 1.00 160.45 ? 355 ASP F C     1 
ATOM   8090  O O     . ASP E 1 355 ? 66.219  -13.032 134.980 1.00 164.32 ? 355 ASP F O     1 
ATOM   8091  C CB    . ASP E 1 355 ? 66.685  -16.119 135.757 1.00 160.38 ? 355 ASP F CB    1 
ATOM   8092  C CG    . ASP E 1 355 ? 66.370  -17.605 135.689 1.00 163.55 ? 355 ASP F CG    1 
ATOM   8093  O OD1   . ASP E 1 355 ? 66.437  -18.180 134.582 1.00 165.62 ? 355 ASP F OD1   1 
ATOM   8094  O OD2   . ASP E 1 355 ? 66.057  -18.200 136.743 1.00 163.17 ? 355 ASP F OD2   1 
ATOM   8095  N N     . LEU E 1 356 ? 65.526  -13.383 137.097 1.00 157.17 ? 356 LEU F N     1 
ATOM   8096  C CA    . LEU E 1 356 ? 65.873  -12.049 137.580 1.00 156.72 ? 356 LEU F CA    1 
ATOM   8097  C C     . LEU E 1 356 ? 66.701  -12.153 138.867 1.00 167.48 ? 356 LEU F C     1 
ATOM   8098  O O     . LEU E 1 356 ? 66.769  -13.217 139.482 1.00 170.71 ? 356 LEU F O     1 
ATOM   8099  C CB    . LEU E 1 356 ? 64.615  -11.196 137.777 1.00 147.56 ? 356 LEU F CB    1 
ATOM   8100  C CG    . LEU E 1 356 ? 63.905  -10.847 136.464 1.00 145.12 ? 356 LEU F CG    1 
ATOM   8101  C CD1   . LEU E 1 356 ? 62.619  -10.064 136.693 1.00 142.61 ? 356 LEU F CD1   1 
ATOM   8102  C CD2   . LEU E 1 356 ? 64.844  -10.075 135.556 1.00 149.94 ? 356 LEU F CD2   1 
ATOM   8103  N N     . CYS E 1 357 ? 67.322  -11.048 139.269 1.00 174.51 ? 357 CYS F N     1 
ATOM   8104  C CA    . CYS E 1 357 ? 68.391  -11.072 140.270 1.00 179.43 ? 357 CYS F CA    1 
ATOM   8105  C C     . CYS E 1 357 ? 67.959  -10.891 141.728 1.00 181.23 ? 357 CYS F C     1 
ATOM   8106  O O     . CYS E 1 357 ? 68.739  -10.377 142.535 1.00 183.58 ? 357 CYS F O     1 
ATOM   8107  C CB    . CYS E 1 357 ? 69.403  -9.979  139.935 1.00 181.07 ? 357 CYS F CB    1 
ATOM   8108  S SG    . CYS E 1 357 ? 68.655  -8.333  139.889 1.00 167.18 ? 357 CYS F SG    1 
ATOM   8109  N N     . LEU E 1 358 ? 66.745  -11.322 142.067 1.00 174.99 ? 358 LEU F N     1 
ATOM   8110  C CA    . LEU E 1 358 ? 66.173  -11.068 143.392 1.00 164.42 ? 358 LEU F CA    1 
ATOM   8111  C C     . LEU E 1 358 ? 66.296  -9.590  143.733 1.00 169.38 ? 358 LEU F C     1 
ATOM   8112  O O     . LEU E 1 358 ? 66.711  -9.238  144.838 1.00 173.52 ? 358 LEU F O     1 
ATOM   8113  C CB    . LEU E 1 358 ? 66.852  -11.912 144.480 1.00 152.53 ? 358 LEU F CB    1 
ATOM   8114  C CG    . LEU E 1 358 ? 66.656  -13.430 144.499 1.00 143.99 ? 358 LEU F CG    1 
ATOM   8115  C CD1   . LEU E 1 358 ? 67.537  -14.117 143.466 1.00 143.08 ? 358 LEU F CD1   1 
ATOM   8116  C CD2   . LEU E 1 358 ? 66.918  -13.990 145.893 1.00 142.81 ? 358 LEU F CD2   1 
ATOM   8117  N N     . ALA E 1 359 ? 65.944  -8.743  142.766 1.00 168.98 ? 359 ALA F N     1 
ATOM   8118  C CA    . ALA E 1 359 ? 66.157  -7.297  142.843 1.00 167.94 ? 359 ALA F CA    1 
ATOM   8119  C C     . ALA E 1 359 ? 65.749  -6.695  144.182 1.00 169.48 ? 359 ALA F C     1 
ATOM   8120  O O     . ALA E 1 359 ? 64.627  -6.888  144.649 1.00 174.44 ? 359 ALA F O     1 
ATOM   8121  C CB    . ALA E 1 359 ? 65.439  -6.592  141.699 1.00 164.91 ? 359 ALA F CB    1 
ATOM   8122  N N     . PHE E 1 360 ? 66.681  -5.968  144.789 1.00 165.20 ? 360 PHE F N     1 
ATOM   8123  C CA    . PHE E 1 360 ? 66.505  -5.435  146.135 1.00 162.97 ? 360 PHE F CA    1 
ATOM   8124  C C     . PHE E 1 360 ? 65.317  -4.472  146.202 1.00 164.87 ? 360 PHE F C     1 
ATOM   8125  O O     . PHE E 1 360 ? 65.349  -3.396  145.604 1.00 168.81 ? 360 PHE F O     1 
ATOM   8126  C CB    . PHE E 1 360 ? 67.802  -4.767  146.604 1.00 164.42 ? 360 PHE F CB    1 
ATOM   8127  C CG    . PHE E 1 360 ? 69.021  -5.651  146.474 1.00 165.24 ? 360 PHE F CG    1 
ATOM   8128  C CD1   . PHE E 1 360 ? 68.919  -7.026  146.637 1.00 159.78 ? 360 PHE F CD1   1 
ATOM   8129  C CD2   . PHE E 1 360 ? 70.263  -5.108  146.179 1.00 167.50 ? 360 PHE F CD2   1 
ATOM   8130  C CE1   . PHE E 1 360 ? 70.030  -7.841  146.513 1.00 158.72 ? 360 PHE F CE1   1 
ATOM   8131  C CE2   . PHE E 1 360 ? 71.379  -5.920  146.055 1.00 168.32 ? 360 PHE F CE2   1 
ATOM   8132  C CZ    . PHE E 1 360 ? 71.261  -7.287  146.223 1.00 165.28 ? 360 PHE F CZ    1 
ATOM   8133  N N     . PRO E 1 361 ? 64.262  -4.869  146.934 1.00 163.82 ? 361 PRO F N     1 
ATOM   8134  C CA    . PRO E 1 361 ? 62.966  -4.177  146.967 1.00 165.80 ? 361 PRO F CA    1 
ATOM   8135  C C     . PRO E 1 361 ? 63.021  -2.802  147.631 1.00 174.57 ? 361 PRO F C     1 
ATOM   8136  O O     . PRO E 1 361 ? 63.662  -2.633  148.670 1.00 178.84 ? 361 PRO F O     1 
ATOM   8137  C CB    . PRO E 1 361 ? 62.085  -5.127  147.785 1.00 160.16 ? 361 PRO F CB    1 
ATOM   8138  C CG    . PRO E 1 361 ? 63.041  -5.846  148.664 1.00 159.62 ? 361 PRO F CG    1 
ATOM   8139  C CD    . PRO E 1 361 ? 64.283  -6.035  147.835 1.00 162.37 ? 361 PRO F CD    1 
ATOM   8140  N N     . SER E 1 362 ? 62.338  -1.834  147.026 1.00 178.45 ? 362 SER F N     1 
ATOM   8141  C CA    . SER E 1 362 ? 62.356  -0.454  147.496 1.00 185.12 ? 362 SER F CA    1 
ATOM   8142  C C     . SER E 1 362 ? 61.721  -0.306  148.879 1.00 191.24 ? 362 SER F C     1 
ATOM   8143  O O     . SER E 1 362 ? 62.365  0.147   149.825 1.00 193.35 ? 362 SER F O     1 
ATOM   8144  C CB    . SER E 1 362 ? 61.645  0.453   146.488 1.00 181.93 ? 362 SER F CB    1 
ATOM   8145  O OG    . SER E 1 362 ? 61.882  1.821   146.770 1.00 180.39 ? 362 SER F OG    1 
ATOM   8146  N N     . GLU E 1 363 ? 60.452  -0.687  148.984 1.00 194.78 ? 363 GLU F N     1 
ATOM   8147  C CA    . GLU E 1 363 ? 59.708  -0.583  150.235 1.00 196.79 ? 363 GLU F CA    1 
ATOM   8148  C C     . GLU E 1 363 ? 58.976  -1.901  150.486 1.00 196.96 ? 363 GLU F C     1 
ATOM   8149  O O     . GLU E 1 363 ? 59.152  -2.853  149.721 1.00 197.67 ? 363 GLU F O     1 
ATOM   8150  C CB    . GLU E 1 363 ? 58.706  0.576   150.154 1.00 195.02 ? 363 GLU F CB    1 
ATOM   8151  C CG    . GLU E 1 363 ? 59.316  1.919   149.807 1.00 196.07 ? 363 GLU F CG    1 
ATOM   8152  C CD    . GLU E 1 363 ? 59.317  2.176   148.316 1.00 195.94 ? 363 GLU F CD    1 
ATOM   8153  O OE1   . GLU E 1 363 ? 58.660  1.406   147.584 1.00 193.87 ? 363 GLU F OE1   1 
ATOM   8154  O OE2   . GLU E 1 363 ? 59.975  3.141   147.875 1.00 197.52 ? 363 GLU F OE2   1 
ATOM   8155  N N     . PRO E 1 364 ? 58.180  -1.980  151.571 1.00 194.90 ? 364 PRO F N     1 
ATOM   8156  C CA    . PRO E 1 364 ? 57.255  -3.114  151.645 1.00 191.33 ? 364 PRO F CA    1 
ATOM   8157  C C     . PRO E 1 364 ? 56.379  -3.214  150.394 1.00 183.91 ? 364 PRO F C     1 
ATOM   8158  O O     . PRO E 1 364 ? 55.604  -2.304  150.093 1.00 180.19 ? 364 PRO F O     1 
ATOM   8159  C CB    . PRO E 1 364 ? 56.413  -2.783  152.876 1.00 191.41 ? 364 PRO F CB    1 
ATOM   8160  C CG    . PRO E 1 364 ? 57.368  -2.071  153.772 1.00 192.96 ? 364 PRO F CG    1 
ATOM   8161  C CD    . PRO E 1 364 ? 58.279  -1.276  152.866 1.00 194.87 ? 364 PRO F CD    1 
ATOM   8162  N N     . CYS E 1 365 ? 56.535  -4.319  149.670 1.00 179.57 ? 365 CYS F N     1 
ATOM   8163  C CA    . CYS E 1 365 ? 55.824  -4.564  148.421 1.00 171.79 ? 365 CYS F CA    1 
ATOM   8164  C C     . CYS E 1 365 ? 55.926  -6.043  148.067 1.00 164.86 ? 365 CYS F C     1 
ATOM   8165  O O     . CYS E 1 365 ? 56.682  -6.784  148.695 1.00 166.26 ? 365 CYS F O     1 
ATOM   8166  C CB    . CYS E 1 365 ? 56.417  -3.730  147.285 1.00 173.67 ? 365 CYS F CB    1 
ATOM   8167  S SG    . CYS E 1 365 ? 55.745  -4.155  145.650 1.00 163.35 ? 365 CYS F SG    1 
ATOM   8168  N N     . SER E 1 366 ? 55.177  -6.470  147.055 1.00 156.01 ? 366 SER F N     1 
ATOM   8169  C CA    . SER E 1 366 ? 55.173  -7.876  146.662 1.00 148.06 ? 366 SER F CA    1 
ATOM   8170  C C     . SER E 1 366 ? 56.040  -8.143  145.434 1.00 143.26 ? 366 SER F C     1 
ATOM   8171  O O     . SER E 1 366 ? 56.365  -7.228  144.676 1.00 144.60 ? 366 SER F O     1 
ATOM   8172  C CB    . SER E 1 366 ? 53.745  -8.369  146.417 1.00 143.93 ? 366 SER F CB    1 
ATOM   8173  O OG    . SER E 1 366 ? 53.158  -7.712  145.309 1.00 142.67 ? 366 SER F OG    1 
ATOM   8174  N N     . VAL E 1 367 ? 56.405  -9.408  145.250 1.00 136.45 ? 367 VAL F N     1 
ATOM   8175  C CA    . VAL E 1 367 ? 57.262  -9.819  144.143 1.00 132.42 ? 367 VAL F CA    1 
ATOM   8176  C C     . VAL E 1 367 ? 56.593  -9.580  142.793 1.00 129.84 ? 367 VAL F C     1 
ATOM   8177  O O     . VAL E 1 367 ? 57.185  -8.980  141.896 1.00 126.78 ? 367 VAL F O     1 
ATOM   8178  C CB    . VAL E 1 367 ? 57.636  -11.311 144.251 1.00 131.36 ? 367 VAL F CB    1 
ATOM   8179  C CG1   . VAL E 1 367 ? 58.598  -11.697 143.139 1.00 131.56 ? 367 VAL F CG1   1 
ATOM   8180  C CG2   . VAL E 1 367 ? 58.237  -11.614 145.619 1.00 133.35 ? 367 VAL F CG2   1 
ATOM   8181  N N     . GLU E 1 368 ? 55.358  -10.056 142.664 1.00 131.97 ? 368 GLU F N     1 
ATOM   8182  C CA    . GLU E 1 368 ? 54.597  -9.941  141.422 1.00 132.54 ? 368 GLU F CA    1 
ATOM   8183  C C     . GLU E 1 368 ? 54.492  -8.504  140.911 1.00 136.41 ? 368 GLU F C     1 
ATOM   8184  O O     . GLU E 1 368 ? 54.702  -8.245  139.725 1.00 136.09 ? 368 GLU F O     1 
ATOM   8185  C CB    . GLU E 1 368 ? 53.195  -10.535 141.594 1.00 126.28 ? 368 GLU F CB    1 
ATOM   8186  C CG    . GLU E 1 368 ? 53.128  -12.053 141.503 1.00 124.23 ? 368 GLU F CG    1 
ATOM   8187  C CD    . GLU E 1 368 ? 53.595  -12.752 142.769 1.00 123.83 ? 368 GLU F CD    1 
ATOM   8188  O OE1   . GLU E 1 368 ? 53.834  -12.061 143.781 1.00 125.01 ? 368 GLU F OE1   1 
ATOM   8189  O OE2   . GLU E 1 368 ? 53.718  -13.997 142.750 1.00 122.37 ? 368 GLU F OE2   1 
ATOM   8190  N N     . TRP E 1 369 ? 54.169  -7.575  141.807 1.00 137.56 ? 369 TRP F N     1 
ATOM   8191  C CA    . TRP E 1 369 ? 53.993  -6.175  141.428 1.00 137.30 ? 369 TRP F CA    1 
ATOM   8192  C C     . TRP E 1 369 ? 55.283  -5.543  140.921 1.00 141.87 ? 369 TRP F C     1 
ATOM   8193  O O     . TRP E 1 369 ? 55.255  -4.665  140.058 1.00 147.26 ? 369 TRP F O     1 
ATOM   8194  C CB    . TRP E 1 369 ? 53.438  -5.355  142.595 1.00 134.36 ? 369 TRP F CB    1 
ATOM   8195  C CG    . TRP E 1 369 ? 51.946  -5.401  142.705 1.00 132.51 ? 369 TRP F CG    1 
ATOM   8196  C CD1   . TRP E 1 369 ? 51.215  -5.887  143.750 1.00 131.84 ? 369 TRP F CD1   1 
ATOM   8197  C CD2   . TRP E 1 369 ? 50.999  -4.947  141.730 1.00 129.31 ? 369 TRP F CD2   1 
ATOM   8198  N NE1   . TRP E 1 369 ? 49.873  -5.760  143.488 1.00 128.79 ? 369 TRP F NE1   1 
ATOM   8199  C CE2   . TRP E 1 369 ? 49.713  -5.186  142.253 1.00 125.38 ? 369 TRP F CE2   1 
ATOM   8200  C CE3   . TRP E 1 369 ? 51.112  -4.359  140.465 1.00 130.40 ? 369 TRP F CE3   1 
ATOM   8201  C CZ2   . TRP E 1 369 ? 48.550  -4.860  141.558 1.00 122.15 ? 369 TRP F CZ2   1 
ATOM   8202  C CZ3   . TRP E 1 369 ? 49.957  -4.036  139.776 1.00 127.46 ? 369 TRP F CZ3   1 
ATOM   8203  C CH2   . TRP E 1 369 ? 48.693  -4.288  140.324 1.00 123.24 ? 369 TRP F CH2   1 
ATOM   8204  N N     . ALA E 1 370 ? 56.410  -5.992  141.463 1.00 139.22 ? 370 ALA F N     1 
ATOM   8205  C CA    . ALA E 1 370 ? 57.710  -5.459  141.075 1.00 137.59 ? 370 ALA F CA    1 
ATOM   8206  C C     . ALA E 1 370 ? 58.083  -5.876  139.656 1.00 139.27 ? 370 ALA F C     1 
ATOM   8207  O O     . ALA E 1 370 ? 58.554  -5.056  138.867 1.00 143.97 ? 370 ALA F O     1 
ATOM   8208  C CB    . ALA E 1 370 ? 58.780  -5.901  142.061 1.00 136.17 ? 370 ALA F CB    1 
ATOM   8209  N N     . VAL E 1 371 ? 57.870  -7.151  139.339 1.00 137.44 ? 371 VAL F N     1 
ATOM   8210  C CA    . VAL E 1 371 ? 58.178  -7.679  138.012 1.00 139.00 ? 371 VAL F CA    1 
ATOM   8211  C C     . VAL E 1 371 ? 57.423  -6.924  136.917 1.00 142.60 ? 371 VAL F C     1 
ATOM   8212  O O     . VAL E 1 371 ? 57.972  -6.651  135.849 1.00 147.81 ? 371 VAL F O     1 
ATOM   8213  C CB    . VAL E 1 371 ? 57.865  -9.190  137.910 1.00 134.97 ? 371 VAL F CB    1 
ATOM   8214  C CG1   . VAL E 1 371 ? 58.205  -9.716  136.521 1.00 133.18 ? 371 VAL F CG1   1 
ATOM   8215  C CG2   . VAL E 1 371 ? 58.627  -9.966  138.974 1.00 133.99 ? 371 VAL F CG2   1 
ATOM   8216  N N     . ARG E 1 372 ? 56.169  -6.576  137.189 1.00 140.96 ? 372 ARG F N     1 
ATOM   8217  C CA    . ARG E 1 372 ? 55.355  -5.850  136.220 1.00 140.98 ? 372 ARG F CA    1 
ATOM   8218  C C     . ARG E 1 372 ? 55.914  -4.449  135.988 1.00 147.18 ? 372 ARG F C     1 
ATOM   8219  O O     . ARG E 1 372 ? 55.893  -3.936  134.868 1.00 151.31 ? 372 ARG F O     1 
ATOM   8220  C CB    . ARG E 1 372 ? 53.904  -5.763  136.690 1.00 134.09 ? 372 ARG F CB    1 
ATOM   8221  C CG    . ARG E 1 372 ? 52.952  -5.205  135.650 1.00 131.64 ? 372 ARG F CG    1 
ATOM   8222  C CD    . ARG E 1 372 ? 51.848  -4.408  136.312 1.00 130.10 ? 372 ARG F CD    1 
ATOM   8223  N NE    . ARG E 1 372 ? 52.401  -3.331  137.127 1.00 129.82 ? 372 ARG F NE    1 
ATOM   8224  C CZ    . ARG E 1 372 ? 52.820  -2.170  136.637 1.00 131.03 ? 372 ARG F CZ    1 
ATOM   8225  N NH1   . ARG E 1 372 ? 52.749  -1.937  135.333 1.00 129.68 ? 372 ARG F NH1   1 
ATOM   8226  N NH2   . ARG E 1 372 ? 53.313  -1.244  137.448 1.00 134.17 ? 372 ARG F NH2   1 
ATOM   8227  N N     . GLU E 1 373 ? 56.409  -3.838  137.059 1.00 146.90 ? 373 GLU F N     1 
ATOM   8228  C CA    . GLU E 1 373 ? 57.047  -2.529  136.986 1.00 146.37 ? 373 GLU F CA    1 
ATOM   8229  C C     . GLU E 1 373 ? 58.335  -2.619  136.175 1.00 145.36 ? 373 GLU F C     1 
ATOM   8230  O O     . GLU E 1 373 ? 58.681  -1.702  135.431 1.00 150.23 ? 373 GLU F O     1 
ATOM   8231  C CB    . GLU E 1 373 ? 57.340  -2.012  138.398 1.00 148.65 ? 373 GLU F CB    1 
ATOM   8232  C CG    . GLU E 1 373 ? 58.399  -0.919  138.477 1.00 151.83 ? 373 GLU F CG    1 
ATOM   8233  C CD    . GLU E 1 373 ? 57.894  0.427   137.998 1.00 152.20 ? 373 GLU F CD    1 
ATOM   8234  O OE1   . GLU E 1 373 ? 58.692  1.184   137.407 1.00 152.03 ? 373 GLU F OE1   1 
ATOM   8235  O OE2   . GLU E 1 373 ? 56.702  0.731   138.220 1.00 152.52 ? 373 GLU F OE2   1 
ATOM   8236  N N     . HIS E 1 374 ? 59.034  -3.740  136.315 1.00 140.12 ? 374 HIS F N     1 
ATOM   8237  C CA    . HIS E 1 374 ? 60.311  -3.939  135.640 1.00 140.26 ? 374 HIS F CA    1 
ATOM   8238  C C     . HIS E 1 374 ? 60.127  -4.272  134.163 1.00 142.61 ? 374 HIS F C     1 
ATOM   8239  O O     . HIS E 1 374 ? 60.898  -3.819  133.316 1.00 149.22 ? 374 HIS F O     1 
ATOM   8240  C CB    . HIS E 1 374 ? 61.111  -5.045  136.329 1.00 140.20 ? 374 HIS F CB    1 
ATOM   8241  C CG    . HIS E 1 374 ? 62.565  -5.022  136.008 1.00 146.54 ? 374 HIS F CG    1 
ATOM   8242  N ND1   . HIS E 1 374 ? 63.342  -3.882  136.125 1.00 149.11 ? 374 HIS F ND1   1 
ATOM   8243  C CD2   . HIS E 1 374 ? 63.409  -5.993  135.573 1.00 148.99 ? 374 HIS F CD2   1 
ATOM   8244  C CE1   . HIS E 1 374 ? 64.581  -4.154  135.779 1.00 152.77 ? 374 HIS F CE1   1 
ATOM   8245  N NE2   . HIS E 1 374 ? 64.650  -5.433  135.438 1.00 153.29 ? 374 HIS F NE2   1 
ATOM   8246  N N     . LEU E 1 375 ? 59.101  -5.061  133.858 1.00 138.85 ? 375 LEU F N     1 
ATOM   8247  C CA    . LEU E 1 375 ? 58.814  -5.450  132.480 1.00 138.78 ? 375 LEU F CA    1 
ATOM   8248  C C     . LEU E 1 375 ? 58.148  -4.320  131.701 1.00 143.59 ? 375 LEU F C     1 
ATOM   8249  O O     . LEU E 1 375 ? 57.725  -4.504  130.560 1.00 143.51 ? 375 LEU F O     1 
ATOM   8250  C CB    . LEU E 1 375 ? 57.948  -6.712  132.435 1.00 134.82 ? 375 LEU F CB    1 
ATOM   8251  C CG    . LEU E 1 375 ? 58.685  -8.050  132.331 1.00 137.42 ? 375 LEU F CG    1 
ATOM   8252  C CD1   . LEU E 1 375 ? 59.686  -8.222  133.464 1.00 138.01 ? 375 LEU F CD1   1 
ATOM   8253  C CD2   . LEU E 1 375 ? 57.698  -9.208  132.309 1.00 137.04 ? 375 LEU F CD2   1 
ATOM   8254  N N     . GLU E 1 376 ? 58.053  -3.153  132.330 1.00 148.54 ? 376 GLU F N     1 
ATOM   8255  C CA    . GLU E 1 376 ? 57.541  -1.965  131.664 1.00 155.60 ? 376 GLU F CA    1 
ATOM   8256  C C     . GLU E 1 376 ? 58.528  -1.505  130.594 1.00 163.72 ? 376 GLU F C     1 
ATOM   8257  O O     . GLU E 1 376 ? 59.742  -1.526  130.801 1.00 168.53 ? 376 GLU F O     1 
ATOM   8258  C CB    . GLU E 1 376 ? 57.252  -0.855  132.684 1.00 159.35 ? 376 GLU F CB    1 
ATOM   8259  C CG    . GLU E 1 376 ? 57.926  0.484   132.409 1.00 165.93 ? 376 GLU F CG    1 
ATOM   8260  C CD    . GLU E 1 376 ? 59.210  0.674   133.201 1.00 167.61 ? 376 GLU F CD    1 
ATOM   8261  O OE1   . GLU E 1 376 ? 59.438  1.796   133.701 1.00 168.58 ? 376 GLU F OE1   1 
ATOM   8262  O OE2   . GLU E 1 376 ? 59.991  -0.294  133.323 1.00 166.24 ? 376 GLU F OE2   1 
ATOM   8263  N N     . GLU E 1 377 ? 57.995  -1.114  129.442 1.00 163.48 ? 377 GLU F N     1 
ATOM   8264  C CA    . GLU E 1 377 ? 58.808  -0.706  128.303 1.00 161.34 ? 377 GLU F CA    1 
ATOM   8265  C C     . GLU E 1 377 ? 57.902  0.069   127.351 1.00 157.46 ? 377 GLU F C     1 
ATOM   8266  O O     . GLU E 1 377 ? 56.692  -0.151  127.349 1.00 152.59 ? 377 GLU F O     1 
ATOM   8267  C CB    . GLU E 1 377 ? 59.397  -1.939  127.606 1.00 161.86 ? 377 GLU F CB    1 
ATOM   8268  C CG    . GLU E 1 377 ? 60.901  -1.875  127.331 1.00 165.88 ? 377 GLU F CG    1 
ATOM   8269  C CD    . GLU E 1 377 ? 61.425  -3.138  126.667 1.00 167.56 ? 377 GLU F CD    1 
ATOM   8270  O OE1   . GLU E 1 377 ? 60.694  -4.151  126.664 1.00 163.30 ? 377 GLU F OE1   1 
ATOM   8271  O OE2   . GLU E 1 377 ? 62.562  -3.121  126.145 1.00 171.33 ? 377 GLU F OE2   1 
ATOM   8272  N N     . PRO E 1 378 ? 58.478  0.991   126.558 1.00 160.67 ? 378 PRO F N     1 
ATOM   8273  C CA    . PRO E 1 378 ? 57.730  1.803   125.589 1.00 162.48 ? 378 PRO F CA    1 
ATOM   8274  C C     . PRO E 1 378 ? 56.666  1.030   124.808 1.00 162.05 ? 378 PRO F C     1 
ATOM   8275  O O     . PRO E 1 378 ? 55.481  1.343   124.921 1.00 162.88 ? 378 PRO F O     1 
ATOM   8276  C CB    . PRO E 1 378 ? 58.827  2.286   124.644 1.00 165.71 ? 378 PRO F CB    1 
ATOM   8277  C CG    . PRO E 1 378 ? 60.004  2.458   125.540 1.00 166.95 ? 378 PRO F CG    1 
ATOM   8278  C CD    . PRO E 1 378 ? 59.898  1.387   126.606 1.00 163.11 ? 378 PRO F CD    1 
ATOM   8279  N N     . GLY E 1 379 ? 57.084  0.030   124.041 1.00 159.50 ? 379 GLY F N     1 
ATOM   8280  C CA    . GLY E 1 379 ? 56.154  -0.734  123.231 1.00 157.92 ? 379 GLY F CA    1 
ATOM   8281  C C     . GLY E 1 379 ? 55.398  -1.814  123.987 1.00 155.91 ? 379 GLY F C     1 
ATOM   8282  O O     . GLY E 1 379 ? 54.432  -2.374  123.467 1.00 156.00 ? 379 GLY F O     1 
ATOM   8283  N N     . CYS E 1 380 ? 55.825  -2.106  125.213 1.00 152.38 ? 380 CYS F N     1 
ATOM   8284  C CA    . CYS E 1 380 ? 55.245  -3.214  125.974 1.00 143.97 ? 380 CYS F CA    1 
ATOM   8285  C C     . CYS E 1 380 ? 54.481  -2.779  127.225 1.00 137.18 ? 380 CYS F C     1 
ATOM   8286  O O     . CYS E 1 380 ? 55.047  -2.169  128.130 1.00 137.69 ? 380 CYS F O     1 
ATOM   8287  C CB    . CYS E 1 380 ? 56.334  -4.216  126.365 1.00 142.39 ? 380 CYS F CB    1 
ATOM   8288  S SG    . CYS E 1 380 ? 55.724  -5.681  127.233 1.00 167.54 ? 380 CYS F SG    1 
ATOM   8289  N N     . ALA E 1 381 ? 53.194  -3.112  127.272 1.00 130.90 ? 381 ALA F N     1 
ATOM   8290  C CA    . ALA E 1 381 ? 52.389  -2.899  128.470 1.00 125.86 ? 381 ALA F CA    1 
ATOM   8291  C C     . ALA E 1 381 ? 52.162  -4.225  129.192 1.00 119.84 ? 381 ALA F C     1 
ATOM   8292  O O     . ALA E 1 381 ? 51.875  -5.243  128.562 1.00 118.32 ? 381 ALA F O     1 
ATOM   8293  C CB    . ALA E 1 381 ? 51.062  -2.247  128.118 1.00 126.04 ? 381 ALA F CB    1 
ATOM   8294  N N     . VAL E 1 382 ? 52.300  -4.207  130.515 1.00 118.33 ? 382 VAL F N     1 
ATOM   8295  C CA    . VAL E 1 382 ? 52.180  -5.420  131.320 1.00 117.14 ? 382 VAL F CA    1 
ATOM   8296  C C     . VAL E 1 382 ? 51.100  -5.276  132.391 1.00 115.75 ? 382 VAL F C     1 
ATOM   8297  O O     . VAL E 1 382 ? 51.008  -4.245  133.058 1.00 121.25 ? 382 VAL F O     1 
ATOM   8298  C CB    . VAL E 1 382 ? 53.514  -5.775  132.007 1.00 117.92 ? 382 VAL F CB    1 
ATOM   8299  C CG1   . VAL E 1 382 ? 53.453  -7.179  132.592 1.00 121.16 ? 382 VAL F CG1   1 
ATOM   8300  C CG2   . VAL E 1 382 ? 54.663  -5.661  131.024 1.00 119.12 ? 382 VAL F CG2   1 
ATOM   8301  N N     . HIS E 1 383 ? 50.292  -6.319  132.554 1.00 108.55 ? 383 HIS F N     1 
ATOM   8302  C CA    . HIS E 1 383 ? 49.191  -6.298  133.509 1.00 109.14 ? 383 HIS F CA    1 
ATOM   8303  C C     . HIS E 1 383 ? 49.287  -7.442  134.515 1.00 113.63 ? 383 HIS F C     1 
ATOM   8304  O O     . HIS E 1 383 ? 50.003  -8.415  134.294 1.00 119.98 ? 383 HIS F O     1 
ATOM   8305  C CB    . HIS E 1 383 ? 47.854  -6.374  132.773 1.00 112.00 ? 383 HIS F CB    1 
ATOM   8306  C CG    . HIS E 1 383 ? 47.646  -5.266  131.788 1.00 113.26 ? 383 HIS F CG    1 
ATOM   8307  N ND1   . HIS E 1 383 ? 46.792  -4.204  132.041 1.00 113.05 ? 383 HIS F ND1   1 
ATOM   8308  C CD2   . HIS E 1 383 ? 48.171  -5.045  130.568 1.00 116.53 ? 383 HIS F CD2   1 
ATOM   8309  C CE1   . HIS E 1 383 ? 46.811  -3.386  131.003 1.00 117.35 ? 383 HIS F CE1   1 
ATOM   8310  N NE2   . HIS E 1 383 ? 47.631  -3.865  130.098 1.00 119.99 ? 383 HIS F NE2   1 
ATOM   8311  N N     . TYR E 1 384 ? 48.554  -7.312  135.617 1.00 110.91 ? 384 TYR F N     1 
ATOM   8312  C CA    . TYR E 1 384 ? 48.495  -8.340  136.653 1.00 107.09 ? 384 TYR F CA    1 
ATOM   8313  C C     . TYR E 1 384 ? 47.053  -8.821  136.750 1.00 103.12 ? 384 TYR F C     1 
ATOM   8314  O O     . TYR E 1 384 ? 46.198  -8.119  137.288 1.00 98.89  ? 384 TYR F O     1 
ATOM   8315  C CB    . TYR E 1 384 ? 48.950  -7.752  137.993 1.00 106.38 ? 384 TYR F CB    1 
ATOM   8316  C CG    . TYR E 1 384 ? 49.168  -8.748  139.118 1.00 112.55 ? 384 TYR F CG    1 
ATOM   8317  C CD1   . TYR E 1 384 ? 49.767  -8.348  140.305 1.00 114.67 ? 384 TYR F CD1   1 
ATOM   8318  C CD2   . TYR E 1 384 ? 48.782  -10.079 138.998 1.00 122.58 ? 384 TYR F CD2   1 
ATOM   8319  C CE1   . TYR E 1 384 ? 49.972  -9.237  141.338 1.00 120.15 ? 384 TYR F CE1   1 
ATOM   8320  C CE2   . TYR E 1 384 ? 48.982  -10.976 140.027 1.00 127.01 ? 384 TYR F CE2   1 
ATOM   8321  C CZ    . TYR E 1 384 ? 49.579  -10.549 141.194 1.00 126.45 ? 384 TYR F CZ    1 
ATOM   8322  O OH    . TYR E 1 384 ? 49.784  -11.437 142.224 1.00 128.57 ? 384 TYR F OH    1 
ATOM   8323  N N     . VAL E 1 385 ? 46.787  -10.019 136.234 1.00 106.12 ? 385 VAL F N     1 
ATOM   8324  C CA    . VAL E 1 385 ? 45.416  -10.500 136.079 1.00 110.71 ? 385 VAL F CA    1 
ATOM   8325  C C     . VAL E 1 385 ? 45.269  -12.013 136.251 1.00 111.96 ? 385 VAL F C     1 
ATOM   8326  O O     . VAL E 1 385 ? 44.593  -12.661 135.449 1.00 117.58 ? 385 VAL F O     1 
ATOM   8327  C CB    . VAL E 1 385 ? 44.879  -10.152 134.674 1.00 116.67 ? 385 VAL F CB    1 
ATOM   8328  C CG1   . VAL E 1 385 ? 44.634  -8.662  134.534 1.00 121.10 ? 385 VAL F CG1   1 
ATOM   8329  C CG2   . VAL E 1 385 ? 45.859  -10.607 133.619 1.00 91.42  ? 385 VAL F CG2   1 
ATOM   8330  N N     . GLU E 1 386 ? 45.884  -12.581 137.285 1.00 108.50 ? 386 GLU F N     1 
ATOM   8331  C CA    . GLU E 1 386 ? 45.836  -14.031 137.470 1.00 111.61 ? 386 GLU F CA    1 
ATOM   8332  C C     . GLU E 1 386 ? 44.400  -14.559 137.509 1.00 116.98 ? 386 GLU F C     1 
ATOM   8333  O O     . GLU E 1 386 ? 43.614  -14.195 138.387 1.00 123.29 ? 386 GLU F O     1 
ATOM   8334  C CB    . GLU E 1 386 ? 46.614  -14.461 138.717 1.00 116.74 ? 386 GLU F CB    1 
ATOM   8335  C CG    . GLU E 1 386 ? 46.139  -13.830 140.008 1.00 122.92 ? 386 GLU F CG    1 
ATOM   8336  C CD    . GLU E 1 386 ? 46.658  -14.559 141.226 1.00 127.17 ? 386 GLU F CD    1 
ATOM   8337  O OE1   . GLU E 1 386 ? 47.883  -14.795 141.293 1.00 129.28 ? 386 GLU F OE1   1 
ATOM   8338  O OE2   . GLU E 1 386 ? 45.843  -14.905 142.108 1.00 125.58 ? 386 GLU F OE2   1 
ATOM   8339  N N     . ASN E 1 387 ? 44.066  -15.387 136.519 1.00 113.61 ? 387 ASN F N     1 
ATOM   8340  C CA    . ASN E 1 387 ? 42.710  -15.916 136.319 1.00 109.12 ? 387 ASN F CA    1 
ATOM   8341  C C     . ASN E 1 387 ? 41.683  -14.872 135.885 1.00 110.90 ? 387 ASN F C     1 
ATOM   8342  O O     . ASN E 1 387 ? 40.697  -15.201 135.231 1.00 113.66 ? 387 ASN F O     1 
ATOM   8343  C CB    . ASN E 1 387 ? 42.197  -16.658 137.558 1.00 99.75  ? 387 ASN F CB    1 
ATOM   8344  C CG    . ASN E 1 387 ? 43.133  -17.749 138.009 1.00 98.07  ? 387 ASN F CG    1 
ATOM   8345  O OD1   . ASN E 1 387 ? 43.472  -17.844 139.187 1.00 96.80  ? 387 ASN F OD1   1 
ATOM   8346  N ND2   . ASN E 1 387 ? 43.561  -18.581 137.073 1.00 100.64 ? 387 ASN F ND2   1 
ATOM   8347  N N     . GLY E 1 388 ? 41.918  -13.619 136.254 1.00 107.98 ? 388 GLY F N     1 
ATOM   8348  C CA    . GLY E 1 388 ? 40.981  -12.548 135.976 1.00 102.49 ? 388 GLY F CA    1 
ATOM   8349  C C     . GLY E 1 388 ? 40.698  -12.306 134.506 1.00 98.54  ? 388 GLY F C     1 
ATOM   8350  O O     . GLY E 1 388 ? 39.543  -12.147 134.115 1.00 93.39  ? 388 GLY F O     1 
ATOM   8351  N N     . LEU E 1 389 ? 41.745  -12.282 133.686 1.00 101.26 ? 389 LEU F N     1 
ATOM   8352  C CA    . LEU E 1 389 ? 41.596  -11.905 132.282 1.00 102.32 ? 389 LEU F CA    1 
ATOM   8353  C C     . LEU E 1 389 ? 40.845  -12.939 131.446 1.00 97.40  ? 389 LEU F C     1 
ATOM   8354  O O     . LEU E 1 389 ? 39.900  -12.599 130.734 1.00 93.99  ? 389 LEU F O     1 
ATOM   8355  C CB    . LEU E 1 389 ? 42.956  -11.596 131.645 1.00 108.14 ? 389 LEU F CB    1 
ATOM   8356  C CG    . LEU E 1 389 ? 42.936  -11.156 130.176 1.00 107.75 ? 389 LEU F CG    1 
ATOM   8357  C CD1   . LEU E 1 389 ? 42.068  -9.918  129.981 1.00 104.51 ? 389 LEU F CD1   1 
ATOM   8358  C CD2   . LEU E 1 389 ? 44.350  -10.907 129.669 1.00 108.07 ? 389 LEU F CD2   1 
ATOM   8359  N N     . ILE E 1 390 ? 41.261  -14.198 131.531 1.00 96.86  ? 390 ILE F N     1 
ATOM   8360  C CA    . ILE E 1 390 ? 40.698  -15.236 130.672 1.00 99.21  ? 390 ILE F CA    1 
ATOM   8361  C C     . ILE E 1 390 ? 39.301  -15.676 131.119 1.00 97.84  ? 390 ILE F C     1 
ATOM   8362  O O     . ILE E 1 390 ? 38.431  -15.937 130.287 1.00 97.64  ? 390 ILE F O     1 
ATOM   8363  C CB    . ILE E 1 390 ? 41.662  -16.434 130.528 1.00 100.38 ? 390 ILE F CB    1 
ATOM   8364  C CG1   . ILE E 1 390 ? 42.988  -15.948 129.938 1.00 99.98  ? 390 ILE F CG1   1 
ATOM   8365  C CG2   . ILE E 1 390 ? 41.053  -17.528 129.659 1.00 101.81 ? 390 ILE F CG2   1 
ATOM   8366  C CD1   . ILE E 1 390 ? 43.888  -17.047 129.426 1.00 102.06 ? 390 ILE F CD1   1 
ATOM   8367  N N     . ASN E 1 391 ? 39.082  -15.738 132.429 1.00 96.89  ? 391 ASN F N     1 
ATOM   8368  C CA    . ASN E 1 391 ? 37.755  -16.042 132.955 1.00 98.23  ? 391 ASN F CA    1 
ATOM   8369  C C     . ASN E 1 391 ? 36.729  -14.978 132.569 1.00 99.38  ? 391 ASN F C     1 
ATOM   8370  O O     . ASN E 1 391 ? 35.579  -15.297 132.268 1.00 104.38 ? 391 ASN F O     1 
ATOM   8371  C CB    . ASN E 1 391 ? 37.794  -16.226 134.475 1.00 105.22 ? 391 ASN F CB    1 
ATOM   8372  C CG    . ASN E 1 391 ? 38.324  -17.588 134.882 1.00 112.05 ? 391 ASN F CG    1 
ATOM   8373  O OD1   . ASN E 1 391 ? 39.489  -17.733 135.255 1.00 113.39 ? 391 ASN F OD1   1 
ATOM   8374  N ND2   . ASN E 1 391 ? 37.467  -18.599 134.807 1.00 114.29 ? 391 ASN F ND2   1 
ATOM   8375  N N     . SER E 1 392 ? 37.153  -13.718 132.570 1.00 98.61  ? 392 SER F N     1 
ATOM   8376  C CA    . SER E 1 392 ? 36.284  -12.617 132.161 1.00 97.71  ? 392 SER F CA    1 
ATOM   8377  C C     . SER E 1 392 ? 35.957  -12.670 130.671 1.00 103.28 ? 392 SER F C     1 
ATOM   8378  O O     . SER E 1 392 ? 34.814  -12.450 130.274 1.00 110.16 ? 392 SER F O     1 
ATOM   8379  C CB    . SER E 1 392 ? 36.913  -11.263 132.504 1.00 91.48  ? 392 SER F CB    1 
ATOM   8380  O OG    . SER E 1 392 ? 37.024  -11.082 133.906 1.00 91.30  ? 392 SER F OG    1 
ATOM   8381  N N     . LEU E 1 393 ? 36.961  -12.952 129.847 1.00 100.43 ? 393 LEU F N     1 
ATOM   8382  C CA    . LEU E 1 393 ? 36.747  -13.004 128.406 1.00 100.76 ? 393 LEU F CA    1 
ATOM   8383  C C     . LEU E 1 393 ? 35.821  -14.165 128.060 1.00 101.51 ? 393 LEU F C     1 
ATOM   8384  O O     . LEU E 1 393 ? 34.982  -14.061 127.165 1.00 100.20 ? 393 LEU F O     1 
ATOM   8385  C CB    . LEU E 1 393 ? 38.075  -13.115 127.651 1.00 98.90  ? 393 LEU F CB    1 
ATOM   8386  C CG    . LEU E 1 393 ? 39.002  -11.897 127.702 1.00 96.06  ? 393 LEU F CG    1 
ATOM   8387  C CD1   . LEU E 1 393 ? 40.203  -12.108 126.800 1.00 94.51  ? 393 LEU F CD1   1 
ATOM   8388  C CD2   . LEU E 1 393 ? 38.258  -10.634 127.312 1.00 92.86  ? 393 LEU F CD2   1 
ATOM   8389  N N     . PHE E 1 394 ? 35.967  -15.265 128.789 1.00 104.60 ? 394 PHE F N     1 
ATOM   8390  C CA    . PHE E 1 394 ? 35.085  -16.409 128.613 1.00 108.45 ? 394 PHE F CA    1 
ATOM   8391  C C     . PHE E 1 394 ? 33.695  -16.099 129.146 1.00 110.38 ? 394 PHE F C     1 
ATOM   8392  O O     . PHE E 1 394 ? 32.692  -16.548 128.592 1.00 118.67 ? 394 PHE F O     1 
ATOM   8393  C CB    . PHE E 1 394 ? 35.649  -17.637 129.322 1.00 108.60 ? 394 PHE F CB    1 
ATOM   8394  C CG    . PHE E 1 394 ? 34.692  -18.787 129.386 1.00 110.87 ? 394 PHE F CG    1 
ATOM   8395  C CD1   . PHE E 1 394 ? 34.422  -19.544 128.258 1.00 113.47 ? 394 PHE F CD1   1 
ATOM   8396  C CD2   . PHE E 1 394 ? 34.065  -19.116 130.575 1.00 113.29 ? 394 PHE F CD2   1 
ATOM   8397  C CE1   . PHE E 1 394 ? 33.542  -20.607 128.315 1.00 114.09 ? 394 PHE F CE1   1 
ATOM   8398  C CE2   . PHE E 1 394 ? 33.183  -20.176 130.638 1.00 116.65 ? 394 PHE F CE2   1 
ATOM   8399  C CZ    . PHE E 1 394 ? 32.922  -20.924 129.505 1.00 114.58 ? 394 PHE F CZ    1 
ATOM   8400  N N     . GLY E 1 395 ? 33.643  -15.331 130.230 1.00 103.05 ? 395 GLY F N     1 
ATOM   8401  C CA    . GLY E 1 395 ? 32.381  -14.963 130.844 1.00 103.00 ? 395 GLY F CA    1 
ATOM   8402  C C     . GLY E 1 395 ? 31.529  -14.062 129.969 1.00 107.22 ? 395 GLY F C     1 
ATOM   8403  O O     . GLY E 1 395 ? 30.302  -14.157 129.978 1.00 113.80 ? 395 GLY F O     1 
ATOM   8404  N N     . LEU E 1 396 ? 32.179  -13.187 129.210 1.00 103.29 ? 396 LEU F N     1 
ATOM   8405  C CA    . LEU E 1 396 ? 31.466  -12.245 128.355 1.00 101.64 ? 396 LEU F CA    1 
ATOM   8406  C C     . LEU E 1 396 ? 30.954  -12.899 127.076 1.00 107.12 ? 396 LEU F C     1 
ATOM   8407  O O     . LEU E 1 396 ? 29.836  -12.633 126.642 1.00 113.67 ? 396 LEU F O     1 
ATOM   8408  C CB    . LEU E 1 396 ? 32.358  -11.050 128.021 1.00 102.86 ? 396 LEU F CB    1 
ATOM   8409  C CG    . LEU E 1 396 ? 32.711  -10.180 129.226 1.00 103.17 ? 396 LEU F CG    1 
ATOM   8410  C CD1   . LEU E 1 396 ? 33.824  -9.212  128.880 1.00 105.43 ? 396 LEU F CD1   1 
ATOM   8411  C CD2   . LEU E 1 396 ? 31.484  -9.432  129.712 1.00 101.19 ? 396 LEU F CD2   1 
ATOM   8412  N N     . LEU E 1 397 ? 31.769  -13.758 126.475 1.00 107.23 ? 397 LEU F N     1 
ATOM   8413  C CA    . LEU E 1 397 ? 31.385  -14.382 125.213 1.00 108.96 ? 397 LEU F CA    1 
ATOM   8414  C C     . LEU E 1 397 ? 30.265  -15.400 125.408 1.00 111.58 ? 397 LEU F C     1 
ATOM   8415  O O     . LEU E 1 397 ? 29.415  -15.571 124.536 1.00 117.28 ? 397 LEU F O     1 
ATOM   8416  C CB    . LEU E 1 397 ? 32.595  -15.026 124.529 1.00 104.33 ? 397 LEU F CB    1 
ATOM   8417  C CG    . LEU E 1 397 ? 32.377  -15.568 123.114 1.00 101.06 ? 397 LEU F CG    1 
ATOM   8418  C CD1   . LEU E 1 397 ? 31.785  -14.500 122.210 1.00 99.35  ? 397 LEU F CD1   1 
ATOM   8419  C CD2   . LEU E 1 397 ? 33.682  -16.092 122.539 1.00 102.70 ? 397 LEU F CD2   1 
ATOM   8420  N N     . CYS E 1 398 ? 30.259  -16.061 126.561 1.00 107.52 ? 398 CYS F N     1 
ATOM   8421  C CA    . CYS E 1 398 ? 29.262  -17.087 126.837 1.00 110.62 ? 398 CYS F CA    1 
ATOM   8422  C C     . CYS E 1 398 ? 28.261  -16.635 127.891 1.00 111.52 ? 398 CYS F C     1 
ATOM   8423  O O     . CYS E 1 398 ? 27.760  -17.448 128.666 1.00 110.88 ? 398 CYS F O     1 
ATOM   8424  C CB    . CYS E 1 398 ? 29.941  -18.380 127.290 1.00 109.85 ? 398 CYS F CB    1 
ATOM   8425  S SG    . CYS E 1 398 ? 31.095  -19.069 126.087 1.00 103.52 ? 398 CYS F SG    1 
ATOM   8426  N N     . TRP E 1 399 ? 27.969  -15.340 127.914 1.00 112.55 ? 399 TRP F N     1 
ATOM   8427  C CA    . TRP E 1 399 ? 27.057  -14.788 128.909 1.00 113.68 ? 399 TRP F CA    1 
ATOM   8428  C C     . TRP E 1 399 ? 25.645  -15.341 128.743 1.00 118.28 ? 399 TRP F C     1 
ATOM   8429  O O     . TRP E 1 399 ? 25.012  -15.753 129.716 1.00 116.52 ? 399 TRP F O     1 
ATOM   8430  C CB    . TRP E 1 399 ? 27.036  -13.262 128.833 1.00 111.56 ? 399 TRP F CB    1 
ATOM   8431  C CG    . TRP E 1 399 ? 26.264  -12.627 129.944 1.00 108.99 ? 399 TRP F CG    1 
ATOM   8432  C CD1   . TRP E 1 399 ? 24.918  -12.405 129.984 1.00 108.13 ? 399 TRP F CD1   1 
ATOM   8433  C CD2   . TRP E 1 399 ? 26.789  -12.130 131.181 1.00 107.64 ? 399 TRP F CD2   1 
ATOM   8434  N NE1   . TRP E 1 399 ? 24.572  -11.803 131.169 1.00 105.11 ? 399 TRP F NE1   1 
ATOM   8435  C CE2   . TRP E 1 399 ? 25.703  -11.621 131.921 1.00 106.70 ? 399 TRP F CE2   1 
ATOM   8436  C CE3   . TRP E 1 399 ? 28.072  -12.065 131.734 1.00 107.61 ? 399 TRP F CE3   1 
ATOM   8437  C CZ2   . TRP E 1 399 ? 25.859  -11.055 133.185 1.00 108.29 ? 399 TRP F CZ2   1 
ATOM   8438  C CZ3   . TRP E 1 399 ? 28.226  -11.502 132.989 1.00 108.06 ? 399 TRP F CZ3   1 
ATOM   8439  C CH2   . TRP E 1 399 ? 27.124  -11.005 133.701 1.00 108.77 ? 399 TRP F CH2   1 
ATOM   8440  N N     . GLU E 1 400 ? 25.157  -15.352 127.506 1.00 123.26 ? 400 GLU F N     1 
ATOM   8441  C CA    . GLU E 1 400 ? 23.817  -15.855 127.221 1.00 124.41 ? 400 GLU F CA    1 
ATOM   8442  C C     . GLU E 1 400 ? 23.711  -17.359 127.454 1.00 119.38 ? 400 GLU F C     1 
ATOM   8443  O O     . GLU E 1 400 ? 22.614  -17.892 127.625 1.00 122.23 ? 400 GLU F O     1 
ATOM   8444  C CB    . GLU E 1 400 ? 23.398  -15.509 125.790 1.00 131.41 ? 400 GLU F CB    1 
ATOM   8445  C CG    . GLU E 1 400 ? 24.395  -15.927 124.725 1.00 138.99 ? 400 GLU F CG    1 
ATOM   8446  C CD    . GLU E 1 400 ? 25.030  -14.739 124.030 1.00 144.02 ? 400 GLU F CD    1 
ATOM   8447  O OE1   . GLU E 1 400 ? 24.857  -14.607 122.799 1.00 146.99 ? 400 GLU F OE1   1 
ATOM   8448  O OE2   . GLU E 1 400 ? 25.701  -13.937 124.715 1.00 142.70 ? 400 GLU F OE2   1 
ATOM   8449  N N     . ALA E 1 401 ? 24.854  -18.038 127.461 1.00 110.67 ? 401 ALA F N     1 
ATOM   8450  C CA    . ALA E 1 401 ? 24.884  -19.472 127.722 1.00 109.02 ? 401 ALA F CA    1 
ATOM   8451  C C     . ALA E 1 401 ? 24.889  -19.753 129.220 1.00 110.33 ? 401 ALA F C     1 
ATOM   8452  O O     . ALA E 1 401 ? 24.158  -20.617 129.702 1.00 111.48 ? 401 ALA F O     1 
ATOM   8453  C CB    . ALA E 1 401 ? 26.092  -20.113 127.051 1.00 106.57 ? 401 ALA F CB    1 
ATOM   8454  N N     . ILE E 1 402 ? 25.718  -19.016 129.953 1.00 112.94 ? 402 ILE F N     1 
ATOM   8455  C CA    . ILE E 1 402 ? 25.822  -19.183 131.398 1.00 112.07 ? 402 ILE F CA    1 
ATOM   8456  C C     . ILE E 1 402 ? 24.505  -18.820 132.076 1.00 114.47 ? 402 ILE F C     1 
ATOM   8457  O O     . ILE E 1 402 ? 24.007  -19.560 132.925 1.00 118.36 ? 402 ILE F O     1 
ATOM   8458  C CB    . ILE E 1 402 ? 26.960  -18.324 131.977 1.00 108.27 ? 402 ILE F CB    1 
ATOM   8459  C CG1   . ILE E 1 402 ? 28.309  -18.807 131.442 1.00 104.27 ? 402 ILE F CG1   1 
ATOM   8460  C CG2   . ILE E 1 402 ? 26.948  -18.370 133.497 1.00 107.93 ? 402 ILE F CG2   1 
ATOM   8461  C CD1   . ILE E 1 402 ? 29.398  -17.761 131.502 1.00 102.49 ? 402 ILE F CD1   1 
ATOM   8462  N N     . PHE E 1 403 ? 23.940  -17.683 131.681 1.00 110.68 ? 403 PHE F N     1 
ATOM   8463  C CA    . PHE E 1 403 ? 22.672  -17.224 132.235 1.00 106.50 ? 403 PHE F CA    1 
ATOM   8464  C C     . PHE E 1 403 ? 21.489  -17.645 131.373 1.00 111.58 ? 403 PHE F C     1 
ATOM   8465  O O     . PHE E 1 403 ? 20.519  -16.901 131.221 1.00 106.97 ? 403 PHE F O     1 
ATOM   8466  C CB    . PHE E 1 403 ? 22.682  -15.707 132.414 1.00 100.20 ? 403 PHE F CB    1 
ATOM   8467  C CG    . PHE E 1 403 ? 23.647  -15.235 133.455 1.00 100.61 ? 403 PHE F CG    1 
ATOM   8468  C CD1   . PHE E 1 403 ? 23.278  -15.193 134.788 1.00 99.60  ? 403 PHE F CD1   1 
ATOM   8469  C CD2   . PHE E 1 403 ? 24.927  -14.842 133.105 1.00 98.85  ? 403 PHE F CD2   1 
ATOM   8470  C CE1   . PHE E 1 403 ? 24.165  -14.763 135.753 1.00 95.55  ? 403 PHE F CE1   1 
ATOM   8471  C CE2   . PHE E 1 403 ? 25.820  -14.410 134.066 1.00 91.05  ? 403 PHE F CE2   1 
ATOM   8472  C CZ    . PHE E 1 403 ? 25.439  -14.370 135.391 1.00 92.47  ? 403 PHE F CZ    1 
ATOM   8473  N N     . ALA E 1 404 ? 21.579  -18.843 130.807 1.00 117.37 ? 404 ALA F N     1 
ATOM   8474  C CA    . ALA E 1 404 ? 20.471  -19.408 130.054 1.00 123.06 ? 404 ALA F CA    1 
ATOM   8475  C C     . ALA E 1 404 ? 19.346  -19.764 131.017 1.00 123.51 ? 404 ALA F C     1 
ATOM   8476  O O     . ALA E 1 404 ? 19.595  -20.103 132.174 1.00 124.46 ? 404 ALA F O     1 
ATOM   8477  C CB    . ALA E 1 404 ? 20.925  -20.634 129.285 1.00 125.74 ? 404 ALA F CB    1 
ATOM   8478  N N     . ALA E 1 405 ? 18.110  -19.688 130.536 1.00 122.16 ? 405 ALA F N     1 
ATOM   8479  C CA    . ALA E 1 405 ? 16.946  -19.963 131.372 1.00 121.02 ? 405 ALA F CA    1 
ATOM   8480  C C     . ALA E 1 405 ? 16.653  -21.457 131.458 1.00 120.78 ? 405 ALA F C     1 
ATOM   8481  O O     . ALA E 1 405 ? 15.496  -21.875 131.413 1.00 124.39 ? 405 ALA F O     1 
ATOM   8482  C CB    . ALA E 1 405 ? 15.730  -19.208 130.856 1.00 123.32 ? 405 ALA F CB    1 
ATOM   8483  N N     . ILE E 1 406 ? 17.712  -22.252 131.572 1.00 116.69 ? 406 ILE F N     1 
ATOM   8484  C CA    . ILE E 1 406 ? 17.591  -23.691 131.748 1.00 114.78 ? 406 ILE F CA    1 
ATOM   8485  C C     . ILE E 1 406 ? 16.790  -23.971 133.012 1.00 122.42 ? 406 ILE F C     1 
ATOM   8486  O O     . ILE E 1 406 ? 17.054  -23.377 134.058 1.00 122.04 ? 406 ILE F O     1 
ATOM   8487  C CB    . ILE E 1 406 ? 18.980  -24.350 131.868 1.00 107.58 ? 406 ILE F CB    1 
ATOM   8488  C CG1   . ILE E 1 406 ? 19.816  -24.062 130.621 1.00 107.31 ? 406 ILE F CG1   1 
ATOM   8489  C CG2   . ILE E 1 406 ? 18.853  -25.848 132.076 1.00 107.28 ? 406 ILE F CG2   1 
ATOM   8490  C CD1   . ILE E 1 406 ? 19.289  -24.729 129.369 1.00 109.00 ? 406 ILE F CD1   1 
ATOM   8491  N N     . PRO E 1 407 ? 15.789  -24.859 132.913 1.00 127.81 ? 407 PRO F N     1 
ATOM   8492  C CA    . PRO E 1 407 ? 14.993  -25.219 134.090 1.00 127.05 ? 407 PRO F CA    1 
ATOM   8493  C C     . PRO E 1 407 ? 15.857  -25.851 135.176 1.00 123.94 ? 407 PRO F C     1 
ATOM   8494  O O     . PRO E 1 407 ? 16.599  -26.799 134.910 1.00 119.73 ? 407 PRO F O     1 
ATOM   8495  C CB    . PRO E 1 407 ? 13.988  -26.237 133.537 1.00 129.41 ? 407 PRO F CB    1 
ATOM   8496  C CG    . PRO E 1 407 ? 14.607  -26.747 132.275 1.00 131.17 ? 407 PRO F CG    1 
ATOM   8497  C CD    . PRO E 1 407 ? 15.341  -25.576 131.707 1.00 130.99 ? 407 PRO F CD    1 
ATOM   8498  N N     . GLY E 1 408 ? 15.765  -25.312 136.387 1.00 122.63 ? 408 GLY F N     1 
ATOM   8499  C CA    . GLY E 1 408 ? 16.537  -25.811 137.508 1.00 121.41 ? 408 GLY F CA    1 
ATOM   8500  C C     . GLY E 1 408 ? 17.724  -24.922 137.822 1.00 121.61 ? 408 GLY F C     1 
ATOM   8501  O O     . GLY E 1 408 ? 18.218  -24.903 138.948 1.00 123.92 ? 408 GLY F O     1 
ATOM   8502  N N     . ALA E 1 409 ? 18.180  -24.177 136.820 1.00 117.51 ? 409 ALA F N     1 
ATOM   8503  C CA    . ALA E 1 409 ? 19.359  -23.334 136.974 1.00 108.09 ? 409 ALA F CA    1 
ATOM   8504  C C     . ALA E 1 409 ? 19.079  -22.152 137.891 1.00 103.45 ? 409 ALA F C     1 
ATOM   8505  O O     . ALA E 1 409 ? 19.857  -21.860 138.801 1.00 108.39 ? 409 ALA F O     1 
ATOM   8506  C CB    . ALA E 1 409 ? 19.841  -22.850 135.619 1.00 106.78 ? 409 ALA F CB    1 
ATOM   8507  N N     . PHE E 1 410 ? 17.964  -21.474 137.644 1.00 100.85 ? 410 PHE F N     1 
ATOM   8508  C CA    . PHE E 1 410 ? 17.570  -20.322 138.446 1.00 104.26 ? 410 PHE F CA    1 
ATOM   8509  C C     . PHE E 1 410 ? 16.182  -20.516 139.038 1.00 107.47 ? 410 PHE F C     1 
ATOM   8510  O O     . PHE E 1 410 ? 15.303  -21.096 138.398 1.00 113.47 ? 410 PHE F O     1 
ATOM   8511  C CB    . PHE E 1 410 ? 17.605  -19.048 137.604 1.00 102.51 ? 410 PHE F CB    1 
ATOM   8512  C CG    . PHE E 1 410 ? 18.940  -18.777 136.983 1.00 101.05 ? 410 PHE F CG    1 
ATOM   8513  C CD1   . PHE E 1 410 ? 19.890  -18.027 137.651 1.00 97.33  ? 410 PHE F CD1   1 
ATOM   8514  C CD2   . PHE E 1 410 ? 19.252  -19.288 135.737 1.00 104.39 ? 410 PHE F CD2   1 
ATOM   8515  C CE1   . PHE E 1 410 ? 21.124  -17.784 137.085 1.00 98.75  ? 410 PHE F CE1   1 
ATOM   8516  C CE2   . PHE E 1 410 ? 20.483  -19.049 135.164 1.00 103.11 ? 410 PHE F CE2   1 
ATOM   8517  C CZ    . PHE E 1 410 ? 21.421  -18.296 135.838 1.00 99.17  ? 410 PHE F CZ    1 
ATOM   8518  N N     . PHE E 1 411 ? 15.989  -20.026 140.260 1.00 99.82  ? 411 PHE F N     1 
ATOM   8519  C CA    . PHE E 1 411 ? 14.709  -20.177 140.948 1.00 96.79  ? 411 PHE F CA    1 
ATOM   8520  C C     . PHE E 1 411 ? 14.437  -19.093 141.999 1.00 94.30  ? 411 PHE F C     1 
ATOM   8521  O O     . PHE E 1 411 ? 13.536  -19.236 142.827 1.00 95.08  ? 411 PHE F O     1 
ATOM   8522  C CB    . PHE E 1 411 ? 14.591  -21.575 141.564 1.00 97.65  ? 411 PHE F CB    1 
ATOM   8523  C CG    . PHE E 1 411 ? 15.814  -22.014 142.311 1.00 93.75  ? 411 PHE F CG    1 
ATOM   8524  C CD1   . PHE E 1 411 ? 16.010  -21.631 143.625 1.00 95.29  ? 411 PHE F CD1   1 
ATOM   8525  C CD2   . PHE E 1 411 ? 16.764  -22.818 141.703 1.00 94.58  ? 411 PHE F CD2   1 
ATOM   8526  C CE1   . PHE E 1 411 ? 17.134  -22.034 144.319 1.00 98.11  ? 411 PHE F CE1   1 
ATOM   8527  C CE2   . PHE E 1 411 ? 17.890  -23.224 142.391 1.00 97.81  ? 411 PHE F CE2   1 
ATOM   8528  C CZ    . PHE E 1 411 ? 18.075  -22.830 143.701 1.00 99.58  ? 411 PHE F CZ    1 
ATOM   8529  N N     . HIS E 1 412 ? 15.222  -18.019 141.958 1.00 97.29  ? 412 HIS F N     1 
ATOM   8530  C CA    . HIS E 1 412 ? 14.964  -16.817 142.752 1.00 97.73  ? 412 HIS F CA    1 
ATOM   8531  C C     . HIS E 1 412 ? 15.798  -15.670 142.188 1.00 93.99  ? 412 HIS F C     1 
ATOM   8532  O O     . HIS E 1 412 ? 16.555  -15.869 141.243 1.00 98.76  ? 412 HIS F O     1 
ATOM   8533  C CB    . HIS E 1 412 ? 15.272  -17.050 144.239 1.00 99.13  ? 412 HIS F CB    1 
ATOM   8534  C CG    . HIS E 1 412 ? 16.658  -17.548 144.508 1.00 101.04 ? 412 HIS F CG    1 
ATOM   8535  N ND1   . HIS E 1 412 ? 17.754  -16.715 144.558 1.00 100.14 ? 412 HIS F ND1   1 
ATOM   8536  C CD2   . HIS E 1 412 ? 17.122  -18.794 144.757 1.00 107.64 ? 412 HIS F CD2   1 
ATOM   8537  C CE1   . HIS E 1 412 ? 18.837  -17.428 144.816 1.00 103.17 ? 412 HIS F CE1   1 
ATOM   8538  N NE2   . HIS E 1 412 ? 18.479  -18.694 144.941 1.00 107.62 ? 412 HIS F NE2   1 
ATOM   8539  N N     . PRO E 1 413 ? 15.647  -14.452 142.735 1.00 92.18  ? 413 PRO F N     1 
ATOM   8540  C CA    . PRO E 1 413 ? 16.647  -13.445 142.361 1.00 98.34  ? 413 PRO F CA    1 
ATOM   8541  C C     . PRO E 1 413 ? 17.984  -13.759 143.033 1.00 111.41 ? 413 PRO F C     1 
ATOM   8542  O O     . PRO E 1 413 ? 18.178  -14.880 143.493 1.00 123.26 ? 413 PRO F O     1 
ATOM   8543  C CB    . PRO E 1 413 ? 16.058  -12.143 142.916 1.00 89.13  ? 413 PRO F CB    1 
ATOM   8544  C CG    . PRO E 1 413 ? 14.595  -12.404 143.013 1.00 85.19  ? 413 PRO F CG    1 
ATOM   8545  C CD    . PRO E 1 413 ? 14.478  -13.845 143.395 1.00 86.81  ? 413 PRO F CD    1 
ATOM   8546  N N     . PHE E 1 414 ? 18.892  -12.792 143.083 1.00 109.85 ? 414 PHE F N     1 
ATOM   8547  C CA    . PHE E 1 414 ? 20.155  -12.962 143.805 1.00 111.78 ? 414 PHE F CA    1 
ATOM   8548  C C     . PHE E 1 414 ? 20.985  -14.166 143.345 1.00 114.67 ? 414 PHE F C     1 
ATOM   8549  O O     . PHE E 1 414 ? 21.645  -14.822 144.152 1.00 116.68 ? 414 PHE F O     1 
ATOM   8550  C CB    . PHE E 1 414 ? 19.898  -13.034 145.313 1.00 106.71 ? 414 PHE F CB    1 
ATOM   8551  C CG    . PHE E 1 414 ? 18.777  -12.152 145.770 1.00 102.29 ? 414 PHE F CG    1 
ATOM   8552  C CD1   . PHE E 1 414 ? 18.948  -10.781 145.844 1.00 103.08 ? 414 PHE F CD1   1 
ATOM   8553  C CD2   . PHE E 1 414 ? 17.549  -12.690 146.117 1.00 97.65  ? 414 PHE F CD2   1 
ATOM   8554  C CE1   . PHE E 1 414 ? 17.918  -9.962  146.258 1.00 100.82 ? 414 PHE F CE1   1 
ATOM   8555  C CE2   . PHE E 1 414 ? 16.513  -11.877 146.532 1.00 98.92  ? 414 PHE F CE2   1 
ATOM   8556  C CZ    . PHE E 1 414 ? 16.699  -10.509 146.603 1.00 100.17 ? 414 PHE F CZ    1 
ATOM   8557  N N     . HIS E 1 415 ? 20.946  -14.450 142.047 1.00 111.32 ? 415 HIS F N     1 
ATOM   8558  C CA    . HIS E 1 415 ? 21.773  -15.507 141.477 1.00 108.73 ? 415 HIS F CA    1 
ATOM   8559  C C     . HIS E 1 415 ? 23.041  -14.944 140.848 1.00 108.14 ? 415 HIS F C     1 
ATOM   8560  O O     . HIS E 1 415 ? 22.980  -14.096 139.959 1.00 110.84 ? 415 HIS F O     1 
ATOM   8561  C CB    . HIS E 1 415 ? 20.997  -16.295 140.422 1.00 115.68 ? 415 HIS F CB    1 
ATOM   8562  C CG    . HIS E 1 415 ? 20.123  -17.374 140.986 1.00 121.10 ? 415 HIS F CG    1 
ATOM   8563  N ND1   . HIS E 1 415 ? 20.627  -18.450 141.688 1.00 122.31 ? 415 HIS F ND1   1 
ATOM   8564  C CD2   . HIS E 1 415 ? 18.786  -17.554 140.932 1.00 119.65 ? 415 HIS F CD2   1 
ATOM   8565  C CE1   . HIS E 1 415 ? 19.632  -19.237 142.053 1.00 116.37 ? 415 HIS F CE1   1 
ATOM   8566  N NE2   . HIS E 1 415 ? 18.502  -18.717 141.610 1.00 116.02 ? 415 HIS F NE2   1 
ATOM   8567  N N     . SER E 1 416 ? 24.190  -15.420 141.313 1.00 107.19 ? 416 SER F N     1 
ATOM   8568  C CA    . SER E 1 416 ? 25.465  -15.061 140.704 1.00 102.52 ? 416 SER F CA    1 
ATOM   8569  C C     . SER E 1 416 ? 25.757  -15.992 139.537 1.00 108.07 ? 416 SER F C     1 
ATOM   8570  O O     . SER E 1 416 ? 26.353  -15.592 138.538 1.00 113.50 ? 416 SER F O     1 
ATOM   8571  C CB    . SER E 1 416 ? 26.589  -15.160 141.731 1.00 93.83  ? 416 SER F CB    1 
ATOM   8572  O OG    . SER E 1 416 ? 26.319  -14.329 142.843 1.00 100.95 ? 416 SER F OG    1 
ATOM   8573  N N     . ALA E 1 417 ? 25.321  -17.239 139.676 1.00 104.12 ? 417 ALA F N     1 
ATOM   8574  C CA    . ALA E 1 417 ? 25.564  -18.262 138.672 1.00 101.64 ? 417 ALA F CA    1 
ATOM   8575  C C     . ALA E 1 417 ? 24.419  -19.266 138.688 1.00 109.31 ? 417 ALA F C     1 
ATOM   8576  O O     . ALA E 1 417 ? 23.694  -19.359 139.681 1.00 114.71 ? 417 ALA F O     1 
ATOM   8577  C CB    . ALA E 1 417 ? 26.886  -18.958 138.959 1.00 97.22  ? 417 ALA F CB    1 
ATOM   8578  N N     . PRO E 1 418 ? 24.238  -20.014 137.586 1.00 108.96 ? 418 PRO F N     1 
ATOM   8579  C CA    . PRO E 1 418 ? 23.265  -21.111 137.607 1.00 109.42 ? 418 PRO F CA    1 
ATOM   8580  C C     . PRO E 1 418 ? 23.656  -22.158 138.644 1.00 110.04 ? 418 PRO F C     1 
ATOM   8581  O O     . PRO E 1 418 ? 24.842  -22.454 138.795 1.00 110.07 ? 418 PRO F O     1 
ATOM   8582  C CB    . PRO E 1 418 ? 23.371  -21.700 136.195 1.00 112.37 ? 418 PRO F CB    1 
ATOM   8583  C CG    . PRO E 1 418 ? 24.701  -21.249 135.684 1.00 111.63 ? 418 PRO F CG    1 
ATOM   8584  C CD    . PRO E 1 418 ? 24.890  -19.888 136.271 1.00 109.48 ? 418 PRO F CD    1 
ATOM   8585  N N     . ALA E 1 419 ? 22.668  -22.708 139.344 1.00 109.55 ? 419 ALA F N     1 
ATOM   8586  C CA    . ALA E 1 419 ? 22.913  -23.663 140.422 1.00 105.69 ? 419 ALA F CA    1 
ATOM   8587  C C     . ALA E 1 419 ? 23.595  -24.941 139.944 1.00 104.27 ? 419 ALA F C     1 
ATOM   8588  O O     . ALA E 1 419 ? 24.228  -25.646 140.729 1.00 105.83 ? 419 ALA F O     1 
ATOM   8589  C CB    . ALA E 1 419 ? 21.612  -23.997 141.134 1.00 104.22 ? 419 ALA F CB    1 
ATOM   8590  N N     . ASP E 1 420 ? 23.457  -25.243 138.658 1.00 102.93 ? 420 ASP F N     1 
ATOM   8591  C CA    . ASP E 1 420 ? 24.028  -26.465 138.108 1.00 109.72 ? 420 ASP F CA    1 
ATOM   8592  C C     . ASP E 1 420 ? 25.376  -26.192 137.461 1.00 115.97 ? 420 ASP F C     1 
ATOM   8593  O O     . ASP E 1 420 ? 25.799  -26.912 136.556 1.00 122.92 ? 420 ASP F O     1 
ATOM   8594  C CB    . ASP E 1 420 ? 23.080  -27.092 137.086 1.00 114.55 ? 420 ASP F CB    1 
ATOM   8595  C CG    . ASP E 1 420 ? 22.897  -26.228 135.855 1.00 116.56 ? 420 ASP F CG    1 
ATOM   8596  O OD1   . ASP E 1 420 ? 22.929  -24.987 135.992 1.00 118.48 ? 420 ASP F OD1   1 
ATOM   8597  O OD2   . ASP E 1 420 ? 22.729  -26.788 134.750 1.00 113.28 ? 420 ASP F OD2   1 
ATOM   8598  N N     . LEU E 1 421 ? 26.048  -25.147 137.930 1.00 114.45 ? 421 LEU F N     1 
ATOM   8599  C CA    . LEU E 1 421 ? 27.340  -24.763 137.378 1.00 112.63 ? 421 LEU F CA    1 
ATOM   8600  C C     . LEU E 1 421 ? 28.383  -25.864 137.567 1.00 110.52 ? 421 LEU F C     1 
ATOM   8601  O O     . LEU E 1 421 ? 29.215  -26.093 136.691 1.00 109.46 ? 421 LEU F O     1 
ATOM   8602  C CB    . LEU E 1 421 ? 27.825  -23.454 138.004 1.00 112.78 ? 421 LEU F CB    1 
ATOM   8603  C CG    . LEU E 1 421 ? 29.157  -22.908 137.487 1.00 108.83 ? 421 LEU F CG    1 
ATOM   8604  C CD1   . LEU E 1 421 ? 29.021  -22.394 136.060 1.00 111.00 ? 421 LEU F CD1   1 
ATOM   8605  C CD2   . LEU E 1 421 ? 29.682  -21.824 138.411 1.00 101.35 ? 421 LEU F CD2   1 
ATOM   8606  N N     . HIS E 1 422 ? 28.325  -26.555 138.703 1.00 113.06 ? 422 HIS F N     1 
ATOM   8607  C CA    . HIS E 1 422 ? 29.307  -27.596 139.009 1.00 118.79 ? 422 HIS F CA    1 
ATOM   8608  C C     . HIS E 1 422 ? 28.875  -28.989 138.574 1.00 123.76 ? 422 HIS F C     1 
ATOM   8609  O O     . HIS E 1 422 ? 29.566  -29.972 138.845 1.00 127.12 ? 422 HIS F O     1 
ATOM   8610  C CB    . HIS E 1 422 ? 29.646  -27.606 140.498 1.00 119.38 ? 422 HIS F CB    1 
ATOM   8611  C CG    . HIS E 1 422 ? 30.583  -26.506 140.900 1.00 122.58 ? 422 HIS F CG    1 
ATOM   8612  N ND1   . HIS E 1 422 ? 30.744  -25.369 140.156 1.00 124.03 ? 422 HIS F ND1   1 
ATOM   8613  C CD2   . HIS E 1 422 ? 31.411  -26.394 141.968 1.00 124.63 ? 422 HIS F CD2   1 
ATOM   8614  C CE1   . HIS E 1 422 ? 31.634  -24.579 140.750 1.00 126.23 ? 422 HIS F CE1   1 
ATOM   8615  N NE2   . HIS E 1 422 ? 32.047  -25.181 141.845 1.00 125.78 ? 422 HIS F NE2   1 
ATOM   8616  N N     . SER E 1 423 ? 27.734  -29.073 137.902 1.00 122.32 ? 423 SER F N     1 
ATOM   8617  C CA    . SER E 1 423 ? 27.249  -30.351 137.405 1.00 120.55 ? 423 SER F CA    1 
ATOM   8618  C C     . SER E 1 423 ? 28.103  -30.811 136.228 1.00 116.10 ? 423 SER F C     1 
ATOM   8619  O O     . SER E 1 423 ? 28.659  -29.992 135.496 1.00 113.17 ? 423 SER F O     1 
ATOM   8620  C CB    . SER E 1 423 ? 25.782  -30.245 136.995 1.00 125.30 ? 423 SER F CB    1 
ATOM   8621  O OG    . SER E 1 423 ? 25.281  -31.498 136.570 1.00 131.79 ? 423 SER F OG    1 
ATOM   8622  N N     . ALA E 1 424 ? 28.206  -32.124 136.053 1.00 114.63 ? 424 ALA F N     1 
ATOM   8623  C CA    . ALA E 1 424 ? 29.059  -32.693 135.014 1.00 112.77 ? 424 ALA F CA    1 
ATOM   8624  C C     . ALA E 1 424 ? 28.418  -32.626 133.630 1.00 119.79 ? 424 ALA F C     1 
ATOM   8625  O O     . ALA E 1 424 ? 29.064  -32.919 132.625 1.00 123.00 ? 424 ALA F O     1 
ATOM   8626  C CB    . ALA E 1 424 ? 29.432  -34.126 135.360 1.00 108.67 ? 424 ALA F CB    1 
ATOM   8627  N N     . ASP E 1 425 ? 27.145  -32.248 133.582 1.00 124.86 ? 425 ASP F N     1 
ATOM   8628  C CA    . ASP E 1 425 ? 26.455  -32.074 132.309 1.00 131.91 ? 425 ASP F CA    1 
ATOM   8629  C C     . ASP E 1 425 ? 26.004  -30.627 132.150 1.00 128.89 ? 425 ASP F C     1 
ATOM   8630  O O     . ASP E 1 425 ? 25.027  -30.339 131.457 1.00 127.12 ? 425 ASP F O     1 
ATOM   8631  C CB    . ASP E 1 425 ? 25.266  -33.031 132.191 1.00 142.19 ? 425 ASP F CB    1 
ATOM   8632  C CG    . ASP E 1 425 ? 24.197  -32.766 133.230 1.00 151.25 ? 425 ASP F CG    1 
ATOM   8633  O OD1   . ASP E 1 425 ? 24.543  -32.294 134.334 1.00 154.05 ? 425 ASP F OD1   1 
ATOM   8634  O OD2   . ASP E 1 425 ? 23.010  -33.028 132.944 1.00 155.39 ? 425 ASP F OD2   1 
ATOM   8635  N N     . PHE E 1 426 ? 26.730  -29.725 132.805 1.00 125.74 ? 426 PHE F N     1 
ATOM   8636  C CA    . PHE E 1 426 ? 26.467  -28.294 132.719 1.00 120.74 ? 426 PHE F CA    1 
ATOM   8637  C C     . PHE E 1 426 ? 26.600  -27.805 131.282 1.00 119.65 ? 426 PHE F C     1 
ATOM   8638  O O     . PHE E 1 426 ? 25.775  -27.028 130.800 1.00 119.95 ? 426 PHE F O     1 
ATOM   8639  C CB    . PHE E 1 426 ? 27.431  -27.527 133.628 1.00 117.28 ? 426 PHE F CB    1 
ATOM   8640  C CG    . PHE E 1 426 ? 27.472  -26.048 133.363 1.00 115.54 ? 426 PHE F CG    1 
ATOM   8641  C CD1   . PHE E 1 426 ? 26.496  -25.212 133.877 1.00 117.23 ? 426 PHE F CD1   1 
ATOM   8642  C CD2   . PHE E 1 426 ? 28.494  -25.492 132.609 1.00 111.72 ? 426 PHE F CD2   1 
ATOM   8643  C CE1   . PHE E 1 426 ? 26.532  -23.851 133.638 1.00 117.44 ? 426 PHE F CE1   1 
ATOM   8644  C CE2   . PHE E 1 426 ? 28.535  -24.133 132.364 1.00 111.43 ? 426 PHE F CE2   1 
ATOM   8645  C CZ    . PHE E 1 426 ? 27.553  -23.310 132.880 1.00 115.07 ? 426 PHE F CZ    1 
ATOM   8646  N N     . ARG E 1 427 ? 27.645  -28.270 130.604 1.00 118.09 ? 427 ARG F N     1 
ATOM   8647  C CA    . ARG E 1 427 ? 27.895  -27.876 129.224 1.00 121.09 ? 427 ARG F CA    1 
ATOM   8648  C C     . ARG E 1 427 ? 26.838  -28.431 128.272 1.00 127.11 ? 427 ARG F C     1 
ATOM   8649  O O     . ARG E 1 427 ? 26.357  -27.721 127.387 1.00 129.09 ? 427 ARG F O     1 
ATOM   8650  C CB    . ARG E 1 427 ? 29.289  -28.325 128.777 1.00 123.28 ? 427 ARG F CB    1 
ATOM   8651  C CG    . ARG E 1 427 ? 29.522  -28.161 127.285 1.00 129.48 ? 427 ARG F CG    1 
ATOM   8652  C CD    . ARG E 1 427 ? 30.981  -28.329 126.898 1.00 134.89 ? 427 ARG F CD    1 
ATOM   8653  N NE    . ARG E 1 427 ? 31.211  -27.834 125.544 1.00 140.45 ? 427 ARG F NE    1 
ATOM   8654  C CZ    . ARG E 1 427 ? 32.409  -27.675 124.992 1.00 140.70 ? 427 ARG F CZ    1 
ATOM   8655  N NH1   . ARG E 1 427 ? 33.505  -27.973 125.678 1.00 138.85 ? 427 ARG F NH1   1 
ATOM   8656  N NH2   . ARG E 1 427 ? 32.510  -27.214 123.752 1.00 140.33 ? 427 ARG F NH2   1 
ATOM   8657  N N     . GLN E 1 428 ? 26.476  -29.697 128.469 1.00 129.58 ? 428 GLN F N     1 
ATOM   8658  C CA    . GLN E 1 428 ? 25.552  -30.397 127.577 1.00 130.44 ? 428 GLN F CA    1 
ATOM   8659  C C     . GLN E 1 428 ? 24.160  -29.770 127.513 1.00 128.95 ? 428 GLN F C     1 
ATOM   8660  O O     . GLN E 1 428 ? 23.573  -29.659 126.436 1.00 133.50 ? 428 GLN F O     1 
ATOM   8661  C CB    . GLN E 1 428 ? 25.427  -31.872 127.974 1.00 132.09 ? 428 GLN F CB    1 
ATOM   8662  C CG    . GLN E 1 428 ? 24.559  -32.691 127.022 1.00 137.89 ? 428 GLN F CG    1 
ATOM   8663  C CD    . GLN E 1 428 ? 24.210  -34.066 127.567 1.00 141.05 ? 428 GLN F CD    1 
ATOM   8664  O OE1   . GLN E 1 428 ? 24.278  -34.306 128.774 1.00 142.90 ? 428 GLN F OE1   1 
ATOM   8665  N NE2   . GLN E 1 428 ? 23.832  -34.977 126.676 1.00 140.38 ? 428 GLN F NE2   1 
ATOM   8666  N N     . ARG E 1 429 ? 23.630  -29.369 128.665 1.00 120.58 ? 429 ARG F N     1 
ATOM   8667  C CA    . ARG E 1 429 ? 22.294  -28.782 128.725 1.00 119.09 ? 429 ARG F CA    1 
ATOM   8668  C C     . ARG E 1 429 ? 22.232  -27.465 127.952 1.00 118.20 ? 429 ARG F C     1 
ATOM   8669  O O     . ARG E 1 429 ? 21.152  -26.979 127.614 1.00 119.46 ? 429 ARG F O     1 
ATOM   8670  C CB    . ARG E 1 429 ? 21.866  -28.559 130.178 1.00 122.36 ? 429 ARG F CB    1 
ATOM   8671  C CG    . ARG E 1 429 ? 21.880  -29.813 131.039 1.00 125.33 ? 429 ARG F CG    1 
ATOM   8672  C CD    . ARG E 1 429 ? 21.583  -29.479 132.495 1.00 127.81 ? 429 ARG F CD    1 
ATOM   8673  N NE    . ARG E 1 429 ? 21.914  -30.583 133.393 1.00 132.44 ? 429 ARG F NE    1 
ATOM   8674  C CZ    . ARG E 1 429 ? 21.875  -30.509 134.720 1.00 135.51 ? 429 ARG F CZ    1 
ATOM   8675  N NH1   . ARG E 1 429 ? 21.519  -29.379 135.317 1.00 136.71 ? 429 ARG F NH1   1 
ATOM   8676  N NH2   . ARG E 1 429 ? 22.195  -31.567 135.454 1.00 135.01 ? 429 ARG F NH2   1 
ATOM   8677  N N     . ARG E 1 430 ? 23.401  -26.897 127.677 1.00 118.25 ? 430 ARG F N     1 
ATOM   8678  C CA    . ARG E 1 430 ? 23.505  -25.640 126.951 1.00 120.11 ? 430 ARG F CA    1 
ATOM   8679  C C     . ARG E 1 430 ? 24.418  -25.811 125.745 1.00 124.86 ? 430 ARG F C     1 
ATOM   8680  O O     . ARG E 1 430 ? 24.960  -24.833 125.225 1.00 126.23 ? 430 ARG F O     1 
ATOM   8681  C CB    . ARG E 1 430 ? 24.083  -24.560 127.862 1.00 116.71 ? 430 ARG F CB    1 
ATOM   8682  C CG    . ARG E 1 430 ? 23.353  -24.386 129.179 1.00 113.05 ? 430 ARG F CG    1 
ATOM   8683  C CD    . ARG E 1 430 ? 24.292  -23.809 130.222 1.00 114.59 ? 430 ARG F CD    1 
ATOM   8684  N NE    . ARG E 1 430 ? 23.595  -23.401 131.437 1.00 118.94 ? 430 ARG F NE    1 
ATOM   8685  C CZ    . ARG E 1 430 ? 23.306  -24.217 132.445 1.00 118.36 ? 430 ARG F CZ    1 
ATOM   8686  N NH1   . ARG E 1 430 ? 23.647  -25.497 132.384 1.00 116.10 ? 430 ARG F NH1   1 
ATOM   8687  N NH2   . ARG E 1 430 ? 22.671  -23.752 133.513 1.00 117.95 ? 430 ARG F NH2   1 
ATOM   8688  N N     . ALA E 1 431 ? 24.584  -27.059 125.313 1.00 125.69 ? 431 ALA F N     1 
ATOM   8689  C CA    . ALA E 1 431 ? 25.525  -27.408 124.251 1.00 119.42 ? 431 ALA F CA    1 
ATOM   8690  C C     . ALA E 1 431 ? 25.291  -26.620 122.969 1.00 119.38 ? 431 ALA F C     1 
ATOM   8691  O O     . ALA E 1 431 ? 26.240  -26.235 122.289 1.00 117.09 ? 431 ALA F O     1 
ATOM   8692  C CB    . ALA E 1 431 ? 25.480  -28.902 123.972 1.00 114.59 ? 431 ALA F CB    1 
ATOM   8693  N N     . ALA E 1 432 ? 24.026  -26.381 122.644 1.00 123.72 ? 432 ALA F N     1 
ATOM   8694  C CA    . ALA E 1 432 ? 23.688  -25.589 121.470 1.00 129.65 ? 432 ALA F CA    1 
ATOM   8695  C C     . ALA E 1 432 ? 24.112  -24.135 121.655 1.00 125.74 ? 432 ALA F C     1 
ATOM   8696  O O     . ALA E 1 432 ? 24.646  -23.515 120.736 1.00 123.24 ? 432 ALA F O     1 
ATOM   8697  C CB    . ALA E 1 432 ? 22.199  -25.677 121.180 1.00 133.90 ? 432 ALA F CB    1 
ATOM   8698  N N     . LEU E 1 433 ? 23.883  -23.600 122.849 1.00 125.88 ? 433 LEU F N     1 
ATOM   8699  C CA    . LEU E 1 433 ? 24.169  -22.194 123.124 1.00 129.03 ? 433 LEU F CA    1 
ATOM   8700  C C     . LEU E 1 433 ? 25.662  -21.897 123.145 1.00 132.06 ? 433 LEU F C     1 
ATOM   8701  O O     . LEU E 1 433 ? 26.095  -20.826 122.719 1.00 131.41 ? 433 LEU F O     1 
ATOM   8702  C CB    . LEU E 1 433 ? 23.540  -21.752 124.448 1.00 124.60 ? 433 LEU F CB    1 
ATOM   8703  C CG    . LEU E 1 433 ? 22.014  -21.655 124.515 1.00 122.98 ? 433 LEU F CG    1 
ATOM   8704  C CD1   . LEU E 1 433 ? 21.374  -23.032 124.681 1.00 124.78 ? 433 LEU F CD1   1 
ATOM   8705  C CD2   . LEU E 1 433 ? 21.588  -20.714 125.634 1.00 117.43 ? 433 LEU F CD2   1 
ATOM   8706  N N     . PHE E 1 434 ? 26.445  -22.843 123.649 1.00 135.90 ? 434 PHE F N     1 
ATOM   8707  C CA    . PHE E 1 434 ? 27.888  -22.659 123.746 1.00 140.06 ? 434 PHE F CA    1 
ATOM   8708  C C     . PHE E 1 434 ? 28.575  -22.680 122.388 1.00 149.41 ? 434 PHE F C     1 
ATOM   8709  O O     . PHE E 1 434 ? 29.472  -21.878 122.129 1.00 151.37 ? 434 PHE F O     1 
ATOM   8710  C CB    . PHE E 1 434 ? 28.508  -23.703 124.670 1.00 136.75 ? 434 PHE F CB    1 
ATOM   8711  C CG    . PHE E 1 434 ? 28.513  -23.299 126.111 1.00 133.37 ? 434 PHE F CG    1 
ATOM   8712  C CD1   . PHE E 1 434 ? 27.474  -23.659 126.950 1.00 134.14 ? 434 PHE F CD1   1 
ATOM   8713  C CD2   . PHE E 1 434 ? 29.554  -22.545 126.624 1.00 130.44 ? 434 PHE F CD2   1 
ATOM   8714  C CE1   . PHE E 1 434 ? 27.477  -23.281 128.279 1.00 132.76 ? 434 PHE F CE1   1 
ATOM   8715  C CE2   . PHE E 1 434 ? 29.564  -22.165 127.951 1.00 130.80 ? 434 PHE F CE2   1 
ATOM   8716  C CZ    . PHE E 1 434 ? 28.523  -22.533 128.780 1.00 131.82 ? 434 PHE F CZ    1 
ATOM   8717  N N     . GLU E 1 435 ? 28.157  -23.599 121.523 1.00 154.68 ? 435 GLU F N     1 
ATOM   8718  C CA    . GLU E 1 435 ? 28.717  -23.676 120.180 1.00 158.77 ? 435 GLU F CA    1 
ATOM   8719  C C     . GLU E 1 435 ? 28.332  -22.437 119.377 1.00 156.16 ? 435 GLU F C     1 
ATOM   8720  O O     . GLU E 1 435 ? 29.014  -22.066 118.422 1.00 159.28 ? 435 GLU F O     1 
ATOM   8721  C CB    . GLU E 1 435 ? 28.242  -24.939 119.458 1.00 166.50 ? 435 GLU F CB    1 
ATOM   8722  C CG    . GLU E 1 435 ? 28.560  -26.244 120.176 1.00 171.31 ? 435 GLU F CG    1 
ATOM   8723  C CD    . GLU E 1 435 ? 30.030  -26.392 120.521 1.00 174.24 ? 435 GLU F CD    1 
ATOM   8724  O OE1   . GLU E 1 435 ? 30.840  -26.646 119.603 1.00 176.66 ? 435 GLU F OE1   1 
ATOM   8725  O OE2   . GLU E 1 435 ? 30.374  -26.259 121.715 1.00 171.81 ? 435 GLU F OE2   1 
ATOM   8726  N N     . ALA E 1 436 ? 27.234  -21.801 119.773 1.00 149.03 ? 436 ALA F N     1 
ATOM   8727  C CA    . ALA E 1 436 ? 26.755  -20.599 119.104 1.00 144.22 ? 436 ALA F CA    1 
ATOM   8728  C C     . ALA E 1 436 ? 27.527  -19.372 119.572 1.00 140.21 ? 436 ALA F C     1 
ATOM   8729  O O     . ALA E 1 436 ? 27.618  -18.373 118.859 1.00 142.33 ? 436 ALA F O     1 
ATOM   8730  C CB    . ALA E 1 436 ? 25.268  -20.415 119.350 1.00 142.08 ? 436 ALA F CB    1 
ATOM   8731  N N     . CYS E 1 437 ? 28.078  -19.455 120.779 1.00 135.57 ? 437 CYS F N     1 
ATOM   8732  C CA    . CYS E 1 437 ? 28.867  -18.366 121.343 1.00 131.16 ? 437 CYS F CA    1 
ATOM   8733  C C     . CYS E 1 437 ? 30.332  -18.486 120.944 1.00 130.87 ? 437 CYS F C     1 
ATOM   8734  O O     . CYS E 1 437 ? 30.973  -17.496 120.594 1.00 136.55 ? 437 CYS F O     1 
ATOM   8735  C CB    . CYS E 1 437 ? 28.739  -18.340 122.866 1.00 127.03 ? 437 CYS F CB    1 
ATOM   8736  S SG    . CYS E 1 437 ? 27.098  -17.875 123.459 1.00 142.75 ? 437 CYS F SG    1 
ATOM   8737  N N     . LEU E 1 438 ? 30.861  -19.703 120.995 1.00 125.79 ? 438 LEU F N     1 
ATOM   8738  C CA    . LEU E 1 438 ? 32.228  -19.944 120.555 1.00 125.45 ? 438 LEU F CA    1 
ATOM   8739  C C     . LEU E 1 438 ? 32.289  -19.966 119.033 1.00 131.46 ? 438 LEU F C     1 
ATOM   8740  O O     . LEU E 1 438 ? 33.369  -19.987 118.445 1.00 132.70 ? 438 LEU F O     1 
ATOM   8741  C CB    . LEU E 1 438 ? 32.759  -21.257 121.126 1.00 120.37 ? 438 LEU F CB    1 
ATOM   8742  C CG    . LEU E 1 438 ? 32.711  -21.390 122.648 1.00 115.78 ? 438 LEU F CG    1 
ATOM   8743  C CD1   . LEU E 1 438 ? 33.286  -22.729 123.077 1.00 115.23 ? 438 LEU F CD1   1 
ATOM   8744  C CD2   . LEU E 1 438 ? 33.448  -20.239 123.323 1.00 113.54 ? 438 LEU F CD2   1 
ATOM   8745  N N     . GLY E 1 439 ? 31.118  -19.969 118.402 1.00 135.61 ? 439 GLY F N     1 
ATOM   8746  C CA    . GLY E 1 439 ? 31.026  -19.919 116.956 1.00 140.92 ? 439 GLY F CA    1 
ATOM   8747  C C     . GLY E 1 439 ? 31.276  -18.508 116.469 1.00 142.11 ? 439 GLY F C     1 
ATOM   8748  O O     . GLY E 1 439 ? 31.683  -18.291 115.329 1.00 144.41 ? 439 GLY F O     1 
ATOM   8749  N N     . ARG E 1 440 ? 31.034  -17.547 117.354 1.00 140.53 ? 440 ARG F N     1 
ATOM   8750  C CA    . ARG E 1 440 ? 31.308  -16.145 117.073 1.00 141.95 ? 440 ARG F CA    1 
ATOM   8751  C C     . ARG E 1 440 ? 32.812  -15.900 117.093 1.00 143.24 ? 440 ARG F C     1 
ATOM   8752  O O     . ARG E 1 440 ? 33.294  -14.872 116.621 1.00 145.31 ? 440 ARG F O     1 
ATOM   8753  C CB    . ARG E 1 440 ? 30.618  -15.256 118.110 1.00 138.09 ? 440 ARG F CB    1 
ATOM   8754  C CG    . ARG E 1 440 ? 29.129  -15.524 118.256 1.00 136.64 ? 440 ARG F CG    1 
ATOM   8755  C CD    . ARG E 1 440 ? 28.484  -14.597 119.275 1.00 135.27 ? 440 ARG F CD    1 
ATOM   8756  N NE    . ARG E 1 440 ? 28.597  -13.194 118.886 1.00 137.66 ? 440 ARG F NE    1 
ATOM   8757  C CZ    . ARG E 1 440 ? 27.761  -12.578 118.056 1.00 140.31 ? 440 ARG F CZ    1 
ATOM   8758  N NH1   . ARG E 1 440 ? 26.745  -13.242 117.518 1.00 142.07 ? 440 ARG F NH1   1 
ATOM   8759  N NH2   . ARG E 1 440 ? 27.941  -11.297 117.761 1.00 139.71 ? 440 ARG F NH2   1 
ATOM   8760  N N     . LEU E 1 441 ? 33.546  -16.864 117.640 1.00 140.91 ? 441 LEU F N     1 
ATOM   8761  C CA    . LEU E 1 441 ? 34.987  -16.748 117.814 1.00 138.84 ? 441 LEU F CA    1 
ATOM   8762  C C     . LEU E 1 441 ? 35.718  -17.134 116.533 1.00 143.98 ? 441 LEU F C     1 
ATOM   8763  O O     . LEU E 1 441 ? 36.941  -17.021 116.442 1.00 145.86 ? 441 LEU F O     1 
ATOM   8764  C CB    . LEU E 1 441 ? 35.436  -17.632 118.979 1.00 132.93 ? 441 LEU F CB    1 
ATOM   8765  C CG    . LEU E 1 441 ? 36.839  -17.453 119.560 1.00 129.66 ? 441 LEU F CG    1 
ATOM   8766  C CD1   . LEU E 1 441 ? 37.011  -16.070 120.165 1.00 126.90 ? 441 LEU F CD1   1 
ATOM   8767  C CD2   . LEU E 1 441 ? 37.108  -18.527 120.596 1.00 126.44 ? 441 LEU F CD2   1 
ATOM   8768  N N     . GLU E 1 442 ? 34.957  -17.583 115.541 1.00 148.94 ? 442 GLU F N     1 
ATOM   8769  C CA    . GLU E 1 442 ? 35.526  -17.995 114.263 1.00 153.69 ? 442 GLU F CA    1 
ATOM   8770  C C     . GLU E 1 442 ? 35.390  -16.899 113.204 1.00 155.17 ? 442 GLU F C     1 
ATOM   8771  O O     . GLU E 1 442 ? 36.359  -16.569 112.521 1.00 157.68 ? 442 GLU F O     1 
ATOM   8772  C CB    . GLU E 1 442 ? 34.897  -19.309 113.794 1.00 156.79 ? 442 GLU F CB    1 
ATOM   8773  C CG    . GLU E 1 442 ? 34.879  -20.391 114.870 1.00 154.96 ? 442 GLU F CG    1 
ATOM   8774  C CD    . GLU E 1 442 ? 36.240  -20.610 115.510 1.00 150.81 ? 442 GLU F CD    1 
ATOM   8775  O OE1   . GLU E 1 442 ? 37.260  -20.545 114.790 1.00 151.53 ? 442 GLU F OE1   1 
ATOM   8776  O OE2   . GLU E 1 442 ? 36.289  -20.844 116.737 1.00 145.61 ? 442 GLU F OE2   1 
ATOM   8777  N N     . ASP E 1 443 ? 34.193  -16.336 113.068 1.00 155.30 ? 443 ASP F N     1 
ATOM   8778  C CA    . ASP E 1 443 ? 34.021  -15.132 112.258 1.00 159.20 ? 443 ASP F CA    1 
ATOM   8779  C C     . ASP E 1 443 ? 34.329  -13.903 113.113 1.00 158.70 ? 443 ASP F C     1 
ATOM   8780  O O     . ASP E 1 443 ? 34.696  -14.033 114.280 1.00 157.93 ? 443 ASP F O     1 
ATOM   8781  C CB    . ASP E 1 443 ? 32.617  -15.054 111.654 1.00 162.45 ? 443 ASP F CB    1 
ATOM   8782  C CG    . ASP E 1 443 ? 31.530  -15.319 112.669 1.00 164.65 ? 443 ASP F CG    1 
ATOM   8783  O OD1   . ASP E 1 443 ? 31.727  -16.196 113.534 1.00 164.40 ? 443 ASP F OD1   1 
ATOM   8784  O OD2   . ASP E 1 443 ? 30.477  -14.650 112.601 1.00 167.10 ? 443 ASP F OD2   1 
ATOM   8785  N N     . GLY E 1 444 ? 34.182  -12.714 112.541 1.00 159.35 ? 444 GLY F N     1 
ATOM   8786  C CA    . GLY E 1 444 ? 34.643  -11.504 113.201 1.00 158.85 ? 444 GLY F CA    1 
ATOM   8787  C C     . GLY E 1 444 ? 33.903  -11.094 114.463 1.00 154.70 ? 444 GLY F C     1 
ATOM   8788  O O     . GLY E 1 444 ? 34.415  -10.301 115.257 1.00 153.69 ? 444 GLY F O     1 
ATOM   8789  N N     . SER E 1 445 ? 32.711  -11.652 114.654 1.00 151.33 ? 445 SER F N     1 
ATOM   8790  C CA    . SER E 1 445 ? 31.752  -11.152 115.644 1.00 148.06 ? 445 SER F CA    1 
ATOM   8791  C C     . SER E 1 445 ? 32.240  -11.087 117.093 1.00 146.96 ? 445 SER F C     1 
ATOM   8792  O O     . SER E 1 445 ? 31.807  -10.220 117.854 1.00 146.03 ? 445 SER F O     1 
ATOM   8793  C CB    . SER E 1 445 ? 30.452  -11.957 115.568 1.00 145.11 ? 445 SER F CB    1 
ATOM   8794  O OG    . SER E 1 445 ? 30.719  -13.346 115.511 1.00 144.29 ? 445 SER F OG    1 
ATOM   8795  N N     . TYR E 1 446 ? 33.140  -11.993 117.464 1.00 145.32 ? 446 TYR F N     1 
ATOM   8796  C CA    . TYR E 1 446 ? 33.584  -12.122 118.852 1.00 139.12 ? 446 TYR F CA    1 
ATOM   8797  C C     . TYR E 1 446 ? 34.159  -10.834 119.458 1.00 140.22 ? 446 TYR F C     1 
ATOM   8798  O O     . TYR E 1 446 ? 33.840  -10.493 120.595 1.00 137.97 ? 446 TYR F O     1 
ATOM   8799  C CB    . TYR E 1 446 ? 34.568  -13.291 119.001 1.00 138.24 ? 446 TYR F CB    1 
ATOM   8800  C CG    . TYR E 1 446 ? 36.019  -12.949 118.741 1.00 138.59 ? 446 TYR F CG    1 
ATOM   8801  C CD1   . TYR E 1 446 ? 36.542  -12.953 117.453 1.00 139.70 ? 446 TYR F CD1   1 
ATOM   8802  C CD2   . TYR E 1 446 ? 36.869  -12.632 119.792 1.00 137.96 ? 446 TYR F CD2   1 
ATOM   8803  C CE1   . TYR E 1 446 ? 37.874  -12.642 117.223 1.00 140.83 ? 446 TYR F CE1   1 
ATOM   8804  C CE2   . TYR E 1 446 ? 38.194  -12.323 119.573 1.00 138.82 ? 446 TYR F CE2   1 
ATOM   8805  C CZ    . TYR E 1 446 ? 38.694  -12.330 118.291 1.00 138.76 ? 446 TYR F CZ    1 
ATOM   8806  O OH    . TYR E 1 446 ? 40.018  -12.017 118.085 1.00 137.27 ? 446 TYR F OH    1 
ATOM   8807  N N     . ARG E 1 447 ? 34.994  -10.124 118.700 1.00 144.33 ? 447 ARG F N     1 
ATOM   8808  C CA    . ARG E 1 447 ? 35.617  -8.890  119.182 1.00 140.93 ? 447 ARG F CA    1 
ATOM   8809  C C     . ARG E 1 447 ? 34.566  -7.848  119.562 1.00 135.55 ? 447 ARG F C     1 
ATOM   8810  O O     . ARG E 1 447 ? 34.667  -7.191  120.600 1.00 129.71 ? 447 ARG F O     1 
ATOM   8811  C CB    . ARG E 1 447 ? 36.560  -8.306  118.121 1.00 144.44 ? 447 ARG F CB    1 
ATOM   8812  C CG    . ARG E 1 447 ? 37.869  -9.069  117.905 1.00 147.25 ? 447 ARG F CG    1 
ATOM   8813  C CD    . ARG E 1 447 ? 38.438  -8.776  116.511 1.00 153.66 ? 447 ARG F CD    1 
ATOM   8814  N NE    . ARG E 1 447 ? 39.881  -8.530  116.513 1.00 157.79 ? 447 ARG F NE    1 
ATOM   8815  C CZ    . ARG E 1 447 ? 40.799  -9.407  116.114 1.00 161.36 ? 447 ARG F CZ    1 
ATOM   8816  N NH1   . ARG E 1 447 ? 40.433  -10.604 115.676 1.00 162.63 ? 447 ARG F NH1   1 
ATOM   8817  N NH2   . ARG E 1 447 ? 42.088  -9.086  116.151 1.00 162.21 ? 447 ARG F NH2   1 
ATOM   8818  N N     . ASP E 1 448 ? 33.555  -7.709  118.710 1.00 136.44 ? 448 ASP F N     1 
ATOM   8819  C CA    . ASP E 1 448 ? 32.488  -6.739  118.927 1.00 135.73 ? 448 ASP F CA    1 
ATOM   8820  C C     . ASP E 1 448 ? 31.456  -7.257  119.928 1.00 128.81 ? 448 ASP F C     1 
ATOM   8821  O O     . ASP E 1 448 ? 30.864  -6.480  120.677 1.00 125.90 ? 448 ASP F O     1 
ATOM   8822  C CB    . ASP E 1 448 ? 31.816  -6.379  117.598 1.00 140.45 ? 448 ASP F CB    1 
ATOM   8823  C CG    . ASP E 1 448 ? 31.984  -4.914  117.234 1.00 141.12 ? 448 ASP F CG    1 
ATOM   8824  O OD1   . ASP E 1 448 ? 31.858  -4.058  118.136 1.00 139.13 ? 448 ASP F OD1   1 
ATOM   8825  O OD2   . ASP E 1 448 ? 32.246  -4.616  116.049 1.00 142.68 ? 448 ASP F OD2   1 
ATOM   8826  N N     . ALA E 1 449 ? 31.251  -8.573  119.937 1.00 123.79 ? 449 ALA F N     1 
ATOM   8827  C CA    . ALA E 1 449 ? 30.305  -9.204  120.855 1.00 115.67 ? 449 ALA F CA    1 
ATOM   8828  C C     . ALA E 1 449 ? 30.708  -8.982  122.309 1.00 114.76 ? 449 ALA F C     1 
ATOM   8829  O O     . ALA E 1 449 ? 29.859  -8.736  123.167 1.00 111.54 ? 449 ALA F O     1 
ATOM   8830  C CB    . ALA E 1 449 ? 30.186  -10.690 120.559 1.00 111.74 ? 449 ALA F CB    1 
ATOM   8831  N N     . ILE E 1 450 ? 32.007  -9.074  122.578 1.00 116.82 ? 450 ILE F N     1 
ATOM   8832  C CA    . ILE E 1 450 ? 32.534  -8.817  123.913 1.00 113.80 ? 450 ILE F CA    1 
ATOM   8833  C C     . ILE E 1 450 ? 32.314  -7.365  124.318 1.00 115.48 ? 450 ILE F C     1 
ATOM   8834  O O     . ILE E 1 450 ? 31.847  -7.089  125.422 1.00 115.21 ? 450 ILE F O     1 
ATOM   8835  C CB    . ILE E 1 450 ? 34.039  -9.141  124.003 1.00 113.48 ? 450 ILE F CB    1 
ATOM   8836  C CG1   . ILE E 1 450 ? 34.287  -10.607 123.657 1.00 115.51 ? 450 ILE F CG1   1 
ATOM   8837  C CG2   . ILE E 1 450 ? 34.571  -8.837  125.394 1.00 107.24 ? 450 ILE F CG2   1 
ATOM   8838  C CD1   . ILE E 1 450 ? 33.505  -11.561 124.513 1.00 115.67 ? 450 ILE F CD1   1 
ATOM   8839  N N     . ARG E 1 451 ? 32.641  -6.442  123.417 1.00 120.23 ? 451 ARG F N     1 
ATOM   8840  C CA    . ARG E 1 451 ? 32.526  -5.013  123.697 1.00 122.36 ? 451 ARG F CA    1 
ATOM   8841  C C     . ARG E 1 451 ? 31.098  -4.595  124.047 1.00 119.24 ? 451 ARG F C     1 
ATOM   8842  O O     . ARG E 1 451 ? 30.889  -3.601  124.743 1.00 116.27 ? 451 ARG F O     1 
ATOM   8843  C CB    . ARG E 1 451 ? 33.034  -4.183  122.514 1.00 127.39 ? 451 ARG F CB    1 
ATOM   8844  C CG    . ARG E 1 451 ? 34.540  -4.234  122.288 1.00 129.98 ? 451 ARG F CG    1 
ATOM   8845  C CD    . ARG E 1 451 ? 34.952  -3.158  121.292 1.00 135.04 ? 451 ARG F CD    1 
ATOM   8846  N NE    . ARG E 1 451 ? 36.399  -3.047  121.128 1.00 137.41 ? 451 ARG F NE    1 
ATOM   8847  C CZ    . ARG E 1 451 ? 37.093  -3.663  120.177 1.00 139.68 ? 451 ARG F CZ    1 
ATOM   8848  N NH1   . ARG E 1 451 ? 36.474  -4.445  119.300 1.00 138.29 ? 451 ARG F NH1   1 
ATOM   8849  N NH2   . ARG E 1 451 ? 38.407  -3.499  120.101 1.00 141.33 ? 451 ARG F NH2   1 
ATOM   8850  N N     . CYS E 1 452 ? 30.123  -5.357  123.561 1.00 119.53 ? 452 CYS F N     1 
ATOM   8851  C CA    . CYS E 1 452 ? 28.718  -5.064  123.819 1.00 119.80 ? 452 CYS F CA    1 
ATOM   8852  C C     . CYS E 1 452 ? 28.277  -5.606  125.176 1.00 116.83 ? 452 CYS F C     1 
ATOM   8853  O O     . CYS E 1 452 ? 27.542  -4.943  125.907 1.00 114.29 ? 452 CYS F O     1 
ATOM   8854  C CB    . CYS E 1 452 ? 27.841  -5.630  122.702 1.00 122.86 ? 452 CYS F CB    1 
ATOM   8855  S SG    . CYS E 1 452 ? 28.127  -4.857  121.091 1.00 189.26 ? 452 CYS F SG    1 
ATOM   8856  N N     . ARG E 1 453 ? 28.727  -6.814  125.501 1.00 115.50 ? 453 ARG F N     1 
ATOM   8857  C CA    . ARG E 1 453 ? 28.477  -7.405  126.810 1.00 109.89 ? 453 ARG F CA    1 
ATOM   8858  C C     . ARG E 1 453 ? 29.032  -6.503  127.898 1.00 109.20 ? 453 ARG F C     1 
ATOM   8859  O O     . ARG E 1 453 ? 28.364  -6.229  128.896 1.00 111.58 ? 453 ARG F O     1 
ATOM   8860  C CB    . ARG E 1 453 ? 29.147  -8.773  126.912 1.00 110.21 ? 453 ARG F CB    1 
ATOM   8861  C CG    . ARG E 1 453 ? 28.597  -9.803  125.959 1.00 115.03 ? 453 ARG F CG    1 
ATOM   8862  C CD    . ARG E 1 453 ? 27.153  -10.126 126.282 1.00 112.35 ? 453 ARG F CD    1 
ATOM   8863  N NE    . ARG E 1 453 ? 26.608  -11.095 125.339 1.00 117.23 ? 453 ARG F NE    1 
ATOM   8864  C CZ    . ARG E 1 453 ? 26.201  -10.784 124.113 1.00 124.44 ? 453 ARG F CZ    1 
ATOM   8865  N NH1   . ARG E 1 453 ? 26.279  -9.529  123.687 1.00 123.19 ? 453 ARG F NH1   1 
ATOM   8866  N NH2   . ARG E 1 453 ? 25.717  -11.724 123.312 1.00 129.36 ? 453 ARG F NH2   1 
ATOM   8867  N N     . TYR E 1 454 ? 30.265  -6.052  127.684 1.00 107.29 ? 454 TYR F N     1 
ATOM   8868  C CA    . TYR E 1 454 ? 30.976  -5.208  128.634 1.00 105.30 ? 454 TYR F CA    1 
ATOM   8869  C C     . TYR E 1 454 ? 30.152  -3.987  129.016 1.00 112.85 ? 454 TYR F C     1 
ATOM   8870  O O     . TYR E 1 454 ? 30.045  -3.647  130.192 1.00 114.36 ? 454 TYR F O     1 
ATOM   8871  C CB    . TYR E 1 454 ? 32.324  -4.774  128.049 1.00 99.60  ? 454 TYR F CB    1 
ATOM   8872  C CG    . TYR E 1 454 ? 33.215  -4.019  129.014 1.00 95.98  ? 454 TYR F CG    1 
ATOM   8873  C CD1   . TYR E 1 454 ? 33.202  -2.630  129.062 1.00 94.97  ? 454 TYR F CD1   1 
ATOM   8874  C CD2   . TYR E 1 454 ? 34.077  -4.695  129.867 1.00 88.52  ? 454 TYR F CD2   1 
ATOM   8875  C CE1   . TYR E 1 454 ? 34.016  -1.937  129.938 1.00 94.12  ? 454 TYR F CE1   1 
ATOM   8876  C CE2   . TYR E 1 454 ? 34.895  -4.009  130.748 1.00 88.07  ? 454 TYR F CE2   1 
ATOM   8877  C CZ    . TYR E 1 454 ? 34.860  -2.630  130.778 1.00 98.08  ? 454 TYR F CZ    1 
ATOM   8878  O OH    . TYR E 1 454 ? 35.671  -1.938  131.649 1.00 103.20 ? 454 TYR F OH    1 
ATOM   8879  N N     . ARG E 1 455 ? 29.559  -3.337  128.021 1.00 116.58 ? 455 ARG F N     1 
ATOM   8880  C CA    . ARG E 1 455 ? 28.771  -2.133  128.266 1.00 117.93 ? 455 ARG F CA    1 
ATOM   8881  C C     . ARG E 1 455 ? 27.398  -2.454  128.846 1.00 114.08 ? 455 ARG F C     1 
ATOM   8882  O O     . ARG E 1 455 ? 26.910  -1.756  129.737 1.00 113.44 ? 455 ARG F O     1 
ATOM   8883  C CB    . ARG E 1 455 ? 28.632  -1.314  126.981 1.00 120.93 ? 455 ARG F CB    1 
ATOM   8884  C CG    . ARG E 1 455 ? 29.819  -0.402  126.707 1.00 122.60 ? 455 ARG F CG    1 
ATOM   8885  C CD    . ARG E 1 455 ? 30.006  -0.150  125.218 1.00 127.37 ? 455 ARG F CD    1 
ATOM   8886  N NE    . ARG E 1 455 ? 31.094  0.788   124.950 1.00 129.71 ? 455 ARG F NE    1 
ATOM   8887  C CZ    . ARG E 1 455 ? 32.388  0.476   124.986 1.00 135.04 ? 455 ARG F CZ    1 
ATOM   8888  N NH1   . ARG E 1 455 ? 32.777  -0.758  125.290 1.00 130.75 ? 455 ARG F NH1   1 
ATOM   8889  N NH2   . ARG E 1 455 ? 33.299  1.403   124.723 1.00 141.27 ? 455 ARG F NH2   1 
ATOM   8890  N N     . ASP E 1 456 ? 26.784  -3.518  128.338 1.00 110.78 ? 456 ASP F N     1 
ATOM   8891  C CA    . ASP E 1 456 ? 25.455  -3.928  128.771 1.00 106.40 ? 456 ASP F CA    1 
ATOM   8892  C C     . ASP E 1 456 ? 25.457  -4.538  130.170 1.00 99.23  ? 456 ASP F C     1 
ATOM   8893  O O     . ASP E 1 456 ? 24.722  -4.092  131.052 1.00 94.61  ? 456 ASP F O     1 
ATOM   8894  C CB    . ASP E 1 456 ? 24.857  -4.926  127.775 1.00 111.11 ? 456 ASP F CB    1 
ATOM   8895  C CG    . ASP E 1 456 ? 24.616  -4.312  126.411 1.00 119.75 ? 456 ASP F CG    1 
ATOM   8896  O OD1   . ASP E 1 456 ? 24.516  -3.070  126.331 1.00 123.10 ? 456 ASP F OD1   1 
ATOM   8897  O OD2   . ASP E 1 456 ? 24.524  -5.069  125.420 1.00 123.14 ? 456 ASP F OD2   1 
ATOM   8898  N N     . LYS E 1 457 ? 26.297  -5.550  130.367 1.00 96.67  ? 457 LYS F N     1 
ATOM   8899  C CA    . LYS E 1 457 ? 26.256  -6.365  131.580 1.00 93.27  ? 457 LYS F CA    1 
ATOM   8900  C C     . LYS E 1 457 ? 27.179  -5.896  132.712 1.00 97.26  ? 457 LYS F C     1 
ATOM   8901  O O     . LYS E 1 457 ? 27.297  -6.575  133.731 1.00 93.55  ? 457 LYS F O     1 
ATOM   8902  C CB    . LYS E 1 457 ? 26.561  -7.825  131.233 1.00 90.15  ? 457 LYS F CB    1 
ATOM   8903  C CG    . LYS E 1 457 ? 25.654  -8.408  130.159 1.00 95.64  ? 457 LYS F CG    1 
ATOM   8904  C CD    . LYS E 1 457 ? 24.227  -8.557  130.661 1.00 94.48  ? 457 LYS F CD    1 
ATOM   8905  C CE    . LYS E 1 457 ? 23.328  -9.157  129.591 1.00 94.16  ? 457 LYS F CE    1 
ATOM   8906  N NZ    . LYS E 1 457 ? 21.950  -9.379  130.103 1.00 97.44  ? 457 LYS F NZ    1 
ATOM   8907  N N     . PHE E 1 458 ? 27.814  -4.738  132.538 1.00 100.78 ? 458 PHE F N     1 
ATOM   8908  C CA    . PHE E 1 458 ? 28.767  -4.216  133.521 1.00 101.50 ? 458 PHE F CA    1 
ATOM   8909  C C     . PHE E 1 458 ? 28.207  -4.159  134.938 1.00 102.79 ? 458 PHE F C     1 
ATOM   8910  O O     . PHE E 1 458 ? 27.119  -3.626  135.164 1.00 108.22 ? 458 PHE F O     1 
ATOM   8911  C CB    . PHE E 1 458 ? 29.246  -2.819  133.123 1.00 104.94 ? 458 PHE F CB    1 
ATOM   8912  C CG    . PHE E 1 458 ? 30.499  -2.390  133.827 1.00 99.76  ? 458 PHE F CG    1 
ATOM   8913  C CD1   . PHE E 1 458 ? 31.734  -2.588  133.236 1.00 96.17  ? 458 PHE F CD1   1 
ATOM   8914  C CD2   . PHE E 1 458 ? 30.447  -1.799  135.081 1.00 95.32  ? 458 PHE F CD2   1 
ATOM   8915  C CE1   . PHE E 1 458 ? 32.892  -2.207  133.874 1.00 93.03  ? 458 PHE F CE1   1 
ATOM   8916  C CE2   . PHE E 1 458 ? 31.606  -1.415  135.726 1.00 94.77  ? 458 PHE F CE2   1 
ATOM   8917  C CZ    . PHE E 1 458 ? 32.830  -1.619  135.120 1.00 92.64  ? 458 PHE F CZ    1 
ATOM   8918  N N     . GLY E 1 459 ? 28.963  -4.706  135.886 1.00 100.25 ? 459 GLY F N     1 
ATOM   8919  C CA    . GLY E 1 459 ? 28.606  -4.628  137.291 1.00 98.38  ? 459 GLY F CA    1 
ATOM   8920  C C     . GLY E 1 459 ? 27.811  -5.818  137.792 1.00 98.32  ? 459 GLY F C     1 
ATOM   8921  O O     . GLY E 1 459 ? 27.794  -6.103  138.991 1.00 99.32  ? 459 GLY F O     1 
ATOM   8922  N N     . LEU E 1 460 ? 27.148  -6.513  136.873 1.00 97.85  ? 460 LEU F N     1 
ATOM   8923  C CA    . LEU E 1 460 ? 26.331  -7.669  137.225 1.00 78.79  ? 460 LEU F CA    1 
ATOM   8924  C C     . LEU E 1 460 ? 27.142  -8.774  137.897 1.00 101.13 ? 460 LEU F C     1 
ATOM   8925  O O     . LEU E 1 460 ? 28.238  -9.116  137.455 1.00 102.34 ? 460 LEU F O     1 
ATOM   8926  C CB    . LEU E 1 460 ? 25.614  -8.220  135.990 1.00 83.81  ? 460 LEU F CB    1 
ATOM   8927  C CG    . LEU E 1 460 ? 24.498  -7.353  135.409 1.00 80.16  ? 460 LEU F CG    1 
ATOM   8928  C CD1   . LEU E 1 460 ? 23.773  -8.090  134.302 1.00 81.14  ? 460 LEU F CD1   1 
ATOM   8929  C CD2   . LEU E 1 460 ? 23.534  -6.957  136.506 1.00 79.34  ? 460 LEU F CD2   1 
ATOM   8930  N N     . GLN E 1 461 ? 26.592  -9.322  138.975 1.00 100.50 ? 461 GLN F N     1 
ATOM   8931  C CA    . GLN E 1 461 ? 27.228  -10.425 139.684 1.00 99.47  ? 461 GLN F CA    1 
ATOM   8932  C C     . GLN E 1 461 ? 27.302  -11.656 138.784 1.00 100.32 ? 461 GLN F C     1 
ATOM   8933  O O     . GLN E 1 461 ? 26.287  -12.098 138.242 1.00 104.65 ? 461 GLN F O     1 
ATOM   8934  C CB    . GLN E 1 461 ? 26.446  -10.758 140.956 1.00 100.37 ? 461 GLN F CB    1 
ATOM   8935  C CG    . GLN E 1 461 ? 27.304  -11.315 142.073 1.00 103.82 ? 461 GLN F CG    1 
ATOM   8936  C CD    . GLN E 1 461 ? 28.210  -10.263 142.679 1.00 107.99 ? 461 GLN F CD    1 
ATOM   8937  O OE1   . GLN E 1 461 ? 27.751  -9.196  143.088 1.00 105.81 ? 461 GLN F OE1   1 
ATOM   8938  N NE2   . GLN E 1 461 ? 29.507  -10.554 142.733 1.00 110.98 ? 461 GLN F NE2   1 
ATOM   8939  N N     . SER E 1 462 ? 28.504  -12.204 138.625 1.00 99.92  ? 462 SER F N     1 
ATOM   8940  C CA    . SER E 1 462 ? 28.715  -13.366 137.766 1.00 101.68 ? 462 SER F CA    1 
ATOM   8941  C C     . SER E 1 462 ? 29.927  -14.160 138.243 1.00 106.16 ? 462 SER F C     1 
ATOM   8942  O O     . SER E 1 462 ? 30.817  -13.605 138.888 1.00 110.14 ? 462 SER F O     1 
ATOM   8943  C CB    . SER E 1 462 ? 28.956  -12.918 136.328 1.00 105.20 ? 462 SER F CB    1 
ATOM   8944  O OG    . SER E 1 462 ? 30.334  -12.656 136.126 1.00 107.08 ? 462 SER F OG    1 
ATOM   8945  N N     . PRO E 1 463 ? 29.983  -15.459 137.905 1.00 109.75 ? 463 PRO F N     1 
ATOM   8946  C CA    . PRO E 1 463 ? 31.072  -16.303 138.406 1.00 111.56 ? 463 PRO F CA    1 
ATOM   8947  C C     . PRO E 1 463 ? 32.365  -16.192 137.596 1.00 114.30 ? 463 PRO F C     1 
ATOM   8948  O O     . PRO E 1 463 ? 33.352  -16.832 137.958 1.00 117.97 ? 463 PRO F O     1 
ATOM   8949  C CB    . PRO E 1 463 ? 30.498  -17.711 138.261 1.00 108.57 ? 463 PRO F CB    1 
ATOM   8950  C CG    . PRO E 1 463 ? 29.617  -17.614 137.064 1.00 108.54 ? 463 PRO F CG    1 
ATOM   8951  C CD    . PRO E 1 463 ? 29.022  -16.231 137.094 1.00 109.68 ? 463 PRO F CD    1 
ATOM   8952  N N     . PHE E 1 464 ? 32.370  -15.400 136.529 1.00 108.41 ? 464 PHE F N     1 
ATOM   8953  C CA    . PHE E 1 464 ? 33.529  -15.370 135.639 1.00 99.48  ? 464 PHE F CA    1 
ATOM   8954  C C     . PHE E 1 464 ? 34.117  -13.981 135.396 1.00 98.31  ? 464 PHE F C     1 
ATOM   8955  O O     . PHE E 1 464 ? 35.334  -13.820 135.361 1.00 99.34  ? 464 PHE F O     1 
ATOM   8956  C CB    . PHE E 1 464 ? 33.197  -16.044 134.304 1.00 99.41  ? 464 PHE F CB    1 
ATOM   8957  C CG    . PHE E 1 464 ? 32.865  -17.503 134.429 1.00 106.57 ? 464 PHE F CG    1 
ATOM   8958  C CD1   . PHE E 1 464 ? 31.597  -17.969 134.127 1.00 109.56 ? 464 PHE F CD1   1 
ATOM   8959  C CD2   . PHE E 1 464 ? 33.821  -18.407 134.860 1.00 112.09 ? 464 PHE F CD2   1 
ATOM   8960  C CE1   . PHE E 1 464 ? 31.290  -19.314 134.244 1.00 112.91 ? 464 PHE F CE1   1 
ATOM   8961  C CE2   . PHE E 1 464 ? 33.521  -19.750 134.981 1.00 112.39 ? 464 PHE F CE2   1 
ATOM   8962  C CZ    . PHE E 1 464 ? 32.255  -20.204 134.673 1.00 112.22 ? 464 PHE F CZ    1 
ATOM   8963  N N     . VAL E 1 465 ? 33.259  -12.981 135.227 1.00 97.89  ? 465 VAL F N     1 
ATOM   8964  C CA    . VAL E 1 465 ? 33.720  -11.645 134.857 1.00 93.94  ? 465 VAL F CA    1 
ATOM   8965  C C     . VAL E 1 465 ? 34.182  -10.802 136.042 1.00 92.56  ? 465 VAL F C     1 
ATOM   8966  O O     . VAL E 1 465 ? 33.421  -10.553 136.977 1.00 95.13  ? 465 VAL F O     1 
ATOM   8967  C CB    . VAL E 1 465 ? 32.642  -10.863 134.087 1.00 92.80  ? 465 VAL F CB    1 
ATOM   8968  C CG1   . VAL E 1 465 ? 33.187  -9.508  133.653 1.00 97.69  ? 465 VAL F CG1   1 
ATOM   8969  C CG2   . VAL E 1 465 ? 32.162  -11.666 132.888 1.00 85.82  ? 465 VAL F CG2   1 
ATOM   8970  N N     . TYR E 1 466 ? 35.432  -10.353 135.979 1.00 88.22  ? 466 TYR F N     1 
ATOM   8971  C CA    . TYR E 1 466 ? 36.016  -9.496  137.005 1.00 90.51  ? 466 TYR F CA    1 
ATOM   8972  C C     . TYR E 1 466 ? 35.943  -8.030  136.573 1.00 100.77 ? 466 TYR F C     1 
ATOM   8973  O O     . TYR E 1 466 ? 36.889  -7.509  135.980 1.00 111.34 ? 466 TYR F O     1 
ATOM   8974  C CB    . TYR E 1 466 ? 37.479  -9.885  137.247 1.00 88.62  ? 466 TYR F CB    1 
ATOM   8975  C CG    . TYR E 1 466 ? 37.693  -11.275 137.816 1.00 86.90  ? 466 TYR F CG    1 
ATOM   8976  C CD1   . TYR E 1 466 ? 38.107  -11.450 139.131 1.00 88.50  ? 466 TYR F CD1   1 
ATOM   8977  C CD2   . TYR E 1 466 ? 37.496  -12.409 137.037 1.00 90.45  ? 466 TYR F CD2   1 
ATOM   8978  C CE1   . TYR E 1 466 ? 38.311  -12.714 139.656 1.00 92.96  ? 466 TYR F CE1   1 
ATOM   8979  C CE2   . TYR E 1 466 ? 37.694  -13.680 137.555 1.00 93.19  ? 466 TYR F CE2   1 
ATOM   8980  C CZ    . TYR E 1 466 ? 38.103  -13.826 138.865 1.00 95.31  ? 466 TYR F CZ    1 
ATOM   8981  O OH    . TYR E 1 466 ? 38.306  -15.083 139.389 1.00 96.35  ? 466 TYR F OH    1 
ATOM   8982  N N     . TRP E 1 467 ? 34.827  -7.368  136.873 1.00 98.29  ? 467 TRP F N     1 
ATOM   8983  C CA    . TRP E 1 467 ? 34.594  -6.003  136.399 1.00 97.42  ? 467 TRP F CA    1 
ATOM   8984  C C     . TRP E 1 467 ? 35.621  -5.002  136.922 1.00 101.28 ? 467 TRP F C     1 
ATOM   8985  O O     . TRP E 1 467 ? 36.042  -4.097  136.200 1.00 106.01 ? 467 TRP F O     1 
ATOM   8986  C CB    . TRP E 1 467 ? 33.183  -5.532  136.765 1.00 93.98  ? 467 TRP F CB    1 
ATOM   8987  C CG    . TRP E 1 467 ? 32.100  -6.396  136.206 1.00 94.88  ? 467 TRP F CG    1 
ATOM   8988  C CD1   . TRP E 1 467 ? 31.272  -7.224  136.903 1.00 95.51  ? 467 TRP F CD1   1 
ATOM   8989  C CD2   . TRP E 1 467 ? 31.732  -6.529  134.828 1.00 97.10  ? 467 TRP F CD2   1 
ATOM   8990  N NE1   . TRP E 1 467 ? 30.408  -7.860  136.047 1.00 97.29  ? 467 TRP F NE1   1 
ATOM   8991  C CE2   . TRP E 1 467 ? 30.670  -7.450  134.766 1.00 97.66  ? 467 TRP F CE2   1 
ATOM   8992  C CE3   . TRP E 1 467 ? 32.197  -5.955  133.640 1.00 98.72  ? 467 TRP F CE3   1 
ATOM   8993  C CZ2   . TRP E 1 467 ? 30.068  -7.814  133.565 1.00 99.38  ? 467 TRP F CZ2   1 
ATOM   8994  C CZ3   . TRP E 1 467 ? 31.593  -6.316  132.448 1.00 100.17 ? 467 TRP F CZ3   1 
ATOM   8995  C CH2   . TRP E 1 467 ? 30.541  -7.236  132.420 1.00 99.32  ? 467 TRP F CH2   1 
ATOM   8996  N N     . GLU E 1 468 ? 36.023  -5.177  138.176 1.00 102.35 ? 468 GLU F N     1 
ATOM   8997  C CA    . GLU E 1 468 ? 36.943  -4.255  138.834 1.00 106.12 ? 468 GLU F CA    1 
ATOM   8998  C C     . GLU E 1 468 ? 38.345  -4.303  138.235 1.00 106.85 ? 468 GLU F C     1 
ATOM   8999  O O     . GLU E 1 468 ? 39.122  -3.358  138.371 1.00 113.30 ? 468 GLU F O     1 
ATOM   9000  C CB    . GLU E 1 468 ? 37.011  -4.554  140.336 1.00 114.82 ? 468 GLU F CB    1 
ATOM   9001  C CG    . GLU E 1 468 ? 37.873  -5.760  140.721 1.00 128.34 ? 468 GLU F CG    1 
ATOM   9002  C CD    . GLU E 1 468 ? 37.343  -7.081  140.181 1.00 134.50 ? 468 GLU F CD    1 
ATOM   9003  O OE1   . GLU E 1 468 ? 36.108  -7.228  140.054 1.00 137.64 ? 468 GLU F OE1   1 
ATOM   9004  O OE2   . GLU E 1 468 ? 38.166  -7.973  139.880 1.00 131.02 ? 468 GLU F OE2   1 
ATOM   9005  N N     . LEU E 1 469 ? 38.662  -5.408  137.571 1.00 102.97 ? 469 LEU F N     1 
ATOM   9006  C CA    . LEU E 1 469 ? 39.995  -5.608  137.020 1.00 101.52 ? 469 LEU F CA    1 
ATOM   9007  C C     . LEU E 1 469 ? 40.011  -5.455  135.505 1.00 100.29 ? 469 LEU F C     1 
ATOM   9008  O O     . LEU E 1 469 ? 41.011  -5.029  134.927 1.00 101.45 ? 469 LEU F O     1 
ATOM   9009  C CB    . LEU E 1 469 ? 40.535  -6.981  137.425 1.00 98.93  ? 469 LEU F CB    1 
ATOM   9010  C CG    . LEU E 1 469 ? 41.797  -7.496  136.738 1.00 93.88  ? 469 LEU F CG    1 
ATOM   9011  C CD1   . LEU E 1 469 ? 42.772  -8.027  137.766 1.00 94.48  ? 469 LEU F CD1   1 
ATOM   9012  C CD2   . LEU E 1 469 ? 41.410  -8.586  135.765 1.00 95.38  ? 469 LEU F CD2   1 
ATOM   9013  N N     . LEU E 1 470 ? 38.900  -5.799  134.863 1.00 93.88  ? 470 LEU F N     1 
ATOM   9014  C CA    . LEU E 1 470 ? 38.819  -5.695  133.415 1.00 87.19  ? 470 LEU F CA    1 
ATOM   9015  C C     . LEU E 1 470 ? 38.559  -4.250  133.001 1.00 104.16 ? 470 LEU F C     1 
ATOM   9016  O O     . LEU E 1 470 ? 37.453  -3.893  132.589 1.00 97.40  ? 470 LEU F O     1 
ATOM   9017  C CB    . LEU E 1 470 ? 37.743  -6.631  132.865 1.00 86.76  ? 470 LEU F CB    1 
ATOM   9018  C CG    . LEU E 1 470 ? 37.714  -6.806  131.345 1.00 94.69  ? 470 LEU F CG    1 
ATOM   9019  C CD1   . LEU E 1 470 ? 39.104  -7.094  130.790 1.00 95.86  ? 470 LEU F CD1   1 
ATOM   9020  C CD2   . LEU E 1 470 ? 36.743  -7.911  130.965 1.00 96.07  ? 470 LEU F CD2   1 
ATOM   9021  N N     . GLY E 1 471 ? 39.591  -3.420  133.129 1.00 109.73 ? 471 GLY F N     1 
ATOM   9022  C CA    . GLY E 1 471 ? 39.524  -2.033  132.710 1.00 110.05 ? 471 GLY F CA    1 
ATOM   9023  C C     . GLY E 1 471 ? 39.397  -1.932  131.203 1.00 114.99 ? 471 GLY F C     1 
ATOM   9024  O O     . GLY E 1 471 ? 39.635  -2.905  130.486 1.00 115.81 ? 471 GLY F O     1 
ATOM   9025  N N     . GLU E 1 472 ? 39.027  -0.752  130.717 1.00 119.43 ? 472 GLU F N     1 
ATOM   9026  C CA    . GLU E 1 472 ? 38.753  -0.567  129.296 1.00 121.61 ? 472 GLU F CA    1 
ATOM   9027  C C     . GLU E 1 472 ? 39.990  -0.786  128.417 1.00 120.16 ? 472 GLU F C     1 
ATOM   9028  O O     . GLU E 1 472 ? 39.889  -1.347  127.325 1.00 118.57 ? 472 GLU F O     1 
ATOM   9029  C CB    . GLU E 1 472 ? 38.142  0.815   129.044 1.00 123.37 ? 472 GLU F CB    1 
ATOM   9030  C CG    . GLU E 1 472 ? 36.932  0.806   128.117 1.00 127.67 ? 472 GLU F CG    1 
ATOM   9031  C CD    . GLU E 1 472 ? 36.271  2.170   128.007 1.00 136.44 ? 472 GLU F CD    1 
ATOM   9032  O OE1   . GLU E 1 472 ? 36.735  3.116   128.681 1.00 134.83 ? 472 GLU F OE1   1 
ATOM   9033  O OE2   . GLU E 1 472 ? 35.287  2.299   127.246 1.00 143.16 ? 472 GLU F OE2   1 
ATOM   9034  N N     . GLU E 1 473 ? 41.155  -0.358  128.896 1.00 119.06 ? 473 GLU F N     1 
ATOM   9035  C CA    . GLU E 1 473 ? 42.391  -0.522  128.133 1.00 123.44 ? 473 GLU F CA    1 
ATOM   9036  C C     . GLU E 1 473 ? 42.796  -1.991  128.028 1.00 121.03 ? 473 GLU F C     1 
ATOM   9037  O O     . GLU E 1 473 ? 43.096  -2.484  126.939 1.00 120.00 ? 473 GLU F O     1 
ATOM   9038  C CB    . GLU E 1 473 ? 43.529  0.295   128.747 1.00 130.21 ? 473 GLU F CB    1 
ATOM   9039  C CG    . GLU E 1 473 ? 44.813  0.267   127.931 1.00 134.85 ? 473 GLU F CG    1 
ATOM   9040  C CD    . GLU E 1 473 ? 45.970  0.949   128.634 1.00 137.14 ? 473 GLU F CD    1 
ATOM   9041  O OE1   . GLU E 1 473 ? 46.292  0.552   129.774 1.00 134.67 ? 473 GLU F OE1   1 
ATOM   9042  O OE2   . GLU E 1 473 ? 46.554  1.886   128.048 1.00 139.95 ? 473 GLU F OE2   1 
ATOM   9043  N N     . LEU E 1 474 ? 42.799  -2.681  129.166 1.00 119.10 ? 474 LEU F N     1 
ATOM   9044  C CA    . LEU E 1 474 ? 43.151  -4.097  129.224 1.00 117.23 ? 474 LEU F CA    1 
ATOM   9045  C C     . LEU E 1 474 ? 42.258  -4.936  128.314 1.00 115.52 ? 474 LEU F C     1 
ATOM   9046  O O     . LEU E 1 474 ? 42.696  -5.932  127.739 1.00 114.96 ? 474 LEU F O     1 
ATOM   9047  C CB    . LEU E 1 474 ? 43.050  -4.605  130.664 1.00 113.56 ? 474 LEU F CB    1 
ATOM   9048  C CG    . LEU E 1 474 ? 43.195  -6.110  130.904 1.00 110.10 ? 474 LEU F CG    1 
ATOM   9049  C CD1   . LEU E 1 474 ? 44.605  -6.589  130.581 1.00 111.91 ? 474 LEU F CD1   1 
ATOM   9050  C CD2   . LEU E 1 474 ? 42.814  -6.457  132.336 1.00 107.25 ? 474 LEU F CD2   1 
ATOM   9051  N N     . LEU E 1 475 ? 41.003  -4.520  128.187 1.00 115.41 ? 475 LEU F N     1 
ATOM   9052  C CA    . LEU E 1 475 ? 40.038  -5.228  127.355 1.00 114.97 ? 475 LEU F CA    1 
ATOM   9053  C C     . LEU E 1 475 ? 40.408  -5.179  125.874 1.00 122.01 ? 475 LEU F C     1 
ATOM   9054  O O     . LEU E 1 475 ? 40.601  -6.217  125.240 1.00 122.21 ? 475 LEU F O     1 
ATOM   9055  C CB    . LEU E 1 475 ? 38.634  -4.657  127.565 1.00 107.30 ? 475 LEU F CB    1 
ATOM   9056  C CG    . LEU E 1 475 ? 37.532  -5.181  126.642 1.00 105.19 ? 475 LEU F CG    1 
ATOM   9057  C CD1   . LEU E 1 475 ? 37.338  -6.678  126.820 1.00 106.84 ? 475 LEU F CD1   1 
ATOM   9058  C CD2   . LEU E 1 475 ? 36.232  -4.437  126.895 1.00 102.05 ? 475 LEU F CD2   1 
ATOM   9059  N N     . GLU E 1 476 ? 40.510  -3.970  125.332 1.00 128.87 ? 476 GLU F N     1 
ATOM   9060  C CA    . GLU E 1 476 ? 40.779  -3.787  123.908 1.00 134.09 ? 476 GLU F CA    1 
ATOM   9061  C C     . GLU E 1 476 ? 42.225  -4.111  123.515 1.00 134.86 ? 476 GLU F C     1 
ATOM   9062  O O     . GLU E 1 476 ? 42.516  -4.347  122.342 1.00 138.07 ? 476 GLU F O     1 
ATOM   9063  C CB    . GLU E 1 476 ? 40.383  -2.375  123.461 1.00 139.68 ? 476 GLU F CB    1 
ATOM   9064  C CG    . GLU E 1 476 ? 38.876  -2.177  123.341 1.00 147.42 ? 476 GLU F CG    1 
ATOM   9065  C CD    . GLU E 1 476 ? 38.379  -0.953  124.088 1.00 154.64 ? 476 GLU F CD    1 
ATOM   9066  O OE1   . GLU E 1 476 ? 39.169  0.000   124.263 1.00 158.12 ? 476 GLU F OE1   1 
ATOM   9067  O OE2   . GLU E 1 476 ? 37.199  -0.948  124.503 1.00 154.39 ? 476 GLU F OE2   1 
ATOM   9068  N N     . GLN E 1 477 ? 43.128  -4.129  124.491 1.00 131.69 ? 477 GLN F N     1 
ATOM   9069  C CA    . GLN E 1 477 ? 44.497  -4.566  124.234 1.00 130.15 ? 477 GLN F CA    1 
ATOM   9070  C C     . GLN E 1 477 ? 44.514  -6.077  124.067 1.00 129.16 ? 477 GLN F C     1 
ATOM   9071  O O     . GLN E 1 477 ? 45.266  -6.619  123.256 1.00 128.83 ? 477 GLN F O     1 
ATOM   9072  C CB    . GLN E 1 477 ? 45.436  -4.155  125.371 1.00 128.43 ? 477 GLN F CB    1 
ATOM   9073  C CG    . GLN E 1 477 ? 46.057  -2.775  125.207 1.00 131.19 ? 477 GLN F CG    1 
ATOM   9074  C CD    . GLN E 1 477 ? 47.051  -2.453  126.309 1.00 131.16 ? 477 GLN F CD    1 
ATOM   9075  O OE1   . GLN E 1 477 ? 47.285  -3.264  127.205 1.00 129.41 ? 477 GLN F OE1   1 
ATOM   9076  N NE2   . GLN E 1 477 ? 47.639  -1.263  126.249 1.00 133.90 ? 477 GLN F NE2   1 
ATOM   9077  N N     . ALA E 1 478 ? 43.670  -6.749  124.843 1.00 129.48 ? 478 ALA F N     1 
ATOM   9078  C CA    . ALA E 1 478 ? 43.542  -8.198  124.772 1.00 128.02 ? 478 ALA F CA    1 
ATOM   9079  C C     . ALA E 1 478 ? 42.844  -8.624  123.482 1.00 130.71 ? 478 ALA F C     1 
ATOM   9080  O O     . ALA E 1 478 ? 43.244  -9.599  122.845 1.00 132.92 ? 478 ALA F O     1 
ATOM   9081  C CB    . ALA E 1 478 ? 42.790  -8.721  125.986 1.00 122.04 ? 478 ALA F CB    1 
ATOM   9082  N N     . LEU E 1 479 ? 41.808  -7.884  123.098 1.00 128.98 ? 479 LEU F N     1 
ATOM   9083  C CA    . LEU E 1 479 ? 41.046  -8.186  121.887 1.00 128.01 ? 479 LEU F CA    1 
ATOM   9084  C C     . LEU E 1 479 ? 41.859  -8.076  120.596 1.00 129.23 ? 479 LEU F C     1 
ATOM   9085  O O     . LEU E 1 479 ? 41.510  -8.687  119.588 1.00 126.72 ? 479 LEU F O     1 
ATOM   9086  C CB    . LEU E 1 479 ? 39.802  -7.300  121.798 1.00 126.84 ? 479 LEU F CB    1 
ATOM   9087  C CG    . LEU E 1 479 ? 38.615  -7.766  122.642 1.00 124.87 ? 479 LEU F CG    1 
ATOM   9088  C CD1   . LEU E 1 479 ? 37.527  -6.705  122.689 1.00 127.22 ? 479 LEU F CD1   1 
ATOM   9089  C CD2   . LEU E 1 479 ? 38.064  -9.075  122.096 1.00 123.61 ? 479 LEU F CD2   1 
ATOM   9090  N N     . ASP E 1 480 ? 42.934  -7.294  120.622 1.00 135.32 ? 480 ASP F N     1 
ATOM   9091  C CA    . ASP E 1 480 ? 43.781  -7.148  119.443 1.00 143.31 ? 480 ASP F CA    1 
ATOM   9092  C C     . ASP E 1 480 ? 44.854  -8.236  119.399 1.00 140.08 ? 480 ASP F C     1 
ATOM   9093  O O     . ASP E 1 480 ? 45.056  -8.883  118.370 1.00 142.60 ? 480 ASP F O     1 
ATOM   9094  C CB    . ASP E 1 480 ? 44.435  -5.762  119.405 1.00 151.66 ? 480 ASP F CB    1 
ATOM   9095  C CG    . ASP E 1 480 ? 43.419  -4.630  119.398 1.00 157.81 ? 480 ASP F CG    1 
ATOM   9096  O OD1   . ASP E 1 480 ? 42.218  -4.901  119.184 1.00 161.21 ? 480 ASP F OD1   1 
ATOM   9097  O OD2   . ASP E 1 480 ? 43.826  -3.465  119.600 1.00 157.31 ? 480 ASP F OD2   1 
ATOM   9098  N N     . CYS E 1 481 ? 45.521  -8.437  120.532 1.00 133.97 ? 481 CYS F N     1 
ATOM   9099  C CA    . CYS E 1 481 ? 46.665  -9.342  120.627 1.00 130.40 ? 481 CYS F CA    1 
ATOM   9100  C C     . CYS E 1 481 ? 46.287  -10.824 120.674 1.00 130.15 ? 481 CYS F C     1 
ATOM   9101  O O     . CYS E 1 481 ? 46.734  -11.608 119.835 1.00 136.13 ? 481 CYS F O     1 
ATOM   9102  C CB    . CYS E 1 481 ? 47.515  -8.984  121.849 1.00 126.55 ? 481 CYS F CB    1 
ATOM   9103  S SG    . CYS E 1 481 ? 48.147  -7.289  121.851 1.00 147.90 ? 481 CYS F SG    1 
ATOM   9104  N N     . LEU E 1 482 ? 45.481  -11.202 121.663 1.00 124.44 ? 482 LEU F N     1 
ATOM   9105  C CA    . LEU E 1 482 ? 45.074  -12.596 121.847 1.00 119.93 ? 482 LEU F CA    1 
ATOM   9106  C C     . LEU E 1 482 ? 44.392  -13.173 120.609 1.00 120.63 ? 482 LEU F C     1 
ATOM   9107  O O     . LEU E 1 482 ? 43.351  -12.674 120.182 1.00 123.73 ? 482 LEU F O     1 
ATOM   9108  C CB    . LEU E 1 482 ? 44.137  -12.721 123.051 1.00 115.17 ? 482 LEU F CB    1 
ATOM   9109  C CG    . LEU E 1 482 ? 44.727  -12.344 124.410 1.00 111.73 ? 482 LEU F CG    1 
ATOM   9110  C CD1   . LEU E 1 482 ? 43.635  -12.265 125.461 1.00 104.51 ? 482 LEU F CD1   1 
ATOM   9111  C CD2   . LEU E 1 482 ? 45.797  -13.346 124.823 1.00 113.19 ? 482 LEU F CD2   1 
ATOM   9112  N N     . PRO E 1 483 ? 44.983  -14.229 120.027 1.00 119.47 ? 483 PRO F N     1 
ATOM   9113  C CA    . PRO E 1 483 ? 44.420  -14.906 118.853 1.00 119.99 ? 483 PRO F CA    1 
ATOM   9114  C C     . PRO E 1 483 ? 43.102  -15.594 119.183 1.00 120.78 ? 483 PRO F C     1 
ATOM   9115  O O     . PRO E 1 483 ? 42.960  -16.147 120.274 1.00 120.07 ? 483 PRO F O     1 
ATOM   9116  C CB    . PRO E 1 483 ? 45.475  -15.968 118.520 1.00 118.78 ? 483 PRO F CB    1 
ATOM   9117  C CG    . PRO E 1 483 ? 46.723  -15.502 119.182 1.00 118.99 ? 483 PRO F CG    1 
ATOM   9118  C CD    . PRO E 1 483 ? 46.276  -14.808 120.425 1.00 118.01 ? 483 PRO F CD    1 
ATOM   9119  N N     . ALA E 1 484 ? 42.157  -15.566 118.248 1.00 122.79 ? 484 ALA F N     1 
ATOM   9120  C CA    . ALA E 1 484 ? 40.867  -16.216 118.447 1.00 122.64 ? 484 ALA F CA    1 
ATOM   9121  C C     . ALA E 1 484 ? 41.030  -17.726 118.601 1.00 126.19 ? 484 ALA F C     1 
ATOM   9122  O O     . ALA E 1 484 ? 40.340  -18.353 119.405 1.00 127.16 ? 484 ALA F O     1 
ATOM   9123  C CB    . ALA E 1 484 ? 39.925  -15.895 117.298 1.00 122.64 ? 484 ALA F CB    1 
ATOM   9124  N N     . ALA E 1 485 ? 41.951  -18.302 117.833 1.00 128.55 ? 485 ALA F N     1 
ATOM   9125  C CA    . ALA E 1 485 ? 42.217  -19.736 117.906 1.00 128.25 ? 485 ALA F CA    1 
ATOM   9126  C C     . ALA E 1 485 ? 42.805  -20.111 119.261 1.00 126.10 ? 485 ALA F C     1 
ATOM   9127  O O     . ALA E 1 485 ? 42.613  -21.225 119.747 1.00 125.90 ? 485 ALA F O     1 
ATOM   9128  C CB    . ALA E 1 485 ? 43.146  -20.164 116.783 1.00 132.83 ? 485 ALA F CB    1 
ATOM   9129  N N     . HIS E 1 486 ? 43.525  -19.173 119.865 1.00 126.99 ? 486 HIS F N     1 
ATOM   9130  C CA    . HIS E 1 486 ? 44.037  -19.364 121.213 1.00 126.21 ? 486 HIS F CA    1 
ATOM   9131  C C     . HIS E 1 486 ? 42.913  -19.231 122.231 1.00 125.66 ? 486 HIS F C     1 
ATOM   9132  O O     . HIS E 1 486 ? 42.865  -19.970 123.216 1.00 128.47 ? 486 HIS F O     1 
ATOM   9133  C CB    . HIS E 1 486 ? 45.141  -18.353 121.519 1.00 127.58 ? 486 HIS F CB    1 
ATOM   9134  C CG    . HIS E 1 486 ? 46.496  -18.780 121.051 1.00 131.17 ? 486 HIS F CG    1 
ATOM   9135  N ND1   . HIS E 1 486 ? 47.645  -18.095 121.380 1.00 132.74 ? 486 HIS F ND1   1 
ATOM   9136  C CD2   . HIS E 1 486 ? 46.887  -19.826 120.286 1.00 134.05 ? 486 HIS F CD2   1 
ATOM   9137  C CE1   . HIS E 1 486 ? 48.686  -18.698 120.835 1.00 134.55 ? 486 HIS F CE1   1 
ATOM   9138  N NE2   . HIS E 1 486 ? 48.253  -19.751 120.165 1.00 136.34 ? 486 HIS F NE2   1 
ATOM   9139  N N     . LEU E 1 487 ? 42.010  -18.286 121.988 1.00 121.54 ? 487 LEU F N     1 
ATOM   9140  C CA    . LEU E 1 487 ? 40.890  -18.055 122.892 1.00 116.64 ? 487 LEU F CA    1 
ATOM   9141  C C     . LEU E 1 487 ? 39.980  -19.273 122.939 1.00 116.54 ? 487 LEU F C     1 
ATOM   9142  O O     . LEU E 1 487 ? 39.355  -19.551 123.961 1.00 111.42 ? 487 LEU F O     1 
ATOM   9143  C CB    . LEU E 1 487 ? 40.099  -16.814 122.477 1.00 112.73 ? 487 LEU F CB    1 
ATOM   9144  C CG    . LEU E 1 487 ? 40.771  -15.465 122.736 1.00 109.01 ? 487 LEU F CG    1 
ATOM   9145  C CD1   . LEU E 1 487 ? 39.928  -14.338 122.163 1.00 110.03 ? 487 LEU F CD1   1 
ATOM   9146  C CD2   . LEU E 1 487 ? 41.005  -15.263 124.225 1.00 101.53 ? 487 LEU F CD2   1 
ATOM   9147  N N     . ARG E 1 488 ? 39.917  -19.999 121.829 1.00 120.77 ? 488 ARG F N     1 
ATOM   9148  C CA    . ARG E 1 488 ? 39.154  -21.236 121.780 1.00 121.55 ? 488 ARG F CA    1 
ATOM   9149  C C     . ARG E 1 488 ? 39.729  -22.241 122.764 1.00 121.24 ? 488 ARG F C     1 
ATOM   9150  O O     . ARG E 1 488 ? 39.070  -22.611 123.732 1.00 123.64 ? 488 ARG F O     1 
ATOM   9151  C CB    . ARG E 1 488 ? 39.165  -21.825 120.370 1.00 121.46 ? 488 ARG F CB    1 
ATOM   9152  C CG    . ARG E 1 488 ? 38.293  -23.056 120.226 1.00 118.28 ? 488 ARG F CG    1 
ATOM   9153  C CD    . ARG E 1 488 ? 37.278  -22.871 119.117 1.00 118.41 ? 488 ARG F CD    1 
ATOM   9154  N NE    . ARG E 1 488 ? 36.032  -23.568 119.416 1.00 122.35 ? 488 ARG F NE    1 
ATOM   9155  C CZ    . ARG E 1 488 ? 34.869  -23.301 118.833 1.00 128.84 ? 488 ARG F CZ    1 
ATOM   9156  N NH1   . ARG E 1 488 ? 34.790  -22.347 117.914 1.00 129.83 ? 488 ARG F NH1   1 
ATOM   9157  N NH2   . ARG E 1 488 ? 33.784  -23.984 119.172 1.00 130.43 ? 488 ARG F NH2   1 
ATOM   9158  N N     . ALA E 1 489 ? 40.971  -22.651 122.518 1.00 118.64 ? 489 ALA F N     1 
ATOM   9159  C CA    . ALA E 1 489 ? 41.641  -23.681 123.310 1.00 118.77 ? 489 ALA F CA    1 
ATOM   9160  C C     . ALA E 1 489 ? 41.521  -23.469 124.816 1.00 119.86 ? 489 ALA F C     1 
ATOM   9161  O O     . ALA E 1 489 ? 41.413  -24.429 125.579 1.00 120.46 ? 489 ALA F O     1 
ATOM   9162  C CB    . ALA E 1 489 ? 43.105  -23.780 122.909 1.00 120.97 ? 489 ALA F CB    1 
ATOM   9163  N N     . TRP E 1 490 ? 41.537  -22.210 125.236 1.00 121.17 ? 490 TRP F N     1 
ATOM   9164  C CA    . TRP E 1 490 ? 41.402  -21.882 126.647 1.00 122.78 ? 490 TRP F CA    1 
ATOM   9165  C C     . TRP E 1 490 ? 39.976  -22.131 127.118 1.00 122.49 ? 490 TRP F C     1 
ATOM   9166  O O     . TRP E 1 490 ? 39.753  -22.803 128.126 1.00 123.26 ? 490 TRP F O     1 
ATOM   9167  C CB    . TRP E 1 490 ? 41.778  -20.424 126.887 1.00 125.50 ? 490 TRP F CB    1 
ATOM   9168  C CG    . TRP E 1 490 ? 43.237  -20.136 126.742 1.00 127.95 ? 490 TRP F CG    1 
ATOM   9169  C CD1   . TRP E 1 490 ? 44.277  -20.961 127.063 1.00 129.01 ? 490 TRP F CD1   1 
ATOM   9170  C CD2   . TRP E 1 490 ? 43.821  -18.933 126.235 1.00 128.92 ? 490 TRP F CD2   1 
ATOM   9171  N NE1   . TRP E 1 490 ? 45.473  -20.342 126.790 1.00 130.33 ? 490 TRP F NE1   1 
ATOM   9172  C CE2   . TRP E 1 490 ? 45.220  -19.095 126.281 1.00 131.12 ? 490 TRP F CE2   1 
ATOM   9173  C CE3   . TRP E 1 490 ? 43.296  -17.732 125.749 1.00 128.56 ? 490 TRP F CE3   1 
ATOM   9174  C CZ2   . TRP E 1 490 ? 46.100  -18.102 125.857 1.00 132.94 ? 490 TRP F CZ2   1 
ATOM   9175  C CZ3   . TRP E 1 490 ? 44.170  -16.747 125.330 1.00 132.42 ? 490 TRP F CZ3   1 
ATOM   9176  C CH2   . TRP E 1 490 ? 45.557  -16.938 125.386 1.00 133.67 ? 490 TRP F CH2   1 
ATOM   9177  N N     . PHE E 1 491 ? 39.017  -21.586 126.375 1.00 119.19 ? 491 PHE F N     1 
ATOM   9178  C CA    . PHE E 1 491 ? 37.603  -21.707 126.717 1.00 114.78 ? 491 PHE F CA    1 
ATOM   9179  C C     . PHE E 1 491 ? 37.162  -23.164 126.725 1.00 120.29 ? 491 PHE F C     1 
ATOM   9180  O O     . PHE E 1 491 ? 36.319  -23.560 127.531 1.00 124.11 ? 491 PHE F O     1 
ATOM   9181  C CB    . PHE E 1 491 ? 36.734  -20.920 125.734 1.00 109.85 ? 491 PHE F CB    1 
ATOM   9182  C CG    . PHE E 1 491 ? 36.980  -19.439 125.747 1.00 110.33 ? 491 PHE F CG    1 
ATOM   9183  C CD1   . PHE E 1 491 ? 37.767  -18.857 126.727 1.00 106.83 ? 491 PHE F CD1   1 
ATOM   9184  C CD2   . PHE E 1 491 ? 36.416  -18.627 124.778 1.00 114.21 ? 491 PHE F CD2   1 
ATOM   9185  C CE1   . PHE E 1 491 ? 37.993  -17.498 126.735 1.00 105.17 ? 491 PHE F CE1   1 
ATOM   9186  C CE2   . PHE E 1 491 ? 36.636  -17.265 124.783 1.00 113.64 ? 491 PHE F CE2   1 
ATOM   9187  C CZ    . PHE E 1 491 ? 37.425  -16.699 125.764 1.00 108.46 ? 491 PHE F CZ    1 
ATOM   9188  N N     . GLU E 1 492 ? 37.730  -23.958 125.821 1.00 121.23 ? 492 GLU F N     1 
ATOM   9189  C CA    . GLU E 1 492 ? 37.405  -25.376 125.751 1.00 121.05 ? 492 GLU F CA    1 
ATOM   9190  C C     . GLU E 1 492 ? 37.910  -26.094 126.996 1.00 113.41 ? 492 GLU F C     1 
ATOM   9191  O O     . GLU E 1 492 ? 37.217  -26.947 127.549 1.00 111.33 ? 492 GLU F O     1 
ATOM   9192  C CB    . GLU E 1 492 ? 38.017  -26.022 124.504 1.00 133.42 ? 492 GLU F CB    1 
ATOM   9193  C CG    . GLU E 1 492 ? 37.748  -25.291 123.195 1.00 143.87 ? 492 GLU F CG    1 
ATOM   9194  C CD    . GLU E 1 492 ? 36.446  -25.695 122.529 1.00 151.49 ? 492 GLU F CD    1 
ATOM   9195  O OE1   . GLU E 1 492 ? 35.476  -26.024 123.244 1.00 154.28 ? 492 GLU F OE1   1 
ATOM   9196  O OE2   . GLU E 1 492 ? 36.399  -25.682 121.279 1.00 154.17 ? 492 GLU F OE2   1 
ATOM   9197  N N     . ARG E 1 493 ? 39.117  -25.746 127.436 1.00 111.71 ? 493 ARG F N     1 
ATOM   9198  C CA    . ARG E 1 493 ? 39.710  -26.398 128.601 1.00 112.14 ? 493 ARG F CA    1 
ATOM   9199  C C     . ARG E 1 493 ? 38.928  -26.077 129.874 1.00 116.16 ? 493 ARG F C     1 
ATOM   9200  O O     . ARG E 1 493 ? 38.836  -26.907 130.780 1.00 118.06 ? 493 ARG F O     1 
ATOM   9201  C CB    . ARG E 1 493 ? 41.192  -26.033 128.765 1.00 109.26 ? 493 ARG F CB    1 
ATOM   9202  C CG    . ARG E 1 493 ? 41.878  -26.760 129.925 1.00 110.22 ? 493 ARG F CG    1 
ATOM   9203  C CD    . ARG E 1 493 ? 43.283  -26.232 130.191 1.00 112.77 ? 493 ARG F CD    1 
ATOM   9204  N NE    . ARG E 1 493 ? 43.647  -26.306 131.607 1.00 111.25 ? 493 ARG F NE    1 
ATOM   9205  C CZ    . ARG E 1 493 ? 44.190  -27.371 132.194 1.00 112.99 ? 493 ARG F CZ    1 
ATOM   9206  N NH1   . ARG E 1 493 ? 44.437  -28.470 131.490 1.00 117.69 ? 493 ARG F NH1   1 
ATOM   9207  N NH2   . ARG E 1 493 ? 44.485  -27.337 133.489 1.00 106.77 ? 493 ARG F NH2   1 
ATOM   9208  N N     . LEU E 1 494 ? 38.362  -24.875 129.936 1.00 114.55 ? 494 LEU F N     1 
ATOM   9209  C CA    . LEU E 1 494 ? 37.523  -24.490 131.064 1.00 111.64 ? 494 LEU F CA    1 
ATOM   9210  C C     . LEU E 1 494 ? 36.273  -25.352 131.125 1.00 112.74 ? 494 LEU F C     1 
ATOM   9211  O O     . LEU E 1 494 ? 35.806  -25.704 132.204 1.00 113.17 ? 494 LEU F O     1 
ATOM   9212  C CB    . LEU E 1 494 ? 37.123  -23.018 130.973 1.00 114.19 ? 494 LEU F CB    1 
ATOM   9213  C CG    . LEU E 1 494 ? 37.948  -22.040 131.807 1.00 115.52 ? 494 LEU F CG    1 
ATOM   9214  C CD1   . LEU E 1 494 ? 39.379  -22.005 131.312 1.00 118.20 ? 494 LEU F CD1   1 
ATOM   9215  C CD2   . LEU E 1 494 ? 37.324  -20.655 131.766 1.00 115.35 ? 494 LEU F CD2   1 
ATOM   9216  N N     . LEU E 1 495 ? 35.737  -25.695 129.960 1.00 114.00 ? 495 LEU F N     1 
ATOM   9217  C CA    . LEU E 1 495 ? 34.514  -26.486 129.899 1.00 110.98 ? 495 LEU F CA    1 
ATOM   9218  C C     . LEU E 1 495 ? 34.749  -27.979 130.128 1.00 116.14 ? 495 LEU F C     1 
ATOM   9219  O O     . LEU E 1 495 ? 33.800  -28.727 130.352 1.00 120.04 ? 495 LEU F O     1 
ATOM   9220  C CB    . LEU E 1 495 ? 33.770  -26.248 128.583 1.00 103.94 ? 495 LEU F CB    1 
ATOM   9221  C CG    . LEU E 1 495 ? 33.118  -24.872 128.425 1.00 99.96  ? 495 LEU F CG    1 
ATOM   9222  C CD1   . LEU E 1 495 ? 32.188  -24.855 127.224 1.00 100.02 ? 495 LEU F CD1   1 
ATOM   9223  C CD2   . LEU E 1 495 ? 32.370  -24.475 129.689 1.00 100.39 ? 495 LEU F CD2   1 
ATOM   9224  N N     . GLU E 1 496 ? 36.006  -28.412 130.068 1.00 119.66 ? 496 GLU F N     1 
ATOM   9225  C CA    . GLU E 1 496 ? 36.332  -29.792 130.411 1.00 124.05 ? 496 GLU F CA    1 
ATOM   9226  C C     . GLU E 1 496 ? 36.022  -29.968 131.884 1.00 123.93 ? 496 GLU F C     1 
ATOM   9227  O O     . GLU E 1 496 ? 35.461  -30.977 132.307 1.00 127.71 ? 496 GLU F O     1 
ATOM   9228  C CB    . GLU E 1 496 ? 37.815  -30.086 130.181 1.00 128.90 ? 496 GLU F CB    1 
ATOM   9229  C CG    . GLU E 1 496 ? 38.364  -29.633 128.844 1.00 137.10 ? 496 GLU F CG    1 
ATOM   9230  C CD    . GLU E 1 496 ? 38.363  -30.725 127.797 1.00 146.56 ? 496 GLU F CD    1 
ATOM   9231  O OE1   . GLU E 1 496 ? 37.458  -31.584 127.829 1.00 150.49 ? 496 GLU F OE1   1 
ATOM   9232  O OE2   . GLU E 1 496 ? 39.275  -30.725 126.942 1.00 149.54 ? 496 GLU F OE2   1 
ATOM   9233  N N     . ASP E 1 497 ? 36.392  -28.958 132.660 1.00 118.48 ? 497 ASP F N     1 
ATOM   9234  C CA    . ASP E 1 497 ? 36.237  -28.997 134.101 1.00 116.64 ? 497 ASP F CA    1 
ATOM   9235  C C     . ASP E 1 497 ? 36.335  -27.582 134.644 1.00 112.06 ? 497 ASP F C     1 
ATOM   9236  O O     . ASP E 1 497 ? 37.429  -27.073 134.877 1.00 113.79 ? 497 ASP F O     1 
ATOM   9237  C CB    . ASP E 1 497 ? 37.321  -29.880 134.720 1.00 120.57 ? 497 ASP F CB    1 
ATOM   9238  C CG    . ASP E 1 497 ? 37.234  -29.942 136.230 1.00 124.52 ? 497 ASP F CG    1 
ATOM   9239  O OD1   . ASP E 1 497 ? 36.160  -29.620 136.780 1.00 125.65 ? 497 ASP F OD1   1 
ATOM   9240  O OD2   . ASP E 1 497 ? 38.238  -30.321 136.869 1.00 125.05 ? 497 ASP F OD2   1 
ATOM   9241  N N     . ILE E 1 498 ? 35.186  -26.944 134.833 1.00 105.14 ? 498 ILE F N     1 
ATOM   9242  C CA    . ILE E 1 498 ? 35.157  -25.575 135.334 1.00 96.32  ? 498 ILE F CA    1 
ATOM   9243  C C     . ILE E 1 498 ? 35.765  -25.410 136.733 1.00 101.71 ? 498 ILE F C     1 
ATOM   9244  O O     . ILE E 1 498 ? 36.629  -24.556 136.923 1.00 108.08 ? 498 ILE F O     1 
ATOM   9245  C CB    . ILE E 1 498 ? 33.740  -24.973 135.286 1.00 87.64  ? 498 ILE F CB    1 
ATOM   9246  C CG1   . ILE E 1 498 ? 33.276  -24.821 133.837 1.00 86.27  ? 498 ILE F CG1   1 
ATOM   9247  C CG2   . ILE E 1 498 ? 33.707  -23.641 136.008 1.00 80.73  ? 498 ILE F CG2   1 
ATOM   9248  C CD1   . ILE E 1 498 ? 31.920  -24.173 133.702 1.00 87.18  ? 498 ILE F CD1   1 
ATOM   9249  N N     . PRO E 1 499 ? 35.331  -26.223 137.717 1.00 105.02 ? 499 PRO F N     1 
ATOM   9250  C CA    . PRO E 1 499 ? 35.923  -26.015 139.043 1.00 108.31 ? 499 PRO F CA    1 
ATOM   9251  C C     . PRO E 1 499 ? 37.410  -26.352 139.098 1.00 109.32 ? 499 PRO F C     1 
ATOM   9252  O O     . PRO E 1 499 ? 38.121  -25.832 139.958 1.00 110.09 ? 499 PRO F O     1 
ATOM   9253  C CB    . PRO E 1 499 ? 35.142  -26.991 139.931 1.00 108.00 ? 499 PRO F CB    1 
ATOM   9254  C CG    . PRO E 1 499 ? 33.872  -27.246 139.198 1.00 107.36 ? 499 PRO F CG    1 
ATOM   9255  C CD    . PRO E 1 499 ? 34.265  -27.241 137.758 1.00 109.00 ? 499 PRO F CD    1 
ATOM   9256  N N     . GLY E 1 500 ? 37.871  -27.207 138.193 1.00 110.52 ? 500 GLY F N     1 
ATOM   9257  C CA    . GLY E 1 500 ? 39.245  -27.671 138.225 1.00 114.46 ? 500 GLY F CA    1 
ATOM   9258  C C     . GLY E 1 500 ? 40.158  -26.851 137.340 1.00 119.21 ? 500 GLY F C     1 
ATOM   9259  O O     . GLY E 1 500 ? 41.381  -26.924 137.456 1.00 122.44 ? 500 GLY F O     1 
ATOM   9260  N N     . ASN E 1 501 ? 39.558  -26.071 136.449 1.00 117.79 ? 501 ASN F N     1 
ATOM   9261  C CA    . ASN E 1 501 ? 40.321  -25.212 135.555 1.00 112.20 ? 501 ASN F CA    1 
ATOM   9262  C C     . ASN E 1 501 ? 39.888  -23.750 135.667 1.00 112.19 ? 501 ASN F C     1 
ATOM   9263  O O     . ASN E 1 501 ? 40.113  -22.957 134.757 1.00 111.60 ? 501 ASN F O     1 
ATOM   9264  C CB    . ASN E 1 501 ? 40.214  -25.704 134.106 1.00 108.69 ? 501 ASN F CB    1 
ATOM   9265  C CG    . ASN E 1 501 ? 40.674  -27.147 133.941 1.00 104.86 ? 501 ASN F CG    1 
ATOM   9266  O OD1   . ASN E 1 501 ? 40.077  -27.921 133.190 1.00 102.55 ? 501 ASN F OD1   1 
ATOM   9267  N ND2   . ASN E 1 501 ? 41.737  -27.515 134.650 1.00 101.05 ? 501 ASN F ND2   1 
ATOM   9268  N N     . ARG E 1 502 ? 39.261  -23.397 136.786 1.00 113.35 ? 502 ARG F N     1 
ATOM   9269  C CA    . ARG E 1 502 ? 38.888  -22.008 137.035 1.00 108.48 ? 502 ARG F CA    1 
ATOM   9270  C C     . ARG E 1 502 ? 40.143  -21.205 137.349 1.00 106.31 ? 502 ARG F C     1 
ATOM   9271  O O     . ARG E 1 502 ? 40.259  -20.036 136.979 1.00 109.72 ? 502 ARG F O     1 
ATOM   9272  C CB    . ARG E 1 502 ? 37.900  -21.900 138.202 1.00 110.68 ? 502 ARG F CB    1 
ATOM   9273  C CG    . ARG E 1 502 ? 36.485  -21.497 137.804 1.00 118.14 ? 502 ARG F CG    1 
ATOM   9274  C CD    . ARG E 1 502 ? 35.809  -20.708 138.917 1.00 128.15 ? 502 ARG F CD    1 
ATOM   9275  N NE    . ARG E 1 502 ? 36.652  -19.595 139.343 1.00 140.63 ? 502 ARG F NE    1 
ATOM   9276  C CZ    . ARG E 1 502 ? 36.734  -18.431 138.705 1.00 146.57 ? 502 ARG F CZ    1 
ATOM   9277  N NH1   . ARG E 1 502 ? 36.013  -18.218 137.611 1.00 148.50 ? 502 ARG F NH1   1 
ATOM   9278  N NH2   . ARG E 1 502 ? 37.537  -17.479 139.161 1.00 146.73 ? 502 ARG F NH2   1 
ATOM   9279  N N     . ALA E 1 503 ? 41.082  -21.853 138.032 1.00 97.98  ? 503 ALA F N     1 
ATOM   9280  C CA    . ALA E 1 503 ? 42.313  -21.205 138.463 1.00 90.34  ? 503 ALA F CA    1 
ATOM   9281  C C     . ALA E 1 503 ? 43.547  -21.869 137.859 1.00 92.71  ? 503 ALA F C     1 
ATOM   9282  O O     . ALA E 1 503 ? 43.440  -22.818 137.082 1.00 99.00  ? 503 ALA F O     1 
ATOM   9283  C CB    . ALA E 1 503 ? 42.399  -21.207 139.975 1.00 81.48  ? 503 ALA F CB    1 
ATOM   9284  N N     . GLY E 1 504 ? 44.720  -21.359 138.219 1.00 94.75  ? 504 GLY F N     1 
ATOM   9285  C CA    . GLY E 1 504 ? 45.972  -21.901 137.724 1.00 102.14 ? 504 GLY F CA    1 
ATOM   9286  C C     . GLY E 1 504 ? 46.632  -21.078 136.629 1.00 112.55 ? 504 GLY F C     1 
ATOM   9287  O O     . GLY E 1 504 ? 47.647  -21.491 136.072 1.00 122.72 ? 504 GLY F O     1 
ATOM   9288  N N     . LEU E 1 505 ? 46.068  -19.915 136.316 1.00 105.02 ? 505 LEU F N     1 
ATOM   9289  C CA    . LEU E 1 505 ? 46.630  -19.059 135.271 1.00 99.92  ? 505 LEU F CA    1 
ATOM   9290  C C     . LEU E 1 505 ? 47.751  -18.169 135.802 1.00 106.51 ? 505 LEU F C     1 
ATOM   9291  O O     . LEU E 1 505 ? 47.724  -17.764 136.964 1.00 114.55 ? 505 LEU F O     1 
ATOM   9292  C CB    . LEU E 1 505 ? 45.533  -18.220 134.613 1.00 92.75  ? 505 LEU F CB    1 
ATOM   9293  C CG    . LEU E 1 505 ? 44.719  -18.963 133.555 1.00 88.21  ? 505 LEU F CG    1 
ATOM   9294  C CD1   . LEU E 1 505 ? 43.302  -18.420 133.490 1.00 95.09  ? 505 LEU F CD1   1 
ATOM   9295  C CD2   . LEU E 1 505 ? 45.401  -18.858 132.200 1.00 90.14  ? 505 LEU F CD2   1 
ATOM   9296  N N     . PRO E 1 506 ? 48.745  -17.864 134.949 1.00 104.84 ? 506 PRO F N     1 
ATOM   9297  C CA    . PRO E 1 506 ? 49.931  -17.111 135.377 1.00 107.75 ? 506 PRO F CA    1 
ATOM   9298  C C     . PRO E 1 506 ? 49.635  -15.690 135.868 1.00 104.44 ? 506 PRO F C     1 
ATOM   9299  O O     . PRO E 1 506 ? 48.628  -15.095 135.477 1.00 105.25 ? 506 PRO F O     1 
ATOM   9300  C CB    . PRO E 1 506 ? 50.794  -17.067 134.108 1.00 114.28 ? 506 PRO F CB    1 
ATOM   9301  C CG    . PRO E 1 506 ? 49.845  -17.283 132.993 1.00 113.01 ? 506 PRO F CG    1 
ATOM   9302  C CD    . PRO E 1 506 ? 48.820  -18.230 133.524 1.00 106.13 ? 506 PRO F CD    1 
ATOM   9303  N N     . ASP E 1 507 ? 50.527  -15.165 136.709 1.00 105.10 ? 507 ASP F N     1 
ATOM   9304  C CA    . ASP E 1 507 ? 50.369  -13.843 137.323 1.00 107.12 ? 507 ASP F CA    1 
ATOM   9305  C C     . ASP E 1 507 ? 50.098  -12.723 136.314 1.00 110.71 ? 507 ASP F C     1 
ATOM   9306  O O     . ASP E 1 507 ? 49.116  -11.990 136.441 1.00 111.36 ? 507 ASP F O     1 
ATOM   9307  C CB    . ASP E 1 507 ? 51.610  -13.474 138.153 1.00 110.92 ? 507 ASP F CB    1 
ATOM   9308  C CG    . ASP E 1 507 ? 51.804  -14.369 139.371 1.00 113.45 ? 507 ASP F CG    1 
ATOM   9309  O OD1   . ASP E 1 507 ? 50.805  -14.716 140.039 1.00 118.65 ? 507 ASP F OD1   1 
ATOM   9310  O OD2   . ASP E 1 507 ? 52.969  -14.714 139.666 1.00 106.64 ? 507 ASP F OD2   1 
ATOM   9311  N N     . LEU E 1 508 ? 50.972  -12.603 135.315 1.00 111.79 ? 508 LEU F N     1 
ATOM   9312  C CA    . LEU E 1 508 ? 50.976  -11.453 134.411 1.00 108.68 ? 508 LEU F CA    1 
ATOM   9313  C C     . LEU E 1 508 ? 50.766  -11.816 132.944 1.00 112.56 ? 508 LEU F C     1 
ATOM   9314  O O     . LEU E 1 508 ? 51.201  -12.871 132.484 1.00 117.72 ? 508 LEU F O     1 
ATOM   9315  C CB    . LEU E 1 508 ? 52.310  -10.711 134.530 1.00 104.47 ? 508 LEU F CB    1 
ATOM   9316  C CG    . LEU E 1 508 ? 52.864  -10.529 135.941 1.00 106.29 ? 508 LEU F CG    1 
ATOM   9317  C CD1   . LEU E 1 508 ? 54.277  -9.967  135.904 1.00 109.34 ? 508 LEU F CD1   1 
ATOM   9318  C CD2   . LEU E 1 508 ? 51.948  -9.629  136.745 1.00 106.32 ? 508 LEU F CD2   1 
ATOM   9319  N N     . ILE E 1 509 ? 50.099  -10.928 132.215 1.00 111.50 ? 509 ILE F N     1 
ATOM   9320  C CA    . ILE E 1 509 ? 50.076  -10.987 130.761 1.00 117.20 ? 509 ILE F CA    1 
ATOM   9321  C C     . ILE E 1 509 ? 50.755  -9.713  130.286 1.00 126.94 ? 509 ILE F C     1 
ATOM   9322  O O     . ILE E 1 509 ? 50.558  -8.652  130.875 1.00 133.63 ? 509 ILE F O     1 
ATOM   9323  C CB    . ILE E 1 509 ? 48.638  -11.008 130.201 1.00 119.76 ? 509 ILE F CB    1 
ATOM   9324  C CG1   . ILE E 1 509 ? 47.723  -11.887 131.057 1.00 133.72 ? 509 ILE F CG1   1 
ATOM   9325  C CG2   . ILE E 1 509 ? 48.629  -11.452 128.742 1.00 116.19 ? 509 ILE F CG2   1 
ATOM   9326  C CD1   . ILE E 1 509 ? 48.069  -13.344 131.063 1.00 138.30 ? 509 ILE F CD1   1 
ATOM   9327  N N     . GLN E 1 510 ? 51.569  -9.805  129.243 1.00 129.06 ? 510 GLN F N     1 
ATOM   9328  C CA    . GLN E 1 510 ? 52.143  -8.599  128.663 1.00 131.95 ? 510 GLN F CA    1 
ATOM   9329  C C     . GLN E 1 510 ? 51.877  -8.568  127.165 1.00 133.41 ? 510 GLN F C     1 
ATOM   9330  O O     . GLN E 1 510 ? 52.134  -9.537  126.451 1.00 131.48 ? 510 GLN F O     1 
ATOM   9331  C CB    . GLN E 1 510 ? 53.638  -8.462  128.991 1.00 136.20 ? 510 GLN F CB    1 
ATOM   9332  C CG    . GLN E 1 510 ? 54.545  -9.486  128.334 1.00 139.85 ? 510 GLN F CG    1 
ATOM   9333  C CD    . GLN E 1 510 ? 55.975  -9.410  128.827 1.00 142.00 ? 510 GLN F CD    1 
ATOM   9334  O OE1   . GLN E 1 510 ? 56.368  -8.446  129.483 1.00 144.53 ? 510 GLN F OE1   1 
ATOM   9335  N NE2   . GLN E 1 510 ? 56.762  -10.433 128.516 1.00 141.79 ? 510 GLN F NE2   1 
ATOM   9336  N N     . PHE E 1 511 ? 51.317  -7.458  126.703 1.00 136.59 ? 511 PHE F N     1 
ATOM   9337  C CA    . PHE E 1 511 ? 51.004  -7.305  125.296 1.00 138.45 ? 511 PHE F CA    1 
ATOM   9338  C C     . PHE E 1 511 ? 52.018  -6.373  124.656 1.00 145.13 ? 511 PHE F C     1 
ATOM   9339  O O     . PHE E 1 511 ? 52.498  -5.431  125.288 1.00 147.81 ? 511 PHE F O     1 
ATOM   9340  C CB    . PHE E 1 511 ? 49.595  -6.736  125.112 1.00 135.09 ? 511 PHE F CB    1 
ATOM   9341  C CG    . PHE E 1 511 ? 48.530  -7.467  125.885 1.00 130.37 ? 511 PHE F CG    1 
ATOM   9342  C CD1   . PHE E 1 511 ? 48.004  -8.660  125.414 1.00 129.88 ? 511 PHE F CD1   1 
ATOM   9343  C CD2   . PHE E 1 511 ? 48.038  -6.947  127.071 1.00 128.08 ? 511 PHE F CD2   1 
ATOM   9344  C CE1   . PHE E 1 511 ? 47.019  -9.328  126.121 1.00 128.04 ? 511 PHE F CE1   1 
ATOM   9345  C CE2   . PHE E 1 511 ? 47.052  -7.609  127.781 1.00 126.68 ? 511 PHE F CE2   1 
ATOM   9346  C CZ    . PHE E 1 511 ? 46.543  -8.801  127.306 1.00 126.61 ? 511 PHE F CZ    1 
ATOM   9347  N N     . TRP E 1 512 ? 52.348  -6.647  123.402 1.00 146.76 ? 512 TRP F N     1 
ATOM   9348  C CA    . TRP E 1 512 ? 53.171  -5.749  122.609 1.00 142.40 ? 512 TRP F CA    1 
ATOM   9349  C C     . TRP E 1 512 ? 52.274  -5.284  121.470 1.00 134.74 ? 512 TRP F C     1 
ATOM   9350  O O     . TRP E 1 512 ? 52.465  -5.685  120.323 1.00 133.15 ? 512 TRP F O     1 
ATOM   9351  C CB    . TRP E 1 512 ? 54.402  -6.481  122.068 1.00 146.99 ? 512 TRP F CB    1 
ATOM   9352  C CG    . TRP E 1 512 ? 55.057  -7.422  123.055 1.00 153.03 ? 512 TRP F CG    1 
ATOM   9353  C CD1   . TRP E 1 512 ? 54.577  -8.629  123.482 1.00 150.82 ? 512 TRP F CD1   1 
ATOM   9354  C CD2   . TRP E 1 512 ? 56.319  -7.242  123.713 1.00 160.53 ? 512 TRP F CD2   1 
ATOM   9355  N NE1   . TRP E 1 512 ? 55.449  -9.201  124.372 1.00 150.40 ? 512 TRP F NE1   1 
ATOM   9356  C CE2   . TRP E 1 512 ? 56.529  -8.373  124.530 1.00 158.92 ? 512 TRP F CE2   1 
ATOM   9357  C CE3   . TRP E 1 512 ? 57.289  -6.235  123.693 1.00 167.93 ? 512 TRP F CE3   1 
ATOM   9358  C CZ2   . TRP E 1 512 ? 57.667  -8.524  125.320 1.00 164.93 ? 512 TRP F CZ2   1 
ATOM   9359  C CZ3   . TRP E 1 512 ? 58.420  -6.387  124.480 1.00 172.42 ? 512 TRP F CZ3   1 
ATOM   9360  C CH2   . TRP E 1 512 ? 58.598  -7.523  125.282 1.00 170.75 ? 512 TRP F CH2   1 
ATOM   9361  N N     . PRO E 1 513 ? 51.285  -4.431  121.793 1.00 132.93 ? 513 PRO F N     1 
ATOM   9362  C CA    . PRO E 1 513 ? 50.122  -4.122  120.950 1.00 132.00 ? 513 PRO F CA    1 
ATOM   9363  C C     . PRO E 1 513 ? 50.468  -3.689  119.531 1.00 134.72 ? 513 PRO F C     1 
ATOM   9364  O O     . PRO E 1 513 ? 49.743  -4.041  118.600 1.00 135.48 ? 513 PRO F O     1 
ATOM   9365  C CB    . PRO E 1 513 ? 49.437  -2.970  121.700 1.00 130.38 ? 513 PRO F CB    1 
ATOM   9366  C CG    . PRO E 1 513 ? 50.493  -2.390  122.566 1.00 134.12 ? 513 PRO F CG    1 
ATOM   9367  C CD    . PRO E 1 513 ? 51.354  -3.545  122.967 1.00 133.59 ? 513 PRO F CD    1 
ATOM   9368  N N     . ALA E 1 514 ? 51.554  -2.938  119.375 1.00 134.83 ? 514 ALA F N     1 
ATOM   9369  C CA    . ALA E 1 514 ? 51.952  -2.437  118.064 1.00 136.04 ? 514 ALA F CA    1 
ATOM   9370  C C     . ALA E 1 514 ? 52.275  -3.581  117.107 1.00 138.92 ? 514 ALA F C     1 
ATOM   9371  O O     . ALA E 1 514 ? 51.892  -3.548  115.937 1.00 138.93 ? 514 ALA F O     1 
ATOM   9372  C CB    . ALA E 1 514 ? 53.137  -1.493  118.192 1.00 135.77 ? 514 ALA F CB    1 
ATOM   9373  N N     . GLN E 1 515 ? 52.974  -4.593  117.612 1.00 141.77 ? 515 GLN F N     1 
ATOM   9374  C CA    . GLN E 1 515 ? 53.308  -5.770  116.816 1.00 145.30 ? 515 GLN F CA    1 
ATOM   9375  C C     . GLN E 1 515 ? 52.311  -6.906  117.051 1.00 149.29 ? 515 GLN F C     1 
ATOM   9376  O O     . GLN E 1 515 ? 52.483  -8.011  116.536 1.00 149.50 ? 515 GLN F O     1 
ATOM   9377  C CB    . GLN E 1 515 ? 54.742  -6.229  117.100 1.00 142.84 ? 515 GLN F CB    1 
ATOM   9378  C CG    . GLN E 1 515 ? 55.018  -6.573  118.555 1.00 140.05 ? 515 GLN F CG    1 
ATOM   9379  C CD    . GLN E 1 515 ? 56.484  -6.425  118.927 1.00 141.52 ? 515 GLN F CD    1 
ATOM   9380  O OE1   . GLN E 1 515 ? 57.075  -5.359  118.752 1.00 139.84 ? 515 GLN F OE1   1 
ATOM   9381  N NE2   . GLN E 1 515 ? 57.076  -7.497  119.443 1.00 144.15 ? 515 GLN F NE2   1 
ATOM   9382  N N     . ARG E 1 516 ? 51.276  -6.619  117.838 1.00 150.13 ? 516 ARG F N     1 
ATOM   9383  C CA    . ARG E 1 516 ? 50.151  -7.532  118.051 1.00 146.82 ? 516 ARG F CA    1 
ATOM   9384  C C     . ARG E 1 516 ? 50.551  -8.938  118.517 1.00 146.28 ? 516 ARG F C     1 
ATOM   9385  O O     . ARG E 1 516 ? 50.033  -9.942  118.024 1.00 143.03 ? 516 ARG F O     1 
ATOM   9386  C CB    . ARG E 1 516 ? 49.278  -7.602  116.792 1.00 147.11 ? 516 ARG F CB    1 
ATOM   9387  C CG    . ARG E 1 516 ? 47.832  -7.978  117.060 1.00 144.82 ? 516 ARG F CG    1 
ATOM   9388  C CD    . ARG E 1 516 ? 46.882  -7.098  116.272 1.00 147.65 ? 516 ARG F CD    1 
ATOM   9389  N NE    . ARG E 1 516 ? 46.987  -7.328  114.835 1.00 153.85 ? 516 ARG F NE    1 
ATOM   9390  C CZ    . ARG E 1 516 ? 45.944  -7.512  114.035 1.00 157.24 ? 516 ARG F CZ    1 
ATOM   9391  N NH1   . ARG E 1 516 ? 44.715  -7.490  114.535 1.00 154.74 ? 516 ARG F NH1   1 
ATOM   9392  N NH2   . ARG E 1 516 ? 46.127  -7.714  112.736 1.00 160.25 ? 516 ARG F NH2   1 
ATOM   9393  N N     . ARG E 1 517 ? 51.473  -9.000  119.471 1.00 151.22 ? 517 ARG F N     1 
ATOM   9394  C CA    . ARG E 1 517 ? 51.861  -10.266 120.081 1.00 155.66 ? 517 ARG F CA    1 
ATOM   9395  C C     . ARG E 1 517 ? 51.740  -10.177 121.599 1.00 150.77 ? 517 ARG F C     1 
ATOM   9396  O O     . ARG E 1 517 ? 51.975  -9.122  122.184 1.00 148.03 ? 517 ARG F O     1 
ATOM   9397  C CB    . ARG E 1 517 ? 53.292  -10.645 119.679 1.00 166.20 ? 517 ARG F CB    1 
ATOM   9398  C CG    . ARG E 1 517 ? 53.813  -11.950 120.284 1.00 172.94 ? 517 ARG F CG    1 
ATOM   9399  C CD    . ARG E 1 517 ? 53.265  -13.185 119.571 1.00 177.11 ? 517 ARG F CD    1 
ATOM   9400  N NE    . ARG E 1 517 ? 51.852  -13.424 119.853 1.00 175.53 ? 517 ARG F NE    1 
ATOM   9401  C CZ    . ARG E 1 517 ? 51.138  -14.411 119.322 1.00 176.60 ? 517 ARG F CZ    1 
ATOM   9402  N NH1   . ARG E 1 517 ? 51.703  -15.262 118.477 1.00 179.13 ? 517 ARG F NH1   1 
ATOM   9403  N NH2   . ARG E 1 517 ? 49.858  -14.549 119.637 1.00 175.15 ? 517 ARG F NH2   1 
ATOM   9404  N N     . TYR E 1 518 ? 51.355  -11.284 122.229 1.00 150.49 ? 518 TYR F N     1 
ATOM   9405  C CA    . TYR E 1 518 ? 51.294  -11.360 123.683 1.00 147.43 ? 518 TYR F CA    1 
ATOM   9406  C C     . TYR E 1 518 ? 52.248  -12.440 124.179 1.00 148.51 ? 518 TYR F C     1 
ATOM   9407  O O     . TYR E 1 518 ? 52.577  -13.373 123.448 1.00 152.80 ? 518 TYR F O     1 
ATOM   9408  C CB    . TYR E 1 518 ? 49.874  -11.688 124.150 1.00 141.17 ? 518 TYR F CB    1 
ATOM   9409  C CG    . TYR E 1 518 ? 49.546  -13.161 124.067 1.00 137.84 ? 518 TYR F CG    1 
ATOM   9410  C CD1   . TYR E 1 518 ? 49.124  -13.729 122.872 1.00 139.27 ? 518 TYR F CD1   1 
ATOM   9411  C CD2   . TYR E 1 518 ? 49.667  -13.987 125.180 1.00 131.79 ? 518 TYR F CD2   1 
ATOM   9412  C CE1   . TYR E 1 518 ? 48.832  -15.073 122.788 1.00 134.58 ? 518 TYR F CE1   1 
ATOM   9413  C CE2   . TYR E 1 518 ? 49.379  -15.332 125.103 1.00 129.41 ? 518 TYR F CE2   1 
ATOM   9414  C CZ    . TYR E 1 518 ? 48.960  -15.869 123.905 1.00 131.70 ? 518 TYR F CZ    1 
ATOM   9415  O OH    . TYR E 1 518 ? 48.668  -17.209 123.821 1.00 135.06 ? 518 TYR F OH    1 
ATOM   9416  N N     . ARG E 1 519 ? 52.683  -12.298 125.425 1.00 143.78 ? 519 ARG F N     1 
ATOM   9417  C CA    . ARG E 1 519 ? 53.481  -13.303 126.114 1.00 144.21 ? 519 ARG F CA    1 
ATOM   9418  C C     . ARG E 1 519 ? 53.066  -13.196 127.570 1.00 139.35 ? 519 ARG F C     1 
ATOM   9419  O O     . ARG E 1 519 ? 52.984  -12.094 128.102 1.00 137.75 ? 519 ARG F O     1 
ATOM   9420  C CB    . ARG E 1 519 ? 54.980  -13.015 125.954 1.00 153.67 ? 519 ARG F CB    1 
ATOM   9421  C CG    . ARG E 1 519 ? 55.518  -13.248 124.536 1.00 164.75 ? 519 ARG F CG    1 
ATOM   9422  C CD    . ARG E 1 519 ? 56.617  -12.259 124.128 1.00 172.33 ? 519 ARG F CD    1 
ATOM   9423  N NE    . ARG E 1 519 ? 56.544  -11.929 122.702 1.00 175.15 ? 519 ARG F NE    1 
ATOM   9424  C CZ    . ARG E 1 519 ? 57.338  -11.057 122.083 1.00 172.47 ? 519 ARG F CZ    1 
ATOM   9425  N NH1   . ARG E 1 519 ? 58.283  -10.418 122.759 1.00 171.69 ? 519 ARG F NH1   1 
ATOM   9426  N NH2   . ARG E 1 519 ? 57.188  -10.822 120.785 1.00 168.74 ? 519 ARG F NH2   1 
ATOM   9427  N N     . MET E 1 520 ? 52.773  -14.320 128.214 1.00 137.39 ? 520 MET F N     1 
ATOM   9428  C CA    . MET E 1 520 ? 52.261  -14.268 129.582 1.00 129.43 ? 520 MET F CA    1 
ATOM   9429  C C     . MET E 1 520 ? 53.145  -15.004 130.591 1.00 121.57 ? 520 MET F C     1 
ATOM   9430  O O     . MET E 1 520 ? 53.654  -16.090 130.316 1.00 121.37 ? 520 MET F O     1 
ATOM   9431  C CB    . MET E 1 520 ? 50.808  -14.750 129.644 1.00 128.57 ? 520 MET F CB    1 
ATOM   9432  C CG    . MET E 1 520 ? 50.590  -16.221 129.355 1.00 132.03 ? 520 MET F CG    1 
ATOM   9433  S SD    . MET E 1 520 ? 48.887  -16.772 129.656 1.00 138.92 ? 520 MET F SD    1 
ATOM   9434  C CE    . MET E 1 520 ? 48.028  -16.091 128.229 1.00 98.11  ? 520 MET F CE    1 
ATOM   9435  N N     . VAL E 1 521 ? 53.320  -14.397 131.762 1.00 113.75 ? 521 VAL F N     1 
ATOM   9436  C CA    . VAL E 1 521 ? 54.324  -14.846 132.721 1.00 111.03 ? 521 VAL F CA    1 
ATOM   9437  C C     . VAL E 1 521 ? 53.785  -15.030 134.137 1.00 112.40 ? 521 VAL F C     1 
ATOM   9438  O O     . VAL E 1 521 ? 53.023  -14.204 134.635 1.00 112.39 ? 521 VAL F O     1 
ATOM   9439  C CB    . VAL E 1 521 ? 55.486  -13.835 132.812 1.00 112.00 ? 521 VAL F CB    1 
ATOM   9440  C CG1   . VAL E 1 521 ? 56.570  -14.351 133.741 1.00 111.25 ? 521 VAL F CG1   1 
ATOM   9441  C CG2   . VAL E 1 521 ? 56.057  -13.540 131.435 1.00 116.35 ? 521 VAL F CG2   1 
ATOM   9442  N N     . GLU E 1 522 ? 54.203  -16.114 134.782 1.00 117.30 ? 522 GLU F N     1 
ATOM   9443  C CA    . GLU E 1 522 ? 53.952  -16.326 136.200 1.00 119.54 ? 522 GLU F CA    1 
ATOM   9444  C C     . GLU E 1 522 ? 55.270  -16.190 136.953 1.00 119.53 ? 522 GLU F C     1 
ATOM   9445  O O     . GLU E 1 522 ? 56.218  -16.927 136.687 1.00 118.67 ? 522 GLU F O     1 
ATOM   9446  C CB    . GLU E 1 522 ? 53.368  -17.719 136.423 1.00 120.01 ? 522 GLU F CB    1 
ATOM   9447  C CG    . GLU E 1 522 ? 53.493  -18.238 137.843 1.00 118.33 ? 522 GLU F CG    1 
ATOM   9448  C CD    . GLU E 1 522 ? 52.509  -17.590 138.790 1.00 113.96 ? 522 GLU F CD    1 
ATOM   9449  O OE1   . GLU E 1 522 ? 51.411  -17.206 138.335 1.00 113.91 ? 522 GLU F OE1   1 
ATOM   9450  O OE2   . GLU E 1 522 ? 52.835  -17.465 139.990 1.00 109.20 ? 522 GLU F OE2   1 
ATOM   9451  N N     . VAL E 1 523 ? 55.337  -15.249 137.889 1.00 119.74 ? 523 VAL F N     1 
ATOM   9452  C CA    . VAL E 1 523 ? 56.588  -15.000 138.599 1.00 120.91 ? 523 VAL F CA    1 
ATOM   9453  C C     . VAL E 1 523 ? 56.632  -15.708 139.953 1.00 117.03 ? 523 VAL F C     1 
ATOM   9454  O O     . VAL E 1 523 ? 55.595  -15.984 140.560 1.00 108.87 ? 523 VAL F O     1 
ATOM   9455  C CB    . VAL E 1 523 ? 56.877  -13.485 138.754 1.00 121.79 ? 523 VAL F CB    1 
ATOM   9456  C CG1   . VAL E 1 523 ? 56.289  -12.716 137.581 1.00 122.07 ? 523 VAL F CG1   1 
ATOM   9457  C CG2   . VAL E 1 523 ? 56.327  -12.954 140.065 1.00 120.20 ? 523 VAL F CG2   1 
ATOM   9458  N N     . LYS E 1 524 ? 57.841  -16.020 140.406 1.00 123.66 ? 524 LYS F N     1 
ATOM   9459  C CA    . LYS E 1 524 ? 58.038  -16.688 141.685 1.00 126.74 ? 524 LYS F CA    1 
ATOM   9460  C C     . LYS E 1 524 ? 59.195  -16.044 142.438 1.00 133.09 ? 524 LYS F C     1 
ATOM   9461  O O     . LYS E 1 524 ? 60.315  -15.977 141.933 1.00 132.78 ? 524 LYS F O     1 
ATOM   9462  C CB    . LYS E 1 524 ? 58.317  -18.182 141.481 1.00 127.17 ? 524 LYS F CB    1 
ATOM   9463  C CG    . LYS E 1 524 ? 57.177  -18.969 140.847 1.00 126.47 ? 524 LYS F CG    1 
ATOM   9464  C CD    . LYS E 1 524 ? 55.939  -18.974 141.734 1.00 124.07 ? 524 LYS F CD    1 
ATOM   9465  C CE    . LYS E 1 524 ? 54.816  -19.792 141.114 1.00 118.05 ? 524 LYS F CE    1 
ATOM   9466  N NZ    . LYS E 1 524 ? 53.589  -19.795 141.957 1.00 115.17 ? 524 LYS F NZ    1 
ATOM   9467  N N     . GLY E 1 525 ? 58.922  -15.566 143.647 1.00 138.59 ? 525 GLY F N     1 
ATOM   9468  C CA    . GLY E 1 525 ? 59.961  -15.001 144.486 1.00 141.22 ? 525 GLY F CA    1 
ATOM   9469  C C     . GLY E 1 525 ? 60.829  -16.093 145.082 1.00 141.79 ? 525 GLY F C     1 
ATOM   9470  O O     . GLY E 1 525 ? 60.760  -17.246 144.656 1.00 139.35 ? 525 GLY F O     1 
ATOM   9471  N N     . PRO E 1 526 ? 61.652  -15.738 146.079 1.00 143.22 ? 526 PRO F N     1 
ATOM   9472  C CA    . PRO E 1 526 ? 62.512  -16.717 146.751 1.00 143.29 ? 526 PRO F CA    1 
ATOM   9473  C C     . PRO E 1 526 ? 61.732  -17.604 147.718 1.00 145.71 ? 526 PRO F C     1 
ATOM   9474  O O     . PRO E 1 526 ? 62.316  -18.501 148.327 1.00 148.34 ? 526 PRO F O     1 
ATOM   9475  C CB    . PRO E 1 526 ? 63.493  -15.835 147.526 1.00 143.24 ? 526 PRO F CB    1 
ATOM   9476  C CG    . PRO E 1 526 ? 62.722  -14.594 147.809 1.00 141.98 ? 526 PRO F CG    1 
ATOM   9477  C CD    . PRO E 1 526 ? 61.861  -14.374 146.595 1.00 143.23 ? 526 PRO F CD    1 
ATOM   9478  N N     . GLY E 1 527 ? 60.432  -17.359 147.853 1.00 145.79 ? 527 GLY F N     1 
ATOM   9479  C CA    . GLY E 1 527 ? 59.605  -18.128 148.765 1.00 144.84 ? 527 GLY F CA    1 
ATOM   9480  C C     . GLY E 1 527 ? 58.308  -18.661 148.179 1.00 143.82 ? 527 GLY F C     1 
ATOM   9481  O O     . GLY E 1 527 ? 57.255  -18.552 148.811 1.00 143.05 ? 527 GLY F O     1 
ATOM   9482  N N     . ASP E 1 528 ? 58.383  -19.239 146.979 1.00 141.98 ? 528 ASP F N     1 
ATOM   9483  C CA    . ASP E 1 528 ? 57.235  -19.890 146.344 1.00 136.85 ? 528 ASP F CA    1 
ATOM   9484  C C     . ASP E 1 528 ? 57.651  -20.654 145.088 1.00 130.70 ? 528 ASP F C     1 
ATOM   9485  O O     . ASP E 1 528 ? 58.517  -20.204 144.340 1.00 131.14 ? 528 ASP F O     1 
ATOM   9486  C CB    . ASP E 1 528 ? 56.150  -18.868 145.986 1.00 139.80 ? 528 ASP F CB    1 
ATOM   9487  C CG    . ASP E 1 528 ? 54.874  -19.521 145.480 1.00 140.92 ? 528 ASP F CG    1 
ATOM   9488  O OD1   . ASP E 1 528 ? 54.530  -20.622 145.962 1.00 137.61 ? 528 ASP F OD1   1 
ATOM   9489  O OD2   . ASP E 1 528 ? 54.213  -18.929 144.601 1.00 143.39 ? 528 ASP F OD2   1 
ATOM   9490  N N     . ARG E 1 529 ? 57.032  -21.809 144.864 1.00 128.99 ? 529 ARG F N     1 
ATOM   9491  C CA    . ARG E 1 529 ? 57.253  -22.573 143.639 1.00 131.82 ? 529 ARG F CA    1 
ATOM   9492  C C     . ARG E 1 529 ? 55.945  -22.725 142.871 1.00 134.27 ? 529 ARG F C     1 
ATOM   9493  O O     . ARG E 1 529 ? 54.885  -22.321 143.350 1.00 136.59 ? 529 ARG F O     1 
ATOM   9494  C CB    . ARG E 1 529 ? 57.852  -23.949 143.944 1.00 132.12 ? 529 ARG F CB    1 
ATOM   9495  C CG    . ARG E 1 529 ? 56.902  -24.906 144.647 1.00 133.07 ? 529 ARG F CG    1 
ATOM   9496  C CD    . ARG E 1 529 ? 57.514  -26.294 144.788 1.00 135.02 ? 529 ARG F CD    1 
ATOM   9497  N NE    . ARG E 1 529 ? 56.673  -27.181 145.586 1.00 132.21 ? 529 ARG F NE    1 
ATOM   9498  C CZ    . ARG E 1 529 ? 56.700  -27.235 146.913 1.00 133.68 ? 529 ARG F CZ    1 
ATOM   9499  N NH1   . ARG E 1 529 ? 57.526  -26.449 147.592 1.00 138.16 ? 529 ARG F NH1   1 
ATOM   9500  N NH2   . ARG E 1 529 ? 55.903  -28.070 147.564 1.00 131.85 ? 529 ARG F NH2   1 
ATOM   9501  N N     . LEU E 1 530 ? 56.023  -23.305 141.677 1.00 133.61 ? 530 LEU F N     1 
ATOM   9502  C CA    . LEU E 1 530 ? 54.840  -23.516 140.851 1.00 129.56 ? 530 LEU F CA    1 
ATOM   9503  C C     . LEU E 1 530 ? 53.861  -24.477 141.513 1.00 126.44 ? 530 LEU F C     1 
ATOM   9504  O O     . LEU E 1 530 ? 54.246  -25.557 141.959 1.00 126.93 ? 530 LEU F O     1 
ATOM   9505  C CB    . LEU E 1 530 ? 55.234  -24.056 139.475 1.00 129.25 ? 530 LEU F CB    1 
ATOM   9506  C CG    . LEU E 1 530 ? 55.856  -23.066 138.491 1.00 129.87 ? 530 LEU F CG    1 
ATOM   9507  C CD1   . LEU E 1 530 ? 56.273  -23.779 137.216 1.00 130.54 ? 530 LEU F CD1   1 
ATOM   9508  C CD2   . LEU E 1 530 ? 54.879  -21.943 138.181 1.00 127.70 ? 530 LEU F CD2   1 
ATOM   9509  N N     . GLN E 1 531 ? 52.595  -24.078 141.580 1.00 122.47 ? 531 GLN F N     1 
ATOM   9510  C CA    . GLN E 1 531 ? 51.554  -24.965 142.079 1.00 114.36 ? 531 GLN F CA    1 
ATOM   9511  C C     . GLN E 1 531 ? 51.246  -26.026 141.028 1.00 117.98 ? 531 GLN F C     1 
ATOM   9512  O O     . GLN E 1 531 ? 51.685  -25.920 139.882 1.00 119.47 ? 531 GLN F O     1 
ATOM   9513  C CB    . GLN E 1 531 ? 50.288  -24.184 142.440 1.00 106.79 ? 531 GLN F CB    1 
ATOM   9514  C CG    . GLN E 1 531 ? 50.428  -23.306 143.672 1.00 107.72 ? 531 GLN F CG    1 
ATOM   9515  C CD    . GLN E 1 531 ? 49.125  -22.626 144.047 1.00 110.90 ? 531 GLN F CD    1 
ATOM   9516  O OE1   . GLN E 1 531 ? 48.119  -22.761 143.349 1.00 108.86 ? 531 GLN F OE1   1 
ATOM   9517  N NE2   . GLN E 1 531 ? 49.137  -21.892 145.157 1.00 112.07 ? 531 GLN F NE2   1 
ATOM   9518  N N     . ASP E 1 532 ? 50.496  -27.048 141.424 1.00 121.00 ? 532 ASP F N     1 
ATOM   9519  C CA    . ASP E 1 532 ? 50.158  -28.145 140.524 1.00 127.13 ? 532 ASP F CA    1 
ATOM   9520  C C     . ASP E 1 532 ? 49.343  -27.682 139.320 1.00 122.56 ? 532 ASP F C     1 
ATOM   9521  O O     . ASP E 1 532 ? 49.686  -27.979 138.175 1.00 119.82 ? 532 ASP F O     1 
ATOM   9522  C CB    . ASP E 1 532 ? 49.396  -29.234 141.279 1.00 137.06 ? 532 ASP F CB    1 
ATOM   9523  C CG    . ASP E 1 532 ? 50.307  -30.114 142.108 1.00 141.84 ? 532 ASP F CG    1 
ATOM   9524  O OD1   . ASP E 1 532 ? 50.834  -31.101 141.555 1.00 140.33 ? 532 ASP F OD1   1 
ATOM   9525  O OD2   . ASP E 1 532 ? 50.494  -29.822 143.309 1.00 145.46 ? 532 ASP F OD2   1 
ATOM   9526  N N     . ASN E 1 533 ? 48.263  -26.955 139.588 1.00 117.41 ? 533 ASN F N     1 
ATOM   9527  C CA    . ASN E 1 533 ? 47.378  -26.479 138.532 1.00 113.09 ? 533 ASN F CA    1 
ATOM   9528  C C     . ASN E 1 533 ? 48.054  -25.463 137.619 1.00 114.27 ? 533 ASN F C     1 
ATOM   9529  O O     . ASN E 1 533 ? 47.786  -25.421 136.417 1.00 117.83 ? 533 ASN F O     1 
ATOM   9530  C CB    . ASN E 1 533 ? 46.097  -25.890 139.128 1.00 110.36 ? 533 ASN F CB    1 
ATOM   9531  C CG    . ASN E 1 533 ? 46.374  -24.787 140.128 1.00 111.78 ? 533 ASN F CG    1 
ATOM   9532  O OD1   . ASN E 1 533 ? 47.456  -24.720 140.710 1.00 116.80 ? 533 ASN F OD1   1 
ATOM   9533  N ND2   . ASN E 1 533 ? 45.392  -23.918 140.338 1.00 109.60 ? 533 ASN F ND2   1 
ATOM   9534  N N     . GLN E 1 534 ? 48.931  -24.646 138.196 1.00 110.90 ? 534 GLN F N     1 
ATOM   9535  C CA    . GLN E 1 534 ? 49.685  -23.663 137.429 1.00 110.17 ? 534 GLN F CA    1 
ATOM   9536  C C     . GLN E 1 534 ? 50.628  -24.367 136.465 1.00 114.57 ? 534 GLN F C     1 
ATOM   9537  O O     . GLN E 1 534 ? 50.868  -23.898 135.353 1.00 115.18 ? 534 GLN F O     1 
ATOM   9538  C CB    . GLN E 1 534 ? 50.470  -22.741 138.364 1.00 108.87 ? 534 GLN F CB    1 
ATOM   9539  C CG    . GLN E 1 534 ? 49.593  -21.783 139.153 1.00 110.13 ? 534 GLN F CG    1 
ATOM   9540  C CD    . GLN E 1 534 ? 50.380  -20.940 140.137 1.00 107.16 ? 534 GLN F CD    1 
ATOM   9541  O OE1   . GLN E 1 534 ? 51.507  -21.279 140.502 1.00 105.43 ? 534 GLN F OE1   1 
ATOM   9542  N NE2   . GLN E 1 534 ? 49.788  -19.830 140.571 1.00 102.58 ? 534 GLN F NE2   1 
ATOM   9543  N N     . LEU E 1 535 ? 51.152  -25.505 136.905 1.00 119.03 ? 535 LEU F N     1 
ATOM   9544  C CA    . LEU E 1 535 ? 52.030  -26.323 136.085 1.00 121.32 ? 535 LEU F CA    1 
ATOM   9545  C C     . LEU E 1 535 ? 51.229  -26.955 134.953 1.00 118.87 ? 535 LEU F C     1 
ATOM   9546  O O     . LEU E 1 535 ? 51.694  -27.036 133.817 1.00 118.68 ? 535 LEU F O     1 
ATOM   9547  C CB    . LEU E 1 535 ? 52.688  -27.400 136.949 1.00 122.76 ? 535 LEU F CB    1 
ATOM   9548  C CG    . LEU E 1 535 ? 54.217  -27.426 136.973 1.00 124.69 ? 535 LEU F CG    1 
ATOM   9549  C CD1   . LEU E 1 535 ? 54.731  -27.949 138.310 1.00 123.95 ? 535 LEU F CD1   1 
ATOM   9550  C CD2   . LEU E 1 535 ? 54.744  -28.273 135.822 1.00 123.88 ? 535 LEU F CD2   1 
ATOM   9551  N N     . ARG E 1 536 ? 50.011  -27.381 135.271 1.00 117.39 ? 536 ARG F N     1 
ATOM   9552  C CA    . ARG E 1 536 ? 49.128  -28.001 134.289 1.00 116.66 ? 536 ARG F CA    1 
ATOM   9553  C C     . ARG E 1 536 ? 48.782  -27.083 133.119 1.00 119.02 ? 536 ARG F C     1 
ATOM   9554  O O     . ARG E 1 536 ? 48.521  -27.553 132.012 1.00 119.25 ? 536 ARG F O     1 
ATOM   9555  C CB    . ARG E 1 536 ? 47.848  -28.500 134.962 1.00 111.49 ? 536 ARG F CB    1 
ATOM   9556  C CG    . ARG E 1 536 ? 48.063  -29.744 135.794 1.00 109.35 ? 536 ARG F CG    1 
ATOM   9557  C CD    . ARG E 1 536 ? 46.760  -30.456 136.094 1.00 110.86 ? 536 ARG F CD    1 
ATOM   9558  N NE    . ARG E 1 536 ? 46.294  -30.182 137.447 1.00 108.49 ? 536 ARG F NE    1 
ATOM   9559  C CZ    . ARG E 1 536 ? 45.251  -29.415 137.740 1.00 105.87 ? 536 ARG F CZ    1 
ATOM   9560  N NH1   . ARG E 1 536 ? 44.550  -28.847 136.768 1.00 108.15 ? 536 ARG F NH1   1 
ATOM   9561  N NH2   . ARG E 1 536 ? 44.906  -29.225 139.005 1.00 102.16 ? 536 ARG F NH2   1 
ATOM   9562  N N     . TRP E 1 537 ? 48.787  -25.777 133.361 1.00 121.31 ? 537 TRP F N     1 
ATOM   9563  C CA    . TRP E 1 537 ? 48.391  -24.824 132.331 1.00 123.11 ? 537 TRP F CA    1 
ATOM   9564  C C     . TRP E 1 537 ? 49.576  -24.366 131.489 1.00 122.54 ? 537 TRP F C     1 
ATOM   9565  O O     . TRP E 1 537 ? 49.431  -24.067 130.304 1.00 123.14 ? 537 TRP F O     1 
ATOM   9566  C CB    . TRP E 1 537 ? 47.681  -23.621 132.948 1.00 126.18 ? 537 TRP F CB    1 
ATOM   9567  C CG    . TRP E 1 537 ? 46.477  -23.211 132.170 1.00 129.27 ? 537 TRP F CG    1 
ATOM   9568  C CD1   . TRP E 1 537 ? 46.453  -22.725 130.895 1.00 135.98 ? 537 TRP F CD1   1 
ATOM   9569  C CD2   . TRP E 1 537 ? 45.117  -23.254 132.609 1.00 122.95 ? 537 TRP F CD2   1 
ATOM   9570  N NE1   . TRP E 1 537 ? 45.161  -22.462 130.513 1.00 134.32 ? 537 TRP F NE1   1 
ATOM   9571  C CE2   . TRP E 1 537 ? 44.320  -22.779 131.547 1.00 125.33 ? 537 TRP F CE2   1 
ATOM   9572  C CE3   . TRP E 1 537 ? 44.492  -23.649 133.797 1.00 120.21 ? 537 TRP F CE3   1 
ATOM   9573  C CZ2   . TRP E 1 537 ? 42.936  -22.686 131.635 1.00 122.87 ? 537 TRP F CZ2   1 
ATOM   9574  C CZ3   . TRP E 1 537 ? 43.117  -23.556 133.883 1.00 122.70 ? 537 TRP F CZ3   1 
ATOM   9575  C CH2   . TRP E 1 537 ? 42.355  -23.078 132.807 1.00 123.65 ? 537 TRP F CH2   1 
ATOM   9576  N N     . LEU E 1 538 ? 50.746  -24.306 132.114 1.00 121.57 ? 538 LEU F N     1 
ATOM   9577  C CA    . LEU E 1 538 ? 51.980  -24.022 131.397 1.00 125.18 ? 538 LEU F CA    1 
ATOM   9578  C C     . LEU E 1 538 ? 52.283  -25.161 130.426 1.00 134.62 ? 538 LEU F C     1 
ATOM   9579  O O     . LEU E 1 538 ? 52.744  -24.926 129.308 1.00 138.65 ? 538 LEU F O     1 
ATOM   9580  C CB    . LEU E 1 538 ? 53.132  -23.835 132.384 1.00 119.15 ? 538 LEU F CB    1 
ATOM   9581  C CG    . LEU E 1 538 ? 52.981  -22.639 133.326 1.00 110.71 ? 538 LEU F CG    1 
ATOM   9582  C CD1   . LEU E 1 538 ? 53.968  -22.721 134.480 1.00 106.45 ? 538 LEU F CD1   1 
ATOM   9583  C CD2   . LEU E 1 538 ? 53.150  -21.338 132.558 1.00 110.78 ? 538 LEU F CD2   1 
ATOM   9584  N N     . GLN E 1 539 ? 52.018  -26.391 130.865 1.00 136.39 ? 539 GLN F N     1 
ATOM   9585  C CA    . GLN E 1 539 ? 52.154  -27.569 130.012 1.00 136.95 ? 539 GLN F CA    1 
ATOM   9586  C C     . GLN E 1 539 ? 51.142  -27.495 128.874 1.00 132.89 ? 539 GLN F C     1 
ATOM   9587  O O     . GLN E 1 539 ? 51.436  -27.876 127.741 1.00 137.58 ? 539 GLN F O     1 
ATOM   9588  C CB    . GLN E 1 539 ? 51.931  -28.862 130.812 1.00 142.78 ? 539 GLN F CB    1 
ATOM   9589  C CG    . GLN E 1 539 ? 52.979  -29.166 131.885 1.00 149.37 ? 539 GLN F CG    1 
ATOM   9590  C CD    . GLN E 1 539 ? 52.692  -30.463 132.638 1.00 152.59 ? 539 GLN F CD    1 
ATOM   9591  O OE1   . GLN E 1 539 ? 52.129  -31.408 132.082 1.00 154.09 ? 539 GLN F OE1   1 
ATOM   9592  N NE2   . GLN E 1 539 ? 53.077  -30.509 133.911 1.00 150.77 ? 539 GLN F NE2   1 
ATOM   9593  N N     . PHE E 1 540 ? 49.948  -27.002 129.190 1.00 126.82 ? 540 PHE F N     1 
ATOM   9594  C CA    . PHE E 1 540 ? 48.873  -26.876 128.212 1.00 126.71 ? 540 PHE F CA    1 
ATOM   9595  C C     . PHE E 1 540 ? 49.251  -25.901 127.104 1.00 127.57 ? 540 PHE F C     1 
ATOM   9596  O O     . PHE E 1 540 ? 49.242  -26.252 125.924 1.00 127.18 ? 540 PHE F O     1 
ATOM   9597  C CB    . PHE E 1 540 ? 47.581  -26.414 128.895 1.00 121.32 ? 540 PHE F CB    1 
ATOM   9598  C CG    . PHE E 1 540 ? 46.409  -26.288 127.959 1.00 115.74 ? 540 PHE F CG    1 
ATOM   9599  C CD1   . PHE E 1 540 ? 45.609  -27.384 127.681 1.00 114.95 ? 540 PHE F CD1   1 
ATOM   9600  C CD2   . PHE E 1 540 ? 46.105  -25.075 127.362 1.00 114.08 ? 540 PHE F CD2   1 
ATOM   9601  C CE1   . PHE E 1 540 ? 44.531  -27.272 126.823 1.00 115.47 ? 540 PHE F CE1   1 
ATOM   9602  C CE2   . PHE E 1 540 ? 45.031  -24.959 126.501 1.00 114.02 ? 540 PHE F CE2   1 
ATOM   9603  C CZ    . PHE E 1 540 ? 44.242  -26.059 126.232 1.00 113.95 ? 540 PHE F CZ    1 
ATOM   9604  N N     . CYS E 1 541 ? 49.580  -24.675 127.496 1.00 127.78 ? 541 CYS F N     1 
ATOM   9605  C CA    . CYS E 1 541 ? 49.909  -23.619 126.547 1.00 130.05 ? 541 CYS F CA    1 
ATOM   9606  C C     . CYS E 1 541 ? 51.167  -23.947 125.750 1.00 134.53 ? 541 CYS F C     1 
ATOM   9607  O O     . CYS E 1 541 ? 51.294  -23.560 124.588 1.00 139.47 ? 541 CYS F O     1 
ATOM   9608  C CB    . CYS E 1 541 ? 50.074  -22.286 127.277 1.00 130.82 ? 541 CYS F CB    1 
ATOM   9609  S SG    . CYS E 1 541 ? 48.565  -21.665 128.060 1.00 121.90 ? 541 CYS F SG    1 
ATOM   9610  N N     . ARG E 1 542 ? 52.093  -24.662 126.382 1.00 134.65 ? 542 ARG F N     1 
ATOM   9611  C CA    . ARG E 1 542 ? 53.320  -25.099 125.722 1.00 137.09 ? 542 ARG F CA    1 
ATOM   9612  C C     . ARG E 1 542 ? 53.014  -26.009 124.539 1.00 137.14 ? 542 ARG F C     1 
ATOM   9613  O O     . ARG E 1 542 ? 53.567  -25.839 123.451 1.00 137.05 ? 542 ARG F O     1 
ATOM   9614  C CB    . ARG E 1 542 ? 54.220  -25.834 126.718 1.00 137.92 ? 542 ARG F CB    1 
ATOM   9615  C CG    . ARG E 1 542 ? 55.343  -26.646 126.091 1.00 142.39 ? 542 ARG F CG    1 
ATOM   9616  C CD    . ARG E 1 542 ? 56.535  -25.778 125.725 1.00 148.31 ? 542 ARG F CD    1 
ATOM   9617  N NE    . ARG E 1 542 ? 57.692  -26.583 125.341 1.00 152.90 ? 542 ARG F NE    1 
ATOM   9618  C CZ    . ARG E 1 542 ? 58.012  -26.887 124.087 1.00 156.23 ? 542 ARG F CZ    1 
ATOM   9619  N NH1   . ARG E 1 542 ? 57.264  -26.449 123.084 1.00 157.10 ? 542 ARG F NH1   1 
ATOM   9620  N NH2   . ARG E 1 542 ? 59.084  -27.627 123.836 1.00 158.17 ? 542 ARG F NH2   1 
ATOM   9621  N N     . GLU E 1 543 ? 52.122  -26.969 124.762 1.00 138.29 ? 543 GLU F N     1 
ATOM   9622  C CA    . GLU E 1 543 ? 51.766  -27.952 123.744 1.00 140.40 ? 543 GLU F CA    1 
ATOM   9623  C C     . GLU E 1 543 ? 51.026  -27.326 122.560 1.00 139.44 ? 543 GLU F C     1 
ATOM   9624  O O     . GLU E 1 543 ? 50.975  -27.908 121.478 1.00 141.73 ? 543 GLU F O     1 
ATOM   9625  C CB    . GLU E 1 543 ? 50.933  -29.083 124.360 1.00 140.36 ? 543 GLU F CB    1 
ATOM   9626  C CG    . GLU E 1 543 ? 51.704  -29.975 125.332 1.00 139.22 ? 543 GLU F CG    1 
ATOM   9627  C CD    . GLU E 1 543 ? 50.806  -30.940 126.092 1.00 135.79 ? 543 GLU F CD    1 
ATOM   9628  O OE1   . GLU E 1 543 ? 49.603  -30.641 126.250 1.00 132.10 ? 543 GLU F OE1   1 
ATOM   9629  O OE2   . GLU E 1 543 ? 51.304  -32.000 126.531 1.00 135.16 ? 543 GLU F OE2   1 
ATOM   9630  N N     . ARG E 1 544 ? 50.459  -26.141 122.766 1.00 135.39 ? 544 ARG F N     1 
ATOM   9631  C CA    . ARG E 1 544 ? 49.746  -25.446 121.697 1.00 133.71 ? 544 ARG F CA    1 
ATOM   9632  C C     . ARG E 1 544 ? 50.475  -24.183 121.251 1.00 132.87 ? 544 ARG F C     1 
ATOM   9633  O O     . ARG E 1 544 ? 49.866  -23.259 120.709 1.00 130.44 ? 544 ARG F O     1 
ATOM   9634  C CB    . ARG E 1 544 ? 48.308  -25.135 122.115 1.00 130.19 ? 544 ARG F CB    1 
ATOM   9635  C CG    . ARG E 1 544 ? 47.400  -26.349 122.034 1.00 130.09 ? 544 ARG F CG    1 
ATOM   9636  C CD    . ARG E 1 544 ? 46.224  -26.246 122.982 1.00 129.76 ? 544 ARG F CD    1 
ATOM   9637  N NE    . ARG E 1 544 ? 45.638  -27.559 123.235 1.00 132.45 ? 544 ARG F NE    1 
ATOM   9638  C CZ    . ARG E 1 544 ? 46.111  -28.423 124.127 1.00 136.04 ? 544 ARG F CZ    1 
ATOM   9639  N NH1   . ARG E 1 544 ? 47.178  -28.111 124.852 1.00 138.55 ? 544 ARG F NH1   1 
ATOM   9640  N NH2   . ARG E 1 544 ? 45.520  -29.598 124.297 1.00 136.02 ? 544 ARG F NH2   1 
ATOM   9641  N N     . GLU E 1 545 ? 51.784  -24.168 121.487 1.00 133.49 ? 545 GLU F N     1 
ATOM   9642  C CA    . GLU E 1 545 ? 52.665  -23.089 121.046 1.00 133.80 ? 545 GLU F CA    1 
ATOM   9643  C C     . GLU E 1 545 ? 52.188  -21.712 121.496 1.00 129.51 ? 545 GLU F C     1 
ATOM   9644  O O     . GLU E 1 545 ? 52.211  -20.752 120.723 1.00 128.58 ? 545 GLU F O     1 
ATOM   9645  C CB    . GLU E 1 545 ? 52.835  -23.128 119.526 1.00 137.52 ? 545 GLU F CB    1 
ATOM   9646  C CG    . GLU E 1 545 ? 53.348  -24.459 119.000 1.00 138.64 ? 545 GLU F CG    1 
ATOM   9647  C CD    . GLU E 1 545 ? 53.380  -24.505 117.489 1.00 141.85 ? 545 GLU F CD    1 
ATOM   9648  O OE1   . GLU E 1 545 ? 53.105  -23.462 116.860 1.00 142.17 ? 545 GLU F OE1   1 
ATOM   9649  O OE2   . GLU E 1 545 ? 53.676  -25.582 116.929 1.00 144.63 ? 545 GLU F OE2   1 
ATOM   9650  N N     . MET E 1 546 ? 51.754  -21.628 122.749 1.00 125.90 ? 546 MET F N     1 
ATOM   9651  C CA    . MET E 1 546 ? 51.295  -20.372 123.327 1.00 122.26 ? 546 MET F CA    1 
ATOM   9652  C C     . MET E 1 546 ? 52.393  -19.741 124.178 1.00 124.50 ? 546 MET F C     1 
ATOM   9653  O O     . MET E 1 546 ? 53.000  -20.411 125.014 1.00 126.13 ? 546 MET F O     1 
ATOM   9654  C CB    . MET E 1 546 ? 50.037  -20.599 124.167 1.00 116.53 ? 546 MET F CB    1 
ATOM   9655  C CG    . MET E 1 546 ? 48.839  -21.092 123.371 1.00 115.29 ? 546 MET F CG    1 
ATOM   9656  S SD    . MET E 1 546 ? 47.414  -21.456 124.412 1.00 155.67 ? 546 MET F SD    1 
ATOM   9657  C CE    . MET E 1 546 ? 46.179  -21.818 123.165 1.00 148.59 ? 546 MET F CE    1 
ATOM   9658  N N     . PRO E 1 547 ? 52.653  -18.442 123.959 1.00 123.89 ? 547 PRO F N     1 
ATOM   9659  C CA    . PRO E 1 547 ? 53.739  -17.711 124.622 1.00 124.23 ? 547 PRO F CA    1 
ATOM   9660  C C     . PRO E 1 547 ? 53.573  -17.632 126.134 1.00 125.20 ? 547 PRO F C     1 
ATOM   9661  O O     . PRO E 1 547 ? 52.954  -16.694 126.636 1.00 126.44 ? 547 PRO F O     1 
ATOM   9662  C CB    . PRO E 1 547 ? 53.631  -16.306 124.020 1.00 126.69 ? 547 PRO F CB    1 
ATOM   9663  C CG    . PRO E 1 547 ? 52.916  -16.495 122.730 1.00 129.30 ? 547 PRO F CG    1 
ATOM   9664  C CD    . PRO E 1 547 ? 51.943  -17.601 122.982 1.00 125.74 ? 547 PRO F CD    1 
ATOM   9665  N N     . VAL E 1 548 ? 54.118  -18.609 126.849 1.00 125.06 ? 548 VAL F N     1 
ATOM   9666  C CA    . VAL E 1 548 ? 54.121  -18.566 128.304 1.00 121.21 ? 548 VAL F CA    1 
ATOM   9667  C C     . VAL E 1 548 ? 55.535  -18.756 128.834 1.00 122.68 ? 548 VAL F C     1 
ATOM   9668  O O     . VAL E 1 548 ? 56.394  -19.317 128.151 1.00 126.75 ? 548 VAL F O     1 
ATOM   9669  C CB    . VAL E 1 548 ? 53.195  -19.633 128.919 1.00 117.41 ? 548 VAL F CB    1 
ATOM   9670  C CG1   . VAL E 1 548 ? 51.759  -19.387 128.505 1.00 116.50 ? 548 VAL F CG1   1 
ATOM   9671  C CG2   . VAL E 1 548 ? 53.637  -21.026 128.508 1.00 118.21 ? 548 VAL F CG2   1 
ATOM   9672  N N     . ALA E 1 549 ? 55.774  -18.279 130.050 1.00 119.84 ? 549 ALA F N     1 
ATOM   9673  C CA    . ALA E 1 549 ? 57.083  -18.418 130.673 1.00 125.65 ? 549 ALA F CA    1 
ATOM   9674  C C     . ALA E 1 549 ? 57.006  -18.223 132.181 1.00 131.53 ? 549 ALA F C     1 
ATOM   9675  O O     . ALA E 1 549 ? 56.174  -17.465 132.678 1.00 131.04 ? 549 ALA F O     1 
ATOM   9676  C CB    . ALA E 1 549 ? 58.074  -17.436 130.058 1.00 123.28 ? 549 ALA F CB    1 
ATOM   9677  N N     . VAL E 1 550 ? 57.877  -18.919 132.905 1.00 133.27 ? 550 VAL F N     1 
ATOM   9678  C CA    . VAL E 1 550 ? 57.966  -18.756 134.350 1.00 127.80 ? 550 VAL F CA    1 
ATOM   9679  C C     . VAL E 1 550 ? 59.142  -17.871 134.719 1.00 130.40 ? 550 VAL F C     1 
ATOM   9680  O O     . VAL E 1 550 ? 60.285  -18.155 134.355 1.00 130.89 ? 550 VAL F O     1 
ATOM   9681  C CB    . VAL E 1 550 ? 58.161  -20.090 135.074 1.00 120.68 ? 550 VAL F CB    1 
ATOM   9682  C CG1   . VAL E 1 550 ? 58.015  -19.887 136.577 1.00 117.33 ? 550 VAL F CG1   1 
ATOM   9683  C CG2   . VAL E 1 550 ? 57.169  -21.110 134.571 1.00 120.89 ? 550 VAL F CG2   1 
ATOM   9684  N N     . CYS E 1 551 ? 58.857  -16.806 135.457 1.00 131.61 ? 551 CYS F N     1 
ATOM   9685  C CA    . CYS E 1 551 ? 59.895  -15.887 135.893 1.00 132.80 ? 551 CYS F CA    1 
ATOM   9686  C C     . CYS E 1 551 ? 60.367  -16.194 137.306 1.00 138.19 ? 551 CYS F C     1 
ATOM   9687  O O     . CYS E 1 551 ? 59.603  -16.089 138.264 1.00 137.72 ? 551 CYS F O     1 
ATOM   9688  C CB    . CYS E 1 551 ? 59.410  -14.443 135.815 1.00 131.20 ? 551 CYS F CB    1 
ATOM   9689  S SG    . CYS E 1 551 ? 60.603  -13.249 136.445 1.00 128.87 ? 551 CYS F SG    1 
ATOM   9690  N N     . TYR E 1 552 ? 61.634  -16.572 137.429 1.00 145.89 ? 552 TYR F N     1 
ATOM   9691  C CA    . TYR E 1 552 ? 62.215  -16.846 138.733 1.00 153.58 ? 552 TYR F CA    1 
ATOM   9692  C C     . TYR E 1 552 ? 63.055  -15.664 139.197 1.00 170.72 ? 552 TYR F C     1 
ATOM   9693  O O     . TYR E 1 552 ? 63.945  -15.199 138.486 1.00 170.19 ? 552 TYR F O     1 
ATOM   9694  C CB    . TYR E 1 552 ? 63.042  -18.132 138.697 1.00 148.04 ? 552 TYR F CB    1 
ATOM   9695  C CG    . TYR E 1 552 ? 62.204  -19.374 138.486 1.00 141.28 ? 552 TYR F CG    1 
ATOM   9696  C CD1   . TYR E 1 552 ? 61.482  -19.932 139.533 1.00 136.80 ? 552 TYR F CD1   1 
ATOM   9697  C CD2   . TYR E 1 552 ? 62.132  -19.986 137.241 1.00 139.76 ? 552 TYR F CD2   1 
ATOM   9698  C CE1   . TYR E 1 552 ? 60.712  -21.064 139.348 1.00 134.92 ? 552 TYR F CE1   1 
ATOM   9699  C CE2   . TYR E 1 552 ? 61.365  -21.122 137.047 1.00 136.80 ? 552 TYR F CE2   1 
ATOM   9700  C CZ    . TYR E 1 552 ? 60.657  -21.655 138.104 1.00 134.22 ? 552 TYR F CZ    1 
ATOM   9701  O OH    . TYR E 1 552 ? 59.890  -22.784 137.920 1.00 130.74 ? 552 TYR F OH    1 
ATOM   9702  N N     . VAL E 1 553 ? 62.755  -15.179 140.396 1.00 190.00 ? 553 VAL F N     1 
ATOM   9703  C CA    . VAL E 1 553 ? 63.396  -13.986 140.928 1.00 105.68 ? 553 VAL F CA    1 
ATOM   9704  C C     . VAL E 1 553 ? 64.278  -14.310 142.131 1.00 113.62 ? 553 VAL F C     1 
ATOM   9705  O O     . VAL E 1 553 ? 63.894  -15.089 143.004 1.00 118.63 ? 553 VAL F O     1 
ATOM   9706  C CB    . VAL E 1 553 ? 62.344  -12.930 141.326 1.00 119.69 ? 553 VAL F CB    1 
ATOM   9707  C CG1   . VAL E 1 553 ? 62.905  -11.972 142.361 1.00 122.13 ? 553 VAL F CG1   1 
ATOM   9708  C CG2   . VAL E 1 553 ? 61.842  -12.182 140.093 1.00 123.82 ? 553 VAL F CG2   1 
ATOM   9709  P P     . DA  F 2 1   ? 31.414  -19.425 143.719 1.00 206.24 ? -2  DA  G P     1 
ATOM   9710  O OP1   . DA  F 2 1   ? 30.817  -19.867 145.002 1.00 209.07 ? -2  DA  G OP1   1 
ATOM   9711  O OP2   . DA  F 2 1   ? 32.825  -18.983 143.684 1.00 201.08 ? -2  DA  G OP2   1 
ATOM   9712  O "O5'" . DA  F 2 1   ? 31.238  -20.565 142.607 1.00 176.82 ? -2  DA  G "O5'" 1 
ATOM   9713  C "C5'" . DA  F 2 1   ? 29.992  -20.745 141.937 1.00 180.07 ? -2  DA  G "C5'" 1 
ATOM   9714  C "C4'" . DA  F 2 1   ? 28.974  -21.324 142.903 1.00 187.37 ? -2  DA  G "C4'" 1 
ATOM   9715  O "O4'" . DA  F 2 1   ? 28.119  -20.263 143.411 1.00 192.01 ? -2  DA  G "O4'" 1 
ATOM   9716  C "C3'" . DA  F 2 1   ? 28.026  -22.385 142.347 1.00 192.97 ? -2  DA  G "C3'" 1 
ATOM   9717  O "O3'" . DA  F 2 1   ? 27.822  -23.354 143.367 1.00 197.39 ? -2  DA  G "O3'" 1 
ATOM   9718  C "C2'" . DA  F 2 1   ? 26.753  -21.577 142.122 1.00 196.94 ? -2  DA  G "C2'" 1 
ATOM   9719  C "C1'" . DA  F 2 1   ? 26.806  -20.783 143.418 1.00 198.96 ? -2  DA  G "C1'" 1 
ATOM   9720  N N9    . DA  F 2 1   ? 25.823  -19.711 143.568 1.00 203.21 ? -2  DA  G N9    1 
ATOM   9721  C C8    . DA  F 2 1   ? 26.051  -18.363 143.534 1.00 202.15 ? -2  DA  G C8    1 
ATOM   9722  N N7    . DA  F 2 1   ? 24.969  -17.640 143.709 1.00 204.06 ? -2  DA  G N7    1 
ATOM   9723  C C5    . DA  F 2 1   ? 23.963  -18.578 143.872 1.00 207.85 ? -2  DA  G C5    1 
ATOM   9724  C C6    . DA  F 2 1   ? 22.577  -18.458 144.097 1.00 215.02 ? -2  DA  G C6    1 
ATOM   9725  N N6    . DA  F 2 1   ? 21.946  -17.285 144.200 1.00 218.64 ? -2  DA  G N6    1 
ATOM   9726  N N1    . DA  F 2 1   ? 21.857  -19.592 144.215 1.00 218.42 ? -2  DA  G N1    1 
ATOM   9727  C C2    . DA  F 2 1   ? 22.488  -20.766 144.111 1.00 216.21 ? -2  DA  G C2    1 
ATOM   9728  N N3    . DA  F 2 1   ? 23.782  -21.007 143.903 1.00 210.57 ? -2  DA  G N3    1 
ATOM   9729  C C4    . DA  F 2 1   ? 24.472  -19.860 143.790 1.00 206.79 ? -2  DA  G C4    1 
ATOM   9730  P P     . DC  F 2 2   ? 27.533  -24.892 142.999 1.00 292.59 ? -1  DC  G P     1 
ATOM   9731  O OP1   . DC  F 2 2   ? 28.787  -25.642 143.220 1.00 289.77 ? -1  DC  G OP1   1 
ATOM   9732  O OP2   . DC  F 2 2   ? 26.865  -24.941 141.679 1.00 292.79 ? -1  DC  G OP2   1 
ATOM   9733  O "O5'" . DC  F 2 2   ? 26.481  -25.360 144.111 1.00 231.94 ? -1  DC  G "O5'" 1 
ATOM   9734  C "C5'" . DC  F 2 2   ? 26.928  -25.838 145.383 1.00 233.43 ? -1  DC  G "C5'" 1 
ATOM   9735  C "C4'" . DC  F 2 2   ? 27.277  -24.715 146.349 1.00 233.83 ? -1  DC  G "C4'" 1 
ATOM   9736  O "O4'" . DC  F 2 2   ? 26.318  -23.637 146.234 1.00 235.46 ? -1  DC  G "O4'" 1 
ATOM   9737  C "C3'" . DC  F 2 2   ? 27.282  -25.122 147.822 1.00 237.32 ? -1  DC  G "C3'" 1 
ATOM   9738  O "O3'" . DC  F 2 2   ? 28.265  -24.398 148.587 1.00 235.02 ? -1  DC  G "O3'" 1 
ATOM   9739  C "C2'" . DC  F 2 2   ? 25.855  -24.783 148.264 1.00 241.84 ? -1  DC  G "C2'" 1 
ATOM   9740  C "C1'" . DC  F 2 2   ? 25.388  -23.692 147.297 1.00 240.79 ? -1  DC  G "C1'" 1 
ATOM   9741  N N1    . DC  F 2 2   ? 24.030  -23.925 146.703 1.00 246.35 ? -1  DC  G N1    1 
ATOM   9742  C C2    . DC  F 2 2   ? 23.095  -22.883 146.653 1.00 248.90 ? -1  DC  G C2    1 
ATOM   9743  O O2    . DC  F 2 2   ? 23.403  -21.774 147.103 1.00 249.22 ? -1  DC  G O2    1 
ATOM   9744  N N3    . DC  F 2 2   ? 21.875  -23.119 146.109 1.00 251.30 ? -1  DC  G N3    1 
ATOM   9745  C C4    . DC  F 2 2   ? 21.578  -24.327 145.630 1.00 253.45 ? -1  DC  G C4    1 
ATOM   9746  N N4    . DC  F 2 2   ? 20.365  -24.513 145.104 1.00 259.04 ? -1  DC  G N4    1 
ATOM   9747  C C5    . DC  F 2 2   ? 22.512  -25.401 145.670 1.00 251.41 ? -1  DC  G C5    1 
ATOM   9748  C C6    . DC  F 2 2   ? 23.709  -25.156 146.210 1.00 248.23 ? -1  DC  G C6    1 
ATOM   9749  P P     . DC  F 2 3   ? 29.829  -24.782 148.507 1.00 223.04 ? 0   DC  G P     1 
ATOM   9750  O OP1   . DC  F 2 3   ? 30.596  -23.533 148.713 1.00 220.57 ? 0   DC  G OP1   1 
ATOM   9751  O OP2   . DC  F 2 3   ? 30.067  -25.574 147.282 1.00 220.89 ? 0   DC  G OP2   1 
ATOM   9752  O "O5'" . DC  F 2 3   ? 30.070  -25.787 149.735 1.00 179.20 ? 0   DC  G "O5'" 1 
ATOM   9753  C "C5'" . DC  F 2 3   ? 29.666  -25.521 151.076 1.00 183.08 ? 0   DC  G "C5'" 1 
ATOM   9754  C "C4'" . DC  F 2 3   ? 30.426  -24.366 151.707 1.00 182.28 ? 0   DC  G "C4'" 1 
ATOM   9755  O "O4'" . DC  F 2 3   ? 29.472  -23.313 151.987 1.00 184.33 ? 0   DC  G "O4'" 1 
ATOM   9756  C "C3'" . DC  F 2 3   ? 31.049  -24.637 153.069 1.00 182.95 ? 0   DC  G "C3'" 1 
ATOM   9757  O "O3'" . DC  F 2 3   ? 31.908  -23.562 153.440 1.00 180.57 ? 0   DC  G "O3'" 1 
ATOM   9758  C "C2'" . DC  F 2 3   ? 29.792  -24.620 153.924 1.00 187.29 ? 0   DC  G "C2'" 1 
ATOM   9759  C "C1'" . DC  F 2 3   ? 29.097  -23.390 153.350 1.00 185.03 ? 0   DC  G "C1'" 1 
ATOM   9760  N N1    . DC  F 2 3   ? 27.630  -23.516 153.424 1.00 183.73 ? 0   DC  G N1    1 
ATOM   9761  C C2    . DC  F 2 3   ? 26.977  -23.207 154.619 1.00 185.78 ? 0   DC  G C2    1 
ATOM   9762  O O2    . DC  F 2 3   ? 27.644  -22.824 155.588 1.00 183.09 ? 0   DC  G O2    1 
ATOM   9763  N N3    . DC  F 2 3   ? 25.630  -23.334 154.673 1.00 191.57 ? 0   DC  G N3    1 
ATOM   9764  C C4    . DC  F 2 3   ? 24.962  -23.751 153.596 1.00 191.88 ? 0   DC  G C4    1 
ATOM   9765  N N4    . DC  F 2 3   ? 23.637  -23.867 153.683 1.00 198.25 ? 0   DC  G N4    1 
ATOM   9766  C C5    . DC  F 2 3   ? 25.615  -24.072 152.372 1.00 186.03 ? 0   DC  G C5    1 
ATOM   9767  C C6    . DC  F 2 3   ? 26.939  -23.942 152.331 1.00 181.85 ? 0   DC  G C6    1 
ATOM   9768  P P     . DA  F 2 4   ? 32.956  -23.728 154.652 1.00 181.49 ? 1   DA  G P     1 
ATOM   9769  O OP1   . DA  F 2 4   ? 32.332  -24.567 155.697 1.00 186.87 ? 1   DA  G OP1   1 
ATOM   9770  O OP2   . DA  F 2 4   ? 33.450  -22.376 154.997 1.00 179.31 ? 1   DA  G OP2   1 
ATOM   9771  O "O5'" . DA  F 2 4   ? 34.179  -24.545 154.017 1.00 200.83 ? 1   DA  G "O5'" 1 
ATOM   9772  C "C5'" . DA  F 2 4   ? 35.131  -23.898 153.178 1.00 196.09 ? 1   DA  G "C5'" 1 
ATOM   9773  C "C4'" . DA  F 2 4   ? 34.495  -23.580 151.838 1.00 194.58 ? 1   DA  G "C4'" 1 
ATOM   9774  O "O4'" . DA  F 2 4   ? 34.076  -22.193 151.819 1.00 194.56 ? 1   DA  G "O4'" 1 
ATOM   9775  C "C3'" . DA  F 2 4   ? 35.363  -23.824 150.613 1.00 190.39 ? 1   DA  G "C3'" 1 
ATOM   9776  O "O3'" . DA  F 2 4   ? 34.701  -24.809 149.820 1.00 191.88 ? 1   DA  G "O3'" 1 
ATOM   9777  C "C2'" . DA  F 2 4   ? 35.464  -22.472 149.903 1.00 188.69 ? 1   DA  G "C2'" 1 
ATOM   9778  C "C1'" . DA  F 2 4   ? 34.742  -21.472 150.805 1.00 190.28 ? 1   DA  G "C1'" 1 
ATOM   9779  N N9    . DA  F 2 4   ? 35.610  -20.493 151.458 1.00 186.98 ? 1   DA  G N9    1 
ATOM   9780  C C8    . DA  F 2 4   ? 36.525  -20.729 152.447 1.00 184.47 ? 1   DA  G C8    1 
ATOM   9781  N N7    . DA  F 2 4   ? 37.157  -19.652 152.852 1.00 182.83 ? 1   DA  G N7    1 
ATOM   9782  C C5    . DA  F 2 4   ? 36.616  -18.639 152.078 1.00 184.21 ? 1   DA  G C5    1 
ATOM   9783  C C6    . DA  F 2 4   ? 36.860  -17.252 152.021 1.00 185.42 ? 1   DA  G C6    1 
ATOM   9784  N N6    . DA  F 2 4   ? 37.756  -16.631 152.795 1.00 186.83 ? 1   DA  G N6    1 
ATOM   9785  N N1    . DA  F 2 4   ? 36.147  -16.526 151.136 1.00 186.02 ? 1   DA  G N1    1 
ATOM   9786  C C2    . DA  F 2 4   ? 35.251  -17.149 150.363 1.00 186.11 ? 1   DA  G C2    1 
ATOM   9787  N N3    . DA  F 2 4   ? 34.934  -18.443 150.326 1.00 186.09 ? 1   DA  G N3    1 
ATOM   9788  C C4    . DA  F 2 4   ? 35.659  -19.139 151.216 1.00 185.85 ? 1   DA  G C4    1 
ATOM   9789  P P     . DG  F 2 5   ? 35.310  -25.263 148.405 1.00 239.94 ? 2   DG  G P     1 
ATOM   9790  O OP1   . DG  F 2 5   ? 34.722  -24.371 147.380 1.00 239.04 ? 2   DG  G OP1   1 
ATOM   9791  O OP2   . DG  F 2 5   ? 35.130  -26.725 148.276 1.00 241.93 ? 2   DG  G OP2   1 
ATOM   9792  O "O5'" . DG  F 2 5   ? 36.880  -24.997 148.560 1.00 144.05 ? 2   DG  G "O5'" 1 
ATOM   9793  C "C5'" . DG  F 2 5   ? 37.757  -25.128 147.451 1.00 145.33 ? 2   DG  G "C5'" 1 
ATOM   9794  C "C4'" . DG  F 2 5   ? 37.660  -23.901 146.565 1.00 149.38 ? 2   DG  G "C4'" 1 
ATOM   9795  O "O4'" . DG  F 2 5   ? 37.481  -22.727 147.402 1.00 149.54 ? 2   DG  G "O4'" 1 
ATOM   9796  C "C3'" . DG  F 2 5   ? 38.902  -23.602 145.746 1.00 150.64 ? 2   DG  G "C3'" 1 
ATOM   9797  O "O3'" . DG  F 2 5   ? 38.562  -22.730 144.666 1.00 152.29 ? 2   DG  G "O3'" 1 
ATOM   9798  C "C2'" . DG  F 2 5   ? 39.713  -22.878 146.812 1.00 149.28 ? 2   DG  G "C2'" 1 
ATOM   9799  C "C1'" . DG  F 2 5   ? 38.638  -21.920 147.305 1.00 148.33 ? 2   DG  G "C1'" 1 
ATOM   9800  N N9    . DG  F 2 5   ? 38.931  -21.313 148.602 1.00 148.05 ? 2   DG  G N9    1 
ATOM   9801  C C8    . DG  F 2 5   ? 38.970  -21.946 149.821 1.00 147.52 ? 2   DG  G C8    1 
ATOM   9802  N N7    . DG  F 2 5   ? 39.262  -21.150 150.811 1.00 148.17 ? 2   DG  G N7    1 
ATOM   9803  C C5    . DG  F 2 5   ? 39.428  -19.907 150.212 1.00 149.84 ? 2   DG  G C5    1 
ATOM   9804  C C6    . DG  F 2 5   ? 39.754  -18.655 150.787 1.00 149.59 ? 2   DG  G C6    1 
ATOM   9805  O O6    . DG  F 2 5   ? 39.966  -18.388 151.978 1.00 149.05 ? 2   DG  G O6    1 
ATOM   9806  N N1    . DG  F 2 5   ? 39.824  -17.648 149.826 1.00 149.11 ? 2   DG  G N1    1 
ATOM   9807  C C2    . DG  F 2 5   ? 39.607  -17.829 148.480 1.00 147.62 ? 2   DG  G C2    1 
ATOM   9808  N N2    . DG  F 2 5   ? 39.720  -16.736 147.710 1.00 145.09 ? 2   DG  G N2    1 
ATOM   9809  N N3    . DG  F 2 5   ? 39.302  -18.998 147.929 1.00 148.59 ? 2   DG  G N3    1 
ATOM   9810  C C4    . DG  F 2 5   ? 39.228  -19.990 148.852 1.00 149.60 ? 2   DG  G C4    1 
ATOM   9811  P P     . DA  F 2 6   ? 39.195  -22.954 143.205 1.00 173.77 ? 3   DA  G P     1 
ATOM   9812  O OP1   . DA  F 2 6   ? 38.089  -22.884 142.223 1.00 175.53 ? 3   DA  G OP1   1 
ATOM   9813  O OP2   . DA  F 2 6   ? 40.049  -24.160 143.273 1.00 169.99 ? 3   DA  G OP2   1 
ATOM   9814  O "O5'" . DA  F 2 6   ? 40.149  -21.683 142.999 1.00 111.40 ? 3   DA  G "O5'" 1 
ATOM   9815  C "C5'" . DA  F 2 6   ? 40.910  -21.229 144.114 1.00 113.25 ? 3   DA  G "C5'" 1 
ATOM   9816  C "C4'" . DA  F 2 6   ? 41.853  -20.084 143.815 1.00 110.92 ? 3   DA  G "C4'" 1 
ATOM   9817  O "O4'" . DA  F 2 6   ? 41.935  -19.246 144.995 1.00 111.56 ? 3   DA  G "O4'" 1 
ATOM   9818  C "C3'" . DA  F 2 6   ? 43.274  -20.530 143.505 1.00 110.49 ? 3   DA  G "C3'" 1 
ATOM   9819  O "O3'" . DA  F 2 6   ? 43.856  -19.706 142.507 1.00 105.81 ? 3   DA  G "O3'" 1 
ATOM   9820  C "C2'" . DA  F 2 6   ? 44.006  -20.403 144.838 1.00 113.65 ? 3   DA  G "C2'" 1 
ATOM   9821  C "C1'" . DA  F 2 6   ? 43.191  -19.386 145.633 1.00 116.25 ? 3   DA  G "C1'" 1 
ATOM   9822  N N9    . DA  F 2 6   ? 43.006  -19.794 147.028 1.00 121.30 ? 3   DA  G N9    1 
ATOM   9823  C C8    . DA  F 2 6   ? 42.593  -21.016 147.483 1.00 117.35 ? 3   DA  G C8    1 
ATOM   9824  N N7    . DA  F 2 6   ? 42.523  -21.105 148.791 1.00 121.31 ? 3   DA  G N7    1 
ATOM   9825  C C5    . DA  F 2 6   ? 42.923  -19.854 149.230 1.00 127.96 ? 3   DA  G C5    1 
ATOM   9826  C C6    . DA  F 2 6   ? 43.067  -19.298 150.519 1.00 131.00 ? 3   DA  G C6    1 
ATOM   9827  N N6    . DA  F 2 6   ? 42.811  -19.972 151.644 1.00 132.52 ? 3   DA  G N6    1 
ATOM   9828  N N1    . DA  F 2 6   ? 43.487  -18.019 150.605 1.00 131.65 ? 3   DA  G N1    1 
ATOM   9829  C C2    . DA  F 2 6   ? 43.744  -17.347 149.476 1.00 128.95 ? 3   DA  G C2    1 
ATOM   9830  N N3    . DA  F 2 6   ? 43.646  -17.761 148.213 1.00 127.47 ? 3   DA  G N3    1 
ATOM   9831  C C4    . DA  F 2 6   ? 43.226  -19.035 148.157 1.00 128.04 ? 3   DA  G C4    1 
ATOM   9832  P P     . DC  F 2 7   ? 45.228  -20.154 141.800 1.00 110.55 ? 4   DC  G P     1 
ATOM   9833  O OP1   . DC  F 2 7   ? 45.260  -19.550 140.451 1.00 111.48 ? 4   DC  G OP1   1 
ATOM   9834  O OP2   . DC  F 2 7   ? 45.347  -21.622 141.943 1.00 106.75 ? 4   DC  G OP2   1 
ATOM   9835  O "O5'" . DC  F 2 7   ? 46.356  -19.469 142.700 1.00 105.55 ? 4   DC  G "O5'" 1 
ATOM   9836  C "C5'" . DC  F 2 7   ? 46.362  -18.054 142.794 1.00 111.17 ? 4   DC  G "C5'" 1 
ATOM   9837  C "C4'" . DC  F 2 7   ? 47.099  -17.569 144.026 1.00 116.23 ? 4   DC  G "C4'" 1 
ATOM   9838  O "O4'" . DC  F 2 7   ? 46.476  -18.126 145.201 1.00 119.69 ? 4   DC  G "O4'" 1 
ATOM   9839  C "C3'" . DC  F 2 7   ? 48.556  -18.002 144.129 1.00 116.91 ? 4   DC  G "C3'" 1 
ATOM   9840  O "O3'" . DC  F 2 7   ? 49.392  -16.974 143.607 1.00 115.56 ? 4   DC  G "O3'" 1 
ATOM   9841  C "C2'" . DC  F 2 7   ? 48.777  -18.225 145.629 1.00 122.25 ? 4   DC  G "C2'" 1 
ATOM   9842  C "C1'" . DC  F 2 7   ? 47.402  -17.984 146.253 1.00 124.34 ? 4   DC  G "C1'" 1 
ATOM   9843  N N1    . DC  F 2 7   ? 47.010  -18.935 147.335 1.00 126.88 ? 4   DC  G N1    1 
ATOM   9844  C C2    . DC  F 2 7   ? 46.921  -18.485 148.657 1.00 131.20 ? 4   DC  G C2    1 
ATOM   9845  O O2    . DC  F 2 7   ? 47.177  -17.302 148.912 1.00 135.55 ? 4   DC  G O2    1 
ATOM   9846  N N3    . DC  F 2 7   ? 46.557  -19.359 149.627 1.00 130.51 ? 4   DC  G N3    1 
ATOM   9847  C C4    . DC  F 2 7   ? 46.288  -20.627 149.313 1.00 129.67 ? 4   DC  G C4    1 
ATOM   9848  N N4    . DC  F 2 7   ? 45.933  -21.457 150.299 1.00 131.34 ? 4   DC  G N4    1 
ATOM   9849  C C5    . DC  F 2 7   ? 46.369  -21.103 147.972 1.00 129.01 ? 4   DC  G C5    1 
ATOM   9850  C C6    . DC  F 2 7   ? 46.730  -20.232 147.024 1.00 126.32 ? 4   DC  G C6    1 
ATOM   9851  P P     . DA  F 2 8   ? 50.954  -17.251 143.351 1.00 133.89 ? 5   DA  G P     1 
ATOM   9852  O OP1   . DA  F 2 8   ? 51.387  -16.387 142.232 1.00 128.25 ? 5   DA  G OP1   1 
ATOM   9853  O OP2   . DA  F 2 8   ? 51.150  -18.716 143.278 1.00 135.80 ? 5   DA  G OP2   1 
ATOM   9854  O "O5'" . DA  F 2 8   ? 51.651  -16.727 144.687 1.00 126.00 ? 5   DA  G "O5'" 1 
ATOM   9855  C "C5'" . DA  F 2 8   ? 51.305  -15.430 145.157 1.00 130.88 ? 5   DA  G "C5'" 1 
ATOM   9856  C "C4'" . DA  F 2 8   ? 51.796  -15.214 146.575 1.00 133.26 ? 5   DA  G "C4'" 1 
ATOM   9857  O "O4'" . DA  F 2 8   ? 51.119  -16.124 147.480 1.00 133.40 ? 5   DA  G "O4'" 1 
ATOM   9858  C "C3'" . DA  F 2 8   ? 53.287  -15.452 146.767 1.00 132.66 ? 5   DA  G "C3'" 1 
ATOM   9859  O "O3'" . DA  F 2 8   ? 53.798  -14.453 147.630 1.00 133.15 ? 5   DA  G "O3'" 1 
ATOM   9860  C "C2'" . DA  F 2 8   ? 53.353  -16.840 147.400 1.00 130.99 ? 5   DA  G "C2'" 1 
ATOM   9861  C "C1'" . DA  F 2 8   ? 52.064  -16.878 148.212 1.00 133.09 ? 5   DA  G "C1'" 1 
ATOM   9862  N N9    . DA  F 2 8   ? 51.517  -18.221 148.398 1.00 135.47 ? 5   DA  G N9    1 
ATOM   9863  C C8    . DA  F 2 8   ? 51.507  -19.244 147.491 1.00 136.98 ? 5   DA  G C8    1 
ATOM   9864  N N7    . DA  F 2 8   ? 50.940  -20.343 147.933 1.00 138.20 ? 5   DA  G N7    1 
ATOM   9865  C C5    . DA  F 2 8   ? 50.546  -20.017 149.220 1.00 139.29 ? 5   DA  G C5    1 
ATOM   9866  C C6    . DA  F 2 8   ? 49.886  -20.751 150.227 1.00 139.57 ? 5   DA  G C6    1 
ATOM   9867  N N6    . DA  F 2 8   ? 49.493  -22.020 150.079 1.00 137.41 ? 5   DA  G N6    1 
ATOM   9868  N N1    . DA  F 2 8   ? 49.646  -20.127 151.399 1.00 141.29 ? 5   DA  G N1    1 
ATOM   9869  C C2    . DA  F 2 8   ? 50.042  -18.857 151.547 1.00 141.67 ? 5   DA  G C2    1 
ATOM   9870  N N3    . DA  F 2 8   ? 50.669  -18.067 150.676 1.00 140.43 ? 5   DA  G N3    1 
ATOM   9871  C C4    . DA  F 2 8   ? 50.894  -18.713 149.522 1.00 138.17 ? 5   DA  G C4    1 
ATOM   9872  P P     . DC  F 2 9   ? 55.383  -14.275 147.800 1.00 162.69 ? 6   DC  G P     1 
ATOM   9873  O OP1   . DC  F 2 9   ? 55.651  -12.838 148.037 1.00 164.88 ? 6   DC  G OP1   1 
ATOM   9874  O OP2   . DC  F 2 9   ? 56.020  -14.963 146.654 1.00 162.92 ? 6   DC  G OP2   1 
ATOM   9875  O "O5'" . DC  F 2 9   ? 55.715  -15.099 149.132 1.00 121.92 ? 6   DC  G "O5'" 1 
ATOM   9876  C "C5'" . DC  F 2 9   ? 55.191  -14.644 150.374 1.00 137.30 ? 6   DC  G "C5'" 1 
ATOM   9877  C "C4'" . DC  F 2 9   ? 55.196  -15.727 151.440 1.00 136.30 ? 6   DC  G "C4'" 1 
ATOM   9878  O "O4'" . DC  F 2 9   ? 54.341  -16.825 151.040 1.00 135.13 ? 6   DC  G "O4'" 1 
ATOM   9879  C "C3'" . DC  F 2 9   ? 56.553  -16.352 151.768 1.00 139.87 ? 6   DC  G "C3'" 1 
ATOM   9880  O "O3'" . DC  F 2 9   ? 56.977  -15.853 153.037 1.00 144.76 ? 6   DC  G "O3'" 1 
ATOM   9881  C "C2'" . DC  F 2 9   ? 56.267  -17.855 151.800 1.00 138.25 ? 6   DC  G "C2'" 1 
ATOM   9882  C "C1'" . DC  F 2 9   ? 54.746  -17.923 151.819 1.00 137.44 ? 6   DC  G "C1'" 1 
ATOM   9883  N N1    . DC  F 2 9   ? 54.217  -19.178 151.233 1.00 140.32 ? 6   DC  G N1    1 
ATOM   9884  C C2    . DC  F 2 9   ? 53.501  -20.055 152.049 1.00 140.94 ? 6   DC  G C2    1 
ATOM   9885  O O2    . DC  F 2 9   ? 53.322  -19.756 153.236 1.00 142.47 ? 6   DC  G O2    1 
ATOM   9886  N N3    . DC  F 2 9   ? 53.022  -21.205 151.513 1.00 139.99 ? 6   DC  G N3    1 
ATOM   9887  C C4    . DC  F 2 9   ? 53.241  -21.485 150.227 1.00 138.85 ? 6   DC  G C4    1 
ATOM   9888  N N4    . DC  F 2 9   ? 52.746  -22.632 149.749 1.00 137.45 ? 6   DC  G N4    1 
ATOM   9889  C C5    . DC  F 2 9   ? 53.972  -20.601 149.379 1.00 140.73 ? 6   DC  G C5    1 
ATOM   9890  C C6    . DC  F 2 9   ? 54.439  -19.470 149.919 1.00 142.97 ? 6   DC  G C6    1 
ATOM   9891  P P     . DA  F 2 10  ? 58.432  -16.201 153.632 1.00 149.82 ? 7   DA  G P     1 
ATOM   9892  O OP1   . DA  F 2 10  ? 59.152  -14.920 153.800 1.00 153.76 ? 7   DA  G OP1   1 
ATOM   9893  O OP2   . DA  F 2 10  ? 59.056  -17.294 152.853 1.00 140.84 ? 7   DA  G OP2   1 
ATOM   9894  O "O5'" . DA  F 2 10  ? 58.105  -16.788 155.079 1.00 161.88 ? 7   DA  G "O5'" 1 
ATOM   9895  C "C5'" . DA  F 2 10  ? 56.857  -17.431 155.284 1.00 157.32 ? 7   DA  G "C5'" 1 
ATOM   9896  C "C4'" . DA  F 2 10  ? 57.056  -18.749 156.002 1.00 158.67 ? 7   DA  G "C4'" 1 
ATOM   9897  O "O4'" . DA  F 2 10  ? 56.356  -19.803 155.288 1.00 159.64 ? 7   DA  G "O4'" 1 
ATOM   9898  C "C3'" . DA  F 2 10  ? 58.506  -19.204 156.090 1.00 161.15 ? 7   DA  G "C3'" 1 
ATOM   9899  O "O3'" . DA  F 2 10  ? 58.673  -19.924 157.295 1.00 161.54 ? 7   DA  G "O3'" 1 
ATOM   9900  C "C2'" . DA  F 2 10  ? 58.619  -20.130 154.886 1.00 161.68 ? 7   DA  G "C2'" 1 
ATOM   9901  C "C1'" . DA  F 2 10  ? 57.276  -20.838 155.005 1.00 161.49 ? 7   DA  G "C1'" 1 
ATOM   9902  N N9    . DA  F 2 10  ? 56.875  -21.553 153.797 1.00 161.79 ? 7   DA  G N9    1 
ATOM   9903  C C8    . DA  F 2 10  ? 57.235  -21.276 152.507 1.00 162.56 ? 7   DA  G C8    1 
ATOM   9904  N N7    . DA  F 2 10  ? 56.719  -22.102 151.627 1.00 159.42 ? 7   DA  G N7    1 
ATOM   9905  C C5    . DA  F 2 10  ? 55.970  -22.981 152.392 1.00 158.29 ? 7   DA  G C5    1 
ATOM   9906  C C6    . DA  F 2 10  ? 55.173  -24.094 152.059 1.00 158.86 ? 7   DA  G C6    1 
ATOM   9907  N N6    . DA  F 2 10  ? 54.995  -24.526 150.806 1.00 159.16 ? 7   DA  G N6    1 
ATOM   9908  N N1    . DA  F 2 10  ? 54.565  -24.749 153.071 1.00 159.04 ? 7   DA  G N1    1 
ATOM   9909  C C2    . DA  F 2 10  ? 54.744  -24.315 154.325 1.00 158.63 ? 7   DA  G C2    1 
ATOM   9910  N N3    . DA  F 2 10  ? 55.466  -23.285 154.759 1.00 158.16 ? 7   DA  G N3    1 
ATOM   9911  C C4    . DA  F 2 10  ? 56.058  -22.656 153.733 1.00 158.65 ? 7   DA  G C4    1 
ATOM   9912  P P     . DC  F 2 11  ? 60.031  -19.794 158.142 1.00 176.31 ? 8   DC  G P     1 
ATOM   9913  O OP1   . DC  F 2 11  ? 59.777  -18.849 159.252 1.00 179.40 ? 8   DC  G OP1   1 
ATOM   9914  O OP2   . DC  F 2 11  ? 61.139  -19.534 157.197 1.00 175.94 ? 8   DC  G OP2   1 
ATOM   9915  O "O5'" . DC  F 2 11  ? 60.237  -21.261 158.745 1.00 168.16 ? 8   DC  G "O5'" 1 
ATOM   9916  C "C5'" . DC  F 2 11  ? 59.214  -21.847 159.541 1.00 167.78 ? 8   DC  G "C5'" 1 
ATOM   9917  C "C4'" . DC  F 2 11  ? 59.070  -23.331 159.244 1.00 166.76 ? 8   DC  G "C4'" 1 
ATOM   9918  O "O4'" . DC  F 2 11  ? 58.563  -23.528 157.895 1.00 164.76 ? 8   DC  G "O4'" 1 
ATOM   9919  C "C3'" . DC  F 2 11  ? 60.359  -24.150 159.325 1.00 166.84 ? 8   DC  G "C3'" 1 
ATOM   9920  O "O3'" . DC  F 2 11  ? 60.115  -25.350 160.052 1.00 167.05 ? 8   DC  G "O3'" 1 
ATOM   9921  C "C2'" . DC  F 2 11  ? 60.654  -24.457 157.860 1.00 163.90 ? 8   DC  G "C2'" 1 
ATOM   9922  C "C1'" . DC  F 2 11  ? 59.226  -24.662 157.380 1.00 162.07 ? 8   DC  G "C1'" 1 
ATOM   9923  N N1    . DC  F 2 11  ? 59.063  -24.758 155.897 1.00 157.14 ? 8   DC  G N1    1 
ATOM   9924  C C2    . DC  F 2 11  ? 58.527  -25.927 155.343 1.00 153.18 ? 8   DC  G C2    1 
ATOM   9925  O O2    . DC  F 2 11  ? 58.192  -26.855 156.091 1.00 151.55 ? 8   DC  G O2    1 
ATOM   9926  N N3    . DC  F 2 11  ? 58.384  -26.010 153.997 1.00 150.44 ? 8   DC  G N3    1 
ATOM   9927  C C4    . DC  F 2 11  ? 58.752  -24.990 153.220 1.00 149.50 ? 8   DC  G C4    1 
ATOM   9928  N N4    . DC  F 2 11  ? 58.591  -25.121 151.899 1.00 147.18 ? 8   DC  G N4    1 
ATOM   9929  C C5    . DC  F 2 11  ? 59.303  -23.792 153.765 1.00 153.00 ? 8   DC  G C5    1 
ATOM   9930  C C6    . DC  F 2 11  ? 59.440  -23.721 155.094 1.00 156.14 ? 8   DC  G C6    1 
ATOM   9931  P P     . DA  F 2 12  ? 61.341  -26.214 160.634 1.00 162.59 ? 9   DA  G P     1 
ATOM   9932  O OP1   . DA  F 2 12  ? 62.052  -25.358 161.609 1.00 168.18 ? 9   DA  G OP1   1 
ATOM   9933  O OP2   . DA  F 2 12  ? 62.079  -26.800 159.493 1.00 159.48 ? 9   DA  G OP2   1 
ATOM   9934  O "O5'" . DA  F 2 12  ? 60.627  -27.412 161.421 1.00 173.56 ? 9   DA  G "O5'" 1 
ATOM   9935  C "C5'" . DA  F 2 12  ? 61.002  -28.768 161.178 1.00 173.70 ? 9   DA  G "C5'" 1 
ATOM   9936  C "C4'" . DA  F 2 12  ? 59.958  -29.481 160.334 1.00 170.55 ? 9   DA  G "C4'" 1 
ATOM   9937  O "O4'" . DA  F 2 12  ? 59.735  -28.724 159.122 1.00 168.61 ? 9   DA  G "O4'" 1 
ATOM   9938  C "C3'" . DA  F 2 12  ? 60.337  -30.887 159.882 1.00 169.43 ? 9   DA  G "C3'" 1 
ATOM   9939  O "O3'" . DA  F 2 12  ? 59.742  -31.853 160.745 1.00 169.70 ? 9   DA  G "O3'" 1 
ATOM   9940  C "C2'" . DA  F 2 12  ? 59.766  -31.012 158.471 1.00 167.71 ? 9   DA  G "C2'" 1 
ATOM   9941  C "C1'" . DA  F 2 12  ? 59.356  -29.595 158.078 1.00 167.28 ? 9   DA  G "C1'" 1 
ATOM   9942  N N9    . DA  F 2 12  ? 59.978  -29.127 156.842 1.00 167.28 ? 9   DA  G N9    1 
ATOM   9943  C C8    . DA  F 2 12  ? 60.941  -28.166 156.719 1.00 168.81 ? 9   DA  G C8    1 
ATOM   9944  N N7    . DA  F 2 12  ? 61.313  -27.947 155.480 1.00 168.15 ? 9   DA  G N7    1 
ATOM   9945  C C5    . DA  F 2 12  ? 60.541  -28.826 154.740 1.00 165.97 ? 9   DA  G C5    1 
ATOM   9946  C C6    . DA  F 2 12  ? 60.458  -29.088 153.358 1.00 164.72 ? 9   DA  G C6    1 
ATOM   9947  N N6    . DA  F 2 12  ? 61.200  -28.452 152.445 1.00 164.16 ? 9   DA  G N6    1 
ATOM   9948  N N1    . DA  F 2 12  ? 59.581  -30.029 152.951 1.00 165.37 ? 9   DA  G N1    1 
ATOM   9949  C C2    . DA  F 2 12  ? 58.842  -30.663 153.869 1.00 165.54 ? 9   DA  G C2    1 
ATOM   9950  N N3    . DA  F 2 12  ? 58.830  -30.503 155.191 1.00 166.43 ? 9   DA  G N3    1 
ATOM   9951  C C4    . DA  F 2 12  ? 59.711  -29.562 155.565 1.00 166.43 ? 9   DA  G C4    1 
ATOM   9952  P P     . DT  F 2 13  ? 60.458  -33.272 160.993 1.00 198.12 ? 10  DT  G P     1 
ATOM   9953  O OP1   . DT  F 2 13  ? 59.598  -34.043 161.918 1.00 198.47 ? 10  DT  G OP1   1 
ATOM   9954  O OP2   . DT  F 2 13  ? 61.873  -33.017 161.342 1.00 199.33 ? 10  DT  G OP2   1 
ATOM   9955  O "O5'" . DT  F 2 13  ? 60.427  -33.982 159.559 1.00 174.25 ? 10  DT  G "O5'" 1 
ATOM   9956  C "C5'" . DT  F 2 13  ? 59.253  -34.661 159.128 1.00 169.40 ? 10  DT  G "C5'" 1 
ATOM   9957  C "C4'" . DT  F 2 13  ? 59.461  -35.296 157.764 1.00 163.65 ? 10  DT  G "C4'" 1 
ATOM   9958  O "O4'" . DT  F 2 13  ? 59.536  -34.257 156.761 1.00 157.32 ? 10  DT  G "O4'" 1 
ATOM   9959  C "C3'" . DT  F 2 13  ? 60.754  -36.089 157.585 1.00 166.03 ? 10  DT  G "C3'" 1 
ATOM   9960  O "O3'" . DT  F 2 13  ? 60.656  -37.448 158.094 1.00 170.13 ? 10  DT  G "O3'" 1 
ATOM   9961  C "C2'" . DT  F 2 13  ? 61.016  -35.994 156.082 1.00 161.89 ? 10  DT  G "C2'" 1 
ATOM   9962  C "C1'" . DT  F 2 13  ? 60.308  -34.707 155.665 1.00 157.39 ? 10  DT  G "C1'" 1 
ATOM   9963  N N1    . DT  F 2 13  ? 61.232  -33.607 155.266 1.00 157.57 ? 10  DT  G N1    1 
ATOM   9964  C C2    . DT  F 2 13  ? 61.509  -33.410 153.931 1.00 154.38 ? 10  DT  G C2    1 
ATOM   9965  O O2    . DT  F 2 13  ? 61.037  -34.097 153.042 1.00 153.27 ? 10  DT  G O2    1 
ATOM   9966  N N3    . DT  F 2 13  ? 62.367  -32.369 153.676 1.00 151.95 ? 10  DT  G N3    1 
ATOM   9967  C C4    . DT  F 2 13  ? 62.956  -31.530 154.603 1.00 153.63 ? 10  DT  G C4    1 
ATOM   9968  O O4    . DT  F 2 13  ? 63.713  -30.623 154.276 1.00 154.39 ? 10  DT  G O4    1 
ATOM   9969  C C5    . DT  F 2 13  ? 62.622  -31.793 155.980 1.00 156.37 ? 10  DT  G C5    1 
ATOM   9970  C C7    . DT  F 2 13  ? 63.203  -30.947 157.075 1.00 157.83 ? 10  DT  G C7    1 
ATOM   9971  C C6    . DT  F 2 13  ? 61.788  -32.805 156.242 1.00 158.82 ? 10  DT  G C6    1 
ATOM   9972  P P     . DT  F 2 14  ? 59.873  -38.607 157.290 1.00 177.24 ? 11  DT  G P     1 
ATOM   9973  O OP1   . DT  F 2 14  ? 58.629  -38.064 156.706 1.00 174.52 ? 11  DT  G OP1   1 
ATOM   9974  O OP2   . DT  F 2 14  ? 59.788  -39.769 158.201 1.00 181.09 ? 11  DT  G OP2   1 
ATOM   9975  O "O5'" . DT  F 2 14  ? 60.851  -38.997 156.087 1.00 183.25 ? 11  DT  G "O5'" 1 
ATOM   9976  C "C5'" . DT  F 2 14  ? 60.289  -39.474 154.868 1.00 183.16 ? 11  DT  G "C5'" 1 
ATOM   9977  C "C4'" . DT  F 2 14  ? 61.279  -39.359 153.723 1.00 184.07 ? 11  DT  G "C4'" 1 
ATOM   9978  O "O4'" . DT  F 2 14  ? 61.718  -37.987 153.561 1.00 183.35 ? 11  DT  G "O4'" 1 
ATOM   9979  C "C3'" . DT  F 2 14  ? 62.550  -40.183 153.903 1.00 187.46 ? 11  DT  G "C3'" 1 
ATOM   9980  O "O3'" . DT  F 2 14  ? 62.576  -41.212 152.926 1.00 189.00 ? 11  DT  G "O3'" 1 
ATOM   9981  C "C2'" . DT  F 2 14  ? 63.698  -39.191 153.709 1.00 187.11 ? 11  DT  G "C2'" 1 
ATOM   9982  C "C1'" . DT  F 2 14  ? 63.017  -38.021 153.010 1.00 184.17 ? 11  DT  G "C1'" 1 
ATOM   9983  N N1    . DT  F 2 14  ? 63.692  -36.708 153.238 1.00 184.00 ? 11  DT  G N1    1 
ATOM   9984  C C2    . DT  F 2 14  ? 63.851  -35.829 152.186 1.00 182.86 ? 11  DT  G C2    1 
ATOM   9985  O O2    . DT  F 2 14  ? 63.462  -36.059 151.054 1.00 183.02 ? 11  DT  G O2    1 
ATOM   9986  N N3    . DT  F 2 14  ? 64.485  -34.656 152.511 1.00 181.19 ? 11  DT  G N3    1 
ATOM   9987  C C4    . DT  F 2 14  ? 64.967  -34.284 153.752 1.00 181.74 ? 11  DT  G C4    1 
ATOM   9988  O O4    . DT  F 2 14  ? 65.524  -33.208 153.946 1.00 181.69 ? 11  DT  G O4    1 
ATOM   9989  C C5    . DT  F 2 14  ? 64.770  -35.249 154.804 1.00 183.80 ? 11  DT  G C5    1 
ATOM   9990  C C7    . DT  F 2 14  ? 65.251  -34.956 156.194 1.00 185.90 ? 11  DT  G C7    1 
ATOM   9991  C C6    . DT  F 2 14  ? 64.153  -36.397 154.501 1.00 184.66 ? 11  DT  G C6    1 
ATOM   9992  P P     . DC  F 2 15  ? 62.869  -42.728 153.364 1.00 295.27 ? 12  DC  G P     1 
ATOM   9993  O OP1   . DC  F 2 15  ? 61.573  -43.438 153.442 1.00 159.57 ? 12  DC  G OP1   1 
ATOM   9994  O OP2   . DC  F 2 15  ? 63.748  -42.674 154.553 1.00 161.05 ? 12  DC  G OP2   1 
ATOM   9995  O "O5'" . DC  F 2 15  ? 63.711  -43.324 152.140 1.00 209.78 ? 12  DC  G "O5'" 1 
ATOM   9996  C "C5'" . DC  F 2 15  ? 64.960  -42.740 151.780 1.00 209.26 ? 12  DC  G "C5'" 1 
ATOM   9997  C "C4'" . DC  F 2 15  ? 65.056  -42.522 150.280 1.00 208.27 ? 12  DC  G "C4'" 1 
ATOM   9998  O "O4'" . DC  F 2 15  ? 65.043  -41.100 149.997 1.00 207.89 ? 12  DC  G "O4'" 1 
ATOM   9999  C "C3'" . DC  F 2 15  ? 66.336  -43.032 149.632 1.00 206.87 ? 12  DC  G "C3'" 1 
ATOM   10000 O "O3'" . DC  F 2 15  ? 66.109  -43.322 148.257 1.00 205.30 ? 12  DC  G "O3'" 1 
ATOM   10001 C "C2'" . DC  F 2 15  ? 67.285  -41.851 149.810 1.00 206.77 ? 12  DC  G "C2'" 1 
ATOM   10002 C "C1'" . DC  F 2 15  ? 66.352  -40.647 149.703 1.00 206.42 ? 12  DC  G "C1'" 1 
ATOM   10003 N N1    . DC  F 2 15  ? 66.689  -39.549 150.656 1.00 204.34 ? 12  DC  G N1    1 
ATOM   10004 C C2    . DC  F 2 15  ? 66.747  -38.227 150.201 1.00 202.40 ? 12  DC  G C2    1 
ATOM   10005 O O2    . DC  F 2 15  ? 66.516  -37.985 149.010 1.00 201.60 ? 12  DC  G O2    1 
ATOM   10006 N N3    . DC  F 2 15  ? 67.053  -37.245 151.083 1.00 200.99 ? 12  DC  G N3    1 
ATOM   10007 C C4    . DC  F 2 15  ? 67.296  -37.541 152.361 1.00 200.33 ? 12  DC  G C4    1 
ATOM   10008 N N4    . DC  F 2 15  ? 67.594  -36.537 153.192 1.00 198.27 ? 12  DC  G N4    1 
ATOM   10009 C C5    . DC  F 2 15  ? 67.243  -38.882 152.843 1.00 202.33 ? 12  DC  G C5    1 
ATOM   10010 C C6    . DC  F 2 15  ? 66.939  -39.842 151.964 1.00 203.51 ? 12  DC  G C6    1 
ATOM   10011 P P     . DG  G 3 1   ? 40.077  14.984  177.513 1.00 210.58 ? 1   DG  H P     1 
ATOM   10012 O OP1   . DG  G 3 1   ? 40.236  16.410  177.145 1.00 216.74 ? 1   DG  H OP1   1 
ATOM   10013 O OP2   . DG  G 3 1   ? 39.962  14.597  178.939 1.00 207.00 ? 1   DG  H OP2   1 
ATOM   10014 O "O5'" . DG  G 3 1   ? 38.835  14.366  176.704 1.00 156.34 ? 1   DG  H "O5'" 1 
ATOM   10015 C "C5'" . DG  G 3 1   ? 38.177  13.177  177.159 1.00 143.64 ? 1   DG  H "C5'" 1 
ATOM   10016 C "C4'" . DG  G 3 1   ? 39.102  11.973  177.094 1.00 132.17 ? 1   DG  H "C4'" 1 
ATOM   10017 O "O4'" . DG  G 3 1   ? 38.875  11.088  178.215 1.00 126.99 ? 1   DG  H "O4'" 1 
ATOM   10018 C "C3'" . DG  G 3 1   ? 38.901  11.055  175.901 1.00 123.36 ? 1   DG  H "C3'" 1 
ATOM   10019 O "O3'" . DG  G 3 1   ? 39.565  11.586  174.780 1.00 121.43 ? 1   DG  H "O3'" 1 
ATOM   10020 C "C2'" . DG  G 3 1   ? 39.582  9.773   176.364 1.00 122.81 ? 1   DG  H "C2'" 1 
ATOM   10021 C "C1'" . DG  G 3 1   ? 39.446  9.835   177.885 1.00 123.69 ? 1   DG  H "C1'" 1 
ATOM   10022 N N9    . DG  G 3 1   ? 38.640  8.749   178.435 1.00 121.61 ? 1   DG  H N9    1 
ATOM   10023 C C8    . DG  G 3 1   ? 37.468  8.842   179.147 1.00 121.10 ? 1   DG  H C8    1 
ATOM   10024 N N7    . DG  G 3 1   ? 36.987  7.680   179.501 1.00 113.85 ? 1   DG  H N7    1 
ATOM   10025 C C5    . DG  G 3 1   ? 37.897  6.760   178.993 1.00 112.19 ? 1   DG  H C5    1 
ATOM   10026 C C6    . DG  G 3 1   ? 37.913  5.345   179.057 1.00 106.40 ? 1   DG  H C6    1 
ATOM   10027 O O6    . DG  G 3 1   ? 37.094  4.588   179.599 1.00 93.90  ? 1   DG  H O6    1 
ATOM   10028 N N1    . DG  G 3 1   ? 39.023  4.810   178.404 1.00 103.20 ? 1   DG  H N1    1 
ATOM   10029 C C2    . DG  G 3 1   ? 39.993  5.547   177.769 1.00 105.83 ? 1   DG  H C2    1 
ATOM   10030 N N2    . DG  G 3 1   ? 40.990  4.862   177.193 1.00 105.34 ? 1   DG  H N2    1 
ATOM   10031 N N3    . DG  G 3 1   ? 39.990  6.869   177.702 1.00 114.33 ? 1   DG  H N3    1 
ATOM   10032 C C4    . DG  G 3 1   ? 38.919  7.406   178.333 1.00 116.79 ? 1   DG  H C4    1 
ATOM   10033 P P     . DT  G 3 2   ? 39.198  11.063  173.308 1.00 153.21 ? 2   DT  H P     1 
ATOM   10034 O OP1   . DT  G 3 2   ? 39.752  12.047  172.353 1.00 159.53 ? 2   DT  H OP1   1 
ATOM   10035 O OP2   . DT  G 3 2   ? 37.753  10.740  173.289 1.00 146.58 ? 2   DT  H OP2   1 
ATOM   10036 O "O5'" . DT  G 3 2   ? 40.012  9.692   173.170 1.00 132.33 ? 2   DT  H "O5'" 1 
ATOM   10037 C "C5'" . DT  G 3 2   ? 41.433  9.709   173.229 1.00 133.08 ? 2   DT  H "C5'" 1 
ATOM   10038 C "C4'" . DT  G 3 2   ? 41.997  8.347   172.865 1.00 128.05 ? 2   DT  H "C4'" 1 
ATOM   10039 O "O4'" . DT  G 3 2   ? 41.502  7.363   173.808 1.00 123.27 ? 2   DT  H "O4'" 1 
ATOM   10040 C "C3'" . DT  G 3 2   ? 41.628  7.847   171.471 1.00 124.64 ? 2   DT  H "C3'" 1 
ATOM   10041 O "O3'" . DT  G 3 2   ? 42.793  7.340   170.824 1.00 117.11 ? 2   DT  H "O3'" 1 
ATOM   10042 C "C2'" . DT  G 3 2   ? 40.584  6.761   171.725 1.00 116.04 ? 2   DT  H "C2'" 1 
ATOM   10043 C "C1'" . DT  G 3 2   ? 40.941  6.264   173.122 1.00 117.12 ? 2   DT  H "C1'" 1 
ATOM   10044 N N1    . DT  G 3 2   ? 39.770  5.789   173.911 1.00 111.16 ? 2   DT  H N1    1 
ATOM   10045 C C2    . DT  G 3 2   ? 39.611  4.441   174.158 1.00 107.50 ? 2   DT  H C2    1 
ATOM   10046 O O2    . DT  G 3 2   ? 40.384  3.588   173.759 1.00 106.90 ? 2   DT  H O2    1 
ATOM   10047 N N3    . DT  G 3 2   ? 38.502  4.123   174.898 1.00 106.94 ? 2   DT  H N3    1 
ATOM   10048 C C4    . DT  G 3 2   ? 37.558  5.001   175.399 1.00 109.80 ? 2   DT  H C4    1 
ATOM   10049 O O4    . DT  G 3 2   ? 36.591  4.623   176.051 1.00 108.67 ? 2   DT  H O4    1 
ATOM   10050 C C5    . DT  G 3 2   ? 37.786  6.394   175.104 1.00 109.99 ? 2   DT  H C5    1 
ATOM   10051 C C7    . DT  G 3 2   ? 36.827  7.437   175.599 1.00 108.76 ? 2   DT  H C7    1 
ATOM   10052 C C6    . DT  G 3 2   ? 38.867  6.717   174.385 1.00 110.75 ? 2   DT  H C6    1 
ATOM   10053 P P     . DT  G 3 3   ? 42.762  6.974   169.259 1.00 147.05 ? 3   DT  H P     1 
ATOM   10054 O OP1   . DT  G 3 3   ? 44.110  7.255   168.717 1.00 153.06 ? 3   DT  H OP1   1 
ATOM   10055 O OP2   . DT  G 3 3   ? 41.578  7.620   168.652 1.00 145.29 ? 3   DT  H OP2   1 
ATOM   10056 O "O5'" . DT  G 3 3   ? 42.504  5.395   169.239 1.00 119.59 ? 3   DT  H "O5'" 1 
ATOM   10057 C "C5'" . DT  G 3 3   ? 43.364  4.519   169.957 1.00 122.44 ? 3   DT  H "C5'" 1 
ATOM   10058 C "C4'" . DT  G 3 3   ? 42.818  3.103   169.955 1.00 123.00 ? 3   DT  H "C4'" 1 
ATOM   10059 O "O4'" . DT  G 3 3   ? 41.719  2.998   170.892 1.00 123.38 ? 3   DT  H "O4'" 1 
ATOM   10060 C "C3'" . DT  G 3 3   ? 42.289  2.619   168.607 1.00 121.54 ? 3   DT  H "C3'" 1 
ATOM   10061 O "O3'" . DT  G 3 3   ? 43.034  1.480   168.210 1.00 121.16 ? 3   DT  H "O3'" 1 
ATOM   10062 C "C2'" . DT  G 3 3   ? 40.822  2.273   168.859 1.00 118.23 ? 3   DT  H "C2'" 1 
ATOM   10063 C "C1'" . DT  G 3 3   ? 40.774  2.091   170.371 1.00 120.00 ? 3   DT  H "C1'" 1 
ATOM   10064 N N1    . DT  G 3 3   ? 39.457  2.407   170.979 1.00 117.37 ? 3   DT  H N1    1 
ATOM   10065 C C2    . DT  G 3 3   ? 38.831  1.432   171.719 1.00 116.12 ? 3   DT  H C2    1 
ATOM   10066 O O2    . DT  G 3 3   ? 39.305  0.322   171.891 1.00 116.10 ? 3   DT  H O2    1 
ATOM   10067 N N3    . DT  G 3 3   ? 37.623  1.809   172.248 1.00 113.74 ? 3   DT  H N3    1 
ATOM   10068 C C4    . DT  G 3 3   ? 37.000  3.036   172.110 1.00 110.37 ? 3   DT  H C4    1 
ATOM   10069 O O4    . DT  G 3 3   ? 35.914  3.277   172.624 1.00 107.09 ? 3   DT  H O4    1 
ATOM   10070 C C5    . DT  G 3 3   ? 37.711  4.012   171.324 1.00 111.21 ? 3   DT  H C5    1 
ATOM   10071 C C7    . DT  G 3 3   ? 37.123  5.378   171.114 1.00 111.41 ? 3   DT  H C7    1 
ATOM   10072 C C6    . DT  G 3 3   ? 38.893  3.655   170.803 1.00 115.94 ? 3   DT  H C6    1 
ATOM   10073 P P     . DG  G 3 4   ? 42.871  0.877   166.730 1.00 142.05 ? 4   DG  H P     1 
ATOM   10074 O OP1   . DG  G 3 4   ? 44.222  0.489   166.271 1.00 143.56 ? 4   DG  H OP1   1 
ATOM   10075 O OP2   . DG  G 3 4   ? 42.057  1.818   165.928 1.00 142.32 ? 4   DG  H OP2   1 
ATOM   10076 O "O5'" . DG  G 3 4   ? 42.016  -0.452  166.960 1.00 129.49 ? 4   DG  H "O5'" 1 
ATOM   10077 C "C5'" . DG  G 3 4   ? 42.454  -1.387  167.938 1.00 128.35 ? 4   DG  H "C5'" 1 
ATOM   10078 C "C4'" . DG  G 3 4   ? 41.451  -2.516  168.080 1.00 126.33 ? 4   DG  H "C4'" 1 
ATOM   10079 O "O4'" . DG  G 3 4   ? 40.327  -2.086  168.891 1.00 127.55 ? 4   DG  H "O4'" 1 
ATOM   10080 C "C3'" . DG  G 3 4   ? 40.888  -3.019  166.757 1.00 126.55 ? 4   DG  H "C3'" 1 
ATOM   10081 O "O3'" . DG  G 3 4   ? 40.990  -4.435  166.741 1.00 103.18 ? 4   DG  H "O3'" 1 
ATOM   10082 C "C2'" . DG  G 3 4   ? 39.446  -2.511  166.746 1.00 123.83 ? 4   DG  H "C2'" 1 
ATOM   10083 C "C1'" . DG  G 3 4   ? 39.111  -2.345  168.222 1.00 122.93 ? 4   DG  H "C1'" 1 
ATOM   10084 N N9    . DG  G 3 4   ? 38.214  -1.225  168.484 1.00 115.26 ? 4   DG  H N9    1 
ATOM   10085 C C8    . DG  G 3 4   ? 38.298  0.047   167.972 1.00 115.36 ? 4   DG  H C8    1 
ATOM   10086 N N7    . DG  G 3 4   ? 37.352  0.840   168.394 1.00 111.48 ? 4   DG  H N7    1 
ATOM   10087 C C5    . DG  G 3 4   ? 36.594  0.043   169.242 1.00 105.92 ? 4   DG  H C5    1 
ATOM   10088 C C6    . DG  G 3 4   ? 35.436  0.354   169.993 1.00 99.67  ? 4   DG  H C6    1 
ATOM   10089 O O6    . DG  G 3 4   ? 34.829  1.433   170.061 1.00 90.33  ? 4   DG  H O6    1 
ATOM   10090 N N1    . DG  G 3 4   ? 34.985  -0.746  170.718 1.00 92.65  ? 4   DG  H N1    1 
ATOM   10091 C C2    . DG  G 3 4   ? 35.579  -1.986  170.717 1.00 94.38  ? 4   DG  H C2    1 
ATOM   10092 N N2    . DG  G 3 4   ? 34.999  -2.922  171.481 1.00 94.61  ? 4   DG  H N2    1 
ATOM   10093 N N3    . DG  G 3 4   ? 36.665  -2.290  170.019 1.00 99.34  ? 4   DG  H N3    1 
ATOM   10094 C C4    . DG  G 3 4   ? 37.114  -1.230  169.308 1.00 106.23 ? 4   DG  H C4    1 
ATOM   10095 P P     . DG  G 3 5   ? 40.389  -5.287  165.518 1.00 124.92 ? 5   DG  H P     1 
ATOM   10096 O OP1   . DG  G 3 5   ? 41.314  -6.417  165.278 1.00 128.28 ? 5   DG  H OP1   1 
ATOM   10097 O OP2   . DG  G 3 5   ? 40.061  -4.367  164.404 1.00 122.10 ? 5   DG  H OP2   1 
ATOM   10098 O "O5'" . DG  G 3 5   ? 39.034  -5.884  166.116 1.00 110.62 ? 5   DG  H "O5'" 1 
ATOM   10099 C "C5'" . DG  G 3 5   ? 39.124  -6.637  167.320 1.00 109.55 ? 5   DG  H "C5'" 1 
ATOM   10100 C "C4'" . DG  G 3 5   ? 37.780  -7.232  167.688 1.00 102.22 ? 5   DG  H "C4'" 1 
ATOM   10101 O "O4'" . DG  G 3 5   ? 36.908  -6.186  168.184 1.00 103.84 ? 5   DG  H "O4'" 1 
ATOM   10102 C "C3'" . DG  G 3 5   ? 37.051  -7.905  166.531 1.00 103.65 ? 5   DG  H "C3'" 1 
ATOM   10103 O "O3'" . DG  G 3 5   ? 36.463  -9.120  166.984 1.00 93.72  ? 5   DG  H "O3'" 1 
ATOM   10104 C "C2'" . DG  G 3 5   ? 36.009  -6.869  166.109 1.00 106.95 ? 5   DG  H "C2'" 1 
ATOM   10105 C "C1'" . DG  G 3 5   ? 35.732  -6.111  167.404 1.00 106.95 ? 5   DG  H "C1'" 1 
ATOM   10106 N N9    . DG  G 3 5   ? 35.431  -4.694  167.221 1.00 104.76 ? 5   DG  H N9    1 
ATOM   10107 C C8    . DG  G 3 5   ? 36.077  -3.812  166.390 1.00 105.93 ? 5   DG  H C8    1 
ATOM   10108 N N7    . DG  G 3 5   ? 35.594  -2.602  166.442 1.00 100.90 ? 5   DG  H N7    1 
ATOM   10109 C C5    . DG  G 3 5   ? 34.565  -2.682  167.370 1.00 96.16  ? 5   DG  H C5    1 
ATOM   10110 C C6    . DG  G 3 5   ? 33.682  -1.680  167.839 1.00 93.33  ? 5   DG  H C6    1 
ATOM   10111 O O6    . DG  G 3 5   ? 33.633  -0.484  167.513 1.00 89.37  ? 5   DG  H O6    1 
ATOM   10112 N N1    . DG  G 3 5   ? 32.786  -2.183  168.779 1.00 90.26  ? 5   DG  H N1    1 
ATOM   10113 C C2    . DG  G 3 5   ? 32.751  -3.489  169.210 1.00 94.62  ? 5   DG  H C2    1 
ATOM   10114 N N2    . DG  G 3 5   ? 31.814  -3.784  170.123 1.00 98.11  ? 5   DG  H N2    1 
ATOM   10115 N N3    . DG  G 3 5   ? 33.575  -4.438  168.780 1.00 92.82  ? 5   DG  H N3    1 
ATOM   10116 C C4    . DG  G 3 5   ? 34.453  -3.964  167.862 1.00 96.62  ? 5   DG  H C4    1 
ATOM   10117 P P     . DG  G 3 6   ? 35.870  -10.179 165.931 1.00 105.24 ? 6   DG  H P     1 
ATOM   10118 O OP1   . DG  G 3 6   ? 36.179  -11.536 166.433 1.00 101.03 ? 6   DG  H OP1   1 
ATOM   10119 O OP2   . DG  G 3 6   ? 36.311  -9.781  164.579 1.00 112.81 ? 6   DG  H OP2   1 
ATOM   10120 O "O5'" . DG  G 3 6   ? 34.294  -9.945  166.011 1.00 102.33 ? 6   DG  H "O5'" 1 
ATOM   10121 C "C5'" . DG  G 3 6   ? 33.658  -10.019 167.275 1.00 96.44  ? 6   DG  H "C5'" 1 
ATOM   10122 C "C4'" . DG  G 3 6   ? 32.359  -9.241  167.262 1.00 97.04  ? 6   DG  H "C4'" 1 
ATOM   10123 O "O4'" . DG  G 3 6   ? 32.635  -7.834  167.055 1.00 98.38  ? 6   DG  H "O4'" 1 
ATOM   10124 C "C3'" . DG  G 3 6   ? 31.355  -9.648  166.185 1.00 103.38 ? 6   DG  H "C3'" 1 
ATOM   10125 O "O3'" . DG  G 3 6   ? 30.162  -10.039 166.852 1.00 111.03 ? 6   DG  H "O3'" 1 
ATOM   10126 C "C2'" . DG  G 3 6   ? 31.158  -8.374  165.362 1.00 99.10  ? 6   DG  H "C2'" 1 
ATOM   10127 C "C1'" . DG  G 3 6   ? 31.539  -7.286  166.359 1.00 98.68  ? 6   DG  H "C1'" 1 
ATOM   10128 N N9    . DG  G 3 6   ? 31.941  -6.020  165.747 1.00 102.30 ? 6   DG  H N9    1 
ATOM   10129 C C8    . DG  G 3 6   ? 32.963  -5.813  164.851 1.00 104.43 ? 6   DG  H C8    1 
ATOM   10130 N N7    . DG  G 3 6   ? 33.088  -4.567  164.480 1.00 102.14 ? 6   DG  H N7    1 
ATOM   10131 C C5    . DG  G 3 6   ? 32.083  -3.902  165.172 1.00 97.93  ? 6   DG  H C5    1 
ATOM   10132 C C6    . DG  G 3 6   ? 31.727  -2.531  165.174 1.00 93.34  ? 6   DG  H C6    1 
ATOM   10133 O O6    . DG  G 3 6   ? 32.244  -1.598  164.543 1.00 93.21  ? 6   DG  H O6    1 
ATOM   10134 N N1    . DG  G 3 6   ? 30.648  -2.282  166.021 1.00 92.16  ? 6   DG  H N1    1 
ATOM   10135 C C2    . DG  G 3 6   ? 29.998  -3.237  166.770 1.00 90.36  ? 6   DG  H C2    1 
ATOM   10136 N N2    . DG  G 3 6   ? 28.979  -2.806  167.529 1.00 82.88  ? 6   DG  H N2    1 
ATOM   10137 N N3    . DG  G 3 6   ? 30.322  -4.524  166.777 1.00 93.06  ? 6   DG  H N3    1 
ATOM   10138 C C4    . DG  G 3 6   ? 31.370  -4.783  165.957 1.00 98.03  ? 6   DG  H C4    1 
ATOM   10139 P P     . DA  G 3 7   ? 29.041  -10.914 166.102 1.00 99.89  ? 7   DA  H P     1 
ATOM   10140 O OP1   . DA  G 3 7   ? 28.831  -12.140 166.902 1.00 97.50  ? 7   DA  H OP1   1 
ATOM   10141 O OP2   . DA  G 3 7   ? 29.399  -11.021 164.671 1.00 102.95 ? 7   DA  H OP2   1 
ATOM   10142 O "O5'" . DA  G 3 7   ? 27.729  -10.006 166.204 1.00 81.71  ? 7   DA  H "O5'" 1 
ATOM   10143 C "C5'" . DA  G 3 7   ? 27.357  -9.427  167.455 1.00 85.72  ? 7   DA  H "C5'" 1 
ATOM   10144 C "C4'" . DA  G 3 7   ? 26.428  -8.235  167.276 1.00 78.18  ? 7   DA  H "C4'" 1 
ATOM   10145 O "O4'" . DA  G 3 7   ? 27.172  -7.095  166.766 1.00 89.44  ? 7   DA  H "O4'" 1 
ATOM   10146 C "C3'" . DA  G 3 7   ? 25.278  -8.452  166.297 1.00 78.29  ? 7   DA  H "C3'" 1 
ATOM   10147 O "O3'" . DA  G 3 7   ? 24.127  -7.781  166.767 1.00 84.73  ? 7   DA  H "O3'" 1 
ATOM   10148 C "C2'" . DA  G 3 7   ? 25.800  -7.809  165.018 1.00 88.39  ? 7   DA  H "C2'" 1 
ATOM   10149 C "C1'" . DA  G 3 7   ? 26.536  -6.612  165.601 1.00 88.95  ? 7   DA  H "C1'" 1 
ATOM   10150 N N9    . DA  G 3 7   ? 27.551  -6.069  164.709 1.00 92.60  ? 7   DA  H N9    1 
ATOM   10151 C C8    . DA  G 3 7   ? 28.485  -6.765  163.994 1.00 101.00 ? 7   DA  H C8    1 
ATOM   10152 N N7    . DA  G 3 7   ? 29.272  -5.998  163.278 1.00 102.01 ? 7   DA  H N7    1 
ATOM   10153 C C5    . DA  G 3 7   ? 28.821  -4.714  163.544 1.00 95.03  ? 7   DA  H C5    1 
ATOM   10154 C C6    . DA  G 3 7   ? 29.232  -3.443  163.094 1.00 87.73  ? 7   DA  H C6    1 
ATOM   10155 N N6    . DA  G 3 7   ? 30.240  -3.259  162.235 1.00 90.94  ? 7   DA  H N6    1 
ATOM   10156 N N1    . DA  G 3 7   ? 28.557  -2.370  163.560 1.00 86.82  ? 7   DA  H N1    1 
ATOM   10157 C C2    . DA  G 3 7   ? 27.546  -2.555  164.415 1.00 84.01  ? 7   DA  H C2    1 
ATOM   10158 N N3    . DA  G 3 7   ? 27.071  -3.694  164.906 1.00 88.70  ? 7   DA  H N3    1 
ATOM   10159 C C4    . DA  G 3 7   ? 27.759  -4.742  164.426 1.00 90.04  ? 7   DA  H C4    1 
ATOM   10160 P P     . DT  G 3 8   ? 22.663  -8.327  166.396 1.00 88.02  ? 8   DT  H P     1 
ATOM   10161 O OP1   . DT  G 3 8   ? 22.137  -9.125  167.528 1.00 104.61 ? 8   DT  H OP1   1 
ATOM   10162 O OP2   . DT  G 3 8   ? 22.766  -8.911  165.041 1.00 81.72  ? 8   DT  H OP2   1 
ATOM   10163 O "O5'" . DT  G 3 8   ? 21.774  -7.011  166.283 1.00 75.66  ? 8   DT  H "O5'" 1 
ATOM   10164 C "C5'" . DT  G 3 8   ? 22.078  -5.861  167.039 1.00 101.37 ? 8   DT  H "C5'" 1 
ATOM   10165 C "C4'" . DT  G 3 8   ? 22.087  -4.677  166.095 1.00 98.04  ? 8   DT  H "C4'" 1 
ATOM   10166 O "O4'" . DT  G 3 8   ? 23.295  -4.721  165.292 1.00 92.68  ? 8   DT  H "O4'" 1 
ATOM   10167 C "C3'" . DT  G 3 8   ? 20.927  -4.601  165.089 1.00 96.40  ? 8   DT  H "C3'" 1 
ATOM   10168 O "O3'" . DT  G 3 8   ? 20.539  -3.233  164.961 1.00 88.61  ? 8   DT  H "O3'" 1 
ATOM   10169 C "C2'" . DT  G 3 8   ? 21.587  -5.082  163.801 1.00 98.41  ? 8   DT  H "C2'" 1 
ATOM   10170 C "C1'" . DT  G 3 8   ? 22.855  -4.278  164.030 1.00 95.90  ? 8   DT  H "C1'" 1 
ATOM   10171 N N1    . DT  G 3 8   ? 23.936  -4.307  163.014 1.00 103.61 ? 8   DT  H N1    1 
ATOM   10172 C C2    . DT  G 3 8   ? 24.472  -5.445  162.443 1.00 114.43 ? 8   DT  H C2    1 
ATOM   10173 O O2    . DT  G 3 8   ? 24.096  -6.570  162.711 1.00 129.85 ? 8   DT  H O2    1 
ATOM   10174 N N3    . DT  G 3 8   ? 25.476  -5.216  161.526 1.00 99.45  ? 8   DT  H N3    1 
ATOM   10175 C C4    . DT  G 3 8   ? 25.975  -3.984  161.143 1.00 95.48  ? 8   DT  H C4    1 
ATOM   10176 O O4    . DT  G 3 8   ? 26.875  -3.856  160.317 1.00 98.19  ? 8   DT  H O4    1 
ATOM   10177 C C5    . DT  G 3 8   ? 25.351  -2.863  161.802 1.00 92.59  ? 8   DT  H C5    1 
ATOM   10178 C C7    . DT  G 3 8   ? 25.729  -1.455  161.550 1.00 88.65  ? 8   DT  H C7    1 
ATOM   10179 C C6    . DT  G 3 8   ? 24.391  -3.070  162.682 1.00 95.83  ? 8   DT  H C6    1 
ATOM   10180 P P     . DT  G 3 9   ? 19.042  -2.824  164.526 1.00 95.39  ? 9   DT  H P     1 
ATOM   10181 O OP1   . DT  G 3 9   ? 18.429  -2.170  165.707 1.00 102.93 ? 9   DT  H OP1   1 
ATOM   10182 O OP2   . DT  G 3 9   ? 18.378  -3.984  163.882 1.00 86.78  ? 9   DT  H OP2   1 
ATOM   10183 O "O5'" . DT  G 3 9   ? 19.257  -1.706  163.398 1.00 93.05  ? 9   DT  H "O5'" 1 
ATOM   10184 C "C5'" . DT  G 3 9   ? 20.323  -1.854  162.471 1.00 100.23 ? 9   DT  H "C5'" 1 
ATOM   10185 C "C4'" . DT  G 3 9   ? 20.444  -0.651  161.555 1.00 86.10  ? 9   DT  H "C4'" 1 
ATOM   10186 O "O4'" . DT  G 3 9   ? 21.804  -0.589  161.053 1.00 151.14 ? 9   DT  H "O4'" 1 
ATOM   10187 C "C3'" . DT  G 3 9   ? 19.505  -0.737  160.350 1.00 88.18  ? 9   DT  H "C3'" 1 
ATOM   10188 O "O3'" . DT  G 3 9   ? 18.579  0.359   160.352 1.00 89.55  ? 9   DT  H "O3'" 1 
ATOM   10189 C "C2'" . DT  G 3 9   ? 20.414  -0.680  159.125 1.00 99.96  ? 9   DT  H "C2'" 1 
ATOM   10190 C "C1'" . DT  G 3 9   ? 21.844  -0.753  159.650 1.00 90.78  ? 9   DT  H "C1'" 1 
ATOM   10191 N N1    . DT  G 3 9   ? 22.523  -2.027  159.293 1.00 90.45  ? 9   DT  H N1    1 
ATOM   10192 C C2    . DT  G 3 9   ? 23.642  -1.976  158.493 1.00 99.83  ? 9   DT  H C2    1 
ATOM   10193 O O2    . DT  G 3 9   ? 24.114  -0.932  158.080 1.00 96.08  ? 9   DT  H O2    1 
ATOM   10194 N N3    . DT  G 3 9   ? 24.210  -3.191  158.197 1.00 93.26  ? 9   DT  H N3    1 
ATOM   10195 C C4    . DT  G 3 9   ? 23.764  -4.427  158.615 1.00 93.28  ? 9   DT  H C4    1 
ATOM   10196 O O4    . DT  G 3 9   ? 24.332  -5.463  158.298 1.00 91.54  ? 9   DT  H O4    1 
ATOM   10197 C C5    . DT  G 3 9   ? 22.586  -4.412  159.442 1.00 88.05  ? 9   DT  H C5    1 
ATOM   10198 C C7    . DT  G 3 9   ? 22.010  -5.698  159.953 1.00 85.91  ? 9   DT  H C7    1 
ATOM   10199 C C6    . DT  G 3 9   ? 22.030  -3.232  159.735 1.00 90.25  ? 9   DT  H C6    1 
ATOM   10200 P P     . DG  G 3 10  ? 17.180  0.257   159.584 1.00 136.90 ? 10  DG  H P     1 
ATOM   10201 O OP1   . DG  G 3 10  ? 16.354  1.396   159.981 1.00 56.13  ? 10  DG  H OP1   1 
ATOM   10202 O OP2   . DG  G 3 10  ? 16.736  -1.131  159.672 1.00 45.75  ? 10  DG  H OP2   1 
ATOM   10203 O "O5'" . DG  G 3 10  ? 17.554  0.524   158.071 1.00 57.97  ? 10  DG  H "O5'" 1 
ATOM   10204 C "C5'" . DG  G 3 10  ? 17.919  1.841   157.602 1.00 67.35  ? 10  DG  H "C5'" 1 
ATOM   10205 C "C4'" . DG  G 3 10  ? 18.726  1.760   156.321 1.00 75.52  ? 10  DG  H "C4'" 1 
ATOM   10206 O "O4'" . DG  G 3 10  ? 19.819  0.840   156.497 1.00 83.71  ? 10  DG  H "O4'" 1 
ATOM   10207 C "C3'" . DG  G 3 10  ? 17.958  1.226   155.130 1.00 79.31  ? 10  DG  H "C3'" 1 
ATOM   10208 O "O3'" . DG  G 3 10  ? 17.467  2.323   154.371 1.00 84.78  ? 10  DG  H "O3'" 1 
ATOM   10209 C "C2'" . DG  G 3 10  ? 18.966  0.389   154.339 1.00 82.30  ? 10  DG  H "C2'" 1 
ATOM   10210 C "C1'" . DG  G 3 10  ? 20.193  0.333   155.239 1.00 86.02  ? 10  DG  H "C1'" 1 
ATOM   10211 N N9    . DG  G 3 10  ? 20.671  -1.006  155.454 1.00 83.39  ? 10  DG  H N9    1 
ATOM   10212 C C8    . DG  G 3 10  ? 19.982  -2.008  156.088 1.00 80.58  ? 10  DG  H C8    1 
ATOM   10213 N N7    . DG  G 3 10  ? 20.666  -3.149  156.137 1.00 80.62  ? 10  DG  H N7    1 
ATOM   10214 C C5    . DG  G 3 10  ? 21.863  -2.834  155.518 1.00 78.28  ? 10  DG  H C5    1 
ATOM   10215 C C6    . DG  G 3 10  ? 22.977  -3.651  155.268 1.00 83.99  ? 10  DG  H C6    1 
ATOM   10216 O O6    . DG  G 3 10  ? 23.138  -4.840  155.576 1.00 92.32  ? 10  DG  H O6    1 
ATOM   10217 N N1    . DG  G 3 10  ? 23.984  -2.962  154.592 1.00 79.05  ? 10  DG  H N1    1 
ATOM   10218 C C2    . DG  G 3 10  ? 23.914  -1.644  154.205 1.00 79.75  ? 10  DG  H C2    1 
ATOM   10219 N N2    . DG  G 3 10  ? 24.975  -1.149  153.561 1.00 86.02  ? 10  DG  H N2    1 
ATOM   10220 N N3    . DG  G 3 10  ? 22.863  -0.866  154.425 1.00 73.17  ? 10  DG  H N3    1 
ATOM   10221 C C4    . DG  G 3 10  ? 21.880  -1.528  155.080 1.00 76.75  ? 10  DG  H C4    1 
ATOM   10222 P P     . DG  H 4 1   ? 75.165  -28.590 149.202 1.00 205.95 ? 1   DG  I P     1 
ATOM   10223 O OP1   . DG  H 4 1   ? 76.159  -29.303 150.037 1.00 208.84 ? 1   DG  I OP1   1 
ATOM   10224 O OP2   . DG  H 4 1   ? 75.572  -27.399 148.423 1.00 210.47 ? 1   DG  I OP2   1 
ATOM   10225 O "O5'" . DG  H 4 1   ? 73.909  -28.183 150.107 1.00 214.75 ? 1   DG  I "O5'" 1 
ATOM   10226 C "C5'" . DG  H 4 1   ? 72.789  -27.523 149.523 1.00 211.60 ? 1   DG  I "C5'" 1 
ATOM   10227 C "C4'" . DG  H 4 1   ? 72.198  -28.345 148.392 1.00 211.24 ? 1   DG  I "C4'" 1 
ATOM   10228 O "O4'" . DG  H 4 1   ? 71.924  -29.688 148.873 1.00 208.68 ? 1   DG  I "O4'" 1 
ATOM   10229 C "C3'" . DG  H 4 1   ? 70.851  -27.862 147.869 1.00 204.57 ? 1   DG  I "C3'" 1 
ATOM   10230 O "O3'" . DG  H 4 1   ? 70.587  -28.485 146.623 1.00 206.35 ? 1   DG  I "O3'" 1 
ATOM   10231 C "C2'" . DG  H 4 1   ? 69.949  -28.495 148.913 1.00 196.12 ? 1   DG  I "C2'" 1 
ATOM   10232 C "C1'" . DG  H 4 1   ? 70.529  -29.894 148.754 1.00 198.63 ? 1   DG  I "C1'" 1 
ATOM   10233 N N9    . DG  H 4 1   ? 70.057  -30.901 149.700 1.00 191.61 ? 1   DG  I N9    1 
ATOM   10234 C C8    . DG  H 4 1   ? 70.047  -30.850 151.074 1.00 188.74 ? 1   DG  I C8    1 
ATOM   10235 N N7    . DG  H 4 1   ? 69.554  -31.925 151.626 1.00 185.85 ? 1   DG  I N7    1 
ATOM   10236 C C5    . DG  H 4 1   ? 69.217  -32.738 150.551 1.00 186.24 ? 1   DG  I C5    1 
ATOM   10237 C C6    . DG  H 4 1   ? 68.641  -34.030 150.523 1.00 184.44 ? 1   DG  I C6    1 
ATOM   10238 O O6    . DG  H 4 1   ? 68.303  -34.734 151.483 1.00 183.09 ? 1   DG  I O6    1 
ATOM   10239 N N1    . DG  H 4 1   ? 68.465  -34.494 149.220 1.00 183.67 ? 1   DG  I N1    1 
ATOM   10240 C C2    . DG  H 4 1   ? 68.804  -33.794 148.085 1.00 185.20 ? 1   DG  I C2    1 
ATOM   10241 N N2    . DG  H 4 1   ? 68.562  -34.400 146.913 1.00 184.88 ? 1   DG  I N2    1 
ATOM   10242 N N3    . DG  H 4 1   ? 69.345  -32.583 148.098 1.00 187.89 ? 1   DG  I N3    1 
ATOM   10243 C C4    . DG  H 4 1   ? 69.521  -32.121 149.360 1.00 188.47 ? 1   DG  I C4    1 
ATOM   10244 P P     . DA  H 4 2   ? 70.673  -27.654 145.251 1.00 211.45 ? 2   DA  I P     1 
ATOM   10245 O OP1   . DA  H 4 2   ? 72.077  -27.710 144.783 1.00 218.87 ? 2   DA  I OP1   1 
ATOM   10246 O OP2   . DA  H 4 2   ? 70.016  -26.347 145.471 1.00 208.23 ? 2   DA  I OP2   1 
ATOM   10247 O "O5'" . DA  H 4 2   ? 69.762  -28.496 144.240 1.00 207.50 ? 2   DA  I "O5'" 1 
ATOM   10248 C "C5'" . DA  H 4 2   ? 68.348  -28.530 144.421 1.00 199.10 ? 2   DA  I "C5'" 1 
ATOM   10249 C "C4'" . DA  H 4 2   ? 67.760  -29.847 143.947 1.00 195.77 ? 2   DA  I "C4'" 1 
ATOM   10250 O "O4'" . DA  H 4 2   ? 67.710  -30.784 145.058 1.00 191.69 ? 2   DA  I "O4'" 1 
ATOM   10251 C "C3'" . DA  H 4 2   ? 66.326  -29.753 143.432 1.00 191.24 ? 2   DA  I "C3'" 1 
ATOM   10252 O "O3'" . DA  H 4 2   ? 66.129  -30.681 142.369 1.00 194.46 ? 2   DA  I "O3'" 1 
ATOM   10253 C "C2'" . DA  H 4 2   ? 65.523  -30.150 144.663 1.00 183.82 ? 2   DA  I "C2'" 1 
ATOM   10254 C "C1'" . DA  H 4 2   ? 66.397  -31.301 145.139 1.00 185.54 ? 2   DA  I "C1'" 1 
ATOM   10255 N N9    . DA  H 4 2   ? 66.109  -31.767 146.494 1.00 180.51 ? 2   DA  I N9    1 
ATOM   10256 C C8    . DA  H 4 2   ? 65.676  -33.016 146.847 1.00 176.64 ? 2   DA  I C8    1 
ATOM   10257 N N7    . DA  H 4 2   ? 65.491  -33.173 148.136 1.00 171.72 ? 2   DA  I N7    1 
ATOM   10258 C C5    . DA  H 4 2   ? 65.822  -31.939 148.668 1.00 171.48 ? 2   DA  I C5    1 
ATOM   10259 C C6    . DA  H 4 2   ? 65.837  -31.451 149.990 1.00 166.56 ? 2   DA  I C6    1 
ATOM   10260 N N6    . DA  H 4 2   ? 65.492  -32.187 151.050 1.00 162.22 ? 2   DA  I N6    1 
ATOM   10261 N N1    . DA  H 4 2   ? 66.218  -30.171 150.181 1.00 167.80 ? 2   DA  I N1    1 
ATOM   10262 C C2    . DA  H 4 2   ? 66.561  -29.436 149.118 1.00 171.68 ? 2   DA  I C2    1 
ATOM   10263 N N3    . DA  H 4 2   ? 66.589  -29.783 147.832 1.00 175.59 ? 2   DA  I N3    1 
ATOM   10264 C C4    . DA  H 4 2   ? 66.204  -31.059 147.672 1.00 176.57 ? 2   DA  I C4    1 
ATOM   10265 P P     . DA  H 4 3   ? 64.780  -30.643 141.494 1.00 192.49 ? 3   DA  I P     1 
ATOM   10266 O OP1   . DA  H 4 3   ? 65.068  -31.310 140.205 1.00 196.24 ? 3   DA  I OP1   1 
ATOM   10267 O OP2   . DA  H 4 3   ? 64.260  -29.259 141.508 1.00 190.96 ? 3   DA  I OP2   1 
ATOM   10268 O "O5'" . DA  H 4 3   ? 63.760  -31.556 142.318 1.00 161.69 ? 3   DA  I "O5'" 1 
ATOM   10269 C "C5'" . DA  H 4 3   ? 63.980  -32.957 142.409 1.00 160.49 ? 3   DA  I "C5'" 1 
ATOM   10270 C "C4'" . DA  H 4 3   ? 62.910  -33.611 143.263 1.00 153.61 ? 3   DA  I "C4'" 1 
ATOM   10271 O "O4'" . DA  H 4 3   ? 63.204  -33.347 144.658 1.00 150.75 ? 3   DA  I "O4'" 1 
ATOM   10272 C "C3'" . DA  H 4 3   ? 61.480  -33.130 143.003 1.00 147.44 ? 3   DA  I "C3'" 1 
ATOM   10273 O "O3'" . DA  H 4 3   ? 60.705  -34.222 142.459 1.00 148.24 ? 3   DA  I "O3'" 1 
ATOM   10274 C "C2'" . DA  H 4 3   ? 60.995  -32.608 144.359 1.00 139.64 ? 3   DA  I "C2'" 1 
ATOM   10275 C "C1'" . DA  H 4 3   ? 62.006  -33.135 145.369 1.00 140.91 ? 3   DA  I "C1'" 1 
ATOM   10276 N N9    . DA  H 4 3   ? 62.279  -32.178 146.437 1.00 139.01 ? 3   DA  I N9    1 
ATOM   10277 C C8    . DA  H 4 3   ? 62.647  -30.872 146.280 1.00 140.00 ? 3   DA  I C8    1 
ATOM   10278 N N7    . DA  H 4 3   ? 62.833  -30.229 147.408 1.00 139.88 ? 3   DA  I N7    1 
ATOM   10279 C C5    . DA  H 4 3   ? 62.565  -31.182 148.374 1.00 139.96 ? 3   DA  I C5    1 
ATOM   10280 C C6    . DA  H 4 3   ? 62.581  -31.129 149.781 1.00 138.83 ? 3   DA  I C6    1 
ATOM   10281 N N6    . DA  H 4 3   ? 62.895  -30.025 150.466 1.00 138.11 ? 3   DA  I N6    1 
ATOM   10282 N N1    . DA  H 4 3   ? 62.266  -32.253 150.456 1.00 138.76 ? 3   DA  I N1    1 
ATOM   10283 C C2    . DA  H 4 3   ? 61.953  -33.353 149.761 1.00 140.87 ? 3   DA  I C2    1 
ATOM   10284 N N3    . DA  H 4 3   ? 61.902  -33.525 148.440 1.00 141.36 ? 3   DA  I N3    1 
ATOM   10285 C C4    . DA  H 4 3   ? 62.222  -32.391 147.796 1.00 140.26 ? 3   DA  I C4    1 
ATOM   10286 P P     . DT  H 4 4   ? 59.117  -34.337 142.704 1.00 139.95 ? 4   DT  I P     1 
ATOM   10287 O OP1   . DT  H 4 4   ? 58.621  -35.386 141.786 1.00 138.22 ? 4   DT  I OP1   1 
ATOM   10288 O OP2   . DT  H 4 4   ? 58.482  -33.000 142.657 1.00 128.32 ? 4   DT  I OP2   1 
ATOM   10289 O "O5'" . DT  H 4 4   ? 59.001  -34.892 144.197 1.00 127.04 ? 4   DT  I "O5'" 1 
ATOM   10290 C "C5'" . DT  H 4 4   ? 57.761  -34.784 144.854 1.00 129.13 ? 4   DT  I "C5'" 1 
ATOM   10291 C "C4'" . DT  H 4 4   ? 57.916  -34.670 146.354 1.00 129.12 ? 4   DT  I "C4'" 1 
ATOM   10292 O "O4'" . DT  H 4 4   ? 58.795  -33.580 146.713 1.00 134.10 ? 4   DT  I "O4'" 1 
ATOM   10293 C "C3'" . DT  H 4 4   ? 56.623  -34.299 147.051 1.00 126.78 ? 4   DT  I "C3'" 1 
ATOM   10294 O "O3'" . DT  H 4 4   ? 55.852  -35.465 147.257 1.00 124.92 ? 4   DT  I "O3'" 1 
ATOM   10295 C "C2'" . DT  H 4 4   ? 57.097  -33.683 148.364 1.00 127.80 ? 4   DT  I "C2'" 1 
ATOM   10296 C "C1'" . DT  H 4 4   ? 58.553  -33.309 148.082 1.00 132.29 ? 4   DT  I "C1'" 1 
ATOM   10297 N N1    . DT  H 4 4   ? 58.905  -31.888 148.419 1.00 131.08 ? 4   DT  I N1    1 
ATOM   10298 C C2    . DT  H 4 4   ? 58.936  -31.520 149.747 1.00 129.28 ? 4   DT  I C2    1 
ATOM   10299 O O2    . DT  H 4 4   ? 58.686  -32.284 150.662 1.00 128.61 ? 4   DT  I O2    1 
ATOM   10300 N N3    . DT  H 4 4   ? 59.271  -30.211 149.973 1.00 130.07 ? 4   DT  I N3    1 
ATOM   10301 C C4    . DT  H 4 4   ? 59.575  -29.251 149.026 1.00 129.63 ? 4   DT  I C4    1 
ATOM   10302 O O4    . DT  H 4 4   ? 59.864  -28.098 149.335 1.00 127.42 ? 4   DT  I O4    1 
ATOM   10303 C C5    . DT  H 4 4   ? 59.528  -29.699 147.656 1.00 131.40 ? 4   DT  I C5    1 
ATOM   10304 C C7    . DT  H 4 4   ? 59.842  -28.740 146.545 1.00 133.86 ? 4   DT  I C7    1 
ATOM   10305 C C6    . DT  H 4 4   ? 59.201  -30.979 147.420 1.00 132.10 ? 4   DT  I C6    1 
ATOM   10306 P P     . DG  H 4 5   ? 54.252  -35.360 147.314 1.00 126.12 ? 5   DG  I P     1 
ATOM   10307 O OP1   . DG  H 4 5   ? 53.696  -36.709 147.071 1.00 129.50 ? 5   DG  I OP1   1 
ATOM   10308 O OP2   . DG  H 4 5   ? 53.859  -34.229 146.444 1.00 121.35 ? 5   DG  I OP2   1 
ATOM   10309 O "O5'" . DG  H 4 5   ? 53.958  -34.931 148.825 1.00 121.53 ? 5   DG  I "O5'" 1 
ATOM   10310 C "C5'" . DG  H 4 5   ? 54.541  -35.666 149.891 1.00 113.03 ? 5   DG  I "C5'" 1 
ATOM   10311 C "C4'" . DG  H 4 5   ? 54.392  -34.871 151.169 1.00 112.73 ? 5   DG  I "C4'" 1 
ATOM   10312 O "O4'" . DG  H 4 5   ? 55.277  -33.726 151.134 1.00 126.47 ? 5   DG  I "O4'" 1 
ATOM   10313 C "C3'" . DG  H 4 5   ? 52.984  -34.329 151.373 1.00 113.56 ? 5   DG  I "C3'" 1 
ATOM   10314 O "O3'" . DG  H 4 5   ? 52.439  -34.918 152.544 1.00 111.49 ? 5   DG  I "O3'" 1 
ATOM   10315 C "C2'" . DG  H 4 5   ? 53.151  -32.814 151.506 1.00 119.63 ? 5   DG  I "C2'" 1 
ATOM   10316 C "C1'" . DG  H 4 5   ? 54.643  -32.640 151.772 1.00 126.80 ? 5   DG  I "C1'" 1 
ATOM   10317 N N9    . DG  H 4 5   ? 55.189  -31.393 151.239 1.00 133.19 ? 5   DG  I N9    1 
ATOM   10318 C C8    . DG  H 4 5   ? 55.405  -31.080 149.918 1.00 135.39 ? 5   DG  I C8    1 
ATOM   10319 N N7    . DG  H 4 5   ? 55.907  -29.889 149.739 1.00 135.92 ? 5   DG  I N7    1 
ATOM   10320 C C5    . DG  H 4 5   ? 56.032  -29.377 151.024 1.00 136.18 ? 5   DG  I C5    1 
ATOM   10321 C C6    . DG  H 4 5   ? 56.519  -28.122 151.462 1.00 138.71 ? 5   DG  I C6    1 
ATOM   10322 O O6    . DG  H 4 5   ? 56.950  -27.182 150.780 1.00 140.05 ? 5   DG  I O6    1 
ATOM   10323 N N1    . DG  H 4 5   ? 56.473  -28.009 152.850 1.00 140.73 ? 5   DG  I N1    1 
ATOM   10324 C C2    . DG  H 4 5   ? 56.018  -28.984 153.705 1.00 141.49 ? 5   DG  I C2    1 
ATOM   10325 N N2    . DG  H 4 5   ? 56.052  -28.691 155.013 1.00 145.05 ? 5   DG  I N2    1 
ATOM   10326 N N3    . DG  H 4 5   ? 55.559  -30.164 153.306 1.00 138.43 ? 5   DG  I N3    1 
ATOM   10327 C C4    . DG  H 4 5   ? 55.595  -30.291 151.958 1.00 135.59 ? 5   DG  I C4    1 
ATOM   10328 P P     . DT  H 4 6   ? 50.870  -34.792 152.864 1.00 130.24 ? 6   DT  I P     1 
ATOM   10329 O OP1   . DT  H 4 6   ? 50.451  -36.061 153.502 1.00 133.24 ? 6   DT  I OP1   1 
ATOM   10330 O OP2   . DT  H 4 6   ? 50.184  -34.312 151.643 1.00 125.90 ? 6   DT  I OP2   1 
ATOM   10331 O "O5'" . DT  H 4 6   ? 50.801  -33.616 153.942 1.00 112.49 ? 6   DT  I "O5'" 1 
ATOM   10332 C "C5'" . DT  H 4 6   ? 51.768  -33.563 154.979 1.00 118.85 ? 6   DT  I "C5'" 1 
ATOM   10333 C "C4'" . DT  H 4 6   ? 51.909  -32.145 155.500 1.00 120.90 ? 6   DT  I "C4'" 1 
ATOM   10334 O "O4'" . DT  H 4 6   ? 52.548  -31.305 154.510 1.00 121.51 ? 6   DT  I "O4'" 1 
ATOM   10335 C "C3'" . DT  H 4 6   ? 50.596  -31.445 155.842 1.00 122.86 ? 6   DT  I "C3'" 1 
ATOM   10336 O "O3'" . DT  H 4 6   ? 50.464  -31.406 157.258 1.00 117.97 ? 6   DT  I "O3'" 1 
ATOM   10337 C "C2'" . DT  H 4 6   ? 50.729  -30.044 155.238 1.00 124.94 ? 6   DT  I "C2'" 1 
ATOM   10338 C "C1'" . DT  H 4 6   ? 52.197  -29.977 154.827 1.00 126.39 ? 6   DT  I "C1'" 1 
ATOM   10339 N N1    . DT  H 4 6   ? 52.472  -29.101 153.650 1.00 130.78 ? 6   DT  I N1    1 
ATOM   10340 C C2    . DT  H 4 6   ? 53.057  -27.870 153.861 1.00 137.49 ? 6   DT  I C2    1 
ATOM   10341 O O2    . DT  H 4 6   ? 53.363  -27.455 154.965 1.00 141.82 ? 6   DT  I O2    1 
ATOM   10342 N N3    . DT  H 4 6   ? 53.274  -27.138 152.722 1.00 136.97 ? 6   DT  I N3    1 
ATOM   10343 C C4    . DT  H 4 6   ? 52.970  -27.506 151.424 1.00 134.22 ? 6   DT  I C4    1 
ATOM   10344 O O4    . DT  H 4 6   ? 53.204  -26.777 150.465 1.00 135.13 ? 6   DT  I O4    1 
ATOM   10345 C C5    . DT  H 4 6   ? 52.361  -28.805 151.276 1.00 128.51 ? 6   DT  I C5    1 
ATOM   10346 C C7    . DT  H 4 6   ? 51.989  -29.309 149.913 1.00 124.78 ? 6   DT  I C7    1 
ATOM   10347 C C6    . DT  H 4 6   ? 52.144  -29.531 152.381 1.00 127.98 ? 6   DT  I C6    1 
ATOM   10348 P P     . DG  H 4 7   ? 49.148  -30.790 157.945 1.00 215.15 ? 7   DG  I P     1 
ATOM   10349 O OP1   . DG  H 4 7   ? 48.983  -31.466 159.249 1.00 92.28  ? 7   DG  I OP1   1 
ATOM   10350 O OP2   . DG  H 4 7   ? 48.041  -30.799 156.964 1.00 102.14 ? 7   DG  I OP2   1 
ATOM   10351 O "O5'" . DG  H 4 7   ? 49.537  -29.264 158.204 1.00 121.43 ? 7   DG  I "O5'" 1 
ATOM   10352 C "C5'" . DG  H 4 7   ? 50.781  -28.949 158.811 1.00 123.51 ? 7   DG  I "C5'" 1 
ATOM   10353 C "C4'" . DG  H 4 7   ? 50.978  -27.448 158.791 1.00 124.61 ? 7   DG  I "C4'" 1 
ATOM   10354 O "O4'" . DG  H 4 7   ? 51.416  -27.045 157.469 1.00 124.70 ? 7   DG  I "O4'" 1 
ATOM   10355 C "C3'" . DG  H 4 7   ? 49.709  -26.653 159.100 1.00 127.37 ? 7   DG  I "C3'" 1 
ATOM   10356 O "O3'" . DG  H 4 7   ? 49.938  -25.723 160.155 1.00 130.93 ? 7   DG  I "O3'" 1 
ATOM   10357 C "C2'" . DG  H 4 7   ? 49.401  -25.936 157.789 1.00 127.78 ? 7   DG  I "C2'" 1 
ATOM   10358 C "C1'" . DG  H 4 7   ? 50.777  -25.831 157.148 1.00 129.38 ? 7   DG  I "C1'" 1 
ATOM   10359 N N9    . DG  H 4 7   ? 50.706  -25.691 155.699 1.00 134.94 ? 7   DG  I N9    1 
ATOM   10360 C C8    . DG  H 4 7   ? 50.249  -26.621 154.799 1.00 136.83 ? 7   DG  I C8    1 
ATOM   10361 N N7    . DG  H 4 7   ? 50.299  -26.213 153.562 1.00 137.30 ? 7   DG  I N7    1 
ATOM   10362 C C5    . DG  H 4 7   ? 50.818  -24.928 153.650 1.00 136.84 ? 7   DG  I C5    1 
ATOM   10363 C C6    . DG  H 4 7   ? 51.099  -23.987 152.632 1.00 138.47 ? 7   DG  I C6    1 
ATOM   10364 O O6    . DG  H 4 7   ? 50.937  -24.109 151.410 1.00 137.52 ? 7   DG  I O6    1 
ATOM   10365 N N1    . DG  H 4 7   ? 51.618  -22.804 153.153 1.00 141.62 ? 7   DG  I N1    1 
ATOM   10366 C C2    . DG  H 4 7   ? 51.838  -22.560 154.488 1.00 141.75 ? 7   DG  I C2    1 
ATOM   10367 N N2    . DG  H 4 7   ? 52.346  -21.357 154.797 1.00 143.48 ? 7   DG  I N2    1 
ATOM   10368 N N3    . DG  H 4 7   ? 51.580  -23.434 155.453 1.00 139.17 ? 7   DG  I N3    1 
ATOM   10369 C C4    . DG  H 4 7   ? 51.073  -24.591 154.960 1.00 136.99 ? 7   DG  I C4    1 
ATOM   10370 P P     . DT  H 4 8   ? 48.732  -25.270 161.120 1.00 159.19 ? 8   DT  I P     1 
ATOM   10371 O OP1   . DT  H 4 8   ? 48.959  -25.896 162.441 1.00 158.52 ? 8   DT  I OP1   1 
ATOM   10372 O OP2   . DT  H 4 8   ? 47.456  -25.495 160.408 1.00 159.67 ? 8   DT  I OP2   1 
ATOM   10373 O "O5'" . DT  H 4 8   ? 48.920  -23.686 161.250 1.00 127.13 ? 8   DT  I "O5'" 1 
ATOM   10374 C "C5'" . DT  H 4 8   ? 48.211  -22.808 160.381 1.00 131.98 ? 8   DT  I "C5'" 1 
ATOM   10375 C "C4'" . DT  H 4 8   ? 49.072  -21.623 159.985 1.00 138.16 ? 8   DT  I "C4'" 1 
ATOM   10376 O "O4'" . DT  H 4 8   ? 49.909  -22.002 158.861 1.00 140.97 ? 8   DT  I "O4'" 1 
ATOM   10377 C "C3'" . DT  H 4 8   ? 48.320  -20.393 159.486 1.00 142.32 ? 8   DT  I "C3'" 1 
ATOM   10378 O "O3'" . DT  H 4 8   ? 47.740  -19.638 160.588 1.00 143.68 ? 8   DT  I "O3'" 1 
ATOM   10379 C "C2'" . DT  H 4 8   ? 49.419  -19.709 158.679 1.00 143.05 ? 8   DT  I "C2'" 1 
ATOM   10380 C "C1'" . DT  H 4 8   ? 50.042  -20.908 157.970 1.00 145.08 ? 8   DT  I "C1'" 1 
ATOM   10381 N N1    . DT  H 4 8   ? 49.391  -21.254 156.664 1.00 151.00 ? 8   DT  I N1    1 
ATOM   10382 C C2    . DT  H 4 8   ? 49.433  -20.355 155.615 1.00 154.69 ? 8   DT  I C2    1 
ATOM   10383 O O2    . DT  H 4 8   ? 49.977  -19.265 155.672 1.00 155.38 ? 8   DT  I O2    1 
ATOM   10384 N N3    . DT  H 4 8   ? 48.806  -20.781 154.472 1.00 155.90 ? 8   DT  I N3    1 
ATOM   10385 C C4    . DT  H 4 8   ? 48.156  -21.985 154.272 1.00 152.09 ? 8   DT  I C4    1 
ATOM   10386 O O4    . DT  H 4 8   ? 47.624  -22.276 153.206 1.00 149.84 ? 8   DT  I O4    1 
ATOM   10387 C C5    . DT  H 4 8   ? 48.148  -22.876 155.404 1.00 150.52 ? 8   DT  I C5    1 
ATOM   10388 C C7    . DT  H 4 8   ? 47.470  -24.210 155.299 1.00 149.53 ? 8   DT  I C7    1 
ATOM   10389 C C6    . DT  H 4 8   ? 48.757  -22.474 156.528 1.00 151.38 ? 8   DT  I C6    1 
ATOM   10390 P P     . DG  H 4 9   ? 48.412  -18.282 161.146 1.00 153.19 ? 9   DG  I P     1 
ATOM   10391 O OP1   . DG  H 4 9   ? 49.836  -18.538 161.454 1.00 154.98 ? 9   DG  I OP1   1 
ATOM   10392 O OP2   . DG  H 4 9   ? 47.531  -17.784 162.226 1.00 152.52 ? 9   DG  I OP2   1 
ATOM   10393 O "O5'" . DG  H 4 9   ? 48.279  -17.238 159.938 1.00 145.24 ? 9   DG  I "O5'" 1 
ATOM   10394 C "C5'" . DG  H 4 9   ? 49.265  -16.226 159.748 1.00 147.38 ? 9   DG  I "C5'" 1 
ATOM   10395 C "C4'" . DG  H 4 9   ? 48.843  -15.268 158.648 1.00 150.09 ? 9   DG  I "C4'" 1 
ATOM   10396 O "O4'" . DG  H 4 9   ? 48.660  -15.984 157.399 1.00 152.91 ? 9   DG  I "O4'" 1 
ATOM   10397 C "C3'" . DG  H 4 9   ? 47.542  -14.525 158.925 1.00 150.50 ? 9   DG  I "C3'" 1 
ATOM   10398 O "O3'" . DG  H 4 9   ? 47.728  -13.147 158.644 1.00 149.39 ? 9   DG  I "O3'" 1 
ATOM   10399 C "C2'" . DG  H 4 9   ? 46.517  -15.172 157.994 1.00 151.07 ? 9   DG  I "C2'" 1 
ATOM   10400 C "C1'" . DG  H 4 9   ? 47.367  -15.758 156.874 1.00 154.59 ? 9   DG  I "C1'" 1 
ATOM   10401 N N9    . DG  H 4 9   ? 46.855  -17.038 156.395 1.00 158.87 ? 9   DG  I N9    1 
ATOM   10402 C C8    . DG  H 4 9   ? 46.462  -18.107 157.164 1.00 160.09 ? 9   DG  I C8    1 
ATOM   10403 N N7    . DG  H 4 9   ? 46.050  -19.127 156.462 1.00 158.60 ? 9   DG  I N7    1 
ATOM   10404 C C5    . DG  H 4 9   ? 46.181  -18.708 155.144 1.00 158.88 ? 9   DG  I C5    1 
ATOM   10405 C C6    . DG  H 4 9   ? 45.889  -19.386 153.937 1.00 160.88 ? 9   DG  I C6    1 
ATOM   10406 O O6    . DG  H 4 9   ? 45.441  -20.532 153.789 1.00 162.89 ? 9   DG  I O6    1 
ATOM   10407 N N1    . DG  H 4 9   ? 46.169  -18.597 152.824 1.00 160.13 ? 9   DG  I N1    1 
ATOM   10408 C C2    . DG  H 4 9   ? 46.667  -17.316 152.870 1.00 155.66 ? 9   DG  I C2    1 
ATOM   10409 N N2    . DG  H 4 9   ? 46.872  -16.715 151.690 1.00 152.33 ? 9   DG  I N2    1 
ATOM   10410 N N3    . DG  H 4 9   ? 46.944  -16.669 153.994 1.00 156.18 ? 9   DG  I N3    1 
ATOM   10411 C C4    . DG  H 4 9   ? 46.677  -17.424 155.087 1.00 158.22 ? 9   DG  I C4    1 
ATOM   10412 P P     . DT  H 4 10  ? 46.507  -12.116 158.801 1.00 185.77 ? 10  DT  I P     1 
ATOM   10413 O OP1   . DT  H 4 10  ? 47.085  -10.781 159.070 1.00 189.70 ? 10  DT  I OP1   1 
ATOM   10414 O OP2   . DT  H 4 10  ? 45.535  -12.699 159.751 1.00 183.01 ? 10  DT  I OP2   1 
ATOM   10415 O "O5'" . DT  H 4 10  ? 45.839  -12.097 157.349 1.00 138.06 ? 10  DT  I "O5'" 1 
ATOM   10416 C "C5'" . DT  H 4 10  ? 46.634  -11.758 156.219 1.00 142.11 ? 10  DT  I "C5'" 1 
ATOM   10417 C "C4'" . DT  H 4 10  ? 45.774  -11.693 154.972 1.00 149.04 ? 10  DT  I "C4'" 1 
ATOM   10418 O "O4'" . DT  H 4 10  ? 45.602  -13.017 154.412 1.00 154.15 ? 10  DT  I "O4'" 1 
ATOM   10419 C "C3'" . DT  H 4 10  ? 44.378  -11.134 155.218 1.00 151.34 ? 10  DT  I "C3'" 1 
ATOM   10420 O "O3'" . DT  H 4 10  ? 44.229  -9.935  154.477 1.00 155.33 ? 10  DT  I "O3'" 1 
ATOM   10421 C "C2'" . DT  H 4 10  ? 43.411  -12.220 154.744 1.00 149.85 ? 10  DT  I "C2'" 1 
ATOM   10422 C "C1'" . DT  H 4 10  ? 44.289  -13.147 153.912 1.00 153.38 ? 10  DT  I "C1'" 1 
ATOM   10423 N N1    . DT  H 4 10  ? 43.907  -14.583 154.018 1.00 155.08 ? 10  DT  I N1    1 
ATOM   10424 C C2    . DT  H 4 10  ? 43.760  -15.320 152.864 1.00 154.07 ? 10  DT  I C2    1 
ATOM   10425 O O2    . DT  H 4 10  ? 43.924  -14.854 151.750 1.00 151.03 ? 10  DT  I O2    1 
ATOM   10426 N N3    . DT  H 4 10  ? 43.410  -16.631 153.068 1.00 156.23 ? 10  DT  I N3    1 
ATOM   10427 C C4    . DT  H 4 10  ? 43.200  -17.259 154.282 1.00 156.17 ? 10  DT  I C4    1 
ATOM   10428 O O4    . DT  H 4 10  ? 42.888  -18.443 154.360 1.00 156.54 ? 10  DT  I O4    1 
ATOM   10429 C C5    . DT  H 4 10  ? 43.372  -16.431 155.448 1.00 155.15 ? 10  DT  I C5    1 
ATOM   10430 C C7    . DT  H 4 10  ? 43.168  -17.008 156.818 1.00 153.74 ? 10  DT  I C7    1 
ATOM   10431 C C6    . DT  H 4 10  ? 43.713  -15.148 155.264 1.00 155.85 ? 10  DT  I C6    1 
ATOM   10432 P P     . DC  H 4 11  ? 43.001  -8.946  154.781 1.00 146.18 ? 11  DC  I P     1 
ATOM   10433 O OP1   . DC  H 4 11  ? 43.459  -7.565  154.513 1.00 148.65 ? 11  DC  I OP1   1 
ATOM   10434 O OP2   . DC  H 4 11  ? 42.452  -9.297  156.110 1.00 141.29 ? 11  DC  I OP2   1 
ATOM   10435 O "O5'" . DC  H 4 11  ? 41.912  -9.350  153.686 1.00 157.48 ? 11  DC  I "O5'" 1 
ATOM   10436 C "C5'" . DC  H 4 11  ? 42.266  -9.405  152.311 1.00 156.32 ? 11  DC  I "C5'" 1 
ATOM   10437 C "C4'" . DC  H 4 11  ? 41.076  -9.914  151.525 1.00 156.09 ? 11  DC  I "C4'" 1 
ATOM   10438 O "O4'" . DC  H 4 11  ? 41.074  -11.361 151.565 1.00 154.15 ? 11  DC  I "O4'" 1 
ATOM   10439 C "C3'" . DC  H 4 11  ? 39.739  -9.440  152.085 1.00 156.97 ? 11  DC  I "C3'" 1 
ATOM   10440 O "O3'" . DC  H 4 11  ? 39.071  -8.595  151.146 1.00 159.83 ? 11  DC  I "O3'" 1 
ATOM   10441 C "C2'" . DC  H 4 11  ? 38.943  -10.711 152.391 1.00 155.30 ? 11  DC  I "C2'" 1 
ATOM   10442 C "C1'" . DC  H 4 11  ? 39.771  -11.849 151.800 1.00 153.45 ? 11  DC  I "C1'" 1 
ATOM   10443 N N1    . DC  H 4 11  ? 39.895  -13.024 152.706 1.00 152.88 ? 11  DC  I N1    1 
ATOM   10444 C C2    . DC  H 4 11  ? 40.187  -14.280 152.165 1.00 151.56 ? 11  DC  I C2    1 
ATOM   10445 O O2    . DC  H 4 11  ? 40.336  -14.387 150.942 1.00 150.35 ? 11  DC  I O2    1 
ATOM   10446 N N3    . DC  H 4 11  ? 40.300  -15.343 152.999 1.00 152.62 ? 11  DC  I N3    1 
ATOM   10447 C C4    . DC  H 4 11  ? 40.133  -15.179 154.312 1.00 153.50 ? 11  DC  I C4    1 
ATOM   10448 N N4    . DC  H 4 11  ? 40.253  -16.257 155.095 1.00 153.35 ? 11  DC  I N4    1 
ATOM   10449 C C5    . DC  H 4 11  ? 39.835  -13.906 154.882 1.00 154.02 ? 11  DC  I C5    1 
ATOM   10450 C C6    . DC  H 4 11  ? 39.726  -12.866 154.050 1.00 153.52 ? 11  DC  I C6    1 
ATOM   10451 P P     . DT  H 4 12  ? 37.782  -7.746  151.598 1.00 191.33 ? 12  DT  I P     1 
ATOM   10452 O OP1   . DT  H 4 12  ? 37.695  -6.548  150.732 1.00 191.91 ? 12  DT  I OP1   1 
ATOM   10453 O OP2   . DT  H 4 12  ? 37.832  -7.587  153.067 1.00 187.23 ? 12  DT  I OP2   1 
ATOM   10454 O "O5'" . DT  H 4 12  ? 36.554  -8.712  151.267 1.00 199.48 ? 12  DT  I "O5'" 1 
ATOM   10455 C "C5'" . DT  H 4 12  ? 35.334  -8.575  151.973 1.00 198.51 ? 12  DT  I "C5'" 1 
ATOM   10456 C "C4'" . DT  H 4 12  ? 34.210  -9.221  151.189 1.00 201.20 ? 12  DT  I "C4'" 1 
ATOM   10457 O "O4'" . DT  H 4 12  ? 34.545  -10.596 150.886 1.00 202.43 ? 12  DT  I "O4'" 1 
ATOM   10458 C "C3'" . DT  H 4 12  ? 32.878  -9.301  151.918 1.00 204.03 ? 12  DT  I "C3'" 1 
ATOM   10459 O "O3'" . DT  H 4 12  ? 32.171  -8.058  151.775 1.00 202.96 ? 12  DT  I "O3'" 1 
ATOM   10460 C "C2'" . DT  H 4 12  ? 32.191  -10.496 151.255 1.00 207.27 ? 12  DT  I "C2'" 1 
ATOM   10461 C "C1'" . DT  H 4 12  ? 33.354  -11.345 150.733 1.00 206.59 ? 12  DT  I "C1'" 1 
ATOM   10462 N N1    . DT  H 4 12  ? 33.528  -12.645 151.445 1.00 207.40 ? 12  DT  I N1    1 
ATOM   10463 C C2    . DT  H 4 12  ? 32.665  -13.688 151.180 1.00 208.15 ? 12  DT  I C2    1 
ATOM   10464 O O2    . DT  H 4 12  ? 31.745  -13.614 150.385 1.00 207.29 ? 12  DT  I O2    1 
ATOM   10465 N N3    . DT  H 4 12  ? 32.924  -14.833 151.892 1.00 209.59 ? 12  DT  I N3    1 
ATOM   10466 C C4    . DT  H 4 12  ? 33.934  -15.032 152.818 1.00 208.84 ? 12  DT  I C4    1 
ATOM   10467 O O4    . DT  H 4 12  ? 34.084  -16.099 153.405 1.00 210.21 ? 12  DT  I O4    1 
ATOM   10468 C C5    . DT  H 4 12  ? 34.799  -13.902 153.043 1.00 205.62 ? 12  DT  I C5    1 
ATOM   10469 C C7    . DT  H 4 12  ? 35.931  -13.998 154.024 1.00 202.05 ? 12  DT  I C7    1 
ATOM   10470 C C6    . DT  H 4 12  ? 34.558  -12.779 152.355 1.00 205.65 ? 12  DT  I C6    1 
ATOM   10471 P P     . DC  H 4 13  ? 31.289  -7.744  150.465 1.00 181.52 ? 13  DC  I P     1 
ATOM   10472 O OP1   . DC  H 4 13  ? 29.924  -8.256  150.714 1.00 181.52 ? 13  DC  I OP1   1 
ATOM   10473 O OP2   . DC  H 4 13  ? 32.023  -8.155  149.249 1.00 180.01 ? 13  DC  I OP2   1 
ATOM   10474 O "O5'" . DC  H 4 13  ? 31.198  -6.150  150.448 1.00 128.52 ? 13  DC  I "O5'" 1 
ATOM   10475 C "C5'" . DC  H 4 13  ? 30.952  -5.467  149.228 1.00 123.41 ? 13  DC  I "C5'" 1 
ATOM   10476 C "C4'" . DC  H 4 13  ? 30.454  -4.076  149.543 1.00 113.85 ? 13  DC  I "C4'" 1 
ATOM   10477 O "O4'" . DC  H 4 13  ? 29.106  -4.191  150.050 1.00 111.65 ? 13  DC  I "O4'" 1 
ATOM   10478 C "C3'" . DC  H 4 13  ? 31.276  -3.357  150.605 1.00 114.98 ? 13  DC  I "C3'" 1 
ATOM   10479 O "O3'" . DC  H 4 13  ? 31.737  -2.115  150.091 1.00 120.18 ? 13  DC  I "O3'" 1 
ATOM   10480 C "C2'" . DC  H 4 13  ? 30.329  -3.156  151.785 1.00 110.82 ? 13  DC  I "C2'" 1 
ATOM   10481 C "C1'" . DC  H 4 13  ? 28.943  -3.385  151.194 1.00 111.29 ? 13  DC  I "C1'" 1 
ATOM   10482 N N1    . DC  H 4 13  ? 28.020  -4.094  152.120 1.00 113.61 ? 13  DC  I N1    1 
ATOM   10483 C C2    . DC  H 4 13  ? 27.162  -3.347  152.932 1.00 110.96 ? 13  DC  I C2    1 
ATOM   10484 O O2    . DC  H 4 13  ? 27.189  -2.111  152.866 1.00 104.42 ? 13  DC  I O2    1 
ATOM   10485 N N3    . DC  H 4 13  ? 26.326  -4.006  153.770 1.00 109.73 ? 13  DC  I N3    1 
ATOM   10486 C C4    . DC  H 4 13  ? 26.329  -5.340  153.814 1.00 112.69 ? 13  DC  I C4    1 
ATOM   10487 N N4    . DC  H 4 13  ? 25.482  -5.938  154.659 1.00 110.35 ? 13  DC  I N4    1 
ATOM   10488 C C5    . DC  H 4 13  ? 27.196  -6.119  152.993 1.00 108.96 ? 13  DC  I C5    1 
ATOM   10489 C C6    . DC  H 4 13  ? 28.016  -5.459  152.168 1.00 116.10 ? 13  DC  I C6    1 
ATOM   10490 P P     . DA  H 4 14  ? 33.109  -1.474  150.629 1.00 147.93 ? 14  DA  I P     1 
ATOM   10491 O OP1   . DA  H 4 14  ? 33.813  -0.893  149.466 1.00 151.72 ? 14  DA  I OP1   1 
ATOM   10492 O OP2   . DA  H 4 14  ? 33.793  -2.469  151.484 1.00 145.66 ? 14  DA  I OP2   1 
ATOM   10493 O "O5'" . DA  H 4 14  ? 32.626  -0.296  151.589 1.00 102.58 ? 14  DA  I "O5'" 1 
ATOM   10494 C "C5'" . DA  H 4 14  ? 31.738  0.704   151.119 1.00 110.52 ? 14  DA  I "C5'" 1 
ATOM   10495 C "C4'" . DA  H 4 14  ? 31.050  1.343   152.312 1.00 113.44 ? 14  DA  I "C4'" 1 
ATOM   10496 O "O4'" . DA  H 4 14  ? 30.145  0.383   152.922 1.00 117.45 ? 14  DA  I "O4'" 1 
ATOM   10497 C "C3'" . DA  H 4 14  ? 31.975  1.799   153.441 1.00 114.79 ? 14  DA  I "C3'" 1 
ATOM   10498 O "O3'" . DA  H 4 14  ? 31.472  3.011   153.987 1.00 118.05 ? 14  DA  I "O3'" 1 
ATOM   10499 C "C2'" . DA  H 4 14  ? 31.840  0.666   154.454 1.00 115.28 ? 14  DA  I "C2'" 1 
ATOM   10500 C "C1'" . DA  H 4 14  ? 30.344  0.423   154.321 1.00 117.45 ? 14  DA  I "C1'" 1 
ATOM   10501 N N9    . DA  H 4 14  ? 29.866  -0.828  154.903 1.00 116.24 ? 14  DA  I N9    1 
ATOM   10502 C C8    . DA  H 4 14  ? 30.528  -2.022  154.952 1.00 114.03 ? 14  DA  I C8    1 
ATOM   10503 N N7    . DA  H 4 14  ? 29.845  -2.982  155.531 1.00 112.03 ? 14  DA  I N7    1 
ATOM   10504 C C5    . DA  H 4 14  ? 28.653  -2.375  155.888 1.00 112.26 ? 14  DA  I C5    1 
ATOM   10505 C C6    . DA  H 4 14  ? 27.505  -2.861  156.541 1.00 110.59 ? 14  DA  I C6    1 
ATOM   10506 N N6    . DA  H 4 14  ? 27.377  -4.123  156.963 1.00 106.90 ? 14  DA  I N6    1 
ATOM   10507 N N1    . DA  H 4 14  ? 26.491  -1.995  156.741 1.00 106.88 ? 14  DA  I N1    1 
ATOM   10508 C C2    . DA  H 4 14  ? 26.628  -0.731  156.317 1.00 103.85 ? 14  DA  I C2    1 
ATOM   10509 N N3    . DA  H 4 14  ? 27.658  -0.160  155.692 1.00 105.51 ? 14  DA  I N3    1 
ATOM   10510 C C4    . DA  H 4 14  ? 28.648  -1.047  155.507 1.00 112.30 ? 14  DA  I C4    1 
ATOM   10511 P P     . DA  H 4 15  ? 32.431  4.004   154.813 1.00 181.62 ? 15  DA  I P     1 
ATOM   10512 O OP1   . DA  H 4 15  ? 32.933  5.017   153.860 1.00 85.83  ? 15  DA  I OP1   1 
ATOM   10513 O OP2   . DA  H 4 15  ? 33.368  3.195   155.627 1.00 78.04  ? 15  DA  I OP2   1 
ATOM   10514 O "O5'" . DA  H 4 15  ? 31.440  4.756   155.819 1.00 72.97  ? 15  DA  I "O5'" 1 
ATOM   10515 C "C5'" . DA  H 4 15  ? 30.411  5.636   155.365 1.00 89.88  ? 15  DA  I "C5'" 1 
ATOM   10516 C "C4'" . DA  H 4 15  ? 29.310  5.759   156.412 1.00 102.77 ? 15  DA  I "C4'" 1 
ATOM   10517 O "O4'" . DA  H 4 15  ? 28.786  4.446   156.736 1.00 101.98 ? 15  DA  I "O4'" 1 
ATOM   10518 C "C3'" . DA  H 4 15  ? 29.727  6.350   157.754 1.00 102.26 ? 15  DA  I "C3'" 1 
ATOM   10519 O "O3'" . DA  H 4 15  ? 28.626  7.025   158.349 1.00 99.76  ? 15  DA  I "O3'" 1 
ATOM   10520 C "C2'" . DA  H 4 15  ? 30.119  5.119   158.568 1.00 98.59  ? 15  DA  I "C2'" 1 
ATOM   10521 C "C1'" . DA  H 4 15  ? 29.083  4.120   158.080 1.00 96.47  ? 15  DA  I "C1'" 1 
ATOM   10522 N N9    . DA  H 4 15  ? 29.522  2.732   158.072 1.00 95.12  ? 15  DA  I N9    1 
ATOM   10523 C C8    . DA  H 4 15  ? 30.601  2.170   157.448 1.00 99.01  ? 15  DA  I C8    1 
ATOM   10524 N N7    . DA  H 4 15  ? 30.696  0.871   157.631 1.00 91.06  ? 15  DA  I N7    1 
ATOM   10525 C C5    . DA  H 4 15  ? 29.603  0.566   158.417 1.00 85.68  ? 15  DA  I C5    1 
ATOM   10526 C C6    . DA  H 4 15  ? 29.119  -0.636  158.965 1.00 87.74  ? 15  DA  I C6    1 
ATOM   10527 N N6    . DA  H 4 15  ? 29.700  -1.831  158.802 1.00 92.00  ? 15  DA  I N6    1 
ATOM   10528 N N1    . DA  H 4 15  ? 27.995  -0.555  159.697 1.00 84.96  ? 15  DA  I N1    1 
ATOM   10529 C C2    . DA  H 4 15  ? 27.406  0.635   159.863 1.00 85.62  ? 15  DA  I C2    1 
ATOM   10530 N N3    . DA  H 4 15  ? 27.752  1.823   159.410 1.00 91.55  ? 15  DA  I N3    1 
ATOM   10531 C C4    . DA  H 4 15  ? 28.872  1.706   158.690 1.00 90.34  ? 15  DA  I C4    1 
ATOM   10532 P P     . DT  H 4 16  ? 28.797  7.736   159.780 1.00 142.67 ? 16  DT  I P     1 
ATOM   10533 O OP1   . DT  H 4 16  ? 27.931  8.935   159.803 1.00 144.77 ? 16  DT  I OP1   1 
ATOM   10534 O OP2   . DT  H 4 16  ? 30.249  7.870   160.036 1.00 144.63 ? 16  DT  I OP2   1 
ATOM   10535 O "O5'" . DT  H 4 16  ? 28.218  6.662   160.814 1.00 110.08 ? 16  DT  I "O5'" 1 
ATOM   10536 C "C5'" . DT  H 4 16  ? 26.888  6.180   160.654 1.00 104.58 ? 16  DT  I "C5'" 1 
ATOM   10537 C "C4'" . DT  H 4 16  ? 26.462  5.321   161.832 1.00 97.26  ? 16  DT  I "C4'" 1 
ATOM   10538 O "O4'" . DT  H 4 16  ? 26.991  3.982   161.690 1.00 100.15 ? 16  DT  I "O4'" 1 
ATOM   10539 C "C3'" . DT  H 4 16  ? 26.916  5.822   163.201 1.00 93.57  ? 16  DT  I "C3'" 1 
ATOM   10540 O "O3'" . DT  H 4 16  ? 25.768  6.142   163.989 1.00 94.92  ? 16  DT  I "O3'" 1 
ATOM   10541 C "C2'" . DT  H 4 16  ? 27.742  4.671   163.784 1.00 87.01  ? 16  DT  I "C2'" 1 
ATOM   10542 C "C1'" . DT  H 4 16  ? 27.279  3.469   162.971 1.00 96.38  ? 16  DT  I "C1'" 1 
ATOM   10543 N N1    . DT  H 4 16  ? 28.292  2.389   162.786 1.00 96.16  ? 16  DT  I N1    1 
ATOM   10544 C C2    . DT  H 4 16  ? 28.026  1.121   163.256 1.00 97.01  ? 16  DT  I C2    1 
ATOM   10545 O O2    . DT  H 4 16  ? 26.999  0.826   163.839 1.00 103.91 ? 16  DT  I O2    1 
ATOM   10546 N N3    . DT  H 4 16  ? 29.014  0.198   163.024 1.00 95.28  ? 16  DT  I N3    1 
ATOM   10547 C C4    . DT  H 4 16  ? 30.216  0.413   162.378 1.00 100.41 ? 16  DT  I C4    1 
ATOM   10548 O O4    . DT  H 4 16  ? 31.047  -0.477  162.215 1.00 101.05 ? 16  DT  I O4    1 
ATOM   10549 C C5    . DT  H 4 16  ? 30.427  1.759   161.907 1.00 98.02  ? 16  DT  I C5    1 
ATOM   10550 C C7    . DT  H 4 16  ? 31.698  2.102   161.192 1.00 94.18  ? 16  DT  I C7    1 
ATOM   10551 C C6    . DT  H 4 16  ? 29.470  2.670   162.126 1.00 98.40  ? 16  DT  I C6    1 
ATOM   10552 P P     . DC  H 4 17  ? 25.940  6.673   165.495 1.00 115.21 ? 17  DC  I P     1 
ATOM   10553 O OP1   . DC  H 4 17  ? 24.735  7.449   165.864 1.00 118.78 ? 17  DC  I OP1   1 
ATOM   10554 O OP2   . DC  H 4 17  ? 27.271  7.309   165.599 1.00 116.33 ? 17  DC  I OP2   1 
ATOM   10555 O "O5'" . DC  H 4 17  ? 25.962  5.333   166.360 1.00 110.53 ? 17  DC  I "O5'" 1 
ATOM   10556 C "C5'" . DC  H 4 17  ? 24.970  4.343   166.136 1.00 110.76 ? 17  DC  I "C5'" 1 
ATOM   10557 C "C4'" . DC  H 4 17  ? 25.166  3.211   167.123 1.00 113.38 ? 17  DC  I "C4'" 1 
ATOM   10558 O "O4'" . DC  H 4 17  ? 26.159  2.280   166.618 1.00 116.36 ? 17  DC  I "O4'" 1 
ATOM   10559 C "C3'" . DC  H 4 17  ? 25.641  3.674   168.496 1.00 112.63 ? 17  DC  I "C3'" 1 
ATOM   10560 O "O3'" . DC  H 4 17