data_4RA2
# 
_entry.id   4RA2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4RA2         
RCSB  RCSB087088   
WWPDB D_1000087088 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4RA2 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pan, C.'    1  
'Tang, J.Y.' 2  
'Xu, Y.F.'   3  
'Xiao, P.'   4  
'Liu, H.D.'  5  
'Wang, H.A.' 6  
'Wang, W.B.' 7  
'Meng, F.G.' 8  
'Yu, X.'     9  
'Sun, J.P.'  10 
# 
_citation.id                        primary 
_citation.title                     'The catalytic role of the M2 metal ion in PP2Ca' 
_citation.journal_abbrev            'SCI REP' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pan, C.'    1  
primary 'Tang, J.Y.' 2  
primary 'Xu, Y.F.'   3  
primary 'Xiao, P.'   4  
primary 'Liu, H.D.'  5  
primary 'Wang, H.A.' 6  
primary 'Wang, W.B.' 7  
primary 'Meng, F.G.' 8  
primary 'Yu, X.'     9  
primary 'Sun, J.P.'  10 
# 
_cell.entry_id           4RA2 
_cell.length_a           90.714 
_cell.length_b           90.714 
_cell.length_c           105.443 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RA2 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein phosphatase 1A' 40757.926 1   3.1.3.16 ? 'PP2Ca, UNP residues 2-368' ? 
2 non-polymer syn 'MANGANESE (II) ION'     54.938    2   ?        ? ?                           ? 
3 non-polymer syn 'PHOSPHATE ION'          94.971    1   ?        ? ?                           ? 
4 water       nat water                    18.015    214 ?        ? ?                           ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein phosphatase 2C isoform alpha, PP2C-alpha, Protein phosphatase IA' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITN
NQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFT
QDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGI
WDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIK
KQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITN
NQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFT
QDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGI
WDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIK
KQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   PHE n 
1 4   LEU n 
1 5   ASP n 
1 6   LYS n 
1 7   PRO n 
1 8   LYS n 
1 9   MET n 
1 10  GLU n 
1 11  LYS n 
1 12  HIS n 
1 13  ASN n 
1 14  ALA n 
1 15  GLN n 
1 16  GLY n 
1 17  GLN n 
1 18  GLY n 
1 19  ASN n 
1 20  GLY n 
1 21  LEU n 
1 22  ARG n 
1 23  TYR n 
1 24  GLY n 
1 25  LEU n 
1 26  SER n 
1 27  SER n 
1 28  MET n 
1 29  GLN n 
1 30  GLY n 
1 31  TRP n 
1 32  ARG n 
1 33  VAL n 
1 34  GLU n 
1 35  MET n 
1 36  GLU n 
1 37  ASP n 
1 38  ALA n 
1 39  HIS n 
1 40  THR n 
1 41  ALA n 
1 42  VAL n 
1 43  ILE n 
1 44  GLY n 
1 45  LEU n 
1 46  PRO n 
1 47  SER n 
1 48  GLY n 
1 49  LEU n 
1 50  GLU n 
1 51  SER n 
1 52  TRP n 
1 53  SER n 
1 54  PHE n 
1 55  PHE n 
1 56  ALA n 
1 57  VAL n 
1 58  TYR n 
1 59  ASP n 
1 60  GLY n 
1 61  HIS n 
1 62  ALA n 
1 63  GLY n 
1 64  SER n 
1 65  GLN n 
1 66  VAL n 
1 67  ALA n 
1 68  LYS n 
1 69  TYR n 
1 70  CYS n 
1 71  CYS n 
1 72  GLU n 
1 73  HIS n 
1 74  LEU n 
1 75  LEU n 
1 76  ASP n 
1 77  HIS n 
1 78  ILE n 
1 79  THR n 
1 80  ASN n 
1 81  ASN n 
1 82  GLN n 
1 83  ASP n 
1 84  PHE n 
1 85  LYS n 
1 86  GLY n 
1 87  SER n 
1 88  ALA n 
1 89  GLY n 
1 90  ALA n 
1 91  PRO n 
1 92  SER n 
1 93  VAL n 
1 94  GLU n 
1 95  ASN n 
1 96  VAL n 
1 97  LYS n 
1 98  ASN n 
1 99  GLY n 
1 100 ILE n 
1 101 ARG n 
1 102 THR n 
1 103 GLY n 
1 104 PHE n 
1 105 LEU n 
1 106 GLU n 
1 107 ILE n 
1 108 ASP n 
1 109 GLU n 
1 110 HIS n 
1 111 MET n 
1 112 ARG n 
1 113 VAL n 
1 114 MET n 
1 115 SER n 
1 116 GLU n 
1 117 LYS n 
1 118 LYS n 
1 119 HIS n 
1 120 GLY n 
1 121 ALA n 
1 122 ASP n 
1 123 ARG n 
1 124 SER n 
1 125 GLY n 
1 126 SER n 
1 127 THR n 
1 128 ALA n 
1 129 VAL n 
1 130 GLY n 
1 131 VAL n 
1 132 LEU n 
1 133 ILE n 
1 134 SER n 
1 135 PRO n 
1 136 GLN n 
1 137 HIS n 
1 138 THR n 
1 139 TYR n 
1 140 PHE n 
1 141 ILE n 
1 142 ASN n 
1 143 CYS n 
1 144 GLY n 
1 145 ASP n 
1 146 SER n 
1 147 ARG n 
1 148 GLY n 
1 149 LEU n 
1 150 LEU n 
1 151 CYS n 
1 152 ARG n 
1 153 ASN n 
1 154 ARG n 
1 155 LYS n 
1 156 VAL n 
1 157 HIS n 
1 158 PHE n 
1 159 PHE n 
1 160 THR n 
1 161 GLN n 
1 162 ASP n 
1 163 HIS n 
1 164 LYS n 
1 165 PRO n 
1 166 SER n 
1 167 ASN n 
1 168 PRO n 
1 169 LEU n 
1 170 GLU n 
1 171 LYS n 
1 172 GLU n 
1 173 ARG n 
1 174 ILE n 
1 175 GLN n 
1 176 ASN n 
1 177 ALA n 
1 178 GLY n 
1 179 GLY n 
1 180 SER n 
1 181 VAL n 
1 182 MET n 
1 183 ILE n 
1 184 GLN n 
1 185 ARG n 
1 186 VAL n 
1 187 ASN n 
1 188 GLY n 
1 189 SER n 
1 190 LEU n 
1 191 ALA n 
1 192 VAL n 
1 193 SER n 
1 194 ARG n 
1 195 ALA n 
1 196 LEU n 
1 197 GLY n 
1 198 ASP n 
1 199 PHE n 
1 200 ASP n 
1 201 TYR n 
1 202 LYS n 
1 203 CYS n 
1 204 VAL n 
1 205 HIS n 
1 206 GLY n 
1 207 LYS n 
1 208 GLY n 
1 209 PRO n 
1 210 THR n 
1 211 GLU n 
1 212 GLN n 
1 213 LEU n 
1 214 VAL n 
1 215 SER n 
1 216 PRO n 
1 217 GLU n 
1 218 PRO n 
1 219 GLU n 
1 220 VAL n 
1 221 HIS n 
1 222 ASP n 
1 223 ILE n 
1 224 GLU n 
1 225 ARG n 
1 226 SER n 
1 227 GLU n 
1 228 GLU n 
1 229 ASP n 
1 230 ASP n 
1 231 GLN n 
1 232 PHE n 
1 233 ILE n 
1 234 ILE n 
1 235 LEU n 
1 236 ALA n 
1 237 CYS n 
1 238 ASP n 
1 239 GLY n 
1 240 ILE n 
1 241 TRP n 
1 242 ASP n 
1 243 VAL n 
1 244 MET n 
1 245 GLY n 
1 246 ASN n 
1 247 GLU n 
1 248 GLU n 
1 249 LEU n 
1 250 CYS n 
1 251 ASP n 
1 252 PHE n 
1 253 VAL n 
1 254 ARG n 
1 255 SER n 
1 256 ARG n 
1 257 LEU n 
1 258 GLU n 
1 259 VAL n 
1 260 THR n 
1 261 ASP n 
1 262 ASP n 
1 263 LEU n 
1 264 GLU n 
1 265 LYS n 
1 266 VAL n 
1 267 CYS n 
1 268 ASN n 
1 269 GLU n 
1 270 VAL n 
1 271 VAL n 
1 272 ASP n 
1 273 THR n 
1 274 CYS n 
1 275 LEU n 
1 276 TYR n 
1 277 LYS n 
1 278 GLY n 
1 279 SER n 
1 280 ARG n 
1 281 ASP n 
1 282 ASN n 
1 283 MET n 
1 284 SER n 
1 285 VAL n 
1 286 ILE n 
1 287 LEU n 
1 288 ILE n 
1 289 CYS n 
1 290 PHE n 
1 291 PRO n 
1 292 ASN n 
1 293 ALA n 
1 294 PRO n 
1 295 LYS n 
1 296 VAL n 
1 297 SER n 
1 298 PRO n 
1 299 GLU n 
1 300 ALA n 
1 301 VAL n 
1 302 LYS n 
1 303 LYS n 
1 304 GLU n 
1 305 ALA n 
1 306 GLU n 
1 307 LEU n 
1 308 ASP n 
1 309 LYS n 
1 310 TYR n 
1 311 LEU n 
1 312 GLU n 
1 313 CYS n 
1 314 ARG n 
1 315 VAL n 
1 316 GLU n 
1 317 GLU n 
1 318 ILE n 
1 319 ILE n 
1 320 LYS n 
1 321 LYS n 
1 322 GLN n 
1 323 GLY n 
1 324 GLU n 
1 325 GLY n 
1 326 VAL n 
1 327 PRO n 
1 328 ASP n 
1 329 LEU n 
1 330 VAL n 
1 331 HIS n 
1 332 VAL n 
1 333 MET n 
1 334 ARG n 
1 335 THR n 
1 336 LEU n 
1 337 ALA n 
1 338 SER n 
1 339 GLU n 
1 340 ASN n 
1 341 ILE n 
1 342 PRO n 
1 343 SER n 
1 344 LEU n 
1 345 PRO n 
1 346 PRO n 
1 347 GLY n 
1 348 GLY n 
1 349 GLU n 
1 350 LEU n 
1 351 ALA n 
1 352 SER n 
1 353 LYS n 
1 354 ARG n 
1 355 ASN n 
1 356 VAL n 
1 357 ILE n 
1 358 GLU n 
1 359 ALA n 
1 360 VAL n 
1 361 TYR n 
1 362 ASN n 
1 363 ARG n 
1 364 LEU n 
1 365 ASN n 
1 366 PRO n 
1 367 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PPM1A, PPPM1A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               bl21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPM1A_HUMAN 
_struct_ref.pdbx_db_accession          P35813 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITN
NQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFT
QDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGI
WDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLECRVEEIIK
KQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPY
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4RA2 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 367 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P35813 
_struct_ref_seq.db_align_beg                  2 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  368 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       368 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'      ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4RA2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.07 
_exptl_crystal.density_percent_sol   59.97 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'15(v/v)% PEG8000, pH 5.5, 50mM K2HPO4, 15% 2mMDTT, VAPOR DIFFUSION, HANGING DROP, temperature 277.15K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               DIFFRACTOMETER 
_diffrn_detector.type                   SYNTEX 
_diffrn_detector.pdbx_collection_date   2014-03-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_wavelength             0.98 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4RA2 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.94 
_reflns.number_obs                   35772 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.4 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              2.02 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4RA2 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     34777 
_refine.ls_number_reflns_all                     38637 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.81 
_refine.ls_d_res_high                            1.94 
_refine.ls_percent_reflns_obs                    98.0 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.196 
_refine.ls_R_factor_R_free                       0.224 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.990 
_refine.ls_number_reflns_R_free                  1838 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.94120 
_refine.aniso_B[2][2]                            -0.94120 
_refine.aniso_B[3][3]                            1.88230 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][3]                            -0.00000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.36 
_refine.solvent_model_param_bsol                 40.47 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1a6q 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.230 
_refine.pdbx_overall_phase_error                 20.960 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2821 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             214 
_refine_hist.number_atoms_total               3042 
_refine_hist.d_res_high                       1.94 
_refine_hist.d_res_low                        36.81 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.007  ? ? 2880 'X-RAY DIFFRACTION' ? 
f_angle_d          1.091  ? ? 3889 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.109 ? ? 1081 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.081  ? ? 419  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 518  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.9420 2.0112  3277 0.2188 94.00  0.2678 . . 196 . . . . 
'X-RAY DIFFRACTION' . 2.0112 2.0917  3378 0.2185 96.00  0.2333 . . 169 . . . . 
'X-RAY DIFFRACTION' . 2.0917 2.1869  3462 0.2105 98.00  0.2357 . . 172 . . . . 
'X-RAY DIFFRACTION' . 2.1869 2.3021  3417 0.2036 97.00  0.2406 . . 172 . . . . 
'X-RAY DIFFRACTION' . 2.3021 2.4464  3496 0.2022 99.00  0.2149 . . 190 . . . . 
'X-RAY DIFFRACTION' . 2.4464 2.6352  3506 0.2108 99.00  0.2509 . . 181 . . . . 
'X-RAY DIFFRACTION' . 2.6352 2.9003  3532 0.2216 99.00  0.2601 . . 196 . . . . 
'X-RAY DIFFRACTION' . 2.9003 3.3197  3566 0.2096 100.00 0.2446 . . 197 . . . . 
'X-RAY DIFFRACTION' . 3.3197 4.1816  3569 0.1767 100.00 0.2051 . . 197 . . . . 
'X-RAY DIFFRACTION' . 4.1816 36.8157 3758 0.1771 99.00  0.1905 . . 168 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4RA2 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4RA2 
_struct.title                     PP2Ca 
_struct.pdbx_descriptor           'Protein phosphatase 1A (E.C.3.1.3.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4RA2 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'serine/threonine phosphatase, PP2C family, Phosphorylation, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 64  ? ASN A 80  ? SER A 65  ASN A 81  1 ? 17 
HELX_P HELX_P2  2  SER A 92  ? LYS A 118 ? SER A 93  LYS A 119 1 ? 27 
HELX_P HELX_P3  3  ASN A 167 ? ALA A 177 ? ASN A 168 ALA A 178 1 ? 11 
HELX_P HELX_P4  4  PHE A 199 ? LYS A 202 ? PHE A 200 LYS A 203 5 ? 4  
HELX_P HELX_P5  5  GLY A 208 ? GLN A 212 ? GLY A 209 GLN A 213 5 ? 5  
HELX_P HELX_P6  6  CYS A 237 ? ASP A 242 ? CYS A 238 ASP A 243 1 ? 6  
HELX_P HELX_P7  7  GLY A 245 ? GLU A 258 ? GLY A 246 GLU A 259 1 ? 14 
HELX_P HELX_P8  8  ASP A 262 ? LYS A 277 ? ASP A 263 LYS A 278 1 ? 16 
HELX_P HELX_P9  9  SER A 297 ? ILE A 319 ? SER A 298 ILE A 320 1 ? 23 
HELX_P HELX_P10 10 ASP A 328 ? GLU A 339 ? ASP A 329 GLU A 340 1 ? 12 
HELX_P HELX_P11 11 GLU A 349 ? SER A 352 ? GLU A 350 SER A 353 5 ? 4  
HELX_P HELX_P12 12 LYS A 353 ? ASN A 365 ? LYS A 354 ASN A 366 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 281 OD2 ? ? ? 1_555 B MN  . MN ? ? A ASP 282 A MN  401 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc2  metalc ? ? C MN  .   MN  ? ? ? 1_555 E HOH . O  ? ? A MN  402 A HOH 505 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc3  metalc ? ? A ASP 59  OD2 ? ? ? 1_555 B MN  . MN ? ? A ASP 60  A MN  401 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc4  metalc ? ? B MN  .   MN  ? ? ? 1_555 E HOH . O  ? ? A MN  401 A HOH 505 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc5  metalc ? ? A ASP 238 OD1 ? ? ? 1_555 B MN  . MN ? ? A ASP 239 A MN  401 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc6  metalc ? ? C MN  .   MN  ? ? ? 1_555 E HOH . O  ? ? A MN  402 A HOH 512 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc7  metalc ? ? A ASP 59  OD1 ? ? ? 1_555 C MN  . MN ? ? A ASP 60  A MN  402 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc8  metalc ? ? C MN  .   MN  ? ? ? 1_555 E HOH . O  ? ? A MN  402 A HOH 547 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc9  metalc ? ? A GLY 60  O   ? ? ? 1_555 C MN  . MN ? ? A GLY 61  A MN  402 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc10 metalc ? ? C MN  .   MN  ? ? ? 1_555 E HOH . O  ? ? A MN  402 A HOH 511 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc11 metalc ? ? B MN  .   MN  ? ? ? 1_555 E HOH . O  ? ? A MN  401 A HOH 522 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc12 metalc ? ? B MN  .   MN  ? ? ? 1_555 E HOH . O  ? ? A MN  401 A HOH 507 1_555 ? ? ? ? ? ? ? 2.413 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           86 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            87 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    87 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     88 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 4 ? 
C ? 5 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 12  ? GLY A 18  ? HIS A 13  GLY A 19  
A 2 LEU A 21  ? MET A 28  ? LEU A 22  MET A 29  
A 3 MET A 283 ? CYS A 289 ? MET A 284 CYS A 290 
A 4 ASP A 230 ? ALA A 236 ? ASP A 231 ALA A 237 
A 5 ARG A 147 ? ARG A 152 ? ARG A 148 ARG A 153 
A 6 LYS A 155 ? PHE A 159 ? LYS A 156 PHE A 160 
B 1 ASP A 37  ? LEU A 45  ? ASP A 38  LEU A 46  
B 2 LEU A 49  ? HIS A 61  ? LEU A 50  HIS A 62  
B 3 GLY A 125 ? SER A 126 ? GLY A 126 SER A 127 
B 4 LEU A 196 ? GLY A 197 ? LEU A 197 GLY A 198 
C 1 ASP A 37  ? LEU A 45  ? ASP A 38  LEU A 46  
C 2 LEU A 49  ? HIS A 61  ? LEU A 50  HIS A 62  
C 3 ALA A 128 ? ILE A 133 ? ALA A 129 ILE A 134 
C 4 HIS A 137 ? CYS A 143 ? HIS A 138 CYS A 144 
C 5 GLU A 219 ? GLU A 224 ? GLU A 220 GLU A 225 
D 1 VAL A 181 ? MET A 182 ? VAL A 182 MET A 183 
D 2 ARG A 185 ? VAL A 186 ? ARG A 186 VAL A 187 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 16  ? N GLY A 17  O TYR A 23  ? O TYR A 24  
A 2 3 N ARG A 22  ? N ARG A 23  O CYS A 289 ? O CYS A 290 
A 3 4 O ILE A 286 ? O ILE A 287 N LEU A 235 ? N LEU A 236 
A 4 5 O PHE A 232 ? O PHE A 233 N CYS A 151 ? N CYS A 152 
A 5 6 N LEU A 150 ? N LEU A 151 O PHE A 158 ? O PHE A 159 
B 1 2 N ALA A 38  ? N ALA A 39  O TYR A 58  ? O TYR A 59  
B 2 3 N HIS A 61  ? N HIS A 62  O GLY A 125 ? O GLY A 126 
B 3 4 N SER A 126 ? N SER A 127 O LEU A 196 ? O LEU A 197 
C 1 2 N ALA A 38  ? N ALA A 39  O TYR A 58  ? O TYR A 59  
C 2 3 N VAL A 57  ? N VAL A 58  O VAL A 129 ? O VAL A 130 
C 3 4 N LEU A 132 ? N LEU A 133 O TYR A 139 ? O TYR A 140 
C 4 5 N THR A 138 ? N THR A 139 O ILE A 223 ? O ILE A 224 
D 1 2 N MET A 182 ? N MET A 183 O ARG A 185 ? O ARG A 186 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 401'  
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 402'  
AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE PO4 A 403' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 59  ? ASP A 60  . ? 1_555 ? 
2  AC1 6 ASP A 238 ? ASP A 239 . ? 1_555 ? 
3  AC1 6 ASP A 281 ? ASP A 282 . ? 1_555 ? 
4  AC1 6 HOH E .   ? HOH A 505 . ? 1_555 ? 
5  AC1 6 HOH E .   ? HOH A 507 . ? 1_555 ? 
6  AC1 6 HOH E .   ? HOH A 522 . ? 1_555 ? 
7  AC2 6 ASP A 59  ? ASP A 60  . ? 1_555 ? 
8  AC2 6 GLY A 60  ? GLY A 61  . ? 1_555 ? 
9  AC2 6 HOH E .   ? HOH A 505 . ? 1_555 ? 
10 AC2 6 HOH E .   ? HOH A 511 . ? 1_555 ? 
11 AC2 6 HOH E .   ? HOH A 512 . ? 1_555 ? 
12 AC2 6 HOH E .   ? HOH A 547 . ? 1_555 ? 
13 AC3 8 ARG A 32  ? ARG A 33  . ? 1_555 ? 
14 AC3 8 LYS A 302 ? LYS A 303 . ? 3_544 ? 
15 AC3 8 HOH E .   ? HOH A 507 . ? 1_555 ? 
16 AC3 8 HOH E .   ? HOH A 512 . ? 1_555 ? 
17 AC3 8 HOH E .   ? HOH A 547 . ? 1_555 ? 
18 AC3 8 HOH E .   ? HOH A 629 . ? 1_555 ? 
19 AC3 8 HOH E .   ? HOH A 638 . ? 1_555 ? 
20 AC3 8 HOH E .   ? HOH A 698 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4RA2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4RA2 
_atom_sites.fract_transf_matrix[1][1]   0.011024 
_atom_sites.fract_transf_matrix[1][2]   0.006365 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012729 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009484 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLY A 1 1   ? 17.942  -47.268 -17.479 1.00 49.64 ? 2   GLY A N   1 
ATOM   2    C  CA  . GLY A 1 1   ? 17.755  -46.152 -16.573 1.00 52.58 ? 2   GLY A CA  1 
ATOM   3    C  C   . GLY A 1 1   ? 17.816  -46.632 -15.140 1.00 62.31 ? 2   GLY A C   1 
ATOM   4    O  O   . GLY A 1 1   ? 18.351  -47.709 -14.867 1.00 64.56 ? 2   GLY A O   1 
ATOM   5    N  N   . ALA A 1 2   ? 17.266  -45.844 -14.221 1.00 62.01 ? 3   ALA A N   1 
ATOM   6    C  CA  . ALA A 1 2   ? 17.249  -46.228 -12.819 1.00 51.93 ? 3   ALA A CA  1 
ATOM   7    C  C   . ALA A 1 2   ? 16.515  -47.543 -12.593 1.00 52.16 ? 3   ALA A C   1 
ATOM   8    O  O   . ALA A 1 2   ? 16.566  -48.463 -13.406 1.00 59.32 ? 3   ALA A O   1 
ATOM   9    C  CB  . ALA A 1 2   ? 16.633  -45.127 -11.964 1.00 56.83 ? 3   ALA A CB  1 
ATOM   10   N  N   . PHE A 1 3   ? 15.811  -47.603 -11.475 1.00 39.67 ? 4   PHE A N   1 
ATOM   11   C  CA  . PHE A 1 3   ? 15.227  -48.833 -10.955 1.00 32.91 ? 4   PHE A CA  1 
ATOM   12   C  C   . PHE A 1 3   ? 16.250  -49.786 -10.355 1.00 37.87 ? 4   PHE A C   1 
ATOM   13   O  O   . PHE A 1 3   ? 17.037  -50.444 -11.061 1.00 32.70 ? 4   PHE A O   1 
ATOM   14   C  CB  . PHE A 1 3   ? 14.300  -49.541 -11.944 1.00 32.49 ? 4   PHE A CB  1 
ATOM   15   C  CG  . PHE A 1 3   ? 13.089  -48.737 -12.313 1.00 30.78 ? 4   PHE A CG  1 
ATOM   16   C  CD1 . PHE A 1 3   ? 12.556  -47.802 -11.429 1.00 27.29 ? 4   PHE A CD1 1 
ATOM   17   C  CD2 . PHE A 1 3   ? 12.488  -48.900 -13.555 1.00 31.54 ? 4   PHE A CD2 1 
ATOM   18   C  CE1 . PHE A 1 3   ? 11.432  -47.054 -11.777 1.00 27.33 ? 4   PHE A CE1 1 
ATOM   19   C  CE2 . PHE A 1 3   ? 11.369  -48.150 -13.912 1.00 28.73 ? 4   PHE A CE2 1 
ATOM   20   C  CZ  . PHE A 1 3   ? 10.842  -47.227 -13.019 1.00 26.32 ? 4   PHE A CZ  1 
ATOM   21   N  N   . LEU A 1 4   ? 16.222  -49.800 -9.028  1.00 34.06 ? 5   LEU A N   1 
ATOM   22   C  CA  . LEU A 1 4   ? 16.822  -50.822 -8.192  1.00 35.20 ? 5   LEU A CA  1 
ATOM   23   C  C   . LEU A 1 4   ? 16.181  -52.154 -8.519  1.00 35.70 ? 5   LEU A C   1 
ATOM   24   O  O   . LEU A 1 4   ? 15.065  -52.197 -9.045  1.00 32.65 ? 5   LEU A O   1 
ATOM   25   C  CB  . LEU A 1 4   ? 16.514  -50.499 -6.726  1.00 31.94 ? 5   LEU A CB  1 
ATOM   26   C  CG  . LEU A 1 4   ? 17.391  -49.488 -5.986  1.00 35.50 ? 5   LEU A CG  1 
ATOM   27   C  CD1 . LEU A 1 4   ? 18.023  -48.539 -6.936  1.00 38.80 ? 5   LEU A CD1 1 
ATOM   28   C  CD2 . LEU A 1 4   ? 16.616  -48.734 -4.898  1.00 32.97 ? 5   LEU A CD2 1 
ATOM   29   N  N   . ASP A 1 5   ? 16.877  -53.239 -8.188  1.00 39.64 ? 6   ASP A N   1 
ATOM   30   C  CA  . ASP A 1 5   ? 16.309  -54.576 -8.290  1.00 41.69 ? 6   ASP A CA  1 
ATOM   31   C  C   . ASP A 1 5   ? 15.187  -54.735 -7.277  1.00 39.67 ? 6   ASP A C   1 
ATOM   32   O  O   . ASP A 1 5   ? 14.241  -55.479 -7.505  1.00 38.63 ? 6   ASP A O   1 
ATOM   33   C  CB  . ASP A 1 5   ? 17.382  -55.639 -8.033  1.00 47.63 ? 6   ASP A CB  1 
ATOM   34   C  CG  . ASP A 1 5   ? 18.505  -55.592 -9.052  1.00 59.07 ? 6   ASP A CG  1 
ATOM   35   O  OD1 . ASP A 1 5   ? 19.676  -55.788 -8.657  1.00 65.56 ? 6   ASP A OD1 1 
ATOM   36   O  OD2 . ASP A 1 5   ? 18.218  -55.357 -10.247 1.00 59.37 ? 6   ASP A OD2 1 
ATOM   37   N  N   . LYS A 1 6   ? 15.318  -54.044 -6.146  1.00 36.68 ? 7   LYS A N   1 
ATOM   38   C  CA  . LYS A 1 6   ? 14.288  -54.027 -5.108  1.00 34.42 ? 7   LYS A CA  1 
ATOM   39   C  C   . LYS A 1 6   ? 14.201  -52.617 -4.523  1.00 32.33 ? 7   LYS A C   1 
ATOM   40   O  O   . LYS A 1 6   ? 15.203  -51.908 -4.440  1.00 33.03 ? 7   LYS A O   1 
ATOM   41   C  CB  . LYS A 1 6   ? 14.607  -55.038 -3.998  1.00 39.90 ? 7   LYS A CB  1 
ATOM   42   C  CG  . LYS A 1 6   ? 14.389  -56.495 -4.390  1.00 49.89 ? 7   LYS A CG  1 
ATOM   43   C  CD  . LYS A 1 6   ? 14.803  -57.436 -3.255  1.00 58.88 ? 7   LYS A CD  1 
ATOM   44   C  CE  . LYS A 1 6   ? 14.585  -58.903 -3.629  1.00 66.65 ? 7   LYS A CE  1 
ATOM   45   N  NZ  . LYS A 1 6   ? 15.001  -59.838 -2.540  1.00 65.64 ? 7   LYS A NZ  1 
ATOM   46   N  N   . PRO A 1 7   ? 12.999  -52.199 -4.118  1.00 32.55 ? 8   PRO A N   1 
ATOM   47   C  CA  . PRO A 1 7   ? 12.849  -50.813 -3.649  1.00 31.21 ? 8   PRO A CA  1 
ATOM   48   C  C   . PRO A 1 7   ? 13.545  -50.564 -2.309  1.00 29.99 ? 8   PRO A C   1 
ATOM   49   O  O   . PRO A 1 7   ? 13.627  -51.479 -1.493  1.00 30.76 ? 8   PRO A O   1 
ATOM   50   C  CB  . PRO A 1 7   ? 11.333  -50.661 -3.512  1.00 29.33 ? 8   PRO A CB  1 
ATOM   51   C  CG  . PRO A 1 7   ? 10.830  -52.066 -3.287  1.00 31.20 ? 8   PRO A CG  1 
ATOM   52   C  CD  . PRO A 1 7   ? 11.732  -52.952 -4.090  1.00 31.72 ? 8   PRO A CD  1 
ATOM   53   N  N   . LYS A 1 8   ? 14.073  -49.361 -2.104  1.00 33.22 ? 9   LYS A N   1 
ATOM   54   C  CA  . LYS A 1 8   ? 14.598  -48.966 -0.793  1.00 32.37 ? 9   LYS A CA  1 
ATOM   55   C  C   . LYS A 1 8   ? 13.432  -48.467 0.045   1.00 34.32 ? 9   LYS A C   1 
ATOM   56   O  O   . LYS A 1 8   ? 12.941  -47.365 -0.184  1.00 33.38 ? 9   LYS A O   1 
ATOM   57   C  CB  . LYS A 1 8   ? 15.617  -47.829 -0.920  1.00 35.07 ? 9   LYS A CB  1 
ATOM   58   C  CG  . LYS A 1 8   ? 17.068  -48.248 -1.094  1.00 42.00 ? 9   LYS A CG  1 
ATOM   59   C  CD  . LYS A 1 8   ? 17.995  -47.039 -0.954  1.00 45.85 ? 9   LYS A CD  1 
ATOM   60   C  CE  . LYS A 1 8   ? 19.432  -47.373 -1.345  1.00 52.70 ? 9   LYS A CE  1 
ATOM   61   N  NZ  . LYS A 1 8   ? 20.289  -46.146 -1.391  1.00 57.27 ? 9   LYS A NZ  1 
ATOM   62   N  N   . MET A 1 9   ? 12.998  -49.262 1.014   1.00 29.57 ? 10  MET A N   1 
ATOM   63   C  CA  . MET A 1 9   ? 11.810  -48.943 1.799   1.00 31.54 ? 10  MET A CA  1 
ATOM   64   C  C   . MET A 1 9   ? 12.079  -48.024 2.987   1.00 31.61 ? 10  MET A C   1 
ATOM   65   O  O   . MET A 1 9   ? 11.147  -47.648 3.701   1.00 30.78 ? 10  MET A O   1 
ATOM   66   C  CB  . MET A 1 9   ? 11.187  -50.225 2.347   1.00 35.00 ? 10  MET A CB  1 
ATOM   67   C  CG  . MET A 1 9   ? 10.929  -51.299 1.331   1.00 40.35 ? 10  MET A CG  1 
ATOM   68   S  SD  . MET A 1 9   ? 9.552   -50.884 0.273   1.00 47.57 ? 10  MET A SD  1 
ATOM   69   C  CE  . MET A 1 9   ? 8.998   -52.522 -0.213  1.00 43.39 ? 10  MET A CE  1 
ATOM   70   N  N   . GLU A 1 10  ? 13.342  -47.689 3.233   1.00 30.85 ? 11  GLU A N   1 
ATOM   71   C  CA  . GLU A 1 10  ? 13.680  -46.917 4.432   1.00 31.58 ? 11  GLU A CA  1 
ATOM   72   C  C   . GLU A 1 10  ? 12.940  -45.572 4.489   1.00 32.97 ? 11  GLU A C   1 
ATOM   73   O  O   . GLU A 1 10  ? 12.992  -44.790 3.549   1.00 28.06 ? 11  GLU A O   1 
ATOM   74   C  CB  . GLU A 1 10  ? 15.188  -46.687 4.529   1.00 35.18 ? 11  GLU A CB  1 
ATOM   75   C  CG  . GLU A 1 10  ? 15.629  -46.058 5.848   1.00 39.63 ? 11  GLU A CG  1 
ATOM   76   C  CD  . GLU A 1 10  ? 17.120  -45.721 5.883   1.00 50.11 ? 11  GLU A CD  1 
ATOM   77   O  OE1 . GLU A 1 10  ? 17.820  -45.989 4.880   1.00 48.46 ? 11  GLU A OE1 1 
ATOM   78   O  OE2 . GLU A 1 10  ? 17.588  -45.181 6.914   1.00 53.78 ? 11  GLU A OE2 1 
ATOM   79   N  N   . LYS A 1 11  ? 12.260  -45.303 5.600   1.00 32.85 ? 12  LYS A N   1 
ATOM   80   C  CA  . LYS A 1 11  ? 11.504  -44.056 5.742   1.00 29.97 ? 12  LYS A CA  1 
ATOM   81   C  C   . LYS A 1 11  ? 12.343  -43.023 6.455   1.00 30.06 ? 12  LYS A C   1 
ATOM   82   O  O   . LYS A 1 11  ? 12.948  -43.313 7.477   1.00 31.81 ? 12  LYS A O   1 
ATOM   83   C  CB  . LYS A 1 11  ? 10.220  -44.274 6.545   1.00 28.66 ? 12  LYS A CB  1 
ATOM   84   C  CG  . LYS A 1 11  ? 9.336   -45.389 6.040   1.00 29.90 ? 12  LYS A CG  1 
ATOM   85   C  CD  . LYS A 1 11  ? 8.845   -45.097 4.626   1.00 28.15 ? 12  LYS A CD  1 
ATOM   86   C  CE  . LYS A 1 11  ? 7.748   -46.059 4.239   1.00 29.76 ? 12  LYS A CE  1 
ATOM   87   N  NZ  . LYS A 1 11  ? 8.251   -47.469 4.241   1.00 31.40 ? 12  LYS A NZ  1 
ATOM   88   N  N   . HIS A 1 12  ? 12.386  -41.815 5.918   1.00 28.89 ? 13  HIS A N   1 
ATOM   89   C  CA  . HIS A 1 12  ? 12.964  -40.708 6.652   1.00 28.76 ? 13  HIS A CA  1 
ATOM   90   C  C   . HIS A 1 12  ? 11.822  -39.840 7.167   1.00 31.02 ? 13  HIS A C   1 
ATOM   91   O  O   . HIS A 1 12  ? 11.041  -39.297 6.381   1.00 27.31 ? 13  HIS A O   1 
ATOM   92   C  CB  . HIS A 1 12  ? 13.955  -39.952 5.768   1.00 33.50 ? 13  HIS A CB  1 
ATOM   93   C  CG  . HIS A 1 12  ? 15.063  -40.828 5.257   1.00 37.53 ? 13  HIS A CG  1 
ATOM   94   N  ND1 . HIS A 1 12  ? 14.859  -41.811 4.307   1.00 39.47 ? 13  HIS A ND1 1 
ATOM   95   C  CD2 . HIS A 1 12  ? 16.370  -40.911 5.606   1.00 41.23 ? 13  HIS A CD2 1 
ATOM   96   C  CE1 . HIS A 1 12  ? 15.998  -42.440 4.074   1.00 37.76 ? 13  HIS A CE1 1 
ATOM   97   N  NE2 . HIS A 1 12  ? 16.931  -41.913 4.849   1.00 43.26 ? 13  HIS A NE2 1 
ATOM   98   N  N   . ASN A 1 13  ? 11.706  -39.755 8.491   1.00 25.57 ? 14  ASN A N   1 
ATOM   99   C  CA  . ASN A 1 13  ? 10.560  -39.105 9.130   1.00 25.11 ? 14  ASN A CA  1 
ATOM   100  C  C   . ASN A 1 13  ? 10.960  -37.859 9.901   1.00 29.52 ? 14  ASN A C   1 
ATOM   101  O  O   . ASN A 1 13  ? 12.085  -37.745 10.381  1.00 27.76 ? 14  ASN A O   1 
ATOM   102  C  CB  . ASN A 1 13  ? 9.875   -40.075 10.092  1.00 25.76 ? 14  ASN A CB  1 
ATOM   103  C  CG  . ASN A 1 13  ? 9.096   -41.152 9.379   1.00 25.77 ? 14  ASN A CG  1 
ATOM   104  O  OD1 . ASN A 1 13  ? 8.218   -40.864 8.564   1.00 26.98 ? 14  ASN A OD1 1 
ATOM   105  N  ND2 . ASN A 1 13  ? 9.407   -42.403 9.678   1.00 25.38 ? 14  ASN A ND2 1 
ATOM   106  N  N   . ALA A 1 14  ? 10.033  -36.922 10.016  1.00 23.87 ? 15  ALA A N   1 
ATOM   107  C  CA  . ALA A 1 14  ? 10.165  -35.847 10.995  1.00 28.07 ? 15  ALA A CA  1 
ATOM   108  C  C   . ALA A 1 14  ? 8.777   -35.450 11.464  1.00 27.63 ? 15  ALA A C   1 
ATOM   109  O  O   . ALA A 1 14  ? 7.783   -35.748 10.805  1.00 24.32 ? 15  ALA A O   1 
ATOM   110  C  CB  . ALA A 1 14  ? 10.886  -34.653 10.408  1.00 27.95 ? 15  ALA A CB  1 
ATOM   111  N  N   . GLN A 1 15  ? 8.710   -34.779 12.607  1.00 26.16 ? 16  GLN A N   1 
ATOM   112  C  CA  . GLN A 1 15  ? 7.437   -34.314 13.125  1.00 28.34 ? 16  GLN A CA  1 
ATOM   113  C  C   . GLN A 1 15  ? 7.671   -33.085 13.984  1.00 29.55 ? 16  GLN A C   1 
ATOM   114  O  O   . GLN A 1 15  ? 8.807   -32.782 14.355  1.00 26.62 ? 16  GLN A O   1 
ATOM   115  C  CB  . GLN A 1 15  ? 6.751   -35.414 13.931  1.00 26.48 ? 16  GLN A CB  1 
ATOM   116  C  CG  . GLN A 1 15  ? 7.559   -35.882 15.140  1.00 34.08 ? 16  GLN A CG  1 
ATOM   117  C  CD  . GLN A 1 15  ? 6.910   -37.050 15.860  1.00 39.53 ? 16  GLN A CD  1 
ATOM   118  O  OE1 . GLN A 1 15  ? 6.100   -37.789 15.284  1.00 44.43 ? 16  GLN A OE1 1 
ATOM   119  N  NE2 . GLN A 1 15  ? 7.258   -37.223 17.128  1.00 43.60 ? 16  GLN A NE2 1 
ATOM   120  N  N   . GLY A 1 16  ? 6.599   -32.367 14.289  1.00 25.36 ? 17  GLY A N   1 
ATOM   121  C  CA  . GLY A 1 16  ? 6.721   -31.169 15.095  1.00 29.62 ? 17  GLY A CA  1 
ATOM   122  C  C   . GLY A 1 16  ? 5.370   -30.580 15.409  1.00 28.78 ? 17  GLY A C   1 
ATOM   123  O  O   . GLY A 1 16  ? 4.349   -31.012 14.869  1.00 27.86 ? 17  GLY A O   1 
ATOM   124  N  N   . GLN A 1 17  ? 5.364   -29.594 16.300  1.00 30.02 ? 18  GLN A N   1 
ATOM   125  C  CA  . GLN A 1 17  ? 4.128   -28.963 16.738  1.00 32.55 ? 18  GLN A CA  1 
ATOM   126  C  C   . GLN A 1 17  ? 4.439   -27.530 17.147  1.00 32.88 ? 18  GLN A C   1 
ATOM   127  O  O   . GLN A 1 17  ? 5.563   -27.225 17.536  1.00 34.35 ? 18  GLN A O   1 
ATOM   128  C  CB  . GLN A 1 17  ? 3.507   -29.731 17.912  1.00 34.17 ? 18  GLN A CB  1 
ATOM   129  C  CG  . GLN A 1 17  ? 3.155   -31.195 17.608  1.00 41.48 ? 18  GLN A CG  1 
ATOM   130  C  CD  . GLN A 1 17  ? 4.304   -32.163 17.897  1.00 47.18 ? 18  GLN A CD  1 
ATOM   131  O  OE1 . GLN A 1 17  ? 5.263   -31.815 18.599  1.00 50.65 ? 18  GLN A OE1 1 
ATOM   132  N  NE2 . GLN A 1 17  ? 4.209   -33.384 17.360  1.00 42.13 ? 18  GLN A NE2 1 
ATOM   133  N  N   . GLY A 1 18  ? 3.439   -26.661 17.045  1.00 28.11 ? 19  GLY A N   1 
ATOM   134  C  CA  . GLY A 1 18  ? 3.581   -25.256 17.397  1.00 30.62 ? 19  GLY A CA  1 
ATOM   135  C  C   . GLY A 1 18  ? 2.600   -24.413 16.596  1.00 29.60 ? 19  GLY A C   1 
ATOM   136  O  O   . GLY A 1 18  ? 2.151   -24.820 15.519  1.00 27.36 ? 19  GLY A O   1 
ATOM   137  N  N   . ASN A 1 19  ? 2.265   -23.235 17.112  1.00 31.91 ? 20  ASN A N   1 
ATOM   138  C  CA  . ASN A 1 19  ? 1.353   -22.334 16.412  1.00 29.68 ? 20  ASN A CA  1 
ATOM   139  C  C   . ASN A 1 19  ? -0.001  -22.978 16.159  1.00 28.70 ? 20  ASN A C   1 
ATOM   140  O  O   . ASN A 1 19  ? -0.698  -22.640 15.203  1.00 29.14 ? 20  ASN A O   1 
ATOM   141  C  CB  . ASN A 1 19  ? 1.974   -21.831 15.105  1.00 31.37 ? 20  ASN A CB  1 
ATOM   142  C  CG  . ASN A 1 19  ? 3.106   -20.835 15.342  1.00 34.50 ? 20  ASN A CG  1 
ATOM   143  O  OD1 . ASN A 1 19  ? 3.199   -20.237 16.411  1.00 35.43 ? 20  ASN A OD1 1 
ATOM   144  N  ND2 . ASN A 1 19  ? 3.973   -20.661 14.349  1.00 32.14 ? 20  ASN A ND2 1 
ATOM   145  N  N   . GLY A 1 20  ? -0.364  -23.910 17.035  1.00 29.68 ? 21  GLY A N   1 
ATOM   146  C  CA  . GLY A 1 20  ? -1.616  -24.633 16.916  1.00 31.64 ? 21  GLY A CA  1 
ATOM   147  C  C   . GLY A 1 20  ? -1.564  -25.752 15.886  1.00 30.63 ? 21  GLY A C   1 
ATOM   148  O  O   . GLY A 1 20  ? -2.554  -26.445 15.681  1.00 33.65 ? 21  GLY A O   1 
ATOM   149  N  N   . LEU A 1 21  ? -0.411  -25.928 15.247  1.00 25.63 ? 22  LEU A N   1 
ATOM   150  C  CA  . LEU A 1 21  ? -0.238  -26.960 14.219  1.00 25.58 ? 22  LEU A CA  1 
ATOM   151  C  C   . LEU A 1 21  ? 0.467   -28.201 14.749  1.00 23.75 ? 22  LEU A C   1 
ATOM   152  O  O   . LEU A 1 21  ? 1.221   -28.128 15.710  1.00 23.25 ? 22  LEU A O   1 
ATOM   153  C  CB  . LEU A 1 21  ? 0.578   -26.403 13.048  1.00 24.36 ? 22  LEU A CB  1 
ATOM   154  C  CG  . LEU A 1 21  ? 0.017   -25.133 12.415  1.00 22.62 ? 22  LEU A CG  1 
ATOM   155  C  CD1 . LEU A 1 21  ? 0.888   -24.649 11.261  1.00 25.89 ? 22  LEU A CD1 1 
ATOM   156  C  CD2 . LEU A 1 21  ? -1.426  -25.342 11.964  1.00 26.77 ? 22  LEU A CD2 1 
ATOM   157  N  N   . ARG A 1 22  ? 0.230   -29.337 14.099  1.00 22.49 ? 23  ARG A N   1 
ATOM   158  C  CA  . ARG A 1 22  ? 1.037   -30.541 14.296  1.00 26.11 ? 23  ARG A CA  1 
ATOM   159  C  C   . ARG A 1 22  ? 1.365   -31.050 12.902  1.00 25.62 ? 23  ARG A C   1 
ATOM   160  O  O   . ARG A 1 22  ? 0.509   -31.004 12.018  1.00 24.42 ? 23  ARG A O   1 
ATOM   161  C  CB  . ARG A 1 22  ? 0.243   -31.635 14.995  1.00 25.84 ? 23  ARG A CB  1 
ATOM   162  C  CG  . ARG A 1 22  ? -0.161  -31.367 16.430  1.00 33.57 ? 23  ARG A CG  1 
ATOM   163  C  CD  . ARG A 1 22  ? -0.906  -32.584 16.988  1.00 31.49 ? 23  ARG A CD  1 
ATOM   164  N  NE  . ARG A 1 22  ? 0.005   -33.709 17.204  1.00 34.53 ? 23  ARG A NE  1 
ATOM   165  C  CZ  . ARG A 1 22  ? -0.214  -34.963 16.809  1.00 34.98 ? 23  ARG A CZ  1 
ATOM   166  N  NH1 . ARG A 1 22  ? -1.324  -35.295 16.160  1.00 30.51 ? 23  ARG A NH1 1 
ATOM   167  N  NH2 . ARG A 1 22  ? 0.687   -35.897 17.074  1.00 36.01 ? 23  ARG A NH2 1 
ATOM   168  N  N   . TYR A 1 23  ? 2.577   -31.542 12.690  1.00 25.38 ? 24  TYR A N   1 
ATOM   169  C  CA  . TYR A 1 23  ? 2.879   -32.137 11.394  1.00 25.06 ? 24  TYR A CA  1 
ATOM   170  C  C   . TYR A 1 23  ? 3.677   -33.415 11.514  1.00 27.56 ? 24  TYR A C   1 
ATOM   171  O  O   . TYR A 1 23  ? 4.327   -33.679 12.538  1.00 24.18 ? 24  TYR A O   1 
ATOM   172  C  CB  . TYR A 1 23  ? 3.623   -31.148 10.486  1.00 23.95 ? 24  TYR A CB  1 
ATOM   173  C  CG  . TYR A 1 23  ? 5.065   -30.914 10.857  1.00 26.88 ? 24  TYR A CG  1 
ATOM   174  C  CD1 . TYR A 1 23  ? 6.083   -31.707 10.330  1.00 24.94 ? 24  TYR A CD1 1 
ATOM   175  C  CD2 . TYR A 1 23  ? 5.413   -29.886 11.722  1.00 26.95 ? 24  TYR A CD2 1 
ATOM   176  C  CE1 . TYR A 1 23  ? 7.411   -31.487 10.673  1.00 29.02 ? 24  TYR A CE1 1 
ATOM   177  C  CE2 . TYR A 1 23  ? 6.736   -29.653 12.064  1.00 31.34 ? 24  TYR A CE2 1 
ATOM   178  C  CZ  . TYR A 1 23  ? 7.726   -30.450 11.542  1.00 32.07 ? 24  TYR A CZ  1 
ATOM   179  O  OH  . TYR A 1 23  ? 9.039   -30.201 11.885  1.00 37.56 ? 24  TYR A OH  1 
ATOM   180  N  N   . GLY A 1 24  ? 3.603   -34.208 10.446  1.00 23.05 ? 25  GLY A N   1 
ATOM   181  C  CA  . GLY A 1 24  ? 4.457   -35.364 10.260  1.00 22.58 ? 25  GLY A CA  1 
ATOM   182  C  C   . GLY A 1 24  ? 4.848   -35.381 8.793   1.00 23.47 ? 25  GLY A C   1 
ATOM   183  O  O   . GLY A 1 24  ? 4.177   -34.772 7.947   1.00 20.27 ? 25  GLY A O   1 
ATOM   184  N  N   . LEU A 1 25  ? 5.944   -36.052 8.479   1.00 21.05 ? 26  LEU A N   1 
ATOM   185  C  CA  . LEU A 1 25  ? 6.347   -36.194 7.090   1.00 20.18 ? 26  LEU A CA  1 
ATOM   186  C  C   . LEU A 1 25  ? 7.102   -37.495 6.899   1.00 20.83 ? 26  LEU A C   1 
ATOM   187  O  O   . LEU A 1 25  ? 7.602   -38.097 7.856   1.00 25.41 ? 26  LEU A O   1 
ATOM   188  C  CB  . LEU A 1 25  ? 7.172   -34.984 6.620   1.00 20.44 ? 26  LEU A CB  1 
ATOM   189  C  CG  . LEU A 1 25  ? 8.538   -34.701 7.265   1.00 22.17 ? 26  LEU A CG  1 
ATOM   190  C  CD1 . LEU A 1 25  ? 9.657   -35.536 6.632   1.00 22.05 ? 26  LEU A CD1 1 
ATOM   191  C  CD2 . LEU A 1 25  ? 8.870   -33.212 7.172   1.00 23.34 ? 26  LEU A CD2 1 
ATOM   192  N  N   . SER A 1 26  ? 7.154   -37.949 5.658   1.00 20.69 ? 27  SER A N   1 
ATOM   193  C  CA  . SER A 1 26  ? 7.882   -39.163 5.328   1.00 22.60 ? 27  SER A CA  1 
ATOM   194  C  C   . SER A 1 26  ? 8.464   -39.005 3.933   1.00 26.82 ? 27  SER A C   1 
ATOM   195  O  O   . SER A 1 26  ? 7.789   -38.503 3.033   1.00 26.12 ? 27  SER A O   1 
ATOM   196  C  CB  . SER A 1 26  ? 6.938   -40.363 5.379   1.00 22.88 ? 27  SER A CB  1 
ATOM   197  O  OG  . SER A 1 26  ? 7.585   -41.551 4.950   1.00 28.05 ? 27  SER A OG  1 
ATOM   198  N  N   . SER A 1 27  ? 9.720   -39.402 3.761   1.00 22.54 ? 28  SER A N   1 
ATOM   199  C  CA  . SER A 1 27  ? 10.296  -39.509 2.425   1.00 25.22 ? 28  SER A CA  1 
ATOM   200  C  C   . SER A 1 27  ? 10.899  -40.896 2.247   1.00 26.28 ? 28  SER A C   1 
ATOM   201  O  O   . SER A 1 27  ? 11.427  -41.484 3.198   1.00 26.11 ? 28  SER A O   1 
ATOM   202  C  CB  . SER A 1 27  ? 11.323  -38.395 2.148   1.00 29.06 ? 28  SER A CB  1 
ATOM   203  O  OG  . SER A 1 27  ? 12.446  -38.491 3.006   1.00 32.16 ? 28  SER A OG  1 
ATOM   204  N  N   . MET A 1 28  ? 10.790  -41.425 1.030   1.00 23.74 ? 29  MET A N   1 
ATOM   205  C  CA  . MET A 1 28  ? 11.277  -42.759 0.731   1.00 26.52 ? 29  MET A CA  1 
ATOM   206  C  C   . MET A 1 28  ? 11.764  -42.781 -0.707  1.00 28.16 ? 29  MET A C   1 
ATOM   207  O  O   . MET A 1 28  ? 11.111  -42.248 -1.615  1.00 23.71 ? 29  MET A O   1 
ATOM   208  C  CB  . MET A 1 28  ? 10.169  -43.791 0.944   1.00 24.40 ? 29  MET A CB  1 
ATOM   209  C  CG  . MET A 1 28  ? 10.617  -45.248 0.787   1.00 26.66 ? 29  MET A CG  1 
ATOM   210  S  SD  . MET A 1 28  ? 9.272   -46.417 0.994   1.00 30.19 ? 29  MET A SD  1 
ATOM   211  C  CE  . MET A 1 28  ? 8.444   -46.283 -0.598  1.00 34.29 ? 29  MET A CE  1 
ATOM   212  N  N   . GLN A 1 29  ? 12.928  -43.382 -0.910  1.00 25.77 ? 30  GLN A N   1 
ATOM   213  C  CA  . GLN A 1 29  ? 13.527  -43.450 -2.239  1.00 24.68 ? 30  GLN A CA  1 
ATOM   214  C  C   . GLN A 1 29  ? 12.745  -44.394 -3.155  1.00 22.54 ? 30  GLN A C   1 
ATOM   215  O  O   . GLN A 1 29  ? 12.569  -44.120 -4.342  1.00 25.99 ? 30  GLN A O   1 
ATOM   216  C  CB  . GLN A 1 29  ? 14.990  -43.886 -2.123  1.00 28.01 ? 30  GLN A CB  1 
ATOM   217  C  CG  . GLN A 1 29  ? 15.751  -43.892 -3.434  1.00 26.70 ? 30  GLN A CG  1 
ATOM   218  C  CD  . GLN A 1 29  ? 17.219  -44.221 -3.225  1.00 31.40 ? 30  GLN A CD  1 
ATOM   219  O  OE1 . GLN A 1 29  ? 17.809  -43.830 -2.221  1.00 29.93 ? 30  GLN A OE1 1 
ATOM   220  N  NE2 . GLN A 1 29  ? 17.808  -44.954 -4.166  1.00 31.54 ? 30  GLN A NE2 1 
ATOM   221  N  N   . GLY A 1 30  ? 12.262  -45.497 -2.602  1.00 20.98 ? 31  GLY A N   1 
ATOM   222  C  CA  . GLY A 1 30  ? 11.483  -46.457 -3.365  1.00 23.31 ? 31  GLY A CA  1 
ATOM   223  C  C   . GLY A 1 30  ? 12.302  -47.173 -4.437  1.00 27.21 ? 31  GLY A C   1 
ATOM   224  O  O   . GLY A 1 30  ? 13.455  -47.538 -4.198  1.00 26.65 ? 31  GLY A O   1 
ATOM   225  N  N   . TRP A 1 31  ? 11.718  -47.342 -5.621  1.00 26.40 ? 32  TRP A N   1 
ATOM   226  C  CA  . TRP A 1 31  ? 12.341  -48.113 -6.710  1.00 26.85 ? 32  TRP A CA  1 
ATOM   227  C  C   . TRP A 1 31  ? 13.476  -47.394 -7.440  1.00 27.65 ? 32  TRP A C   1 
ATOM   228  O  O   . TRP A 1 31  ? 14.246  -48.022 -8.169  1.00 28.36 ? 32  TRP A O   1 
ATOM   229  C  CB  . TRP A 1 31  ? 11.289  -48.513 -7.742  1.00 26.59 ? 32  TRP A CB  1 
ATOM   230  C  CG  . TRP A 1 31  ? 10.415  -49.661 -7.361  1.00 27.34 ? 32  TRP A CG  1 
ATOM   231  C  CD1 . TRP A 1 31  ? 9.139   -49.598 -6.883  1.00 25.20 ? 32  TRP A CD1 1 
ATOM   232  C  CD2 . TRP A 1 31  ? 10.736  -51.051 -7.470  1.00 27.80 ? 32  TRP A CD2 1 
ATOM   233  N  NE1 . TRP A 1 31  ? 8.650   -50.869 -6.668  1.00 29.44 ? 32  TRP A NE1 1 
ATOM   234  C  CE2 . TRP A 1 31  ? 9.614   -51.778 -7.022  1.00 29.96 ? 32  TRP A CE2 1 
ATOM   235  C  CE3 . TRP A 1 31  ? 11.872  -51.752 -7.889  1.00 31.28 ? 32  TRP A CE3 1 
ATOM   236  C  CZ2 . TRP A 1 31  ? 9.590   -53.174 -6.990  1.00 30.75 ? 32  TRP A CZ2 1 
ATOM   237  C  CZ3 . TRP A 1 31  ? 11.847  -53.138 -7.855  1.00 28.02 ? 32  TRP A CZ3 1 
ATOM   238  C  CH2 . TRP A 1 31  ? 10.714  -53.832 -7.412  1.00 31.11 ? 32  TRP A CH2 1 
ATOM   239  N  N   . ARG A 1 32  ? 13.576  -46.083 -7.256  1.00 22.87 ? 33  ARG A N   1 
ATOM   240  C  CA  . ARG A 1 32  ? 14.554  -45.283 -7.985  1.00 26.70 ? 33  ARG A CA  1 
ATOM   241  C  C   . ARG A 1 32  ? 15.973  -45.475 -7.452  1.00 29.70 ? 33  ARG A C   1 
ATOM   242  O  O   . ARG A 1 32  ? 16.181  -45.682 -6.256  1.00 25.59 ? 33  ARG A O   1 
ATOM   243  C  CB  . ARG A 1 32  ? 14.185  -43.801 -7.930  1.00 26.77 ? 33  ARG A CB  1 
ATOM   244  C  CG  . ARG A 1 32  ? 12.839  -43.461 -8.578  1.00 25.09 ? 33  ARG A CG  1 
ATOM   245  C  CD  . ARG A 1 32  ? 12.844  -43.769 -10.084 1.00 28.60 ? 33  ARG A CD  1 
ATOM   246  N  NE  . ARG A 1 32  ? 11.628  -43.269 -10.723 1.00 27.28 ? 33  ARG A NE  1 
ATOM   247  C  CZ  . ARG A 1 32  ? 11.519  -42.049 -11.237 1.00 29.30 ? 33  ARG A CZ  1 
ATOM   248  N  NH1 . ARG A 1 32  ? 12.565  -41.232 -11.207 1.00 23.54 ? 33  ARG A NH1 1 
ATOM   249  N  NH2 . ARG A 1 32  ? 10.373  -41.650 -11.787 1.00 28.75 ? 33  ARG A NH2 1 
ATOM   250  N  N   . VAL A 1 33  ? 16.943  -45.353 -8.346  1.00 25.66 ? 34  VAL A N   1 
ATOM   251  C  CA  . VAL A 1 33  ? 18.349  -45.527 -7.999  1.00 31.93 ? 34  VAL A CA  1 
ATOM   252  C  C   . VAL A 1 33  ? 18.907  -44.374 -7.169  1.00 30.85 ? 34  VAL A C   1 
ATOM   253  O  O   . VAL A 1 33  ? 19.858  -44.558 -6.406  1.00 26.64 ? 34  VAL A O   1 
ATOM   254  C  CB  . VAL A 1 33  ? 19.206  -45.748 -9.268  1.00 30.58 ? 34  VAL A CB  1 
ATOM   255  C  CG1 . VAL A 1 33  ? 20.666  -45.449 -8.991  1.00 36.42 ? 34  VAL A CG1 1 
ATOM   256  C  CG2 . VAL A 1 33  ? 19.028  -47.171 -9.771  1.00 34.00 ? 34  VAL A CG2 1 
ATOM   257  N  N   . GLU A 1 34  ? 18.322  -43.186 -7.318  1.00 30.45 ? 35  GLU A N   1 
ATOM   258  C  CA  . GLU A 1 34  ? 18.712  -42.039 -6.507  1.00 32.69 ? 35  GLU A CA  1 
ATOM   259  C  C   . GLU A 1 34  ? 17.496  -41.418 -5.801  1.00 32.50 ? 35  GLU A C   1 
ATOM   260  O  O   . GLU A 1 34  ? 16.369  -41.533 -6.276  1.00 30.02 ? 35  GLU A O   1 
ATOM   261  C  CB  . GLU A 1 34  ? 19.382  -40.976 -7.380  1.00 37.74 ? 35  GLU A CB  1 
ATOM   262  C  CG  . GLU A 1 34  ? 20.532  -41.491 -8.266  1.00 43.02 ? 35  GLU A CG  1 
ATOM   263  C  CD  . GLU A 1 34  ? 21.833  -41.717 -7.505  1.00 51.45 ? 35  GLU A CD  1 
ATOM   264  O  OE1 . GLU A 1 34  ? 21.868  -41.488 -6.273  1.00 50.66 ? 35  GLU A OE1 1 
ATOM   265  O  OE2 . GLU A 1 34  ? 22.827  -42.126 -8.149  1.00 54.11 ? 35  GLU A OE2 1 
ATOM   266  N  N   . MET A 1 35  ? 17.730  -40.757 -4.675  1.00 28.50 ? 36  MET A N   1 
ATOM   267  C  CA  . MET A 1 35  ? 16.681  -39.971 -4.029  1.00 29.16 ? 36  MET A CA  1 
ATOM   268  C  C   . MET A 1 35  ? 16.876  -38.498 -4.392  1.00 28.70 ? 36  MET A C   1 
ATOM   269  O  O   . MET A 1 35  ? 17.890  -37.898 -4.036  1.00 29.16 ? 36  MET A O   1 
ATOM   270  C  CB  . MET A 1 35  ? 16.705  -40.165 -2.508  1.00 27.33 ? 36  MET A CB  1 
ATOM   271  C  CG  . MET A 1 35  ? 15.692  -39.309 -1.771  1.00 29.67 ? 36  MET A CG  1 
ATOM   272  S  SD  . MET A 1 35  ? 14.023  -39.537 -2.452  1.00 26.10 ? 36  MET A SD  1 
ATOM   273  C  CE  . MET A 1 35  ? 13.007  -39.340 -0.977  1.00 25.69 ? 36  MET A CE  1 
ATOM   274  N  N   . GLU A 1 36  ? 15.919  -37.927 -5.120  1.00 26.19 ? 37  GLU A N   1 
ATOM   275  C  CA  . GLU A 1 36  ? 16.040  -36.536 -5.575  1.00 28.02 ? 37  GLU A CA  1 
ATOM   276  C  C   . GLU A 1 36  ? 14.945  -35.594 -5.056  1.00 27.80 ? 37  GLU A C   1 
ATOM   277  O  O   . GLU A 1 36  ? 14.892  -34.424 -5.444  1.00 26.69 ? 37  GLU A O   1 
ATOM   278  C  CB  . GLU A 1 36  ? 16.149  -36.466 -7.103  1.00 29.62 ? 37  GLU A CB  1 
ATOM   279  C  CG  . GLU A 1 36  ? 17.313  -37.275 -7.637  1.00 30.75 ? 37  GLU A CG  1 
ATOM   280  C  CD  . GLU A 1 36  ? 17.526  -37.123 -9.131  1.00 34.73 ? 37  GLU A CD  1 
ATOM   281  O  OE1 . GLU A 1 36  ? 16.543  -36.897 -9.869  1.00 30.15 ? 37  GLU A OE1 1 
ATOM   282  O  OE2 . GLU A 1 36  ? 18.693  -37.234 -9.564  1.00 38.94 ? 37  GLU A OE2 1 
ATOM   283  N  N   . ASP A 1 37  ? 14.086  -36.106 -4.178  1.00 28.67 ? 38  ASP A N   1 
ATOM   284  C  CA  . ASP A 1 37  ? 13.129  -35.273 -3.436  1.00 29.11 ? 38  ASP A CA  1 
ATOM   285  C  C   . ASP A 1 37  ? 13.824  -34.564 -2.270  1.00 30.31 ? 38  ASP A C   1 
ATOM   286  O  O   . ASP A 1 37  ? 14.806  -35.077 -1.714  1.00 31.95 ? 38  ASP A O   1 
ATOM   287  C  CB  . ASP A 1 37  ? 12.029  -36.140 -2.814  1.00 26.56 ? 38  ASP A CB  1 
ATOM   288  C  CG  . ASP A 1 37  ? 10.989  -36.620 -3.813  1.00 28.30 ? 38  ASP A CG  1 
ATOM   289  O  OD1 . ASP A 1 37  ? 11.104  -36.357 -5.031  1.00 28.03 ? 38  ASP A OD1 1 
ATOM   290  O  OD2 . ASP A 1 37  ? 10.038  -37.285 -3.353  1.00 26.52 ? 38  ASP A OD2 1 
ATOM   291  N  N   . ALA A 1 38  ? 13.290  -33.408 -1.877  1.00 23.52 ? 39  ALA A N   1 
ATOM   292  C  CA  . ALA A 1 38  ? 13.687  -32.734 -0.643  1.00 25.46 ? 39  ALA A CA  1 
ATOM   293  C  C   . ALA A 1 38  ? 12.449  -32.054 -0.041  1.00 25.27 ? 39  ALA A C   1 
ATOM   294  O  O   . ALA A 1 38  ? 11.390  -32.029 -0.665  1.00 22.26 ? 39  ALA A O   1 
ATOM   295  C  CB  . ALA A 1 38  ? 14.785  -31.720 -0.921  1.00 22.46 ? 39  ALA A CB  1 
ATOM   296  N  N   . HIS A 1 39  ? 12.571  -31.494 1.155   1.00 23.89 ? 40  HIS A N   1 
ATOM   297  C  CA  . HIS A 1 39  ? 11.418  -30.852 1.784   1.00 23.78 ? 40  HIS A CA  1 
ATOM   298  C  C   . HIS A 1 39  ? 11.846  -29.810 2.808   1.00 25.86 ? 40  HIS A C   1 
ATOM   299  O  O   . HIS A 1 39  ? 12.987  -29.802 3.256   1.00 24.88 ? 40  HIS A O   1 
ATOM   300  C  CB  . HIS A 1 39  ? 10.536  -31.899 2.458   1.00 24.61 ? 40  HIS A CB  1 
ATOM   301  C  CG  . HIS A 1 39  ? 11.238  -32.663 3.532   1.00 26.53 ? 40  HIS A CG  1 
ATOM   302  N  ND1 . HIS A 1 39  ? 11.813  -33.896 3.316   1.00 30.05 ? 40  HIS A ND1 1 
ATOM   303  C  CD2 . HIS A 1 39  ? 11.486  -32.350 4.825   1.00 28.09 ? 40  HIS A CD2 1 
ATOM   304  C  CE1 . HIS A 1 39  ? 12.381  -34.312 4.433   1.00 31.64 ? 40  HIS A CE1 1 
ATOM   305  N  NE2 . HIS A 1 39  ? 12.195  -33.393 5.363   1.00 31.13 ? 40  HIS A NE2 1 
ATOM   306  N  N   . THR A 1 40  ? 10.920  -28.929 3.159   1.00 20.86 ? 41  THR A N   1 
ATOM   307  C  CA  . THR A 1 40  ? 11.130  -27.942 4.208   1.00 22.82 ? 41  THR A CA  1 
ATOM   308  C  C   . THR A 1 40  ? 9.956   -28.067 5.165   1.00 26.12 ? 41  THR A C   1 
ATOM   309  O  O   . THR A 1 40  ? 8.812   -28.208 4.731   1.00 22.59 ? 41  THR A O   1 
ATOM   310  C  CB  . THR A 1 40  ? 11.122  -26.517 3.641   1.00 24.69 ? 41  THR A CB  1 
ATOM   311  O  OG1 . THR A 1 40  ? 12.044  -26.415 2.543   1.00 25.15 ? 41  THR A OG1 1 
ATOM   312  C  CG2 . THR A 1 40  ? 11.497  -25.499 4.723   1.00 23.51 ? 41  THR A CG2 1 
ATOM   313  N  N   . ALA A 1 41  ? 10.218  -28.017 6.466   1.00 26.99 ? 42  ALA A N   1 
ATOM   314  C  CA  . ALA A 1 41  ? 9.132   -27.990 7.439   1.00 24.61 ? 42  ALA A CA  1 
ATOM   315  C  C   . ALA A 1 41  ? 9.593   -27.149 8.614   1.00 29.30 ? 42  ALA A C   1 
ATOM   316  O  O   . ALA A 1 41  ? 10.515  -27.528 9.333   1.00 27.99 ? 42  ALA A O   1 
ATOM   317  C  CB  . ALA A 1 41  ? 8.772   -29.393 7.891   1.00 24.51 ? 42  ALA A CB  1 
ATOM   318  N  N   . VAL A 1 42  ? 8.989   -25.984 8.782   1.00 30.08 ? 43  VAL A N   1 
ATOM   319  C  CA  . VAL A 1 42  ? 9.397   -25.107 9.868   1.00 31.65 ? 43  VAL A CA  1 
ATOM   320  C  C   . VAL A 1 42  ? 8.209   -24.388 10.464  1.00 30.56 ? 43  VAL A C   1 
ATOM   321  O  O   . VAL A 1 42  ? 7.385   -23.828 9.752   1.00 26.87 ? 43  VAL A O   1 
ATOM   322  C  CB  . VAL A 1 42  ? 10.476  -24.101 9.425   1.00 31.68 ? 43  VAL A CB  1 
ATOM   323  C  CG1 . VAL A 1 42  ? 10.072  -23.416 8.155   1.00 34.87 ? 43  VAL A CG1 1 
ATOM   324  C  CG2 . VAL A 1 42  ? 10.733  -23.079 10.526  1.00 37.82 ? 43  VAL A CG2 1 
ATOM   325  N  N   . ILE A 1 43  ? 8.112   -24.441 11.786  1.00 30.00 ? 44  ILE A N   1 
ATOM   326  C  CA  . ILE A 1 43  ? 7.080   -23.717 12.505  1.00 30.70 ? 44  ILE A CA  1 
ATOM   327  C  C   . ILE A 1 43  ? 7.766   -22.563 13.216  1.00 34.24 ? 44  ILE A C   1 
ATOM   328  O  O   . ILE A 1 43  ? 8.716   -22.769 13.972  1.00 36.34 ? 44  ILE A O   1 
ATOM   329  C  CB  . ILE A 1 43  ? 6.357   -24.634 13.510  1.00 34.81 ? 44  ILE A CB  1 
ATOM   330  C  CG1 . ILE A 1 43  ? 5.676   -25.786 12.764  1.00 30.15 ? 44  ILE A CG1 1 
ATOM   331  C  CG2 . ILE A 1 43  ? 5.351   -23.848 14.333  1.00 30.72 ? 44  ILE A CG2 1 
ATOM   332  C  CD1 . ILE A 1 43  ? 4.831   -26.687 13.640  1.00 32.92 ? 44  ILE A CD1 1 
ATOM   333  N  N   . GLY A 1 44  ? 7.302   -21.349 12.943  1.00 31.45 ? 45  GLY A N   1 
ATOM   334  C  CA  . GLY A 1 44  ? 7.937   -20.150 13.456  1.00 35.84 ? 45  GLY A CA  1 
ATOM   335  C  C   . GLY A 1 44  ? 9.039   -19.673 12.533  1.00 34.68 ? 45  GLY A C   1 
ATOM   336  O  O   . GLY A 1 44  ? 10.117  -20.267 12.475  1.00 37.16 ? 45  GLY A O   1 
ATOM   337  N  N   . LEU A 1 45  ? 8.760   -18.604 11.798  1.00 37.65 ? 46  LEU A N   1 
ATOM   338  C  CA  . LEU A 1 45  ? 9.727   -18.033 10.869  1.00 42.14 ? 46  LEU A CA  1 
ATOM   339  C  C   . LEU A 1 45  ? 10.447  -16.853 11.517  1.00 43.78 ? 46  LEU A C   1 
ATOM   340  O  O   . LEU A 1 45  ? 9.894   -16.190 12.389  1.00 43.77 ? 46  LEU A O   1 
ATOM   341  C  CB  . LEU A 1 45  ? 9.029   -17.586 9.579   1.00 38.81 ? 46  LEU A CB  1 
ATOM   342  C  CG  . LEU A 1 45  ? 8.044   -18.602 8.974   1.00 38.06 ? 46  LEU A CG  1 
ATOM   343  C  CD1 . LEU A 1 45  ? 7.649   -18.195 7.573   1.00 38.00 ? 46  LEU A CD1 1 
ATOM   344  C  CD2 . LEU A 1 45  ? 8.620   -20.005 8.966   1.00 32.93 ? 46  LEU A CD2 1 
ATOM   345  N  N   . PRO A 1 46  ? 11.687  -16.587 11.089  1.00 53.58 ? 47  PRO A N   1 
ATOM   346  C  CA  . PRO A 1 46  ? 12.460  -15.474 11.657  1.00 58.30 ? 47  PRO A CA  1 
ATOM   347  C  C   . PRO A 1 46  ? 11.909  -14.101 11.280  1.00 56.11 ? 47  PRO A C   1 
ATOM   348  O  O   . PRO A 1 46  ? 10.937  -14.010 10.535  1.00 57.11 ? 47  PRO A O   1 
ATOM   349  C  CB  . PRO A 1 46  ? 13.853  -15.669 11.050  1.00 60.91 ? 47  PRO A CB  1 
ATOM   350  C  CG  . PRO A 1 46  ? 13.633  -16.501 9.828   1.00 60.00 ? 47  PRO A CG  1 
ATOM   351  C  CD  . PRO A 1 46  ? 12.479  -17.395 10.147  1.00 52.15 ? 47  PRO A CD  1 
ATOM   352  N  N   . SER A 1 47  ? 12.523  -13.049 11.815  1.00 59.88 ? 48  SER A N   1 
ATOM   353  C  CA  . SER A 1 47  ? 12.243  -11.676 11.392  1.00 61.88 ? 48  SER A CA  1 
ATOM   354  C  C   . SER A 1 47  ? 10.828  -11.187 11.698  1.00 57.58 ? 48  SER A C   1 
ATOM   355  O  O   . SER A 1 47  ? 10.237  -10.456 10.899  1.00 55.70 ? 48  SER A O   1 
ATOM   356  C  CB  . SER A 1 47  ? 12.527  -11.512 9.894   1.00 68.48 ? 48  SER A CB  1 
ATOM   357  O  OG  . SER A 1 47  ? 13.886  -11.781 9.591   1.00 69.25 ? 48  SER A OG  1 
ATOM   358  N  N   . GLY A 1 48  ? 10.291  -11.583 12.849  1.00 48.00 ? 49  GLY A N   1 
ATOM   359  C  CA  . GLY A 1 48  ? 8.976   -11.128 13.271  1.00 47.10 ? 49  GLY A CA  1 
ATOM   360  C  C   . GLY A 1 48  ? 7.817   -11.970 12.762  1.00 44.61 ? 49  GLY A C   1 
ATOM   361  O  O   . GLY A 1 48  ? 6.654   -11.585 12.889  1.00 44.40 ? 49  GLY A O   1 
ATOM   362  N  N   . LEU A 1 49  ? 8.130   -13.128 12.192  1.00 46.65 ? 50  LEU A N   1 
ATOM   363  C  CA  . LEU A 1 49  ? 7.099   -14.017 11.658  1.00 43.78 ? 50  LEU A CA  1 
ATOM   364  C  C   . LEU A 1 49  ? 7.002   -15.296 12.480  1.00 41.45 ? 50  LEU A C   1 
ATOM   365  O  O   . LEU A 1 49  ? 6.777   -16.385 11.936  1.00 36.58 ? 50  LEU A O   1 
ATOM   366  C  CB  . LEU A 1 49  ? 7.398   -14.358 10.195  1.00 43.99 ? 50  LEU A CB  1 
ATOM   367  C  CG  . LEU A 1 49  ? 7.512   -13.168 9.237   1.00 44.55 ? 50  LEU A CG  1 
ATOM   368  C  CD1 . LEU A 1 49  ? 7.911   -13.637 7.844   1.00 44.90 ? 50  LEU A CD1 1 
ATOM   369  C  CD2 . LEU A 1 49  ? 6.220   -12.365 9.193   1.00 44.24 ? 50  LEU A CD2 1 
ATOM   370  N  N   . GLU A 1 50  ? 7.177   -15.163 13.793  1.00 37.99 ? 51  GLU A N   1 
ATOM   371  C  CA  . GLU A 1 50  ? 7.174   -16.324 14.677  1.00 39.02 ? 51  GLU A CA  1 
ATOM   372  C  C   . GLU A 1 50  ? 5.839   -17.072 14.629  1.00 30.29 ? 51  GLU A C   1 
ATOM   373  O  O   . GLU A 1 50  ? 5.784   -18.280 14.856  1.00 33.27 ? 51  GLU A O   1 
ATOM   374  C  CB  . GLU A 1 50  ? 7.528   -15.907 16.115  1.00 44.45 ? 51  GLU A CB  1 
ATOM   375  C  CG  . GLU A 1 50  ? 7.164   -16.939 17.193  1.00 50.27 ? 51  GLU A CG  1 
ATOM   376  C  CD  . GLU A 1 50  ? 7.813   -18.309 16.969  1.00 54.47 ? 51  GLU A CD  1 
ATOM   377  O  OE1 . GLU A 1 50  ? 8.970   -18.353 16.481  1.00 54.69 ? 51  GLU A OE1 1 
ATOM   378  O  OE2 . GLU A 1 50  ? 7.159   -19.339 17.281  1.00 54.89 ? 51  GLU A OE2 1 
ATOM   379  N  N   . SER A 1 51  ? 4.768   -16.346 14.332  1.00 29.89 ? 52  SER A N   1 
ATOM   380  C  CA  . SER A 1 51  ? 3.424   -16.916 14.273  1.00 32.69 ? 52  SER A CA  1 
ATOM   381  C  C   . SER A 1 51  ? 3.156   -17.636 12.954  1.00 31.02 ? 52  SER A C   1 
ATOM   382  O  O   . SER A 1 51  ? 2.073   -18.194 12.757  1.00 30.93 ? 52  SER A O   1 
ATOM   383  C  CB  . SER A 1 51  ? 2.379   -15.810 14.434  1.00 35.06 ? 52  SER A CB  1 
ATOM   384  O  OG  . SER A 1 51  ? 2.393   -15.291 15.753  1.00 48.91 ? 52  SER A OG  1 
ATOM   385  N  N   . TRP A 1 52  ? 4.132   -17.579 12.054  1.00 30.10 ? 53  TRP A N   1 
ATOM   386  C  CA  . TRP A 1 52  ? 4.030   -18.149 10.706  1.00 30.25 ? 53  TRP A CA  1 
ATOM   387  C  C   . TRP A 1 52  ? 4.698   -19.514 10.677  1.00 31.13 ? 53  TRP A C   1 
ATOM   388  O  O   . TRP A 1 52  ? 5.554   -19.793 11.512  1.00 28.91 ? 53  TRP A O   1 
ATOM   389  C  CB  . TRP A 1 52  ? 4.813   -17.268 9.741   1.00 31.48 ? 53  TRP A CB  1 
ATOM   390  C  CG  . TRP A 1 52  ? 4.054   -16.367 8.833   1.00 37.17 ? 53  TRP A CG  1 
ATOM   391  C  CD1 . TRP A 1 52  ? 3.880   -16.522 7.477   1.00 40.76 ? 53  TRP A CD1 1 
ATOM   392  C  CD2 . TRP A 1 52  ? 3.436   -15.130 9.172   1.00 39.47 ? 53  TRP A CD2 1 
ATOM   393  N  NE1 . TRP A 1 52  ? 3.177   -15.471 6.965   1.00 35.14 ? 53  TRP A NE1 1 
ATOM   394  C  CE2 . TRP A 1 52  ? 2.887   -14.600 7.986   1.00 42.39 ? 53  TRP A CE2 1 
ATOM   395  C  CE3 . TRP A 1 52  ? 3.283   -14.421 10.363  1.00 38.27 ? 53  TRP A CE3 1 
ATOM   396  C  CZ2 . TRP A 1 52  ? 2.189   -13.395 7.963   1.00 41.84 ? 53  TRP A CZ2 1 
ATOM   397  C  CZ3 . TRP A 1 52  ? 2.594   -13.232 10.338  1.00 46.03 ? 53  TRP A CZ3 1 
ATOM   398  C  CH2 . TRP A 1 52  ? 2.051   -12.729 9.146   1.00 48.44 ? 53  TRP A CH2 1 
ATOM   399  N  N   . SER A 1 53  ? 4.331   -20.341 9.692   1.00 25.01 ? 54  SER A N   1 
ATOM   400  C  CA  . SER A 1 53  ? 4.962   -21.644 9.474   1.00 24.55 ? 54  SER A CA  1 
ATOM   401  C  C   . SER A 1 53  ? 5.110   -21.833 7.964   1.00 23.28 ? 54  SER A C   1 
ATOM   402  O  O   . SER A 1 53  ? 4.410   -21.185 7.192   1.00 21.87 ? 54  SER A O   1 
ATOM   403  C  CB  . SER A 1 53  ? 4.117   -22.782 10.049  1.00 24.07 ? 54  SER A CB  1 
ATOM   404  O  OG  . SER A 1 53  ? 3.803   -22.567 11.414  1.00 28.25 ? 54  SER A OG  1 
ATOM   405  N  N   . PHE A 1 54  ? 6.010   -22.713 7.552   1.00 25.42 ? 55  PHE A N   1 
ATOM   406  C  CA  . PHE A 1 54  ? 6.243   -22.961 6.131   1.00 23.78 ? 55  PHE A CA  1 
ATOM   407  C  C   . PHE A 1 54  ? 6.532   -24.439 5.917   1.00 24.26 ? 55  PHE A C   1 
ATOM   408  O  O   . PHE A 1 54  ? 7.334   -25.035 6.644   1.00 23.84 ? 55  PHE A O   1 
ATOM   409  C  CB  . PHE A 1 54  ? 7.398   -22.087 5.616   1.00 23.57 ? 55  PHE A CB  1 
ATOM   410  C  CG  . PHE A 1 54  ? 7.740   -22.313 4.170   1.00 26.25 ? 55  PHE A CG  1 
ATOM   411  C  CD1 . PHE A 1 54  ? 6.901   -21.843 3.162   1.00 24.37 ? 55  PHE A CD1 1 
ATOM   412  C  CD2 . PHE A 1 54  ? 8.907   -22.981 3.816   1.00 24.95 ? 55  PHE A CD2 1 
ATOM   413  C  CE1 . PHE A 1 54  ? 7.210   -22.049 1.825   1.00 25.04 ? 55  PHE A CE1 1 
ATOM   414  C  CE2 . PHE A 1 54  ? 9.230   -23.193 2.477   1.00 25.89 ? 55  PHE A CE2 1 
ATOM   415  C  CZ  . PHE A 1 54  ? 8.373   -22.729 1.481   1.00 24.42 ? 55  PHE A CZ  1 
ATOM   416  N  N   . PHE A 1 55  ? 5.848   -25.039 4.943   1.00 22.29 ? 56  PHE A N   1 
ATOM   417  C  CA  . PHE A 1 55  ? 6.077   -26.427 4.570   1.00 20.74 ? 56  PHE A CA  1 
ATOM   418  C  C   . PHE A 1 55  ? 6.149   -26.539 3.044   1.00 21.59 ? 56  PHE A C   1 
ATOM   419  O  O   . PHE A 1 55  ? 5.379   -25.901 2.346   1.00 20.31 ? 56  PHE A O   1 
ATOM   420  C  CB  . PHE A 1 55  ? 4.944   -27.327 5.082   1.00 20.46 ? 56  PHE A CB  1 
ATOM   421  C  CG  . PHE A 1 55  ? 4.730   -27.246 6.569   1.00 21.81 ? 56  PHE A CG  1 
ATOM   422  C  CD1 . PHE A 1 55  ? 3.885   -26.283 7.107   1.00 23.02 ? 56  PHE A CD1 1 
ATOM   423  C  CD2 . PHE A 1 55  ? 5.390   -28.124 7.428   1.00 22.32 ? 56  PHE A CD2 1 
ATOM   424  C  CE1 . PHE A 1 55  ? 3.690   -26.199 8.484   1.00 23.63 ? 56  PHE A CE1 1 
ATOM   425  C  CE2 . PHE A 1 55  ? 5.199   -28.053 8.798   1.00 24.60 ? 56  PHE A CE2 1 
ATOM   426  C  CZ  . PHE A 1 55  ? 4.347   -27.082 9.327   1.00 25.35 ? 56  PHE A CZ  1 
ATOM   427  N  N   . ALA A 1 56  ? 7.057   -27.360 2.532   1.00 21.26 ? 57  ALA A N   1 
ATOM   428  C  CA  . ALA A 1 56  ? 7.201   -27.504 1.082   1.00 19.73 ? 57  ALA A CA  1 
ATOM   429  C  C   . ALA A 1 56  ? 7.808   -28.848 0.715   1.00 20.01 ? 57  ALA A C   1 
ATOM   430  O  O   . ALA A 1 56  ? 8.597   -29.405 1.483   1.00 21.90 ? 57  ALA A O   1 
ATOM   431  C  CB  . ALA A 1 56  ? 8.064   -26.366 0.527   1.00 21.40 ? 57  ALA A CB  1 
ATOM   432  N  N   . VAL A 1 57  ? 7.423   -29.368 -0.450  1.00 18.66 ? 58  VAL A N   1 
ATOM   433  C  CA  . VAL A 1 57  ? 8.017   -30.568 -1.020  1.00 18.57 ? 58  VAL A CA  1 
ATOM   434  C  C   . VAL A 1 57  ? 8.651   -30.188 -2.350  1.00 22.19 ? 58  VAL A C   1 
ATOM   435  O  O   . VAL A 1 57  ? 8.045   -29.451 -3.147  1.00 19.44 ? 58  VAL A O   1 
ATOM   436  C  CB  . VAL A 1 57  ? 6.956   -31.678 -1.263  1.00 19.03 ? 58  VAL A CB  1 
ATOM   437  C  CG1 . VAL A 1 57  ? 7.553   -32.828 -2.081  1.00 19.43 ? 58  VAL A CG1 1 
ATOM   438  C  CG2 . VAL A 1 57  ? 6.409   -32.193 0.074   1.00 19.92 ? 58  VAL A CG2 1 
ATOM   439  N  N   . TYR A 1 58  ? 9.867   -30.681 -2.590  1.00 21.55 ? 59  TYR A N   1 
ATOM   440  C  CA  . TYR A 1 58  ? 10.596  -30.376 -3.818  1.00 20.41 ? 59  TYR A CA  1 
ATOM   441  C  C   . TYR A 1 58  ? 10.900  -31.665 -4.556  1.00 22.24 ? 59  TYR A C   1 
ATOM   442  O  O   . TYR A 1 58  ? 11.508  -32.581 -4.002  1.00 23.21 ? 59  TYR A O   1 
ATOM   443  C  CB  . TYR A 1 58  ? 11.908  -29.630 -3.512  1.00 22.28 ? 59  TYR A CB  1 
ATOM   444  C  CG  . TYR A 1 58  ? 11.725  -28.439 -2.593  1.00 21.88 ? 59  TYR A CG  1 
ATOM   445  C  CD1 . TYR A 1 58  ? 11.445  -27.170 -3.095  1.00 20.26 ? 59  TYR A CD1 1 
ATOM   446  C  CD2 . TYR A 1 58  ? 11.821  -28.591 -1.219  1.00 22.65 ? 59  TYR A CD2 1 
ATOM   447  C  CE1 . TYR A 1 58  ? 11.267  -26.079 -2.235  1.00 21.93 ? 59  TYR A CE1 1 
ATOM   448  C  CE2 . TYR A 1 58  ? 11.649  -27.522 -0.360  1.00 23.17 ? 59  TYR A CE2 1 
ATOM   449  C  CZ  . TYR A 1 58  ? 11.376  -26.277 -0.865  1.00 22.63 ? 59  TYR A CZ  1 
ATOM   450  O  OH  . TYR A 1 58  ? 11.228  -25.233 0.012   1.00 23.20 ? 59  TYR A OH  1 
ATOM   451  N  N   . ASP A 1 59  ? 10.462  -31.753 -5.804  1.00 20.42 ? 60  ASP A N   1 
ATOM   452  C  CA  . ASP A 1 59  ? 10.717  -32.950 -6.587  1.00 22.48 ? 60  ASP A CA  1 
ATOM   453  C  C   . ASP A 1 59  ? 11.830  -32.642 -7.584  1.00 25.27 ? 60  ASP A C   1 
ATOM   454  O  O   . ASP A 1 59  ? 11.574  -32.072 -8.639  1.00 22.10 ? 60  ASP A O   1 
ATOM   455  C  CB  . ASP A 1 59  ? 9.435   -33.404 -7.288  1.00 24.08 ? 60  ASP A CB  1 
ATOM   456  C  CG  . ASP A 1 59  ? 9.596   -34.740 -7.968  1.00 26.91 ? 60  ASP A CG  1 
ATOM   457  O  OD1 . ASP A 1 59  ? 10.741  -35.180 -8.083  1.00 21.43 ? 60  ASP A OD1 1 
ATOM   458  O  OD2 . ASP A 1 59  ? 8.597   -35.330 -8.386  1.00 23.39 ? 60  ASP A OD2 1 
ATOM   459  N  N   . GLY A 1 60  ? 13.068  -32.998 -7.228  1.00 23.92 ? 61  GLY A N   1 
ATOM   460  C  CA  . GLY A 1 60  ? 14.226  -32.708 -8.073  1.00 22.54 ? 61  GLY A CA  1 
ATOM   461  C  C   . GLY A 1 60  ? 14.265  -33.621 -9.289  1.00 24.99 ? 61  GLY A C   1 
ATOM   462  O  O   . GLY A 1 60  ? 13.862  -34.762 -9.204  1.00 24.67 ? 61  GLY A O   1 
ATOM   463  N  N   . HIS A 1 61  ? 14.751  -33.120 -10.424 1.00 27.14 ? 62  HIS A N   1 
ATOM   464  C  CA  . HIS A 1 61  ? 14.998  -33.989 -11.574 1.00 28.11 ? 62  HIS A CA  1 
ATOM   465  C  C   . HIS A 1 61  ? 16.386  -33.732 -12.163 1.00 26.75 ? 62  HIS A C   1 
ATOM   466  O  O   . HIS A 1 61  ? 16.919  -32.637 -12.033 1.00 27.23 ? 62  HIS A O   1 
ATOM   467  C  CB  . HIS A 1 61  ? 13.899  -33.861 -12.637 1.00 29.71 ? 62  HIS A CB  1 
ATOM   468  C  CG  . HIS A 1 61  ? 13.531  -32.449 -12.974 1.00 27.10 ? 62  HIS A CG  1 
ATOM   469  N  ND1 . HIS A 1 61  ? 12.392  -31.843 -12.489 1.00 29.17 ? 62  HIS A ND1 1 
ATOM   470  C  CD2 . HIS A 1 61  ? 14.126  -31.538 -13.779 1.00 28.85 ? 62  HIS A CD2 1 
ATOM   471  C  CE1 . HIS A 1 61  ? 12.308  -30.614 -12.968 1.00 29.26 ? 62  HIS A CE1 1 
ATOM   472  N  NE2 . HIS A 1 61  ? 13.348  -30.404 -13.757 1.00 29.99 ? 62  HIS A NE2 1 
ATOM   473  N  N   . ALA A 1 62  ? 16.956  -34.759 -12.789 1.00 30.52 ? 63  ALA A N   1 
ATOM   474  C  CA  . ALA A 1 62  ? 18.318  -34.706 -13.325 1.00 32.45 ? 63  ALA A CA  1 
ATOM   475  C  C   . ALA A 1 62  ? 19.306  -34.278 -12.257 1.00 31.92 ? 63  ALA A C   1 
ATOM   476  O  O   . ALA A 1 62  ? 20.228  -33.522 -12.533 1.00 32.92 ? 63  ALA A O   1 
ATOM   477  C  CB  . ALA A 1 62  ? 18.397  -33.773 -14.519 1.00 30.68 ? 63  ALA A CB  1 
ATOM   478  N  N   . GLY A 1 63  ? 19.102  -34.757 -11.033 1.00 36.62 ? 64  GLY A N   1 
ATOM   479  C  CA  . GLY A 1 63  ? 19.955  -34.379 -9.921  1.00 33.72 ? 64  GLY A CA  1 
ATOM   480  C  C   . GLY A 1 63  ? 19.180  -33.784 -8.756  1.00 35.74 ? 64  GLY A C   1 
ATOM   481  O  O   . GLY A 1 63  ? 18.009  -33.424 -8.884  1.00 33.24 ? 64  GLY A O   1 
ATOM   482  N  N   . SER A 1 64  ? 19.848  -33.671 -7.614  1.00 34.90 ? 65  SER A N   1 
ATOM   483  C  CA  . SER A 1 64  ? 19.206  -33.212 -6.394  1.00 32.84 ? 65  SER A CA  1 
ATOM   484  C  C   . SER A 1 64  ? 19.642  -31.803 -6.016  1.00 32.63 ? 65  SER A C   1 
ATOM   485  O  O   . SER A 1 64  ? 19.105  -31.216 -5.087  1.00 30.96 ? 65  SER A O   1 
ATOM   486  C  CB  . SER A 1 64  ? 19.495  -34.191 -5.249  1.00 37.48 ? 65  SER A CB  1 
ATOM   487  O  OG  . SER A 1 64  ? 20.889  -34.278 -4.982  1.00 37.22 ? 65  SER A OG  1 
ATOM   488  N  N   . GLN A 1 65  ? 20.605  -31.253 -6.753  1.00 30.80 ? 66  GLN A N   1 
ATOM   489  C  CA  . GLN A 1 65  ? 21.195  -29.965 -6.392  1.00 33.52 ? 66  GLN A CA  1 
ATOM   490  C  C   . GLN A 1 65  ? 20.187  -28.829 -6.228  1.00 31.28 ? 66  GLN A C   1 
ATOM   491  O  O   . GLN A 1 65  ? 20.219  -28.108 -5.233  1.00 28.76 ? 66  GLN A O   1 
ATOM   492  C  CB  . GLN A 1 65  ? 22.273  -29.548 -7.401  1.00 33.69 ? 66  GLN A CB  1 
ATOM   493  C  CG  . GLN A 1 65  ? 23.581  -30.326 -7.280  1.00 37.08 ? 66  GLN A CG  1 
ATOM   494  C  CD  . GLN A 1 65  ? 23.718  -31.429 -8.309  1.00 40.33 ? 66  GLN A CD  1 
ATOM   495  O  OE1 . GLN A 1 65  ? 24.829  -31.899 -8.576  1.00 40.41 ? 66  GLN A OE1 1 
ATOM   496  N  NE2 . GLN A 1 65  ? 22.592  -31.858 -8.889  1.00 34.96 ? 66  GLN A NE2 1 
ATOM   497  N  N   . VAL A 1 66  ? 19.319  -28.650 -7.219  1.00 27.84 ? 67  VAL A N   1 
ATOM   498  C  CA  . VAL A 1 66  ? 18.340  -27.575 -7.164  1.00 26.62 ? 67  VAL A CA  1 
ATOM   499  C  C   . VAL A 1 66  ? 17.368  -27.820 -6.020  1.00 25.31 ? 67  VAL A C   1 
ATOM   500  O  O   . VAL A 1 66  ? 17.088  -26.916 -5.227  1.00 25.36 ? 67  VAL A O   1 
ATOM   501  C  CB  . VAL A 1 66  ? 17.581  -27.398 -8.503  1.00 25.90 ? 67  VAL A CB  1 
ATOM   502  C  CG1 . VAL A 1 66  ? 16.441  -26.379 -8.356  1.00 25.11 ? 67  VAL A CG1 1 
ATOM   503  C  CG2 . VAL A 1 66  ? 18.546  -26.942 -9.591  1.00 26.05 ? 67  VAL A CG2 1 
ATOM   504  N  N   . ALA A 1 67  ? 16.865  -29.046 -5.924  1.00 24.34 ? 68  ALA A N   1 
ATOM   505  C  CA  . ALA A 1 67  ? 15.885  -29.361 -4.885  1.00 26.15 ? 68  ALA A CA  1 
ATOM   506  C  C   . ALA A 1 67  ? 16.473  -29.093 -3.507  1.00 25.61 ? 68  ALA A C   1 
ATOM   507  O  O   . ALA A 1 67  ? 15.817  -28.500 -2.648  1.00 26.14 ? 68  ALA A O   1 
ATOM   508  C  CB  . ALA A 1 67  ? 15.417  -30.804 -5.009  1.00 21.76 ? 68  ALA A CB  1 
ATOM   509  N  N   . LYS A 1 68  ? 17.726  -29.508 -3.313  1.00 31.61 ? 69  LYS A N   1 
ATOM   510  C  CA  . LYS A 1 68  ? 18.416  -29.322 -2.035  1.00 30.56 ? 69  LYS A CA  1 
ATOM   511  C  C   . LYS A 1 68  ? 18.693  -27.867 -1.707  1.00 30.01 ? 69  LYS A C   1 
ATOM   512  O  O   . LYS A 1 68  ? 18.572  -27.460 -0.550  1.00 28.87 ? 69  LYS A O   1 
ATOM   513  C  CB  . LYS A 1 68  ? 19.718  -30.135 -1.992  1.00 30.94 ? 69  LYS A CB  1 
ATOM   514  C  CG  . LYS A 1 68  ? 19.491  -31.631 -1.890  1.00 31.24 ? 69  LYS A CG  1 
ATOM   515  C  CD  . LYS A 1 68  ? 20.811  -32.366 -1.693  1.00 40.76 ? 69  LYS A CD  1 
ATOM   516  C  CE  . LYS A 1 68  ? 20.604  -33.735 -1.068  1.00 39.49 ? 69  LYS A CE  1 
ATOM   517  N  NZ  . LYS A 1 68  ? 20.407  -34.802 -2.083  1.00 46.90 ? 69  LYS A NZ  1 
ATOM   518  N  N   . TYR A 1 69  ? 19.069  -27.075 -2.708  1.00 26.11 ? 70  TYR A N   1 
ATOM   519  C  CA  . TYR A 1 69  ? 19.270  -25.661 -2.445  1.00 28.08 ? 70  TYR A CA  1 
ATOM   520  C  C   . TYR A 1 69  ? 17.930  -25.023 -2.063  1.00 27.49 ? 70  TYR A C   1 
ATOM   521  O  O   . TYR A 1 69  ? 17.852  -24.234 -1.120  1.00 26.04 ? 70  TYR A O   1 
ATOM   522  C  CB  . TYR A 1 69  ? 19.911  -24.920 -3.634  1.00 26.41 ? 70  TYR A CB  1 
ATOM   523  C  CG  . TYR A 1 69  ? 20.253  -23.491 -3.276  1.00 34.22 ? 70  TYR A CG  1 
ATOM   524  C  CD1 . TYR A 1 69  ? 21.386  -23.199 -2.517  1.00 34.32 ? 70  TYR A CD1 1 
ATOM   525  C  CD2 . TYR A 1 69  ? 19.424  -22.436 -3.651  1.00 31.35 ? 70  TYR A CD2 1 
ATOM   526  C  CE1 . TYR A 1 69  ? 21.690  -21.901 -2.157  1.00 33.92 ? 70  TYR A CE1 1 
ATOM   527  C  CE2 . TYR A 1 69  ? 19.724  -21.132 -3.293  1.00 32.79 ? 70  TYR A CE2 1 
ATOM   528  C  CZ  . TYR A 1 69  ? 20.862  -20.873 -2.550  1.00 33.39 ? 70  TYR A CZ  1 
ATOM   529  O  OH  . TYR A 1 69  ? 21.158  -19.573 -2.192  1.00 37.76 ? 70  TYR A OH  1 
ATOM   530  N  N   . CYS A 1 70  ? 16.871  -25.375 -2.786  1.00 27.44 ? 71  CYS A N   1 
ATOM   531  C  CA  . CYS A 1 70  ? 15.545  -24.826 -2.488  1.00 26.51 ? 71  CYS A CA  1 
ATOM   532  C  C   . CYS A 1 70  ? 15.072  -25.159 -1.073  1.00 26.03 ? 71  CYS A C   1 
ATOM   533  O  O   . CYS A 1 70  ? 14.554  -24.297 -0.364  1.00 25.74 ? 71  CYS A O   1 
ATOM   534  C  CB  . CYS A 1 70  ? 14.516  -25.315 -3.510  1.00 25.34 ? 71  CYS A CB  1 
ATOM   535  S  SG  . CYS A 1 70  ? 14.710  -24.549 -5.123  1.00 28.28 ? 71  CYS A SG  1 
ATOM   536  N  N   . CYS A 1 71  ? 15.242  -26.408 -0.662  1.00 26.26 ? 72  CYS A N   1 
ATOM   537  C  CA  . CYS A 1 71  ? 14.699  -26.826 0.623   1.00 26.62 ? 72  CYS A CA  1 
ATOM   538  C  C   . CYS A 1 71  ? 15.365  -26.069 1.772   1.00 28.76 ? 72  CYS A C   1 
ATOM   539  O  O   . CYS A 1 71  ? 14.805  -25.940 2.858   1.00 27.93 ? 72  CYS A O   1 
ATOM   540  C  CB  . CYS A 1 71  ? 14.791  -28.349 0.792   1.00 27.11 ? 72  CYS A CB  1 
ATOM   541  S  SG  . CYS A 1 71  ? 16.285  -29.028 1.565   1.00 32.14 ? 72  CYS A SG  1 
ATOM   542  N  N   . GLU A 1 72  ? 16.560  -25.566 1.551   1.00 31.58 ? 73  GLU A N   1 
ATOM   543  C  CA  . GLU A 1 72  ? 17.279  -24.778 2.547   1.00 33.52 ? 73  GLU A CA  1 
ATOM   544  C  C   . GLU A 1 72  ? 17.166  -23.265 2.356   1.00 34.98 ? 73  GLU A C   1 
ATOM   545  O  O   . GLU A 1 72  ? 17.377  -22.507 3.300   1.00 36.03 ? 73  GLU A O   1 
ATOM   546  C  CB  . GLU A 1 72  ? 18.753  -25.185 2.568   1.00 37.76 ? 73  GLU A CB  1 
ATOM   547  C  CG  . GLU A 1 72  ? 18.986  -26.597 3.071   1.00 42.59 ? 73  GLU A CG  1 
ATOM   548  C  CD  . GLU A 1 72  ? 20.445  -27.001 3.015   1.00 55.38 ? 73  GLU A CD  1 
ATOM   549  O  OE1 . GLU A 1 72  ? 21.247  -26.254 2.409   1.00 56.34 ? 73  GLU A OE1 1 
ATOM   550  O  OE2 . GLU A 1 72  ? 20.792  -28.060 3.584   1.00 55.03 ? 73  GLU A OE2 1 
ATOM   551  N  N   . HIS A 1 73  ? 16.830  -22.771 1.250   1.00 27.96 ? 74  HIS A N   1 
ATOM   552  C  CA  . HIS A 1 73  ? 16.880  -21.321 1.036   1.00 29.55 ? 74  HIS A CA  1 
ATOM   553  C  C   . HIS A 1 73  ? 15.688  -20.684 0.348   1.00 29.10 ? 74  HIS A C   1 
ATOM   554  O  O   . HIS A 1 73  ? 15.620  -19.462 0.245   1.00 28.76 ? 74  HIS A O   1 
ATOM   555  C  CB  . HIS A 1 73  ? 18.148  -20.936 0.277   1.00 32.40 ? 74  HIS A CB  1 
ATOM   556  C  CG  . HIS A 1 73  ? 19.392  -21.220 1.045   1.00 35.40 ? 74  HIS A CG  1 
ATOM   557  N  ND1 . HIS A 1 73  ? 20.173  -22.329 0.809   1.00 37.08 ? 74  HIS A ND1 1 
ATOM   558  C  CD2 . HIS A 1 73  ? 19.960  -20.569 2.088   1.00 39.41 ? 74  HIS A CD2 1 
ATOM   559  C  CE1 . HIS A 1 73  ? 21.188  -22.335 1.656   1.00 38.57 ? 74  HIS A CE1 1 
ATOM   560  N  NE2 . HIS A 1 73  ? 21.079  -21.280 2.445   1.00 39.33 ? 74  HIS A NE2 1 
ATOM   561  N  N   . LEU A 1 74  ? 14.751  -21.485 -0.139  1.00 28.43 ? 75  LEU A N   1 
ATOM   562  C  CA  . LEU A 1 74  ? 13.608  -20.872 -0.800  1.00 25.51 ? 75  LEU A CA  1 
ATOM   563  C  C   . LEU A 1 74  ? 12.904  -19.898 0.144   1.00 26.04 ? 75  LEU A C   1 
ATOM   564  O  O   . LEU A 1 74  ? 12.522  -18.803 -0.251  1.00 26.48 ? 75  LEU A O   1 
ATOM   565  C  CB  . LEU A 1 74  ? 12.628  -21.926 -1.297  1.00 27.25 ? 75  LEU A CB  1 
ATOM   566  C  CG  . LEU A 1 74  ? 11.375  -21.322 -1.938  1.00 26.92 ? 75  LEU A CG  1 
ATOM   567  C  CD1 . LEU A 1 74  ? 11.766  -20.500 -3.153  1.00 23.00 ? 75  LEU A CD1 1 
ATOM   568  C  CD2 . LEU A 1 74  ? 10.392  -22.437 -2.321  1.00 22.20 ? 75  LEU A CD2 1 
ATOM   569  N  N   . LEU A 1 75  ? 12.738  -20.302 1.397   1.00 26.11 ? 76  LEU A N   1 
ATOM   570  C  CA  . LEU A 1 75  ? 11.980  -19.497 2.353   1.00 27.79 ? 76  LEU A CA  1 
ATOM   571  C  C   . LEU A 1 75  ? 12.615  -18.122 2.564   1.00 28.85 ? 76  LEU A C   1 
ATOM   572  O  O   . LEU A 1 75  ? 11.933  -17.103 2.495   1.00 28.00 ? 76  LEU A O   1 
ATOM   573  C  CB  . LEU A 1 75  ? 11.866  -20.228 3.688   1.00 26.86 ? 76  LEU A CB  1 
ATOM   574  C  CG  . LEU A 1 75  ? 10.631  -19.999 4.566   1.00 31.25 ? 76  LEU A CG  1 
ATOM   575  C  CD1 . LEU A 1 75  ? 11.040  -19.905 6.018   1.00 34.66 ? 76  LEU A CD1 1 
ATOM   576  C  CD2 . LEU A 1 75  ? 9.813   -18.778 4.147   1.00 31.43 ? 76  LEU A CD2 1 
ATOM   577  N  N   . ASP A 1 76  ? 13.919  -18.087 2.826   1.00 30.74 ? 77  ASP A N   1 
ATOM   578  C  CA  . ASP A 1 76  ? 14.552  -16.795 3.047   1.00 33.71 ? 77  ASP A CA  1 
ATOM   579  C  C   . ASP A 1 76  ? 14.546  -15.945 1.780   1.00 33.00 ? 77  ASP A C   1 
ATOM   580  O  O   . ASP A 1 76  ? 14.426  -14.733 1.859   1.00 34.11 ? 77  ASP A O   1 
ATOM   581  C  CB  . ASP A 1 76  ? 15.946  -16.906 3.681   1.00 37.58 ? 77  ASP A CB  1 
ATOM   582  C  CG  . ASP A 1 76  ? 16.908  -17.719 2.858   1.00 39.26 ? 77  ASP A CG  1 
ATOM   583  O  OD1 . ASP A 1 76  ? 17.368  -17.227 1.806   1.00 41.90 ? 77  ASP A OD1 1 
ATOM   584  O  OD2 . ASP A 1 76  ? 17.244  -18.841 3.286   1.00 44.55 ? 77  ASP A OD2 1 
ATOM   585  N  N   . HIS A 1 77  ? 14.634  -16.575 0.612   1.00 26.68 ? 78  HIS A N   1 
ATOM   586  C  CA  . HIS A 1 77  ? 14.504  -15.819 -0.629  1.00 26.27 ? 78  HIS A CA  1 
ATOM   587  C  C   . HIS A 1 77  ? 13.115  -15.187 -0.753  1.00 26.05 ? 78  HIS A C   1 
ATOM   588  O  O   . HIS A 1 77  ? 12.970  -14.095 -1.292  1.00 27.23 ? 78  HIS A O   1 
ATOM   589  C  CB  . HIS A 1 77  ? 14.825  -16.685 -1.855  1.00 26.92 ? 78  HIS A CB  1 
ATOM   590  C  CG  . HIS A 1 77  ? 16.290  -16.785 -2.155  1.00 28.27 ? 78  HIS A CG  1 
ATOM   591  N  ND1 . HIS A 1 77  ? 17.113  -17.708 -1.546  1.00 31.04 ? 78  HIS A ND1 1 
ATOM   592  C  CD2 . HIS A 1 77  ? 17.082  -16.067 -2.989  1.00 28.98 ? 78  HIS A CD2 1 
ATOM   593  C  CE1 . HIS A 1 77  ? 18.346  -17.564 -2.000  1.00 30.77 ? 78  HIS A CE1 1 
ATOM   594  N  NE2 . HIS A 1 77  ? 18.353  -16.577 -2.878  1.00 31.26 ? 78  HIS A NE2 1 
ATOM   595  N  N   . ILE A 1 78  ? 12.097  -15.882 -0.247  1.00 28.98 ? 79  ILE A N   1 
ATOM   596  C  CA  . ILE A 1 78  ? 10.730  -15.370 -0.269  1.00 31.03 ? 79  ILE A CA  1 
ATOM   597  C  C   . ILE A 1 78  ? 10.509  -14.236 0.736   1.00 32.50 ? 79  ILE A C   1 
ATOM   598  O  O   . ILE A 1 78  ? 9.909   -13.211 0.402   1.00 34.47 ? 79  ILE A O   1 
ATOM   599  C  CB  . ILE A 1 78  ? 9.715   -16.483 0.043   1.00 29.98 ? 79  ILE A CB  1 
ATOM   600  C  CG1 . ILE A 1 78  ? 9.672   -17.499 -1.100  1.00 28.92 ? 79  ILE A CG1 1 
ATOM   601  C  CG2 . ILE A 1 78  ? 8.338   -15.891 0.287   1.00 30.67 ? 79  ILE A CG2 1 
ATOM   602  C  CD1 . ILE A 1 78  ? 8.843   -18.707 -0.782  1.00 32.16 ? 79  ILE A CD1 1 
ATOM   603  N  N   . THR A 1 79  ? 10.979  -14.424 1.967   1.00 34.10 ? 80  THR A N   1 
ATOM   604  C  CA  . THR A 1 79  ? 10.706  -13.458 3.033   1.00 35.81 ? 80  THR A CA  1 
ATOM   605  C  C   . THR A 1 79  ? 11.675  -12.275 3.051   1.00 41.54 ? 80  THR A C   1 
ATOM   606  O  O   . THR A 1 79  ? 11.340  -11.209 3.572   1.00 40.61 ? 80  THR A O   1 
ATOM   607  C  CB  . THR A 1 79  ? 10.747  -14.114 4.419   1.00 37.13 ? 80  THR A CB  1 
ATOM   608  O  OG1 . THR A 1 79  ? 12.041  -14.690 4.631   1.00 36.41 ? 80  THR A OG1 1 
ATOM   609  C  CG2 . THR A 1 79  ? 9.680   -15.189 4.541   1.00 36.72 ? 80  THR A CG2 1 
ATOM   610  N  N   . ASN A 1 80  ? 12.870  -12.472 2.492   1.00 45.29 ? 81  ASN A N   1 
ATOM   611  C  CA  . ASN A 1 80  ? 13.911  -11.443 2.492   1.00 45.07 ? 81  ASN A CA  1 
ATOM   612  C  C   . ASN A 1 80  ? 14.067  -10.722 1.160   1.00 49.12 ? 81  ASN A C   1 
ATOM   613  O  O   . ASN A 1 80  ? 15.175  -10.611 0.639   1.00 54.43 ? 81  ASN A O   1 
ATOM   614  C  CB  . ASN A 1 80  ? 15.266  -12.042 2.881   1.00 49.11 ? 81  ASN A CB  1 
ATOM   615  C  CG  . ASN A 1 80  ? 15.262  -12.641 4.270   1.00 52.35 ? 81  ASN A CG  1 
ATOM   616  O  OD1 . ASN A 1 80  ? 14.398  -12.327 5.090   1.00 57.31 ? 81  ASN A OD1 1 
ATOM   617  N  ND2 . ASN A 1 80  ? 16.236  -13.504 4.546   1.00 55.80 ? 81  ASN A ND2 1 
ATOM   618  N  N   . ASN A 1 81  ? 12.957  -10.256 0.600   1.00 35.92 ? 82  ASN A N   1 
ATOM   619  C  CA  . ASN A 1 81  ? 12.991  -9.368  -0.555  1.00 35.94 ? 82  ASN A CA  1 
ATOM   620  C  C   . ASN A 1 81  ? 12.038  -8.204  -0.313  1.00 35.39 ? 82  ASN A C   1 
ATOM   621  O  O   . ASN A 1 81  ? 11.159  -8.295  0.537   1.00 34.90 ? 82  ASN A O   1 
ATOM   622  C  CB  . ASN A 1 81  ? 12.677  -10.111 -1.867  1.00 33.47 ? 82  ASN A CB  1 
ATOM   623  C  CG  . ASN A 1 81  ? 11.216  -10.565 -1.967  1.00 30.35 ? 82  ASN A CG  1 
ATOM   624  O  OD1 . ASN A 1 81  ? 10.311  -9.748  -2.128  1.00 26.14 ? 82  ASN A OD1 1 
ATOM   625  N  ND2 . ASN A 1 81  ? 10.992  -11.882 -1.898  1.00 29.13 ? 82  ASN A ND2 1 
ATOM   626  N  N   . GLN A 1 82  ? 12.216  -7.111  -1.048  1.00 41.96 ? 83  GLN A N   1 
ATOM   627  C  CA  . GLN A 1 82  ? 11.462  -5.889  -0.776  1.00 41.57 ? 83  GLN A CA  1 
ATOM   628  C  C   . GLN A 1 82  ? 9.960   -6.061  -0.999  1.00 42.05 ? 83  GLN A C   1 
ATOM   629  O  O   . GLN A 1 82  ? 9.155   -5.421  -0.332  1.00 40.31 ? 83  GLN A O   1 
ATOM   630  C  CB  . GLN A 1 82  ? 11.997  -4.712  -1.603  1.00 46.05 ? 83  GLN A CB  1 
ATOM   631  C  CG  . GLN A 1 82  ? 11.844  -4.886  -3.111  1.00 48.54 ? 83  GLN A CG  1 
ATOM   632  C  CD  . GLN A 1 82  ? 12.471  -3.754  -3.911  1.00 56.30 ? 83  GLN A CD  1 
ATOM   633  O  OE1 . GLN A 1 82  ? 12.494  -3.792  -5.141  1.00 60.35 ? 83  GLN A OE1 1 
ATOM   634  N  NE2 . GLN A 1 82  ? 12.983  -2.741  -3.216  1.00 57.65 ? 83  GLN A NE2 1 
ATOM   635  N  N   . ASP A 1 83  ? 9.582   -6.926  -1.932  1.00 39.22 ? 84  ASP A N   1 
ATOM   636  C  CA  . ASP A 1 83  ? 8.166   -7.116  -2.231  1.00 37.30 ? 84  ASP A CA  1 
ATOM   637  C  C   . ASP A 1 83  ? 7.419   -7.720  -1.049  1.00 38.46 ? 84  ASP A C   1 
ATOM   638  O  O   . ASP A 1 83  ? 6.341   -7.240  -0.679  1.00 38.32 ? 84  ASP A O   1 
ATOM   639  C  CB  . ASP A 1 83  ? 7.985   -7.964  -3.490  1.00 36.44 ? 84  ASP A CB  1 
ATOM   640  C  CG  . ASP A 1 83  ? 8.376   -7.218  -4.739  1.00 40.51 ? 84  ASP A CG  1 
ATOM   641  O  OD1 . ASP A 1 83  ? 7.986   -6.034  -4.863  1.00 43.01 ? 84  ASP A OD1 1 
ATOM   642  O  OD2 . ASP A 1 83  ? 9.079   -7.801  -5.587  1.00 37.97 ? 84  ASP A OD2 1 
ATOM   643  N  N   . PHE A 1 84  ? 7.998   -8.767  -0.459  1.00 30.50 ? 85  PHE A N   1 
ATOM   644  C  CA  . PHE A 1 84  ? 7.426   -9.381  0.729   1.00 31.76 ? 85  PHE A CA  1 
ATOM   645  C  C   . PHE A 1 84  ? 7.381   -8.391  1.890   1.00 36.90 ? 85  PHE A C   1 
ATOM   646  O  O   . PHE A 1 84  ? 6.394   -8.327  2.631   1.00 33.74 ? 85  PHE A O   1 
ATOM   647  C  CB  . PHE A 1 84  ? 8.231   -10.615 1.150   1.00 30.59 ? 85  PHE A CB  1 
ATOM   648  C  CG  . PHE A 1 84  ? 7.586   -11.396 2.256   1.00 33.69 ? 85  PHE A CG  1 
ATOM   649  C  CD1 . PHE A 1 84  ? 7.810   -11.061 3.580   1.00 31.31 ? 85  PHE A CD1 1 
ATOM   650  C  CD2 . PHE A 1 84  ? 6.718   -12.448 1.969   1.00 32.00 ? 85  PHE A CD2 1 
ATOM   651  C  CE1 . PHE A 1 84  ? 7.203   -11.768 4.601   1.00 33.66 ? 85  PHE A CE1 1 
ATOM   652  C  CE2 . PHE A 1 84  ? 6.106   -13.161 2.988   1.00 32.74 ? 85  PHE A CE2 1 
ATOM   653  C  CZ  . PHE A 1 84  ? 6.351   -12.820 4.305   1.00 34.63 ? 85  PHE A CZ  1 
ATOM   654  N  N   . LYS A 1 85  ? 8.467   -7.641  2.052   1.00 37.87 ? 86  LYS A N   1 
ATOM   655  C  CA  . LYS A 1 85  ? 8.598   -6.700  3.155   1.00 44.22 ? 86  LYS A CA  1 
ATOM   656  C  C   . LYS A 1 85  ? 7.743   -5.450  2.964   1.00 55.00 ? 86  LYS A C   1 
ATOM   657  O  O   . LYS A 1 85  ? 7.777   -4.546  3.797   1.00 71.87 ? 86  LYS A O   1 
ATOM   658  C  CB  . LYS A 1 85  ? 10.064  -6.303  3.359   1.00 43.17 ? 86  LYS A CB  1 
ATOM   659  C  CG  . LYS A 1 85  ? 10.958  -7.400  3.939   1.00 46.72 ? 86  LYS A CG  1 
ATOM   660  C  CD  . LYS A 1 85  ? 12.387  -6.887  4.138   1.00 45.53 ? 86  LYS A CD  1 
ATOM   661  C  CE  . LYS A 1 85  ? 13.350  -7.987  4.575   1.00 51.24 ? 86  LYS A CE  1 
ATOM   662  N  NZ  . LYS A 1 85  ? 13.110  -8.466  5.971   1.00 61.39 ? 86  LYS A NZ  1 
ATOM   663  N  N   . GLY A 1 86  ? 6.988   -5.394  1.870   1.00 53.53 ? 87  GLY A N   1 
ATOM   664  C  CA  . GLY A 1 86  ? 6.093   -4.275  1.609   1.00 66.14 ? 87  GLY A CA  1 
ATOM   665  C  C   . GLY A 1 86  ? 6.664   -2.952  2.083   1.00 77.75 ? 87  GLY A C   1 
ATOM   666  O  O   . GLY A 1 86  ? 7.656   -2.495  1.518   1.00 81.57 ? 87  GLY A O   1 
ATOM   667  N  N   . SER A 1 87  ? 6.078   -2.319  3.102   1.00 90.21 ? 88  SER A N   1 
ATOM   668  C  CA  . SER A 1 87  ? 4.849   -2.720  3.797   1.00 90.48 ? 88  SER A CA  1 
ATOM   669  C  C   . SER A 1 87  ? 4.811   -1.932  5.099   1.00 99.10 ? 88  SER A C   1 
ATOM   670  O  O   . SER A 1 87  ? 5.812   -1.336  5.500   1.00 99.10 ? 88  SER A O   1 
ATOM   671  C  CB  . SER A 1 87  ? 4.801   -4.215  4.131   1.00 89.43 ? 88  SER A CB  1 
ATOM   672  O  OG  . SER A 1 87  ? 5.498   -4.503  5.332   1.00 89.13 ? 88  SER A OG  1 
ATOM   673  N  N   . ALA A 1 88  ? 3.661   -1.931  5.762   1.00 97.31 ? 89  ALA A N   1 
ATOM   674  C  CA  . ALA A 1 88  ? 3.556   -1.324  7.083   1.00 92.81 ? 89  ALA A CA  1 
ATOM   675  C  C   . ALA A 1 88  ? 4.323   -2.187  8.076   1.00 87.98 ? 89  ALA A C   1 
ATOM   676  O  O   . ALA A 1 88  ? 5.555   -2.240  8.056   1.00 87.90 ? 89  ALA A O   1 
ATOM   677  C  CB  . ALA A 1 88  ? 2.095   -1.203  7.498   1.00 88.08 ? 89  ALA A CB  1 
ATOM   678  N  N   . GLY A 1 89  ? 3.584   -2.867  8.943   1.00 85.16 ? 90  GLY A N   1 
ATOM   679  C  CA  . GLY A 1 89  ? 4.173   -3.860  9.816   1.00 83.95 ? 90  GLY A CA  1 
ATOM   680  C  C   . GLY A 1 89  ? 3.998   -5.222  9.181   1.00 78.78 ? 90  GLY A C   1 
ATOM   681  O  O   . GLY A 1 89  ? 4.920   -5.757  8.563   1.00 79.35 ? 90  GLY A O   1 
ATOM   682  N  N   . ALA A 1 90  ? 2.798   -5.776  9.317   1.00 65.39 ? 91  ALA A N   1 
ATOM   683  C  CA  . ALA A 1 90  ? 2.489   -7.074  8.737   1.00 59.54 ? 91  ALA A CA  1 
ATOM   684  C  C   . ALA A 1 90  ? 2.292   -6.958  7.231   1.00 58.52 ? 91  ALA A C   1 
ATOM   685  O  O   . ALA A 1 90  ? 1.711   -5.988  6.739   1.00 55.53 ? 91  ALA A O   1 
ATOM   686  C  CB  . ALA A 1 90  ? 1.256   -7.671  9.391   1.00 60.09 ? 91  ALA A CB  1 
ATOM   687  N  N   . PRO A 1 91  ? 2.785   -7.956  6.490   1.00 58.21 ? 92  PRO A N   1 
ATOM   688  C  CA  . PRO A 1 91  ? 2.650   -7.973  5.032   1.00 49.63 ? 92  PRO A CA  1 
ATOM   689  C  C   . PRO A 1 91  ? 1.188   -8.085  4.617   1.00 42.76 ? 92  PRO A C   1 
ATOM   690  O  O   . PRO A 1 91  ? 0.439   -8.856  5.216   1.00 44.95 ? 92  PRO A O   1 
ATOM   691  C  CB  . PRO A 1 91  ? 3.398   -9.249  4.628   1.00 47.22 ? 92  PRO A CB  1 
ATOM   692  C  CG  . PRO A 1 91  ? 4.270   -9.587  5.798   1.00 52.44 ? 92  PRO A CG  1 
ATOM   693  C  CD  . PRO A 1 91  ? 3.517   -9.127  6.996   1.00 53.62 ? 92  PRO A CD  1 
ATOM   694  N  N   . SER A 1 92  ? 0.789   -7.319  3.607   1.00 38.49 ? 93  SER A N   1 
ATOM   695  C  CA  . SER A 1 92  ? -0.525  -7.487  3.000   1.00 37.80 ? 93  SER A CA  1 
ATOM   696  C  C   . SER A 1 92  ? -0.556  -8.780  2.182   1.00 35.89 ? 93  SER A C   1 
ATOM   697  O  O   . SER A 1 92  ? 0.480   -9.400  1.941   1.00 33.85 ? 93  SER A O   1 
ATOM   698  C  CB  . SER A 1 92  ? -0.844  -6.314  2.081   1.00 36.31 ? 93  SER A CB  1 
ATOM   699  O  OG  . SER A 1 92  ? 0.027   -6.320  0.961   1.00 33.90 ? 93  SER A OG  1 
ATOM   700  N  N   . VAL A 1 93  ? -1.747  -9.172  1.747   1.00 38.78 ? 94  VAL A N   1 
ATOM   701  C  CA  . VAL A 1 93  ? -1.887  -10.344 0.894   1.00 37.78 ? 94  VAL A CA  1 
ATOM   702  C  C   . VAL A 1 93  ? -1.083  -10.171 -0.390  1.00 36.65 ? 94  VAL A C   1 
ATOM   703  O  O   . VAL A 1 93  ? -0.448  -11.115 -0.868  1.00 34.36 ? 94  VAL A O   1 
ATOM   704  C  CB  . VAL A 1 93  ? -3.360  -10.636 0.548   1.00 37.73 ? 94  VAL A CB  1 
ATOM   705  C  CG1 . VAL A 1 93  ? -3.450  -11.750 -0.495  1.00 37.39 ? 94  VAL A CG1 1 
ATOM   706  C  CG2 . VAL A 1 93  ? -4.138  -11.004 1.815   1.00 41.63 ? 94  VAL A CG2 1 
ATOM   707  N  N   . GLU A 1 94  ? -1.110  -8.964  -0.942  1.00 33.61 ? 95  GLU A N   1 
ATOM   708  C  CA  . GLU A 1 94  ? -0.327  -8.657  -2.132  1.00 35.27 ? 95  GLU A CA  1 
ATOM   709  C  C   . GLU A 1 94  ? 1.183   -8.741  -1.858  1.00 33.96 ? 95  GLU A C   1 
ATOM   710  O  O   . GLU A 1 94  ? 1.926   -9.277  -2.682  1.00 31.25 ? 95  GLU A O   1 
ATOM   711  C  CB  . GLU A 1 94  ? -0.707  -7.283  -2.690  1.00 36.04 ? 95  GLU A CB  1 
ATOM   712  C  CG  . GLU A 1 94  ? -2.127  -7.205  -3.240  1.00 39.46 ? 95  GLU A CG  1 
ATOM   713  C  CD  . GLU A 1 94  ? -3.204  -7.076  -2.160  1.00 41.00 ? 95  GLU A CD  1 
ATOM   714  O  OE1 . GLU A 1 94  ? -2.855  -6.852  -0.974  1.00 34.79 ? 95  GLU A OE1 1 
ATOM   715  O  OE2 . GLU A 1 94  ? -4.406  -7.194  -2.510  1.00 38.41 ? 95  GLU A OE2 1 
ATOM   716  N  N   . ASN A 1 95  ? 1.632   -8.210  -0.717  1.00 26.29 ? 96  ASN A N   1 
ATOM   717  C  CA  . ASN A 1 95  ? 3.037   -8.340  -0.317  1.00 30.26 ? 96  ASN A CA  1 
ATOM   718  C  C   . ASN A 1 95  ? 3.459   -9.808  -0.311  1.00 28.47 ? 96  ASN A C   1 
ATOM   719  O  O   . ASN A 1 95  ? 4.531   -10.173 -0.792  1.00 27.41 ? 96  ASN A O   1 
ATOM   720  C  CB  . ASN A 1 95  ? 3.297   -7.785  1.092   1.00 31.17 ? 96  ASN A CB  1 
ATOM   721  C  CG  . ASN A 1 95  ? 3.108   -6.275  1.194   1.00 40.42 ? 96  ASN A CG  1 
ATOM   722  O  OD1 . ASN A 1 95  ? 2.735   -5.758  2.255   1.00 39.15 ? 96  ASN A OD1 1 
ATOM   723  N  ND2 . ASN A 1 95  ? 3.354   -5.567  0.099   1.00 33.83 ? 96  ASN A ND2 1 
ATOM   724  N  N   . VAL A 1 96  ? 2.617   -10.644 0.276   1.00 29.76 ? 97  VAL A N   1 
ATOM   725  C  CA  . VAL A 1 96  ? 2.924   -12.064 0.359   1.00 28.90 ? 97  VAL A CA  1 
ATOM   726  C  C   . VAL A 1 96  ? 2.990   -12.692 -1.026  1.00 27.05 ? 97  VAL A C   1 
ATOM   727  O  O   . VAL A 1 96  ? 3.959   -13.367 -1.347  1.00 27.22 ? 97  VAL A O   1 
ATOM   728  C  CB  . VAL A 1 96  ? 1.916   -12.811 1.249   1.00 31.70 ? 97  VAL A CB  1 
ATOM   729  C  CG1 . VAL A 1 96  ? 2.121   -14.334 1.145   1.00 28.88 ? 97  VAL A CG1 1 
ATOM   730  C  CG2 . VAL A 1 96  ? 2.055   -12.332 2.688   1.00 31.50 ? 97  VAL A CG2 1 
ATOM   731  N  N   . LYS A 1 97  ? 1.977   -12.458 -1.855  1.00 27.01 ? 98  LYS A N   1 
ATOM   732  C  CA  . LYS A 1 97  ? 1.959   -13.075 -3.180  1.00 28.18 ? 98  LYS A CA  1 
ATOM   733  C  C   . LYS A 1 97  ? 3.112   -12.572 -4.060  1.00 30.52 ? 98  LYS A C   1 
ATOM   734  O  O   . LYS A 1 97  ? 3.804   -13.368 -4.694  1.00 28.51 ? 98  LYS A O   1 
ATOM   735  C  CB  . LYS A 1 97  ? 0.631   -12.835 -3.884  1.00 27.91 ? 98  LYS A CB  1 
ATOM   736  C  CG  . LYS A 1 97  ? -0.551  -13.579 -3.277  1.00 29.01 ? 98  LYS A CG  1 
ATOM   737  C  CD  . LYS A 1 97  ? -1.804  -13.271 -4.068  1.00 31.76 ? 98  LYS A CD  1 
ATOM   738  C  CE  . LYS A 1 97  ? -2.756  -14.447 -4.067  1.00 33.78 ? 98  LYS A CE  1 
ATOM   739  N  NZ  . LYS A 1 97  ? -3.855  -14.252 -5.054  1.00 35.47 ? 98  LYS A NZ  1 
ATOM   740  N  N   . ASN A 1 98  ? 3.294   -11.255 -4.115  1.00 29.41 ? 99  ASN A N   1 
ATOM   741  C  CA  . ASN A 1 98  ? 4.407   -10.675 -4.870  1.00 31.01 ? 99  ASN A CA  1 
ATOM   742  C  C   . ASN A 1 98  ? 5.750   -11.132 -4.307  1.00 30.21 ? 99  ASN A C   1 
ATOM   743  O  O   . ASN A 1 98  ? 6.705   -11.354 -5.049  1.00 30.04 ? 99  ASN A O   1 
ATOM   744  C  CB  . ASN A 1 98  ? 4.345   -9.139  -4.869  1.00 32.92 ? 99  ASN A CB  1 
ATOM   745  C  CG  . ASN A 1 98  ? 3.124   -8.591  -5.592  1.00 37.55 ? 99  ASN A CG  1 
ATOM   746  O  OD1 . ASN A 1 98  ? 2.683   -7.468  -5.326  1.00 44.31 ? 99  ASN A OD1 1 
ATOM   747  N  ND2 . ASN A 1 98  ? 2.568   -9.379  -6.502  1.00 39.13 ? 99  ASN A ND2 1 
ATOM   748  N  N   . GLY A 1 99  ? 5.814   -11.272 -2.987  1.00 28.00 ? 100 GLY A N   1 
ATOM   749  C  CA  . GLY A 1 99  ? 7.036   -11.675 -2.322  1.00 25.54 ? 100 GLY A CA  1 
ATOM   750  C  C   . GLY A 1 99  ? 7.417   -13.095 -2.668  1.00 28.13 ? 100 GLY A C   1 
ATOM   751  O  O   . GLY A 1 99  ? 8.599   -13.405 -2.854  1.00 25.58 ? 100 GLY A O   1 
ATOM   752  N  N   . ILE A 1 100 ? 6.412   -13.968 -2.748  1.00 24.97 ? 101 ILE A N   1 
ATOM   753  C  CA  . ILE A 1 100 ? 6.641   -15.351 -3.154  1.00 23.99 ? 101 ILE A CA  1 
ATOM   754  C  C   . ILE A 1 100 ? 7.087   -15.383 -4.608  1.00 23.17 ? 101 ILE A C   1 
ATOM   755  O  O   . ILE A 1 100 ? 8.030   -16.085 -4.948  1.00 23.67 ? 101 ILE A O   1 
ATOM   756  C  CB  . ILE A 1 100 ? 5.377   -16.225 -2.958  1.00 23.58 ? 101 ILE A CB  1 
ATOM   757  C  CG1 . ILE A 1 100 ? 5.061   -16.338 -1.460  1.00 25.15 ? 101 ILE A CG1 1 
ATOM   758  C  CG2 . ILE A 1 100 ? 5.568   -17.624 -3.612  1.00 22.88 ? 101 ILE A CG2 1 
ATOM   759  C  CD1 . ILE A 1 100 ? 3.626   -16.823 -1.136  1.00 25.98 ? 101 ILE A CD1 1 
ATOM   760  N  N   . ARG A 1 101 ? 6.428   -14.605 -5.463  1.00 25.53 ? 102 ARG A N   1 
ATOM   761  C  CA  . ARG A 1 101 ? 6.812   -14.574 -6.871  1.00 28.01 ? 102 ARG A CA  1 
ATOM   762  C  C   . ARG A 1 101 ? 8.270   -14.136 -7.026  1.00 27.57 ? 102 ARG A C   1 
ATOM   763  O  O   . ARG A 1 101 ? 9.059   -14.784 -7.710  1.00 25.70 ? 102 ARG A O   1 
ATOM   764  C  CB  . ARG A 1 101 ? 5.911   -13.637 -7.680  1.00 29.47 ? 102 ARG A CB  1 
ATOM   765  C  CG  . ARG A 1 101 ? 5.981   -13.913 -9.176  1.00 34.01 ? 102 ARG A CG  1 
ATOM   766  C  CD  . ARG A 1 101 ? 5.162   -12.932 -9.990  1.00 34.83 ? 102 ARG A CD  1 
ATOM   767  N  NE  . ARG A 1 101 ? 6.011   -11.813 -10.336 1.00 46.74 ? 102 ARG A NE  1 
ATOM   768  C  CZ  . ARG A 1 101 ? 6.547   -11.618 -11.530 1.00 43.67 ? 102 ARG A CZ  1 
ATOM   769  N  NH1 . ARG A 1 101 ? 6.277   -12.448 -12.524 1.00 43.60 ? 102 ARG A NH1 1 
ATOM   770  N  NH2 . ARG A 1 101 ? 7.336   -10.570 -11.727 1.00 48.22 ? 102 ARG A NH2 1 
ATOM   771  N  N   . THR A 1 102 ? 8.614   -13.019 -6.393  1.00 26.76 ? 103 THR A N   1 
ATOM   772  C  CA  . THR A 1 102 ? 9.981   -12.509 -6.436  1.00 29.69 ? 103 THR A CA  1 
ATOM   773  C  C   . THR A 1 102 ? 10.992  -13.512 -5.858  1.00 27.64 ? 103 THR A C   1 
ATOM   774  O  O   . THR A 1 102 ? 12.091  -13.684 -6.393  1.00 27.09 ? 103 THR A O   1 
ATOM   775  C  CB  . THR A 1 102 ? 10.075  -11.147 -5.722  1.00 26.58 ? 103 THR A CB  1 
ATOM   776  O  OG1 . THR A 1 102 ? 9.274   -10.201 -6.438  1.00 28.53 ? 103 THR A OG1 1 
ATOM   777  C  CG2 . THR A 1 102 ? 11.527  -10.648 -5.672  1.00 29.58 ? 103 THR A CG2 1 
ATOM   778  N  N   . GLY A 1 103 ? 10.610  -14.185 -4.780  1.00 24.74 ? 104 GLY A N   1 
ATOM   779  C  CA  . GLY A 1 103 ? 11.467  -15.194 -4.182  1.00 24.99 ? 104 GLY A CA  1 
ATOM   780  C  C   . GLY A 1 103 ? 11.806  -16.333 -5.135  1.00 25.94 ? 104 GLY A C   1 
ATOM   781  O  O   . GLY A 1 103 ? 12.943  -16.805 -5.168  1.00 23.04 ? 104 GLY A O   1 
ATOM   782  N  N   . PHE A 1 104 ? 10.819  -16.790 -5.904  1.00 26.72 ? 105 PHE A N   1 
ATOM   783  C  CA  . PHE A 1 104 ? 11.072  -17.830 -6.907  1.00 25.41 ? 105 PHE A CA  1 
ATOM   784  C  C   . PHE A 1 104 ? 11.987  -17.316 -8.027  1.00 23.33 ? 105 PHE A C   1 
ATOM   785  O  O   . PHE A 1 104 ? 12.932  -18.002 -8.429  1.00 25.42 ? 105 PHE A O   1 
ATOM   786  C  CB  . PHE A 1 104 ? 9.751   -18.369 -7.500  1.00 23.31 ? 105 PHE A CB  1 
ATOM   787  C  CG  . PHE A 1 104 ? 9.152   -19.514 -6.721  1.00 23.31 ? 105 PHE A CG  1 
ATOM   788  C  CD1 . PHE A 1 104 ? 8.605   -19.306 -5.462  1.00 23.72 ? 105 PHE A CD1 1 
ATOM   789  C  CD2 . PHE A 1 104 ? 9.127   -20.799 -7.258  1.00 22.01 ? 105 PHE A CD2 1 
ATOM   790  C  CE1 . PHE A 1 104 ? 8.039   -20.369 -4.749  1.00 25.55 ? 105 PHE A CE1 1 
ATOM   791  C  CE2 . PHE A 1 104 ? 8.586   -21.864 -6.550  1.00 23.67 ? 105 PHE A CE2 1 
ATOM   792  C  CZ  . PHE A 1 104 ? 8.040   -21.652 -5.290  1.00 24.04 ? 105 PHE A CZ  1 
ATOM   793  N  N   . LEU A 1 105 ? 11.700  -16.127 -8.543  1.00 25.18 ? 106 LEU A N   1 
ATOM   794  C  CA  . LEU A 1 105 ? 12.496  -15.602 -9.650  1.00 28.72 ? 106 LEU A CA  1 
ATOM   795  C  C   . LEU A 1 105 ? 13.918  -15.349 -9.173  1.00 28.51 ? 106 LEU A C   1 
ATOM   796  O  O   . LEU A 1 105 ? 14.890  -15.664 -9.865  1.00 28.65 ? 106 LEU A O   1 
ATOM   797  C  CB  . LEU A 1 105 ? 11.891  -14.325 -10.250 1.00 26.35 ? 106 LEU A CB  1 
ATOM   798  C  CG  . LEU A 1 105 ? 10.476  -14.373 -10.836 1.00 32.63 ? 106 LEU A CG  1 
ATOM   799  C  CD1 . LEU A 1 105 ? 10.333  -13.409 -12.011 1.00 32.47 ? 106 LEU A CD1 1 
ATOM   800  C  CD2 . LEU A 1 105 ? 10.043  -15.786 -11.227 1.00 31.24 ? 106 LEU A CD2 1 
ATOM   801  N  N   . GLU A 1 106 ? 14.039  -14.803 -7.973  1.00 28.16 ? 107 GLU A N   1 
ATOM   802  C  CA  . GLU A 1 106 ? 15.354  -14.461 -7.461  1.00 27.69 ? 107 GLU A CA  1 
ATOM   803  C  C   . GLU A 1 106 ? 16.210  -15.664 -7.086  1.00 30.04 ? 107 GLU A C   1 
ATOM   804  O  O   . GLU A 1 106 ? 17.409  -15.672 -7.356  1.00 28.81 ? 107 GLU A O   1 
ATOM   805  C  CB  . GLU A 1 106 ? 15.255  -13.448 -6.326  1.00 26.85 ? 107 GLU A CB  1 
ATOM   806  C  CG  . GLU A 1 106 ? 14.851  -12.075 -6.831  1.00 30.54 ? 107 GLU A CG  1 
ATOM   807  C  CD  . GLU A 1 106 ? 14.957  -11.002 -5.768  1.00 33.46 ? 107 GLU A CD  1 
ATOM   808  O  OE1 . GLU A 1 106 ? 15.167  -11.347 -4.584  1.00 35.26 ? 107 GLU A OE1 1 
ATOM   809  O  OE2 . GLU A 1 106 ? 14.830  -9.810  -6.119  1.00 34.47 ? 107 GLU A OE2 1 
ATOM   810  N  N   . ILE A 1 107 ? 15.619  -16.690 -6.479  1.00 28.19 ? 108 ILE A N   1 
ATOM   811  C  CA  . ILE A 1 107 ? 16.416  -17.870 -6.176  1.00 27.08 ? 108 ILE A CA  1 
ATOM   812  C  C   . ILE A 1 107 ? 16.825  -18.567 -7.478  1.00 29.09 ? 108 ILE A C   1 
ATOM   813  O  O   . ILE A 1 107 ? 17.903  -19.161 -7.566  1.00 27.16 ? 108 ILE A O   1 
ATOM   814  C  CB  . ILE A 1 107 ? 15.707  -18.859 -5.204  1.00 28.12 ? 108 ILE A CB  1 
ATOM   815  C  CG1 . ILE A 1 107 ? 16.731  -19.800 -4.563  1.00 29.37 ? 108 ILE A CG1 1 
ATOM   816  C  CG2 . ILE A 1 107 ? 14.634  -19.663 -5.930  1.00 27.07 ? 108 ILE A CG2 1 
ATOM   817  C  CD1 . ILE A 1 107 ? 16.146  -20.797 -3.593  1.00 28.87 ? 108 ILE A CD1 1 
ATOM   818  N  N   . ASP A 1 108 ? 15.970  -18.486 -8.498  1.00 25.24 ? 109 ASP A N   1 
ATOM   819  C  CA  . ASP A 1 108 ? 16.291  -19.127 -9.765  1.00 26.75 ? 109 ASP A CA  1 
ATOM   820  C  C   . ASP A 1 108 ? 17.540  -18.463 -10.352 1.00 27.35 ? 109 ASP A C   1 
ATOM   821  O  O   . ASP A 1 108 ? 18.506  -19.140 -10.681 1.00 27.09 ? 109 ASP A O   1 
ATOM   822  C  CB  . ASP A 1 108 ? 15.113  -19.047 -10.743 1.00 25.04 ? 109 ASP A CB  1 
ATOM   823  C  CG  . ASP A 1 108 ? 15.078  -20.221 -11.712 1.00 24.07 ? 109 ASP A CG  1 
ATOM   824  O  OD1 . ASP A 1 108 ? 15.458  -21.332 -11.319 1.00 26.52 ? 109 ASP A OD1 1 
ATOM   825  O  OD2 . ASP A 1 108 ? 14.671  -20.025 -12.872 1.00 27.68 ? 109 ASP A OD2 1 
ATOM   826  N  N   . GLU A 1 109 ? 17.518  -17.136 -10.445 1.00 29.93 ? 110 GLU A N   1 
ATOM   827  C  CA  . GLU A 1 109 ? 18.651  -16.383 -10.975 1.00 33.71 ? 110 GLU A CA  1 
ATOM   828  C  C   . GLU A 1 109 ? 19.892  -16.580 -10.103 1.00 33.45 ? 110 GLU A C   1 
ATOM   829  O  O   . GLU A 1 109 ? 21.001  -16.751 -10.613 1.00 34.79 ? 110 GLU A O   1 
ATOM   830  C  CB  . GLU A 1 109 ? 18.299  -14.895 -11.097 1.00 35.70 ? 110 GLU A CB  1 
ATOM   831  C  CG  . GLU A 1 109 ? 19.447  -14.001 -11.595 1.00 41.24 ? 110 GLU A CG  1 
ATOM   832  C  CD  . GLU A 1 109 ? 19.796  -14.219 -13.075 1.00 44.63 ? 110 GLU A CD  1 
ATOM   833  O  OE1 . GLU A 1 109 ? 19.127  -15.033 -13.756 1.00 45.61 ? 110 GLU A OE1 1 
ATOM   834  O  OE2 . GLU A 1 109 ? 20.748  -13.566 -13.563 1.00 50.90 ? 110 GLU A OE2 1 
ATOM   835  N  N   . HIS A 1 110 ? 19.692  -16.560 -8.789  1.00 30.03 ? 111 HIS A N   1 
ATOM   836  C  CA  . HIS A 1 110 ? 20.758  -16.822 -7.828  1.00 32.66 ? 111 HIS A CA  1 
ATOM   837  C  C   . HIS A 1 110 ? 21.471  -18.150 -8.136  1.00 33.49 ? 111 HIS A C   1 
ATOM   838  O  O   . HIS A 1 110 ? 22.699  -18.189 -8.252  1.00 32.43 ? 111 HIS A O   1 
ATOM   839  C  CB  . HIS A 1 110 ? 20.171  -16.814 -6.406  1.00 34.37 ? 111 HIS A CB  1 
ATOM   840  C  CG  . HIS A 1 110 ? 21.193  -16.810 -5.309  1.00 37.83 ? 111 HIS A CG  1 
ATOM   841  N  ND1 . HIS A 1 110 ? 22.552  -16.818 -5.543  1.00 40.89 ? 111 HIS A ND1 1 
ATOM   842  C  CD2 . HIS A 1 110 ? 21.046  -16.789 -3.962  1.00 39.08 ? 111 HIS A CD2 1 
ATOM   843  C  CE1 . HIS A 1 110 ? 23.197  -16.811 -4.389  1.00 36.31 ? 111 HIS A CE1 1 
ATOM   844  N  NE2 . HIS A 1 110 ? 22.306  -16.792 -3.413  1.00 43.66 ? 111 HIS A NE2 1 
ATOM   845  N  N   . MET A 1 111 ? 20.712  -19.237 -8.286  1.00 27.28 ? 112 MET A N   1 
ATOM   846  C  CA  . MET A 1 111 ? 21.315  -20.526 -8.614  1.00 28.36 ? 112 MET A CA  1 
ATOM   847  C  C   . MET A 1 111 ? 22.012  -20.478 -9.970  1.00 28.08 ? 112 MET A C   1 
ATOM   848  O  O   . MET A 1 111 ? 23.082  -21.064 -10.152 1.00 27.47 ? 112 MET A O   1 
ATOM   849  C  CB  . MET A 1 111 ? 20.275  -21.656 -8.599  1.00 28.88 ? 112 MET A CB  1 
ATOM   850  C  CG  . MET A 1 111 ? 19.813  -22.053 -7.204  1.00 30.37 ? 112 MET A CG  1 
ATOM   851  S  SD  . MET A 1 111 ? 18.615  -23.422 -7.224  1.00 27.89 ? 112 MET A SD  1 
ATOM   852  C  CE  . MET A 1 111 ? 17.260  -22.651 -8.111  1.00 22.70 ? 112 MET A CE  1 
ATOM   853  N  N   . ARG A 1 112 ? 21.400  -19.783 -10.920 1.00 31.94 ? 113 ARG A N   1 
ATOM   854  C  CA  . ARG A 1 112 ? 21.990  -19.657 -12.242 1.00 32.74 ? 113 ARG A CA  1 
ATOM   855  C  C   . ARG A 1 112 ? 23.380  -18.995 -12.179 1.00 33.18 ? 113 ARG A C   1 
ATOM   856  O  O   . ARG A 1 112 ? 24.319  -19.456 -12.828 1.00 33.36 ? 113 ARG A O   1 
ATOM   857  C  CB  . ARG A 1 112 ? 21.053  -18.896 -13.182 1.00 33.32 ? 113 ARG A CB  1 
ATOM   858  C  CG  . ARG A 1 112 ? 21.566  -18.827 -14.605 1.00 36.34 ? 113 ARG A CG  1 
ATOM   859  C  CD  . ARG A 1 112 ? 20.585  -18.123 -15.527 1.00 40.23 ? 113 ARG A CD  1 
ATOM   860  N  NE  . ARG A 1 112 ? 20.443  -18.880 -16.769 1.00 47.86 ? 113 ARG A NE  1 
ATOM   861  C  CZ  . ARG A 1 112 ? 19.398  -18.812 -17.585 1.00 42.43 ? 113 ARG A CZ  1 
ATOM   862  N  NH1 . ARG A 1 112 ? 18.375  -18.008 -17.309 1.00 42.46 ? 113 ARG A NH1 1 
ATOM   863  N  NH2 . ARG A 1 112 ? 19.382  -19.558 -18.681 1.00 44.45 ? 113 ARG A NH2 1 
ATOM   864  N  N   . VAL A 1 113 ? 23.519  -17.929 -11.399 1.00 35.47 ? 114 VAL A N   1 
ATOM   865  C  CA  . VAL A 1 113 ? 24.820  -17.265 -11.313 1.00 37.00 ? 114 VAL A CA  1 
ATOM   866  C  C   . VAL A 1 113 ? 25.842  -18.145 -10.587 1.00 40.39 ? 114 VAL A C   1 
ATOM   867  O  O   . VAL A 1 113 ? 27.009  -18.205 -10.979 1.00 40.05 ? 114 VAL A O   1 
ATOM   868  C  CB  . VAL A 1 113 ? 24.747  -15.867 -10.657 1.00 39.74 ? 114 VAL A CB  1 
ATOM   869  C  CG1 . VAL A 1 113 ? 23.701  -15.010 -11.347 1.00 38.92 ? 114 VAL A CG1 1 
ATOM   870  C  CG2 . VAL A 1 113 ? 24.463  -15.973 -9.175  1.00 45.99 ? 114 VAL A CG2 1 
ATOM   871  N  N   . MET A 1 114 ? 25.396  -18.836 -9.540  1.00 32.02 ? 115 MET A N   1 
ATOM   872  C  CA  . MET A 1 114 ? 26.276  -19.718 -8.778  1.00 32.70 ? 115 MET A CA  1 
ATOM   873  C  C   . MET A 1 114 ? 26.814  -20.814 -9.678  1.00 34.94 ? 115 MET A C   1 
ATOM   874  O  O   . MET A 1 114 ? 28.000  -21.148 -9.636  1.00 35.32 ? 115 MET A O   1 
ATOM   875  C  CB  . MET A 1 114 ? 25.541  -20.328 -7.583  1.00 35.19 ? 115 MET A CB  1 
ATOM   876  C  CG  . MET A 1 114 ? 25.541  -19.451 -6.336  1.00 36.92 ? 115 MET A CG  1 
ATOM   877  S  SD  . MET A 1 114 ? 24.714  -20.210 -4.915  1.00 39.99 ? 115 MET A SD  1 
ATOM   878  C  CE  . MET A 1 114 ? 25.270  -19.150 -3.582  1.00 49.41 ? 115 MET A CE  1 
ATOM   879  N  N   . SER A 1 115 ? 25.939  -21.359 -10.512 1.00 31.45 ? 116 SER A N   1 
ATOM   880  C  CA  . SER A 1 115 ? 26.322  -22.416 -11.427 1.00 32.97 ? 116 SER A CA  1 
ATOM   881  C  C   . SER A 1 115 ? 27.293  -21.904 -12.499 1.00 36.38 ? 116 SER A C   1 
ATOM   882  O  O   . SER A 1 115 ? 28.266  -22.578 -12.853 1.00 34.45 ? 116 SER A O   1 
ATOM   883  C  CB  . SER A 1 115 ? 25.072  -23.000 -12.089 1.00 35.60 ? 116 SER A CB  1 
ATOM   884  O  OG  . SER A 1 115 ? 25.415  -24.042 -12.983 1.00 40.77 ? 116 SER A OG  1 
ATOM   885  N  N   . GLU A 1 116 ? 27.015  -20.723 -13.034 1.00 36.45 ? 117 GLU A N   1 
ATOM   886  C  CA  . GLU A 1 116 ? 27.876  -20.160 -14.069 1.00 42.64 ? 117 GLU A CA  1 
ATOM   887  C  C   . GLU A 1 116 ? 29.268  -19.876 -13.487 1.00 41.28 ? 117 GLU A C   1 
ATOM   888  O  O   . GLU A 1 116 ? 30.297  -20.161 -14.108 1.00 42.51 ? 117 GLU A O   1 
ATOM   889  C  CB  . GLU A 1 116 ? 27.236  -18.899 -14.658 1.00 43.23 ? 117 GLU A CB  1 
ATOM   890  C  CG  . GLU A 1 116 ? 28.044  -18.240 -15.761 1.00 51.97 ? 117 GLU A CG  1 
ATOM   891  C  CD  . GLU A 1 116 ? 29.067  -17.261 -15.218 1.00 60.99 ? 117 GLU A CD  1 
ATOM   892  O  OE1 . GLU A 1 116 ? 28.795  -16.654 -14.153 1.00 63.27 ? 117 GLU A OE1 1 
ATOM   893  O  OE2 . GLU A 1 116 ? 30.139  -17.102 -15.848 1.00 64.57 ? 117 GLU A OE2 1 
ATOM   894  N  N   . LYS A 1 117 ? 29.267  -19.347 -12.269 1.00 42.99 ? 118 LYS A N   1 
ATOM   895  C  CA  . LYS A 1 117 ? 30.464  -18.957 -11.534 1.00 43.93 ? 118 LYS A CA  1 
ATOM   896  C  C   . LYS A 1 117 ? 31.350  -20.154 -11.171 1.00 46.46 ? 118 LYS A C   1 
ATOM   897  O  O   . LYS A 1 117 ? 32.565  -20.121 -11.369 1.00 42.34 ? 118 LYS A O   1 
ATOM   898  C  CB  . LYS A 1 117 ? 30.016  -18.220 -10.274 1.00 44.77 ? 118 LYS A CB  1 
ATOM   899  C  CG  . LYS A 1 117 ? 31.062  -17.446 -9.511  1.00 52.60 ? 118 LYS A CG  1 
ATOM   900  C  CD  . LYS A 1 117 ? 30.350  -16.559 -8.484  1.00 64.30 ? 118 LYS A CD  1 
ATOM   901  C  CE  . LYS A 1 117 ? 29.105  -17.269 -7.914  1.00 57.60 ? 118 LYS A CE  1 
ATOM   902  N  NZ  . LYS A 1 117 ? 28.153  -16.363 -7.183  1.00 57.63 ? 118 LYS A NZ  1 
ATOM   903  N  N   . LYS A 1 118 ? 30.741  -21.214 -10.651 1.00 33.45 ? 119 LYS A N   1 
ATOM   904  C  CA  . LYS A 1 118 ? 31.491  -22.395 -10.234 1.00 35.07 ? 119 LYS A CA  1 
ATOM   905  C  C   . LYS A 1 118 ? 31.551  -23.472 -11.312 1.00 34.90 ? 119 LYS A C   1 
ATOM   906  O  O   . LYS A 1 118 ? 31.977  -24.591 -11.050 1.00 35.24 ? 119 LYS A O   1 
ATOM   907  C  CB  . LYS A 1 118 ? 30.923  -22.964 -8.930  1.00 32.10 ? 119 LYS A CB  1 
ATOM   908  C  CG  . LYS A 1 118 ? 31.075  -22.032 -7.751  1.00 31.86 ? 119 LYS A CG  1 
ATOM   909  C  CD  . LYS A 1 118 ? 30.505  -22.614 -6.460  1.00 36.04 ? 119 LYS A CD  1 
ATOM   910  C  CE  . LYS A 1 118 ? 30.750  -21.667 -5.286  1.00 40.55 ? 119 LYS A CE  1 
ATOM   911  N  NZ  . LYS A 1 118 ? 30.412  -22.238 -3.934  1.00 37.67 ? 119 LYS A NZ  1 
ATOM   912  N  N   . HIS A 1 119 ? 31.136  -23.123 -12.527 1.00 38.03 ? 120 HIS A N   1 
ATOM   913  C  CA  . HIS A 1 119 ? 31.082  -24.078 -13.638 1.00 39.51 ? 120 HIS A CA  1 
ATOM   914  C  C   . HIS A 1 119 ? 30.328  -25.372 -13.286 1.00 37.10 ? 120 HIS A C   1 
ATOM   915  O  O   . HIS A 1 119 ? 30.801  -26.478 -13.553 1.00 37.55 ? 120 HIS A O   1 
ATOM   916  C  CB  . HIS A 1 119 ? 32.488  -24.391 -14.147 1.00 42.35 ? 120 HIS A CB  1 
ATOM   917  C  CG  . HIS A 1 119 ? 33.228  -23.184 -14.637 1.00 46.12 ? 120 HIS A CG  1 
ATOM   918  N  ND1 . HIS A 1 119 ? 33.936  -22.354 -13.794 1.00 50.48 ? 120 HIS A ND1 1 
ATOM   919  C  CD2 . HIS A 1 119 ? 33.344  -22.652 -15.877 1.00 49.05 ? 120 HIS A CD2 1 
ATOM   920  C  CE1 . HIS A 1 119 ? 34.469  -21.368 -14.496 1.00 50.41 ? 120 HIS A CE1 1 
ATOM   921  N  NE2 . HIS A 1 119 ? 34.124  -21.525 -15.762 1.00 54.10 ? 120 HIS A NE2 1 
ATOM   922  N  N   . GLY A 1 120 ? 29.146  -25.217 -12.696 1.00 35.38 ? 121 GLY A N   1 
ATOM   923  C  CA  . GLY A 1 120 ? 28.324  -26.351 -12.302 1.00 34.40 ? 121 GLY A CA  1 
ATOM   924  C  C   . GLY A 1 120 ? 28.128  -27.336 -13.436 1.00 30.58 ? 121 GLY A C   1 
ATOM   925  O  O   . GLY A 1 120 ? 27.843  -26.946 -14.567 1.00 32.72 ? 121 GLY A O   1 
ATOM   926  N  N   . ALA A 1 121 ? 28.294  -28.618 -13.141 1.00 30.23 ? 122 ALA A N   1 
ATOM   927  C  CA  . ALA A 1 121 ? 28.148  -29.646 -14.165 1.00 33.55 ? 122 ALA A CA  1 
ATOM   928  C  C   . ALA A 1 121 ? 26.701  -30.118 -14.249 1.00 34.97 ? 122 ALA A C   1 
ATOM   929  O  O   . ALA A 1 121 ? 26.245  -30.574 -15.298 1.00 35.54 ? 122 ALA A O   1 
ATOM   930  C  CB  . ALA A 1 121 ? 29.065  -30.829 -13.877 1.00 32.02 ? 122 ALA A CB  1 
ATOM   931  N  N   . ASP A 1 122 ? 25.978  -30.026 -13.141 1.00 31.36 ? 123 ASP A N   1 
ATOM   932  C  CA  . ASP A 1 122 ? 24.627  -30.579 -13.126 1.00 35.43 ? 123 ASP A CA  1 
ATOM   933  C  C   . ASP A 1 122 ? 23.678  -29.759 -13.985 1.00 32.09 ? 123 ASP A C   1 
ATOM   934  O  O   . ASP A 1 122 ? 23.882  -28.564 -14.203 1.00 30.92 ? 123 ASP A O   1 
ATOM   935  C  CB  . ASP A 1 122 ? 24.088  -30.724 -11.697 1.00 36.20 ? 123 ASP A CB  1 
ATOM   936  C  CG  . ASP A 1 122 ? 23.610  -29.417 -11.123 1.00 36.60 ? 123 ASP A CG  1 
ATOM   937  O  OD1 . ASP A 1 122 ? 24.442  -28.681 -10.555 1.00 35.73 ? 123 ASP A OD1 1 
ATOM   938  O  OD2 . ASP A 1 122 ? 22.395  -29.123 -11.232 1.00 37.31 ? 123 ASP A OD2 1 
ATOM   939  N  N   . ARG A 1 123 ? 22.641  -30.417 -14.479 1.00 33.93 ? 124 ARG A N   1 
ATOM   940  C  CA  . ARG A 1 123 ? 21.621  -29.751 -15.262 1.00 34.34 ? 124 ARG A CA  1 
ATOM   941  C  C   . ARG A 1 123 ? 20.274  -30.051 -14.616 1.00 34.07 ? 124 ARG A C   1 
ATOM   942  O  O   . ARG A 1 123 ? 19.283  -30.301 -15.306 1.00 30.02 ? 124 ARG A O   1 
ATOM   943  C  CB  . ARG A 1 123 ? 21.643  -30.306 -16.684 1.00 36.48 ? 124 ARG A CB  1 
ATOM   944  C  CG  . ARG A 1 123 ? 21.750  -29.266 -17.771 1.00 43.22 ? 124 ARG A CG  1 
ATOM   945  C  CD  . ARG A 1 123 ? 23.187  -28.965 -18.129 1.00 42.36 ? 124 ARG A CD  1 
ATOM   946  N  NE  . ARG A 1 123 ? 23.825  -28.101 -17.146 1.00 48.72 ? 124 ARG A NE  1 
ATOM   947  C  CZ  . ARG A 1 123 ? 25.097  -27.712 -17.203 1.00 42.68 ? 124 ARG A CZ  1 
ATOM   948  N  NH1 . ARG A 1 123 ? 25.874  -28.105 -18.205 1.00 51.56 ? 124 ARG A NH1 1 
ATOM   949  N  NH2 . ARG A 1 123 ? 25.591  -26.932 -16.257 1.00 37.13 ? 124 ARG A NH2 1 
ATOM   950  N  N   . SER A 1 124 ? 20.249  -30.047 -13.287 1.00 29.01 ? 125 SER A N   1 
ATOM   951  C  CA  . SER A 1 124 ? 19.053  -30.453 -12.560 1.00 29.34 ? 125 SER A CA  1 
ATOM   952  C  C   . SER A 1 124 ? 18.003  -29.340 -12.488 1.00 26.02 ? 125 SER A C   1 
ATOM   953  O  O   . SER A 1 124 ? 18.258  -28.190 -12.840 1.00 25.00 ? 125 SER A O   1 
ATOM   954  C  CB  . SER A 1 124 ? 19.418  -30.940 -11.153 1.00 29.88 ? 125 SER A CB  1 
ATOM   955  O  OG  . SER A 1 124 ? 19.874  -29.868 -10.353 1.00 28.15 ? 125 SER A OG  1 
ATOM   956  N  N   . GLY A 1 125 ? 16.803  -29.708 -12.049 1.00 25.70 ? 126 GLY A N   1 
ATOM   957  C  CA  . GLY A 1 125 ? 15.737  -28.759 -11.819 1.00 24.03 ? 126 GLY A CA  1 
ATOM   958  C  C   . GLY A 1 125 ? 14.898  -29.319 -10.686 1.00 23.74 ? 126 GLY A C   1 
ATOM   959  O  O   . GLY A 1 125 ? 15.175  -30.412 -10.193 1.00 23.02 ? 126 GLY A O   1 
ATOM   960  N  N   . SER A 1 126 ? 13.881  -28.581 -10.260 1.00 24.14 ? 127 SER A N   1 
ATOM   961  C  CA  . SER A 1 126 ? 12.989  -29.094 -9.226  1.00 20.77 ? 127 SER A CA  1 
ATOM   962  C  C   . SER A 1 126 ? 11.635  -28.416 -9.281  1.00 22.61 ? 127 SER A C   1 
ATOM   963  O  O   . SER A 1 126 ? 11.514  -27.235 -9.637  1.00 21.73 ? 127 SER A O   1 
ATOM   964  C  CB  . SER A 1 126 ? 13.585  -28.928 -7.820  1.00 22.33 ? 127 SER A CB  1 
ATOM   965  O  OG  . SER A 1 126 ? 12.747  -29.527 -6.830  1.00 21.54 ? 127 SER A OG  1 
ATOM   966  N  N   . THR A 1 127 ? 10.614  -29.182 -8.925  1.00 24.82 ? 128 THR A N   1 
ATOM   967  C  CA  . THR A 1 127 ? 9.303   -28.615 -8.671  1.00 21.86 ? 128 THR A CA  1 
ATOM   968  C  C   . THR A 1 127 ? 9.358   -28.050 -7.256  1.00 21.49 ? 128 THR A C   1 
ATOM   969  O  O   . THR A 1 127 ? 10.328  -28.267 -6.525  1.00 22.76 ? 128 THR A O   1 
ATOM   970  C  CB  . THR A 1 127 ? 8.209   -29.709 -8.660  1.00 23.82 ? 128 THR A CB  1 
ATOM   971  O  OG1 . THR A 1 127 ? 8.438   -30.579 -7.546  1.00 25.06 ? 128 THR A OG1 1 
ATOM   972  C  CG2 . THR A 1 127 ? 8.229   -30.530 -9.934  1.00 24.11 ? 128 THR A CG2 1 
ATOM   973  N  N   . ALA A 1 128 ? 8.314   -27.325 -6.875  1.00 20.70 ? 129 ALA A N   1 
ATOM   974  C  CA  . ALA A 1 128 ? 8.118   -26.916 -5.498  1.00 21.11 ? 129 ALA A CA  1 
ATOM   975  C  C   . ALA A 1 128 ? 6.615   -26.812 -5.268  1.00 22.78 ? 129 ALA A C   1 
ATOM   976  O  O   . ALA A 1 128 ? 5.906   -26.247 -6.091  1.00 22.93 ? 129 ALA A O   1 
ATOM   977  C  CB  . ALA A 1 128 ? 8.760   -25.579 -5.233  1.00 20.59 ? 129 ALA A CB  1 
ATOM   978  N  N   . VAL A 1 129 ? 6.148   -27.353 -4.153  1.00 22.31 ? 130 VAL A N   1 
ATOM   979  C  CA  . VAL A 1 129 ? 4.778   -27.131 -3.714  1.00 21.91 ? 130 VAL A CA  1 
ATOM   980  C  C   . VAL A 1 129 ? 4.846   -26.895 -2.215  1.00 20.87 ? 130 VAL A C   1 
ATOM   981  O  O   . VAL A 1 129 ? 5.605   -27.558 -1.509  1.00 21.24 ? 130 VAL A O   1 
ATOM   982  C  CB  . VAL A 1 129 ? 3.829   -28.326 -4.074  1.00 20.65 ? 130 VAL A CB  1 
ATOM   983  C  CG1 . VAL A 1 129 ? 4.125   -29.570 -3.232  1.00 20.84 ? 130 VAL A CG1 1 
ATOM   984  C  CG2 . VAL A 1 129 ? 2.352   -27.912 -3.919  1.00 19.27 ? 130 VAL A CG2 1 
ATOM   985  N  N   . GLY A 1 130 ? 4.083   -25.936 -1.718  1.00 21.09 ? 131 GLY A N   1 
ATOM   986  C  CA  . GLY A 1 130 ? 4.114   -25.688 -0.292  1.00 20.96 ? 131 GLY A CA  1 
ATOM   987  C  C   . GLY A 1 130 ? 2.986   -24.812 0.190   1.00 21.10 ? 131 GLY A C   1 
ATOM   988  O  O   . GLY A 1 130 ? 2.138   -24.380 -0.591  1.00 20.59 ? 131 GLY A O   1 
ATOM   989  N  N   . VAL A 1 131 ? 2.986   -24.555 1.493   1.00 20.29 ? 132 VAL A N   1 
ATOM   990  C  CA  . VAL A 1 131 ? 2.059   -23.622 2.087   1.00 19.70 ? 132 VAL A CA  1 
ATOM   991  C  C   . VAL A 1 131 ? 2.816   -22.719 3.044   1.00 20.11 ? 132 VAL A C   1 
ATOM   992  O  O   . VAL A 1 131 ? 3.670   -23.184 3.809   1.00 21.83 ? 132 VAL A O   1 
ATOM   993  C  CB  . VAL A 1 131 ? 0.928   -24.331 2.893   1.00 22.00 ? 132 VAL A CB  1 
ATOM   994  C  CG1 . VAL A 1 131 ? -0.111  -24.920 1.968   1.00 24.49 ? 132 VAL A CG1 1 
ATOM   995  C  CG2 . VAL A 1 131 ? 1.496   -25.378 3.821   1.00 20.42 ? 132 VAL A CG2 1 
ATOM   996  N  N   . LEU A 1 132 ? 2.501   -21.432 2.985   1.00 21.95 ? 133 LEU A N   1 
ATOM   997  C  CA  . LEU A 1 132 ? 2.986   -20.459 3.962   1.00 23.25 ? 133 LEU A CA  1 
ATOM   998  C  C   . LEU A 1 132 ? 1.761   -20.163 4.814   1.00 26.02 ? 133 LEU A C   1 
ATOM   999  O  O   . LEU A 1 132 ? 0.755   -19.679 4.294   1.00 25.41 ? 133 LEU A O   1 
ATOM   1000 C  CB  . LEU A 1 132 ? 3.455   -19.184 3.243   1.00 26.03 ? 133 LEU A CB  1 
ATOM   1001 C  CG  . LEU A 1 132 ? 4.719   -18.423 3.655   1.00 32.38 ? 133 LEU A CG  1 
ATOM   1002 C  CD1 . LEU A 1 132 ? 4.590   -16.931 3.322   1.00 29.47 ? 133 LEU A CD1 1 
ATOM   1003 C  CD2 . LEU A 1 132 ? 5.097   -18.624 5.115   1.00 28.08 ? 133 LEU A CD2 1 
ATOM   1004 N  N   . ILE A 1 133 ? 1.833   -20.475 6.109   1.00 21.80 ? 134 ILE A N   1 
ATOM   1005 C  CA  . ILE A 1 133 ? 0.674   -20.382 6.985   1.00 23.84 ? 134 ILE A CA  1 
ATOM   1006 C  C   . ILE A 1 133 ? 0.867   -19.228 7.970   1.00 25.17 ? 134 ILE A C   1 
ATOM   1007 O  O   . ILE A 1 133 ? 1.820   -19.221 8.743   1.00 26.67 ? 134 ILE A O   1 
ATOM   1008 C  CB  . ILE A 1 133 ? 0.432   -21.708 7.752   1.00 23.52 ? 134 ILE A CB  1 
ATOM   1009 C  CG1 . ILE A 1 133 ? 0.306   -22.884 6.766   1.00 25.77 ? 134 ILE A CG1 1 
ATOM   1010 C  CG2 . ILE A 1 133 ? -0.807  -21.603 8.665   1.00 25.46 ? 134 ILE A CG2 1 
ATOM   1011 C  CD1 . ILE A 1 133 ? 0.032   -24.241 7.435   1.00 20.72 ? 134 ILE A CD1 1 
ATOM   1012 N  N   . SER A 1 134 ? -0.012  -18.233 7.886   1.00 27.85 ? 135 SER A N   1 
ATOM   1013 C  CA  . SER A 1 134 ? -0.015  -17.122 8.827   1.00 28.90 ? 135 SER A CA  1 
ATOM   1014 C  C   . SER A 1 134 ? -1.150  -17.328 9.821   1.00 28.22 ? 135 SER A C   1 
ATOM   1015 O  O   . SER A 1 134 ? -1.934  -18.269 9.692   1.00 26.02 ? 135 SER A O   1 
ATOM   1016 C  CB  . SER A 1 134 ? -0.211  -15.801 8.089   1.00 28.33 ? 135 SER A CB  1 
ATOM   1017 O  OG  . SER A 1 134 ? -1.544  -15.672 7.626   1.00 26.68 ? 135 SER A OG  1 
ATOM   1018 N  N   . PRO A 1 135 ? -1.254  -16.441 10.823  1.00 29.86 ? 136 PRO A N   1 
ATOM   1019 C  CA  . PRO A 1 135 ? -2.360  -16.603 11.770  1.00 30.22 ? 136 PRO A CA  1 
ATOM   1020 C  C   . PRO A 1 135 ? -3.735  -16.645 11.089  1.00 30.26 ? 136 PRO A C   1 
ATOM   1021 O  O   . PRO A 1 135 ? -4.632  -17.340 11.560  1.00 32.64 ? 136 PRO A O   1 
ATOM   1022 C  CB  . PRO A 1 135 ? -2.221  -15.365 12.668  1.00 33.00 ? 136 PRO A CB  1 
ATOM   1023 C  CG  . PRO A 1 135 ? -0.744  -15.067 12.639  1.00 34.01 ? 136 PRO A CG  1 
ATOM   1024 C  CD  . PRO A 1 135 ? -0.318  -15.375 11.231  1.00 29.67 ? 136 PRO A CD  1 
ATOM   1025 N  N   . GLN A 1 136 ? -3.900  -15.953 9.970   1.00 31.83 ? 137 GLN A N   1 
ATOM   1026 C  CA  . GLN A 1 136 ? -5.228  -15.877 9.371   1.00 31.11 ? 137 GLN A CA  1 
ATOM   1027 C  C   . GLN A 1 136 ? -5.352  -16.423 7.944   1.00 29.35 ? 137 GLN A C   1 
ATOM   1028 O  O   . GLN A 1 136 ? -6.462  -16.490 7.408   1.00 26.51 ? 137 GLN A O   1 
ATOM   1029 C  CB  . GLN A 1 136 ? -5.748  -14.439 9.425   1.00 38.27 ? 137 GLN A CB  1 
ATOM   1030 C  CG  . GLN A 1 136 ? -5.925  -13.913 10.847  1.00 42.86 ? 137 GLN A CG  1 
ATOM   1031 C  CD  . GLN A 1 136 ? -6.488  -12.508 10.877  1.00 52.60 ? 137 GLN A CD  1 
ATOM   1032 O  OE1 . GLN A 1 136 ? -7.438  -12.227 11.611  1.00 59.07 ? 137 GLN A OE1 1 
ATOM   1033 N  NE2 . GLN A 1 136 ? -5.904  -11.611 10.077  1.00 56.64 ? 137 GLN A NE2 1 
ATOM   1034 N  N   . HIS A 1 137 ? -4.230  -16.805 7.335   1.00 28.42 ? 138 HIS A N   1 
ATOM   1035 C  CA  . HIS A 1 137 ? -4.247  -17.290 5.949   1.00 26.29 ? 138 HIS A CA  1 
ATOM   1036 C  C   . HIS A 1 137 ? -3.363  -18.503 5.713   1.00 26.34 ? 138 HIS A C   1 
ATOM   1037 O  O   . HIS A 1 137 ? -2.319  -18.669 6.344   1.00 25.56 ? 138 HIS A O   1 
ATOM   1038 C  CB  . HIS A 1 137 ? -3.819  -16.191 4.973   1.00 26.30 ? 138 HIS A CB  1 
ATOM   1039 C  CG  . HIS A 1 137 ? -4.717  -14.997 4.987   1.00 32.36 ? 138 HIS A CG  1 
ATOM   1040 N  ND1 . HIS A 1 137 ? -4.559  -13.960 5.882   1.00 34.37 ? 138 HIS A ND1 1 
ATOM   1041 C  CD2 . HIS A 1 137 ? -5.799  -14.685 4.234   1.00 31.98 ? 138 HIS A CD2 1 
ATOM   1042 C  CE1 . HIS A 1 137 ? -5.504  -13.059 5.678   1.00 36.45 ? 138 HIS A CE1 1 
ATOM   1043 N  NE2 . HIS A 1 137 ? -6.271  -13.476 4.685   1.00 37.44 ? 138 HIS A NE2 1 
ATOM   1044 N  N   . THR A 1 138 ? -3.788  -19.346 4.780   1.00 23.26 ? 139 THR A N   1 
ATOM   1045 C  CA  . THR A 1 138 ? -2.890  -20.357 4.249   1.00 24.08 ? 139 THR A CA  1 
ATOM   1046 C  C   . THR A 1 138 ? -2.653  -19.957 2.806   1.00 23.76 ? 139 THR A C   1 
ATOM   1047 O  O   . THR A 1 138 ? -3.608  -19.830 2.027   1.00 21.48 ? 139 THR A O   1 
ATOM   1048 C  CB  . THR A 1 138 ? -3.489  -21.790 4.315   1.00 26.56 ? 139 THR A CB  1 
ATOM   1049 O  OG1 . THR A 1 138 ? -4.664  -21.857 3.502   1.00 37.25 ? 139 THR A OG1 1 
ATOM   1050 C  CG2 . THR A 1 138 ? -3.857  -22.158 5.731   1.00 20.61 ? 139 THR A CG2 1 
ATOM   1051 N  N   . TYR A 1 139 ? -1.391  -19.713 2.459   1.00 24.28 ? 140 TYR A N   1 
ATOM   1052 C  CA  . TYR A 1 139 ? -1.047  -19.372 1.086   1.00 22.89 ? 140 TYR A CA  1 
ATOM   1053 C  C   . TYR A 1 139 ? -0.465  -20.611 0.436   1.00 21.43 ? 140 TYR A C   1 
ATOM   1054 O  O   . TYR A 1 139 ? 0.627   -21.042 0.790   1.00 20.68 ? 140 TYR A O   1 
ATOM   1055 C  CB  . TYR A 1 139 ? 0.001   -18.266 1.041   1.00 24.25 ? 140 TYR A CB  1 
ATOM   1056 C  CG  . TYR A 1 139 ? -0.422  -16.985 1.704   1.00 28.65 ? 140 TYR A CG  1 
ATOM   1057 C  CD1 . TYR A 1 139 ? -1.033  -15.977 0.976   1.00 32.33 ? 140 TYR A CD1 1 
ATOM   1058 C  CD2 . TYR A 1 139 ? -0.211  -16.780 3.057   1.00 27.38 ? 140 TYR A CD2 1 
ATOM   1059 C  CE1 . TYR A 1 139 ? -1.422  -14.793 1.579   1.00 34.96 ? 140 TYR A CE1 1 
ATOM   1060 C  CE2 . TYR A 1 139 ? -0.605  -15.603 3.669   1.00 30.32 ? 140 TYR A CE2 1 
ATOM   1061 C  CZ  . TYR A 1 139 ? -1.207  -14.617 2.927   1.00 31.44 ? 140 TYR A CZ  1 
ATOM   1062 O  OH  . TYR A 1 139 ? -1.590  -13.445 3.535   1.00 34.97 ? 140 TYR A OH  1 
ATOM   1063 N  N   . PHE A 1 140 ? -1.203  -21.187 -0.504  1.00 21.77 ? 141 PHE A N   1 
ATOM   1064 C  CA  . PHE A 1 140 ? -0.697  -22.332 -1.255  1.00 19.89 ? 141 PHE A CA  1 
ATOM   1065 C  C   . PHE A 1 140 ? 0.209   -21.829 -2.348  1.00 20.86 ? 141 PHE A C   1 
ATOM   1066 O  O   . PHE A 1 140 ? -0.078  -20.812 -2.984  1.00 23.72 ? 141 PHE A O   1 
ATOM   1067 C  CB  . PHE A 1 140 ? -1.834  -23.162 -1.854  1.00 21.04 ? 141 PHE A CB  1 
ATOM   1068 C  CG  . PHE A 1 140 ? -2.381  -24.199 -0.903  1.00 21.01 ? 141 PHE A CG  1 
ATOM   1069 C  CD1 . PHE A 1 140 ? -3.284  -23.837 0.087   1.00 22.99 ? 141 PHE A CD1 1 
ATOM   1070 C  CD2 . PHE A 1 140 ? -1.974  -25.523 -0.983  1.00 21.46 ? 141 PHE A CD2 1 
ATOM   1071 C  CE1 . PHE A 1 140 ? -3.789  -24.785 0.982   1.00 20.22 ? 141 PHE A CE1 1 
ATOM   1072 C  CE2 . PHE A 1 140 ? -2.467  -26.480 -0.100  1.00 19.89 ? 141 PHE A CE2 1 
ATOM   1073 C  CZ  . PHE A 1 140 ? -3.376  -26.121 0.882   1.00 18.89 ? 141 PHE A CZ  1 
ATOM   1074 N  N   . ILE A 1 141 ? 1.309   -22.545 -2.550  1.00 21.57 ? 142 ILE A N   1 
ATOM   1075 C  CA  . ILE A 1 141 ? 2.311   -22.175 -3.541  1.00 21.02 ? 142 ILE A CA  1 
ATOM   1076 C  C   . ILE A 1 141 ? 2.571   -23.382 -4.435  1.00 21.13 ? 142 ILE A C   1 
ATOM   1077 O  O   . ILE A 1 141 ? 2.810   -24.474 -3.935  1.00 19.75 ? 142 ILE A O   1 
ATOM   1078 C  CB  . ILE A 1 141 ? 3.615   -21.767 -2.842  1.00 22.28 ? 142 ILE A CB  1 
ATOM   1079 C  CG1 . ILE A 1 141 ? 3.346   -20.617 -1.860  1.00 21.32 ? 142 ILE A CG1 1 
ATOM   1080 C  CG2 . ILE A 1 141 ? 4.698   -21.368 -3.870  1.00 20.71 ? 142 ILE A CG2 1 
ATOM   1081 C  CD1 . ILE A 1 141 ? 4.461   -20.412 -0.818  1.00 22.11 ? 142 ILE A CD1 1 
ATOM   1082 N  N   . ASN A 1 142 ? 2.515   -23.190 -5.748  1.00 19.36 ? 143 ASN A N   1 
ATOM   1083 C  CA  . ASN A 1 142 ? 2.821   -24.284 -6.657  1.00 21.42 ? 143 ASN A CA  1 
ATOM   1084 C  C   . ASN A 1 142 ? 3.643   -23.906 -7.867  1.00 20.71 ? 143 ASN A C   1 
ATOM   1085 O  O   . ASN A 1 142 ? 3.329   -22.958 -8.569  1.00 22.33 ? 143 ASN A O   1 
ATOM   1086 C  CB  . ASN A 1 142 ? 1.566   -25.010 -7.139  1.00 21.17 ? 143 ASN A CB  1 
ATOM   1087 C  CG  . ASN A 1 142 ? 1.912   -26.256 -7.929  1.00 20.93 ? 143 ASN A CG  1 
ATOM   1088 O  OD1 . ASN A 1 142 ? 1.701   -26.326 -9.151  1.00 23.67 ? 143 ASN A OD1 1 
ATOM   1089 N  ND2 . ASN A 1 142 ? 2.508   -27.226 -7.252  1.00 17.67 ? 143 ASN A ND2 1 
ATOM   1090 N  N   . CYS A 1 143 ? 4.679   -24.696 -8.111  1.00 21.82 ? 144 CYS A N   1 
ATOM   1091 C  CA  . CYS A 1 143 ? 5.524   -24.549 -9.280  1.00 23.69 ? 144 CYS A CA  1 
ATOM   1092 C  C   . CYS A 1 143 ? 5.924   -25.943 -9.754  1.00 21.82 ? 144 CYS A C   1 
ATOM   1093 O  O   . CYS A 1 143 ? 6.893   -26.522 -9.261  1.00 23.44 ? 144 CYS A O   1 
ATOM   1094 C  CB  . CYS A 1 143 ? 6.771   -23.716 -8.940  1.00 24.84 ? 144 CYS A CB  1 
ATOM   1095 S  SG  . CYS A 1 143 ? 7.819   -23.320 -10.382 1.00 24.55 ? 144 CYS A SG  1 
ATOM   1096 N  N   . GLY A 1 144 ? 5.173   -26.493 -10.706 1.00 20.58 ? 145 GLY A N   1 
ATOM   1097 C  CA  . GLY A 1 144 ? 5.479   -27.814 -11.235 1.00 21.73 ? 145 GLY A CA  1 
ATOM   1098 C  C   . GLY A 1 144 ? 4.363   -28.824 -11.024 1.00 24.32 ? 145 GLY A C   1 
ATOM   1099 O  O   . GLY A 1 144 ? 3.197   -28.443 -10.922 1.00 22.29 ? 145 GLY A O   1 
ATOM   1100 N  N   . ASP A 1 145 ? 4.707   -30.111 -10.981 1.00 21.92 ? 146 ASP A N   1 
ATOM   1101 C  CA  . ASP A 1 145 ? 3.677   -31.148 -10.893 1.00 22.68 ? 146 ASP A CA  1 
ATOM   1102 C  C   . ASP A 1 145 ? 3.683   -31.909 -9.569  1.00 22.68 ? 146 ASP A C   1 
ATOM   1103 O  O   . ASP A 1 145 ? 3.173   -33.018 -9.476  1.00 21.54 ? 146 ASP A O   1 
ATOM   1104 C  CB  . ASP A 1 145 ? 3.747   -32.112 -12.088 1.00 26.62 ? 146 ASP A CB  1 
ATOM   1105 C  CG  . ASP A 1 145 ? 4.984   -33.011 -12.061 1.00 28.57 ? 146 ASP A CG  1 
ATOM   1106 O  OD1 . ASP A 1 145 ? 5.865   -32.839 -11.181 1.00 26.88 ? 146 ASP A OD1 1 
ATOM   1107 O  OD2 . ASP A 1 145 ? 5.083   -33.893 -12.941 1.00 29.05 ? 146 ASP A OD2 1 
ATOM   1108 N  N   . SER A 1 146 ? 4.276   -31.315 -8.538  1.00 20.47 ? 147 SER A N   1 
ATOM   1109 C  CA  . SER A 1 146 ? 3.956   -31.754 -7.188  1.00 21.52 ? 147 SER A CA  1 
ATOM   1110 C  C   . SER A 1 146 ? 2.592   -31.141 -6.899  1.00 20.97 ? 147 SER A C   1 
ATOM   1111 O  O   . SER A 1 146 ? 2.093   -30.360 -7.701  1.00 20.90 ? 147 SER A O   1 
ATOM   1112 C  CB  . SER A 1 146 ? 5.024   -31.289 -6.208  1.00 22.01 ? 147 SER A CB  1 
ATOM   1113 O  OG  . SER A 1 146 ? 6.251   -31.955 -6.486  1.00 23.19 ? 147 SER A OG  1 
ATOM   1114 N  N   . ARG A 1 147 ? 1.970   -31.491 -5.780  1.00 20.70 ? 148 ARG A N   1 
ATOM   1115 C  CA  . ARG A 1 147 ? 0.599   -31.019 -5.537  1.00 18.92 ? 148 ARG A CA  1 
ATOM   1116 C  C   . ARG A 1 147 ? 0.270   -30.929 -4.051  1.00 18.81 ? 148 ARG A C   1 
ATOM   1117 O  O   . ARG A 1 147 ? 0.797   -31.682 -3.240  1.00 18.48 ? 148 ARG A O   1 
ATOM   1118 C  CB  . ARG A 1 147 ? -0.416  -31.935 -6.232  1.00 18.63 ? 148 ARG A CB  1 
ATOM   1119 C  CG  . ARG A 1 147 ? -1.855  -31.415 -6.185  1.00 19.81 ? 148 ARG A CG  1 
ATOM   1120 C  CD  . ARG A 1 147 ? -2.834  -32.470 -6.692  1.00 21.09 ? 148 ARG A CD  1 
ATOM   1121 N  NE  . ARG A 1 147 ? -2.429  -32.980 -8.005  1.00 20.59 ? 148 ARG A NE  1 
ATOM   1122 C  CZ  . ARG A 1 147 ? -2.821  -34.154 -8.497  1.00 22.96 ? 148 ARG A CZ  1 
ATOM   1123 N  NH1 . ARG A 1 147 ? -3.639  -34.938 -7.793  1.00 19.76 ? 148 ARG A NH1 1 
ATOM   1124 N  NH2 . ARG A 1 147 ? -2.396  -34.548 -9.688  1.00 22.82 ? 148 ARG A NH2 1 
ATOM   1125 N  N   . GLY A 1 148 ? -0.587  -29.986 -3.701  1.00 20.36 ? 149 GLY A N   1 
ATOM   1126 C  CA  . GLY A 1 148 ? -1.011  -29.840 -2.324  1.00 19.36 ? 149 GLY A CA  1 
ATOM   1127 C  C   . GLY A 1 148 ? -2.512  -29.709 -2.263  1.00 21.70 ? 149 GLY A C   1 
ATOM   1128 O  O   . GLY A 1 148 ? -3.148  -29.287 -3.234  1.00 20.52 ? 149 GLY A O   1 
ATOM   1129 N  N   . LEU A 1 149 ? -3.092  -30.073 -1.125  1.00 20.44 ? 150 LEU A N   1 
ATOM   1130 C  CA  . LEU A 1 149 ? -4.520  -29.872 -0.946  1.00 21.61 ? 150 LEU A CA  1 
ATOM   1131 C  C   . LEU A 1 149 ? -4.874  -29.563 0.495   1.00 22.31 ? 150 LEU A C   1 
ATOM   1132 O  O   . LEU A 1 149 ? -4.129  -29.872 1.424   1.00 20.32 ? 150 LEU A O   1 
ATOM   1133 C  CB  . LEU A 1 149 ? -5.334  -31.062 -1.460  1.00 22.75 ? 150 LEU A CB  1 
ATOM   1134 C  CG  . LEU A 1 149 ? -5.242  -32.418 -0.767  1.00 22.76 ? 150 LEU A CG  1 
ATOM   1135 C  CD1 . LEU A 1 149 ? -5.922  -32.409 0.600   1.00 22.97 ? 150 LEU A CD1 1 
ATOM   1136 C  CD2 . LEU A 1 149 ? -5.918  -33.449 -1.655  1.00 24.87 ? 150 LEU A CD2 1 
ATOM   1137 N  N   . LEU A 1 150 ? -6.025  -28.933 0.656   1.00 19.81 ? 151 LEU A N   1 
ATOM   1138 C  CA  . LEU A 1 150 ? -6.518  -28.561 1.962   1.00 20.70 ? 151 LEU A CA  1 
ATOM   1139 C  C   . LEU A 1 150 ? -7.820  -29.316 2.186   1.00 21.67 ? 151 LEU A C   1 
ATOM   1140 O  O   . LEU A 1 150 ? -8.713  -29.273 1.342   1.00 21.48 ? 151 LEU A O   1 
ATOM   1141 C  CB  . LEU A 1 150 ? -6.770  -27.056 1.956   1.00 19.06 ? 151 LEU A CB  1 
ATOM   1142 C  CG  . LEU A 1 150 ? -7.089  -26.262 3.225   1.00 28.56 ? 151 LEU A CG  1 
ATOM   1143 C  CD1 . LEU A 1 150 ? -8.397  -25.498 3.088   1.00 27.60 ? 151 LEU A CD1 1 
ATOM   1144 C  CD2 . LEU A 1 150 ? -7.018  -27.058 4.517   1.00 21.70 ? 151 LEU A CD2 1 
ATOM   1145 N  N   . CYS A 1 151 ? -7.918  -30.019 3.311   1.00 20.93 ? 152 CYS A N   1 
ATOM   1146 C  CA  . CYS A 1 151 ? -9.163  -30.669 3.699   1.00 22.10 ? 152 CYS A CA  1 
ATOM   1147 C  C   . CYS A 1 151 ? -9.862  -29.791 4.735   1.00 25.33 ? 152 CYS A C   1 
ATOM   1148 O  O   . CYS A 1 151 ? -9.280  -29.439 5.761   1.00 21.77 ? 152 CYS A O   1 
ATOM   1149 C  CB  . CYS A 1 151 ? -8.912  -32.065 4.284   1.00 23.65 ? 152 CYS A CB  1 
ATOM   1150 S  SG  . CYS A 1 151 ? -10.437 -32.912 4.834   1.00 27.08 ? 152 CYS A SG  1 
ATOM   1151 N  N   . ARG A 1 152 ? -11.100 -29.418 4.435   1.00 24.06 ? 153 ARG A N   1 
ATOM   1152 C  CA  . ARG A 1 152 ? -11.905 -28.587 5.324   1.00 23.73 ? 153 ARG A CA  1 
ATOM   1153 C  C   . ARG A 1 152 ? -13.291 -29.221 5.378   1.00 27.80 ? 153 ARG A C   1 
ATOM   1154 O  O   . ARG A 1 152 ? -13.880 -29.540 4.336   1.00 27.39 ? 153 ARG A O   1 
ATOM   1155 C  CB  . ARG A 1 152 ? -11.959 -27.128 4.818   1.00 23.65 ? 153 ARG A CB  1 
ATOM   1156 C  CG  . ARG A 1 152 ? -12.939 -26.224 5.576   1.00 27.47 ? 153 ARG A CG  1 
ATOM   1157 C  CD  . ARG A 1 152 ? -12.972 -24.803 5.032   1.00 27.18 ? 153 ARG A CD  1 
ATOM   1158 N  NE  . ARG A 1 152 ? -11.692 -24.133 5.232   1.00 26.09 ? 153 ARG A NE  1 
ATOM   1159 C  CZ  . ARG A 1 152 ? -11.480 -22.837 5.033   1.00 26.70 ? 153 ARG A CZ  1 
ATOM   1160 N  NH1 . ARG A 1 152 ? -12.472 -22.051 4.622   1.00 26.33 ? 153 ARG A NH1 1 
ATOM   1161 N  NH2 . ARG A 1 152 ? -10.273 -22.332 5.241   1.00 24.43 ? 153 ARG A NH2 1 
ATOM   1162 N  N   . ASN A 1 153 ? -13.791 -29.456 6.586   1.00 30.32 ? 154 ASN A N   1 
ATOM   1163 C  CA  . ASN A 1 153 ? -15.120 -30.037 6.751   1.00 31.74 ? 154 ASN A CA  1 
ATOM   1164 C  C   . ASN A 1 153 ? -15.257 -31.362 5.990   1.00 33.34 ? 154 ASN A C   1 
ATOM   1165 O  O   . ASN A 1 153 ? -16.260 -31.613 5.313   1.00 32.79 ? 154 ASN A O   1 
ATOM   1166 C  CB  . ASN A 1 153 ? -16.192 -29.022 6.315   1.00 34.97 ? 154 ASN A CB  1 
ATOM   1167 C  CG  . ASN A 1 153 ? -17.591 -29.419 6.754   1.00 44.78 ? 154 ASN A CG  1 
ATOM   1168 O  OD1 . ASN A 1 153 ? -17.764 -30.145 7.738   1.00 44.04 ? 154 ASN A OD1 1 
ATOM   1169 N  ND2 . ASN A 1 153 ? -18.600 -28.949 6.021   1.00 49.32 ? 154 ASN A ND2 1 
ATOM   1170 N  N   . ARG A 1 154 ? -14.226 -32.200 6.107   1.00 32.29 ? 155 ARG A N   1 
ATOM   1171 C  CA  . ARG A 1 154 ? -14.186 -33.540 5.517   1.00 32.88 ? 155 ARG A CA  1 
ATOM   1172 C  C   . ARG A 1 154 ? -14.144 -33.582 3.988   1.00 35.72 ? 155 ARG A C   1 
ATOM   1173 O  O   . ARG A 1 154 ? -14.294 -34.646 3.391   1.00 37.25 ? 155 ARG A O   1 
ATOM   1174 C  CB  . ARG A 1 154 ? -15.343 -34.409 6.038   1.00 38.36 ? 155 ARG A CB  1 
ATOM   1175 C  CG  . ARG A 1 154 ? -15.368 -34.552 7.554   1.00 39.66 ? 155 ARG A CG  1 
ATOM   1176 C  CD  . ARG A 1 154 ? -16.724 -35.052 8.050   1.00 51.74 ? 155 ARG A CD  1 
ATOM   1177 N  NE  . ARG A 1 154 ? -17.007 -36.414 7.600   1.00 57.02 ? 155 ARG A NE  1 
ATOM   1178 C  CZ  . ARG A 1 154 ? -16.991 -37.486 8.390   1.00 65.24 ? 155 ARG A CZ  1 
ATOM   1179 N  NH1 . ARG A 1 154 ? -16.712 -37.362 9.686   1.00 63.32 ? 155 ARG A NH1 1 
ATOM   1180 N  NH2 . ARG A 1 154 ? -17.263 -38.685 7.886   1.00 66.35 ? 155 ARG A NH2 1 
ATOM   1181 N  N   . LYS A 1 155 ? -13.933 -32.438 3.352   1.00 28.22 ? 156 LYS A N   1 
ATOM   1182 C  CA  . LYS A 1 155 ? -13.930 -32.391 1.894   1.00 30.80 ? 156 LYS A CA  1 
ATOM   1183 C  C   . LYS A 1 155 ? -12.643 -31.762 1.364   1.00 28.53 ? 156 LYS A C   1 
ATOM   1184 O  O   . LYS A 1 155 ? -11.934 -31.068 2.098   1.00 27.03 ? 156 LYS A O   1 
ATOM   1185 C  CB  . LYS A 1 155 ? -15.139 -31.595 1.396   1.00 34.76 ? 156 LYS A CB  1 
ATOM   1186 C  CG  . LYS A 1 155 ? -16.476 -32.194 1.821   1.00 37.96 ? 156 LYS A CG  1 
ATOM   1187 C  CD  . LYS A 1 155 ? -17.627 -31.221 1.591   1.00 46.55 ? 156 LYS A CD  1 
ATOM   1188 C  CE  . LYS A 1 155 ? -17.463 -29.953 2.427   1.00 46.96 ? 156 LYS A CE  1 
ATOM   1189 N  NZ  . LYS A 1 155 ? -18.602 -28.996 2.244   1.00 48.98 ? 156 LYS A NZ  1 
ATOM   1190 N  N   . VAL A 1 156 ? -12.345 -31.998 0.090   1.00 24.54 ? 157 VAL A N   1 
ATOM   1191 C  CA  . VAL A 1 156 ? -11.227 -31.315 -0.557  1.00 23.30 ? 157 VAL A CA  1 
ATOM   1192 C  C   . VAL A 1 156 ? -11.635 -29.870 -0.868  1.00 22.31 ? 157 VAL A C   1 
ATOM   1193 O  O   . VAL A 1 156 ? -12.334 -29.602 -1.841  1.00 22.57 ? 157 VAL A O   1 
ATOM   1194 C  CB  . VAL A 1 156 ? -10.789 -32.020 -1.861  1.00 24.82 ? 157 VAL A CB  1 
ATOM   1195 C  CG1 . VAL A 1 156 ? -9.723  -31.195 -2.556  1.00 19.81 ? 157 VAL A CG1 1 
ATOM   1196 C  CG2 . VAL A 1 156 ? -10.270 -33.442 -1.566  1.00 23.94 ? 157 VAL A CG2 1 
ATOM   1197 N  N   . HIS A 1 157 ? -11.191 -28.941 -0.035  1.00 22.17 ? 158 HIS A N   1 
ATOM   1198 C  CA  . HIS A 1 157 ? -11.591 -27.544 -0.157  1.00 23.33 ? 158 HIS A CA  1 
ATOM   1199 C  C   . HIS A 1 157 ? -10.815 -26.832 -1.255  1.00 25.25 ? 158 HIS A C   1 
ATOM   1200 O  O   . HIS A 1 157 ? -11.339 -25.951 -1.942  1.00 23.74 ? 158 HIS A O   1 
ATOM   1201 C  CB  . HIS A 1 157 ? -11.346 -26.834 1.165   1.00 21.91 ? 158 HIS A CB  1 
ATOM   1202 C  CG  . HIS A 1 157 ? -12.058 -25.523 1.278   1.00 26.67 ? 158 HIS A CG  1 
ATOM   1203 N  ND1 . HIS A 1 157 ? -11.416 -24.308 1.166   1.00 28.19 ? 158 HIS A ND1 1 
ATOM   1204 C  CD2 . HIS A 1 157 ? -13.365 -25.242 1.487   1.00 25.36 ? 158 HIS A CD2 1 
ATOM   1205 C  CE1 . HIS A 1 157 ? -12.297 -23.334 1.313   1.00 26.86 ? 158 HIS A CE1 1 
ATOM   1206 N  NE2 . HIS A 1 157 ? -13.487 -23.874 1.509   1.00 28.37 ? 158 HIS A NE2 1 
ATOM   1207 N  N   . PHE A 1 158 ? -9.558  -27.234 -1.423  1.00 21.12 ? 159 PHE A N   1 
ATOM   1208 C  CA  . PHE A 1 158 ? -8.691  -26.651 -2.438  1.00 22.45 ? 159 PHE A CA  1 
ATOM   1209 C  C   . PHE A 1 158 ? -7.591  -27.639 -2.796  1.00 22.68 ? 159 PHE A C   1 
ATOM   1210 O  O   . PHE A 1 158 ? -7.122  -28.381 -1.933  1.00 19.17 ? 159 PHE A O   1 
ATOM   1211 C  CB  . PHE A 1 158 ? -8.053  -25.366 -1.905  1.00 21.42 ? 159 PHE A CB  1 
ATOM   1212 C  CG  . PHE A 1 158 ? -6.989  -24.798 -2.812  1.00 23.25 ? 159 PHE A CG  1 
ATOM   1213 C  CD1 . PHE A 1 158 ? -5.652  -25.153 -2.649  1.00 21.29 ? 159 PHE A CD1 1 
ATOM   1214 C  CD2 . PHE A 1 158 ? -7.327  -23.912 -3.828  1.00 24.89 ? 159 PHE A CD2 1 
ATOM   1215 C  CE1 . PHE A 1 158 ? -4.661  -24.645 -3.493  1.00 24.01 ? 159 PHE A CE1 1 
ATOM   1216 C  CE2 . PHE A 1 158 ? -6.343  -23.397 -4.680  1.00 25.63 ? 159 PHE A CE2 1 
ATOM   1217 C  CZ  . PHE A 1 158 ? -5.007  -23.766 -4.507  1.00 23.37 ? 159 PHE A CZ  1 
ATOM   1218 N  N   . PHE A 1 159 ? -7.184  -27.655 -4.062  1.00 21.98 ? 160 PHE A N   1 
ATOM   1219 C  CA  . PHE A 1 159 ? -5.961  -28.364 -4.445  1.00 21.80 ? 160 PHE A CA  1 
ATOM   1220 C  C   . PHE A 1 159 ? -5.238  -27.580 -5.528  1.00 23.57 ? 160 PHE A C   1 
ATOM   1221 O  O   . PHE A 1 159 ? -5.863  -26.823 -6.283  1.00 20.46 ? 160 PHE A O   1 
ATOM   1222 C  CB  . PHE A 1 159 ? -6.253  -29.793 -4.911  1.00 22.21 ? 160 PHE A CB  1 
ATOM   1223 C  CG  . PHE A 1 159 ? -7.026  -29.858 -6.190  1.00 24.93 ? 160 PHE A CG  1 
ATOM   1224 C  CD1 . PHE A 1 159 ? -6.371  -29.942 -7.405  1.00 28.24 ? 160 PHE A CD1 1 
ATOM   1225 C  CD2 . PHE A 1 159 ? -8.413  -29.827 -6.176  1.00 29.96 ? 160 PHE A CD2 1 
ATOM   1226 C  CE1 . PHE A 1 159 ? -7.093  -29.988 -8.592  1.00 32.35 ? 160 PHE A CE1 1 
ATOM   1227 C  CE2 . PHE A 1 159 ? -9.137  -29.873 -7.352  1.00 31.78 ? 160 PHE A CE2 1 
ATOM   1228 C  CZ  . PHE A 1 159 ? -8.475  -29.953 -8.560  1.00 33.63 ? 160 PHE A CZ  1 
ATOM   1229 N  N   . THR A 1 160 ? -3.923  -27.752 -5.598  1.00 18.38 ? 161 THR A N   1 
ATOM   1230 C  CA  . THR A 1 160 ? -3.124  -27.017 -6.568  1.00 19.93 ? 161 THR A CA  1 
ATOM   1231 C  C   . THR A 1 160 ? -3.248  -27.641 -7.956  1.00 19.35 ? 161 THR A C   1 
ATOM   1232 O  O   . THR A 1 160 ? -3.379  -28.845 -8.090  1.00 20.37 ? 161 THR A O   1 
ATOM   1233 C  CB  . THR A 1 160 ? -1.640  -26.934 -6.146  1.00 20.43 ? 161 THR A CB  1 
ATOM   1234 O  OG1 . THR A 1 160 ? -1.115  -28.258 -5.989  1.00 18.80 ? 161 THR A OG1 1 
ATOM   1235 C  CG2 . THR A 1 160 ? -1.506  -26.169 -4.822  1.00 18.02 ? 161 THR A CG2 1 
ATOM   1236 N  N   . GLN A 1 161 ? -3.210  -26.809 -8.988  1.00 23.85 ? 162 GLN A N   1 
ATOM   1237 C  CA  . GLN A 1 161 ? -3.275  -27.303 -10.362 1.00 25.32 ? 162 GLN A CA  1 
ATOM   1238 C  C   . GLN A 1 161 ? -1.888  -27.590 -10.917 1.00 24.22 ? 162 GLN A C   1 
ATOM   1239 O  O   . GLN A 1 161 ? -1.049  -26.679 -10.996 1.00 24.13 ? 162 GLN A O   1 
ATOM   1240 C  CB  . GLN A 1 161 ? -3.974  -26.277 -11.245 1.00 30.10 ? 162 GLN A CB  1 
ATOM   1241 C  CG  . GLN A 1 161 ? -5.477  -26.451 -11.292 1.00 39.83 ? 162 GLN A CG  1 
ATOM   1242 C  CD  . GLN A 1 161 ? -5.885  -27.495 -12.312 1.00 44.39 ? 162 GLN A CD  1 
ATOM   1243 O  OE1 . GLN A 1 161 ? -6.225  -28.626 -11.963 1.00 48.77 ? 162 GLN A OE1 1 
ATOM   1244 N  NE2 . GLN A 1 161 ? -5.834  -27.121 -13.592 1.00 51.51 ? 162 GLN A NE2 1 
ATOM   1245 N  N   . ASP A 1 162 ? -1.652  -28.842 -11.306 1.00 24.50 ? 163 ASP A N   1 
ATOM   1246 C  CA  . ASP A 1 162 ? -0.331  -29.259 -11.791 1.00 23.32 ? 163 ASP A CA  1 
ATOM   1247 C  C   . ASP A 1 162 ? 0.048   -28.496 -13.062 1.00 23.48 ? 163 ASP A C   1 
ATOM   1248 O  O   . ASP A 1 162 ? -0.758  -28.360 -13.979 1.00 24.89 ? 163 ASP A O   1 
ATOM   1249 C  CB  . ASP A 1 162 ? -0.274  -30.760 -12.132 1.00 24.55 ? 163 ASP A CB  1 
ATOM   1250 C  CG  . ASP A 1 162 ? -0.646  -31.669 -10.963 1.00 25.85 ? 163 ASP A CG  1 
ATOM   1251 O  OD1 . ASP A 1 162 ? -0.802  -31.189 -9.819  1.00 27.31 ? 163 ASP A OD1 1 
ATOM   1252 O  OD2 . ASP A 1 162 ? -0.772  -32.890 -11.210 1.00 26.01 ? 163 ASP A OD2 1 
ATOM   1253 N  N   . HIS A 1 163 ? 1.295   -28.043 -13.125 1.00 23.19 ? 164 HIS A N   1 
ATOM   1254 C  CA  . HIS A 1 163 ? 1.815   -27.378 -14.320 1.00 23.35 ? 164 HIS A CA  1 
ATOM   1255 C  C   . HIS A 1 163 ? 2.330   -28.408 -15.317 1.00 26.50 ? 164 HIS A C   1 
ATOM   1256 O  O   . HIS A 1 163 ? 3.441   -28.914 -15.169 1.00 28.00 ? 164 HIS A O   1 
ATOM   1257 C  CB  . HIS A 1 163 ? 2.943   -26.424 -13.929 1.00 23.57 ? 164 HIS A CB  1 
ATOM   1258 C  CG  . HIS A 1 163 ? 2.473   -25.211 -13.187 1.00 26.01 ? 164 HIS A CG  1 
ATOM   1259 N  ND1 . HIS A 1 163 ? 2.979   -24.845 -11.958 1.00 22.01 ? 164 HIS A ND1 1 
ATOM   1260 C  CD2 . HIS A 1 163 ? 1.539   -24.280 -13.501 1.00 27.12 ? 164 HIS A CD2 1 
ATOM   1261 C  CE1 . HIS A 1 163 ? 2.375   -23.742 -11.546 1.00 25.62 ? 164 HIS A CE1 1 
ATOM   1262 N  NE2 . HIS A 1 163 ? 1.497   -23.379 -12.464 1.00 26.41 ? 164 HIS A NE2 1 
ATOM   1263 N  N   . LYS A 1 164 ? 1.525   -28.717 -16.330 1.00 24.78 ? 165 LYS A N   1 
ATOM   1264 C  CA  . LYS A 1 164 ? 1.921   -29.674 -17.359 1.00 26.41 ? 165 LYS A CA  1 
ATOM   1265 C  C   . LYS A 1 164 ? 2.072   -28.954 -18.703 1.00 24.77 ? 165 LYS A C   1 
ATOM   1266 O  O   . LYS A 1 164 ? 1.315   -28.033 -18.994 1.00 24.64 ? 165 LYS A O   1 
ATOM   1267 C  CB  . LYS A 1 164 ? 0.887   -30.797 -17.477 1.00 29.01 ? 165 LYS A CB  1 
ATOM   1268 C  CG  . LYS A 1 164 ? 0.513   -31.476 -16.148 1.00 28.08 ? 165 LYS A CG  1 
ATOM   1269 C  CD  . LYS A 1 164 ? 1.680   -32.277 -15.556 1.00 29.96 ? 165 LYS A CD  1 
ATOM   1270 C  CE  . LYS A 1 164 ? 2.135   -33.398 -16.480 1.00 39.17 ? 165 LYS A CE  1 
ATOM   1271 N  NZ  . LYS A 1 164 ? 3.315   -34.144 -15.937 1.00 37.27 ? 165 LYS A NZ  1 
ATOM   1272 N  N   . PRO A 1 165 ? 3.063   -29.360 -19.518 1.00 26.50 ? 166 PRO A N   1 
ATOM   1273 C  CA  . PRO A 1 165 ? 3.314   -28.660 -20.789 1.00 24.98 ? 166 PRO A CA  1 
ATOM   1274 C  C   . PRO A 1 165 ? 2.082   -28.598 -21.700 1.00 27.03 ? 166 PRO A C   1 
ATOM   1275 O  O   . PRO A 1 165 ? 1.913   -27.606 -22.416 1.00 25.86 ? 166 PRO A O   1 
ATOM   1276 C  CB  . PRO A 1 165 ? 4.441   -29.481 -21.429 1.00 25.29 ? 166 PRO A CB  1 
ATOM   1277 C  CG  . PRO A 1 165 ? 5.179   -30.079 -20.257 1.00 25.88 ? 166 PRO A CG  1 
ATOM   1278 C  CD  . PRO A 1 165 ? 4.087   -30.390 -19.246 1.00 26.81 ? 166 PRO A CD  1 
ATOM   1279 N  N   . SER A 1 166 ? 1.231   -29.620 -21.657 1.00 30.64 ? 167 SER A N   1 
ATOM   1280 C  CA  . SER A 1 166 ? 0.051   -29.663 -22.528 1.00 31.20 ? 167 SER A CA  1 
ATOM   1281 C  C   . SER A 1 166 ? -1.087  -28.752 -22.070 1.00 34.44 ? 167 SER A C   1 
ATOM   1282 O  O   . SER A 1 166 ? -2.037  -28.523 -22.820 1.00 32.21 ? 167 SER A O   1 
ATOM   1283 C  CB  . SER A 1 166 ? -0.446  -31.105 -22.720 1.00 33.02 ? 167 SER A CB  1 
ATOM   1284 O  OG  . SER A 1 166 ? -0.802  -31.703 -21.483 1.00 35.52 ? 167 SER A OG  1 
ATOM   1285 N  N   . ASN A 1 167 ? -1.002  -28.236 -20.844 1.00 28.50 ? 168 ASN A N   1 
ATOM   1286 C  CA  . ASN A 1 167 ? -1.960  -27.227 -20.401 1.00 29.89 ? 168 ASN A CA  1 
ATOM   1287 C  C   . ASN A 1 167 ? -1.893  -26.028 -21.343 1.00 32.10 ? 168 ASN A C   1 
ATOM   1288 O  O   . ASN A 1 167 ? -0.806  -25.536 -21.640 1.00 29.01 ? 168 ASN A O   1 
ATOM   1289 C  CB  . ASN A 1 167 ? -1.658  -26.758 -18.976 1.00 29.88 ? 168 ASN A CB  1 
ATOM   1290 C  CG  . ASN A 1 167 ? -1.859  -27.844 -17.945 1.00 32.44 ? 168 ASN A CG  1 
ATOM   1291 O  OD1 . ASN A 1 167 ? -2.193  -28.983 -18.274 1.00 33.33 ? 168 ASN A OD1 1 
ATOM   1292 N  ND2 . ASN A 1 167 ? -1.639  -27.496 -16.681 1.00 32.99 ? 168 ASN A ND2 1 
ATOM   1293 N  N   . PRO A 1 168 ? -3.061  -25.542 -21.794 1.00 36.77 ? 169 PRO A N   1 
ATOM   1294 C  CA  . PRO A 1 168 ? -3.167  -24.558 -22.883 1.00 35.57 ? 169 PRO A CA  1 
ATOM   1295 C  C   . PRO A 1 168 ? -2.232  -23.350 -22.750 1.00 34.93 ? 169 PRO A C   1 
ATOM   1296 O  O   . PRO A 1 168 ? -1.535  -23.003 -23.703 1.00 34.09 ? 169 PRO A O   1 
ATOM   1297 C  CB  . PRO A 1 168 ? -4.630  -24.107 -22.804 1.00 37.95 ? 169 PRO A CB  1 
ATOM   1298 C  CG  . PRO A 1 168 ? -5.344  -25.278 -22.209 1.00 41.56 ? 169 PRO A CG  1 
ATOM   1299 C  CD  . PRO A 1 168 ? -4.379  -25.897 -21.233 1.00 33.21 ? 169 PRO A CD  1 
ATOM   1300 N  N   . LEU A 1 169 ? -2.219  -22.711 -21.589 1.00 31.02 ? 170 LEU A N   1 
ATOM   1301 C  CA  . LEU A 1 169 ? -1.380  -21.532 -21.406 1.00 34.32 ? 170 LEU A CA  1 
ATOM   1302 C  C   . LEU A 1 169 ? 0.109   -21.892 -21.341 1.00 32.26 ? 170 LEU A C   1 
ATOM   1303 O  O   . LEU A 1 169 ? 0.972   -21.092 -21.717 1.00 31.36 ? 170 LEU A O   1 
ATOM   1304 C  CB  . LEU A 1 169 ? -1.810  -20.754 -20.158 1.00 36.53 ? 170 LEU A CB  1 
ATOM   1305 C  CG  . LEU A 1 169 ? -3.212  -20.143 -20.259 1.00 43.10 ? 170 LEU A CG  1 
ATOM   1306 C  CD1 . LEU A 1 169 ? -3.587  -19.414 -18.977 1.00 41.91 ? 170 LEU A CD1 1 
ATOM   1307 C  CD2 . LEU A 1 169 ? -3.286  -19.205 -21.459 1.00 40.83 ? 170 LEU A CD2 1 
ATOM   1308 N  N   . GLU A 1 170 ? 0.404   -23.099 -20.867 1.00 28.93 ? 171 GLU A N   1 
ATOM   1309 C  CA  . GLU A 1 170 ? 1.780   -23.567 -20.795 1.00 28.40 ? 171 GLU A CA  1 
ATOM   1310 C  C   . GLU A 1 170 ? 2.255   -23.847 -22.218 1.00 26.80 ? 171 GLU A C   1 
ATOM   1311 O  O   . GLU A 1 170 ? 3.337   -23.422 -22.630 1.00 26.13 ? 171 GLU A O   1 
ATOM   1312 C  CB  . GLU A 1 170 ? 1.889   -24.838 -19.935 1.00 25.40 ? 171 GLU A CB  1 
ATOM   1313 C  CG  . GLU A 1 170 ? 1.368   -24.681 -18.497 1.00 28.46 ? 171 GLU A CG  1 
ATOM   1314 C  CD  . GLU A 1 170 ? 2.080   -23.572 -17.734 1.00 29.35 ? 171 GLU A CD  1 
ATOM   1315 O  OE1 . GLU A 1 170 ? 3.281   -23.734 -17.428 1.00 27.22 ? 171 GLU A OE1 1 
ATOM   1316 O  OE2 . GLU A 1 170 ? 1.443   -22.530 -17.454 1.00 30.59 ? 171 GLU A OE2 1 
ATOM   1317 N  N   . LYS A 1 171 ? 1.432   -24.572 -22.967 1.00 29.07 ? 172 LYS A N   1 
ATOM   1318 C  CA  . LYS A 1 171 ? 1.760   -24.919 -24.344 1.00 29.55 ? 172 LYS A CA  1 
ATOM   1319 C  C   . LYS A 1 171 ? 2.028   -23.640 -25.122 1.00 28.98 ? 172 LYS A C   1 
ATOM   1320 O  O   . LYS A 1 171 ? 3.001   -23.549 -25.872 1.00 31.65 ? 172 LYS A O   1 
ATOM   1321 C  CB  . LYS A 1 171 ? 0.605   -25.703 -24.971 1.00 28.61 ? 172 LYS A CB  1 
ATOM   1322 C  CG  . LYS A 1 171 ? 0.849   -26.196 -26.392 1.00 34.29 ? 172 LYS A CG  1 
ATOM   1323 C  CD  . LYS A 1 171 ? -0.270  -27.144 -26.819 1.00 36.74 ? 172 LYS A CD  1 
ATOM   1324 C  CE  . LYS A 1 171 ? -0.145  -27.568 -28.282 1.00 43.26 ? 172 LYS A CE  1 
ATOM   1325 N  NZ  . LYS A 1 171 ? 0.800   -28.714 -28.480 1.00 47.27 ? 172 LYS A NZ  1 
ATOM   1326 N  N   . GLU A 1 172 ? 1.163   -22.654 -24.908 1.00 34.65 ? 173 GLU A N   1 
ATOM   1327 C  CA  . GLU A 1 172 ? 1.245   -21.365 -25.589 1.00 37.65 ? 173 GLU A CA  1 
ATOM   1328 C  C   . GLU A 1 172 ? 2.571   -20.649 -25.342 1.00 37.58 ? 173 GLU A C   1 
ATOM   1329 O  O   . GLU A 1 172 ? 3.191   -20.143 -26.276 1.00 35.82 ? 173 GLU A O   1 
ATOM   1330 C  CB  . GLU A 1 172 ? 0.079   -20.469 -25.162 1.00 40.44 ? 173 GLU A CB  1 
ATOM   1331 C  CG  . GLU A 1 172 ? 0.019   -19.141 -25.903 1.00 44.34 ? 173 GLU A CG  1 
ATOM   1332 C  CD  . GLU A 1 172 ? -1.121  -18.258 -25.439 1.00 53.41 ? 173 GLU A CD  1 
ATOM   1333 O  OE1 . GLU A 1 172 ? -1.894  -18.691 -24.558 1.00 56.81 ? 173 GLU A OE1 1 
ATOM   1334 O  OE2 . GLU A 1 172 ? -1.246  -17.126 -25.959 1.00 60.21 ? 173 GLU A OE2 1 
ATOM   1335 N  N   . ARG A 1 173 ? 2.989   -20.598 -24.079 1.00 33.09 ? 174 ARG A N   1 
ATOM   1336 C  CA  . ARG A 1 173 ? 4.260   -19.985 -23.716 1.00 34.05 ? 174 ARG A CA  1 
ATOM   1337 C  C   . ARG A 1 173 ? 5.415   -20.738 -24.374 1.00 33.13 ? 174 ARG A C   1 
ATOM   1338 O  O   . ARG A 1 173 ? 6.356   -20.136 -24.906 1.00 34.32 ? 174 ARG A O   1 
ATOM   1339 C  CB  . ARG A 1 173 ? 4.436   -19.974 -22.187 1.00 32.63 ? 174 ARG A CB  1 
ATOM   1340 C  CG  . ARG A 1 173 ? 5.687   -19.234 -21.698 1.00 34.38 ? 174 ARG A CG  1 
ATOM   1341 C  CD  . ARG A 1 173 ? 6.465   -20.063 -20.687 1.00 36.60 ? 174 ARG A CD  1 
ATOM   1342 N  NE  . ARG A 1 173 ? 5.589   -20.587 -19.656 1.00 42.46 ? 174 ARG A NE  1 
ATOM   1343 C  CZ  . ARG A 1 173 ? 5.632   -21.820 -19.164 1.00 33.04 ? 174 ARG A CZ  1 
ATOM   1344 N  NH1 . ARG A 1 173 ? 6.531   -22.706 -19.581 1.00 35.49 ? 174 ARG A NH1 1 
ATOM   1345 N  NH2 . ARG A 1 173 ? 4.765   -22.158 -18.234 1.00 35.50 ? 174 ARG A NH2 1 
ATOM   1346 N  N   . ILE A 1 174 ? 5.332   -22.061 -24.332 1.00 27.84 ? 175 ILE A N   1 
ATOM   1347 C  CA  . ILE A 1 174 ? 6.361   -22.934 -24.881 1.00 30.18 ? 175 ILE A CA  1 
ATOM   1348 C  C   . ILE A 1 174 ? 6.525   -22.736 -26.391 1.00 32.64 ? 175 ILE A C   1 
ATOM   1349 O  O   . ILE A 1 174 ? 7.654   -22.627 -26.897 1.00 31.41 ? 175 ILE A O   1 
ATOM   1350 C  CB  . ILE A 1 174 ? 6.049   -24.415 -24.552 1.00 28.38 ? 175 ILE A CB  1 
ATOM   1351 C  CG1 . ILE A 1 174 ? 6.182   -24.649 -23.041 1.00 26.40 ? 175 ILE A CG1 1 
ATOM   1352 C  CG2 . ILE A 1 174 ? 6.954   -25.359 -25.323 1.00 27.58 ? 175 ILE A CG2 1 
ATOM   1353 C  CD1 . ILE A 1 174 ? 5.646   -25.985 -22.571 1.00 26.99 ? 175 ILE A CD1 1 
ATOM   1354 N  N   . GLN A 1 175 ? 5.403   -22.689 -27.102 1.00 32.55 ? 176 GLN A N   1 
ATOM   1355 C  CA  . GLN A 1 175 ? 5.421   -22.444 -28.541 1.00 34.80 ? 176 GLN A CA  1 
ATOM   1356 C  C   . GLN A 1 175 ? 5.966   -21.051 -28.865 1.00 35.34 ? 176 GLN A C   1 
ATOM   1357 O  O   . GLN A 1 175 ? 6.808   -20.901 -29.752 1.00 37.64 ? 176 GLN A O   1 
ATOM   1358 C  CB  . GLN A 1 175 ? 4.019   -22.625 -29.129 1.00 35.34 ? 176 GLN A CB  1 
ATOM   1359 C  CG  . GLN A 1 175 ? 3.587   -24.076 -29.167 1.00 35.42 ? 176 GLN A CG  1 
ATOM   1360 C  CD  . GLN A 1 175 ? 2.115   -24.255 -29.476 1.00 40.06 ? 176 GLN A CD  1 
ATOM   1361 O  OE1 . GLN A 1 175 ? 1.336   -23.300 -29.447 1.00 40.78 ? 176 GLN A OE1 1 
ATOM   1362 N  NE2 . GLN A 1 175 ? 1.722   -25.490 -29.765 1.00 40.93 ? 176 GLN A NE2 1 
ATOM   1363 N  N   . ASN A 1 176 ? 5.495   -20.043 -28.133 1.00 38.01 ? 177 ASN A N   1 
ATOM   1364 C  CA  . ASN A 1 176 ? 5.981   -18.674 -28.300 1.00 37.42 ? 177 ASN A CA  1 
ATOM   1365 C  C   . ASN A 1 176 ? 7.469   -18.531 -27.997 1.00 40.80 ? 177 ASN A C   1 
ATOM   1366 O  O   . ASN A 1 176 ? 8.113   -17.568 -28.427 1.00 41.41 ? 177 ASN A O   1 
ATOM   1367 C  CB  . ASN A 1 176 ? 5.194   -17.708 -27.420 1.00 37.94 ? 177 ASN A CB  1 
ATOM   1368 C  CG  . ASN A 1 176 ? 3.790   -17.476 -27.923 1.00 41.54 ? 177 ASN A CG  1 
ATOM   1369 O  OD1 . ASN A 1 176 ? 2.915   -17.045 -27.173 1.00 45.95 ? 177 ASN A OD1 1 
ATOM   1370 N  ND2 . ASN A 1 176 ? 3.564   -17.766 -29.197 1.00 40.40 ? 177 ASN A ND2 1 
ATOM   1371 N  N   . ALA A 1 177 ? 8.011   -19.490 -27.255 1.00 32.06 ? 178 ALA A N   1 
ATOM   1372 C  CA  . ALA A 1 177 ? 9.431   -19.491 -26.929 1.00 32.31 ? 178 ALA A CA  1 
ATOM   1373 C  C   . ALA A 1 177 ? 10.225  -20.345 -27.914 1.00 33.39 ? 178 ALA A C   1 
ATOM   1374 O  O   . ALA A 1 177 ? 11.401  -20.634 -27.688 1.00 33.14 ? 178 ALA A O   1 
ATOM   1375 C  CB  . ALA A 1 177 ? 9.647   -19.976 -25.507 1.00 32.65 ? 178 ALA A CB  1 
ATOM   1376 N  N   . GLY A 1 178 ? 9.578   -20.759 -29.000 1.00 35.78 ? 179 GLY A N   1 
ATOM   1377 C  CA  . GLY A 1 178 ? 10.262  -21.486 -30.055 1.00 35.71 ? 179 GLY A CA  1 
ATOM   1378 C  C   . GLY A 1 178 ? 10.292  -22.989 -29.866 1.00 37.37 ? 179 GLY A C   1 
ATOM   1379 O  O   . GLY A 1 178 ? 10.919  -23.708 -30.645 1.00 37.26 ? 179 GLY A O   1 
ATOM   1380 N  N   . GLY A 1 179 ? 9.610   -23.477 -28.834 1.00 32.23 ? 180 GLY A N   1 
ATOM   1381 C  CA  . GLY A 1 179 ? 9.597   -24.904 -28.562 1.00 35.35 ? 180 GLY A CA  1 
ATOM   1382 C  C   . GLY A 1 179 ? 8.321   -25.574 -29.024 1.00 31.23 ? 180 GLY A C   1 
ATOM   1383 O  O   . GLY A 1 179 ? 7.478   -24.952 -29.657 1.00 34.99 ? 180 GLY A O   1 
ATOM   1384 N  N   . SER A 1 180 ? 8.183   -26.856 -28.717 1.00 34.76 ? 181 SER A N   1 
ATOM   1385 C  CA  . SER A 1 180 ? 6.949   -27.566 -29.000 1.00 36.35 ? 181 SER A CA  1 
ATOM   1386 C  C   . SER A 1 180 ? 6.600   -28.487 -27.833 1.00 35.59 ? 181 SER A C   1 
ATOM   1387 O  O   . SER A 1 180 ? 7.465   -28.851 -27.036 1.00 37.64 ? 181 SER A O   1 
ATOM   1388 C  CB  . SER A 1 180 ? 7.081   -28.391 -30.285 1.00 37.26 ? 181 SER A CB  1 
ATOM   1389 O  OG  . SER A 1 180 ? 8.046   -29.415 -30.117 1.00 40.98 ? 181 SER A OG  1 
ATOM   1390 N  N   . VAL A 1 181 ? 5.329   -28.854 -27.736 1.00 29.77 ? 182 VAL A N   1 
ATOM   1391 C  CA  . VAL A 1 181 ? 4.912   -29.865 -26.782 1.00 28.95 ? 182 VAL A CA  1 
ATOM   1392 C  C   . VAL A 1 181 ? 4.631   -31.134 -27.568 1.00 30.27 ? 182 VAL A C   1 
ATOM   1393 O  O   . VAL A 1 181 ? 3.730   -31.175 -28.408 1.00 29.04 ? 182 VAL A O   1 
ATOM   1394 C  CB  . VAL A 1 181 ? 3.666   -29.428 -25.995 1.00 30.47 ? 182 VAL A CB  1 
ATOM   1395 C  CG1 . VAL A 1 181 ? 3.181   -30.566 -25.102 1.00 27.68 ? 182 VAL A CG1 1 
ATOM   1396 C  CG2 . VAL A 1 181 ? 3.980   -28.173 -25.158 1.00 25.75 ? 182 VAL A CG2 1 
ATOM   1397 N  N   . MET A 1 182 ? 5.441   -32.153 -27.320 1.00 30.46 ? 183 MET A N   1 
ATOM   1398 C  CA  . MET A 1 182 ? 5.271   -33.442 -27.972 1.00 32.14 ? 183 MET A CA  1 
ATOM   1399 C  C   . MET A 1 182 ? 4.672   -34.426 -26.977 1.00 29.96 ? 183 MET A C   1 
ATOM   1400 O  O   . MET A 1 182 ? 5.325   -34.830 -26.018 1.00 27.43 ? 183 MET A O   1 
ATOM   1401 C  CB  . MET A 1 182 ? 6.607   -33.932 -28.516 1.00 31.42 ? 183 MET A CB  1 
ATOM   1402 C  CG  . MET A 1 182 ? 7.207   -32.964 -29.521 1.00 33.65 ? 183 MET A CG  1 
ATOM   1403 S  SD  . MET A 1 182 ? 8.899   -33.394 -29.963 1.00 47.95 ? 183 MET A SD  1 
ATOM   1404 C  CE  . MET A 1 182 ? 9.299   -32.020 -31.046 1.00 51.35 ? 183 MET A CE  1 
ATOM   1405 N  N   . ILE A 1 183 ? 3.413   -34.782 -27.215 1.00 29.04 ? 184 ILE A N   1 
ATOM   1406 C  CA  . ILE A 1 183 ? 2.617   -35.552 -26.268 1.00 29.95 ? 184 ILE A CA  1 
ATOM   1407 C  C   . ILE A 1 183 ? 2.470   -34.752 -24.973 1.00 31.32 ? 184 ILE A C   1 
ATOM   1408 O  O   . ILE A 1 183 ? 1.630   -33.864 -24.893 1.00 32.45 ? 184 ILE A O   1 
ATOM   1409 C  CB  . ILE A 1 183 ? 3.208   -36.948 -26.004 1.00 30.44 ? 184 ILE A CB  1 
ATOM   1410 C  CG1 . ILE A 1 183 ? 3.506   -37.653 -27.336 1.00 27.95 ? 184 ILE A CG1 1 
ATOM   1411 C  CG2 . ILE A 1 183 ? 2.250   -37.776 -25.160 1.00 29.83 ? 184 ILE A CG2 1 
ATOM   1412 C  CD1 . ILE A 1 183 ? 2.318   -37.688 -28.276 1.00 28.74 ? 184 ILE A CD1 1 
ATOM   1413 N  N   . GLN A 1 184 ? 3.306   -35.041 -23.981 1.00 38.06 ? 185 GLN A N   1 
ATOM   1414 C  CA  . GLN A 1 184 ? 3.225   -34.343 -22.698 1.00 41.01 ? 185 GLN A CA  1 
ATOM   1415 C  C   . GLN A 1 184 ? 4.540   -33.678 -22.313 1.00 38.46 ? 185 GLN A C   1 
ATOM   1416 O  O   . GLN A 1 184 ? 4.704   -33.225 -21.177 1.00 40.86 ? 185 GLN A O   1 
ATOM   1417 C  CB  . GLN A 1 184 ? 2.805   -35.310 -21.585 1.00 38.69 ? 185 GLN A CB  1 
ATOM   1418 C  CG  . GLN A 1 184 ? 1.424   -35.038 -21.017 1.00 49.86 ? 185 GLN A CG  1 
ATOM   1419 C  CD  . GLN A 1 184 ? 0.317   -35.618 -21.875 1.00 49.59 ? 185 GLN A CD  1 
ATOM   1420 O  OE1 . GLN A 1 184 ? 0.154   -36.841 -21.957 1.00 56.74 ? 185 GLN A OE1 1 
ATOM   1421 N  NE2 . GLN A 1 184 ? -0.451  -34.747 -22.523 1.00 50.13 ? 185 GLN A NE2 1 
ATOM   1422 N  N   . ARG A 1 185 ? 5.478   -33.614 -23.254 1.00 30.30 ? 186 ARG A N   1 
ATOM   1423 C  CA  . ARG A 1 185 ? 6.826   -33.142 -22.935 1.00 31.66 ? 186 ARG A CA  1 
ATOM   1424 C  C   . ARG A 1 185 ? 7.329   -31.964 -23.770 1.00 32.78 ? 186 ARG A C   1 
ATOM   1425 O  O   . ARG A 1 185 ? 7.124   -31.902 -24.988 1.00 30.03 ? 186 ARG A O   1 
ATOM   1426 C  CB  . ARG A 1 185 ? 7.822   -34.309 -22.980 1.00 34.20 ? 186 ARG A CB  1 
ATOM   1427 C  CG  . ARG A 1 185 ? 7.545   -35.315 -21.869 1.00 33.72 ? 186 ARG A CG  1 
ATOM   1428 C  CD  . ARG A 1 185 ? 8.373   -36.596 -21.935 1.00 34.88 ? 186 ARG A CD  1 
ATOM   1429 N  NE  . ARG A 1 185 ? 7.957   -37.456 -20.828 1.00 32.05 ? 186 ARG A NE  1 
ATOM   1430 C  CZ  . ARG A 1 185 ? 8.652   -37.623 -19.711 1.00 32.25 ? 186 ARG A CZ  1 
ATOM   1431 N  NH1 . ARG A 1 185 ? 9.833   -37.036 -19.569 1.00 36.98 ? 186 ARG A NH1 1 
ATOM   1432 N  NH2 . ARG A 1 185 ? 8.176   -38.401 -18.750 1.00 31.68 ? 186 ARG A NH2 1 
ATOM   1433 N  N   . VAL A 1 186 ? 7.990   -31.032 -23.089 1.00 31.37 ? 187 VAL A N   1 
ATOM   1434 C  CA  . VAL A 1 186 ? 8.640   -29.913 -23.743 1.00 30.69 ? 187 VAL A CA  1 
ATOM   1435 C  C   . VAL A 1 186 ? 9.718   -30.467 -24.656 1.00 33.45 ? 187 VAL A C   1 
ATOM   1436 O  O   . VAL A 1 186 ? 10.637  -31.151 -24.195 1.00 32.13 ? 187 VAL A O   1 
ATOM   1437 C  CB  . VAL A 1 186 ? 9.278   -28.951 -22.724 1.00 33.03 ? 187 VAL A CB  1 
ATOM   1438 C  CG1 . VAL A 1 186 ? 9.897   -27.764 -23.434 1.00 33.91 ? 187 VAL A CG1 1 
ATOM   1439 C  CG2 . VAL A 1 186 ? 8.230   -28.468 -21.718 1.00 31.91 ? 187 VAL A CG2 1 
ATOM   1440 N  N   . ASN A 1 187 ? 9.592   -30.180 -25.951 1.00 36.09 ? 188 ASN A N   1 
ATOM   1441 C  CA  . ASN A 1 187 ? 10.525  -30.688 -26.950 1.00 35.86 ? 188 ASN A CA  1 
ATOM   1442 C  C   . ASN A 1 187 ? 10.738  -32.188 -26.817 1.00 37.19 ? 188 ASN A C   1 
ATOM   1443 O  O   . ASN A 1 187 ? 11.806  -32.702 -27.133 1.00 40.55 ? 188 ASN A O   1 
ATOM   1444 C  CB  . ASN A 1 187 ? 11.860  -29.942 -26.866 1.00 38.64 ? 188 ASN A CB  1 
ATOM   1445 C  CG  . ASN A 1 187 ? 11.719  -28.470 -27.214 1.00 35.71 ? 188 ASN A CG  1 
ATOM   1446 O  OD1 . ASN A 1 187 ? 10.782  -28.080 -27.904 1.00 36.25 ? 188 ASN A OD1 1 
ATOM   1447 N  ND2 . ASN A 1 187 ? 12.647  -27.652 -26.737 1.00 38.28 ? 188 ASN A ND2 1 
ATOM   1448 N  N   . GLY A 1 188 ? 9.710   -32.886 -26.343 1.00 37.40 ? 189 GLY A N   1 
ATOM   1449 C  CA  . GLY A 1 188 ? 9.767   -34.326 -26.180 1.00 36.53 ? 189 GLY A CA  1 
ATOM   1450 C  C   . GLY A 1 188 ? 10.609  -34.824 -25.014 1.00 38.13 ? 189 GLY A C   1 
ATOM   1451 O  O   . GLY A 1 188 ? 10.837  -36.032 -24.892 1.00 36.44 ? 189 GLY A O   1 
ATOM   1452 N  N   . SER A 1 189 ? 11.053  -33.910 -24.149 1.00 39.70 ? 190 SER A N   1 
ATOM   1453 C  CA  . SER A 1 189 ? 11.948  -34.272 -23.046 1.00 40.99 ? 190 SER A CA  1 
ATOM   1454 C  C   . SER A 1 189 ? 11.358  -34.056 -21.646 1.00 42.24 ? 190 SER A C   1 
ATOM   1455 O  O   . SER A 1 189 ? 11.218  -35.005 -20.876 1.00 43.49 ? 190 SER A O   1 
ATOM   1456 C  CB  . SER A 1 189 ? 13.272  -33.512 -23.166 1.00 44.19 ? 190 SER A CB  1 
ATOM   1457 O  OG  . SER A 1 189 ? 13.818  -33.655 -24.466 1.00 47.66 ? 190 SER A OG  1 
ATOM   1458 N  N   . LEU A 1 190 ? 11.025  -32.808 -21.321 1.00 37.51 ? 191 LEU A N   1 
ATOM   1459 C  CA  . LEU A 1 190 ? 10.602  -32.454 -19.969 1.00 37.57 ? 191 LEU A CA  1 
ATOM   1460 C  C   . LEU A 1 190 ? 9.096   -32.561 -19.750 1.00 35.89 ? 191 LEU A C   1 
ATOM   1461 O  O   . LEU A 1 190 ? 8.308   -31.988 -20.504 1.00 34.56 ? 191 LEU A O   1 
ATOM   1462 C  CB  . LEU A 1 190 ? 11.059  -31.031 -19.634 1.00 40.74 ? 191 LEU A CB  1 
ATOM   1463 C  CG  . LEU A 1 190 ? 11.644  -30.878 -18.231 1.00 43.34 ? 191 LEU A CG  1 
ATOM   1464 C  CD1 . LEU A 1 190 ? 13.035  -31.508 -18.166 1.00 42.03 ? 191 LEU A CD1 1 
ATOM   1465 C  CD2 . LEU A 1 190 ? 11.689  -29.410 -17.825 1.00 40.98 ? 191 LEU A CD2 1 
ATOM   1466 N  N   . ALA A 1 191 ? 8.703   -33.262 -18.691 1.00 29.39 ? 192 ALA A N   1 
ATOM   1467 C  CA  . ALA A 1 191 ? 7.285   -33.520 -18.421 1.00 33.44 ? 192 ALA A CA  1 
ATOM   1468 C  C   . ALA A 1 191 ? 6.657   -32.481 -17.484 1.00 32.28 ? 192 ALA A C   1 
ATOM   1469 O  O   . ALA A 1 191 ? 5.495   -32.609 -17.078 1.00 31.12 ? 192 ALA A O   1 
ATOM   1470 C  CB  . ALA A 1 191 ? 7.084   -34.939 -17.873 1.00 34.81 ? 192 ALA A CB  1 
ATOM   1471 N  N   . VAL A 1 192 ? 7.422   -31.449 -17.145 1.00 33.65 ? 193 VAL A N   1 
ATOM   1472 C  CA  . VAL A 1 192 ? 6.877   -30.326 -16.390 1.00 33.05 ? 193 VAL A CA  1 
ATOM   1473 C  C   . VAL A 1 192 ? 7.159   -29.011 -17.111 1.00 32.15 ? 193 VAL A C   1 
ATOM   1474 O  O   . VAL A 1 192 ? 8.211   -28.836 -17.730 1.00 34.56 ? 193 VAL A O   1 
ATOM   1475 C  CB  . VAL A 1 192 ? 7.426   -30.253 -14.944 1.00 33.19 ? 193 VAL A CB  1 
ATOM   1476 C  CG1 . VAL A 1 192 ? 6.944   -31.452 -14.130 1.00 34.73 ? 193 VAL A CG1 1 
ATOM   1477 C  CG2 . VAL A 1 192 ? 8.950   -30.168 -14.954 1.00 36.75 ? 193 VAL A CG2 1 
ATOM   1478 N  N   . SER A 1 193 ? 6.209   -28.092 -17.030 1.00 27.90 ? 194 SER A N   1 
ATOM   1479 C  CA  . SER A 1 193 ? 6.333   -26.833 -17.731 1.00 27.63 ? 194 SER A CA  1 
ATOM   1480 C  C   . SER A 1 193 ? 6.891   -25.754 -16.805 1.00 29.02 ? 194 SER A C   1 
ATOM   1481 O  O   . SER A 1 193 ? 7.307   -24.683 -17.255 1.00 26.92 ? 194 SER A O   1 
ATOM   1482 C  CB  . SER A 1 193 ? 4.979   -26.407 -18.305 1.00 28.51 ? 194 SER A CB  1 
ATOM   1483 O  OG  . SER A 1 193 ? 4.094   -25.997 -17.274 1.00 34.28 ? 194 SER A OG  1 
ATOM   1484 N  N   . ARG A 1 194 ? 6.909   -26.038 -15.509 1.00 23.82 ? 195 ARG A N   1 
ATOM   1485 C  CA  . ARG A 1 194 ? 7.399   -25.057 -14.546 1.00 23.79 ? 195 ARG A CA  1 
ATOM   1486 C  C   . ARG A 1 194 ? 8.300   -25.710 -13.517 1.00 24.02 ? 195 ARG A C   1 
ATOM   1487 O  O   . ARG A 1 194 ? 7.997   -26.791 -13.015 1.00 23.61 ? 195 ARG A O   1 
ATOM   1488 C  CB  . ARG A 1 194 ? 6.243   -24.322 -13.855 1.00 25.43 ? 195 ARG A CB  1 
ATOM   1489 C  CG  . ARG A 1 194 ? 5.386   -23.508 -14.801 1.00 23.85 ? 195 ARG A CG  1 
ATOM   1490 C  CD  . ARG A 1 194 ? 4.652   -22.405 -14.061 1.00 25.24 ? 195 ARG A CD  1 
ATOM   1491 N  NE  . ARG A 1 194 ? 3.571   -21.859 -14.878 1.00 28.03 ? 195 ARG A NE  1 
ATOM   1492 C  CZ  . ARG A 1 194 ? 2.857   -20.784 -14.557 1.00 30.86 ? 195 ARG A CZ  1 
ATOM   1493 N  NH1 . ARG A 1 194 ? 3.112   -20.124 -13.432 1.00 28.19 ? 195 ARG A NH1 1 
ATOM   1494 N  NH2 . ARG A 1 194 ? 1.890   -20.365 -15.366 1.00 30.26 ? 195 ARG A NH2 1 
ATOM   1495 N  N   . ALA A 1 195 ? 9.399   -25.037 -13.199 1.00 22.66 ? 196 ALA A N   1 
ATOM   1496 C  CA  . ALA A 1 195 ? 10.401  -25.578 -12.279 1.00 22.70 ? 196 ALA A CA  1 
ATOM   1497 C  C   . ALA A 1 195 ? 11.478  -24.546 -12.011 1.00 24.23 ? 196 ALA A C   1 
ATOM   1498 O  O   . ALA A 1 195 ? 11.674  -23.622 -12.797 1.00 23.15 ? 196 ALA A O   1 
ATOM   1499 C  CB  . ALA A 1 195 ? 11.038  -26.852 -12.856 1.00 25.34 ? 196 ALA A CB  1 
ATOM   1500 N  N   . LEU A 1 196 ? 12.169  -24.700 -10.887 1.00 27.88 ? 197 LEU A N   1 
ATOM   1501 C  CA  . LEU A 1 196 ? 13.404  -23.970 -10.659 1.00 28.31 ? 197 LEU A CA  1 
ATOM   1502 C  C   . LEU A 1 196 ? 14.504  -24.786 -11.326 1.00 25.51 ? 197 LEU A C   1 
ATOM   1503 O  O   . LEU A 1 196 ? 14.355  -25.996 -11.491 1.00 25.40 ? 197 LEU A O   1 
ATOM   1504 C  CB  . LEU A 1 196 ? 13.652  -23.801 -9.153  1.00 25.58 ? 197 LEU A CB  1 
ATOM   1505 C  CG  . LEU A 1 196 ? 12.532  -22.961 -8.520  1.00 26.16 ? 197 LEU A CG  1 
ATOM   1506 C  CD1 . LEU A 1 196 ? 12.611  -22.913 -7.016  1.00 31.03 ? 197 LEU A CD1 1 
ATOM   1507 C  CD2 . LEU A 1 196 ? 12.537  -21.557 -9.093  1.00 24.13 ? 197 LEU A CD2 1 
ATOM   1508 N  N   . GLY A 1 197 ? 15.597  -24.137 -11.731 1.00 26.97 ? 198 GLY A N   1 
ATOM   1509 C  CA  . GLY A 1 197 ? 16.643  -24.845 -12.450 1.00 26.10 ? 198 GLY A CA  1 
ATOM   1510 C  C   . GLY A 1 197 ? 16.304  -25.066 -13.916 1.00 25.62 ? 198 GLY A C   1 
ATOM   1511 O  O   . GLY A 1 197 ? 15.650  -24.224 -14.523 1.00 26.19 ? 198 GLY A O   1 
ATOM   1512 N  N   . ASP A 1 198 ? 16.745  -26.192 -14.482 1.00 25.81 ? 199 ASP A N   1 
ATOM   1513 C  CA  . ASP A 1 198 ? 16.547  -26.470 -15.908 1.00 26.70 ? 199 ASP A CA  1 
ATOM   1514 C  C   . ASP A 1 198 ? 16.971  -25.283 -16.760 1.00 29.67 ? 199 ASP A C   1 
ATOM   1515 O  O   . ASP A 1 198 ? 16.251  -24.862 -17.668 1.00 27.85 ? 199 ASP A O   1 
ATOM   1516 C  CB  . ASP A 1 198 ? 15.080  -26.790 -16.198 1.00 27.59 ? 199 ASP A CB  1 
ATOM   1517 C  CG  . ASP A 1 198 ? 14.589  -28.000 -15.440 1.00 27.78 ? 199 ASP A CG  1 
ATOM   1518 O  OD1 . ASP A 1 198 ? 15.330  -29.005 -15.344 1.00 28.33 ? 199 ASP A OD1 1 
ATOM   1519 O  OD2 . ASP A 1 198 ? 13.452  -27.944 -14.939 1.00 29.83 ? 199 ASP A OD2 1 
ATOM   1520 N  N   . PHE A 1 199 ? 18.144  -24.741 -16.465 1.00 28.03 ? 200 PHE A N   1 
ATOM   1521 C  CA  . PHE A 1 199 ? 18.584  -23.511 -17.110 1.00 28.90 ? 200 PHE A CA  1 
ATOM   1522 C  C   . PHE A 1 199 ? 18.814  -23.623 -18.618 1.00 31.37 ? 200 PHE A C   1 
ATOM   1523 O  O   . PHE A 1 199 ? 18.759  -22.615 -19.330 1.00 33.80 ? 200 PHE A O   1 
ATOM   1524 C  CB  . PHE A 1 199 ? 19.804  -22.964 -16.379 1.00 30.62 ? 200 PHE A CB  1 
ATOM   1525 C  CG  . PHE A 1 199 ? 19.515  -22.607 -14.950 1.00 29.89 ? 200 PHE A CG  1 
ATOM   1526 C  CD1 . PHE A 1 199 ? 18.535  -21.670 -14.649 1.00 30.90 ? 200 PHE A CD1 1 
ATOM   1527 C  CD2 . PHE A 1 199 ? 20.195  -23.220 -13.907 1.00 26.79 ? 200 PHE A CD2 1 
ATOM   1528 C  CE1 . PHE A 1 199 ? 18.251  -21.340 -13.336 1.00 29.54 ? 200 PHE A CE1 1 
ATOM   1529 C  CE2 . PHE A 1 199 ? 19.918  -22.885 -12.589 1.00 28.71 ? 200 PHE A CE2 1 
ATOM   1530 C  CZ  . PHE A 1 199 ? 18.937  -21.951 -12.306 1.00 27.46 ? 200 PHE A CZ  1 
ATOM   1531 N  N   . ASP A 1 200 ? 19.057  -24.835 -19.108 1.00 33.55 ? 201 ASP A N   1 
ATOM   1532 C  CA  . ASP A 1 200 ? 19.149  -25.060 -20.553 1.00 36.79 ? 201 ASP A CA  1 
ATOM   1533 C  C   . ASP A 1 200 ? 17.840  -24.695 -21.244 1.00 38.71 ? 201 ASP A C   1 
ATOM   1534 O  O   . ASP A 1 200 ? 17.822  -24.379 -22.437 1.00 35.51 ? 201 ASP A O   1 
ATOM   1535 C  CB  . ASP A 1 200 ? 19.486  -26.514 -20.865 1.00 34.73 ? 201 ASP A CB  1 
ATOM   1536 C  CG  . ASP A 1 200 ? 20.950  -26.823 -20.680 1.00 38.40 ? 201 ASP A CG  1 
ATOM   1537 O  OD1 . ASP A 1 200 ? 21.752  -25.873 -20.591 1.00 41.22 ? 201 ASP A OD1 1 
ATOM   1538 O  OD2 . ASP A 1 200 ? 21.298  -28.018 -20.624 1.00 39.33 ? 201 ASP A OD2 1 
ATOM   1539 N  N   . TYR A 1 201 ? 16.742  -24.750 -20.493 1.00 32.41 ? 202 TYR A N   1 
ATOM   1540 C  CA  . TYR A 1 201 ? 15.430  -24.405 -21.033 1.00 33.09 ? 202 TYR A CA  1 
ATOM   1541 C  C   . TYR A 1 201 ? 15.070  -22.950 -20.780 1.00 32.32 ? 202 TYR A C   1 
ATOM   1542 O  O   . TYR A 1 201 ? 13.924  -22.542 -20.989 1.00 32.93 ? 202 TYR A O   1 
ATOM   1543 C  CB  . TYR A 1 201 ? 14.347  -25.285 -20.410 1.00 32.73 ? 202 TYR A CB  1 
ATOM   1544 C  CG  . TYR A 1 201 ? 14.366  -26.736 -20.828 1.00 31.79 ? 202 TYR A CG  1 
ATOM   1545 C  CD1 . TYR A 1 201 ? 15.232  -27.645 -20.226 1.00 34.52 ? 202 TYR A CD1 1 
ATOM   1546 C  CD2 . TYR A 1 201 ? 13.483  -27.208 -21.797 1.00 34.25 ? 202 TYR A CD2 1 
ATOM   1547 C  CE1 . TYR A 1 201 ? 15.236  -28.988 -20.599 1.00 38.13 ? 202 TYR A CE1 1 
ATOM   1548 C  CE2 . TYR A 1 201 ? 13.477  -28.537 -22.175 1.00 37.78 ? 202 TYR A CE2 1 
ATOM   1549 C  CZ  . TYR A 1 201 ? 14.354  -29.424 -21.577 1.00 42.44 ? 202 TYR A CZ  1 
ATOM   1550 O  OH  . TYR A 1 201 ? 14.337  -30.749 -21.959 1.00 40.72 ? 202 TYR A OH  1 
ATOM   1551 N  N   . LYS A 1 202 ? 16.025  -22.167 -20.301 1.00 27.72 ? 203 LYS A N   1 
ATOM   1552 C  CA  . LYS A 1 202 ? 15.740  -20.772 -19.988 1.00 31.10 ? 203 LYS A CA  1 
ATOM   1553 C  C   . LYS A 1 202 ? 16.741  -19.848 -20.673 1.00 33.97 ? 203 LYS A C   1 
ATOM   1554 O  O   . LYS A 1 202 ? 17.234  -18.886 -20.076 1.00 28.70 ? 203 LYS A O   1 
ATOM   1555 C  CB  . LYS A 1 202 ? 15.728  -20.551 -18.472 1.00 29.60 ? 203 LYS A CB  1 
ATOM   1556 C  CG  . LYS A 1 202 ? 14.636  -21.382 -17.754 1.00 27.53 ? 203 LYS A CG  1 
ATOM   1557 C  CD  . LYS A 1 202 ? 14.786  -21.329 -16.221 1.00 28.44 ? 203 LYS A CD  1 
ATOM   1558 C  CE  . LYS A 1 202 ? 13.593  -21.994 -15.528 1.00 25.39 ? 203 LYS A CE  1 
ATOM   1559 N  NZ  . LYS A 1 202 ? 13.859  -22.251 -14.069 1.00 19.86 ? 203 LYS A NZ  1 
ATOM   1560 N  N   . CYS A 1 203 ? 17.023  -20.157 -21.935 1.00 38.54 ? 204 CYS A N   1 
ATOM   1561 C  CA  . CYS A 1 203 ? 18.047  -19.455 -22.701 1.00 40.65 ? 204 CYS A CA  1 
ATOM   1562 C  C   . CYS A 1 203 ? 17.475  -18.810 -23.955 1.00 42.84 ? 204 CYS A C   1 
ATOM   1563 O  O   . CYS A 1 203 ? 18.215  -18.493 -24.885 1.00 45.90 ? 204 CYS A O   1 
ATOM   1564 C  CB  . CYS A 1 203 ? 19.155  -20.428 -23.107 1.00 41.12 ? 204 CYS A CB  1 
ATOM   1565 S  SG  . CYS A 1 203 ? 20.223  -20.977 -21.761 1.00 48.57 ? 204 CYS A SG  1 
ATOM   1566 N  N   . VAL A 1 204 ? 16.160  -18.623 -23.987 1.00 36.59 ? 205 VAL A N   1 
ATOM   1567 C  CA  . VAL A 1 204 ? 15.516  -18.032 -25.154 1.00 41.55 ? 205 VAL A CA  1 
ATOM   1568 C  C   . VAL A 1 204 ? 15.704  -16.514 -25.181 1.00 44.40 ? 205 VAL A C   1 
ATOM   1569 O  O   . VAL A 1 204 ? 15.200  -15.794 -24.318 1.00 39.23 ? 205 VAL A O   1 
ATOM   1570 C  CB  . VAL A 1 204 ? 14.012  -18.380 -25.223 1.00 40.78 ? 205 VAL A CB  1 
ATOM   1571 C  CG1 . VAL A 1 204 ? 13.397  -17.826 -26.498 1.00 42.69 ? 205 VAL A CG1 1 
ATOM   1572 C  CG2 . VAL A 1 204 ? 13.816  -19.896 -25.162 1.00 39.45 ? 205 VAL A CG2 1 
ATOM   1573 N  N   . HIS A 1 205 ? 16.436  -16.035 -26.182 1.00 54.31 ? 206 HIS A N   1 
ATOM   1574 C  CA  . HIS A 1 205 ? 16.704  -14.609 -26.309 1.00 56.38 ? 206 HIS A CA  1 
ATOM   1575 C  C   . HIS A 1 205 ? 15.436  -13.859 -26.694 1.00 53.42 ? 206 HIS A C   1 
ATOM   1576 O  O   . HIS A 1 205 ? 14.628  -14.350 -27.483 1.00 54.63 ? 206 HIS A O   1 
ATOM   1577 C  CB  . HIS A 1 205 ? 17.805  -14.359 -27.344 1.00 65.02 ? 206 HIS A CB  1 
ATOM   1578 C  CG  . HIS A 1 205 ? 19.067  -15.125 -27.083 1.00 69.69 ? 206 HIS A CG  1 
ATOM   1579 N  ND1 . HIS A 1 205 ? 19.891  -14.861 -26.010 1.00 72.77 ? 206 HIS A ND1 1 
ATOM   1580 C  CD2 . HIS A 1 205 ? 19.650  -16.143 -27.762 1.00 73.71 ? 206 HIS A CD2 1 
ATOM   1581 C  CE1 . HIS A 1 205 ? 20.924  -15.686 -26.036 1.00 75.87 ? 206 HIS A CE1 1 
ATOM   1582 N  NE2 . HIS A 1 205 ? 20.802  -16.472 -27.091 1.00 73.96 ? 206 HIS A NE2 1 
ATOM   1583 N  N   . GLY A 1 206 ? 15.259  -12.669 -26.133 1.00 51.20 ? 207 GLY A N   1 
ATOM   1584 C  CA  . GLY A 1 206 ? 14.093  -11.865 -26.446 1.00 53.81 ? 207 GLY A CA  1 
ATOM   1585 C  C   . GLY A 1 206 ? 12.842  -12.281 -25.690 1.00 50.90 ? 207 GLY A C   1 
ATOM   1586 O  O   . GLY A 1 206 ? 11.732  -11.864 -26.028 1.00 45.74 ? 207 GLY A O   1 
ATOM   1587 N  N   . LYS A 1 207 ? 13.024  -13.110 -24.667 1.00 41.86 ? 208 LYS A N   1 
ATOM   1588 C  CA  . LYS A 1 207 ? 11.929  -13.511 -23.792 1.00 41.78 ? 208 LYS A CA  1 
ATOM   1589 C  C   . LYS A 1 207 ? 12.357  -13.324 -22.340 1.00 37.66 ? 208 LYS A C   1 
ATOM   1590 O  O   . LYS A 1 207 ? 13.485  -13.654 -21.977 1.00 40.84 ? 208 LYS A O   1 
ATOM   1591 C  CB  . LYS A 1 207 ? 11.550  -14.975 -24.046 1.00 39.11 ? 208 LYS A CB  1 
ATOM   1592 C  CG  . LYS A 1 207 ? 10.761  -15.203 -25.324 1.00 41.01 ? 208 LYS A CG  1 
ATOM   1593 C  CD  . LYS A 1 207 ? 9.467   -14.406 -25.314 1.00 41.47 ? 208 LYS A CD  1 
ATOM   1594 C  CE  . LYS A 1 207 ? 8.691   -14.596 -26.606 1.00 40.65 ? 208 LYS A CE  1 
ATOM   1595 N  NZ  . LYS A 1 207 ? 7.663   -13.534 -26.809 1.00 48.69 ? 208 LYS A NZ  1 
ATOM   1596 N  N   . GLY A 1 208 ? 11.466  -12.793 -21.513 1.00 37.88 ? 209 GLY A N   1 
ATOM   1597 C  CA  . GLY A 1 208 ? 11.763  -12.600 -20.104 1.00 39.49 ? 209 GLY A CA  1 
ATOM   1598 C  C   . GLY A 1 208 ? 11.838  -13.915 -19.339 1.00 38.14 ? 209 GLY A C   1 
ATOM   1599 O  O   . GLY A 1 208 ? 11.593  -14.988 -19.904 1.00 36.19 ? 209 GLY A O   1 
ATOM   1600 N  N   . PRO A 1 209 ? 12.170  -13.839 -18.039 1.00 39.93 ? 210 PRO A N   1 
ATOM   1601 C  CA  . PRO A 1 209 ? 12.350  -15.032 -17.203 1.00 38.07 ? 210 PRO A CA  1 
ATOM   1602 C  C   . PRO A 1 209 ? 11.103  -15.920 -17.143 1.00 36.64 ? 210 PRO A C   1 
ATOM   1603 O  O   . PRO A 1 209 ? 11.250  -17.139 -17.048 1.00 37.64 ? 210 PRO A O   1 
ATOM   1604 C  CB  . PRO A 1 209 ? 12.653  -14.453 -15.815 1.00 38.87 ? 210 PRO A CB  1 
ATOM   1605 C  CG  . PRO A 1 209 ? 13.134  -13.073 -16.068 1.00 44.04 ? 210 PRO A CG  1 
ATOM   1606 C  CD  . PRO A 1 209 ? 12.397  -12.595 -17.285 1.00 40.16 ? 210 PRO A CD  1 
ATOM   1607 N  N   . THR A 1 210 ? 9.911   -15.331 -17.203 1.00 31.22 ? 211 THR A N   1 
ATOM   1608 C  CA  . THR A 1 210 ? 8.674   -16.110 -17.101 1.00 30.86 ? 211 THR A CA  1 
ATOM   1609 C  C   . THR A 1 210 ? 8.067   -16.433 -18.459 1.00 32.93 ? 211 THR A C   1 
ATOM   1610 O  O   . THR A 1 210 ? 6.934   -16.919 -18.542 1.00 30.63 ? 211 THR A O   1 
ATOM   1611 C  CB  . THR A 1 210 ? 7.617   -15.402 -16.237 1.00 31.37 ? 211 THR A CB  1 
ATOM   1612 O  OG1 . THR A 1 210 ? 7.191   -14.197 -16.887 1.00 34.32 ? 211 THR A OG1 1 
ATOM   1613 C  CG2 . THR A 1 210 ? 8.189   -15.068 -14.881 1.00 31.97 ? 211 THR A CG2 1 
ATOM   1614 N  N   . GLU A 1 211 ? 8.835   -16.184 -19.518 1.00 34.00 ? 212 GLU A N   1 
ATOM   1615 C  CA  . GLU A 1 211 ? 8.384   -16.437 -20.885 1.00 36.06 ? 212 GLU A CA  1 
ATOM   1616 C  C   . GLU A 1 211 ? 9.263   -17.480 -21.574 1.00 35.57 ? 212 GLU A C   1 
ATOM   1617 O  O   . GLU A 1 211 ? 9.158   -17.689 -22.782 1.00 36.94 ? 212 GLU A O   1 
ATOM   1618 C  CB  . GLU A 1 211 ? 8.377   -15.133 -21.690 1.00 37.59 ? 212 GLU A CB  1 
ATOM   1619 C  CG  . GLU A 1 211 ? 7.509   -14.036 -21.078 1.00 40.25 ? 212 GLU A CG  1 
ATOM   1620 C  CD  . GLU A 1 211 ? 7.632   -12.698 -21.804 1.00 45.73 ? 212 GLU A CD  1 
ATOM   1621 O  OE1 . GLU A 1 211 ? 8.726   -12.387 -22.330 1.00 45.48 ? 212 GLU A OE1 1 
ATOM   1622 O  OE2 . GLU A 1 211 ? 6.627   -11.957 -21.847 1.00 50.45 ? 212 GLU A OE2 1 
ATOM   1623 N  N   . GLN A 1 212 ? 10.119  -18.134 -20.793 1.00 30.81 ? 213 GLN A N   1 
ATOM   1624 C  CA  . GLN A 1 212 ? 11.028  -19.165 -21.297 1.00 30.57 ? 213 GLN A CA  1 
ATOM   1625 C  C   . GLN A 1 212 ? 10.294  -20.486 -21.546 1.00 33.01 ? 213 GLN A C   1 
ATOM   1626 O  O   . GLN A 1 212 ? 9.099   -20.581 -21.276 1.00 30.32 ? 213 GLN A O   1 
ATOM   1627 C  CB  . GLN A 1 212 ? 12.163  -19.385 -20.291 1.00 29.95 ? 213 GLN A CB  1 
ATOM   1628 C  CG  . GLN A 1 212 ? 12.996  -18.141 -20.038 1.00 32.04 ? 213 GLN A CG  1 
ATOM   1629 C  CD  . GLN A 1 212 ? 13.795  -17.735 -21.265 1.00 33.77 ? 213 GLN A CD  1 
ATOM   1630 O  OE1 . GLN A 1 212 ? 14.374  -18.579 -21.940 1.00 33.64 ? 213 GLN A OE1 1 
ATOM   1631 N  NE2 . GLN A 1 212 ? 13.808  -16.446 -21.567 1.00 38.19 ? 213 GLN A NE2 1 
ATOM   1632 N  N   . LEU A 1 213 ? 11.009  -21.494 -22.053 1.00 26.88 ? 214 LEU A N   1 
ATOM   1633 C  CA  . LEU A 1 213 ? 10.416  -22.814 -22.305 1.00 28.90 ? 214 LEU A CA  1 
ATOM   1634 C  C   . LEU A 1 213 ? 9.876   -23.393 -20.997 1.00 29.89 ? 214 LEU A C   1 
ATOM   1635 O  O   . LEU A 1 213 ? 8.756   -23.905 -20.931 1.00 27.50 ? 214 LEU A O   1 
ATOM   1636 C  CB  . LEU A 1 213 ? 11.457  -23.776 -22.893 1.00 26.52 ? 214 LEU A CB  1 
ATOM   1637 C  CG  . LEU A 1 213 ? 11.974  -23.465 -24.302 1.00 31.16 ? 214 LEU A CG  1 
ATOM   1638 C  CD1 . LEU A 1 213 ? 13.097  -24.403 -24.676 1.00 33.27 ? 214 LEU A CD1 1 
ATOM   1639 C  CD2 . LEU A 1 213 ? 10.852  -23.555 -25.310 1.00 30.83 ? 214 LEU A CD2 1 
ATOM   1640 N  N   . VAL A 1 214 ? 10.696  -23.303 -19.959 1.00 27.71 ? 215 VAL A N   1 
ATOM   1641 C  CA  . VAL A 1 214 ? 10.284  -23.675 -18.611 1.00 26.07 ? 215 VAL A CA  1 
ATOM   1642 C  C   . VAL A 1 214 ? 10.252  -22.421 -17.742 1.00 27.77 ? 215 VAL A C   1 
ATOM   1643 O  O   . VAL A 1 214 ? 11.186  -21.615 -17.774 1.00 28.34 ? 215 VAL A O   1 
ATOM   1644 C  CB  . VAL A 1 214 ? 11.265  -24.676 -18.004 1.00 25.33 ? 215 VAL A CB  1 
ATOM   1645 C  CG1 . VAL A 1 214 ? 10.975  -24.859 -16.507 1.00 25.01 ? 215 VAL A CG1 1 
ATOM   1646 C  CG2 . VAL A 1 214 ? 11.199  -26.012 -18.753 1.00 24.09 ? 215 VAL A CG2 1 
ATOM   1647 N  N   . SER A 1 215 ? 9.187   -22.251 -16.966 1.00 26.41 ? 216 SER A N   1 
ATOM   1648 C  CA  . SER A 1 215 ? 9.039   -21.047 -16.162 1.00 28.31 ? 216 SER A CA  1 
ATOM   1649 C  C   . SER A 1 215 ? 9.226   -21.321 -14.681 1.00 25.60 ? 216 SER A C   1 
ATOM   1650 O  O   . SER A 1 215 ? 8.719   -22.312 -14.172 1.00 23.98 ? 216 SER A O   1 
ATOM   1651 C  CB  . SER A 1 215 ? 7.663   -20.419 -16.381 1.00 27.91 ? 216 SER A CB  1 
ATOM   1652 O  OG  . SER A 1 215 ? 7.445   -19.348 -15.473 1.00 27.38 ? 216 SER A OG  1 
ATOM   1653 N  N   . PRO A 1 216 ? 9.919   -20.411 -13.979 1.00 26.95 ? 217 PRO A N   1 
ATOM   1654 C  CA  . PRO A 1 216 ? 10.068  -20.494 -12.523 1.00 25.07 ? 217 PRO A CA  1 
ATOM   1655 C  C   . PRO A 1 216 ? 8.924   -19.786 -11.769 1.00 23.00 ? 217 PRO A C   1 
ATOM   1656 O  O   . PRO A 1 216 ? 8.981   -19.671 -10.545 1.00 23.19 ? 217 PRO A O   1 
ATOM   1657 C  CB  . PRO A 1 216 ? 11.378  -19.752 -12.287 1.00 24.51 ? 217 PRO A CB  1 
ATOM   1658 C  CG  . PRO A 1 216 ? 11.317  -18.626 -13.318 1.00 28.60 ? 217 PRO A CG  1 
ATOM   1659 C  CD  . PRO A 1 216 ? 10.649  -19.253 -14.542 1.00 28.05 ? 217 PRO A CD  1 
ATOM   1660 N  N   . GLU A 1 217 ? 7.913   -19.315 -12.488 1.00 23.16 ? 218 GLU A N   1 
ATOM   1661 C  CA  . GLU A 1 217 ? 6.862   -18.504 -11.878 1.00 27.34 ? 218 GLU A CA  1 
ATOM   1662 C  C   . GLU A 1 217 ? 5.878   -19.389 -11.119 1.00 22.47 ? 218 GLU A C   1 
ATOM   1663 O  O   . GLU A 1 217 ? 5.333   -20.328 -11.683 1.00 24.23 ? 218 GLU A O   1 
ATOM   1664 C  CB  . GLU A 1 217 ? 6.128   -17.665 -12.933 1.00 27.51 ? 218 GLU A CB  1 
ATOM   1665 C  CG  . GLU A 1 217 ? 5.165   -16.644 -12.332 1.00 29.20 ? 218 GLU A CG  1 
ATOM   1666 C  CD  . GLU A 1 217 ? 4.559   -15.712 -13.367 1.00 32.89 ? 218 GLU A CD  1 
ATOM   1667 O  OE1 . GLU A 1 217 ? 4.387   -16.131 -14.527 1.00 31.94 ? 218 GLU A OE1 1 
ATOM   1668 O  OE2 . GLU A 1 217 ? 4.262   -14.553 -13.018 1.00 34.54 ? 218 GLU A OE2 1 
ATOM   1669 N  N   . PRO A 1 218 ? 5.686   -19.109 -9.819  1.00 22.70 ? 219 PRO A N   1 
ATOM   1670 C  CA  . PRO A 1 218 ? 4.783   -19.916 -8.994  1.00 23.66 ? 219 PRO A CA  1 
ATOM   1671 C  C   . PRO A 1 218 ? 3.339   -19.425 -9.111  1.00 23.79 ? 219 PRO A C   1 
ATOM   1672 O  O   . PRO A 1 218 ? 3.088   -18.279 -9.483  1.00 24.76 ? 219 PRO A O   1 
ATOM   1673 C  CB  . PRO A 1 218 ? 5.305   -19.669 -7.578  1.00 23.25 ? 219 PRO A CB  1 
ATOM   1674 C  CG  . PRO A 1 218 ? 5.799   -18.232 -7.626  1.00 23.28 ? 219 PRO A CG  1 
ATOM   1675 C  CD  . PRO A 1 218 ? 6.350   -18.042 -9.040  1.00 23.00 ? 219 PRO A CD  1 
ATOM   1676 N  N   . GLU A 1 219 ? 2.395   -20.303 -8.809  1.00 23.99 ? 220 GLU A N   1 
ATOM   1677 C  CA  . GLU A 1 219 ? 1.010   -19.895 -8.694  1.00 23.91 ? 220 GLU A CA  1 
ATOM   1678 C  C   . GLU A 1 219 ? 0.692   -19.846 -7.205  1.00 25.43 ? 220 GLU A C   1 
ATOM   1679 O  O   . GLU A 1 219 ? 0.982   -20.799 -6.475  1.00 22.75 ? 220 GLU A O   1 
ATOM   1680 C  CB  . GLU A 1 219 ? 0.108   -20.899 -9.417  1.00 27.37 ? 220 GLU A CB  1 
ATOM   1681 C  CG  . GLU A 1 219 ? -1.351  -20.511 -9.486  1.00 32.43 ? 220 GLU A CG  1 
ATOM   1682 C  CD  . GLU A 1 219 ? -2.143  -21.390 -10.456 1.00 35.35 ? 220 GLU A CD  1 
ATOM   1683 O  OE1 . GLU A 1 219 ? -1.532  -21.956 -11.394 1.00 34.69 ? 220 GLU A OE1 1 
ATOM   1684 O  OE2 . GLU A 1 219 ? -3.376  -21.526 -10.270 1.00 36.43 ? 220 GLU A OE2 1 
ATOM   1685 N  N   . VAL A 1 220 ? 0.114   -18.741 -6.750  1.00 22.87 ? 221 VAL A N   1 
ATOM   1686 C  CA  . VAL A 1 220 ? -0.143  -18.556 -5.322  1.00 22.32 ? 221 VAL A CA  1 
ATOM   1687 C  C   . VAL A 1 220 ? -1.623  -18.319 -5.063  1.00 23.34 ? 221 VAL A C   1 
ATOM   1688 O  O   . VAL A 1 220 ? -2.272  -17.562 -5.783  1.00 23.09 ? 221 VAL A O   1 
ATOM   1689 C  CB  . VAL A 1 220 ? 0.682   -17.393 -4.739  1.00 25.73 ? 221 VAL A CB  1 
ATOM   1690 C  CG1 . VAL A 1 220 ? 0.380   -17.225 -3.269  1.00 23.93 ? 221 VAL A CG1 1 
ATOM   1691 C  CG2 . VAL A 1 220 ? 2.182   -17.631 -4.976  1.00 23.93 ? 221 VAL A CG2 1 
ATOM   1692 N  N   . HIS A 1 221 ? -2.155  -18.984 -4.043  1.00 21.75 ? 222 HIS A N   1 
ATOM   1693 C  CA  . HIS A 1 221 ? -3.561  -18.855 -3.689  1.00 24.89 ? 222 HIS A CA  1 
ATOM   1694 C  C   . HIS A 1 221 ? -3.734  -18.646 -2.200  1.00 25.84 ? 222 HIS A C   1 
ATOM   1695 O  O   . HIS A 1 221 ? -3.285  -19.460 -1.380  1.00 23.05 ? 222 HIS A O   1 
ATOM   1696 C  CB  . HIS A 1 221 ? -4.374  -20.064 -4.157  1.00 23.40 ? 222 HIS A CB  1 
ATOM   1697 C  CG  . HIS A 1 221 ? -4.571  -20.097 -5.639  1.00 29.01 ? 222 HIS A CG  1 
ATOM   1698 N  ND1 . HIS A 1 221 ? -3.796  -20.870 -6.476  1.00 27.68 ? 222 HIS A ND1 1 
ATOM   1699 C  CD2 . HIS A 1 221 ? -5.423  -19.410 -6.438  1.00 26.06 ? 222 HIS A CD2 1 
ATOM   1700 C  CE1 . HIS A 1 221 ? -4.174  -20.672 -7.727  1.00 29.46 ? 222 HIS A CE1 1 
ATOM   1701 N  NE2 . HIS A 1 221 ? -5.156  -19.790 -7.732  1.00 31.72 ? 222 HIS A NE2 1 
ATOM   1702 N  N   . ASP A 1 222 ? -4.376  -17.532 -1.871  1.00 27.21 ? 223 ASP A N   1 
ATOM   1703 C  CA  . ASP A 1 222 ? -4.642  -17.155 -0.493  1.00 27.44 ? 223 ASP A CA  1 
ATOM   1704 C  C   . ASP A 1 222 ? -5.977  -17.749 -0.063  1.00 30.27 ? 223 ASP A C   1 
ATOM   1705 O  O   . ASP A 1 222 ? -7.022  -17.429 -0.639  1.00 28.76 ? 223 ASP A O   1 
ATOM   1706 C  CB  . ASP A 1 222 ? -4.679  -15.623 -0.377  1.00 31.84 ? 223 ASP A CB  1 
ATOM   1707 C  CG  . ASP A 1 222 ? -5.374  -15.146 0.881   1.00 36.33 ? 223 ASP A CG  1 
ATOM   1708 O  OD1 . ASP A 1 222 ? -5.337  -15.868 1.901   1.00 36.58 ? 223 ASP A OD1 1 
ATOM   1709 O  OD2 . ASP A 1 222 ? -5.955  -14.043 0.845   1.00 37.69 ? 223 ASP A OD2 1 
ATOM   1710 N  N   . ILE A 1 223 ? -5.940  -18.613 0.946   1.00 25.81 ? 224 ILE A N   1 
ATOM   1711 C  CA  . ILE A 1 223 ? -7.168  -19.168 1.513   1.00 26.67 ? 224 ILE A CA  1 
ATOM   1712 C  C   . ILE A 1 223 ? -7.302  -18.687 2.951   1.00 29.21 ? 224 ILE A C   1 
ATOM   1713 O  O   . ILE A 1 223 ? -6.441  -18.975 3.782   1.00 27.12 ? 224 ILE A O   1 
ATOM   1714 C  CB  . ILE A 1 223 ? -7.135  -20.702 1.506   1.00 27.24 ? 224 ILE A CB  1 
ATOM   1715 C  CG1 . ILE A 1 223 ? -6.836  -21.212 0.097   1.00 28.07 ? 224 ILE A CG1 1 
ATOM   1716 C  CG2 . ILE A 1 223 ? -8.460  -21.285 2.036   1.00 27.88 ? 224 ILE A CG2 1 
ATOM   1717 C  CD1 . ILE A 1 223 ? -6.772  -22.725 0.002   1.00 28.73 ? 224 ILE A CD1 1 
ATOM   1718 N  N   . GLU A 1 224 ? -8.363  -17.936 3.244   1.00 25.61 ? 225 GLU A N   1 
ATOM   1719 C  CA  . GLU A 1 224 ? -8.586  -17.479 4.611   1.00 28.89 ? 225 GLU A CA  1 
ATOM   1720 C  C   . GLU A 1 224 ? -8.804  -18.695 5.496   1.00 24.06 ? 225 GLU A C   1 
ATOM   1721 O  O   . GLU A 1 224 ? -9.569  -19.602 5.153   1.00 27.56 ? 225 GLU A O   1 
ATOM   1722 C  CB  . GLU A 1 224 ? -9.794  -16.527 4.707   1.00 28.33 ? 225 GLU A CB  1 
ATOM   1723 C  CG  . GLU A 1 224 ? -9.639  -15.189 3.948   1.00 33.46 ? 225 GLU A CG  1 
ATOM   1724 C  CD  . GLU A 1 224 ? -10.805 -14.237 4.223   1.00 36.70 ? 225 GLU A CD  1 
ATOM   1725 O  OE1 . GLU A 1 224 ? -11.706 -14.650 4.987   1.00 33.04 ? 225 GLU A OE1 1 
ATOM   1726 O  OE2 . GLU A 1 224 ? -10.823 -13.095 3.691   1.00 34.03 ? 225 GLU A OE2 1 
ATOM   1727 N  N   . ARG A 1 225 ? -8.125  -18.711 6.632   1.00 27.30 ? 226 ARG A N   1 
ATOM   1728 C  CA  . ARG A 1 225 ? -8.206  -19.838 7.548   1.00 27.94 ? 226 ARG A CA  1 
ATOM   1729 C  C   . ARG A 1 225 ? -9.566  -19.902 8.233   1.00 31.23 ? 226 ARG A C   1 
ATOM   1730 O  O   . ARG A 1 225 ? -10.243 -18.882 8.412   1.00 28.06 ? 226 ARG A O   1 
ATOM   1731 C  CB  . ARG A 1 225 ? -7.086  -19.758 8.588   1.00 29.33 ? 226 ARG A CB  1 
ATOM   1732 C  CG  . ARG A 1 225 ? -5.722  -20.084 8.015   1.00 25.61 ? 226 ARG A CG  1 
ATOM   1733 C  CD  . ARG A 1 225 ? -4.644  -20.039 9.064   1.00 29.44 ? 226 ARG A CD  1 
ATOM   1734 N  NE  . ARG A 1 225 ? -4.830  -21.062 10.093  1.00 28.08 ? 226 ARG A NE  1 
ATOM   1735 C  CZ  . ARG A 1 225 ? -3.988  -21.251 11.104  1.00 25.98 ? 226 ARG A CZ  1 
ATOM   1736 N  NH1 . ARG A 1 225 ? -2.911  -20.491 11.218  1.00 25.37 ? 226 ARG A NH1 1 
ATOM   1737 N  NH2 . ARG A 1 225 ? -4.224  -22.202 11.998  1.00 29.79 ? 226 ARG A NH2 1 
ATOM   1738 N  N   . SER A 1 226 ? -9.968  -21.113 8.584   1.00 29.49 ? 227 SER A N   1 
ATOM   1739 C  CA  . SER A 1 226 ? -11.189 -21.341 9.333   1.00 30.09 ? 227 SER A CA  1 
ATOM   1740 C  C   . SER A 1 226 ? -10.842 -22.207 10.535  1.00 32.87 ? 227 SER A C   1 
ATOM   1741 O  O   . SER A 1 226 ? -10.622 -23.413 10.400  1.00 28.55 ? 227 SER A O   1 
ATOM   1742 C  CB  . SER A 1 226 ? -12.226 -22.051 8.465   1.00 32.24 ? 227 SER A CB  1 
ATOM   1743 O  OG  . SER A 1 226 ? -13.245 -22.626 9.270   1.00 37.07 ? 227 SER A OG  1 
ATOM   1744 N  N   . GLU A 1 227 ? -10.755 -21.592 11.709  1.00 31.51 ? 228 GLU A N   1 
ATOM   1745 C  CA  . GLU A 1 227 ? -10.377 -22.337 12.906  1.00 33.77 ? 228 GLU A CA  1 
ATOM   1746 C  C   . GLU A 1 227 ? -11.325 -23.518 13.146  1.00 33.65 ? 228 GLU A C   1 
ATOM   1747 O  O   . GLU A 1 227 ? -10.888 -24.598 13.548  1.00 31.71 ? 228 GLU A O   1 
ATOM   1748 C  CB  . GLU A 1 227 ? -10.310 -21.408 14.126  1.00 39.28 ? 228 GLU A CB  1 
ATOM   1749 C  CG  . GLU A 1 227 ? -10.081 -22.107 15.472  1.00 45.04 ? 228 GLU A CG  1 
ATOM   1750 C  CD  . GLU A 1 227 ? -8.665  -22.663 15.657  1.00 46.48 ? 228 GLU A CD  1 
ATOM   1751 O  OE1 . GLU A 1 227 ? -7.758  -22.323 14.859  1.00 45.22 ? 228 GLU A OE1 1 
ATOM   1752 O  OE2 . GLU A 1 227 ? -8.462  -23.450 16.614  1.00 46.83 ? 228 GLU A OE2 1 
ATOM   1753 N  N   . GLU A 1 228 ? -12.615 -23.325 12.872  1.00 32.33 ? 229 GLU A N   1 
ATOM   1754 C  CA  . GLU A 1 228 ? -13.605 -24.382 13.103  1.00 33.84 ? 229 GLU A CA  1 
ATOM   1755 C  C   . GLU A 1 228 ? -13.555 -25.535 12.104  1.00 31.50 ? 229 GLU A C   1 
ATOM   1756 O  O   . GLU A 1 228 ? -13.780 -26.693 12.469  1.00 28.73 ? 229 GLU A O   1 
ATOM   1757 C  CB  . GLU A 1 228 ? -15.034 -23.813 13.144  1.00 37.35 ? 229 GLU A CB  1 
ATOM   1758 C  CG  . GLU A 1 228 ? -15.298 -22.942 14.375  1.00 47.92 ? 229 GLU A CG  1 
ATOM   1759 C  CD  . GLU A 1 228 ? -14.749 -23.568 15.658  1.00 52.37 ? 229 GLU A CD  1 
ATOM   1760 O  OE1 . GLU A 1 228 ? -15.307 -24.598 16.113  1.00 54.51 ? 229 GLU A OE1 1 
ATOM   1761 O  OE2 . GLU A 1 228 ? -13.748 -23.037 16.204  1.00 53.22 ? 229 GLU A OE2 1 
ATOM   1762 N  N   . ASP A 1 229 ? -13.279 -25.218 10.846  1.00 29.25 ? 230 ASP A N   1 
ATOM   1763 C  CA  . ASP A 1 229 ? -13.483 -26.181 9.772   1.00 30.53 ? 230 ASP A CA  1 
ATOM   1764 C  C   . ASP A 1 229 ? -12.189 -26.732 9.134   1.00 27.13 ? 230 ASP A C   1 
ATOM   1765 O  O   . ASP A 1 229 ? -12.222 -27.816 8.555   1.00 26.66 ? 230 ASP A O   1 
ATOM   1766 C  CB  . ASP A 1 229 ? -14.394 -25.591 8.686   1.00 30.23 ? 230 ASP A CB  1 
ATOM   1767 C  CG  . ASP A 1 229 ? -15.835 -25.414 9.151   1.00 40.81 ? 230 ASP A CG  1 
ATOM   1768 O  OD1 . ASP A 1 229 ? -16.269 -26.124 10.089  1.00 39.56 ? 230 ASP A OD1 1 
ATOM   1769 O  OD2 . ASP A 1 229 ? -16.539 -24.563 8.565   1.00 43.88 ? 230 ASP A OD2 1 
ATOM   1770 N  N   . ASP A 1 230 ? -11.078 -26.002 9.237   1.00 27.02 ? 231 ASP A N   1 
ATOM   1771 C  CA  . ASP A 1 230 ? -9.801  -26.479 8.670   1.00 26.57 ? 231 ASP A CA  1 
ATOM   1772 C  C   . ASP A 1 230 ? -9.344  -27.773 9.338   1.00 26.42 ? 231 ASP A C   1 
ATOM   1773 O  O   . ASP A 1 230 ? -9.216  -27.833 10.556  1.00 25.40 ? 231 ASP A O   1 
ATOM   1774 C  CB  . ASP A 1 230 ? -8.697  -25.419 8.793   1.00 25.79 ? 231 ASP A CB  1 
ATOM   1775 C  CG  . ASP A 1 230 ? -8.745  -24.383 7.670   1.00 27.92 ? 231 ASP A CG  1 
ATOM   1776 O  OD1 . ASP A 1 230 ? -9.348  -24.669 6.612   1.00 28.25 ? 231 ASP A OD1 1 
ATOM   1777 O  OD2 . ASP A 1 230 ? -8.179  -23.285 7.855   1.00 28.59 ? 231 ASP A OD2 1 
ATOM   1778 N  N   . GLN A 1 231 ? -9.087  -28.811 8.550   1.00 21.89 ? 232 GLN A N   1 
ATOM   1779 C  CA  . GLN A 1 231 ? -8.690  -30.082 9.146   1.00 23.08 ? 232 GLN A CA  1 
ATOM   1780 C  C   . GLN A 1 231 ? -7.224  -30.438 8.931   1.00 21.81 ? 232 GLN A C   1 
ATOM   1781 O  O   . GLN A 1 231 ? -6.480  -30.596 9.893   1.00 21.94 ? 232 GLN A O   1 
ATOM   1782 C  CB  . GLN A 1 231 ? -9.616  -31.201 8.673   1.00 20.72 ? 232 GLN A CB  1 
ATOM   1783 C  CG  . GLN A 1 231 ? -11.055 -30.948 9.096   1.00 23.94 ? 232 GLN A CG  1 
ATOM   1784 C  CD  . GLN A 1 231 ? -11.898 -32.185 9.040   1.00 27.25 ? 232 GLN A CD  1 
ATOM   1785 O  OE1 . GLN A 1 231 ? -12.292 -32.630 7.963   1.00 27.65 ? 232 GLN A OE1 1 
ATOM   1786 N  NE2 . GLN A 1 231 ? -12.174 -32.766 10.206  1.00 32.91 ? 232 GLN A NE2 1 
ATOM   1787 N  N   . PHE A 1 232 ? -6.807  -30.581 7.676   1.00 19.24 ? 233 PHE A N   1 
ATOM   1788 C  CA  . PHE A 1 232 ? -5.397  -30.828 7.420   1.00 19.03 ? 233 PHE A CA  1 
ATOM   1789 C  C   . PHE A 1 232 ? -5.020  -30.467 6.000   1.00 19.41 ? 233 PHE A C   1 
ATOM   1790 O  O   . PHE A 1 232 ? -5.885  -30.327 5.129   1.00 17.84 ? 233 PHE A O   1 
ATOM   1791 C  CB  . PHE A 1 232 ? -5.028  -32.298 7.699   1.00 17.02 ? 233 PHE A CB  1 
ATOM   1792 C  CG  . PHE A 1 232 ? -5.844  -33.289 6.919   1.00 19.38 ? 233 PHE A CG  1 
ATOM   1793 C  CD1 . PHE A 1 232 ? -5.524  -33.604 5.611   1.00 21.21 ? 233 PHE A CD1 1 
ATOM   1794 C  CD2 . PHE A 1 232 ? -6.950  -33.902 7.501   1.00 22.17 ? 233 PHE A CD2 1 
ATOM   1795 C  CE1 . PHE A 1 232 ? -6.303  -34.532 4.890   1.00 21.09 ? 233 PHE A CE1 1 
ATOM   1796 C  CE2 . PHE A 1 232 ? -7.720  -34.828 6.799   1.00 22.24 ? 233 PHE A CE2 1 
ATOM   1797 C  CZ  . PHE A 1 232 ? -7.406  -35.137 5.494   1.00 22.00 ? 233 PHE A CZ  1 
ATOM   1798 N  N   . ILE A 1 233 ? -3.717  -30.346 5.791   1.00 18.77 ? 234 ILE A N   1 
ATOM   1799 C  CA  . ILE A 1 233 ? -3.139  -30.063 4.480   1.00 19.44 ? 234 ILE A CA  1 
ATOM   1800 C  C   . ILE A 1 233 ? -2.255  -31.235 4.121   1.00 18.35 ? 234 ILE A C   1 
ATOM   1801 O  O   . ILE A 1 233 ? -1.549  -31.754 4.995   1.00 19.97 ? 234 ILE A O   1 
ATOM   1802 C  CB  . ILE A 1 233 ? -2.286  -28.782 4.549   1.00 16.97 ? 234 ILE A CB  1 
ATOM   1803 C  CG1 . ILE A 1 233 ? -3.213  -27.563 4.677   1.00 17.59 ? 234 ILE A CG1 1 
ATOM   1804 C  CG2 . ILE A 1 233 ? -1.327  -28.654 3.326   1.00 17.81 ? 234 ILE A CG2 1 
ATOM   1805 C  CD1 . ILE A 1 233 ? -2.490  -26.276 5.064   1.00 20.59 ? 234 ILE A CD1 1 
ATOM   1806 N  N   . ILE A 1 234 ? -2.285  -31.655 2.854   1.00 17.17 ? 235 ILE A N   1 
ATOM   1807 C  CA  . ILE A 1 234 ? -1.332  -32.653 2.353   1.00 16.77 ? 235 ILE A CA  1 
ATOM   1808 C  C   . ILE A 1 234 ? -0.469  -32.039 1.255   1.00 17.23 ? 235 ILE A C   1 
ATOM   1809 O  O   . ILE A 1 234 ? -0.998  -31.441 0.317   1.00 19.75 ? 235 ILE A O   1 
ATOM   1810 C  CB  . ILE A 1 234 ? -2.037  -33.884 1.748   1.00 18.66 ? 235 ILE A CB  1 
ATOM   1811 C  CG1 . ILE A 1 234 ? -2.998  -34.513 2.759   1.00 21.66 ? 235 ILE A CG1 1 
ATOM   1812 C  CG2 . ILE A 1 234 ? -0.998  -34.921 1.251   1.00 17.66 ? 235 ILE A CG2 1 
ATOM   1813 C  CD1 . ILE A 1 234 ? -3.864  -35.640 2.178   1.00 22.28 ? 235 ILE A CD1 1 
ATOM   1814 N  N   . LEU A 1 235 ? 0.851   -32.160 1.390   1.00 16.76 ? 236 LEU A N   1 
ATOM   1815 C  CA  . LEU A 1 235 ? 1.792   -31.804 0.322   1.00 17.77 ? 236 LEU A CA  1 
ATOM   1816 C  C   . LEU A 1 235 ? 2.517   -33.070 -0.089  1.00 18.76 ? 236 LEU A C   1 
ATOM   1817 O  O   . LEU A 1 235 ? 2.996   -33.805 0.769   1.00 19.73 ? 236 LEU A O   1 
ATOM   1818 C  CB  . LEU A 1 235 ? 2.841   -30.803 0.825   1.00 18.58 ? 236 LEU A CB  1 
ATOM   1819 C  CG  . LEU A 1 235 ? 2.326   -29.493 1.440   1.00 20.23 ? 236 LEU A CG  1 
ATOM   1820 C  CD1 . LEU A 1 235 ? 3.506   -28.652 1.953   1.00 18.37 ? 236 LEU A CD1 1 
ATOM   1821 C  CD2 . LEU A 1 235 ? 1.493   -28.679 0.450   1.00 18.00 ? 236 LEU A CD2 1 
ATOM   1822 N  N   . ALA A 1 236 ? 2.612   -33.332 -1.387  1.00 19.72 ? 237 ALA A N   1 
ATOM   1823 C  CA  . ALA A 1 236 ? 3.321   -34.528 -1.842  1.00 20.35 ? 237 ALA A CA  1 
ATOM   1824 C  C   . ALA A 1 236 ? 3.814   -34.386 -3.280  1.00 21.90 ? 237 ALA A C   1 
ATOM   1825 O  O   . ALA A 1 236 ? 3.282   -33.595 -4.057  1.00 18.50 ? 237 ALA A O   1 
ATOM   1826 C  CB  . ALA A 1 236 ? 2.423   -35.794 -1.692  1.00 19.26 ? 237 ALA A CB  1 
ATOM   1827 N  N   . CYS A 1 237 ? 4.841   -35.154 -3.629  1.00 20.51 ? 238 CYS A N   1 
ATOM   1828 C  CA  . CYS A 1 237 ? 5.322   -35.182 -5.008  1.00 21.89 ? 238 CYS A CA  1 
ATOM   1829 C  C   . CYS A 1 237 ? 4.437   -36.110 -5.847  1.00 20.77 ? 238 CYS A C   1 
ATOM   1830 O  O   . CYS A 1 237 ? 3.580   -36.836 -5.311  1.00 19.50 ? 238 CYS A O   1 
ATOM   1831 C  CB  . CYS A 1 237 ? 6.773   -35.656 -5.039  1.00 20.64 ? 238 CYS A CB  1 
ATOM   1832 S  SG  . CYS A 1 237 ? 6.896   -37.378 -4.544  1.00 25.92 ? 238 CYS A SG  1 
ATOM   1833 N  N   . ASP A 1 238 ? 4.619   -36.071 -7.163  1.00 18.52 ? 239 ASP A N   1 
ATOM   1834 C  CA  . ASP A 1 238 ? 3.839   -36.919 -8.061  1.00 20.50 ? 239 ASP A CA  1 
ATOM   1835 C  C   . ASP A 1 238 ? 4.012   -38.441 -7.808  1.00 21.38 ? 239 ASP A C   1 
ATOM   1836 O  O   . ASP A 1 238 ? 3.220   -39.253 -8.294  1.00 21.84 ? 239 ASP A O   1 
ATOM   1837 C  CB  . ASP A 1 238 ? 4.130   -36.560 -9.533  1.00 22.11 ? 239 ASP A CB  1 
ATOM   1838 C  CG  . ASP A 1 238 ? 5.575   -36.830 -9.929  1.00 25.62 ? 239 ASP A CG  1 
ATOM   1839 O  OD1 . ASP A 1 238 ? 6.376   -37.126 -9.036  1.00 21.38 ? 239 ASP A OD1 1 
ATOM   1840 O  OD2 . ASP A 1 238 ? 5.905   -36.753 -11.124 1.00 25.34 ? 239 ASP A OD2 1 
ATOM   1841 N  N   . GLY A 1 239 ? 5.013   -38.828 -7.023  1.00 21.07 ? 240 GLY A N   1 
ATOM   1842 C  CA  . GLY A 1 239 ? 5.172   -40.234 -6.669  1.00 22.69 ? 240 GLY A CA  1 
ATOM   1843 C  C   . GLY A 1 239 ? 3.946   -40.725 -5.902  1.00 22.27 ? 240 GLY A C   1 
ATOM   1844 O  O   . GLY A 1 239 ? 3.578   -41.912 -5.912  1.00 20.57 ? 240 GLY A O   1 
ATOM   1845 N  N   . ILE A 1 240 ? 3.304   -39.787 -5.226  1.00 19.49 ? 241 ILE A N   1 
ATOM   1846 C  CA  . ILE A 1 240 ? 2.077   -40.079 -4.497  1.00 18.35 ? 241 ILE A CA  1 
ATOM   1847 C  C   . ILE A 1 240 ? 0.880   -39.879 -5.424  1.00 19.98 ? 241 ILE A C   1 
ATOM   1848 O  O   . ILE A 1 240 ? 0.063   -40.792 -5.606  1.00 20.63 ? 241 ILE A O   1 
ATOM   1849 C  CB  . ILE A 1 240 ? 1.939   -39.153 -3.271  1.00 21.27 ? 241 ILE A CB  1 
ATOM   1850 C  CG1 . ILE A 1 240 ? 3.040   -39.480 -2.249  1.00 22.27 ? 241 ILE A CG1 1 
ATOM   1851 C  CG2 . ILE A 1 240 ? 0.540   -39.246 -2.667  1.00 22.26 ? 241 ILE A CG2 1 
ATOM   1852 C  CD1 . ILE A 1 240 ? 3.028   -40.930 -1.816  1.00 24.42 ? 241 ILE A CD1 1 
ATOM   1853 N  N   . TRP A 1 241 ? 0.779   -38.687 -6.007  1.00 18.06 ? 242 TRP A N   1 
ATOM   1854 C  CA  . TRP A 1 241 ? -0.394  -38.335 -6.804  1.00 21.08 ? 242 TRP A CA  1 
ATOM   1855 C  C   . TRP A 1 241 ? -0.572  -39.174 -8.075  1.00 21.64 ? 242 TRP A C   1 
ATOM   1856 O  O   . TRP A 1 241 ? -1.692  -39.348 -8.546  1.00 23.90 ? 242 TRP A O   1 
ATOM   1857 C  CB  . TRP A 1 241 ? -0.394  -36.843 -7.147  1.00 22.50 ? 242 TRP A CB  1 
ATOM   1858 C  CG  . TRP A 1 241 ? -0.313  -35.940 -5.919  1.00 21.04 ? 242 TRP A CG  1 
ATOM   1859 C  CD1 . TRP A 1 241 ? 0.735   -35.148 -5.556  1.00 19.50 ? 242 TRP A CD1 1 
ATOM   1860 C  CD2 . TRP A 1 241 ? -1.320  -35.763 -4.909  1.00 19.87 ? 242 TRP A CD2 1 
ATOM   1861 N  NE1 . TRP A 1 241 ? 0.445   -34.479 -4.386  1.00 19.68 ? 242 TRP A NE1 1 
ATOM   1862 C  CE2 . TRP A 1 241 ? -0.808  -34.847 -3.964  1.00 20.21 ? 242 TRP A CE2 1 
ATOM   1863 C  CE3 . TRP A 1 241 ? -2.598  -36.302 -4.703  1.00 22.60 ? 242 TRP A CE3 1 
ATOM   1864 C  CZ2 . TRP A 1 241 ? -1.533  -34.442 -2.845  1.00 21.07 ? 242 TRP A CZ2 1 
ATOM   1865 C  CZ3 . TRP A 1 241 ? -3.319  -35.900 -3.580  1.00 21.43 ? 242 TRP A CZ3 1 
ATOM   1866 C  CH2 . TRP A 1 241 ? -2.787  -34.978 -2.673  1.00 21.72 ? 242 TRP A CH2 1 
ATOM   1867 N  N   . ASP A 1 242 ? 0.519   -39.693 -8.627  1.00 22.98 ? 243 ASP A N   1 
ATOM   1868 C  CA  . ASP A 1 242 ? 0.421   -40.588 -9.791  1.00 26.25 ? 243 ASP A CA  1 
ATOM   1869 C  C   . ASP A 1 242 ? -0.525  -41.771 -9.562  1.00 26.92 ? 243 ASP A C   1 
ATOM   1870 O  O   . ASP A 1 242 ? -1.066  -42.333 -10.515 1.00 23.55 ? 243 ASP A O   1 
ATOM   1871 C  CB  . ASP A 1 242 ? 1.797   -41.149 -10.185 1.00 24.67 ? 243 ASP A CB  1 
ATOM   1872 C  CG  . ASP A 1 242 ? 2.637   -40.157 -10.985 1.00 29.50 ? 243 ASP A CG  1 
ATOM   1873 O  OD1 . ASP A 1 242 ? 2.086   -39.142 -11.443 1.00 28.06 ? 243 ASP A OD1 1 
ATOM   1874 O  OD2 . ASP A 1 242 ? 3.852   -40.408 -11.164 1.00 34.14 ? 243 ASP A OD2 1 
ATOM   1875 N  N   . VAL A 1 243 ? -0.700  -42.170 -8.307  1.00 21.56 ? 244 VAL A N   1 
ATOM   1876 C  CA  . VAL A 1 243 ? -1.440  -43.395 -8.027  1.00 22.77 ? 244 VAL A CA  1 
ATOM   1877 C  C   . VAL A 1 243 ? -2.638  -43.240 -7.083  1.00 23.80 ? 244 VAL A C   1 
ATOM   1878 O  O   . VAL A 1 243 ? -3.410  -44.185 -6.880  1.00 24.53 ? 244 VAL A O   1 
ATOM   1879 C  CB  . VAL A 1 243 ? -0.478  -44.506 -7.537  1.00 23.53 ? 244 VAL A CB  1 
ATOM   1880 C  CG1 . VAL A 1 243 ? 0.610   -44.813 -8.582  1.00 22.46 ? 244 VAL A CG1 1 
ATOM   1881 C  CG2 . VAL A 1 243 ? 0.113   -44.121 -6.230  1.00 35.11 ? 244 VAL A CG2 1 
ATOM   1882 N  N   . MET A 1 244 ? -2.798  -42.048 -6.515  1.00 23.20 ? 245 MET A N   1 
ATOM   1883 C  CA  . MET A 1 244 ? -3.958  -41.743 -5.680  1.00 21.81 ? 245 MET A CA  1 
ATOM   1884 C  C   . MET A 1 244 ? -4.495  -40.364 -6.035  1.00 23.17 ? 245 MET A C   1 
ATOM   1885 O  O   . MET A 1 244 ? -3.724  -39.405 -6.119  1.00 22.76 ? 245 MET A O   1 
ATOM   1886 C  CB  . MET A 1 244 ? -3.618  -41.820 -4.184  1.00 21.91 ? 245 MET A CB  1 
ATOM   1887 C  CG  . MET A 1 244 ? -3.329  -43.251 -3.690  1.00 24.73 ? 245 MET A CG  1 
ATOM   1888 S  SD  . MET A 1 244 ? -3.219  -43.389 -1.883  1.00 24.02 ? 245 MET A SD  1 
ATOM   1889 C  CE  . MET A 1 244 ? -4.945  -43.163 -1.395  1.00 25.20 ? 245 MET A CE  1 
ATOM   1890 N  N   . GLY A 1 245 ? -5.806  -40.281 -6.248  1.00 23.78 ? 246 GLY A N   1 
ATOM   1891 C  CA  . GLY A 1 245 ? -6.463  -39.018 -6.565  1.00 24.20 ? 246 GLY A CA  1 
ATOM   1892 C  C   . GLY A 1 245 ? -6.699  -38.174 -5.322  1.00 23.64 ? 246 GLY A C   1 
ATOM   1893 O  O   . GLY A 1 245 ? -6.508  -38.649 -4.198  1.00 21.84 ? 246 GLY A O   1 
ATOM   1894 N  N   . ASN A 1 246 ? -7.137  -36.932 -5.520  1.00 21.12 ? 247 ASN A N   1 
ATOM   1895 C  CA  . ASN A 1 246 ? -7.304  -35.996 -4.410  1.00 20.66 ? 247 ASN A CA  1 
ATOM   1896 C  C   . ASN A 1 246 ? -8.286  -36.508 -3.367  1.00 21.72 ? 247 ASN A C   1 
ATOM   1897 O  O   . ASN A 1 246 ? -7.993  -36.520 -2.166  1.00 19.07 ? 247 ASN A O   1 
ATOM   1898 C  CB  . ASN A 1 246 ? -7.785  -34.641 -4.918  1.00 21.48 ? 247 ASN A CB  1 
ATOM   1899 C  CG  . ASN A 1 246 ? -6.781  -33.965 -5.820  1.00 25.55 ? 247 ASN A CG  1 
ATOM   1900 O  OD1 . ASN A 1 246 ? -5.576  -34.146 -5.669  1.00 23.29 ? 247 ASN A OD1 1 
ATOM   1901 N  ND2 . ASN A 1 246 ? -7.276  -33.178 -6.772  1.00 27.63 ? 247 ASN A ND2 1 
ATOM   1902 N  N   . GLU A 1 247 ? -9.462  -36.922 -3.823  1.00 23.50 ? 248 GLU A N   1 
ATOM   1903 C  CA  . GLU A 1 247 ? -10.487 -37.355 -2.885  1.00 27.80 ? 248 GLU A CA  1 
ATOM   1904 C  C   . GLU A 1 247 ? -10.124 -38.686 -2.209  1.00 27.02 ? 248 GLU A C   1 
ATOM   1905 O  O   . GLU A 1 247 ? -10.352 -38.854 -1.013  1.00 27.76 ? 248 GLU A O   1 
ATOM   1906 C  CB  . GLU A 1 247 ? -11.852 -37.436 -3.575  1.00 29.70 ? 248 GLU A CB  1 
ATOM   1907 C  CG  . GLU A 1 247 ? -13.014 -37.487 -2.586  1.00 43.91 ? 248 GLU A CG  1 
ATOM   1908 C  CD  . GLU A 1 247 ? -12.989 -36.324 -1.590  1.00 46.65 ? 248 GLU A CD  1 
ATOM   1909 O  OE1 . GLU A 1 247 ? -13.199 -35.170 -2.033  1.00 52.73 ? 248 GLU A OE1 1 
ATOM   1910 O  OE2 . GLU A 1 247 ? -12.753 -36.559 -0.372  1.00 44.46 ? 248 GLU A OE2 1 
ATOM   1911 N  N   . GLU A 1 248 ? -9.552  -39.614 -2.973  1.00 25.41 ? 249 GLU A N   1 
ATOM   1912 C  CA  . GLU A 1 248 ? -9.065  -40.889 -2.420  1.00 27.25 ? 249 GLU A CA  1 
ATOM   1913 C  C   . GLU A 1 248 ? -8.086  -40.674 -1.268  1.00 24.50 ? 249 GLU A C   1 
ATOM   1914 O  O   . GLU A 1 248 ? -8.212  -41.275 -0.193  1.00 23.10 ? 249 GLU A O   1 
ATOM   1915 C  CB  . GLU A 1 248 ? -8.338  -41.711 -3.487  1.00 25.92 ? 249 GLU A CB  1 
ATOM   1916 C  CG  . GLU A 1 248 ? -9.200  -42.323 -4.567  1.00 29.90 ? 249 GLU A CG  1 
ATOM   1917 C  CD  . GLU A 1 248 ? -8.400  -43.271 -5.457  1.00 37.56 ? 249 GLU A CD  1 
ATOM   1918 O  OE1 . GLU A 1 248 ? -7.360  -42.851 -6.017  1.00 30.62 ? 249 GLU A OE1 1 
ATOM   1919 O  OE2 . GLU A 1 248 ? -8.803  -44.448 -5.580  1.00 50.60 ? 249 GLU A OE2 1 
ATOM   1920 N  N   . LEU A 1 249 ? -7.086  -39.834 -1.502  1.00 20.02 ? 250 LEU A N   1 
ATOM   1921 C  CA  . LEU A 1 249 ? -6.034  -39.646 -0.512  1.00 19.82 ? 250 LEU A CA  1 
ATOM   1922 C  C   . LEU A 1 249 ? -6.579  -38.895 0.690   1.00 21.35 ? 250 LEU A C   1 
ATOM   1923 O  O   . LEU A 1 249 ? -6.241  -39.200 1.830   1.00 19.50 ? 250 LEU A O   1 
ATOM   1924 C  CB  . LEU A 1 249 ? -4.845  -38.897 -1.113  1.00 19.45 ? 250 LEU A CB  1 
ATOM   1925 C  CG  . LEU A 1 249 ? -3.641  -38.785 -0.178  1.00 21.89 ? 250 LEU A CG  1 
ATOM   1926 C  CD1 . LEU A 1 249 ? -3.213  -40.193 0.279   1.00 20.21 ? 250 LEU A CD1 1 
ATOM   1927 C  CD2 . LEU A 1 249 ? -2.485  -38.057 -0.840  1.00 20.26 ? 250 LEU A CD2 1 
ATOM   1928 N  N   . CYS A 1 250 ? -7.418  -37.896 0.431   1.00 24.11 ? 251 CYS A N   1 
ATOM   1929 C  CA  . CYS A 1 250 ? -8.077  -37.182 1.517   1.00 22.54 ? 251 CYS A CA  1 
ATOM   1930 C  C   . CYS A 1 250 ? -8.901  -38.145 2.387   1.00 23.81 ? 251 CYS A C   1 
ATOM   1931 O  O   . CYS A 1 250 ? -8.748  -38.180 3.618   1.00 25.08 ? 251 CYS A O   1 
ATOM   1932 C  CB  . CYS A 1 250 ? -8.954  -36.064 0.941   1.00 26.94 ? 251 CYS A CB  1 
ATOM   1933 S  SG  . CYS A 1 250 ? -9.583  -34.912 2.164   1.00 33.93 ? 251 CYS A SG  1 
ATOM   1934 N  N   . ASP A 1 251 ? -9.766  -38.934 1.753   1.00 23.08 ? 252 ASP A N   1 
ATOM   1935 C  CA  . ASP A 1 251 ? -10.530 -39.964 2.458   1.00 23.56 ? 252 ASP A CA  1 
ATOM   1936 C  C   . ASP A 1 251 ? -9.621  -40.943 3.205   1.00 22.72 ? 252 ASP A C   1 
ATOM   1937 O  O   . ASP A 1 251 ? -9.889  -41.310 4.353   1.00 22.09 ? 252 ASP A O   1 
ATOM   1938 C  CB  . ASP A 1 251 ? -11.417 -40.750 1.487   1.00 25.13 ? 252 ASP A CB  1 
ATOM   1939 C  CG  . ASP A 1 251 ? -12.586 -39.934 0.958   1.00 27.38 ? 252 ASP A CG  1 
ATOM   1940 O  OD1 . ASP A 1 251 ? -12.848 -38.844 1.491   1.00 30.98 ? 252 ASP A OD1 1 
ATOM   1941 O  OD2 . ASP A 1 251 ? -13.258 -40.399 0.017   1.00 28.62 ? 252 ASP A OD2 1 
ATOM   1942 N  N   . PHE A 1 252 ? -8.577  -41.414 2.549   1.00 19.78 ? 253 PHE A N   1 
ATOM   1943 C  CA  . PHE A 1 252 ? -7.606  -42.312 3.168   1.00 21.88 ? 253 PHE A CA  1 
ATOM   1944 C  C   . PHE A 1 252 ? -6.961  -41.750 4.431   1.00 23.33 ? 253 PHE A C   1 
ATOM   1945 O  O   . PHE A 1 252 ? -6.982  -42.372 5.457   1.00 20.76 ? 253 PHE A O   1 
ATOM   1946 C  CB  . PHE A 1 252 ? -6.495  -42.701 2.206   1.00 20.32 ? 253 PHE A CB  1 
ATOM   1947 C  CG  . PHE A 1 252 ? -5.583  -43.732 2.757   1.00 19.84 ? 253 PHE A CG  1 
ATOM   1948 C  CD1 . PHE A 1 252 ? -6.084  -44.913 3.219   1.00 21.61 ? 253 PHE A CD1 1 
ATOM   1949 C  CD2 . PHE A 1 252 ? -4.249  -43.522 2.850   1.00 19.14 ? 253 PHE A CD2 1 
ATOM   1950 C  CE1 . PHE A 1 252 ? -5.261  -45.841 3.752   1.00 21.64 ? 253 PHE A CE1 1 
ATOM   1951 C  CE2 . PHE A 1 252 ? -3.435  -44.443 3.376   1.00 20.84 ? 253 PHE A CE2 1 
ATOM   1952 C  CZ  . PHE A 1 252 ? -3.946  -45.615 3.826   1.00 21.11 ? 253 PHE A CZ  1 
ATOM   1953 N  N   . VAL A 1 253 ? -6.382  -40.574 4.300   1.00 20.13 ? 254 VAL A N   1 
ATOM   1954 C  CA  . VAL A 1 253 ? -5.793  -39.901 5.407   1.00 22.66 ? 254 VAL A CA  1 
ATOM   1955 C  C   . VAL A 1 253 ? -6.780  -39.713 6.564   1.00 21.77 ? 254 VAL A C   1 
ATOM   1956 O  O   . VAL A 1 253 ? -6.465  -39.983 7.655   1.00 21.54 ? 254 VAL A O   1 
ATOM   1957 C  CB  . VAL A 1 253 ? -5.169  -38.597 4.975   1.00 22.44 ? 254 VAL A CB  1 
ATOM   1958 C  CG1 . VAL A 1 253 ? -4.759  -37.818 6.131   1.00 20.06 ? 254 VAL A CG1 1 
ATOM   1959 C  CG2 . VAL A 1 253 ? -3.987  -38.861 4.117   1.00 20.36 ? 254 VAL A CG2 1 
ATOM   1960 N  N   . ARG A 1 254 ? -7.976  -39.275 6.289   1.00 23.18 ? 255 ARG A N   1 
ATOM   1961 C  CA  . ARG A 1 254 ? -8.943  -39.186 7.348   1.00 25.50 ? 255 ARG A CA  1 
ATOM   1962 C  C   . ARG A 1 254 ? -9.166  -40.540 8.011   1.00 28.15 ? 255 ARG A C   1 
ATOM   1963 O  O   . ARG A 1 254 ? -9.184  -40.635 9.190   1.00 28.74 ? 255 ARG A O   1 
ATOM   1964 C  CB  . ARG A 1 254 ? -10.240 -38.633 6.869   1.00 25.63 ? 255 ARG A CB  1 
ATOM   1965 C  CG  . ARG A 1 254 ? -11.282 -38.756 7.900   1.00 31.51 ? 255 ARG A CG  1 
ATOM   1966 C  CD  . ARG A 1 254 ? -12.456 -37.913 7.642   1.00 38.39 ? 255 ARG A CD  1 
ATOM   1967 N  NE  . ARG A 1 254 ? -13.106 -38.251 6.411   1.00 40.65 ? 255 ARG A NE  1 
ATOM   1968 C  CZ  . ARG A 1 254 ? -12.860 -37.643 5.268   1.00 39.59 ? 255 ARG A CZ  1 
ATOM   1969 N  NH1 . ARG A 1 254 ? -11.989 -36.669 5.212   1.00 38.55 ? 255 ARG A NH1 1 
ATOM   1970 N  NH2 . ARG A 1 254 ? -13.495 -38.019 4.190   1.00 40.33 ? 255 ARG A NH2 1 
ATOM   1971 N  N   . SER A 1 255 ? -9.279  -41.584 7.235   1.00 24.02 ? 256 SER A N   1 
ATOM   1972 C  CA  . SER A 1 255 ? -9.363  -42.909 7.790   1.00 27.80 ? 256 SER A CA  1 
ATOM   1973 C  C   . SER A 1 255 ? -8.224  -43.278 8.717   1.00 25.93 ? 256 SER A C   1 
ATOM   1974 O  O   . SER A 1 255 ? -8.447  -43.927 9.674   1.00 27.24 ? 256 SER A O   1 
ATOM   1975 C  CB  . SER A 1 255 ? -9.514  -43.975 6.714   1.00 27.47 ? 256 SER A CB  1 
ATOM   1976 O  OG  . SER A 1 255 ? -8.314  -44.434 6.280   1.00 24.52 ? 256 SER A OG  1 
ATOM   1977 N  N   . ARG A 1 256 ? -7.018  -42.875 8.397   1.00 21.60 ? 257 ARG A N   1 
ATOM   1978 C  CA  . ARG A 1 256 ? -5.849  -43.219 9.200   1.00 21.69 ? 257 ARG A CA  1 
ATOM   1979 C  C   . ARG A 1 256 ? -5.777  -42.363 10.461  1.00 22.91 ? 257 ARG A C   1 
ATOM   1980 O  O   . ARG A 1 256 ? -5.342  -42.836 11.514  1.00 25.38 ? 257 ARG A O   1 
ATOM   1981 C  CB  . ARG A 1 256 ? -4.568  -43.088 8.379   1.00 21.55 ? 257 ARG A CB  1 
ATOM   1982 C  CG  . ARG A 1 256 ? -4.549  -43.986 7.118   1.00 22.73 ? 257 ARG A CG  1 
ATOM   1983 C  CD  . ARG A 1 256 ? -4.720  -45.472 7.454   1.00 25.41 ? 257 ARG A CD  1 
ATOM   1984 N  NE  . ARG A 1 256 ? -6.122  -45.864 7.572   1.00 26.32 ? 257 ARG A NE  1 
ATOM   1985 C  CZ  . ARG A 1 256 ? -6.529  -47.065 7.974   1.00 30.85 ? 257 ARG A CZ  1 
ATOM   1986 N  NH1 . ARG A 1 256 ? -5.636  -47.992 8.296   1.00 29.56 ? 257 ARG A NH1 1 
ATOM   1987 N  NH2 . ARG A 1 256 ? -7.825  -47.343 8.055   1.00 26.99 ? 257 ARG A NH2 1 
ATOM   1988 N  N   . LEU A 1 257 ? -6.205  -41.105 10.352  1.00 21.54 ? 258 LEU A N   1 
ATOM   1989 C  CA  . LEU A 1 257 ? -6.214  -40.199 11.501  1.00 21.47 ? 258 LEU A CA  1 
ATOM   1990 C  C   . LEU A 1 257 ? -7.249  -40.642 12.547  1.00 23.79 ? 258 LEU A C   1 
ATOM   1991 O  O   . LEU A 1 257 ? -7.097  -40.379 13.739  1.00 26.65 ? 258 LEU A O   1 
ATOM   1992 C  CB  . LEU A 1 257 ? -6.491  -38.770 11.046  1.00 18.86 ? 258 LEU A CB  1 
ATOM   1993 C  CG  . LEU A 1 257 ? -5.343  -38.087 10.288  1.00 20.62 ? 258 LEU A CG  1 
ATOM   1994 C  CD1 . LEU A 1 257 ? -5.740  -36.695 9.794   1.00 21.78 ? 258 LEU A CD1 1 
ATOM   1995 C  CD2 . LEU A 1 257 ? -4.106  -38.001 11.191  1.00 19.59 ? 258 LEU A CD2 1 
ATOM   1996 N  N   . GLU A 1 258 ? -8.301  -41.311 12.100  1.00 21.62 ? 259 GLU A N   1 
ATOM   1997 C  CA  . GLU A 1 258 ? -9.292  -41.831 13.032  1.00 24.97 ? 259 GLU A CA  1 
ATOM   1998 C  C   . GLU A 1 258 ? -8.739  -43.015 13.827  1.00 27.81 ? 259 GLU A C   1 
ATOM   1999 O  O   . GLU A 1 258 ? -9.316  -43.438 14.824  1.00 26.31 ? 259 GLU A O   1 
ATOM   2000 C  CB  . GLU A 1 258 ? -10.585 -42.165 12.299  1.00 26.31 ? 259 GLU A CB  1 
ATOM   2001 C  CG  . GLU A 1 258 ? -11.295 -40.882 11.838  1.00 30.99 ? 259 GLU A CG  1 
ATOM   2002 C  CD  . GLU A 1 258 ? -12.583 -41.124 11.085  1.00 41.02 ? 259 GLU A CD  1 
ATOM   2003 O  OE1 . GLU A 1 258 ? -12.857 -42.288 10.723  1.00 43.20 ? 259 GLU A OE1 1 
ATOM   2004 O  OE2 . GLU A 1 258 ? -13.320 -40.137 10.849  1.00 46.84 ? 259 GLU A OE2 1 
ATOM   2005 N  N   . VAL A 1 259 ? -7.581  -43.506 13.408  1.00 27.31 ? 260 VAL A N   1 
ATOM   2006 C  CA  . VAL A 1 259 ? -6.993  -44.679 14.032  1.00 27.64 ? 260 VAL A CA  1 
ATOM   2007 C  C   . VAL A 1 259 ? -5.723  -44.363 14.818  1.00 29.43 ? 260 VAL A C   1 
ATOM   2008 O  O   . VAL A 1 259 ? -5.405  -45.054 15.784  1.00 29.74 ? 260 VAL A O   1 
ATOM   2009 C  CB  . VAL A 1 259 ? -6.761  -45.789 12.981  1.00 27.51 ? 260 VAL A CB  1 
ATOM   2010 C  CG1 . VAL A 1 259 ? -5.793  -46.832 13.490  1.00 35.37 ? 260 VAL A CG1 1 
ATOM   2011 C  CG2 . VAL A 1 259 ? -8.105  -46.413 12.593  1.00 30.02 ? 260 VAL A CG2 1 
ATOM   2012 N  N   . THR A 1 260 ? -5.063  -43.428 14.456  1.00 26.06 ? 261 THR A N   1 
ATOM   2013 C  CA  . THR A 1 260 ? -3.833  -43.017 15.124  1.00 26.37 ? 261 THR A CA  1 
ATOM   2014 C  C   . THR A 1 260 ? -3.622  -41.525 15.017  1.00 25.43 ? 261 THR A C   1 
ATOM   2015 O  O   . THR A 1 260 ? -4.012  -40.922 14.026  1.00 25.80 ? 261 THR A O   1 
ATOM   2016 C  CB  . THR A 1 260 ? -2.577  -43.656 14.496  1.00 29.62 ? 261 THR A CB  1 
ATOM   2017 O  OG1 . THR A 1 260 ? -1.431  -43.391 15.308  1.00 42.36 ? 261 THR A OG1 1 
ATOM   2018 C  CG2 . THR A 1 260 ? -2.355  -43.095 13.105  1.00 23.29 ? 261 THR A CG2 1 
ATOM   2019 N  N   . ASP A 1 261 ? -2.904  -40.843 15.994  1.00 27.94 ? 262 ASP A N   1 
ATOM   2020 C  CA  . ASP A 1 261 ? -2.524  -39.438 15.932  1.00 26.66 ? 262 ASP A CA  1 
ATOM   2021 C  C   . ASP A 1 261 ? -1.032  -39.294 15.684  1.00 26.60 ? 262 ASP A C   1 
ATOM   2022 O  O   . ASP A 1 261 ? -0.491  -38.202 15.755  1.00 28.56 ? 262 ASP A O   1 
ATOM   2023 C  CB  . ASP A 1 261 ? -2.958  -38.672 17.195  1.00 31.70 ? 262 ASP A CB  1 
ATOM   2024 C  CG  . ASP A 1 261 ? -2.297  -39.197 18.469  1.00 37.96 ? 262 ASP A CG  1 
ATOM   2025 O  OD1 . ASP A 1 261 ? -1.366  -40.026 18.389  1.00 37.33 ? 262 ASP A OD1 1 
ATOM   2026 O  OD2 . ASP A 1 261 ? -2.708  -38.768 19.567  1.00 43.41 ? 262 ASP A OD2 1 
ATOM   2027 N  N   . ASP A 1 262 ? -0.374  -40.412 15.393  1.00 24.40 ? 263 ASP A N   1 
ATOM   2028 C  CA  . ASP A 1 262 ? 1.045   -40.425 15.071  1.00 24.52 ? 263 ASP A CA  1 
ATOM   2029 C  C   . ASP A 1 262 ? 1.175   -40.025 13.595  1.00 23.90 ? 263 ASP A C   1 
ATOM   2030 O  O   . ASP A 1 262 ? 0.915   -40.829 12.705  1.00 24.04 ? 263 ASP A O   1 
ATOM   2031 C  CB  . ASP A 1 262 ? 1.593   -41.833 15.326  1.00 26.54 ? 263 ASP A CB  1 
ATOM   2032 C  CG  . ASP A 1 262 ? 3.064   -41.974 15.001  1.00 29.36 ? 263 ASP A CG  1 
ATOM   2033 O  OD1 . ASP A 1 262 ? 3.622   -41.115 14.300  1.00 24.59 ? 263 ASP A OD1 1 
ATOM   2034 O  OD2 . ASP A 1 262 ? 3.663   -42.974 15.439  1.00 29.93 ? 263 ASP A OD2 1 
ATOM   2035 N  N   . LEU A 1 263 ? 1.534   -38.770 13.340  1.00 23.78 ? 264 LEU A N   1 
ATOM   2036 C  CA  . LEU A 1 263 ? 1.500   -38.252 11.971  1.00 23.08 ? 264 LEU A CA  1 
ATOM   2037 C  C   . LEU A 1 263 ? 2.597   -38.857 11.093  1.00 24.35 ? 264 LEU A C   1 
ATOM   2038 O  O   . LEU A 1 263 ? 2.420   -38.998 9.887   1.00 22.90 ? 264 LEU A O   1 
ATOM   2039 C  CB  . LEU A 1 263 ? 1.547   -36.720 11.962  1.00 21.75 ? 264 LEU A CB  1 
ATOM   2040 C  CG  . LEU A 1 263 ? 0.434   -36.027 12.762  1.00 22.94 ? 264 LEU A CG  1 
ATOM   2041 C  CD1 . LEU A 1 263 ? 0.437   -34.502 12.542  1.00 20.36 ? 264 LEU A CD1 1 
ATOM   2042 C  CD2 . LEU A 1 263 ? -0.941  -36.630 12.415  1.00 21.10 ? 264 LEU A CD2 1 
ATOM   2043 N  N   . GLU A 1 264 ? 3.723   -39.238 11.694  1.00 23.41 ? 265 GLU A N   1 
ATOM   2044 C  CA  . GLU A 1 264 ? 4.773   -39.912 10.927  1.00 23.87 ? 265 GLU A CA  1 
ATOM   2045 C  C   . GLU A 1 264 ? 4.267   -41.248 10.428  1.00 23.84 ? 265 GLU A C   1 
ATOM   2046 O  O   . GLU A 1 264 ? 4.500   -41.635 9.275   1.00 22.63 ? 265 GLU A O   1 
ATOM   2047 C  CB  . GLU A 1 264 ? 6.045   -40.090 11.765  1.00 24.04 ? 265 GLU A CB  1 
ATOM   2048 C  CG  . GLU A 1 264 ? 6.792   -38.783 11.983  1.00 25.39 ? 265 GLU A CG  1 
ATOM   2049 C  CD  . GLU A 1 264 ? 8.008   -38.934 12.889  1.00 30.72 ? 265 GLU A CD  1 
ATOM   2050 O  OE1 . GLU A 1 264 ? 8.078   -39.919 13.650  1.00 37.64 ? 265 GLU A OE1 1 
ATOM   2051 O  OE2 . GLU A 1 264 ? 8.896   -38.072 12.825  1.00 26.45 ? 265 GLU A OE2 1 
ATOM   2052 N  N   . LYS A 1 265 ? 3.548   -41.949 11.296  1.00 22.71 ? 266 LYS A N   1 
ATOM   2053 C  CA  . LYS A 1 265 ? 2.985   -43.232 10.914  1.00 23.86 ? 266 LYS A CA  1 
ATOM   2054 C  C   . LYS A 1 265 ? 1.978   -43.072 9.774   1.00 25.01 ? 266 LYS A C   1 
ATOM   2055 O  O   . LYS A 1 265 ? 1.968   -43.866 8.833   1.00 23.59 ? 266 LYS A O   1 
ATOM   2056 C  CB  . LYS A 1 265 ? 2.329   -43.913 12.119  1.00 25.00 ? 266 LYS A CB  1 
ATOM   2057 C  CG  . LYS A 1 265 ? 1.695   -45.255 11.801  1.00 32.81 ? 266 LYS A CG  1 
ATOM   2058 C  CD  . LYS A 1 265 ? 1.184   -45.932 13.081  1.00 38.37 ? 266 LYS A CD  1 
ATOM   2059 C  CE  . LYS A 1 265 ? 0.334   -47.160 12.760  1.00 43.61 ? 266 LYS A CE  1 
ATOM   2060 N  NZ  . LYS A 1 265 ? -0.323  -47.735 13.981  1.00 50.87 ? 266 LYS A NZ  1 
ATOM   2061 N  N   . VAL A 1 266 ? 1.129   -42.050 9.860   1.00 23.12 ? 267 VAL A N   1 
ATOM   2062 C  CA  . VAL A 1 266 ? 0.139   -41.824 8.806   1.00 21.48 ? 267 VAL A CA  1 
ATOM   2063 C  C   . VAL A 1 266 ? 0.850   -41.569 7.472   1.00 21.07 ? 267 VAL A C   1 
ATOM   2064 O  O   . VAL A 1 266 ? 0.469   -42.122 6.441   1.00 23.07 ? 267 VAL A O   1 
ATOM   2065 C  CB  . VAL A 1 266 ? -0.834  -40.670 9.149   1.00 20.26 ? 267 VAL A CB  1 
ATOM   2066 C  CG1 . VAL A 1 266 ? -1.772  -40.351 7.943   1.00 19.89 ? 267 VAL A CG1 1 
ATOM   2067 C  CG2 . VAL A 1 266 ? -1.658  -41.020 10.403  1.00 23.71 ? 267 VAL A CG2 1 
ATOM   2068 N  N   . CYS A 1 267 ? 1.879   -40.733 7.494   1.00 22.30 ? 268 CYS A N   1 
ATOM   2069 C  CA  . CYS A 1 267 ? 2.668   -40.492 6.282   1.00 23.91 ? 268 CYS A CA  1 
ATOM   2070 C  C   . CYS A 1 267 ? 3.336   -41.753 5.731   1.00 24.08 ? 268 CYS A C   1 
ATOM   2071 O  O   . CYS A 1 267 ? 3.372   -41.961 4.509   1.00 21.76 ? 268 CYS A O   1 
ATOM   2072 C  CB  . CYS A 1 267 ? 3.702   -39.390 6.507   1.00 23.07 ? 268 CYS A CB  1 
ATOM   2073 S  SG  . CYS A 1 267 ? 2.959   -37.754 6.765   1.00 22.59 ? 268 CYS A SG  1 
ATOM   2074 N  N   . ASN A 1 268 ? 3.873   -42.586 6.621   1.00 23.47 ? 269 ASN A N   1 
ATOM   2075 C  CA  . ASN A 1 268 ? 4.448   -43.869 6.203   1.00 24.59 ? 269 ASN A CA  1 
ATOM   2076 C  C   . ASN A 1 268 ? 3.405   -44.762 5.565   1.00 22.93 ? 269 ASN A C   1 
ATOM   2077 O  O   . ASN A 1 268 ? 3.685   -45.445 4.582   1.00 22.51 ? 269 ASN A O   1 
ATOM   2078 C  CB  . ASN A 1 268 ? 5.118   -44.605 7.376   1.00 22.26 ? 269 ASN A CB  1 
ATOM   2079 C  CG  . ASN A 1 268 ? 6.373   -43.907 7.854   1.00 24.42 ? 269 ASN A CG  1 
ATOM   2080 O  OD1 . ASN A 1 268 ? 6.957   -43.105 7.137   1.00 22.75 ? 269 ASN A OD1 1 
ATOM   2081 N  ND2 . ASN A 1 268 ? 6.794   -44.208 9.076   1.00 23.31 ? 269 ASN A ND2 1 
ATOM   2082 N  N   . GLU A 1 269 ? 2.200   -44.753 6.129   1.00 22.83 ? 270 GLU A N   1 
ATOM   2083 C  CA  . GLU A 1 269 ? 1.105   -45.533 5.573   1.00 24.99 ? 270 GLU A CA  1 
ATOM   2084 C  C   . GLU A 1 269 ? 0.746   -45.054 4.164   1.00 22.93 ? 270 GLU A C   1 
ATOM   2085 O  O   . GLU A 1 269 ? 0.497   -45.865 3.278   1.00 23.33 ? 270 GLU A O   1 
ATOM   2086 C  CB  . GLU A 1 269 ? -0.105  -45.520 6.509   1.00 24.53 ? 270 GLU A CB  1 
ATOM   2087 C  CG  . GLU A 1 269 ? 0.120   -46.362 7.757   1.00 28.82 ? 270 GLU A CG  1 
ATOM   2088 C  CD  . GLU A 1 269 ? -0.930  -46.132 8.836   1.00 36.76 ? 270 GLU A CD  1 
ATOM   2089 O  OE1 . GLU A 1 269 ? -1.578  -45.057 8.850   1.00 31.31 ? 270 GLU A OE1 1 
ATOM   2090 O  OE2 . GLU A 1 269 ? -1.099  -47.032 9.687   1.00 41.37 ? 270 GLU A OE2 1 
ATOM   2091 N  N   . VAL A 1 270 ? 0.753   -43.742 3.953   1.00 22.17 ? 271 VAL A N   1 
ATOM   2092 C  CA  . VAL A 1 270 ? 0.485   -43.196 2.621   1.00 23.00 ? 271 VAL A CA  1 
ATOM   2093 C  C   . VAL A 1 270 ? 1.568   -43.637 1.632   1.00 23.39 ? 271 VAL A C   1 
ATOM   2094 O  O   . VAL A 1 270 ? 1.275   -44.111 0.530   1.00 22.88 ? 271 VAL A O   1 
ATOM   2095 C  CB  . VAL A 1 270 ? 0.407   -41.651 2.645   1.00 22.88 ? 271 VAL A CB  1 
ATOM   2096 C  CG1 . VAL A 1 270 ? 0.349   -41.088 1.225   1.00 20.35 ? 271 VAL A CG1 1 
ATOM   2097 C  CG2 . VAL A 1 270 ? -0.827  -41.198 3.430   1.00 19.86 ? 271 VAL A CG2 1 
ATOM   2098 N  N   . VAL A 1 271 ? 2.819   -43.475 2.036   1.00 19.66 ? 272 VAL A N   1 
ATOM   2099 C  CA  . VAL A 1 271 ? 3.941   -43.813 1.163   1.00 21.69 ? 272 VAL A CA  1 
ATOM   2100 C  C   . VAL A 1 271 ? 3.950   -45.308 0.782   1.00 23.69 ? 272 VAL A C   1 
ATOM   2101 O  O   . VAL A 1 271 ? 4.080   -45.650 -0.406  1.00 22.00 ? 272 VAL A O   1 
ATOM   2102 C  CB  . VAL A 1 271 ? 5.282   -43.382 1.805   1.00 24.04 ? 272 VAL A CB  1 
ATOM   2103 C  CG1 . VAL A 1 271 ? 6.461   -44.056 1.109   1.00 24.49 ? 272 VAL A CG1 1 
ATOM   2104 C  CG2 . VAL A 1 271 ? 5.404   -41.867 1.761   1.00 24.55 ? 272 VAL A CG2 1 
ATOM   2105 N  N   . ASP A 1 272 ? 3.804   -46.194 1.773   1.00 23.26 ? 273 ASP A N   1 
ATOM   2106 C  CA  . ASP A 1 272 ? 3.755   -47.635 1.491   1.00 24.11 ? 273 ASP A CA  1 
ATOM   2107 C  C   . ASP A 1 272 ? 2.552   -47.993 0.630   1.00 25.32 ? 273 ASP A C   1 
ATOM   2108 O  O   . ASP A 1 272 ? 2.644   -48.804 -0.295  1.00 26.14 ? 273 ASP A O   1 
ATOM   2109 C  CB  . ASP A 1 272 ? 3.714   -48.468 2.777   1.00 26.95 ? 273 ASP A CB  1 
ATOM   2110 C  CG  . ASP A 1 272 ? 5.077   -48.598 3.439   1.00 29.90 ? 273 ASP A CG  1 
ATOM   2111 O  OD1 . ASP A 1 272 ? 6.100   -48.269 2.797   1.00 31.18 ? 273 ASP A OD1 1 
ATOM   2112 O  OD2 . ASP A 1 272 ? 5.118   -49.047 4.601   1.00 31.13 ? 273 ASP A OD2 1 
ATOM   2113 N  N   . THR A 1 273 ? 1.409   -47.393 0.930   1.00 21.26 ? 274 THR A N   1 
ATOM   2114 C  CA  . THR A 1 273 ? 0.222   -47.661 0.129   1.00 19.74 ? 274 THR A CA  1 
ATOM   2115 C  C   . THR A 1 273 ? 0.466   -47.316 -1.341  1.00 22.03 ? 274 THR A C   1 
ATOM   2116 O  O   . THR A 1 273 ? 0.123   -48.101 -2.232  1.00 20.95 ? 274 THR A O   1 
ATOM   2117 C  CB  . THR A 1 273 ? -0.999  -46.930 0.680   1.00 25.21 ? 274 THR A CB  1 
ATOM   2118 O  OG1 . THR A 1 273 ? -1.322  -47.489 1.957   1.00 24.09 ? 274 THR A OG1 1 
ATOM   2119 C  CG2 . THR A 1 273 ? -2.216  -47.087 -0.261  1.00 21.03 ? 274 THR A CG2 1 
ATOM   2120 N  N   . CYS A 1 274 ? 1.085   -46.164 -1.590  1.00 21.50 ? 275 CYS A N   1 
ATOM   2121 C  CA  . CYS A 1 274 ? 1.358   -45.737 -2.960  1.00 22.69 ? 275 CYS A CA  1 
ATOM   2122 C  C   . CYS A 1 274 ? 2.401   -46.636 -3.658  1.00 24.65 ? 275 CYS A C   1 
ATOM   2123 O  O   . CYS A 1 274 ? 2.309   -46.910 -4.854  1.00 22.57 ? 275 CYS A O   1 
ATOM   2124 C  CB  . CYS A 1 274 ? 1.755   -44.254 -2.992  1.00 23.31 ? 275 CYS A CB  1 
ATOM   2125 S  SG  . CYS A 1 274 ? 0.327   -43.148 -2.604  1.00 21.09 ? 275 CYS A SG  1 
ATOM   2126 N  N   . LEU A 1 275 ? 3.389   -47.096 -2.906  1.00 22.16 ? 276 LEU A N   1 
ATOM   2127 C  CA  . LEU A 1 275 ? 4.327   -48.083 -3.430  1.00 24.30 ? 276 LEU A CA  1 
ATOM   2128 C  C   . LEU A 1 275 ? 3.576   -49.355 -3.856  1.00 26.27 ? 276 LEU A C   1 
ATOM   2129 O  O   . LEU A 1 275 ? 3.788   -49.888 -4.958  1.00 25.35 ? 276 LEU A O   1 
ATOM   2130 C  CB  . LEU A 1 275 ? 5.390   -48.392 -2.370  1.00 25.56 ? 276 LEU A CB  1 
ATOM   2131 C  CG  . LEU A 1 275 ? 6.549   -49.367 -2.651  1.00 31.40 ? 276 LEU A CG  1 
ATOM   2132 C  CD1 . LEU A 1 275 ? 6.066   -50.789 -2.878  1.00 35.79 ? 276 LEU A CD1 1 
ATOM   2133 C  CD2 . LEU A 1 275 ? 7.375   -48.907 -3.815  1.00 26.43 ? 276 LEU A CD2 1 
ATOM   2134 N  N   . TYR A 1 276 ? 2.693   -49.834 -2.988  1.00 23.92 ? 277 TYR A N   1 
ATOM   2135 C  CA  . TYR A 1 276 ? 1.947   -51.057 -3.259  1.00 26.91 ? 277 TYR A CA  1 
ATOM   2136 C  C   . TYR A 1 276 ? 0.909   -50.908 -4.373  1.00 28.30 ? 277 TYR A C   1 
ATOM   2137 O  O   . TYR A 1 276 ? 0.502   -51.903 -4.984  1.00 27.76 ? 277 TYR A O   1 
ATOM   2138 C  CB  . TYR A 1 276 ? 1.314   -51.596 -1.975  1.00 26.57 ? 277 TYR A CB  1 
ATOM   2139 C  CG  . TYR A 1 276 ? 2.351   -51.888 -0.914  1.00 28.45 ? 277 TYR A CG  1 
ATOM   2140 C  CD1 . TYR A 1 276 ? 3.646   -52.255 -1.270  1.00 31.40 ? 277 TYR A CD1 1 
ATOM   2141 C  CD2 . TYR A 1 276 ? 2.048   -51.782 0.437   1.00 27.61 ? 277 TYR A CD2 1 
ATOM   2142 C  CE1 . TYR A 1 276 ? 4.613   -52.516 -0.306  1.00 33.14 ? 277 TYR A CE1 1 
ATOM   2143 C  CE2 . TYR A 1 276 ? 3.002   -52.042 1.410   1.00 29.04 ? 277 TYR A CE2 1 
ATOM   2144 C  CZ  . TYR A 1 276 ? 4.284   -52.406 1.035   1.00 34.72 ? 277 TYR A CZ  1 
ATOM   2145 O  OH  . TYR A 1 276 ? 5.240   -52.652 2.000   1.00 33.87 ? 277 TYR A OH  1 
ATOM   2146 N  N   . LYS A 1 277 ? 0.495   -49.672 -4.644  1.00 23.03 ? 278 LYS A N   1 
ATOM   2147 C  CA  . LYS A 1 277 ? -0.388  -49.396 -5.768  1.00 22.55 ? 278 LYS A CA  1 
ATOM   2148 C  C   . LYS A 1 277 ? 0.405   -49.276 -7.071  1.00 23.10 ? 278 LYS A C   1 
ATOM   2149 O  O   . LYS A 1 277 ? -0.165  -49.056 -8.135  1.00 24.61 ? 278 LYS A O   1 
ATOM   2150 C  CB  . LYS A 1 277 ? -1.169  -48.100 -5.525  1.00 25.07 ? 278 LYS A CB  1 
ATOM   2151 C  CG  . LYS A 1 277 ? -2.327  -48.219 -4.523  1.00 25.93 ? 278 LYS A CG  1 
ATOM   2152 C  CD  . LYS A 1 277 ? -2.857  -46.827 -4.160  1.00 25.85 ? 278 LYS A CD  1 
ATOM   2153 C  CE  . LYS A 1 277 ? -4.018  -46.911 -3.203  1.00 24.94 ? 278 LYS A CE  1 
ATOM   2154 N  NZ  . LYS A 1 277 ? -5.222  -47.501 -3.846  1.00 27.42 ? 278 LYS A NZ  1 
ATOM   2155 N  N   . GLY A 1 278 ? 1.724   -49.385 -6.981  1.00 24.07 ? 279 GLY A N   1 
ATOM   2156 C  CA  . GLY A 1 278 ? 2.544   -49.424 -8.175  1.00 24.03 ? 279 GLY A CA  1 
ATOM   2157 C  C   . GLY A 1 278 ? 3.448   -48.234 -8.431  1.00 25.39 ? 279 GLY A C   1 
ATOM   2158 O  O   . GLY A 1 278 ? 4.097   -48.167 -9.472  1.00 24.41 ? 279 GLY A O   1 
ATOM   2159 N  N   . SER A 1 279 ? 3.525   -47.293 -7.498  1.00 23.87 ? 280 SER A N   1 
ATOM   2160 C  CA  . SER A 1 279 ? 4.382   -46.141 -7.747  1.00 21.96 ? 280 SER A CA  1 
ATOM   2161 C  C   . SER A 1 279 ? 5.861   -46.518 -7.684  1.00 23.95 ? 280 SER A C   1 
ATOM   2162 O  O   . SER A 1 279 ? 6.321   -47.068 -6.691  1.00 24.74 ? 280 SER A O   1 
ATOM   2163 C  CB  . SER A 1 279 ? 4.086   -44.976 -6.798  1.00 22.67 ? 280 SER A CB  1 
ATOM   2164 O  OG  . SER A 1 279 ? 5.026   -43.928 -7.017  1.00 24.21 ? 280 SER A OG  1 
ATOM   2165 N  N   . ARG A 1 280 ? 6.605   -46.195 -8.739  1.00 22.31 ? 281 ARG A N   1 
ATOM   2166 C  CA  . ARG A 1 280 ? 8.014   -46.567 -8.805  1.00 25.61 ? 281 ARG A CA  1 
ATOM   2167 C  C   . ARG A 1 280 ? 8.926   -45.354 -8.717  1.00 26.48 ? 281 ARG A C   1 
ATOM   2168 O  O   . ARG A 1 280 ? 10.088  -45.411 -9.092  1.00 27.30 ? 281 ARG A O   1 
ATOM   2169 C  CB  . ARG A 1 280 ? 8.281   -47.404 -10.064 1.00 29.47 ? 281 ARG A CB  1 
ATOM   2170 C  CG  . ARG A 1 280 ? 7.485   -48.717 -10.056 1.00 31.21 ? 281 ARG A CG  1 
ATOM   2171 C  CD  . ARG A 1 280 ? 7.745   -49.603 -11.283 1.00 33.61 ? 281 ARG A CD  1 
ATOM   2172 N  NE  . ARG A 1 280 ? 9.134   -50.037 -11.386 1.00 37.18 ? 281 ARG A NE  1 
ATOM   2173 C  CZ  . ARG A 1 280 ? 9.604   -51.197 -10.935 1.00 39.45 ? 281 ARG A CZ  1 
ATOM   2174 N  NH1 . ARG A 1 280 ? 8.795   -52.067 -10.333 1.00 39.95 ? 281 ARG A NH1 1 
ATOM   2175 N  NH2 . ARG A 1 280 ? 10.888  -51.491 -11.094 1.00 35.67 ? 281 ARG A NH2 1 
ATOM   2176 N  N   . ASP A 1 281 ? 8.384   -44.254 -8.196  1.00 23.94 ? 282 ASP A N   1 
ATOM   2177 C  CA  . ASP A 1 281 ? 9.119   -43.009 -8.075  1.00 23.97 ? 282 ASP A CA  1 
ATOM   2178 C  C   . ASP A 1 281 ? 9.533   -42.785 -6.617  1.00 22.70 ? 282 ASP A C   1 
ATOM   2179 O  O   . ASP A 1 281 ? 9.068   -43.505 -5.725  1.00 21.28 ? 282 ASP A O   1 
ATOM   2180 C  CB  . ASP A 1 281 ? 8.211   -41.874 -8.545  1.00 23.63 ? 282 ASP A CB  1 
ATOM   2181 C  CG  . ASP A 1 281 ? 8.956   -40.586 -8.832  1.00 26.18 ? 282 ASP A CG  1 
ATOM   2182 O  OD1 . ASP A 1 281 ? 10.204  -40.540 -8.739  1.00 26.62 ? 282 ASP A OD1 1 
ATOM   2183 O  OD2 . ASP A 1 281 ? 8.264   -39.610 -9.184  1.00 24.93 ? 282 ASP A OD2 1 
ATOM   2184 N  N   . ASN A 1 282 ? 10.416  -41.809 -6.396  1.00 20.81 ? 283 ASN A N   1 
ATOM   2185 C  CA  . ASN A 1 282 ? 10.673  -41.268 -5.060  1.00 21.61 ? 283 ASN A CA  1 
ATOM   2186 C  C   . ASN A 1 282 ? 9.344   -40.762 -4.506  1.00 22.33 ? 283 ASN A C   1 
ATOM   2187 O  O   . ASN A 1 282 ? 8.526   -40.238 -5.258  1.00 21.67 ? 283 ASN A O   1 
ATOM   2188 C  CB  . ASN A 1 282 ? 11.602  -40.053 -5.118  1.00 20.42 ? 283 ASN A CB  1 
ATOM   2189 C  CG  . ASN A 1 282 ? 13.028  -40.373 -5.617  1.00 23.09 ? 283 ASN A CG  1 
ATOM   2190 O  OD1 . ASN A 1 282 ? 13.710  -39.483 -6.121  1.00 22.41 ? 283 ASN A OD1 1 
ATOM   2191 N  ND2 . ASN A 1 282 ? 13.480  -41.610 -5.453  1.00 20.63 ? 283 ASN A ND2 1 
ATOM   2192 N  N   . MET A 1 283 ? 9.137   -40.867 -3.199  1.00 22.90 ? 284 MET A N   1 
ATOM   2193 C  CA  . MET A 1 283 ? 7.902   -40.365 -2.591  1.00 23.35 ? 284 MET A CA  1 
ATOM   2194 C  C   . MET A 1 283 ? 8.190   -39.528 -1.358  1.00 26.26 ? 284 MET A C   1 
ATOM   2195 O  O   . MET A 1 283 ? 8.995   -39.918 -0.505  1.00 23.85 ? 284 MET A O   1 
ATOM   2196 C  CB  . MET A 1 283 ? 6.969   -41.516 -2.228  1.00 22.92 ? 284 MET A CB  1 
ATOM   2197 C  CG  . MET A 1 283 ? 6.369   -42.196 -3.451  1.00 24.86 ? 284 MET A CG  1 
ATOM   2198 S  SD  . MET A 1 283 ? 5.445   -43.680 -3.038  1.00 30.30 ? 284 MET A SD  1 
ATOM   2199 C  CE  . MET A 1 283 ? 6.669   -44.957 -3.324  1.00 28.43 ? 284 MET A CE  1 
ATOM   2200 N  N   . SER A 1 284 ? 7.541   -38.368 -1.283  1.00 21.16 ? 285 SER A N   1 
ATOM   2201 C  CA  . SER A 1 284 ? 7.633   -37.481 -0.123  1.00 21.18 ? 285 SER A CA  1 
ATOM   2202 C  C   . SER A 1 284 ? 6.243   -36.929 0.151   1.00 23.76 ? 285 SER A C   1 
ATOM   2203 O  O   . SER A 1 284 ? 5.543   -36.527 -0.784  1.00 20.35 ? 285 SER A O   1 
ATOM   2204 C  CB  . SER A 1 284 ? 8.569   -36.307 -0.402  1.00 22.45 ? 285 SER A CB  1 
ATOM   2205 O  OG  . SER A 1 284 ? 9.884   -36.752 -0.684  1.00 26.50 ? 285 SER A OG  1 
ATOM   2206 N  N   . VAL A 1 285 ? 5.848   -36.920 1.424   1.00 22.41 ? 286 VAL A N   1 
ATOM   2207 C  CA  . VAL A 1 285 ? 4.539   -36.407 1.839   1.00 20.70 ? 286 VAL A CA  1 
ATOM   2208 C  C   . VAL A 1 285 ? 4.717   -35.653 3.146   1.00 22.71 ? 286 VAL A C   1 
ATOM   2209 O  O   . VAL A 1 285 ? 5.445   -36.108 4.034   1.00 20.72 ? 286 VAL A O   1 
ATOM   2210 C  CB  . VAL A 1 285 ? 3.531   -37.542 2.158   1.00 23.92 ? 286 VAL A CB  1 
ATOM   2211 C  CG1 . VAL A 1 285 ? 3.953   -38.297 3.437   1.00 21.95 ? 286 VAL A CG1 1 
ATOM   2212 C  CG2 . VAL A 1 285 ? 2.129   -37.021 2.269   1.00 32.48 ? 286 VAL A CG2 1 
ATOM   2213 N  N   . ILE A 1 286 ? 4.053   -34.505 3.259   1.00 20.83 ? 287 ILE A N   1 
ATOM   2214 C  CA  . ILE A 1 286 ? 3.972   -33.796 4.527   1.00 18.87 ? 287 ILE A CA  1 
ATOM   2215 C  C   . ILE A 1 286 ? 2.500   -33.674 4.896   1.00 22.15 ? 287 ILE A C   1 
ATOM   2216 O  O   . ILE A 1 286 ? 1.688   -33.280 4.063   1.00 20.98 ? 287 ILE A O   1 
ATOM   2217 C  CB  . ILE A 1 286 ? 4.552   -32.372 4.430   1.00 19.06 ? 287 ILE A CB  1 
ATOM   2218 C  CG1 . ILE A 1 286 ? 5.982   -32.391 3.881   1.00 19.30 ? 287 ILE A CG1 1 
ATOM   2219 C  CG2 . ILE A 1 286 ? 4.501   -31.698 5.810   1.00 21.27 ? 287 ILE A CG2 1 
ATOM   2220 C  CD1 . ILE A 1 286 ? 6.597   -30.997 3.794   1.00 18.57 ? 287 ILE A CD1 1 
ATOM   2221 N  N   . LEU A 1 287 ? 2.159   -34.029 6.136   1.00 20.61 ? 288 LEU A N   1 
ATOM   2222 C  CA  . LEU A 1 287 ? 0.792   -33.923 6.620   1.00 19.69 ? 288 LEU A CA  1 
ATOM   2223 C  C   . LEU A 1 287 ? 0.779   -32.897 7.735   1.00 22.86 ? 288 LEU A C   1 
ATOM   2224 O  O   . LEU A 1 287 ? 1.461   -33.079 8.741   1.00 21.09 ? 288 LEU A O   1 
ATOM   2225 C  CB  . LEU A 1 287 ? 0.341   -35.257 7.199   1.00 18.72 ? 288 LEU A CB  1 
ATOM   2226 C  CG  . LEU A 1 287 ? -1.112  -35.721 7.137   1.00 27.72 ? 288 LEU A CG  1 
ATOM   2227 C  CD1 . LEU A 1 287 ? -1.420  -36.665 8.322   1.00 21.94 ? 288 LEU A CD1 1 
ATOM   2228 C  CD2 . LEU A 1 287 ? -2.137  -34.602 7.006   1.00 22.26 ? 288 LEU A CD2 1 
ATOM   2229 N  N   . ILE A 1 288 ? 0.001   -31.834 7.569   1.00 20.49 ? 289 ILE A N   1 
ATOM   2230 C  CA  . ILE A 1 288 ? -0.058  -30.765 8.564   1.00 20.96 ? 289 ILE A CA  1 
ATOM   2231 C  C   . ILE A 1 288 ? -1.477  -30.712 9.099   1.00 23.66 ? 289 ILE A C   1 
ATOM   2232 O  O   . ILE A 1 288 ? -2.411  -30.438 8.349   1.00 21.39 ? 289 ILE A O   1 
ATOM   2233 C  CB  . ILE A 1 288 ? 0.272   -29.388 7.953   1.00 20.86 ? 289 ILE A CB  1 
ATOM   2234 C  CG1 . ILE A 1 288 ? 1.653   -29.395 7.302   1.00 21.80 ? 289 ILE A CG1 1 
ATOM   2235 C  CG2 . ILE A 1 288 ? 0.190   -28.285 9.013   1.00 21.62 ? 289 ILE A CG2 1 
ATOM   2236 C  CD1 . ILE A 1 288 ? 1.606   -29.275 5.788   1.00 23.68 ? 289 ILE A CD1 1 
ATOM   2237 N  N   . CYS A 1 289 ? -1.642  -30.986 10.389  1.00 21.37 ? 290 CYS A N   1 
ATOM   2238 C  CA  . CYS A 1 289 ? -2.972  -31.031 10.980  1.00 21.73 ? 290 CYS A CA  1 
ATOM   2239 C  C   . CYS A 1 289 ? -3.284  -29.760 11.757  1.00 24.80 ? 290 CYS A C   1 
ATOM   2240 O  O   . CYS A 1 289 ? -2.432  -29.235 12.483  1.00 25.04 ? 290 CYS A O   1 
ATOM   2241 C  CB  . CYS A 1 289 ? -3.107  -32.242 11.895  1.00 22.81 ? 290 CYS A CB  1 
ATOM   2242 S  SG  . CYS A 1 289 ? -3.236  -33.788 11.002  1.00 24.02 ? 290 CYS A SG  1 
ATOM   2243 N  N   . PHE A 1 290 ? -4.512  -29.274 11.592  1.00 21.76 ? 291 PHE A N   1 
ATOM   2244 C  CA  . PHE A 1 290 ? -5.013  -28.145 12.378  1.00 22.60 ? 291 PHE A CA  1 
ATOM   2245 C  C   . PHE A 1 290 ? -5.716  -28.693 13.616  1.00 26.59 ? 291 PHE A C   1 
ATOM   2246 O  O   . PHE A 1 290 ? -5.925  -29.899 13.719  1.00 24.36 ? 291 PHE A O   1 
ATOM   2247 C  CB  . PHE A 1 290 ? -5.984  -27.313 11.540  1.00 21.59 ? 291 PHE A CB  1 
ATOM   2248 C  CG  . PHE A 1 290 ? -5.335  -26.615 10.386  1.00 24.25 ? 291 PHE A CG  1 
ATOM   2249 C  CD1 . PHE A 1 290 ? -4.696  -25.401 10.564  1.00 24.04 ? 291 PHE A CD1 1 
ATOM   2250 C  CD2 . PHE A 1 290 ? -5.378  -27.166 9.120   1.00 23.67 ? 291 PHE A CD2 1 
ATOM   2251 C  CE1 . PHE A 1 290 ? -4.092  -24.747 9.497   1.00 26.02 ? 291 PHE A CE1 1 
ATOM   2252 C  CE2 . PHE A 1 290 ? -4.787  -26.511 8.042   1.00 26.28 ? 291 PHE A CE2 1 
ATOM   2253 C  CZ  . PHE A 1 290 ? -4.132  -25.309 8.237   1.00 26.74 ? 291 PHE A CZ  1 
ATOM   2254 N  N   . PRO A 1 291 ? -6.089  -27.813 14.556  1.00 28.19 ? 292 PRO A N   1 
ATOM   2255 C  CA  . PRO A 1 291 ? -6.745  -28.252 15.797  1.00 30.78 ? 292 PRO A CA  1 
ATOM   2256 C  C   . PRO A 1 291 ? -7.984  -29.131 15.586  1.00 28.75 ? 292 PRO A C   1 
ATOM   2257 O  O   . PRO A 1 291 ? -8.258  -30.021 16.392  1.00 30.95 ? 292 PRO A O   1 
ATOM   2258 C  CB  . PRO A 1 291 ? -7.132  -26.929 16.466  1.00 31.90 ? 292 PRO A CB  1 
ATOM   2259 C  CG  . PRO A 1 291 ? -6.099  -25.970 16.001  1.00 33.68 ? 292 PRO A CG  1 
ATOM   2260 C  CD  . PRO A 1 291 ? -5.735  -26.381 14.594  1.00 30.34 ? 292 PRO A CD  1 
ATOM   2261 N  N   . ASN A 1 292 ? -8.738  -28.891 14.522  1.00 27.51 ? 293 ASN A N   1 
ATOM   2262 C  CA  . ASN A 1 292 ? -9.949  -29.669 14.301  1.00 29.57 ? 293 ASN A CA  1 
ATOM   2263 C  C   . ASN A 1 292 ? -9.824  -30.780 13.250  1.00 28.96 ? 293 ASN A C   1 
ATOM   2264 O  O   . ASN A 1 292 ? -10.813 -31.217 12.654  1.00 27.39 ? 293 ASN A O   1 
ATOM   2265 C  CB  . ASN A 1 292 ? -11.153 -28.751 14.058  1.00 32.85 ? 293 ASN A CB  1 
ATOM   2266 C  CG  . ASN A 1 292 ? -11.605 -28.052 15.342  1.00 37.00 ? 293 ASN A CG  1 
ATOM   2267 O  OD1 . ASN A 1 292 ? -11.825 -28.705 16.362  1.00 40.33 ? 293 ASN A OD1 1 
ATOM   2268 N  ND2 . ASN A 1 292 ? -11.699 -26.726 15.308  1.00 38.21 ? 293 ASN A ND2 1 
ATOM   2269 N  N   . ALA A 1 293 ? -8.590  -31.242 13.066  1.00 26.75 ? 294 ALA A N   1 
ATOM   2270 C  CA  . ALA A 1 293 ? -8.313  -32.452 12.307  1.00 25.79 ? 294 ALA A CA  1 
ATOM   2271 C  C   . ALA A 1 293 ? -9.104  -33.592 12.932  1.00 27.32 ? 294 ALA A C   1 
ATOM   2272 O  O   . ALA A 1 293 ? -9.424  -33.536 14.116  1.00 27.20 ? 294 ALA A O   1 
ATOM   2273 C  CB  . ALA A 1 293 ? -6.811  -32.754 12.370  1.00 24.91 ? 294 ALA A CB  1 
ATOM   2274 N  N   . PRO A 1 294 ? -9.433  -34.630 12.147  1.00 26.39 ? 295 PRO A N   1 
ATOM   2275 C  CA  . PRO A 1 294 ? -10.158 -35.744 12.772  1.00 27.46 ? 295 PRO A CA  1 
ATOM   2276 C  C   . PRO A 1 294 ? -9.398  -36.342 13.953  1.00 26.94 ? 295 PRO A C   1 
ATOM   2277 O  O   . PRO A 1 294 ? -8.162  -36.375 13.973  1.00 25.00 ? 295 PRO A O   1 
ATOM   2278 C  CB  . PRO A 1 294 ? -10.312 -36.770 11.644  1.00 27.46 ? 295 PRO A CB  1 
ATOM   2279 C  CG  . PRO A 1 294 ? -9.429  -36.285 10.529  1.00 30.08 ? 295 PRO A CG  1 
ATOM   2280 C  CD  . PRO A 1 294 ? -9.239  -34.823 10.701  1.00 27.04 ? 295 PRO A CD  1 
ATOM   2281 N  N   . LYS A 1 295 ? -10.157 -36.801 14.940  1.00 29.52 ? 296 LYS A N   1 
ATOM   2282 C  CA  . LYS A 1 295 ? -9.586  -37.336 16.165  1.00 31.07 ? 296 LYS A CA  1 
ATOM   2283 C  C   . LYS A 1 295 ? -9.621  -38.862 16.157  1.00 27.85 ? 296 LYS A C   1 
ATOM   2284 O  O   . LYS A 1 295 ? -10.413 -39.478 15.449  1.00 28.11 ? 296 LYS A O   1 
ATOM   2285 C  CB  . LYS A 1 295 ? -10.358 -36.798 17.376  1.00 34.09 ? 296 LYS A CB  1 
ATOM   2286 C  CG  . LYS A 1 295 ? -10.361 -35.270 17.497  1.00 39.03 ? 296 LYS A CG  1 
ATOM   2287 C  CD  . LYS A 1 295 ? -9.043  -34.754 18.074  1.00 43.51 ? 296 LYS A CD  1 
ATOM   2288 C  CE  . LYS A 1 295 ? -8.905  -33.225 17.946  1.00 48.51 ? 296 LYS A CE  1 
ATOM   2289 N  NZ  . LYS A 1 295 ? -8.194  -32.811 16.687  1.00 41.60 ? 296 LYS A NZ  1 
ATOM   2290 N  N   . VAL A 1 296 ? -8.760  -39.474 16.957  1.00 24.45 ? 297 VAL A N   1 
ATOM   2291 C  CA  . VAL A 1 296 ? -8.774  -40.913 17.071  1.00 27.76 ? 297 VAL A CA  1 
ATOM   2292 C  C   . VAL A 1 296 ? -10.134 -41.368 17.611  1.00 29.89 ? 297 VAL A C   1 
ATOM   2293 O  O   . VAL A 1 296 ? -10.654 -40.795 18.563  1.00 29.10 ? 297 VAL A O   1 
ATOM   2294 C  CB  . VAL A 1 296 ? -7.628  -41.411 17.957  1.00 25.35 ? 297 VAL A CB  1 
ATOM   2295 C  CG1 . VAL A 1 296 ? -7.740  -42.909 18.150  1.00 25.46 ? 297 VAL A CG1 1 
ATOM   2296 C  CG2 . VAL A 1 296 ? -6.292  -41.044 17.322  1.00 26.82 ? 297 VAL A CG2 1 
ATOM   2297 N  N   . SER A 1 297 ? -10.718 -42.374 16.966  1.00 26.52 ? 298 SER A N   1 
ATOM   2298 C  CA  . SER A 1 297 ? -12.025 -42.902 17.356  1.00 29.80 ? 298 SER A CA  1 
ATOM   2299 C  C   . SER A 1 297 ? -11.924 -44.329 17.905  1.00 28.32 ? 298 SER A C   1 
ATOM   2300 O  O   . SER A 1 297 ? -11.376 -45.206 17.246  1.00 24.78 ? 298 SER A O   1 
ATOM   2301 C  CB  . SER A 1 297 ? -12.960 -42.893 16.148  1.00 29.52 ? 298 SER A CB  1 
ATOM   2302 O  OG  . SER A 1 297 ? -13.986 -43.855 16.287  1.00 30.08 ? 298 SER A OG  1 
ATOM   2303 N  N   . PRO A 1 298 ? -12.464 -44.567 19.113  1.00 29.35 ? 299 PRO A N   1 
ATOM   2304 C  CA  . PRO A 1 298 ? -12.432 -45.925 19.671  1.00 27.49 ? 299 PRO A CA  1 
ATOM   2305 C  C   . PRO A 1 298 ? -13.037 -46.949 18.710  1.00 26.06 ? 299 PRO A C   1 
ATOM   2306 O  O   . PRO A 1 298 ? -12.496 -48.041 18.562  1.00 25.42 ? 299 PRO A O   1 
ATOM   2307 C  CB  . PRO A 1 298 ? -13.296 -45.809 20.939  1.00 27.93 ? 299 PRO A CB  1 
ATOM   2308 C  CG  . PRO A 1 298 ? -13.193 -44.362 21.330  1.00 32.23 ? 299 PRO A CG  1 
ATOM   2309 C  CD  . PRO A 1 298 ? -13.096 -43.598 20.030  1.00 30.47 ? 299 PRO A CD  1 
ATOM   2310 N  N   . GLU A 1 299 ? -14.146 -46.602 18.068  1.00 28.88 ? 300 GLU A N   1 
ATOM   2311 C  CA  . GLU A 1 299 ? -14.797 -47.536 17.156  1.00 31.74 ? 300 GLU A CA  1 
ATOM   2312 C  C   . GLU A 1 299 ? -13.942 -47.786 15.909  1.00 30.71 ? 300 GLU A C   1 
ATOM   2313 O  O   . GLU A 1 299 ? -13.847 -48.913 15.428  1.00 28.69 ? 300 GLU A O   1 
ATOM   2314 C  CB  . GLU A 1 299 ? -16.188 -47.023 16.770  1.00 35.56 ? 300 GLU A CB  1 
ATOM   2315 C  CG  . GLU A 1 299 ? -17.149 -48.101 16.301  1.00 43.17 ? 300 GLU A CG  1 
ATOM   2316 C  CD  . GLU A 1 299 ? -18.597 -47.618 16.290  1.00 54.79 ? 300 GLU A CD  1 
ATOM   2317 O  OE1 . GLU A 1 299 ? -19.084 -47.185 17.363  1.00 59.69 ? 300 GLU A OE1 1 
ATOM   2318 O  OE2 . GLU A 1 299 ? -19.244 -47.662 15.213  1.00 53.79 ? 300 GLU A OE2 1 
ATOM   2319 N  N   . ALA A 1 300 ? -13.322 -46.733 15.388  1.00 27.38 ? 301 ALA A N   1 
ATOM   2320 C  CA  . ALA A 1 300 ? -12.411 -46.889 14.257  1.00 26.04 ? 301 ALA A CA  1 
ATOM   2321 C  C   . ALA A 1 300 ? -11.232 -47.787 14.615  1.00 25.39 ? 301 ALA A C   1 
ATOM   2322 O  O   . ALA A 1 300 ? -10.806 -48.604 13.812  1.00 24.31 ? 301 ALA A O   1 
ATOM   2323 C  CB  . ALA A 1 300 ? -11.917 -45.546 13.779  1.00 23.00 ? 301 ALA A CB  1 
ATOM   2324 N  N   . VAL A 1 301 ? -10.685 -47.620 15.813  1.00 23.94 ? 302 VAL A N   1 
ATOM   2325 C  CA  . VAL A 1 301 ? -9.554  -48.441 16.228  1.00 24.17 ? 302 VAL A CA  1 
ATOM   2326 C  C   . VAL A 1 301 ? -9.988  -49.909 16.306  1.00 27.13 ? 302 VAL A C   1 
ATOM   2327 O  O   . VAL A 1 301 ? -9.281  -50.802 15.823  1.00 26.81 ? 302 VAL A O   1 
ATOM   2328 C  CB  . VAL A 1 301 ? -8.960  -47.974 17.576  1.00 23.95 ? 302 VAL A CB  1 
ATOM   2329 C  CG1 . VAL A 1 301 ? -7.888  -48.960 18.068  1.00 26.83 ? 302 VAL A CG1 1 
ATOM   2330 C  CG2 . VAL A 1 301 ? -8.389  -46.544 17.446  1.00 23.24 ? 302 VAL A CG2 1 
ATOM   2331 N  N   . LYS A 1 302 ? -11.171 -50.158 16.850  1.00 27.38 ? 303 LYS A N   1 
ATOM   2332 C  CA  . LYS A 1 302 ? -11.719 -51.510 16.932  1.00 29.41 ? 303 LYS A CA  1 
ATOM   2333 C  C   . LYS A 1 302 ? -11.924 -52.116 15.561  1.00 29.63 ? 303 LYS A C   1 
ATOM   2334 O  O   . LYS A 1 302 ? -11.504 -53.194 15.303  1.00 28.21 ? 303 LYS A O   1 
ATOM   2335 C  CB  . LYS A 1 302 ? -13.036 -51.525 17.696  1.00 29.73 ? 303 LYS A CB  1 
ATOM   2336 C  CG  . LYS A 1 302 ? -12.935 -51.553 19.224  1.00 35.69 ? 303 LYS A CG  1 
ATOM   2337 C  CD  . LYS A 1 302 ? -14.159 -52.222 19.826  1.00 40.25 ? 303 LYS A CD  1 
ATOM   2338 C  CE  . LYS A 1 302 ? -14.181 -52.262 21.292  1.00 38.73 ? 303 LYS A CE  1 
ATOM   2339 N  NZ  . LYS A 1 302 ? -15.442 -52.849 21.693  1.00 37.63 ? 303 LYS A NZ  1 
ATOM   2340 N  N   . LYS A 1 303 ? -12.551 -51.379 14.676  1.00 28.81 ? 304 LYS A N   1 
ATOM   2341 C  CA  . LYS A 1 303 ? -12.800 -51.870 13.333  1.00 28.85 ? 304 LYS A CA  1 
ATOM   2342 C  C   . LYS A 1 303 ? -11.511 -52.289 12.640  1.00 28.43 ? 304 LYS A C   1 
ATOM   2343 O  O   . LYS A 1 303 ? -11.462 -53.258 11.947  1.00 29.71 ? 304 LYS A O   1 
ATOM   2344 C  CB  . LYS A 1 303 ? -13.526 -50.825 12.516  1.00 28.02 ? 304 LYS A CB  1 
ATOM   2345 C  CG  . LYS A 1 303 ? -14.934 -50.666 12.895  1.00 33.77 ? 304 LYS A CG  1 
ATOM   2346 C  CD  . LYS A 1 303 ? -15.596 -49.540 12.208  1.00 35.03 ? 304 LYS A CD  1 
ATOM   2347 C  CE  . LYS A 1 303 ? -17.094 -49.558 12.503  1.00 39.71 ? 304 LYS A CE  1 
ATOM   2348 N  NZ  . LYS A 1 303 ? -17.841 -48.452 11.899  1.00 42.99 ? 304 LYS A NZ  1 
ATOM   2349 N  N   . GLU A 1 304 ? -10.469 -51.530 12.870  1.00 29.98 ? 305 GLU A N   1 
ATOM   2350 C  CA  . GLU A 1 304 ? -9.195  -51.834 12.292  1.00 30.21 ? 305 GLU A CA  1 
ATOM   2351 C  C   . GLU A 1 304 ? -8.586  -53.087 12.893  1.00 30.90 ? 305 GLU A C   1 
ATOM   2352 O  O   . GLU A 1 304 ? -8.050  -53.895 12.191  1.00 28.21 ? 305 GLU A O   1 
ATOM   2353 C  CB  . GLU A 1 304 ? -8.268  -50.653 12.456  1.00 29.53 ? 305 GLU A CB  1 
ATOM   2354 C  CG  . GLU A 1 304 ? -6.947  -50.806 11.828  1.00 31.90 ? 305 GLU A CG  1 
ATOM   2355 C  CD  . GLU A 1 304 ? -6.828  -50.255 10.427  1.00 38.56 ? 305 GLU A CD  1 
ATOM   2356 O  OE1 . GLU A 1 304 ? -7.769  -50.158 9.651   1.00 38.97 ? 305 GLU A OE1 1 
ATOM   2357 O  OE2 . GLU A 1 304 ? -5.714  -49.940 10.094  1.00 41.59 ? 305 GLU A OE2 1 
ATOM   2358 N  N   . ALA A 1 305 ? -8.696  -53.233 14.195  1.00 25.55 ? 306 ALA A N   1 
ATOM   2359 C  CA  . ALA A 1 305 ? -8.206  -54.456 14.818  1.00 28.23 ? 306 ALA A CA  1 
ATOM   2360 C  C   . ALA A 1 305 ? -8.980  -55.676 14.297  1.00 27.64 ? 306 ALA A C   1 
ATOM   2361 O  O   . ALA A 1 305 ? -8.400  -56.732 14.043  1.00 28.76 ? 306 ALA A O   1 
ATOM   2362 C  CB  . ALA A 1 305 ? -8.294  -54.360 16.351  1.00 27.30 ? 306 ALA A CB  1 
ATOM   2363 N  N   . GLU A 1 306 ? -10.287 -55.521 14.133  1.00 31.32 ? 307 GLU A N   1 
ATOM   2364 C  CA  . GLU A 1 306 ? -11.114 -56.591 13.580  1.00 31.71 ? 307 GLU A CA  1 
ATOM   2365 C  C   . GLU A 1 306 ? -10.698 -56.934 12.156  1.00 32.27 ? 307 GLU A C   1 
ATOM   2366 O  O   . GLU A 1 306 ? -10.581 -58.111 11.799  1.00 30.69 ? 307 GLU A O   1 
ATOM   2367 C  CB  . GLU A 1 306 ? -12.590 -56.199 13.625  1.00 32.22 ? 307 GLU A CB  1 
ATOM   2368 C  CG  . GLU A 1 306 ? -13.139 -56.157 15.042  1.00 32.98 ? 307 GLU A CG  1 
ATOM   2369 C  CD  . GLU A 1 306 ? -14.255 -55.147 15.211  1.00 33.90 ? 307 GLU A CD  1 
ATOM   2370 O  OE1 . GLU A 1 306 ? -14.865 -54.744 14.194  1.00 35.01 ? 307 GLU A OE1 1 
ATOM   2371 O  OE2 . GLU A 1 306 ? -14.512 -54.742 16.369  1.00 36.54 ? 307 GLU A OE2 1 
ATOM   2372 N  N   . LEU A 1 307 ? -10.460 -55.904 11.346  1.00 26.89 ? 308 LEU A N   1 
ATOM   2373 C  CA  . LEU A 1 307 ? -10.052 -56.118 9.964   1.00 24.72 ? 308 LEU A CA  1 
ATOM   2374 C  C   . LEU A 1 307 ? -8.712  -56.833 9.911   1.00 25.15 ? 308 LEU A C   1 
ATOM   2375 O  O   . LEU A 1 307 ? -8.530  -57.752 9.113   1.00 27.16 ? 308 LEU A O   1 
ATOM   2376 C  CB  . LEU A 1 307 ? -9.967  -54.792 9.201   1.00 21.89 ? 308 LEU A CB  1 
ATOM   2377 C  CG  . LEU A 1 307 ? -9.414  -54.904 7.776   1.00 25.19 ? 308 LEU A CG  1 
ATOM   2378 C  CD1 . LEU A 1 307 ? -10.309 -55.825 6.935   1.00 24.73 ? 308 LEU A CD1 1 
ATOM   2379 C  CD2 . LEU A 1 307 ? -9.271  -53.518 7.121   1.00 23.21 ? 308 LEU A CD2 1 
ATOM   2380 N  N   . ASP A 1 308 ? -7.776  -56.419 10.760  1.00 25.57 ? 309 ASP A N   1 
ATOM   2381 C  CA  . ASP A 1 308 ? -6.454  -57.032 10.758  1.00 28.11 ? 309 ASP A CA  1 
ATOM   2382 C  C   . ASP A 1 308 ? -6.519  -58.516 11.129  1.00 29.06 ? 309 ASP A C   1 
ATOM   2383 O  O   . ASP A 1 308 ? -5.836  -59.338 10.517  1.00 29.33 ? 309 ASP A O   1 
ATOM   2384 C  CB  . ASP A 1 308 ? -5.489  -56.299 11.688  1.00 27.84 ? 309 ASP A CB  1 
ATOM   2385 C  CG  . ASP A 1 308 ? -5.060  -54.941 11.139  1.00 29.19 ? 309 ASP A CG  1 
ATOM   2386 O  OD1 . ASP A 1 308 ? -5.380  -54.628 9.971   1.00 25.73 ? 309 ASP A OD1 1 
ATOM   2387 O  OD2 . ASP A 1 308 ? -4.397  -54.199 11.875  1.00 25.58 ? 309 ASP A OD2 1 
ATOM   2388 N  N   . LYS A 1 309 ? -7.339  -58.841 12.124  1.00 33.21 ? 310 LYS A N   1 
ATOM   2389 C  CA  . LYS A 1 309 ? -7.508  -60.224 12.556  1.00 36.47 ? 310 LYS A CA  1 
ATOM   2390 C  C   . LYS A 1 309 ? -8.184  -61.035 11.461  1.00 34.88 ? 310 LYS A C   1 
ATOM   2391 O  O   . LYS A 1 309 ? -7.794  -62.173 11.187  1.00 34.90 ? 310 LYS A O   1 
ATOM   2392 C  CB  . LYS A 1 309 ? -8.321  -60.297 13.847  1.00 37.28 ? 310 LYS A CB  1 
ATOM   2393 C  CG  . LYS A 1 309 ? -8.275  -61.664 14.520  1.00 43.97 ? 310 LYS A CG  1 
ATOM   2394 C  CD  . LYS A 1 309 ? -6.852  -61.989 14.978  1.00 53.21 ? 310 LYS A CD  1 
ATOM   2395 C  CE  . LYS A 1 309 ? -6.772  -63.326 15.715  1.00 56.73 ? 310 LYS A CE  1 
ATOM   2396 N  NZ  . LYS A 1 309 ? -7.014  -64.482 14.810  1.00 57.01 ? 310 LYS A NZ  1 
ATOM   2397 N  N   . TYR A 1 310 ? -9.192  -60.439 10.829  1.00 29.40 ? 311 TYR A N   1 
ATOM   2398 C  CA  . TYR A 1 310 ? -9.855  -61.074 9.691   1.00 32.73 ? 311 TYR A CA  1 
ATOM   2399 C  C   . TYR A 1 310 ? -8.855  -61.388 8.581   1.00 30.18 ? 311 TYR A C   1 
ATOM   2400 O  O   . TYR A 1 310 ? -8.853  -62.490 8.021   1.00 31.90 ? 311 TYR A O   1 
ATOM   2401 C  CB  . TYR A 1 310 ? -10.999 -60.201 9.156   1.00 28.19 ? 311 TYR A CB  1 
ATOM   2402 C  CG  . TYR A 1 310 ? -11.791 -60.852 8.039   1.00 30.83 ? 311 TYR A CG  1 
ATOM   2403 C  CD1 . TYR A 1 310 ? -11.446 -60.658 6.709   1.00 33.59 ? 311 TYR A CD1 1 
ATOM   2404 C  CD2 . TYR A 1 310 ? -12.873 -61.674 8.320   1.00 34.96 ? 311 TYR A CD2 1 
ATOM   2405 C  CE1 . TYR A 1 310 ? -12.159 -61.256 5.687   1.00 32.89 ? 311 TYR A CE1 1 
ATOM   2406 C  CE2 . TYR A 1 310 ? -13.595 -62.284 7.303   1.00 38.38 ? 311 TYR A CE2 1 
ATOM   2407 C  CZ  . TYR A 1 310 ? -13.230 -62.069 5.987   1.00 38.09 ? 311 TYR A CZ  1 
ATOM   2408 O  OH  . TYR A 1 310 ? -13.941 -62.666 4.972   1.00 39.06 ? 311 TYR A OH  1 
ATOM   2409 N  N   . LEU A 1 311 ? -7.996  -60.422 8.264   1.00 27.67 ? 312 LEU A N   1 
ATOM   2410 C  CA  . LEU A 1 311 ? -7.019  -60.612 7.203   1.00 26.78 ? 312 LEU A CA  1 
ATOM   2411 C  C   . LEU A 1 311 ? -6.044  -61.726 7.586   1.00 27.42 ? 312 LEU A C   1 
ATOM   2412 O  O   . LEU A 1 311 ? -5.680  -62.557 6.754   1.00 27.84 ? 312 LEU A O   1 
ATOM   2413 C  CB  . LEU A 1 311 ? -6.264  -59.304 6.905   1.00 24.80 ? 312 LEU A CB  1 
ATOM   2414 C  CG  . LEU A 1 311 ? -7.085  -58.213 6.197   1.00 26.35 ? 312 LEU A CG  1 
ATOM   2415 C  CD1 . LEU A 1 311 ? -6.239  -56.941 6.000   1.00 23.52 ? 312 LEU A CD1 1 
ATOM   2416 C  CD2 . LEU A 1 311 ? -7.616  -58.738 4.859   1.00 26.64 ? 312 LEU A CD2 1 
ATOM   2417 N  N   . GLU A 1 312 ? -5.626  -61.735 8.848   1.00 31.50 ? 313 GLU A N   1 
ATOM   2418 C  CA  . GLU A 1 312 ? -4.696  -62.751 9.338   1.00 34.23 ? 313 GLU A CA  1 
ATOM   2419 C  C   . GLU A 1 312 ? -5.289  -64.163 9.198   1.00 35.83 ? 313 GLU A C   1 
ATOM   2420 O  O   . GLU A 1 312 ? -4.609  -65.088 8.762   1.00 35.43 ? 313 GLU A O   1 
ATOM   2421 C  CB  . GLU A 1 312 ? -4.265  -62.435 10.779  1.00 35.20 ? 313 GLU A CB  1 
ATOM   2422 C  CG  . GLU A 1 312 ? -3.531  -61.089 10.864  1.00 41.48 ? 313 GLU A CG  1 
ATOM   2423 C  CD  . GLU A 1 312 ? -3.139  -60.649 12.269  1.00 43.90 ? 313 GLU A CD  1 
ATOM   2424 O  OE1 . GLU A 1 312 ? -3.953  -60.793 13.210  1.00 46.12 ? 313 GLU A OE1 1 
ATOM   2425 O  OE2 . GLU A 1 312 ? -2.010  -60.130 12.421  1.00 46.85 ? 313 GLU A OE2 1 
ATOM   2426 N  N   . CYS A 1 313 ? -6.567  -64.312 9.529   1.00 34.84 ? 314 CYS A N   1 
ATOM   2427 C  CA  . CYS A 1 313 ? -7.232  -65.599 9.370   1.00 36.46 ? 314 CYS A CA  1 
ATOM   2428 C  C   . CYS A 1 313 ? -7.347  -65.998 7.907   1.00 38.17 ? 314 CYS A C   1 
ATOM   2429 O  O   . CYS A 1 313 ? -7.123  -67.155 7.565   1.00 41.36 ? 314 CYS A O   1 
ATOM   2430 C  CB  . CYS A 1 313 ? -8.606  -65.581 10.035  1.00 36.00 ? 314 CYS A CB  1 
ATOM   2431 S  SG  . CYS A 1 313 ? -8.505  -65.392 11.817  1.00 46.69 ? 314 CYS A SG  1 
ATOM   2432 N  N   . ARG A 1 314 ? -7.687  -65.051 7.037   1.00 30.84 ? 315 ARG A N   1 
ATOM   2433 C  CA  . ARG A 1 314 ? -7.777  -65.360 5.617   1.00 34.93 ? 315 ARG A CA  1 
ATOM   2434 C  C   . ARG A 1 314 ? -6.437  -65.892 5.115   1.00 38.45 ? 315 ARG A C   1 
ATOM   2435 O  O   . ARG A 1 314 ? -6.384  -66.910 4.418   1.00 35.89 ? 315 ARG A O   1 
ATOM   2436 C  CB  . ARG A 1 314 ? -8.197  -64.138 4.795   1.00 35.03 ? 315 ARG A CB  1 
ATOM   2437 C  CG  . ARG A 1 314 ? -9.632  -63.680 5.011   1.00 36.47 ? 315 ARG A CG  1 
ATOM   2438 C  CD  . ARG A 1 314 ? -10.621 -64.515 4.219   1.00 43.25 ? 315 ARG A CD  1 
ATOM   2439 N  NE  . ARG A 1 314 ? -10.582 -65.912 4.618   1.00 46.12 ? 315 ARG A NE  1 
ATOM   2440 C  CZ  . ARG A 1 314 ? -10.384 -66.935 3.795   1.00 44.85 ? 315 ARG A CZ  1 
ATOM   2441 N  NH1 . ARG A 1 314 ? -10.215 -66.745 2.493   1.00 45.48 ? 315 ARG A NH1 1 
ATOM   2442 N  NH2 . ARG A 1 314 ? -10.364 -68.163 4.285   1.00 48.99 ? 315 ARG A NH2 1 
ATOM   2443 N  N   . VAL A 1 315 ? -5.356  -65.201 5.472   1.00 30.84 ? 316 VAL A N   1 
ATOM   2444 C  CA  . VAL A 1 315 ? -4.023  -65.619 5.049   1.00 31.59 ? 316 VAL A CA  1 
ATOM   2445 C  C   . VAL A 1 315 ? -3.704  -67.040 5.527   1.00 35.33 ? 316 VAL A C   1 
ATOM   2446 O  O   . VAL A 1 315 ? -3.206  -67.857 4.757   1.00 33.98 ? 316 VAL A O   1 
ATOM   2447 C  CB  . VAL A 1 315 ? -2.923  -64.647 5.522   1.00 32.46 ? 316 VAL A CB  1 
ATOM   2448 C  CG1 . VAL A 1 315 ? -1.539  -65.226 5.233   1.00 32.69 ? 316 VAL A CG1 1 
ATOM   2449 C  CG2 . VAL A 1 315 ? -3.071  -63.290 4.831   1.00 27.90 ? 316 VAL A CG2 1 
ATOM   2450 N  N   . GLU A 1 316 ? -3.994  -67.320 6.793   1.00 43.36 ? 317 GLU A N   1 
ATOM   2451 C  CA  . GLU A 1 316 ? -3.790  -68.649 7.354   1.00 47.13 ? 317 GLU A CA  1 
ATOM   2452 C  C   . GLU A 1 316 ? -4.464  -69.712 6.502   1.00 47.24 ? 317 GLU A C   1 
ATOM   2453 O  O   . GLU A 1 316 ? -3.865  -70.731 6.172   1.00 47.45 ? 317 GLU A O   1 
ATOM   2454 C  CB  . GLU A 1 316 ? -4.371  -68.731 8.763   1.00 47.58 ? 317 GLU A CB  1 
ATOM   2455 C  CG  . GLU A 1 316 ? -3.654  -67.914 9.809   1.00 52.09 ? 317 GLU A CG  1 
ATOM   2456 C  CD  . GLU A 1 316 ? -4.185  -68.200 11.201  1.00 59.21 ? 317 GLU A CD  1 
ATOM   2457 O  OE1 . GLU A 1 316 ? -4.138  -69.380 11.612  1.00 64.68 ? 317 GLU A OE1 1 
ATOM   2458 O  OE2 . GLU A 1 316 ? -4.664  -67.258 11.873  1.00 57.78 ? 317 GLU A OE2 1 
ATOM   2459 N  N   . GLU A 1 317 ? -5.723  -69.465 6.164   1.00 48.52 ? 318 GLU A N   1 
ATOM   2460 C  CA  . GLU A 1 317 ? -6.527  -70.408 5.403   1.00 52.32 ? 318 GLU A CA  1 
ATOM   2461 C  C   . GLU A 1 317 ? -6.057  -70.527 3.961   1.00 53.40 ? 318 GLU A C   1 
ATOM   2462 O  O   . GLU A 1 317 ? -5.952  -71.630 3.428   1.00 55.60 ? 318 GLU A O   1 
ATOM   2463 C  CB  . GLU A 1 317 ? -8.000  -69.999 5.442   1.00 50.96 ? 318 GLU A CB  1 
ATOM   2464 C  CG  . GLU A 1 317 ? -8.666  -70.194 6.794   1.00 58.24 ? 318 GLU A CG  1 
ATOM   2465 C  CD  . GLU A 1 317 ? -9.019  -71.649 7.068   1.00 68.72 ? 318 GLU A CD  1 
ATOM   2466 O  OE1 . GLU A 1 317 ? -9.931  -72.176 6.391   1.00 70.10 ? 318 GLU A OE1 1 
ATOM   2467 O  OE2 . GLU A 1 317 ? -8.385  -72.265 7.958   1.00 71.23 ? 318 GLU A OE2 1 
ATOM   2468 N  N   . ILE A 1 318 ? -5.784  -69.391 3.327   1.00 41.75 ? 319 ILE A N   1 
ATOM   2469 C  CA  . ILE A 1 318 ? -5.344  -69.389 1.937   1.00 43.48 ? 319 ILE A CA  1 
ATOM   2470 C  C   . ILE A 1 318 ? -4.026  -70.137 1.791   1.00 48.52 ? 319 ILE A C   1 
ATOM   2471 O  O   . ILE A 1 318 ? -3.823  -70.889 0.833   1.00 50.08 ? 319 ILE A O   1 
ATOM   2472 C  CB  . ILE A 1 318 ? -5.189  -67.961 1.387   1.00 39.23 ? 319 ILE A CB  1 
ATOM   2473 C  CG1 . ILE A 1 318 ? -6.550  -67.274 1.322   1.00 36.91 ? 319 ILE A CG1 1 
ATOM   2474 C  CG2 . ILE A 1 318 ? -4.548  -67.989 0.006   1.00 38.08 ? 319 ILE A CG2 1 
ATOM   2475 C  CD1 . ILE A 1 318 ? -6.476  -65.812 0.943   1.00 35.55 ? 319 ILE A CD1 1 
ATOM   2476 N  N   . ILE A 1 319 ? -3.140  -69.934 2.759   1.00 54.76 ? 320 ILE A N   1 
ATOM   2477 C  CA  . ILE A 1 319 ? -1.835  -70.580 2.766   1.00 59.68 ? 320 ILE A CA  1 
ATOM   2478 C  C   . ILE A 1 319 ? -1.975  -72.092 2.974   1.00 63.43 ? 320 ILE A C   1 
ATOM   2479 O  O   . ILE A 1 319 ? -0.999  -72.838 2.886   1.00 69.80 ? 320 ILE A O   1 
ATOM   2480 C  CB  . ILE A 1 319 ? -0.917  -69.945 3.839   1.00 58.43 ? 320 ILE A CB  1 
ATOM   2481 C  CG1 . ILE A 1 319 ? 0.386   -69.462 3.204   1.00 60.58 ? 320 ILE A CG1 1 
ATOM   2482 C  CG2 . ILE A 1 319 ? -0.674  -70.903 5.000   1.00 58.80 ? 320 ILE A CG2 1 
ATOM   2483 C  CD1 . ILE A 1 319 ? 1.314   -68.763 4.180   1.00 56.85 ? 320 ILE A CD1 1 
ATOM   2484 N  N   . LYS A 1 320 ? -3.207  -72.526 3.229   1.00 62.21 ? 321 LYS A N   1 
ATOM   2485 C  CA  . LYS A 1 320 ? -3.555  -73.938 3.380   1.00 65.10 ? 321 LYS A CA  1 
ATOM   2486 C  C   . LYS A 1 320 ? -3.211  -74.451 4.776   1.00 65.48 ? 321 LYS A C   1 
ATOM   2487 O  O   . LYS A 1 320 ? -3.949  -74.213 5.734   1.00 63.51 ? 321 LYS A O   1 
ATOM   2488 C  CB  . LYS A 1 320 ? -2.886  -74.800 2.299   1.00 70.41 ? 321 LYS A CB  1 
ATOM   2489 C  CG  . LYS A 1 320 ? -3.006  -74.259 0.868   1.00 69.48 ? 321 LYS A CG  1 
ATOM   2490 C  CD  . LYS A 1 320 ? -4.137  -74.909 0.080   1.00 69.81 ? 321 LYS A CD  1 
ATOM   2491 C  CE  . LYS A 1 320 ? -5.449  -74.168 0.262   1.00 67.71 ? 321 LYS A CE  1 
ATOM   2492 N  NZ  . LYS A 1 320 ? -5.958  -74.273 1.654   1.00 65.38 ? 321 LYS A NZ  1 
ATOM   2493 N  N   . GLY A 1 325 ? 0.631   -76.234 -1.901  1.00 87.08 ? 326 GLY A N   1 
ATOM   2494 C  CA  . GLY A 1 325 ? 1.910   -75.914 -2.510  1.00 85.68 ? 326 GLY A CA  1 
ATOM   2495 C  C   . GLY A 1 325 ? 2.487   -74.592 -2.032  1.00 75.28 ? 326 GLY A C   1 
ATOM   2496 O  O   . GLY A 1 325 ? 3.526   -74.147 -2.519  1.00 73.15 ? 326 GLY A O   1 
ATOM   2497 N  N   . VAL A 1 326 ? 1.810   -73.967 -1.074  1.00 69.43 ? 327 VAL A N   1 
ATOM   2498 C  CA  . VAL A 1 326 ? 2.247   -72.688 -0.509  1.00 62.95 ? 327 VAL A CA  1 
ATOM   2499 C  C   . VAL A 1 326 ? 2.379   -71.583 -1.561  1.00 55.69 ? 327 VAL A C   1 
ATOM   2500 O  O   . VAL A 1 326 ? 3.425   -71.423 -2.188  1.00 51.82 ? 327 VAL A O   1 
ATOM   2501 C  CB  . VAL A 1 326 ? 3.563   -72.825 0.289   1.00 62.55 ? 327 VAL A CB  1 
ATOM   2502 C  CG1 . VAL A 1 326 ? 4.080   -71.458 0.698   1.00 59.83 ? 327 VAL A CG1 1 
ATOM   2503 C  CG2 . VAL A 1 326 ? 3.349   -73.698 1.516   1.00 63.98 ? 327 VAL A CG2 1 
ATOM   2504 N  N   . PRO A 1 327 ? 1.307   -70.806 -1.746  1.00 47.06 ? 328 PRO A N   1 
ATOM   2505 C  CA  . PRO A 1 327 ? 1.297   -69.696 -2.704  1.00 44.96 ? 328 PRO A CA  1 
ATOM   2506 C  C   . PRO A 1 327 ? 2.279   -68.611 -2.283  1.00 39.60 ? 328 PRO A C   1 
ATOM   2507 O  O   . PRO A 1 327 ? 2.507   -68.455 -1.082  1.00 39.48 ? 328 PRO A O   1 
ATOM   2508 C  CB  . PRO A 1 327 ? -0.135  -69.172 -2.606  1.00 43.39 ? 328 PRO A CB  1 
ATOM   2509 C  CG  . PRO A 1 327 ? -0.598  -69.578 -1.248  1.00 43.73 ? 328 PRO A CG  1 
ATOM   2510 C  CD  . PRO A 1 327 ? 0.050   -70.901 -0.986  1.00 49.05 ? 328 PRO A CD  1 
ATOM   2511 N  N   . ASP A 1 328 ? 2.868   -67.890 -3.233  1.00 42.89 ? 329 ASP A N   1 
ATOM   2512 C  CA  . ASP A 1 328 ? 3.722   -66.765 -2.868  1.00 42.01 ? 329 ASP A CA  1 
ATOM   2513 C  C   . ASP A 1 328 ? 2.847   -65.579 -2.456  1.00 42.73 ? 329 ASP A C   1 
ATOM   2514 O  O   . ASP A 1 328 ? 1.628   -65.620 -2.620  1.00 40.54 ? 329 ASP A O   1 
ATOM   2515 C  CB  . ASP A 1 328 ? 4.696   -66.384 -3.993  1.00 43.44 ? 329 ASP A CB  1 
ATOM   2516 C  CG  . ASP A 1 328 ? 3.995   -66.033 -5.297  1.00 48.90 ? 329 ASP A CG  1 
ATOM   2517 O  OD1 . ASP A 1 328 ? 2.827   -65.592 -5.261  1.00 48.57 ? 329 ASP A OD1 1 
ATOM   2518 O  OD2 . ASP A 1 328 ? 4.624   -66.191 -6.366  1.00 52.75 ? 329 ASP A OD2 1 
ATOM   2519 N  N   . LEU A 1 329 ? 3.466   -64.537 -1.911  1.00 43.90 ? 330 LEU A N   1 
ATOM   2520 C  CA  . LEU A 1 329 ? 2.713   -63.396 -1.398  1.00 40.55 ? 330 LEU A CA  1 
ATOM   2521 C  C   . LEU A 1 329 ? 1.880   -62.752 -2.506  1.00 42.33 ? 330 LEU A C   1 
ATOM   2522 O  O   . LEU A 1 329 ? 0.714   -62.403 -2.303  1.00 41.15 ? 330 LEU A O   1 
ATOM   2523 C  CB  . LEU A 1 329 ? 3.652   -62.378 -0.757  1.00 40.35 ? 330 LEU A CB  1 
ATOM   2524 C  CG  . LEU A 1 329 ? 2.983   -61.121 -0.196  1.00 40.83 ? 330 LEU A CG  1 
ATOM   2525 C  CD1 . LEU A 1 329 ? 1.926   -61.489 0.841   1.00 37.37 ? 330 LEU A CD1 1 
ATOM   2526 C  CD2 . LEU A 1 329 ? 4.029   -60.183 0.394   1.00 40.00 ? 330 LEU A CD2 1 
ATOM   2527 N  N   . VAL A 1 330 ? 2.478   -62.613 -3.684  1.00 40.21 ? 331 VAL A N   1 
ATOM   2528 C  CA  . VAL A 1 330 ? 1.765   -62.084 -4.836  1.00 41.25 ? 331 VAL A CA  1 
ATOM   2529 C  C   . VAL A 1 330 ? 0.447   -62.825 -5.060  1.00 43.00 ? 331 VAL A C   1 
ATOM   2530 O  O   . VAL A 1 330 ? -0.597  -62.209 -5.306  1.00 41.79 ? 331 VAL A O   1 
ATOM   2531 C  CB  . VAL A 1 330 ? 2.621   -62.180 -6.107  1.00 47.46 ? 331 VAL A CB  1 
ATOM   2532 C  CG1 . VAL A 1 330 ? 1.926   -61.482 -7.266  1.00 48.91 ? 331 VAL A CG1 1 
ATOM   2533 C  CG2 . VAL A 1 330 ? 3.989   -61.573 -5.859  1.00 50.38 ? 331 VAL A CG2 1 
ATOM   2534 N  N   . HIS A 1 331 ? 0.493   -64.150 -4.975  1.00 40.89 ? 332 HIS A N   1 
ATOM   2535 C  CA  . HIS A 1 331 ? -0.705  -64.952 -5.195  1.00 43.20 ? 332 HIS A CA  1 
ATOM   2536 C  C   . HIS A 1 331 ? -1.712  -64.864 -4.052  1.00 38.63 ? 332 HIS A C   1 
ATOM   2537 O  O   . HIS A 1 331 ? -2.919  -64.976 -4.268  1.00 36.91 ? 332 HIS A O   1 
ATOM   2538 C  CB  . HIS A 1 331 ? -0.341  -66.411 -5.480  1.00 44.73 ? 332 HIS A CB  1 
ATOM   2539 C  CG  . HIS A 1 331 ? 0.000   -66.667 -6.914  1.00 48.30 ? 332 HIS A CG  1 
ATOM   2540 N  ND1 . HIS A 1 331 ? 1.213   -66.312 -7.464  1.00 49.71 ? 332 HIS A ND1 1 
ATOM   2541 C  CD2 . HIS A 1 331 ? -0.725  -67.212 -7.919  1.00 46.93 ? 332 HIS A CD2 1 
ATOM   2542 C  CE1 . HIS A 1 331 ? 1.227   -66.644 -8.743  1.00 52.56 ? 332 HIS A CE1 1 
ATOM   2543 N  NE2 . HIS A 1 331 ? 0.062   -67.191 -9.044  1.00 52.22 ? 332 HIS A NE2 1 
ATOM   2544 N  N   . VAL A 1 332 ? -1.214  -64.678 -2.836  1.00 34.45 ? 333 VAL A N   1 
ATOM   2545 C  CA  . VAL A 1 332 ? -2.097  -64.510 -1.691  1.00 34.26 ? 333 VAL A CA  1 
ATOM   2546 C  C   . VAL A 1 332 ? -2.873  -63.205 -1.831  1.00 34.28 ? 333 VAL A C   1 
ATOM   2547 O  O   . VAL A 1 332 ? -4.096  -63.171 -1.624  1.00 32.76 ? 333 VAL A O   1 
ATOM   2548 C  CB  . VAL A 1 332 ? -1.323  -64.549 -0.363  1.00 34.12 ? 333 VAL A CB  1 
ATOM   2549 C  CG1 . VAL A 1 332 ? -2.229  -64.155 0.796   1.00 32.81 ? 333 VAL A CG1 1 
ATOM   2550 C  CG2 . VAL A 1 332 ? -0.748  -65.940 -0.135  1.00 33.80 ? 333 VAL A CG2 1 
ATOM   2551 N  N   . MET A 1 333 ? -2.157  -62.143 -2.201  1.00 34.93 ? 334 MET A N   1 
ATOM   2552 C  CA  . MET A 1 333 ? -2.776  -60.845 -2.447  1.00 36.86 ? 334 MET A CA  1 
ATOM   2553 C  C   . MET A 1 333 ? -3.850  -60.942 -3.530  1.00 37.57 ? 334 MET A C   1 
ATOM   2554 O  O   . MET A 1 333 ? -4.930  -60.358 -3.410  1.00 34.69 ? 334 MET A O   1 
ATOM   2555 C  CB  . MET A 1 333 ? -1.717  -59.814 -2.855  1.00 35.68 ? 334 MET A CB  1 
ATOM   2556 C  CG  . MET A 1 333 ? -0.789  -59.390 -1.727  1.00 34.43 ? 334 MET A CG  1 
ATOM   2557 S  SD  . MET A 1 333 ? -1.643  -58.600 -0.337  1.00 35.36 ? 334 MET A SD  1 
ATOM   2558 C  CE  . MET A 1 333 ? -2.398  -57.167 -1.108  1.00 35.62 ? 334 MET A CE  1 
ATOM   2559 N  N   . ARG A 1 334 ? -3.536  -61.689 -4.585  1.00 43.34 ? 335 ARG A N   1 
ATOM   2560 C  CA  . ARG A 1 334 ? -4.443  -61.884 -5.709  1.00 43.48 ? 335 ARG A CA  1 
ATOM   2561 C  C   . ARG A 1 334 ? -5.740  -62.551 -5.256  1.00 41.04 ? 335 ARG A C   1 
ATOM   2562 O  O   . ARG A 1 334 ? -6.835  -62.144 -5.642  1.00 40.30 ? 335 ARG A O   1 
ATOM   2563 C  CB  . ARG A 1 334 ? -3.744  -62.730 -6.775  1.00 46.68 ? 335 ARG A CB  1 
ATOM   2564 C  CG  . ARG A 1 334 ? -4.381  -62.694 -8.149  1.00 57.83 ? 335 ARG A CG  1 
ATOM   2565 C  CD  . ARG A 1 334 ? -3.462  -63.355 -9.169  1.00 61.75 ? 335 ARG A CD  1 
ATOM   2566 N  NE  . ARG A 1 334 ? -2.139  -62.735 -9.168  1.00 64.78 ? 335 ARG A NE  1 
ATOM   2567 C  CZ  . ARG A 1 334 ? -1.078  -63.230 -9.800  1.00 67.89 ? 335 ARG A CZ  1 
ATOM   2568 N  NH1 . ARG A 1 334 ? -1.179  -64.360 -10.491 1.00 66.33 ? 335 ARG A NH1 1 
ATOM   2569 N  NH2 . ARG A 1 334 ? 0.087   -62.594 -9.742  1.00 63.54 ? 335 ARG A NH2 1 
ATOM   2570 N  N   . THR A 1 335 ? -5.605  -63.582 -4.430  1.00 35.30 ? 336 THR A N   1 
ATOM   2571 C  CA  . THR A 1 335 ? -6.754  -64.282 -3.866  1.00 35.86 ? 336 THR A CA  1 
ATOM   2572 C  C   . THR A 1 335 ? -7.575  -63.348 -2.981  1.00 34.01 ? 336 THR A C   1 
ATOM   2573 O  O   . THR A 1 335 ? -8.794  -63.258 -3.113  1.00 35.74 ? 336 THR A O   1 
ATOM   2574 C  CB  . THR A 1 335 ? -6.297  -65.495 -3.042  1.00 34.83 ? 336 THR A CB  1 
ATOM   2575 O  OG1 . THR A 1 335 ? -5.510  -66.354 -3.874  1.00 38.63 ? 336 THR A OG1 1 
ATOM   2576 C  CG2 . THR A 1 335 ? -7.491  -66.271 -2.503  1.00 33.93 ? 336 THR A CG2 1 
ATOM   2577 N  N   . LEU A 1 336 ? -6.899  -62.658 -2.070  1.00 35.85 ? 337 LEU A N   1 
ATOM   2578 C  CA  . LEU A 1 336 ? -7.562  -61.697 -1.195  1.00 34.19 ? 337 LEU A CA  1 
ATOM   2579 C  C   . LEU A 1 336 ? -8.367  -60.678 -2.002  1.00 32.63 ? 337 LEU A C   1 
ATOM   2580 O  O   . LEU A 1 336 ? -9.487  -60.308 -1.637  1.00 31.15 ? 337 LEU A O   1 
ATOM   2581 C  CB  . LEU A 1 336 ? -6.518  -60.989 -0.331  1.00 34.07 ? 337 LEU A CB  1 
ATOM   2582 C  CG  . LEU A 1 336 ? -5.961  -61.864 0.789   1.00 34.27 ? 337 LEU A CG  1 
ATOM   2583 C  CD1 . LEU A 1 336 ? -4.823  -61.162 1.519   1.00 31.91 ? 337 LEU A CD1 1 
ATOM   2584 C  CD2 . LEU A 1 336 ? -7.089  -62.267 1.751   1.00 30.29 ? 337 LEU A CD2 1 
ATOM   2585 N  N   . ALA A 1 337 ? -7.790  -60.222 -3.105  1.00 33.84 ? 338 ALA A N   1 
ATOM   2586 C  CA  . ALA A 1 337 ? -8.450  -59.212 -3.921  1.00 36.89 ? 338 ALA A CA  1 
ATOM   2587 C  C   . ALA A 1 337 ? -9.717  -59.781 -4.560  1.00 36.18 ? 338 ALA A C   1 
ATOM   2588 O  O   . ALA A 1 337 ? -10.730 -59.089 -4.680  1.00 38.10 ? 338 ALA A O   1 
ATOM   2589 C  CB  . ALA A 1 337 ? -7.491  -58.671 -4.983  1.00 35.60 ? 338 ALA A CB  1 
ATOM   2590 N  N   . SER A 1 338 ? -9.667  -61.047 -4.961  1.00 37.69 ? 339 SER A N   1 
ATOM   2591 C  CA  . SER A 1 338 ? -10.813 -61.662 -5.620  1.00 36.58 ? 339 SER A CA  1 
ATOM   2592 C  C   . SER A 1 338 ? -11.947 -61.920 -4.633  1.00 40.21 ? 339 SER A C   1 
ATOM   2593 O  O   . SER A 1 338 ? -13.078 -62.183 -5.034  1.00 41.20 ? 339 SER A O   1 
ATOM   2594 C  CB  . SER A 1 338 ? -10.414 -62.960 -6.325  1.00 40.09 ? 339 SER A CB  1 
ATOM   2595 O  OG  . SER A 1 338 ? -10.158 -63.988 -5.385  1.00 40.66 ? 339 SER A OG  1 
ATOM   2596 N  N   . GLU A 1 339 ? -11.649 -61.829 -3.341  1.00 38.68 ? 340 GLU A N   1 
ATOM   2597 C  CA  . GLU A 1 339 ? -12.666 -62.060 -2.318  1.00 38.01 ? 340 GLU A CA  1 
ATOM   2598 C  C   . GLU A 1 339 ? -13.528 -60.827 -2.054  1.00 37.67 ? 340 GLU A C   1 
ATOM   2599 O  O   . GLU A 1 339 ? -14.529 -60.904 -1.340  1.00 39.23 ? 340 GLU A O   1 
ATOM   2600 C  CB  . GLU A 1 339 ? -12.023 -62.572 -1.022  1.00 38.45 ? 340 GLU A CB  1 
ATOM   2601 C  CG  . GLU A 1 339 ? -11.343 -63.936 -1.187  1.00 39.38 ? 340 GLU A CG  1 
ATOM   2602 C  CD  . GLU A 1 339 ? -10.716 -64.459 0.094   1.00 42.45 ? 340 GLU A CD  1 
ATOM   2603 O  OE1 . GLU A 1 339 ? -10.906 -63.833 1.164   1.00 41.86 ? 340 GLU A OE1 1 
ATOM   2604 O  OE2 . GLU A 1 339 ? -10.030 -65.507 0.029   1.00 43.74 ? 340 GLU A OE2 1 
ATOM   2605 N  N   . ASN A 1 340 ? -13.144 -59.695 -2.637  1.00 37.66 ? 341 ASN A N   1 
ATOM   2606 C  CA  . ASN A 1 340 ? -13.882 -58.444 -2.447  1.00 37.03 ? 341 ASN A CA  1 
ATOM   2607 C  C   . ASN A 1 340 ? -14.229 -58.196 -0.978  1.00 38.59 ? 341 ASN A C   1 
ATOM   2608 O  O   . ASN A 1 340 ? -15.393 -58.017 -0.612  1.00 36.83 ? 341 ASN A O   1 
ATOM   2609 C  CB  . ASN A 1 340 ? -15.142 -58.416 -3.318  1.00 42.80 ? 341 ASN A CB  1 
ATOM   2610 C  CG  . ASN A 1 340 ? -14.825 -58.487 -4.806  1.00 47.69 ? 341 ASN A CG  1 
ATOM   2611 O  OD1 . ASN A 1 340 ? -13.939 -57.786 -5.299  1.00 46.38 ? 341 ASN A OD1 1 
ATOM   2612 N  ND2 . ASN A 1 340 ? -15.537 -59.348 -5.524  1.00 49.09 ? 341 ASN A ND2 1 
ATOM   2613 N  N   . ILE A 1 341 ? -13.193 -58.193 -0.148  1.00 32.27 ? 342 ILE A N   1 
ATOM   2614 C  CA  . ILE A 1 341 ? -13.312 -57.977 1.289   1.00 29.77 ? 342 ILE A CA  1 
ATOM   2615 C  C   . ILE A 1 341 ? -13.868 -56.588 1.602   1.00 30.64 ? 342 ILE A C   1 
ATOM   2616 O  O   . ILE A 1 341 ? -13.367 -55.589 1.095   1.00 29.31 ? 342 ILE A O   1 
ATOM   2617 C  CB  . ILE A 1 341 ? -11.935 -58.164 1.959   1.00 29.12 ? 342 ILE A CB  1 
ATOM   2618 C  CG1 . ILE A 1 341 ? -11.464 -59.600 1.750   1.00 31.70 ? 342 ILE A CG1 1 
ATOM   2619 C  CG2 . ILE A 1 341 ? -11.991 -57.832 3.446   1.00 30.88 ? 342 ILE A CG2 1 
ATOM   2620 C  CD1 . ILE A 1 341 ? -10.056 -59.852 2.231   1.00 34.20 ? 342 ILE A CD1 1 
ATOM   2621 N  N   . PRO A 1 342 ? -14.918 -56.527 2.438   1.00 27.29 ? 343 PRO A N   1 
ATOM   2622 C  CA  . PRO A 1 342 ? -15.563 -55.250 2.753   1.00 29.45 ? 343 PRO A CA  1 
ATOM   2623 C  C   . PRO A 1 342 ? -14.762 -54.475 3.786   1.00 27.56 ? 343 PRO A C   1 
ATOM   2624 O  O   . PRO A 1 342 ? -13.875 -55.042 4.432   1.00 28.74 ? 343 PRO A O   1 
ATOM   2625 C  CB  . PRO A 1 342 ? -16.901 -55.689 3.363   1.00 30.82 ? 343 PRO A CB  1 
ATOM   2626 C  CG  . PRO A 1 342 ? -16.553 -56.976 4.069   1.00 29.37 ? 343 PRO A CG  1 
ATOM   2627 C  CD  . PRO A 1 342 ? -15.523 -57.653 3.182   1.00 26.89 ? 343 PRO A CD  1 
ATOM   2628 N  N   . SER A 1 343 ? -15.062 -53.187 3.922   1.00 31.76 ? 344 SER A N   1 
ATOM   2629 C  CA  . SER A 1 343 ? -14.521 -52.370 5.007   1.00 32.28 ? 344 SER A CA  1 
ATOM   2630 C  C   . SER A 1 343 ? -13.011 -52.126 4.935   1.00 27.54 ? 344 SER A C   1 
ATOM   2631 O  O   . SER A 1 343 ? -12.368 -51.872 5.945   1.00 27.11 ? 344 SER A O   1 
ATOM   2632 C  CB  . SER A 1 343 ? -14.912 -52.978 6.358   1.00 31.50 ? 344 SER A CB  1 
ATOM   2633 O  OG  . SER A 1 343 ? -16.321 -53.201 6.387   1.00 33.23 ? 344 SER A OG  1 
ATOM   2634 N  N   . LEU A 1 344 ? -12.447 -52.194 3.738   1.00 24.57 ? 345 LEU A N   1 
ATOM   2635 C  CA  . LEU A 1 344 ? -11.057 -51.813 3.566   1.00 28.03 ? 345 LEU A CA  1 
ATOM   2636 C  C   . LEU A 1 344 ? -10.963 -50.285 3.625   1.00 24.25 ? 345 LEU A C   1 
ATOM   2637 O  O   . LEU A 1 344 ? -11.959 -49.585 3.407   1.00 25.01 ? 345 LEU A O   1 
ATOM   2638 C  CB  . LEU A 1 344 ? -10.509 -52.353 2.243   1.00 27.12 ? 345 LEU A CB  1 
ATOM   2639 C  CG  . LEU A 1 344 ? -10.480 -53.882 2.072   1.00 28.02 ? 345 LEU A CG  1 
ATOM   2640 C  CD1 . LEU A 1 344 ? -10.171 -54.257 0.630   1.00 28.36 ? 345 LEU A CD1 1 
ATOM   2641 C  CD2 . LEU A 1 344 ? -9.471  -54.503 3.026   1.00 25.30 ? 345 LEU A CD2 1 
ATOM   2642 N  N   . PRO A 1 345 ? -9.775  -49.754 3.935   1.00 25.11 ? 346 PRO A N   1 
ATOM   2643 C  CA  . PRO A 1 345 ? -9.705  -48.291 4.038   1.00 23.47 ? 346 PRO A CA  1 
ATOM   2644 C  C   . PRO A 1 345 ? -10.130 -47.584 2.740   1.00 24.82 ? 346 PRO A C   1 
ATOM   2645 O  O   . PRO A 1 345 ? -9.776  -48.025 1.647   1.00 25.99 ? 346 PRO A O   1 
ATOM   2646 C  CB  . PRO A 1 345 ? -8.222  -48.040 4.325   1.00 23.13 ? 346 PRO A CB  1 
ATOM   2647 C  CG  . PRO A 1 345 ? -7.795  -49.273 5.100   1.00 22.29 ? 346 PRO A CG  1 
ATOM   2648 C  CD  . PRO A 1 345 ? -8.542  -50.410 4.416   1.00 23.93 ? 346 PRO A CD  1 
ATOM   2649 N  N   . PRO A 1 346 ? -10.891 -46.491 2.859   1.00 25.27 ? 347 PRO A N   1 
ATOM   2650 C  CA  . PRO A 1 346 ? -11.289 -45.744 1.664   1.00 24.44 ? 347 PRO A CA  1 
ATOM   2651 C  C   . PRO A 1 346 ? -10.044 -45.219 0.958   1.00 24.70 ? 347 PRO A C   1 
ATOM   2652 O  O   . PRO A 1 346 ? -9.108  -44.768 1.618   1.00 23.71 ? 347 PRO A O   1 
ATOM   2653 C  CB  . PRO A 1 346 ? -12.119 -44.584 2.235   1.00 28.85 ? 347 PRO A CB  1 
ATOM   2654 C  CG  . PRO A 1 346 ? -11.660 -44.461 3.665   1.00 29.08 ? 347 PRO A CG  1 
ATOM   2655 C  CD  . PRO A 1 346 ? -11.383 -45.866 4.098   1.00 26.70 ? 347 PRO A CD  1 
ATOM   2656 N  N   . GLY A 1 347 ? -10.021 -45.301 -0.369  1.00 24.71 ? 348 GLY A N   1 
ATOM   2657 C  CA  . GLY A 1 347 ? -8.873  -44.834 -1.127  1.00 24.83 ? 348 GLY A CA  1 
ATOM   2658 C  C   . GLY A 1 347 ? -7.689  -45.788 -1.081  1.00 26.41 ? 348 GLY A C   1 
ATOM   2659 O  O   . GLY A 1 347 ? -7.189  -46.205 -2.132  1.00 26.36 ? 348 GLY A O   1 
ATOM   2660 N  N   . GLY A 1 348 ? -7.248  -46.139 0.128   1.00 23.55 ? 349 GLY A N   1 
ATOM   2661 C  CA  . GLY A 1 348 ? -6.122  -47.045 0.309   1.00 23.82 ? 349 GLY A CA  1 
ATOM   2662 C  C   . GLY A 1 348 ? -6.383  -48.465 -0.180  1.00 25.26 ? 349 GLY A C   1 
ATOM   2663 O  O   . GLY A 1 348 ? -5.487  -49.138 -0.707  1.00 26.08 ? 349 GLY A O   1 
ATOM   2664 N  N   . GLU A 1 349 ? -7.610  -48.929 0.017   1.00 31.07 ? 350 GLU A N   1 
ATOM   2665 C  CA  . GLU A 1 349 ? -8.025  -50.259 -0.433  1.00 32.96 ? 350 GLU A CA  1 
ATOM   2666 C  C   . GLU A 1 349 ? -7.110  -51.407 0.050   1.00 31.31 ? 350 GLU A C   1 
ATOM   2667 O  O   . GLU A 1 349 ? -6.527  -51.314 1.123   1.00 28.52 ? 350 GLU A O   1 
ATOM   2668 C  CB  . GLU A 1 349 ? -8.229  -50.257 -1.950  1.00 33.75 ? 350 GLU A CB  1 
ATOM   2669 C  CG  . GLU A 1 349 ? -9.416  -49.403 -2.357  1.00 38.15 ? 350 GLU A CG  1 
ATOM   2670 C  CD  . GLU A 1 349 ? -10.710 -49.868 -1.687  1.00 44.71 ? 350 GLU A CD  1 
ATOM   2671 O  OE1 . GLU A 1 349 ? -11.039 -51.075 -1.788  1.00 47.20 ? 350 GLU A OE1 1 
ATOM   2672 O  OE2 . GLU A 1 349 ? -11.390 -49.035 -1.043  1.00 46.39 ? 350 GLU A OE2 1 
ATOM   2673 N  N   . LEU A 1 350 ? -7.002  -52.489 -0.719  1.00 27.56 ? 351 LEU A N   1 
ATOM   2674 C  CA  . LEU A 1 350 ? -6.203  -53.642 -0.280  1.00 29.06 ? 351 LEU A CA  1 
ATOM   2675 C  C   . LEU A 1 350 ? -4.726  -53.286 -0.145  1.00 26.56 ? 351 LEU A C   1 
ATOM   2676 O  O   . LEU A 1 350 ? -4.040  -53.770 0.758   1.00 25.28 ? 351 LEU A O   1 
ATOM   2677 C  CB  . LEU A 1 350 ? -6.342  -54.817 -1.254  1.00 31.00 ? 351 LEU A CB  1 
ATOM   2678 C  CG  . LEU A 1 350 ? -6.870  -56.161 -0.733  1.00 35.31 ? 351 LEU A CG  1 
ATOM   2679 C  CD1 . LEU A 1 350 ? -6.439  -57.305 -1.662  1.00 32.59 ? 351 LEU A CD1 1 
ATOM   2680 C  CD2 . LEU A 1 350 ? -6.451  -56.455 0.689   1.00 30.26 ? 351 LEU A CD2 1 
ATOM   2681 N  N   . ALA A 1 351 ? -4.235  -52.445 -1.051  1.00 22.95 ? 352 ALA A N   1 
ATOM   2682 C  CA  . ALA A 1 351 ? -2.837  -52.019 -1.013  1.00 24.13 ? 352 ALA A CA  1 
ATOM   2683 C  C   . ALA A 1 351 ? -2.464  -51.437 0.345   1.00 24.57 ? 352 ALA A C   1 
ATOM   2684 O  O   . ALA A 1 351 ? -1.346  -51.636 0.818   1.00 23.95 ? 352 ALA A O   1 
ATOM   2685 C  CB  . ALA A 1 351 ? -2.530  -51.015 -2.140  1.00 24.18 ? 352 ALA A CB  1 
ATOM   2686 N  N   . SER A 1 352 ? -3.401  -50.723 0.973   1.00 22.63 ? 353 SER A N   1 
ATOM   2687 C  CA  . SER A 1 352 ? -3.141  -50.112 2.272   1.00 21.96 ? 353 SER A CA  1 
ATOM   2688 C  C   . SER A 1 352 ? -3.094  -51.124 3.414   1.00 24.08 ? 353 SER A C   1 
ATOM   2689 O  O   . SER A 1 352 ? -2.720  -50.782 4.539   1.00 23.98 ? 353 SER A O   1 
ATOM   2690 C  CB  . SER A 1 352 ? -4.158  -48.992 2.583   1.00 21.70 ? 353 SER A CB  1 
ATOM   2691 O  OG  . SER A 1 352 ? -5.460  -49.494 2.838   1.00 23.79 ? 353 SER A OG  1 
ATOM   2692 N  N   . LYS A 1 353 ? -3.464  -52.370 3.125   1.00 23.89 ? 354 LYS A N   1 
ATOM   2693 C  CA  . LYS A 1 353 ? -3.442  -53.414 4.141   1.00 26.29 ? 354 LYS A CA  1 
ATOM   2694 C  C   . LYS A 1 353 ? -2.339  -54.440 3.865   1.00 25.89 ? 354 LYS A C   1 
ATOM   2695 O  O   . LYS A 1 353 ? -2.215  -55.440 4.574   1.00 25.05 ? 354 LYS A O   1 
ATOM   2696 C  CB  . LYS A 1 353 ? -4.810  -54.109 4.239   1.00 24.04 ? 354 LYS A CB  1 
ATOM   2697 C  CG  . LYS A 1 353 ? -5.989  -53.168 4.576   1.00 22.82 ? 354 LYS A CG  1 
ATOM   2698 C  CD  . LYS A 1 353 ? -5.748  -52.385 5.861   1.00 23.40 ? 354 LYS A CD  1 
ATOM   2699 C  CE  . LYS A 1 353 ? -5.420  -53.307 7.032   1.00 24.97 ? 354 LYS A CE  1 
ATOM   2700 N  NZ  . LYS A 1 353 ? -5.315  -52.579 8.320   1.00 25.38 ? 354 LYS A NZ  1 
ATOM   2701 N  N   . ARG A 1 354 ? -1.532  -54.176 2.845   1.00 28.84 ? 355 ARG A N   1 
ATOM   2702 C  CA  . ARG A 1 354 ? -0.474  -55.098 2.453   1.00 30.39 ? 355 ARG A CA  1 
ATOM   2703 C  C   . ARG A 1 354 ? 0.580   -55.319 3.537   1.00 30.85 ? 355 ARG A C   1 
ATOM   2704 O  O   . ARG A 1 354 ? 1.065   -56.434 3.700   1.00 30.33 ? 355 ARG A O   1 
ATOM   2705 C  CB  . ARG A 1 354 ? 0.191   -54.652 1.150   1.00 31.52 ? 355 ARG A CB  1 
ATOM   2706 C  CG  . ARG A 1 354 ? 1.152   -55.701 0.572   1.00 36.61 ? 355 ARG A CG  1 
ATOM   2707 C  CD  . ARG A 1 354 ? 1.729   -55.231 -0.740  1.00 36.11 ? 355 ARG A CD  1 
ATOM   2708 N  NE  . ARG A 1 354 ? 2.476   -56.264 -1.458  1.00 41.32 ? 355 ARG A NE  1 
ATOM   2709 C  CZ  . ARG A 1 354 ? 3.707   -56.655 -1.144  1.00 44.12 ? 355 ARG A CZ  1 
ATOM   2710 N  NH1 . ARG A 1 354 ? 4.327   -56.126 -0.102  1.00 45.52 ? 355 ARG A NH1 1 
ATOM   2711 N  NH2 . ARG A 1 354 ? 4.316   -57.588 -1.861  1.00 53.13 ? 355 ARG A NH2 1 
ATOM   2712 N  N   . ASN A 1 355 ? 0.944   -54.277 4.278   1.00 28.05 ? 356 ASN A N   1 
ATOM   2713 C  CA  . ASN A 1 355 ? 1.898   -54.474 5.378   1.00 31.64 ? 356 ASN A CA  1 
ATOM   2714 C  C   . ASN A 1 355 ? 1.382   -55.483 6.421   1.00 30.50 ? 356 ASN A C   1 
ATOM   2715 O  O   . ASN A 1 355 ? 2.142   -56.315 6.936   1.00 28.58 ? 356 ASN A O   1 
ATOM   2716 C  CB  . ASN A 1 355 ? 2.271   -53.142 6.052   1.00 32.51 ? 356 ASN A CB  1 
ATOM   2717 C  CG  . ASN A 1 355 ? 3.298   -52.335 5.252   1.00 34.59 ? 356 ASN A CG  1 
ATOM   2718 O  OD1 . ASN A 1 355 ? 4.048   -52.877 4.435   1.00 33.22 ? 356 ASN A OD1 1 
ATOM   2719 N  ND2 . ASN A 1 355 ? 3.342   -51.033 5.500   1.00 35.72 ? 356 ASN A ND2 1 
ATOM   2720 N  N   . VAL A 1 356 ? 0.092   -55.406 6.734   1.00 24.52 ? 357 VAL A N   1 
ATOM   2721 C  CA  . VAL A 1 356 ? -0.525  -56.337 7.685   1.00 26.20 ? 357 VAL A CA  1 
ATOM   2722 C  C   . VAL A 1 356 ? -0.519  -57.769 7.126   1.00 27.96 ? 357 VAL A C   1 
ATOM   2723 O  O   . VAL A 1 356 ? -0.154  -58.728 7.817   1.00 26.75 ? 357 VAL A O   1 
ATOM   2724 C  CB  . VAL A 1 356 ? -1.979  -55.915 8.014   1.00 26.17 ? 357 VAL A CB  1 
ATOM   2725 C  CG1 . VAL A 1 356 ? -2.730  -57.032 8.754   1.00 25.15 ? 357 VAL A CG1 1 
ATOM   2726 C  CG2 . VAL A 1 356 ? -1.987  -54.618 8.826   1.00 24.24 ? 357 VAL A CG2 1 
ATOM   2727 N  N   . ILE A 1 357 ? -0.906  -57.894 5.864   1.00 26.14 ? 358 ILE A N   1 
ATOM   2728 C  CA  . ILE A 1 357 ? -0.968  -59.184 5.181   1.00 28.25 ? 358 ILE A CA  1 
ATOM   2729 C  C   . ILE A 1 357 ? 0.408   -59.830 5.067   1.00 32.08 ? 358 ILE A C   1 
ATOM   2730 O  O   . ILE A 1 357 ? 0.579   -61.025 5.356   1.00 31.45 ? 358 ILE A O   1 
ATOM   2731 C  CB  . ILE A 1 357 ? -1.595  -59.019 3.786   1.00 28.48 ? 358 ILE A CB  1 
ATOM   2732 C  CG1 . ILE A 1 357 ? -3.079  -58.657 3.937   1.00 29.76 ? 358 ILE A CG1 1 
ATOM   2733 C  CG2 . ILE A 1 357 ? -1.408  -60.289 2.941   1.00 26.31 ? 358 ILE A CG2 1 
ATOM   2734 C  CD1 . ILE A 1 357 ? -3.683  -57.949 2.734   1.00 26.24 ? 358 ILE A CD1 1 
ATOM   2735 N  N   . GLU A 1 358 ? 1.386   -59.031 4.656   1.00 32.19 ? 359 GLU A N   1 
ATOM   2736 C  CA  . GLU A 1 358 ? 2.764   -59.486 4.532   1.00 32.79 ? 359 GLU A CA  1 
ATOM   2737 C  C   . GLU A 1 358 ? 3.371   -59.894 5.875   1.00 34.94 ? 359 GLU A C   1 
ATOM   2738 O  O   . GLU A 1 358 ? 4.123   -60.864 5.951   1.00 36.14 ? 359 GLU A O   1 
ATOM   2739 C  CB  . GLU A 1 358 ? 3.620   -58.413 3.863   1.00 33.57 ? 359 GLU A CB  1 
ATOM   2740 C  CG  . GLU A 1 358 ? 5.085   -58.798 3.719   1.00 38.58 ? 359 GLU A CG  1 
ATOM   2741 C  CD  . GLU A 1 358 ? 5.780   -58.027 2.611   1.00 48.69 ? 359 GLU A CD  1 
ATOM   2742 O  OE1 . GLU A 1 358 ? 5.138   -57.132 2.025   1.00 50.60 ? 359 GLU A OE1 1 
ATOM   2743 O  OE2 . GLU A 1 358 ? 6.961   -58.315 2.317   1.00 48.55 ? 359 GLU A OE2 1 
ATOM   2744 N  N   . ALA A 1 359 ? 3.055   -59.153 6.934   1.00 29.18 ? 360 ALA A N   1 
ATOM   2745 C  CA  . ALA A 1 359 ? 3.526   -59.518 8.264   1.00 30.48 ? 360 ALA A CA  1 
ATOM   2746 C  C   . ALA A 1 359 ? 3.053   -60.924 8.677   1.00 34.45 ? 360 ALA A C   1 
ATOM   2747 O  O   . ALA A 1 359 ? 3.847   -61.733 9.167   1.00 35.58 ? 360 ALA A O   1 
ATOM   2748 C  CB  . ALA A 1 359 ? 3.110   -58.468 9.297   1.00 32.65 ? 360 ALA A CB  1 
ATOM   2749 N  N   . VAL A 1 360 ? 1.770   -61.221 8.475   1.00 31.04 ? 361 VAL A N   1 
ATOM   2750 C  CA  . VAL A 1 360 ? 1.254   -62.557 8.783   1.00 34.02 ? 361 VAL A CA  1 
ATOM   2751 C  C   . VAL A 1 360 ? 1.871   -63.603 7.865   1.00 33.48 ? 361 VAL A C   1 
ATOM   2752 O  O   . VAL A 1 360 ? 2.306   -64.672 8.313   1.00 32.87 ? 361 VAL A O   1 
ATOM   2753 C  CB  . VAL A 1 360 ? -0.263  -62.642 8.605   1.00 33.37 ? 361 VAL A CB  1 
ATOM   2754 C  CG1 . VAL A 1 360 ? -0.767  -63.981 9.117   1.00 33.08 ? 361 VAL A CG1 1 
ATOM   2755 C  CG2 . VAL A 1 360 ? -0.930  -61.519 9.345   1.00 37.22 ? 361 VAL A CG2 1 
ATOM   2756 N  N   . TYR A 1 361 ? 1.894   -63.295 6.575   1.00 30.54 ? 362 TYR A N   1 
ATOM   2757 C  CA  . TYR A 1 361 ? 2.466   -64.207 5.599   1.00 34.37 ? 362 TYR A CA  1 
ATOM   2758 C  C   . TYR A 1 361 ? 3.892   -64.571 6.004   1.00 35.47 ? 362 TYR A C   1 
ATOM   2759 O  O   . TYR A 1 361 ? 4.290   -65.736 5.929   1.00 33.24 ? 362 TYR A O   1 
ATOM   2760 C  CB  . TYR A 1 361 ? 2.452   -63.592 4.196   1.00 31.51 ? 362 TYR A CB  1 
ATOM   2761 C  CG  . TYR A 1 361 ? 2.984   -64.536 3.144   1.00 35.01 ? 362 TYR A CG  1 
ATOM   2762 C  CD1 . TYR A 1 361 ? 4.348   -64.669 2.941   1.00 35.67 ? 362 TYR A CD1 1 
ATOM   2763 C  CD2 . TYR A 1 361 ? 2.124   -65.315 2.373   1.00 35.56 ? 362 TYR A CD2 1 
ATOM   2764 C  CE1 . TYR A 1 361 ? 4.853   -65.533 1.995   1.00 38.19 ? 362 TYR A CE1 1 
ATOM   2765 C  CE2 . TYR A 1 361 ? 2.624   -66.196 1.414   1.00 38.62 ? 362 TYR A CE2 1 
ATOM   2766 C  CZ  . TYR A 1 361 ? 3.997   -66.297 1.236   1.00 41.39 ? 362 TYR A CZ  1 
ATOM   2767 O  OH  . TYR A 1 361 ? 4.534   -67.157 0.297   1.00 40.86 ? 362 TYR A OH  1 
ATOM   2768 N  N   . ASN A 1 362 ? 4.650   -63.567 6.442   1.00 33.41 ? 363 ASN A N   1 
ATOM   2769 C  CA  . ASN A 1 362 ? 6.032   -63.775 6.857   1.00 32.84 ? 363 ASN A CA  1 
ATOM   2770 C  C   . ASN A 1 362 ? 6.169   -64.679 8.061   1.00 34.05 ? 363 ASN A C   1 
ATOM   2771 O  O   . ASN A 1 362 ? 7.101   -65.480 8.120   1.00 33.33 ? 363 ASN A O   1 
ATOM   2772 C  CB  . ASN A 1 362 ? 6.742   -62.446 7.123   1.00 31.77 ? 363 ASN A CB  1 
ATOM   2773 C  CG  . ASN A 1 362 ? 7.246   -61.806 5.858   1.00 34.19 ? 363 ASN A CG  1 
ATOM   2774 O  OD1 . ASN A 1 362 ? 7.123   -62.383 4.775   1.00 33.44 ? 363 ASN A OD1 1 
ATOM   2775 N  ND2 . ASN A 1 362 ? 7.811   -60.604 5.976   1.00 30.91 ? 363 ASN A ND2 1 
ATOM   2776 N  N   . ARG A 1 363 ? 5.250   -64.555 9.015   1.00 36.19 ? 364 ARG A N   1 
ATOM   2777 C  CA  . ARG A 1 363 ? 5.262   -65.424 10.186  1.00 36.81 ? 364 ARG A CA  1 
ATOM   2778 C  C   . ARG A 1 363 ? 5.012   -66.883 9.802   1.00 38.79 ? 364 ARG A C   1 
ATOM   2779 O  O   . ARG A 1 363 ? 5.607   -67.788 10.378  1.00 36.76 ? 364 ARG A O   1 
ATOM   2780 C  CB  . ARG A 1 363 ? 4.236   -64.968 11.227  1.00 37.44 ? 364 ARG A CB  1 
ATOM   2781 C  CG  . ARG A 1 363 ? 4.432   -63.526 11.681  1.00 41.24 ? 364 ARG A CG  1 
ATOM   2782 C  CD  . ARG A 1 363 ? 3.827   -63.246 13.055  1.00 41.07 ? 364 ARG A CD  1 
ATOM   2783 N  NE  . ARG A 1 363 ? 2.370   -63.299 13.049  1.00 43.46 ? 364 ARG A NE  1 
ATOM   2784 C  CZ  . ARG A 1 363 ? 1.575   -62.270 12.761  1.00 47.41 ? 364 ARG A CZ  1 
ATOM   2785 N  NH1 . ARG A 1 363 ? 2.085   -61.083 12.443  1.00 42.07 ? 364 ARG A NH1 1 
ATOM   2786 N  NH2 . ARG A 1 363 ? 0.258   -62.430 12.792  1.00 45.87 ? 364 ARG A NH2 1 
ATOM   2787 N  N   . LEU A 1 364 ? 4.141   -67.098 8.819   1.00 42.20 ? 365 LEU A N   1 
ATOM   2788 C  CA  . LEU A 1 364 ? 3.752   -68.446 8.392   1.00 40.17 ? 365 LEU A CA  1 
ATOM   2789 C  C   . LEU A 1 364 ? 4.690   -69.060 7.354   1.00 42.51 ? 365 LEU A C   1 
ATOM   2790 O  O   . LEU A 1 364 ? 4.744   -70.279 7.203   1.00 43.80 ? 365 LEU A O   1 
ATOM   2791 C  CB  . LEU A 1 364 ? 2.340   -68.421 7.811   1.00 41.26 ? 365 LEU A CB  1 
ATOM   2792 C  CG  . LEU A 1 364 ? 1.241   -67.920 8.740   1.00 41.27 ? 365 LEU A CG  1 
ATOM   2793 C  CD1 . LEU A 1 364 ? -0.056  -67.726 7.965   1.00 41.87 ? 365 LEU A CD1 1 
ATOM   2794 C  CD2 . LEU A 1 364 ? 1.058   -68.880 9.899   1.00 40.37 ? 365 LEU A CD2 1 
ATOM   2795 N  N   . ASN A 1 365 ? 5.404   -68.221 6.619   1.00 32.48 ? 366 ASN A N   1 
ATOM   2796 C  CA  . ASN A 1 365 ? 6.298   -68.708 5.577   1.00 34.96 ? 366 ASN A CA  1 
ATOM   2797 C  C   . ASN A 1 365 ? 7.590   -67.919 5.607   1.00 31.30 ? 366 ASN A C   1 
ATOM   2798 O  O   . ASN A 1 365 ? 7.951   -67.263 4.631   1.00 32.14 ? 366 ASN A O   1 
ATOM   2799 C  CB  . ASN A 1 365 ? 5.634   -68.614 4.196   1.00 35.82 ? 366 ASN A CB  1 
ATOM   2800 C  CG  . ASN A 1 365 ? 6.374   -69.416 3.124   1.00 43.59 ? 366 ASN A CG  1 
ATOM   2801 O  OD1 . ASN A 1 365 ? 7.153   -70.326 3.430   1.00 39.75 ? 366 ASN A OD1 1 
ATOM   2802 N  ND2 . ASN A 1 365 ? 6.120   -69.090 1.858   1.00 40.16 ? 366 ASN A ND2 1 
ATOM   2803 N  N   . PRO A 1 366 ? 8.299   -67.981 6.744   1.00 33.46 ? 367 PRO A N   1 
ATOM   2804 C  CA  . PRO A 1 366 ? 9.501   -67.165 6.959   1.00 31.19 ? 367 PRO A CA  1 
ATOM   2805 C  C   . PRO A 1 366 ? 10.652  -67.431 5.985   1.00 35.99 ? 367 PRO A C   1 
ATOM   2806 O  O   . PRO A 1 366 ? 11.534  -66.569 5.847   1.00 32.45 ? 367 PRO A O   1 
ATOM   2807 C  CB  . PRO A 1 366 ? 9.912   -67.512 8.398   1.00 34.45 ? 367 PRO A CB  1 
ATOM   2808 C  CG  . PRO A 1 366 ? 9.268   -68.842 8.674   1.00 34.52 ? 367 PRO A CG  1 
ATOM   2809 C  CD  . PRO A 1 366 ? 7.970   -68.804 7.921   1.00 30.74 ? 367 PRO A CD  1 
ATOM   2810 N  N   . TYR A 1 367 ? 10.662  -68.586 5.321   1.00 35.11 ? 368 TYR A N   1 
ATOM   2811 C  CA  . TYR A 1 367 ? 11.768  -68.896 4.417   1.00 35.46 ? 368 TYR A CA  1 
ATOM   2812 C  C   . TYR A 1 367 ? 11.449  -68.581 2.955   1.00 39.24 ? 368 TYR A C   1 
ATOM   2813 O  O   . TYR A 1 367 ? 12.321  -68.697 2.090   1.00 43.68 ? 368 TYR A O   1 
ATOM   2814 C  CB  . TYR A 1 367 ? 12.201  -70.353 4.594   1.00 37.01 ? 368 TYR A CB  1 
ATOM   2815 C  CG  . TYR A 1 367 ? 12.426  -70.710 6.046   1.00 35.63 ? 368 TYR A CG  1 
ATOM   2816 C  CD1 . TYR A 1 367 ? 13.044  -69.811 6.916   1.00 36.88 ? 368 TYR A CD1 1 
ATOM   2817 C  CD2 . TYR A 1 367 ? 11.989  -71.921 6.560   1.00 34.64 ? 368 TYR A CD2 1 
ATOM   2818 C  CE1 . TYR A 1 367 ? 13.242  -70.128 8.252   1.00 33.34 ? 368 TYR A CE1 1 
ATOM   2819 C  CE2 . TYR A 1 367 ? 12.188  -72.248 7.894   1.00 36.75 ? 368 TYR A CE2 1 
ATOM   2820 C  CZ  . TYR A 1 367 ? 12.812  -71.344 8.736   1.00 35.90 ? 368 TYR A CZ  1 
ATOM   2821 O  OH  . TYR A 1 367 ? 13.008  -71.667 10.063  1.00 39.91 ? 368 TYR A OH  1 
HETATM 2822 MN MN  . MN  B 2 .   ? 8.621   -37.475 -9.023  1.00 27.34 ? 401 MN  A MN  1 
HETATM 2823 MN MN  . MN  C 2 .   ? 12.323  -36.483 -9.108  1.00 35.01 ? 402 MN  A MN  1 
HETATM 2824 P  P   . PO4 D 3 .   ? 11.318  -38.372 -13.159 1.00 51.39 ? 403 PO4 A P   1 
HETATM 2825 O  O1  . PO4 D 3 .   ? 10.111  -38.776 -12.359 1.00 53.49 ? 403 PO4 A O1  1 
HETATM 2826 O  O2  . PO4 D 3 .   ? 11.267  -39.055 -14.512 1.00 55.90 ? 403 PO4 A O2  1 
HETATM 2827 O  O3  . PO4 D 3 .   ? 12.545  -38.797 -12.375 1.00 61.04 ? 403 PO4 A O3  1 
HETATM 2828 O  O4  . PO4 D 3 .   ? 11.401  -36.870 -13.361 1.00 55.11 ? 403 PO4 A O4  1 
HETATM 2829 O  O   . HOH E 4 .   ? -0.157  -29.055 -8.432  1.00 23.63 ? 501 HOH A O   1 
HETATM 2830 O  O   . HOH E 4 .   ? 4.778   -28.726 -8.130  1.00 20.93 ? 502 HOH A O   1 
HETATM 2831 O  O   . HOH E 4 .   ? 9.072   -46.259 -5.676  1.00 25.84 ? 503 HOH A O   1 
HETATM 2832 O  O   . HOH E 4 .   ? 6.305   -33.964 -8.444  1.00 23.74 ? 504 HOH A O   1 
HETATM 2833 O  O   . HOH E 4 .   ? 10.789  -38.023 -9.422  1.00 29.08 ? 505 HOH A O   1 
HETATM 2834 O  O   . HOH E 4 .   ? -8.933  -26.437 12.885  1.00 27.54 ? 506 HOH A O   1 
HETATM 2835 O  O   . HOH E 4 .   ? 8.451   -36.907 -11.362 1.00 28.19 ? 507 HOH A O   1 
HETATM 2836 O  O   . HOH E 4 .   ? 17.145  -30.912 -8.115  1.00 27.62 ? 508 HOH A O   1 
HETATM 2837 O  O   . HOH E 4 .   ? 10.685  -33.233 -10.931 1.00 26.85 ? 509 HOH A O   1 
HETATM 2838 O  O   . HOH E 4 .   ? -3.944  -37.601 -8.666  1.00 24.72 ? 510 HOH A O   1 
HETATM 2839 O  O   . HOH E 4 .   ? 12.820  -37.165 -6.954  1.00 26.86 ? 511 HOH A O   1 
HETATM 2840 O  O   . HOH E 4 .   ? 11.524  -35.790 -11.137 1.00 29.05 ? 512 HOH A O   1 
HETATM 2841 O  O   . HOH E 4 .   ? -0.626  -24.411 -9.950  1.00 27.92 ? 513 HOH A O   1 
HETATM 2842 O  O   . HOH E 4 .   ? 15.079  -32.501 2.622   1.00 29.29 ? 514 HOH A O   1 
HETATM 2843 O  O   . HOH E 4 .   ? -9.675  -39.540 -5.958  1.00 29.58 ? 515 HOH A O   1 
HETATM 2844 O  O   . HOH E 4 .   ? 5.120   -18.224 -16.122 1.00 34.29 ? 516 HOH A O   1 
HETATM 2845 O  O   . HOH E 4 .   ? 8.855   -43.935 -11.768 1.00 29.85 ? 517 HOH A O   1 
HETATM 2846 O  O   . HOH E 4 .   ? -7.049  -22.620 10.392  1.00 31.17 ? 518 HOH A O   1 
HETATM 2847 O  O   . HOH E 4 .   ? 0.340   -37.051 -10.688 1.00 31.04 ? 519 HOH A O   1 
HETATM 2848 O  O   . HOH E 4 .   ? -10.872 -48.246 11.108  1.00 30.11 ? 520 HOH A O   1 
HETATM 2849 O  O   . HOH E 4 .   ? 2.942   -37.219 15.290  1.00 30.23 ? 521 HOH A O   1 
HETATM 2850 O  O   . HOH E 4 .   ? 9.220   -37.908 -6.765  1.00 27.95 ? 522 HOH A O   1 
HETATM 2851 O  O   . HOH E 4 .   ? 1.379   -34.514 -10.856 1.00 31.03 ? 523 HOH A O   1 
HETATM 2852 O  O   . HOH E 4 .   ? -13.680 -52.661 1.056   1.00 30.24 ? 524 HOH A O   1 
HETATM 2853 O  O   . HOH E 4 .   ? -2.654  -13.269 9.328   1.00 33.66 ? 525 HOH A O   1 
HETATM 2854 O  O   . HOH E 4 .   ? -1.295  -22.530 -5.386  1.00 28.08 ? 526 HOH A O   1 
HETATM 2855 O  O   . HOH E 4 .   ? 11.896  -35.181 0.925   1.00 31.36 ? 527 HOH A O   1 
HETATM 2856 O  O   . HOH E 4 .   ? 6.391   -40.198 -10.942 1.00 31.49 ? 528 HOH A O   1 
HETATM 2857 O  O   . HOH E 4 .   ? 8.973   -70.824 5.172   1.00 32.96 ? 529 HOH A O   1 
HETATM 2858 O  O   . HOH E 4 .   ? 1.741   -20.807 11.708  1.00 33.42 ? 530 HOH A O   1 
HETATM 2859 O  O   . HOH E 4 .   ? -10.575 -45.802 9.880   1.00 33.46 ? 531 HOH A O   1 
HETATM 2860 O  O   . HOH E 4 .   ? 8.296   -33.936 -11.429 1.00 30.84 ? 532 HOH A O   1 
HETATM 2861 O  O   . HOH E 4 .   ? 7.063   -10.324 -8.320  1.00 37.91 ? 533 HOH A O   1 
HETATM 2862 O  O   . HOH E 4 .   ? 2.404   -35.467 -13.355 1.00 32.47 ? 534 HOH A O   1 
HETATM 2863 O  O   . HOH E 4 .   ? 0.238   -51.504 3.362   1.00 28.59 ? 535 HOH A O   1 
HETATM 2864 O  O   . HOH E 4 .   ? -12.634 -41.233 5.188   1.00 33.38 ? 536 HOH A O   1 
HETATM 2865 O  O   . HOH E 4 .   ? 3.166   -34.256 15.079  1.00 30.71 ? 537 HOH A O   1 
HETATM 2866 O  O   . HOH E 4 .   ? 13.258  -41.244 10.302  1.00 34.80 ? 538 HOH A O   1 
HETATM 2867 O  O   . HOH E 4 .   ? 16.150  -50.701 -14.507 1.00 37.62 ? 539 HOH A O   1 
HETATM 2868 O  O   . HOH E 4 .   ? 22.428  -28.006 -3.686  1.00 31.67 ? 540 HOH A O   1 
HETATM 2869 O  O   . HOH E 4 .   ? -2.189  -24.023 -7.712  1.00 26.90 ? 541 HOH A O   1 
HETATM 2870 O  O   . HOH E 4 .   ? -10.477 -36.777 -6.673  1.00 33.83 ? 542 HOH A O   1 
HETATM 2871 O  O   . HOH E 4 .   ? -10.601 -57.746 -1.282  1.00 32.78 ? 543 HOH A O   1 
HETATM 2872 O  O   . HOH E 4 .   ? -13.557 -53.997 10.303  1.00 32.35 ? 544 HOH A O   1 
HETATM 2873 O  O   . HOH E 4 .   ? -13.033 -55.225 -1.675  1.00 36.11 ? 545 HOH A O   1 
HETATM 2874 O  O   . HOH E 4 .   ? 14.985  -17.711 -14.083 1.00 33.67 ? 546 HOH A O   1 
HETATM 2875 O  O   . HOH E 4 .   ? 14.039  -37.779 -9.934  1.00 31.41 ? 547 HOH A O   1 
HETATM 2876 O  O   . HOH E 4 .   ? -2.060  -48.374 5.639   1.00 31.71 ? 548 HOH A O   1 
HETATM 2877 O  O   . HOH E 4 .   ? -0.701  -21.216 12.944  1.00 30.82 ? 549 HOH A O   1 
HETATM 2878 O  O   . HOH E 4 .   ? 26.724  -30.135 -10.231 1.00 36.10 ? 550 HOH A O   1 
HETATM 2879 O  O   . HOH E 4 .   ? 21.024  -37.618 -7.743  1.00 36.63 ? 551 HOH A O   1 
HETATM 2880 O  O   . HOH E 4 .   ? 4.570   -36.170 -13.159 1.00 37.35 ? 552 HOH A O   1 
HETATM 2881 O  O   . HOH E 4 .   ? 14.854  -40.334 -8.781  1.00 29.60 ? 553 HOH A O   1 
HETATM 2882 O  O   . HOH E 4 .   ? 14.309  -44.709 1.246   1.00 34.15 ? 554 HOH A O   1 
HETATM 2883 O  O   . HOH E 4 .   ? -0.744  -16.763 -8.661  1.00 34.10 ? 555 HOH A O   1 
HETATM 2884 O  O   . HOH E 4 .   ? -10.797 -49.783 7.095   1.00 33.92 ? 556 HOH A O   1 
HETATM 2885 O  O   . HOH E 4 .   ? -7.152  -23.807 12.635  1.00 34.03 ? 557 HOH A O   1 
HETATM 2886 O  O   . HOH E 4 .   ? 2.181   -14.335 -6.886  1.00 34.52 ? 558 HOH A O   1 
HETATM 2887 O  O   . HOH E 4 .   ? 9.177   -12.401 -17.564 1.00 36.52 ? 559 HOH A O   1 
HETATM 2888 O  O   . HOH E 4 .   ? 31.263  -28.159 -15.749 1.00 39.29 ? 560 HOH A O   1 
HETATM 2889 O  O   . HOH E 4 .   ? -3.939  -30.709 -10.813 1.00 35.50 ? 561 HOH A O   1 
HETATM 2890 O  O   . HOH E 4 .   ? 5.112   -37.179 -23.452 1.00 36.64 ? 562 HOH A O   1 
HETATM 2891 O  O   . HOH E 4 .   ? -13.656 -35.234 11.084  1.00 39.95 ? 563 HOH A O   1 
HETATM 2892 O  O   . HOH E 4 .   ? -9.344  -26.341 -5.960  1.00 33.80 ? 564 HOH A O   1 
HETATM 2893 O  O   . HOH E 4 .   ? 16.105  -22.331 -23.607 1.00 37.43 ? 565 HOH A O   1 
HETATM 2894 O  O   . HOH E 4 .   ? -7.588  -36.376 -8.396  1.00 36.56 ? 566 HOH A O   1 
HETATM 2895 O  O   . HOH E 4 .   ? 13.253  -25.233 -28.388 1.00 38.74 ? 567 HOH A O   1 
HETATM 2896 O  O   . HOH E 4 .   ? -3.324  -29.367 -14.315 1.00 34.33 ? 568 HOH A O   1 
HETATM 2897 O  O   . HOH E 4 .   ? -5.732  -38.315 14.919  1.00 29.01 ? 569 HOH A O   1 
HETATM 2898 O  O   . HOH E 4 .   ? -0.281  -18.659 13.952  1.00 33.64 ? 570 HOH A O   1 
HETATM 2899 O  O   . HOH E 4 .   ? 15.283  -13.208 -2.834  1.00 36.54 ? 571 HOH A O   1 
HETATM 2900 O  O   . HOH E 4 .   ? -5.711  -45.323 -5.957  1.00 32.80 ? 572 HOH A O   1 
HETATM 2901 O  O   . HOH E 4 .   ? 15.293  -20.315 4.030   1.00 35.08 ? 573 HOH A O   1 
HETATM 2902 O  O   . HOH E 4 .   ? 19.476  -27.225 -17.782 1.00 37.39 ? 574 HOH A O   1 
HETATM 2903 O  O   . HOH E 4 .   ? 14.207  -15.474 -12.616 1.00 33.93 ? 575 HOH A O   1 
HETATM 2904 O  O   . HOH E 4 .   ? -2.275  -37.303 -11.226 1.00 35.88 ? 576 HOH A O   1 
HETATM 2905 O  O   . HOH E 4 .   ? 17.356  -41.829 -9.538  1.00 50.30 ? 577 HOH A O   1 
HETATM 2906 O  O   . HOH E 4 .   ? 14.225  -22.972 4.659   1.00 35.33 ? 578 HOH A O   1 
HETATM 2907 O  O   . HOH E 4 .   ? 1.642   -33.734 -29.151 1.00 35.42 ? 579 HOH A O   1 
HETATM 2908 O  O   . HOH E 4 .   ? 19.897  -26.641 -14.928 1.00 33.31 ? 580 HOH A O   1 
HETATM 2909 O  O   . HOH E 4 .   ? -12.427 -44.130 10.075  1.00 36.36 ? 581 HOH A O   1 
HETATM 2910 O  O   . HOH E 4 .   ? 5.810   -50.079 -6.710  1.00 36.02 ? 582 HOH A O   1 
HETATM 2911 O  O   . HOH E 4 .   ? 13.050  -23.101 2.196   1.00 30.35 ? 583 HOH A O   1 
HETATM 2912 O  O   . HOH E 4 .   ? 16.884  -30.625 -16.617 1.00 35.89 ? 584 HOH A O   1 
HETATM 2913 O  O   . HOH E 4 .   ? 13.127  -27.936 7.172   1.00 34.41 ? 585 HOH A O   1 
HETATM 2914 O  O   . HOH E 4 .   ? -10.630 -48.776 20.878  1.00 32.61 ? 586 HOH A O   1 
HETATM 2915 O  O   . HOH E 4 .   ? -6.443  -51.077 15.774  1.00 34.55 ? 587 HOH A O   1 
HETATM 2916 O  O   . HOH E 4 .   ? 5.607   -45.092 -11.224 1.00 34.71 ? 588 HOH A O   1 
HETATM 2917 O  O   . HOH E 4 .   ? -3.179  -23.543 -19.036 1.00 37.10 ? 589 HOH A O   1 
HETATM 2918 O  O   . HOH E 4 .   ? -3.343  -51.847 11.088  1.00 38.64 ? 590 HOH A O   1 
HETATM 2919 O  O   . HOH E 4 .   ? 0.658   -25.443 19.193  1.00 37.96 ? 591 HOH A O   1 
HETATM 2920 O  O   . HOH E 4 .   ? 22.128  -33.163 -14.504 1.00 35.96 ? 592 HOH A O   1 
HETATM 2921 O  O   . HOH E 4 .   ? 34.587  -25.039 -10.346 1.00 38.97 ? 593 HOH A O   1 
HETATM 2922 O  O   . HOH E 4 .   ? -0.847  -52.444 6.389   1.00 33.14 ? 594 HOH A O   1 
HETATM 2923 O  O   . HOH E 4 .   ? -4.800  -23.978 -8.316  1.00 36.28 ? 595 HOH A O   1 
HETATM 2924 O  O   . HOH E 4 .   ? -11.845 -46.720 -2.126  1.00 38.23 ? 596 HOH A O   1 
HETATM 2925 O  O   . HOH E 4 .   ? -10.355 -55.683 -2.689  1.00 37.18 ? 597 HOH A O   1 
HETATM 2926 O  O   . HOH E 4 .   ? -8.979  -53.260 -2.882  1.00 38.17 ? 598 HOH A O   1 
HETATM 2927 O  O   . HOH E 4 .   ? -1.022  -25.083 -15.837 1.00 37.10 ? 599 HOH A O   1 
HETATM 2928 O  O   . HOH E 4 .   ? 24.872  -26.573 -12.191 1.00 38.44 ? 600 HOH A O   1 
HETATM 2929 O  O   . HOH E 4 .   ? 12.313  -47.198 8.047   1.00 36.84 ? 601 HOH A O   1 
HETATM 2930 O  O   . HOH E 4 .   ? 30.586  -24.999 -3.431  1.00 38.09 ? 602 HOH A O   1 
HETATM 2931 O  O   . HOH E 4 .   ? -2.869  -48.354 8.183   1.00 37.55 ? 603 HOH A O   1 
HETATM 2932 O  O   . HOH E 4 .   ? 0.580   -48.988 4.641   1.00 33.07 ? 604 HOH A O   1 
HETATM 2933 O  O   . HOH E 4 .   ? -1.132  -22.563 -17.010 1.00 38.74 ? 605 HOH A O   1 
HETATM 2934 O  O   . HOH E 4 .   ? 1.245   -18.158 -12.414 1.00 37.64 ? 606 HOH A O   1 
HETATM 2935 O  O   . HOH E 4 .   ? 20.413  -40.656 -3.843  1.00 36.62 ? 607 HOH A O   1 
HETATM 2936 O  O   . HOH E 4 .   ? 3.415   -15.554 -9.187  1.00 34.29 ? 608 HOH A O   1 
HETATM 2937 O  O   . HOH E 4 .   ? 5.015   -55.988 6.956   1.00 38.92 ? 609 HOH A O   1 
HETATM 2938 O  O   . HOH E 4 .   ? 14.325  -51.647 2.016   1.00 39.49 ? 610 HOH A O   1 
HETATM 2939 O  O   . HOH E 4 .   ? 4.205   -49.830 -11.571 1.00 39.11 ? 611 HOH A O   1 
HETATM 2940 O  O   . HOH E 4 .   ? -11.660 -18.633 11.904  1.00 40.24 ? 612 HOH A O   1 
HETATM 2941 O  O   . HOH E 4 .   ? -11.602 -24.252 -4.051  1.00 37.16 ? 613 HOH A O   1 
HETATM 2942 O  O   . HOH E 4 .   ? 13.565  -22.183 -28.206 1.00 37.96 ? 614 HOH A O   1 
HETATM 2943 O  O   . HOH E 4 .   ? 7.051   -36.754 -25.928 1.00 38.59 ? 615 HOH A O   1 
HETATM 2944 O  O   . HOH E 4 .   ? 27.045  -32.836 -10.815 1.00 38.31 ? 616 HOH A O   1 
HETATM 2945 O  O   . HOH E 4 .   ? -1.582  -33.911 -13.911 1.00 39.47 ? 617 HOH A O   1 
HETATM 2946 O  O   . HOH E 4 .   ? 3.714   -27.739 -29.860 1.00 40.25 ? 618 HOH A O   1 
HETATM 2947 O  O   . HOH E 4 .   ? 6.741   -35.861 -13.964 1.00 39.00 ? 619 HOH A O   1 
HETATM 2948 O  O   . HOH E 4 .   ? 10.276  -25.940 13.232  1.00 38.09 ? 620 HOH A O   1 
HETATM 2949 O  O   . HOH E 4 .   ? -2.859  -51.259 8.080   1.00 39.42 ? 621 HOH A O   1 
HETATM 2950 O  O   . HOH E 4 .   ? 11.590  -73.361 11.767  1.00 38.24 ? 622 HOH A O   1 
HETATM 2951 O  O   . HOH E 4 .   ? -13.230 -39.077 14.708  1.00 37.72 ? 623 HOH A O   1 
HETATM 2952 O  O   . HOH E 4 .   ? -14.369 -33.254 -1.792  1.00 40.40 ? 624 HOH A O   1 
HETATM 2953 O  O   . HOH E 4 .   ? -12.907 -63.110 2.534   1.00 42.90 ? 625 HOH A O   1 
HETATM 2954 O  O   . HOH E 4 .   ? -3.854  -46.411 -8.570  1.00 35.33 ? 626 HOH A O   1 
HETATM 2955 O  O   . HOH E 4 .   ? 15.130  -27.833 5.358   1.00 37.76 ? 627 HOH A O   1 
HETATM 2956 O  O   . HOH E 4 .   ? 7.150   -17.654 -24.465 1.00 35.64 ? 628 HOH A O   1 
HETATM 2957 O  O   . HOH E 4 .   ? 13.954  -37.549 -12.864 1.00 38.97 ? 629 HOH A O   1 
HETATM 2958 O  O   . HOH E 4 .   ? 13.831  -18.079 -16.755 1.00 36.07 ? 630 HOH A O   1 
HETATM 2959 O  O   . HOH E 4 .   ? 5.378   -46.187 10.472  1.00 35.64 ? 631 HOH A O   1 
HETATM 2960 O  O   . HOH E 4 .   ? 14.064  -52.681 -13.635 1.00 40.04 ? 632 HOH A O   1 
HETATM 2961 O  O   . HOH E 4 .   ? 14.552  -7.241  -2.764  1.00 43.15 ? 633 HOH A O   1 
HETATM 2962 O  O   . HOH E 4 .   ? 14.576  -36.264 0.875   1.00 38.13 ? 634 HOH A O   1 
HETATM 2963 O  O   . HOH E 4 .   ? -9.898  -18.024 -1.322  1.00 33.92 ? 635 HOH A O   1 
HETATM 2964 O  O   . HOH E 4 .   ? -2.888  -31.172 -19.917 1.00 38.65 ? 636 HOH A O   1 
HETATM 2965 O  O   . HOH E 4 .   ? -12.484 -42.517 -1.924  1.00 36.67 ? 637 HOH A O   1 
HETATM 2966 O  O   . HOH E 4 .   ? 10.219  -37.793 -16.442 1.00 40.28 ? 638 HOH A O   1 
HETATM 2967 O  O   . HOH E 4 .   ? 4.671   -43.086 -9.858  1.00 34.50 ? 639 HOH A O   1 
HETATM 2968 O  O   . HOH E 4 .   ? 3.405   -19.194 -18.052 1.00 37.91 ? 640 HOH A O   1 
HETATM 2969 O  O   . HOH E 4 .   ? 17.459  -16.776 -14.840 1.00 41.94 ? 641 HOH A O   1 
HETATM 2970 O  O   . HOH E 4 .   ? 14.998  -38.722 1.941   1.00 36.53 ? 642 HOH A O   1 
HETATM 2971 O  O   . HOH E 4 .   ? -3.080  -28.997 15.384  1.00 36.49 ? 643 HOH A O   1 
HETATM 2972 O  O   . HOH E 4 .   ? -2.533  -47.530 11.849  1.00 42.92 ? 644 HOH A O   1 
HETATM 2973 O  O   . HOH E 4 .   ? 17.842  -14.352 1.142   1.00 42.89 ? 645 HOH A O   1 
HETATM 2974 O  O   . HOH E 4 .   ? 15.808  -16.723 -17.973 1.00 42.21 ? 646 HOH A O   1 
HETATM 2975 O  O   . HOH E 4 .   ? -6.197  -57.156 15.769  1.00 38.83 ? 647 HOH A O   1 
HETATM 2976 O  O   . HOH E 4 .   ? 11.040  -38.471 14.338  1.00 38.01 ? 648 HOH A O   1 
HETATM 2977 O  O   . HOH E 4 .   ? -13.851 -20.837 12.576  1.00 41.13 ? 649 HOH A O   1 
HETATM 2978 O  O   . HOH E 4 .   ? -5.017  -53.314 14.267  1.00 38.91 ? 650 HOH A O   1 
HETATM 2979 O  O   . HOH E 4 .   ? 6.030   -51.799 -9.060  1.00 36.64 ? 651 HOH A O   1 
HETATM 2980 O  O   . HOH E 4 .   ? 13.335  -53.276 -11.194 1.00 41.69 ? 652 HOH A O   1 
HETATM 2981 O  O   . HOH E 4 .   ? 3.455   -22.567 19.774  1.00 41.42 ? 653 HOH A O   1 
HETATM 2982 O  O   . HOH E 4 .   ? 7.771   -59.467 8.490   1.00 40.19 ? 654 HOH A O   1 
HETATM 2983 O  O   . HOH E 4 .   ? 23.639  -28.702 -21.251 1.00 43.74 ? 655 HOH A O   1 
HETATM 2984 O  O   . HOH E 4 .   ? 15.736  -49.430 2.974   1.00 42.53 ? 656 HOH A O   1 
HETATM 2985 O  O   . HOH E 4 .   ? 22.894  -18.696 -0.259  1.00 43.30 ? 657 HOH A O   1 
HETATM 2986 O  O   . HOH E 4 .   ? 0.830   -18.346 -22.013 1.00 41.50 ? 658 HOH A O   1 
HETATM 2987 O  O   . HOH E 4 .   ? 4.889   -60.029 12.424  1.00 44.82 ? 659 HOH A O   1 
HETATM 2988 O  O   . HOH E 4 .   ? 1.364   -32.906 -20.409 1.00 37.54 ? 660 HOH A O   1 
HETATM 2989 O  O   . HOH E 4 .   ? 15.929  -9.116  -2.993  1.00 44.75 ? 661 HOH A O   1 
HETATM 2990 O  O   . HOH E 4 .   ? 2.580   -68.987 -5.970  1.00 49.13 ? 662 HOH A O   1 
HETATM 2991 O  O   . HOH E 4 .   ? 2.898   -25.575 21.086  1.00 49.34 ? 663 HOH A O   1 
HETATM 2992 O  O   . HOH E 4 .   ? -7.424  -61.074 -8.079  1.00 45.34 ? 664 HOH A O   1 
HETATM 2993 O  O   . HOH E 4 .   ? 11.468  -53.362 -14.212 1.00 41.87 ? 665 HOH A O   1 
HETATM 2994 O  O   . HOH E 4 .   ? 8.976   -58.899 3.953   1.00 48.35 ? 666 HOH A O   1 
HETATM 2995 O  O   . HOH E 4 .   ? 7.800   -61.429 2.441   1.00 46.54 ? 667 HOH A O   1 
HETATM 2996 O  O   . HOH E 4 .   ? -17.258 -51.918 2.214   1.00 43.13 ? 668 HOH A O   1 
HETATM 2997 O  O   . HOH E 4 .   ? 17.560  -35.122 -2.279  1.00 39.05 ? 669 HOH A O   1 
HETATM 2998 O  O   . HOH E 4 .   ? 5.471   -48.544 -13.991 1.00 40.27 ? 670 HOH A O   1 
HETATM 2999 O  O   . HOH E 4 .   ? -3.706  -45.149 10.762  1.00 36.52 ? 671 HOH A O   1 
HETATM 3000 O  O   . HOH E 4 .   ? 18.960  -13.268 -7.573  1.00 38.04 ? 672 HOH A O   1 
HETATM 3001 O  O   . HOH E 4 .   ? 13.357  -33.416 8.089   1.00 43.78 ? 673 HOH A O   1 
HETATM 3002 O  O   . HOH E 4 .   ? -5.476  -52.030 -3.731  1.00 36.51 ? 674 HOH A O   1 
HETATM 3003 O  O   . HOH E 4 .   ? 2.496   -38.011 18.232  1.00 39.84 ? 675 HOH A O   1 
HETATM 3004 O  O   . HOH E 4 .   ? -12.996 -17.870 8.339   1.00 43.01 ? 676 HOH A O   1 
HETATM 3005 O  O   . HOH E 4 .   ? 7.412   -50.966 5.557   1.00 46.07 ? 677 HOH A O   1 
HETATM 3006 O  O   . HOH E 4 .   ? 22.564  -34.934 -7.695  1.00 38.92 ? 678 HOH A O   1 
HETATM 3007 O  O   . HOH E 4 .   ? 3.054   -48.243 6.608   1.00 37.26 ? 679 HOH A O   1 
HETATM 3008 O  O   . HOH E 4 .   ? 0.752   -56.438 -3.782  1.00 47.45 ? 680 HOH A O   1 
HETATM 3009 O  O   . HOH E 4 .   ? 1.071   -48.943 9.666   1.00 44.48 ? 681 HOH A O   1 
HETATM 3010 O  O   . HOH E 4 .   ? 13.481  -7.373  -5.094  1.00 42.91 ? 682 HOH A O   1 
HETATM 3011 O  O   . HOH E 4 .   ? 17.457  -51.720 -2.834  1.00 40.21 ? 683 HOH A O   1 
HETATM 3012 O  O   . HOH E 4 .   ? 18.027  -29.249 -18.539 1.00 38.89 ? 684 HOH A O   1 
HETATM 3013 O  O   . HOH E 4 .   ? -11.360 -47.257 7.467   1.00 36.79 ? 685 HOH A O   1 
HETATM 3014 O  O   . HOH E 4 .   ? -3.390  -22.939 14.490  1.00 37.01 ? 686 HOH A O   1 
HETATM 3015 O  O   . HOH E 4 .   ? 22.307  -26.889 -1.333  1.00 39.66 ? 687 HOH A O   1 
HETATM 3016 O  O   . HOH E 4 .   ? -13.325 -48.923 0.685   1.00 38.73 ? 688 HOH A O   1 
HETATM 3017 O  O   . HOH E 4 .   ? -13.207 -42.742 7.480   1.00 40.94 ? 689 HOH A O   1 
HETATM 3018 O  O   . HOH E 4 .   ? -7.703  -12.144 2.228   1.00 41.63 ? 690 HOH A O   1 
HETATM 3019 O  O   . HOH E 4 .   ? -11.661 -19.295 3.515   1.00 36.84 ? 691 HOH A O   1 
HETATM 3020 O  O   . HOH E 4 .   ? -5.790  -49.863 -4.876  1.00 38.03 ? 692 HOH A O   1 
HETATM 3021 O  O   . HOH E 4 .   ? -8.485  -50.646 21.458  1.00 39.41 ? 693 HOH A O   1 
HETATM 3022 O  O   . HOH E 4 .   ? -7.055  -37.753 18.468  1.00 37.17 ? 694 HOH A O   1 
HETATM 3023 O  O   . HOH E 4 .   ? -2.135  -55.271 13.282  1.00 43.22 ? 695 HOH A O   1 
HETATM 3024 O  O   . HOH E 4 .   ? 9.086   -34.985 -14.521 1.00 30.00 ? 696 HOH A O   1 
HETATM 3025 O  O   . HOH E 4 .   ? 15.972  -37.308 -12.531 1.00 30.00 ? 697 HOH A O   1 
HETATM 3026 O  O   . HOH E 4 .   ? 13.581  -40.362 -16.047 1.00 30.00 ? 698 HOH A O   1 
HETATM 3027 O  O   . HOH E 4 .   ? 14.722  -42.176 -16.477 1.00 30.00 ? 699 HOH A O   1 
HETATM 3028 O  O   . HOH E 4 .   ? 10.587  -34.823 -16.623 1.00 30.00 ? 700 HOH A O   1 
HETATM 3029 O  O   . HOH E 4 .   ? 15.699  -42.661 -11.366 1.00 30.00 ? 701 HOH A O   1 
HETATM 3030 O  O   . HOH E 4 .   ? 4.058   -38.004 -13.241 1.00 30.00 ? 702 HOH A O   1 
HETATM 3031 O  O   . HOH E 4 .   ? -0.511  -38.427 -19.309 1.00 30.00 ? 703 HOH A O   1 
HETATM 3032 O  O   . HOH E 4 .   ? -3.868  -41.055 -9.769  1.00 30.00 ? 704 HOH A O   1 
HETATM 3033 O  O   . HOH E 4 .   ? 7.945   -50.001 -14.448 1.00 30.00 ? 705 HOH A O   1 
HETATM 3034 O  O   . HOH E 4 .   ? 20.368  -37.472 -4.564  1.00 30.00 ? 706 HOH A O   1 
HETATM 3035 O  O   . HOH E 4 .   ? 24.057  -34.485 -10.339 1.00 30.00 ? 707 HOH A O   1 
HETATM 3036 O  O   . HOH E 4 .   ? 17.010  -28.359 -24.163 1.00 30.00 ? 708 HOH A O   1 
HETATM 3037 O  O   . HOH E 4 .   ? 16.075  -26.688 -25.831 1.00 30.00 ? 709 HOH A O   1 
HETATM 3038 O  O   . HOH E 4 .   ? 11.901  -17.779 -30.473 1.00 30.00 ? 710 HOH A O   1 
HETATM 3039 O  O   . HOH E 4 .   ? 22.502  -23.884 -18.730 1.00 30.00 ? 711 HOH A O   1 
HETATM 3040 O  O   . HOH E 4 .   ? 11.661  -34.623 14.302  1.00 30.00 ? 712 HOH A O   1 
HETATM 3041 O  O   . HOH E 4 .   ? 14.019  -36.475 7.521   1.00 30.00 ? 713 HOH A O   1 
HETATM 3042 O  O   . HOH E 4 .   ? 14.810  -30.671 5.101   1.00 30.00 ? 714 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   2   GLY GLY A . n 
A 1 2   ALA 2   3   3   ALA ALA A . n 
A 1 3   PHE 3   4   4   PHE PHE A . n 
A 1 4   LEU 4   5   5   LEU LEU A . n 
A 1 5   ASP 5   6   6   ASP ASP A . n 
A 1 6   LYS 6   7   7   LYS LYS A . n 
A 1 7   PRO 7   8   8   PRO PRO A . n 
A 1 8   LYS 8   9   9   LYS LYS A . n 
A 1 9   MET 9   10  10  MET MET A . n 
A 1 10  GLU 10  11  11  GLU GLU A . n 
A 1 11  LYS 11  12  12  LYS LYS A . n 
A 1 12  HIS 12  13  13  HIS HIS A . n 
A 1 13  ASN 13  14  14  ASN ASN A . n 
A 1 14  ALA 14  15  15  ALA ALA A . n 
A 1 15  GLN 15  16  16  GLN GLN A . n 
A 1 16  GLY 16  17  17  GLY GLY A . n 
A 1 17  GLN 17  18  18  GLN GLN A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ASN 19  20  20  ASN ASN A . n 
A 1 20  GLY 20  21  21  GLY GLY A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  ARG 22  23  23  ARG ARG A . n 
A 1 23  TYR 23  24  24  TYR TYR A . n 
A 1 24  GLY 24  25  25  GLY GLY A . n 
A 1 25  LEU 25  26  26  LEU LEU A . n 
A 1 26  SER 26  27  27  SER SER A . n 
A 1 27  SER 27  28  28  SER SER A . n 
A 1 28  MET 28  29  29  MET MET A . n 
A 1 29  GLN 29  30  30  GLN GLN A . n 
A 1 30  GLY 30  31  31  GLY GLY A . n 
A 1 31  TRP 31  32  32  TRP TRP A . n 
A 1 32  ARG 32  33  33  ARG ARG A . n 
A 1 33  VAL 33  34  34  VAL VAL A . n 
A 1 34  GLU 34  35  35  GLU GLU A . n 
A 1 35  MET 35  36  36  MET MET A . n 
A 1 36  GLU 36  37  37  GLU GLU A . n 
A 1 37  ASP 37  38  38  ASP ASP A . n 
A 1 38  ALA 38  39  39  ALA ALA A . n 
A 1 39  HIS 39  40  40  HIS HIS A . n 
A 1 40  THR 40  41  41  THR THR A . n 
A 1 41  ALA 41  42  42  ALA ALA A . n 
A 1 42  VAL 42  43  43  VAL VAL A . n 
A 1 43  ILE 43  44  44  ILE ILE A . n 
A 1 44  GLY 44  45  45  GLY GLY A . n 
A 1 45  LEU 45  46  46  LEU LEU A . n 
A 1 46  PRO 46  47  47  PRO PRO A . n 
A 1 47  SER 47  48  48  SER SER A . n 
A 1 48  GLY 48  49  49  GLY GLY A . n 
A 1 49  LEU 49  50  50  LEU LEU A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  SER 51  52  52  SER SER A . n 
A 1 52  TRP 52  53  53  TRP TRP A . n 
A 1 53  SER 53  54  54  SER SER A . n 
A 1 54  PHE 54  55  55  PHE PHE A . n 
A 1 55  PHE 55  56  56  PHE PHE A . n 
A 1 56  ALA 56  57  57  ALA ALA A . n 
A 1 57  VAL 57  58  58  VAL VAL A . n 
A 1 58  TYR 58  59  59  TYR TYR A . n 
A 1 59  ASP 59  60  60  ASP ASP A . n 
A 1 60  GLY 60  61  61  GLY GLY A . n 
A 1 61  HIS 61  62  62  HIS HIS A . n 
A 1 62  ALA 62  63  63  ALA ALA A . n 
A 1 63  GLY 63  64  64  GLY GLY A . n 
A 1 64  SER 64  65  65  SER SER A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  VAL 66  67  67  VAL VAL A . n 
A 1 67  ALA 67  68  68  ALA ALA A . n 
A 1 68  LYS 68  69  69  LYS LYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  CYS 70  71  71  CYS CYS A . n 
A 1 71  CYS 71  72  72  CYS CYS A . n 
A 1 72  GLU 72  73  73  GLU GLU A . n 
A 1 73  HIS 73  74  74  HIS HIS A . n 
A 1 74  LEU 74  75  75  LEU LEU A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  ASP 76  77  77  ASP ASP A . n 
A 1 77  HIS 77  78  78  HIS HIS A . n 
A 1 78  ILE 78  79  79  ILE ILE A . n 
A 1 79  THR 79  80  80  THR THR A . n 
A 1 80  ASN 80  81  81  ASN ASN A . n 
A 1 81  ASN 81  82  82  ASN ASN A . n 
A 1 82  GLN 82  83  83  GLN GLN A . n 
A 1 83  ASP 83  84  84  ASP ASP A . n 
A 1 84  PHE 84  85  85  PHE PHE A . n 
A 1 85  LYS 85  86  86  LYS LYS A . n 
A 1 86  GLY 86  87  87  GLY GLY A . n 
A 1 87  SER 87  88  88  SER SER A . n 
A 1 88  ALA 88  89  89  ALA ALA A . n 
A 1 89  GLY 89  90  90  GLY GLY A . n 
A 1 90  ALA 90  91  91  ALA ALA A . n 
A 1 91  PRO 91  92  92  PRO PRO A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  VAL 93  94  94  VAL VAL A . n 
A 1 94  GLU 94  95  95  GLU GLU A . n 
A 1 95  ASN 95  96  96  ASN ASN A . n 
A 1 96  VAL 96  97  97  VAL VAL A . n 
A 1 97  LYS 97  98  98  LYS LYS A . n 
A 1 98  ASN 98  99  99  ASN ASN A . n 
A 1 99  GLY 99  100 100 GLY GLY A . n 
A 1 100 ILE 100 101 101 ILE ILE A . n 
A 1 101 ARG 101 102 102 ARG ARG A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 GLY 103 104 104 GLY GLY A . n 
A 1 104 PHE 104 105 105 PHE PHE A . n 
A 1 105 LEU 105 106 106 LEU LEU A . n 
A 1 106 GLU 106 107 107 GLU GLU A . n 
A 1 107 ILE 107 108 108 ILE ILE A . n 
A 1 108 ASP 108 109 109 ASP ASP A . n 
A 1 109 GLU 109 110 110 GLU GLU A . n 
A 1 110 HIS 110 111 111 HIS HIS A . n 
A 1 111 MET 111 112 112 MET MET A . n 
A 1 112 ARG 112 113 113 ARG ARG A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 MET 114 115 115 MET MET A . n 
A 1 115 SER 115 116 116 SER SER A . n 
A 1 116 GLU 116 117 117 GLU GLU A . n 
A 1 117 LYS 117 118 118 LYS LYS A . n 
A 1 118 LYS 118 119 119 LYS LYS A . n 
A 1 119 HIS 119 120 120 HIS HIS A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 ALA 121 122 122 ALA ALA A . n 
A 1 122 ASP 122 123 123 ASP ASP A . n 
A 1 123 ARG 123 124 124 ARG ARG A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 SER 126 127 127 SER SER A . n 
A 1 127 THR 127 128 128 THR THR A . n 
A 1 128 ALA 128 129 129 ALA ALA A . n 
A 1 129 VAL 129 130 130 VAL VAL A . n 
A 1 130 GLY 130 131 131 GLY GLY A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 LEU 132 133 133 LEU LEU A . n 
A 1 133 ILE 133 134 134 ILE ILE A . n 
A 1 134 SER 134 135 135 SER SER A . n 
A 1 135 PRO 135 136 136 PRO PRO A . n 
A 1 136 GLN 136 137 137 GLN GLN A . n 
A 1 137 HIS 137 138 138 HIS HIS A . n 
A 1 138 THR 138 139 139 THR THR A . n 
A 1 139 TYR 139 140 140 TYR TYR A . n 
A 1 140 PHE 140 141 141 PHE PHE A . n 
A 1 141 ILE 141 142 142 ILE ILE A . n 
A 1 142 ASN 142 143 143 ASN ASN A . n 
A 1 143 CYS 143 144 144 CYS CYS A . n 
A 1 144 GLY 144 145 145 GLY GLY A . n 
A 1 145 ASP 145 146 146 ASP ASP A . n 
A 1 146 SER 146 147 147 SER SER A . n 
A 1 147 ARG 147 148 148 ARG ARG A . n 
A 1 148 GLY 148 149 149 GLY GLY A . n 
A 1 149 LEU 149 150 150 LEU LEU A . n 
A 1 150 LEU 150 151 151 LEU LEU A . n 
A 1 151 CYS 151 152 152 CYS CYS A . n 
A 1 152 ARG 152 153 153 ARG ARG A . n 
A 1 153 ASN 153 154 154 ASN ASN A . n 
A 1 154 ARG 154 155 155 ARG ARG A . n 
A 1 155 LYS 155 156 156 LYS LYS A . n 
A 1 156 VAL 156 157 157 VAL VAL A . n 
A 1 157 HIS 157 158 158 HIS HIS A . n 
A 1 158 PHE 158 159 159 PHE PHE A . n 
A 1 159 PHE 159 160 160 PHE PHE A . n 
A 1 160 THR 160 161 161 THR THR A . n 
A 1 161 GLN 161 162 162 GLN GLN A . n 
A 1 162 ASP 162 163 163 ASP ASP A . n 
A 1 163 HIS 163 164 164 HIS HIS A . n 
A 1 164 LYS 164 165 165 LYS LYS A . n 
A 1 165 PRO 165 166 166 PRO PRO A . n 
A 1 166 SER 166 167 167 SER SER A . n 
A 1 167 ASN 167 168 168 ASN ASN A . n 
A 1 168 PRO 168 169 169 PRO PRO A . n 
A 1 169 LEU 169 170 170 LEU LEU A . n 
A 1 170 GLU 170 171 171 GLU GLU A . n 
A 1 171 LYS 171 172 172 LYS LYS A . n 
A 1 172 GLU 172 173 173 GLU GLU A . n 
A 1 173 ARG 173 174 174 ARG ARG A . n 
A 1 174 ILE 174 175 175 ILE ILE A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ASN 176 177 177 ASN ASN A . n 
A 1 177 ALA 177 178 178 ALA ALA A . n 
A 1 178 GLY 178 179 179 GLY GLY A . n 
A 1 179 GLY 179 180 180 GLY GLY A . n 
A 1 180 SER 180 181 181 SER SER A . n 
A 1 181 VAL 181 182 182 VAL VAL A . n 
A 1 182 MET 182 183 183 MET MET A . n 
A 1 183 ILE 183 184 184 ILE ILE A . n 
A 1 184 GLN 184 185 185 GLN GLN A . n 
A 1 185 ARG 185 186 186 ARG ARG A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ASN 187 188 188 ASN ASN A . n 
A 1 188 GLY 188 189 189 GLY GLY A . n 
A 1 189 SER 189 190 190 SER SER A . n 
A 1 190 LEU 190 191 191 LEU LEU A . n 
A 1 191 ALA 191 192 192 ALA ALA A . n 
A 1 192 VAL 192 193 193 VAL VAL A . n 
A 1 193 SER 193 194 194 SER SER A . n 
A 1 194 ARG 194 195 195 ARG ARG A . n 
A 1 195 ALA 195 196 196 ALA ALA A . n 
A 1 196 LEU 196 197 197 LEU LEU A . n 
A 1 197 GLY 197 198 198 GLY GLY A . n 
A 1 198 ASP 198 199 199 ASP ASP A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 ASP 200 201 201 ASP ASP A . n 
A 1 201 TYR 201 202 202 TYR TYR A . n 
A 1 202 LYS 202 203 203 LYS LYS A . n 
A 1 203 CYS 203 204 204 CYS CYS A . n 
A 1 204 VAL 204 205 205 VAL VAL A . n 
A 1 205 HIS 205 206 206 HIS HIS A . n 
A 1 206 GLY 206 207 207 GLY GLY A . n 
A 1 207 LYS 207 208 208 LYS LYS A . n 
A 1 208 GLY 208 209 209 GLY GLY A . n 
A 1 209 PRO 209 210 210 PRO PRO A . n 
A 1 210 THR 210 211 211 THR THR A . n 
A 1 211 GLU 211 212 212 GLU GLU A . n 
A 1 212 GLN 212 213 213 GLN GLN A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 VAL 214 215 215 VAL VAL A . n 
A 1 215 SER 215 216 216 SER SER A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 GLU 217 218 218 GLU GLU A . n 
A 1 218 PRO 218 219 219 PRO PRO A . n 
A 1 219 GLU 219 220 220 GLU GLU A . n 
A 1 220 VAL 220 221 221 VAL VAL A . n 
A 1 221 HIS 221 222 222 HIS HIS A . n 
A 1 222 ASP 222 223 223 ASP ASP A . n 
A 1 223 ILE 223 224 224 ILE ILE A . n 
A 1 224 GLU 224 225 225 GLU GLU A . n 
A 1 225 ARG 225 226 226 ARG ARG A . n 
A 1 226 SER 226 227 227 SER SER A . n 
A 1 227 GLU 227 228 228 GLU GLU A . n 
A 1 228 GLU 228 229 229 GLU GLU A . n 
A 1 229 ASP 229 230 230 ASP ASP A . n 
A 1 230 ASP 230 231 231 ASP ASP A . n 
A 1 231 GLN 231 232 232 GLN GLN A . n 
A 1 232 PHE 232 233 233 PHE PHE A . n 
A 1 233 ILE 233 234 234 ILE ILE A . n 
A 1 234 ILE 234 235 235 ILE ILE A . n 
A 1 235 LEU 235 236 236 LEU LEU A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 CYS 237 238 238 CYS CYS A . n 
A 1 238 ASP 238 239 239 ASP ASP A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 ILE 240 241 241 ILE ILE A . n 
A 1 241 TRP 241 242 242 TRP TRP A . n 
A 1 242 ASP 242 243 243 ASP ASP A . n 
A 1 243 VAL 243 244 244 VAL VAL A . n 
A 1 244 MET 244 245 245 MET MET A . n 
A 1 245 GLY 245 246 246 GLY GLY A . n 
A 1 246 ASN 246 247 247 ASN ASN A . n 
A 1 247 GLU 247 248 248 GLU GLU A . n 
A 1 248 GLU 248 249 249 GLU GLU A . n 
A 1 249 LEU 249 250 250 LEU LEU A . n 
A 1 250 CYS 250 251 251 CYS CYS A . n 
A 1 251 ASP 251 252 252 ASP ASP A . n 
A 1 252 PHE 252 253 253 PHE PHE A . n 
A 1 253 VAL 253 254 254 VAL VAL A . n 
A 1 254 ARG 254 255 255 ARG ARG A . n 
A 1 255 SER 255 256 256 SER SER A . n 
A 1 256 ARG 256 257 257 ARG ARG A . n 
A 1 257 LEU 257 258 258 LEU LEU A . n 
A 1 258 GLU 258 259 259 GLU GLU A . n 
A 1 259 VAL 259 260 260 VAL VAL A . n 
A 1 260 THR 260 261 261 THR THR A . n 
A 1 261 ASP 261 262 262 ASP ASP A . n 
A 1 262 ASP 262 263 263 ASP ASP A . n 
A 1 263 LEU 263 264 264 LEU LEU A . n 
A 1 264 GLU 264 265 265 GLU GLU A . n 
A 1 265 LYS 265 266 266 LYS LYS A . n 
A 1 266 VAL 266 267 267 VAL VAL A . n 
A 1 267 CYS 267 268 268 CYS CYS A . n 
A 1 268 ASN 268 269 269 ASN ASN A . n 
A 1 269 GLU 269 270 270 GLU GLU A . n 
A 1 270 VAL 270 271 271 VAL VAL A . n 
A 1 271 VAL 271 272 272 VAL VAL A . n 
A 1 272 ASP 272 273 273 ASP ASP A . n 
A 1 273 THR 273 274 274 THR THR A . n 
A 1 274 CYS 274 275 275 CYS CYS A . n 
A 1 275 LEU 275 276 276 LEU LEU A . n 
A 1 276 TYR 276 277 277 TYR TYR A . n 
A 1 277 LYS 277 278 278 LYS LYS A . n 
A 1 278 GLY 278 279 279 GLY GLY A . n 
A 1 279 SER 279 280 280 SER SER A . n 
A 1 280 ARG 280 281 281 ARG ARG A . n 
A 1 281 ASP 281 282 282 ASP ASP A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 MET 283 284 284 MET MET A . n 
A 1 284 SER 284 285 285 SER SER A . n 
A 1 285 VAL 285 286 286 VAL VAL A . n 
A 1 286 ILE 286 287 287 ILE ILE A . n 
A 1 287 LEU 287 288 288 LEU LEU A . n 
A 1 288 ILE 288 289 289 ILE ILE A . n 
A 1 289 CYS 289 290 290 CYS CYS A . n 
A 1 290 PHE 290 291 291 PHE PHE A . n 
A 1 291 PRO 291 292 292 PRO PRO A . n 
A 1 292 ASN 292 293 293 ASN ASN A . n 
A 1 293 ALA 293 294 294 ALA ALA A . n 
A 1 294 PRO 294 295 295 PRO PRO A . n 
A 1 295 LYS 295 296 296 LYS LYS A . n 
A 1 296 VAL 296 297 297 VAL VAL A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PRO 298 299 299 PRO PRO A . n 
A 1 299 GLU 299 300 300 GLU GLU A . n 
A 1 300 ALA 300 301 301 ALA ALA A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 LYS 302 303 303 LYS LYS A . n 
A 1 303 LYS 303 304 304 LYS LYS A . n 
A 1 304 GLU 304 305 305 GLU GLU A . n 
A 1 305 ALA 305 306 306 ALA ALA A . n 
A 1 306 GLU 306 307 307 GLU GLU A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 ASP 308 309 309 ASP ASP A . n 
A 1 309 LYS 309 310 310 LYS LYS A . n 
A 1 310 TYR 310 311 311 TYR TYR A . n 
A 1 311 LEU 311 312 312 LEU LEU A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 CYS 313 314 314 CYS CYS A . n 
A 1 314 ARG 314 315 315 ARG ARG A . n 
A 1 315 VAL 315 316 316 VAL VAL A . n 
A 1 316 GLU 316 317 317 GLU GLU A . n 
A 1 317 GLU 317 318 318 GLU GLU A . n 
A 1 318 ILE 318 319 319 ILE ILE A . n 
A 1 319 ILE 319 320 320 ILE ILE A . n 
A 1 320 LYS 320 321 321 LYS LYS A . n 
A 1 321 LYS 321 322 ?   ?   ?   A . n 
A 1 322 GLN 322 323 ?   ?   ?   A . n 
A 1 323 GLY 323 324 ?   ?   ?   A . n 
A 1 324 GLU 324 325 ?   ?   ?   A . n 
A 1 325 GLY 325 326 326 GLY GLY A . n 
A 1 326 VAL 326 327 327 VAL VAL A . n 
A 1 327 PRO 327 328 328 PRO PRO A . n 
A 1 328 ASP 328 329 329 ASP ASP A . n 
A 1 329 LEU 329 330 330 LEU LEU A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 HIS 331 332 332 HIS HIS A . n 
A 1 332 VAL 332 333 333 VAL VAL A . n 
A 1 333 MET 333 334 334 MET MET A . n 
A 1 334 ARG 334 335 335 ARG ARG A . n 
A 1 335 THR 335 336 336 THR THR A . n 
A 1 336 LEU 336 337 337 LEU LEU A . n 
A 1 337 ALA 337 338 338 ALA ALA A . n 
A 1 338 SER 338 339 339 SER SER A . n 
A 1 339 GLU 339 340 340 GLU GLU A . n 
A 1 340 ASN 340 341 341 ASN ASN A . n 
A 1 341 ILE 341 342 342 ILE ILE A . n 
A 1 342 PRO 342 343 343 PRO PRO A . n 
A 1 343 SER 343 344 344 SER SER A . n 
A 1 344 LEU 344 345 345 LEU LEU A . n 
A 1 345 PRO 345 346 346 PRO PRO A . n 
A 1 346 PRO 346 347 347 PRO PRO A . n 
A 1 347 GLY 347 348 348 GLY GLY A . n 
A 1 348 GLY 348 349 349 GLY GLY A . n 
A 1 349 GLU 349 350 350 GLU GLU A . n 
A 1 350 LEU 350 351 351 LEU LEU A . n 
A 1 351 ALA 351 352 352 ALA ALA A . n 
A 1 352 SER 352 353 353 SER SER A . n 
A 1 353 LYS 353 354 354 LYS LYS A . n 
A 1 354 ARG 354 355 355 ARG ARG A . n 
A 1 355 ASN 355 356 356 ASN ASN A . n 
A 1 356 VAL 356 357 357 VAL VAL A . n 
A 1 357 ILE 357 358 358 ILE ILE A . n 
A 1 358 GLU 358 359 359 GLU GLU A . n 
A 1 359 ALA 359 360 360 ALA ALA A . n 
A 1 360 VAL 360 361 361 VAL VAL A . n 
A 1 361 TYR 361 362 362 TYR TYR A . n 
A 1 362 ASN 362 363 363 ASN ASN A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 LEU 364 365 365 LEU LEU A . n 
A 1 365 ASN 365 366 366 ASN ASN A . n 
A 1 366 PRO 366 367 367 PRO PRO A . n 
A 1 367 TYR 367 368 368 TYR TYR A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD2 ? A ASP 281 ? A ASP 282 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OD2 ? A ASP 59  ? A ASP 60  ? 1_555 164.2 ? 
2  OD2 ? A ASP 281 ? A ASP 282 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 505 ? 1_555 84.6  ? 
3  OD2 ? A ASP 59  ? A ASP 60  ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 505 ? 1_555 106.9 ? 
4  OD2 ? A ASP 281 ? A ASP 282 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OD1 ? A ASP 238 ? A ASP 239 ? 1_555 89.3  ? 
5  OD2 ? A ASP 59  ? A ASP 60  ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OD1 ? A ASP 238 ? A ASP 239 ? 1_555 81.0  ? 
6  O   ? E HOH .   ? A HOH 505 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 OD1 ? A ASP 238 ? A ASP 239 ? 1_555 168.3 ? 
7  OD2 ? A ASP 281 ? A ASP 282 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 522 ? 1_555 86.1  ? 
8  OD2 ? A ASP 59  ? A ASP 60  ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 522 ? 1_555 84.7  ? 
9  O   ? E HOH .   ? A HOH 505 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 522 ? 1_555 83.2  ? 
10 OD1 ? A ASP 238 ? A ASP 239 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 522 ? 1_555 106.4 ? 
11 OD2 ? A ASP 281 ? A ASP 282 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 507 ? 1_555 98.5  ? 
12 OD2 ? A ASP 59  ? A ASP 60  ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 507 ? 1_555 92.8  ? 
13 O   ? E HOH .   ? A HOH 505 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 507 ? 1_555 87.3  ? 
14 OD1 ? A ASP 238 ? A ASP 239 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 507 ? 1_555 83.6  ? 
15 O   ? E HOH .   ? A HOH 522 ? 1_555 MN ? B MN . ? A MN 401 ? 1_555 O   ? E HOH .   ? A HOH 507 ? 1_555 169.1 ? 
16 O   ? E HOH .   ? A HOH 505 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 512 ? 1_555 80.9  ? 
17 O   ? E HOH .   ? A HOH 505 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OD1 ? A ASP 59  ? A ASP 60  ? 1_555 88.9  ? 
18 O   ? E HOH .   ? A HOH 512 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 OD1 ? A ASP 59  ? A ASP 60  ? 1_555 89.0  ? 
19 O   ? E HOH .   ? A HOH 505 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 547 ? 1_555 94.3  ? 
20 O   ? E HOH .   ? A HOH 512 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 547 ? 1_555 96.5  ? 
21 OD1 ? A ASP 59  ? A ASP 60  ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 547 ? 1_555 174.0 ? 
22 O   ? E HOH .   ? A HOH 505 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? A GLY 60  ? A GLY 61  ? 1_555 169.0 ? 
23 O   ? E HOH .   ? A HOH 512 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? A GLY 60  ? A GLY 61  ? 1_555 88.3  ? 
24 OD1 ? A ASP 59  ? A ASP 60  ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? A GLY 60  ? A GLY 61  ? 1_555 93.1  ? 
25 O   ? E HOH .   ? A HOH 547 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? A GLY 60  ? A GLY 61  ? 1_555 84.7  ? 
26 O   ? E HOH .   ? A HOH 505 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 511 ? 1_555 94.4  ? 
27 O   ? E HOH .   ? A HOH 512 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 511 ? 1_555 171.9 ? 
28 OD1 ? A ASP 59  ? A ASP 60  ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 511 ? 1_555 84.2  ? 
29 O   ? E HOH .   ? A HOH 547 ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 511 ? 1_555 90.5  ? 
30 O   ? A GLY 60  ? A GLY 61  ? 1_555 MN ? C MN . ? A MN 402 ? 1_555 O   ? E HOH .   ? A HOH 511 ? 1_555 96.6  ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-05-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                            ? 1 
PHASES   phasing           .                            ? 2 
PHENIX   refinement        '(phenix.refine: 1.6.2_432)' ? 3 
HKL-2000 'data reduction'  .                            ? 4 
HKL-2000 'data scaling'    .                            ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 552 ? ? O A HOH 702 ? ? 1.91 
2 1 O3  A PO4 403 ? ? O A HOH 629 ? ? 1.94 
3 1 OE1 A GLU 259 ? ? O A HOH 581 ? ? 2.00 
4 1 O   A HOH 629 ? ? O A HOH 697 ? ? 2.06 
5 1 O   A HOH 698 ? ? O A HOH 699 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 3   ? ? -59.43  -143.43 
2 1 PHE A 4   ? ? 73.46   105.04  
3 1 ASN A 81  ? ? -102.86 49.50   
4 1 SER A 88  ? ? 164.27  166.81  
5 1 ALA A 89  ? ? -70.19  -109.16 
6 1 ILE A 184 ? ? 61.61   -97.31  
7 1 GLN A 232 ? ? -108.48 -60.93  
8 1 VAL A 327 ? ? 58.19   92.84   
9 1 GLU A 350 ? ? 53.26   -150.35 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A LYS 322 ? A LYS 321 
2 1 Y 1 A GLN 323 ? A GLN 322 
3 1 Y 1 A GLY 324 ? A GLY 323 
4 1 Y 1 A GLU 325 ? A GLU 324 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 'PHOSPHATE ION'      PO4 
4 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MN  1   401 383 MN  MN  A . 
C 2 MN  1   402 384 MN  MN  A . 
D 3 PO4 1   403 701 PO4 PO4 A . 
E 4 HOH 1   501 1   HOH HOH A . 
E 4 HOH 2   502 2   HOH HOH A . 
E 4 HOH 3   503 3   HOH HOH A . 
E 4 HOH 4   504 4   HOH HOH A . 
E 4 HOH 5   505 5   HOH HOH A . 
E 4 HOH 6   506 6   HOH HOH A . 
E 4 HOH 7   507 7   HOH HOH A . 
E 4 HOH 8   508 8   HOH HOH A . 
E 4 HOH 9   509 9   HOH HOH A . 
E 4 HOH 10  510 10  HOH HOH A . 
E 4 HOH 11  511 11  HOH HOH A . 
E 4 HOH 12  512 12  HOH HOH A . 
E 4 HOH 13  513 13  HOH HOH A . 
E 4 HOH 14  514 14  HOH HOH A . 
E 4 HOH 15  515 15  HOH HOH A . 
E 4 HOH 16  516 16  HOH HOH A . 
E 4 HOH 17  517 17  HOH HOH A . 
E 4 HOH 18  518 18  HOH HOH A . 
E 4 HOH 19  519 19  HOH HOH A . 
E 4 HOH 20  520 20  HOH HOH A . 
E 4 HOH 21  521 21  HOH HOH A . 
E 4 HOH 22  522 22  HOH HOH A . 
E 4 HOH 23  523 23  HOH HOH A . 
E 4 HOH 24  524 24  HOH HOH A . 
E 4 HOH 25  525 25  HOH HOH A . 
E 4 HOH 26  526 26  HOH HOH A . 
E 4 HOH 27  527 27  HOH HOH A . 
E 4 HOH 28  528 28  HOH HOH A . 
E 4 HOH 29  529 29  HOH HOH A . 
E 4 HOH 30  530 30  HOH HOH A . 
E 4 HOH 31  531 31  HOH HOH A . 
E 4 HOH 32  532 32  HOH HOH A . 
E 4 HOH 33  533 33  HOH HOH A . 
E 4 HOH 34  534 34  HOH HOH A . 
E 4 HOH 35  535 35  HOH HOH A . 
E 4 HOH 36  536 36  HOH HOH A . 
E 4 HOH 37  537 37  HOH HOH A . 
E 4 HOH 38  538 38  HOH HOH A . 
E 4 HOH 39  539 39  HOH HOH A . 
E 4 HOH 40  540 40  HOH HOH A . 
E 4 HOH 41  541 41  HOH HOH A . 
E 4 HOH 42  542 42  HOH HOH A . 
E 4 HOH 43  543 43  HOH HOH A . 
E 4 HOH 44  544 44  HOH HOH A . 
E 4 HOH 45  545 45  HOH HOH A . 
E 4 HOH 46  546 46  HOH HOH A . 
E 4 HOH 47  547 47  HOH HOH A . 
E 4 HOH 48  548 48  HOH HOH A . 
E 4 HOH 49  549 49  HOH HOH A . 
E 4 HOH 50  550 50  HOH HOH A . 
E 4 HOH 51  551 51  HOH HOH A . 
E 4 HOH 52  552 52  HOH HOH A . 
E 4 HOH 53  553 53  HOH HOH A . 
E 4 HOH 54  554 54  HOH HOH A . 
E 4 HOH 55  555 55  HOH HOH A . 
E 4 HOH 56  556 56  HOH HOH A . 
E 4 HOH 57  557 57  HOH HOH A . 
E 4 HOH 58  558 58  HOH HOH A . 
E 4 HOH 59  559 59  HOH HOH A . 
E 4 HOH 60  560 60  HOH HOH A . 
E 4 HOH 61  561 61  HOH HOH A . 
E 4 HOH 62  562 62  HOH HOH A . 
E 4 HOH 63  563 63  HOH HOH A . 
E 4 HOH 64  564 64  HOH HOH A . 
E 4 HOH 65  565 65  HOH HOH A . 
E 4 HOH 66  566 66  HOH HOH A . 
E 4 HOH 67  567 67  HOH HOH A . 
E 4 HOH 68  568 68  HOH HOH A . 
E 4 HOH 69  569 69  HOH HOH A . 
E 4 HOH 70  570 70  HOH HOH A . 
E 4 HOH 71  571 71  HOH HOH A . 
E 4 HOH 72  572 72  HOH HOH A . 
E 4 HOH 73  573 73  HOH HOH A . 
E 4 HOH 74  574 74  HOH HOH A . 
E 4 HOH 75  575 75  HOH HOH A . 
E 4 HOH 76  576 76  HOH HOH A . 
E 4 HOH 77  577 77  HOH HOH A . 
E 4 HOH 78  578 78  HOH HOH A . 
E 4 HOH 79  579 79  HOH HOH A . 
E 4 HOH 80  580 80  HOH HOH A . 
E 4 HOH 81  581 81  HOH HOH A . 
E 4 HOH 82  582 82  HOH HOH A . 
E 4 HOH 83  583 83  HOH HOH A . 
E 4 HOH 84  584 84  HOH HOH A . 
E 4 HOH 85  585 85  HOH HOH A . 
E 4 HOH 86  586 86  HOH HOH A . 
E 4 HOH 87  587 87  HOH HOH A . 
E 4 HOH 88  588 88  HOH HOH A . 
E 4 HOH 89  589 89  HOH HOH A . 
E 4 HOH 90  590 90  HOH HOH A . 
E 4 HOH 91  591 91  HOH HOH A . 
E 4 HOH 92  592 92  HOH HOH A . 
E 4 HOH 93  593 93  HOH HOH A . 
E 4 HOH 94  594 94  HOH HOH A . 
E 4 HOH 95  595 95  HOH HOH A . 
E 4 HOH 96  596 96  HOH HOH A . 
E 4 HOH 97  597 97  HOH HOH A . 
E 4 HOH 98  598 98  HOH HOH A . 
E 4 HOH 99  599 99  HOH HOH A . 
E 4 HOH 100 600 100 HOH HOH A . 
E 4 HOH 101 601 101 HOH HOH A . 
E 4 HOH 102 602 102 HOH HOH A . 
E 4 HOH 103 603 103 HOH HOH A . 
E 4 HOH 104 604 104 HOH HOH A . 
E 4 HOH 105 605 105 HOH HOH A . 
E 4 HOH 106 606 106 HOH HOH A . 
E 4 HOH 107 607 107 HOH HOH A . 
E 4 HOH 108 608 108 HOH HOH A . 
E 4 HOH 109 609 109 HOH HOH A . 
E 4 HOH 110 610 110 HOH HOH A . 
E 4 HOH 111 611 111 HOH HOH A . 
E 4 HOH 112 612 112 HOH HOH A . 
E 4 HOH 113 613 113 HOH HOH A . 
E 4 HOH 114 614 114 HOH HOH A . 
E 4 HOH 115 615 115 HOH HOH A . 
E 4 HOH 116 616 116 HOH HOH A . 
E 4 HOH 117 617 117 HOH HOH A . 
E 4 HOH 118 618 119 HOH HOH A . 
E 4 HOH 119 619 120 HOH HOH A . 
E 4 HOH 120 620 121 HOH HOH A . 
E 4 HOH 121 621 122 HOH HOH A . 
E 4 HOH 122 622 123 HOH HOH A . 
E 4 HOH 123 623 124 HOH HOH A . 
E 4 HOH 124 624 125 HOH HOH A . 
E 4 HOH 125 625 126 HOH HOH A . 
E 4 HOH 126 626 127 HOH HOH A . 
E 4 HOH 127 627 128 HOH HOH A . 
E 4 HOH 128 628 129 HOH HOH A . 
E 4 HOH 129 629 130 HOH HOH A . 
E 4 HOH 130 630 131 HOH HOH A . 
E 4 HOH 131 631 132 HOH HOH A . 
E 4 HOH 132 632 133 HOH HOH A . 
E 4 HOH 133 633 134 HOH HOH A . 
E 4 HOH 134 634 135 HOH HOH A . 
E 4 HOH 135 635 136 HOH HOH A . 
E 4 HOH 136 636 137 HOH HOH A . 
E 4 HOH 137 637 138 HOH HOH A . 
E 4 HOH 138 638 139 HOH HOH A . 
E 4 HOH 139 639 140 HOH HOH A . 
E 4 HOH 140 640 141 HOH HOH A . 
E 4 HOH 141 641 142 HOH HOH A . 
E 4 HOH 142 642 143 HOH HOH A . 
E 4 HOH 143 643 144 HOH HOH A . 
E 4 HOH 144 644 145 HOH HOH A . 
E 4 HOH 145 645 146 HOH HOH A . 
E 4 HOH 146 646 147 HOH HOH A . 
E 4 HOH 147 647 148 HOH HOH A . 
E 4 HOH 148 648 149 HOH HOH A . 
E 4 HOH 149 649 150 HOH HOH A . 
E 4 HOH 150 650 151 HOH HOH A . 
E 4 HOH 151 651 152 HOH HOH A . 
E 4 HOH 152 652 153 HOH HOH A . 
E 4 HOH 153 653 154 HOH HOH A . 
E 4 HOH 154 654 155 HOH HOH A . 
E 4 HOH 155 655 156 HOH HOH A . 
E 4 HOH 156 656 157 HOH HOH A . 
E 4 HOH 157 657 158 HOH HOH A . 
E 4 HOH 158 658 159 HOH HOH A . 
E 4 HOH 159 659 160 HOH HOH A . 
E 4 HOH 160 660 161 HOH HOH A . 
E 4 HOH 161 661 162 HOH HOH A . 
E 4 HOH 162 662 163 HOH HOH A . 
E 4 HOH 163 663 164 HOH HOH A . 
E 4 HOH 164 664 165 HOH HOH A . 
E 4 HOH 165 665 166 HOH HOH A . 
E 4 HOH 166 666 167 HOH HOH A . 
E 4 HOH 167 667 168 HOH HOH A . 
E 4 HOH 168 668 169 HOH HOH A . 
E 4 HOH 169 669 170 HOH HOH A . 
E 4 HOH 170 670 171 HOH HOH A . 
E 4 HOH 171 671 172 HOH HOH A . 
E 4 HOH 172 672 173 HOH HOH A . 
E 4 HOH 173 673 174 HOH HOH A . 
E 4 HOH 174 674 175 HOH HOH A . 
E 4 HOH 175 675 176 HOH HOH A . 
E 4 HOH 176 676 177 HOH HOH A . 
E 4 HOH 177 677 178 HOH HOH A . 
E 4 HOH 178 678 179 HOH HOH A . 
E 4 HOH 179 679 180 HOH HOH A . 
E 4 HOH 180 680 181 HOH HOH A . 
E 4 HOH 181 681 182 HOH HOH A . 
E 4 HOH 182 682 183 HOH HOH A . 
E 4 HOH 183 683 184 HOH HOH A . 
E 4 HOH 184 684 185 HOH HOH A . 
E 4 HOH 185 685 186 HOH HOH A . 
E 4 HOH 186 686 187 HOH HOH A . 
E 4 HOH 187 687 188 HOH HOH A . 
E 4 HOH 188 688 189 HOH HOH A . 
E 4 HOH 189 689 190 HOH HOH A . 
E 4 HOH 190 690 191 HOH HOH A . 
E 4 HOH 191 691 192 HOH HOH A . 
E 4 HOH 192 692 193 HOH HOH A . 
E 4 HOH 193 693 194 HOH HOH A . 
E 4 HOH 194 694 195 HOH HOH A . 
E 4 HOH 195 695 196 HOH HOH A . 
E 4 HOH 196 696 197 HOH HOH A . 
E 4 HOH 197 697 199 HOH HOH A . 
E 4 HOH 198 698 200 HOH HOH A . 
E 4 HOH 199 699 201 HOH HOH A . 
E 4 HOH 200 700 202 HOH HOH A . 
E 4 HOH 201 701 203 HOH HOH A . 
E 4 HOH 202 702 204 HOH HOH A . 
E 4 HOH 203 703 205 HOH HOH A . 
E 4 HOH 204 704 206 HOH HOH A . 
E 4 HOH 205 705 207 HOH HOH A . 
E 4 HOH 206 706 208 HOH HOH A . 
E 4 HOH 207 707 209 HOH HOH A . 
E 4 HOH 208 708 210 HOH HOH A . 
E 4 HOH 209 709 211 HOH HOH A . 
E 4 HOH 210 710 212 HOH HOH A . 
E 4 HOH 211 711 213 HOH HOH A . 
E 4 HOH 212 712 214 HOH HOH A . 
E 4 HOH 213 713 215 HOH HOH A . 
E 4 HOH 214 714 216 HOH HOH A . 
#