data_4RBO
# 
_entry.id   4RBO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4RBO         
NDB   NA3168       
RCSB  RCSB087145   
WWPDB D_1000087145 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          JCSG-423217 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.entry_id                        4RBO 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-12 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Joint Center for Structural Genomics (JCSG)'  1 
'Partnership for Stem Cell Biology (STEMCELL)' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structure-based discovery of NANOG variant with enhanced properties to promote self-renewal and reprogramming of pluripotent stem cells.
;
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            112 
_citation.page_first                4666 
_citation.page_last                 4671 
_citation.year                      2015 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25825768 
_citation.pdbx_database_id_DOI      10.1073/pnas.1502855112 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hayashi, Y.'      1  
primary 'Caboni, L.'       2  
primary 'Das, D.'          3  
primary 'Yumoto, F.'       4  
primary 'Clayton, T.'      5  
primary 'Deller, M.C.'     6  
primary 'Nguyen, P.'       7  
primary 'Farr, C.L.'       8  
primary 'Chiu, H.J.'       9  
primary 'Miller, M.D.'     10 
primary 'Elsliger, M.A.'   11 
primary 'Deacon, A.M.'     12 
primary 'Godzik, A.'       13 
primary 'Lesley, S.A.'     14 
primary 'Tomoda, K.'       15 
primary 'Conklin, B.R.'    16 
primary 'Wilson, I.A.'     17 
primary 'Yamanaka, S.'     18 
primary 'Fletterick, R.J.' 19 
# 
_cell.entry_id           4RBO 
_cell.length_a           215.603 
_cell.length_b           215.603 
_cell.length_c           42.269 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RBO 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Putative homeobox protein NANOGP8'            8610.933 2 ? ? 'UNP residues 94-162' ? 
2 polymer syn "5'-D(*GP*GP*CP*CP*CP*AP*TP*TP*CP*AP*AP*G)-3'" 3647.393 2 ? ? ?                     ? 
3 polymer syn "5'-D(*CP*TP*TP*GP*AP*AP*TP*GP*GP*GP*CP*C)-3'" 3678.403 2 ? ? ?                     ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no GKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNS 
GKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNS A,D JCSG-423217 
2 polydeoxyribonucleotide no no '(DG)(DG)(DC)(DC)(DC)(DA)(DT)(DT)(DC)(DA)(DA)(DG)'                     GGCCCATTCAAG B,E ? 
3 polydeoxyribonucleotide no no '(DC)(DT)(DT)(DG)(DA)(DA)(DT)(DG)(DG)(DG)(DC)(DC)'                     CTTGAATGGGCC C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  LYS n 
1 3  LYS n 
1 4  GLN n 
1 5  LYS n 
1 6  THR n 
1 7  ARG n 
1 8  THR n 
1 9  VAL n 
1 10 PHE n 
1 11 SER n 
1 12 SER n 
1 13 THR n 
1 14 GLN n 
1 15 LEU n 
1 16 CYS n 
1 17 VAL n 
1 18 LEU n 
1 19 ASN n 
1 20 ASP n 
1 21 ARG n 
1 22 PHE n 
1 23 GLN n 
1 24 ARG n 
1 25 GLN n 
1 26 LYS n 
1 27 TYR n 
1 28 LEU n 
1 29 SER n 
1 30 LEU n 
1 31 GLN n 
1 32 GLN n 
1 33 MET n 
1 34 GLN n 
1 35 GLU n 
1 36 LEU n 
1 37 SER n 
1 38 ASN n 
1 39 ILE n 
1 40 LEU n 
1 41 ASN n 
1 42 LEU n 
1 43 SER n 
1 44 TYR n 
1 45 LYS n 
1 46 GLN n 
1 47 VAL n 
1 48 LYS n 
1 49 THR n 
1 50 TRP n 
1 51 PHE n 
1 52 GLN n 
1 53 ASN n 
1 54 GLN n 
1 55 ARG n 
1 56 MET n 
1 57 LYS n 
1 58 SER n 
1 59 LYS n 
1 60 ARG n 
1 61 TRP n 
1 62 GLN n 
1 63 LYS n 
1 64 ASN n 
1 65 ASN n 
1 66 TRP n 
1 67 PRO n 
1 68 LYS n 
1 69 ASN n 
1 70 SER n 
2 1  DG  n 
2 2  DG  n 
2 3  DC  n 
2 4  DC  n 
2 5  DC  n 
2 6  DA  n 
2 7  DT  n 
2 8  DT  n 
2 9  DC  n 
2 10 DA  n 
2 11 DA  n 
2 12 DG  n 
3 1  DC  n 
3 2  DT  n 
3 3  DT  n 
3 4  DG  n 
3 5  DA  n 
3 6  DA  n 
3 7  DT  n 
3 8  DG  n 
3 9  DG  n 
3 10 DG  n 
3 11 DC  n 
3 12 DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NANOGP8, NM_024865' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia Coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)Star' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       46EkTevLIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP NANP8_HUMAN Q6NSW7 1 KKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNS 94 ? 
2 PDB 4RBO        4RBO   2 ?                                                                     ?  ? 
3 PDB 4RBO        4RBO   3 ?                                                                     ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4RBO A 2 ? 70 ? Q6NSW7 94 ? 162 ? 94 162 
2 1 4RBO D 2 ? 70 ? Q6NSW7 94 ? 162 ? 94 162 
3 2 4RBO B 1 ? 12 ? 4RBO   1  ? 12  ? 1  12  
4 2 4RBO E 1 ? 12 ? 4RBO   1  ? 12  ? 1  12  
5 3 4RBO C 1 ? 12 ? 4RBO   1  ? 12  ? 1  12  
6 3 4RBO F 1 ? 12 ? 4RBO   1  ? 12  ? 1  12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4RBO GLY A 1 ? UNP Q6NSW7 ? ? 'LEADER SEQUENCE' 0 1 
2 4RBO GLY D 1 ? UNP Q6NSW7 ? ? 'LEADER SEQUENCE' 0 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          4RBO 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      4.45 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   72.35 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              5.66 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
;0.200M calcium acetate, 12.00% 2-propanol, 0.1M sodium cacodylate pH 5.66, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 293K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.details                
'Flat mirror (vertical focusing); single crystal Si(111) bent monochromator (horizontal focusing)' 
_diffrn_detector.pdbx_collection_date   2013-02-22 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'single crystal Si(111) bent' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.pdbx_synchrotron_beamline   BL11-1 
_diffrn_source.type                        'SSRL BEAMLINE BL11-1' 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.entry_id                     4RBO 
_reflns.d_resolution_high            3.30 
_reflns.d_resolution_low             29.899 
_reflns.number_all                   8834 
_reflns.number_obs                   8834 
_reflns.pdbx_netI_over_sigmaI        9.400 
_reflns.pdbx_Rsym_value              0.083 
_reflns.pdbx_redundancy              3.400 
_reflns.percent_possible_obs         97.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.meanI_over_sigI_obs 
3.300  3.390  ? 1939 ? 0.552 0.552 ? 3.200 ? 602 94.300  1  1 ? 
3.390  3.480  ? 2275 ? 0.426 0.426 ? 3.600 ? 639 97.200  2  1 ? 
3.480  3.580  ? 2196 ? 0.489 0.489 ? 3.600 ? 613 98.600  3  1 ? 
3.580  3.690  ? 2161 ? 0.353 0.353 ? 3.700 ? 582 99.100  4  1 ? 
3.690  3.810  ? 2119 ? 0.268 0.268 ? 3.800 ? 565 96.000  5  1 ? 
3.810  3.940  ? 1907 ? 0.275 0.275 ? 3.600 ? 537 96.100  6  1 ? 
3.940  4.090  ? 1656 ? 0.222 0.222 ? 3.300 ? 496 93.200  7  1 ? 
4.090  4.260  ? 1761 ? 0.137 0.137 ? 3.200 ? 542 98.700  8  1 ? 
4.260  4.450  ? 1836 ? 0.142 0.142 ? 3.600 ? 504 100.000 9  1 ? 
4.450  4.670  ? 1771 ? 0.112 0.112 ? 3.500 ? 505 99.600  10 1 ? 
4.670  4.920  ? 1540 ? 0.108 0.108 ? 3.300 ? 467 99.700  11 1 ? 
4.920  5.220  ? 1565 ? 0.077 0.077 ? 3.500 ? 444 97.000  12 1 ? 
5.220  5.580  ? 1206 ? 0.063 0.063 ? 3.300 ? 371 91.500  13 1 ? 
5.580  6.030  ? 1416 ? 0.069 0.069 ? 3.500 ? 409 99.300  14 1 ? 
6.030  6.600  ? 1288 ? 0.072 0.072 ? 3.600 ? 361 99.400  15 1 ? 
6.600  7.380  ? 1177 ? 0.055 0.055 ? 3.500 ? 335 97.500  16 1 ? 
7.380  8.520  ? 819  ? 0.041 0.041 ? 2.900 ? 283 91.100  17 1 ? 
8.520  10.440 ? 820  ? 0.040 0.040 ? 3.100 ? 262 99.100  18 1 ? 
10.440 14.760 ? 649  ? 0.037 0.037 ? 3.100 ? 210 98.700  19 1 ? 
14.760 29.899 ? 301  ? 0.020 0.020 ? 2.800 ? 107 82.200  20 1 ? 
# 
_refine.entry_id                                 4RBO 
_refine.ls_d_res_high                            3.3000 
_refine.ls_d_res_low                             29.899 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.0700 
_refine.ls_number_reflns_obs                     8823 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.details                                  
;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 2. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2365 
_refine.ls_R_factor_R_work                       0.2349 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2682 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.7300 
_refine.ls_number_reflns_R_free                  417 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               188.3153 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.4800 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                325.040 
_refine.B_iso_min                                76.410 
_refine.pdbx_overall_phase_error                 30.1500 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        932 
_refine_hist.pdbx_number_atoms_nucleic_acid   972 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1904 
_refine_hist.d_res_high                       3.3000 
_refine_hist.d_res_low                        29.899 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           2036 0.003  ? ? ? 'X-RAY DIFFRACTION' 
f_angle_d          2938 0.778  ? ? ? 'X-RAY DIFFRACTION' 
f_chiral_restr     325  0.036  ? ? ? 'X-RAY DIFFRACTION' 
f_plane_restr      207  0.002  ? ? ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 830  23.088 ? ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
3.3003 3.7771  3 96.0000 2703 . 0.2804 0.3111 . 153 . 2856 . . 'X-RAY DIFFRACTION' 
3.7771 4.7556  3 96.0000 2763 . 0.2676 0.2935 . 137 . 2900 . . 'X-RAY DIFFRACTION' 
4.7556 29.9000 3 96.0000 2940 . 0.2079 0.2393 . 127 . 3067 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4RBO 
_struct.title                     'Crystal structure of a Nanog homeobox (NANOG) from Homo sapiens at 3.30 A resolution' 
_struct.pdbx_descriptor           'Putative homeobox protein NANOGP8/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
;Homeobox, PF00046 family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Partnership for Stem Cell Biology, STEMCELL, Protein Structure Initiative, PSI-BIOLOGY, DNA BINDING PROTEIN, TRANSCRIPTION, TRANSCRIPTION-DNA complex
;
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN, TRANSCRIPTION/DNA' 
_struct_keywords.entry_id        4RBO 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 11 ? GLN A 25 ? SER A 103 GLN A 117 1 ? 15 
HELX_P HELX_P2 2 SER A 29 ? LEU A 40 ? SER A 121 LEU A 132 1 ? 12 
HELX_P HELX_P3 3 SER A 43 ? TRP A 61 ? SER A 135 TRP A 153 1 ? 19 
HELX_P HELX_P4 4 SER D 11 ? GLN D 25 ? SER D 103 GLN D 117 1 ? 15 
HELX_P HELX_P5 5 SER D 29 ? LEU D 40 ? SER D 121 LEU D 132 1 ? 12 
HELX_P HELX_P6 6 SER D 43 ? TRP D 61 ? SER D 135 TRP D 153 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 16 SG ? ? ? 1_555 D CYS 16 SG ? ? A CYS 108 D CYS 108 1_556 ? ? ? ? ? ? ?               2.028 ? 
hydrog1  hydrog ? ? B DG  1  N1 ? ? ? 1_555 C DC  12 N3 ? ? B DG  1   C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? B DG  1  N2 ? ? ? 1_555 C DC  12 O2 ? ? B DG  1   C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? B DG  1  O6 ? ? ? 1_555 C DC  12 N4 ? ? B DG  1   C DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? B DG  2  N1 ? ? ? 1_555 C DC  11 N3 ? ? B DG  2   C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? B DG  2  N2 ? ? ? 1_555 C DC  11 O2 ? ? B DG  2   C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? B DG  2  O6 ? ? ? 1_555 C DC  11 N4 ? ? B DG  2   C DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? B DC  3  N3 ? ? ? 1_555 C DG  10 N1 ? ? B DC  3   C DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? B DC  3  N4 ? ? ? 1_555 C DG  10 O6 ? ? B DC  3   C DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? B DC  3  O2 ? ? ? 1_555 C DG  10 N2 ? ? B DC  3   C DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? B DC  4  N4 ? ? ? 1_555 C DG  8  O6 ? ? B DC  4   C DG  8   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog11 hydrog ? ? B DC  4  N3 ? ? ? 1_555 C DG  9  N1 ? ? B DC  4   C DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? B DC  4  N4 ? ? ? 1_555 C DG  9  O6 ? ? B DC  4   C DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? B DC  4  O2 ? ? ? 1_555 C DG  9  N2 ? ? B DC  4   C DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? B DC  5  N4 ? ? ? 1_555 C DT  7  O4 ? ? B DC  5   C DT  7   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog15 hydrog ? ? B DC  5  N3 ? ? ? 1_555 C DG  8  N1 ? ? B DC  5   C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? B DC  5  N4 ? ? ? 1_555 C DG  8  O6 ? ? B DC  5   C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? B DC  5  O2 ? ? ? 1_555 C DG  8  N2 ? ? B DC  5   C DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? B DA  6  N1 ? ? ? 1_555 C DT  7  N3 ? ? B DA  6   C DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? B DA  6  N6 ? ? ? 1_555 C DT  7  O4 ? ? B DA  6   C DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? B DT  7  N3 ? ? ? 1_555 C DA  6  N1 ? ? B DT  7   C DA  6   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog21 hydrog ? ? B DT  8  N3 ? ? ? 1_555 C DA  5  N1 ? ? B DT  8   C DA  5   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog22 hydrog ? ? B DC  9  N4 ? ? ? 1_555 C DT  3  O4 ? ? B DC  9   C DT  3   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog23 hydrog ? ? B DC  9  O2 ? ? ? 1_555 C DG  4  N2 ? ? B DC  9   C DG  4   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog24 hydrog ? ? B DA  10 N1 ? ? ? 1_555 C DT  3  N3 ? ? B DA  10  C DT  3   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog25 hydrog ? ? B DA  11 N1 ? ? ? 1_555 C DT  2  N3 ? ? B DA  11  C DT  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ? ? B DA  11 N6 ? ? ? 1_555 C DT  2  O4 ? ? B DA  11  C DT  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? B DG  12 N1 ? ? ? 1_555 C DC  1  N3 ? ? B DG  12  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? B DG  12 N2 ? ? ? 1_555 C DC  1  O2 ? ? B DG  12  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? B DG  12 O6 ? ? ? 1_555 C DC  1  N4 ? ? B DG  12  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? E DG  1  O6 ? ? ? 1_555 F DC  11 N4 ? ? E DG  1   F DC  11  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog31 hydrog ? ? E DG  1  N2 ? ? ? 1_555 F DC  12 O2 ? ? E DG  1   F DC  12  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog32 hydrog ? ? E DG  2  O6 ? ? ? 1_555 F DG  10 N1 ? ? E DG  2   F DG  10  1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? 
hydrog33 hydrog ? ? E DG  2  N1 ? ? ? 1_555 F DC  11 N3 ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ? ? E DG  2  N2 ? ? ? 1_555 F DC  11 O2 ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ? ? E DG  2  O6 ? ? ? 1_555 F DC  11 N4 ? ? E DG  2   F DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ? ? E DC  3  N4 ? ? ? 1_555 F DG  9  O6 ? ? E DC  3   F DG  9   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog37 hydrog ? ? E DC  3  N3 ? ? ? 1_555 F DG  10 N1 ? ? E DC  3   F DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38 hydrog ? ? E DC  3  N4 ? ? ? 1_555 F DG  10 O6 ? ? E DC  3   F DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39 hydrog ? ? E DC  3  O2 ? ? ? 1_555 F DG  10 N2 ? ? E DC  3   F DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ? ? E DC  4  N4 ? ? ? 1_555 F DG  8  O6 ? ? E DC  4   F DG  8   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog41 hydrog ? ? E DC  4  N3 ? ? ? 1_555 F DG  9  N1 ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42 hydrog ? ? E DC  4  N4 ? ? ? 1_555 F DG  9  O6 ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43 hydrog ? ? E DC  4  O2 ? ? ? 1_555 F DG  9  N2 ? ? E DC  4   F DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44 hydrog ? ? E DC  5  N4 ? ? ? 1_555 F DT  7  O4 ? ? E DC  5   F DT  7   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog45 hydrog ? ? E DC  5  N3 ? ? ? 1_555 F DG  8  N1 ? ? E DC  5   F DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46 hydrog ? ? E DC  5  N4 ? ? ? 1_555 F DG  8  O6 ? ? E DC  5   F DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47 hydrog ? ? E DC  5  O2 ? ? ? 1_555 F DG  8  N2 ? ? E DC  5   F DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48 hydrog ? ? E DA  6  N1 ? ? ? 1_555 F DT  7  N3 ? ? E DA  6   F DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49 hydrog ? ? E DA  6  N6 ? ? ? 1_555 F DT  7  O4 ? ? E DA  6   F DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50 hydrog ? ? E DT  7  N3 ? ? ? 1_555 F DA  6  N1 ? ? E DT  7   F DA  6   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog51 hydrog ? ? E DT  8  N3 ? ? ? 1_555 F DA  5  N1 ? ? E DT  8   F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52 hydrog ? ? E DT  8  O4 ? ? ? 1_555 F DA  5  N6 ? ? E DT  8   F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53 hydrog ? ? E DC  9  O2 ? ? ? 1_555 F DG  4  N2 ? ? E DC  9   F DG  4   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog54 hydrog ? ? E DA  10 N1 ? ? ? 1_555 F DT  3  N3 ? ? E DA  10  F DT  3   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog55 hydrog ? ? E DA  11 N1 ? ? ? 1_555 F DT  2  N3 ? ? E DA  11  F DT  2   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog56 hydrog ? ? E DG  12 N2 ? ? ? 1_555 F DC  1  O2 ? ? E DG  12  F DC  1   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
hydrog ? ? 
# 
_atom_sites.entry_id                    4RBO 
_atom_sites.fract_transf_matrix[1][1]   0.004638 
_atom_sites.fract_transf_matrix[1][2]   0.002678 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005356 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023658 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N      . THR A 1 8  ? 124.607 124.231 53.386 1.00 153.04 ? 100 THR A N      1 
ATOM 2    C CA     . THR A 1 8  ? 124.090 123.002 53.976 1.00 181.37 ? 100 THR A CA     1 
ATOM 3    C C      . THR A 1 8  ? 125.186 121.943 54.010 1.00 188.15 ? 100 THR A C      1 
ATOM 4    O O      . THR A 1 8  ? 126.152 122.010 53.251 1.00 182.67 ? 100 THR A O      1 
ATOM 5    C CB     . THR A 1 8  ? 122.871 122.474 53.187 1.00 181.80 ? 100 THR A CB     1 
ATOM 6    O OG1    . THR A 1 8  ? 121.828 123.456 53.208 1.00 205.56 ? 100 THR A OG1    1 
ATOM 7    C CG2    . THR A 1 8  ? 122.337 121.160 53.769 1.00 133.70 ? 100 THR A CG2    1 
ATOM 8    H HA     . THR A 1 8  ? 123.809 123.178 54.887 1.00 217.64 ? 100 THR A HA     1 
ATOM 9    H HB     . THR A 1 8  ? 123.134 122.311 52.268 1.00 218.16 ? 100 THR A HB     1 
ATOM 10   H HG1    . THR A 1 8  ? 121.598 123.613 54.001 1.00 246.67 ? 100 THR A HG1    1 
ATOM 11   H HG21   . THR A 1 8  ? 121.574 120.855 53.254 1.00 160.44 ? 100 THR A HG21   1 
ATOM 12   H HG22   . THR A 1 8  ? 123.029 120.480 53.741 1.00 160.44 ? 100 THR A HG22   1 
ATOM 13   H HG23   . THR A 1 8  ? 122.063 121.293 54.690 1.00 160.44 ? 100 THR A HG23   1 
ATOM 14   N N      . VAL A 1 9  ? 125.027 120.971 54.901 1.00 189.03 ? 101 VAL A N      1 
ATOM 15   C CA     . VAL A 1 9  ? 125.972 119.872 55.032 1.00 190.15 ? 101 VAL A CA     1 
ATOM 16   C C      . VAL A 1 9  ? 125.246 118.650 55.577 1.00 184.25 ? 101 VAL A C      1 
ATOM 17   O O      . VAL A 1 9  ? 124.356 118.774 56.418 1.00 185.39 ? 101 VAL A O      1 
ATOM 18   C CB     . VAL A 1 9  ? 127.143 120.249 55.964 1.00 186.06 ? 101 VAL A CB     1 
ATOM 19   C CG1    . VAL A 1 9  ? 126.614 120.779 57.295 1.00 189.67 ? 101 VAL A CG1    1 
ATOM 20   C CG2    . VAL A 1 9  ? 128.083 119.064 56.175 1.00 152.15 ? 101 VAL A CG2    1 
ATOM 21   H H      . VAL A 1 9  ? 124.368 120.927 55.451 1.00 226.84 ? 101 VAL A H      1 
ATOM 22   H HA     . VAL A 1 9  ? 126.333 119.651 54.159 1.00 228.18 ? 101 VAL A HA     1 
ATOM 23   H HB     . VAL A 1 9  ? 127.655 120.960 55.547 1.00 223.27 ? 101 VAL A HB     1 
ATOM 24   H HG11   . VAL A 1 9  ? 127.365 121.009 57.864 1.00 227.60 ? 101 VAL A HG11   1 
ATOM 25   H HG12   . VAL A 1 9  ? 126.071 121.566 57.129 1.00 227.60 ? 101 VAL A HG12   1 
ATOM 26   H HG13   . VAL A 1 9  ? 126.077 120.090 57.718 1.00 227.60 ? 101 VAL A HG13   1 
ATOM 27   H HG21   . VAL A 1 9  ? 128.804 119.335 56.763 1.00 182.58 ? 101 VAL A HG21   1 
ATOM 28   H HG22   . VAL A 1 9  ? 127.585 118.334 56.575 1.00 182.58 ? 101 VAL A HG22   1 
ATOM 29   H HG23   . VAL A 1 9  ? 128.440 118.788 55.316 1.00 182.58 ? 101 VAL A HG23   1 
ATOM 30   N N      . PHE A 1 10 ? 125.632 117.472 55.097 1.00 156.42 ? 102 PHE A N      1 
ATOM 31   C CA     . PHE A 1 10 ? 124.984 116.231 55.503 1.00 149.05 ? 102 PHE A CA     1 
ATOM 32   C C      . PHE A 1 10 ? 125.766 115.511 56.590 1.00 149.70 ? 102 PHE A C      1 
ATOM 33   O O      . PHE A 1 10 ? 126.976 115.694 56.723 1.00 155.50 ? 102 PHE A O      1 
ATOM 34   C CB     . PHE A 1 10 ? 124.810 115.315 54.294 1.00 179.56 ? 102 PHE A CB     1 
ATOM 35   C CG     . PHE A 1 10 ? 123.887 115.865 53.252 1.00 177.29 ? 102 PHE A CG     1 
ATOM 36   C CD1    . PHE A 1 10 ? 122.536 116.013 53.513 1.00 150.08 ? 102 PHE A CD1    1 
ATOM 37   C CD2    . PHE A 1 10 ? 124.368 116.238 52.011 1.00 155.73 ? 102 PHE A CD2    1 
ATOM 38   C CE1    . PHE A 1 10 ? 121.684 116.523 52.557 1.00 153.62 ? 102 PHE A CE1    1 
ATOM 39   C CE2    . PHE A 1 10 ? 123.520 116.745 51.051 1.00 115.64 ? 102 PHE A CE2    1 
ATOM 40   C CZ     . PHE A 1 10 ? 122.178 116.889 51.324 1.00 155.07 ? 102 PHE A CZ     1 
ATOM 41   H H      . PHE A 1 10 ? 126.271 117.365 54.532 1.00 187.71 ? 102 PHE A H      1 
ATOM 42   H HA     . PHE A 1 10 ? 124.103 116.435 55.853 1.00 178.86 ? 102 PHE A HA     1 
ATOM 43   H HB2    . PHE A 1 10 ? 125.676 115.175 53.880 1.00 215.47 ? 102 PHE A HB2    1 
ATOM 44   H HB3    . PHE A 1 10 ? 124.448 114.466 54.594 1.00 215.47 ? 102 PHE A HB3    1 
ATOM 45   H HD1    . PHE A 1 10 ? 122.199 115.767 54.345 1.00 180.09 ? 102 PHE A HD1    1 
ATOM 46   H HD2    . PHE A 1 10 ? 125.273 116.144 51.821 1.00 186.88 ? 102 PHE A HD2    1 
ATOM 47   H HE1    . PHE A 1 10 ? 120.778 116.617 52.742 1.00 184.34 ? 102 PHE A HE1    1 
ATOM 48   H HE2    . PHE A 1 10 ? 123.854 116.993 50.220 1.00 138.76 ? 102 PHE A HE2    1 
ATOM 49   H HZ     . PHE A 1 10 ? 121.606 117.231 50.676 1.00 186.09 ? 102 PHE A HZ     1 
ATOM 50   N N      . SER A 1 11 ? 125.066 114.686 57.361 1.00 157.44 ? 103 SER A N      1 
ATOM 51   C CA     . SER A 1 11 ? 125.689 113.936 58.442 1.00 143.02 ? 103 SER A CA     1 
ATOM 52   C C      . SER A 1 11 ? 126.529 112.802 57.875 1.00 126.49 ? 103 SER A C      1 
ATOM 53   O O      . SER A 1 11 ? 126.386 112.443 56.708 1.00 147.16 ? 103 SER A O      1 
ATOM 54   C CB     . SER A 1 11 ? 124.625 113.375 59.383 1.00 157.72 ? 103 SER A CB     1 
ATOM 55   O OG     . SER A 1 11 ? 123.483 114.212 59.417 1.00 167.26 ? 103 SER A OG     1 
ATOM 56   H H      . SER A 1 11 ? 124.223 114.543 57.277 1.00 188.93 ? 103 SER A H      1 
ATOM 57   H HA     . SER A 1 11 ? 126.269 114.524 58.950 1.00 171.62 ? 103 SER A HA     1 
ATOM 58   H HB2    . SER A 1 11 ? 124.361 112.495 59.072 1.00 189.27 ? 103 SER A HB2    1 
ATOM 59   H HB3    . SER A 1 11 ? 124.996 113.313 60.277 1.00 189.27 ? 103 SER A HB3    1 
ATOM 60   H HG     . SER A 1 11 ? 122.907 113.892 59.938 1.00 200.71 ? 103 SER A HG     1 
ATOM 61   N N      . SER A 1 12 ? 127.406 112.237 58.697 1.00 161.89 ? 104 SER A N      1 
ATOM 62   C CA     . SER A 1 12 ? 128.177 111.075 58.281 1.00 161.32 ? 104 SER A CA     1 
ATOM 63   C C      . SER A 1 12 ? 127.216 109.896 58.172 1.00 165.82 ? 104 SER A C      1 
ATOM 64   O O      . SER A 1 12 ? 127.365 109.031 57.310 1.00 161.82 ? 104 SER A O      1 
ATOM 65   C CB     . SER A 1 12 ? 129.306 110.778 59.267 1.00 163.08 ? 104 SER A CB     1 
ATOM 66   O OG     . SER A 1 12 ? 130.105 109.699 58.817 1.00 183.05 ? 104 SER A OG     1 
ATOM 67   H H      . SER A 1 12 ? 127.572 112.506 59.497 1.00 194.27 ? 104 SER A H      1 
ATOM 68   H HA     . SER A 1 12 ? 128.565 111.239 57.407 1.00 193.59 ? 104 SER A HA     1 
ATOM 69   H HB2    . SER A 1 12 ? 129.863 111.567 59.355 1.00 195.70 ? 104 SER A HB2    1 
ATOM 70   H HB3    . SER A 1 12 ? 128.921 110.547 60.127 1.00 195.70 ? 104 SER A HB3    1 
ATOM 71   H HG     . SER A 1 12 ? 130.720 109.547 59.368 1.00 219.67 ? 104 SER A HG     1 
ATOM 72   N N      . THR A 1 13 ? 126.228 109.880 59.064 1.00 161.91 ? 105 THR A N      1 
ATOM 73   C CA     . THR A 1 13 ? 125.168 108.875 59.053 1.00 156.26 ? 105 THR A CA     1 
ATOM 74   C C      . THR A 1 13 ? 124.405 108.883 57.738 1.00 171.51 ? 105 THR A C      1 
ATOM 75   O O      . THR A 1 13 ? 124.015 107.839 57.224 1.00 204.79 ? 105 THR A O      1 
ATOM 76   C CB     . THR A 1 13 ? 124.151 109.096 60.191 1.00 169.85 ? 105 THR A CB     1 
ATOM 77   O OG1    . THR A 1 13 ? 123.597 110.413 60.095 1.00 186.95 ? 105 THR A OG1    1 
ATOM 78   C CG2    . THR A 1 13 ? 124.802 108.921 61.545 1.00 188.81 ? 105 THR A CG2    1 
ATOM 79   H H      . THR A 1 13 ? 126.149 110.454 59.700 1.00 194.29 ? 105 THR A H      1 
ATOM 80   H HA     . THR A 1 13 ? 125.563 107.996 59.167 1.00 187.51 ? 105 THR A HA     1 
ATOM 81   H HB     . THR A 1 13 ? 123.437 108.444 60.112 1.00 203.82 ? 105 THR A HB     1 
ATOM 82   H HG1    . THR A 1 13 ? 123.042 110.537 60.714 1.00 224.34 ? 105 THR A HG1    1 
ATOM 83   H HG21   . THR A 1 13 ? 124.149 109.064 62.248 1.00 226.57 ? 105 THR A HG21   1 
ATOM 84   H HG22   . THR A 1 13 ? 125.162 108.024 61.626 1.00 226.57 ? 105 THR A HG22   1 
ATOM 85   H HG23   . THR A 1 13 ? 125.524 109.561 61.650 1.00 226.57 ? 105 THR A HG23   1 
ATOM 86   N N      . GLN A 1 14 ? 124.176 110.079 57.209 1.00 154.75 ? 106 GLN A N      1 
ATOM 87   C CA     . GLN A 1 14 ? 123.364 110.249 56.012 1.00 140.25 ? 106 GLN A CA     1 
ATOM 88   C C      . GLN A 1 14 ? 124.140 109.875 54.751 1.00 146.10 ? 106 GLN A C      1 
ATOM 89   O O      . GLN A 1 14 ? 123.642 109.119 53.905 1.00 165.76 ? 106 GLN A O      1 
ATOM 90   C CB     . GLN A 1 14 ? 122.870 111.694 55.935 1.00 134.87 ? 106 GLN A CB     1 
ATOM 91   C CG     . GLN A 1 14 ? 121.997 112.084 57.122 1.00 136.77 ? 106 GLN A CG     1 
ATOM 92   C CD     . GLN A 1 14 ? 121.362 113.451 56.973 1.00 141.18 ? 106 GLN A CD     1 
ATOM 93   O OE1    . GLN A 1 14 ? 122.034 114.431 56.650 1.00 127.18 ? 106 GLN A OE1    1 
ATOM 94   N NE2    . GLN A 1 14 ? 120.059 113.526 57.225 1.00 123.92 ? 106 GLN A NE2    1 
ATOM 95   H H      . GLN A 1 14 ? 124.483 110.816 57.529 1.00 185.70 ? 106 GLN A H      1 
ATOM 96   H HA     . GLN A 1 14 ? 122.589 109.669 56.070 1.00 168.30 ? 106 GLN A HA     1 
ATOM 97   H HB2    . GLN A 1 14 ? 123.635 112.289 55.918 1.00 161.84 ? 106 GLN A HB2    1 
ATOM 98   H HB3    . GLN A 1 14 ? 122.344 111.806 55.128 1.00 161.84 ? 106 GLN A HB3    1 
ATOM 99   H HG2    . GLN A 1 14 ? 121.284 111.432 57.216 1.00 164.12 ? 106 GLN A HG2    1 
ATOM 100  H HG3    . GLN A 1 14 ? 122.543 112.094 57.924 1.00 164.12 ? 106 GLN A HG3    1 
ATOM 101  H HE21   . GLN A 1 14 ? 119.625 112.821 57.459 1.00 148.70 ? 106 GLN A HE21   1 
ATOM 102  H HE22   . GLN A 1 14 ? 119.650 114.279 57.155 1.00 148.70 ? 106 GLN A HE22   1 
ATOM 103  N N      . LEU A 1 15 ? 125.367 110.381 54.647 1.00 120.05 ? 107 LEU A N      1 
ATOM 104  C CA     . LEU A 1 15 ? 126.224 110.096 53.499 1.00 123.63 ? 107 LEU A CA     1 
ATOM 105  C C      . LEU A 1 15 ? 126.383 108.602 53.323 1.00 133.53 ? 107 LEU A C      1 
ATOM 106  O O      . LEU A 1 15 ? 126.576 108.109 52.215 1.00 161.74 ? 107 LEU A O      1 
ATOM 107  C CB     . LEU A 1 15 ? 127.600 110.736 53.661 1.00 106.44 ? 107 LEU A CB     1 
ATOM 108  C CG     . LEU A 1 15 ? 127.823 111.969 52.792 1.00 141.29 ? 107 LEU A CG     1 
ATOM 109  C CD1    . LEU A 1 15 ? 127.032 113.124 53.353 1.00 158.79 ? 107 LEU A CD1    1 
ATOM 110  C CD2    . LEU A 1 15 ? 129.300 112.310 52.693 1.00 171.52 ? 107 LEU A CD2    1 
ATOM 111  H H      . LEU A 1 15 ? 125.729 110.896 55.233 1.00 144.07 ? 107 LEU A H      1 
ATOM 112  H HA     . LEU A 1 15 ? 125.814 110.455 52.697 1.00 148.35 ? 107 LEU A HA     1 
ATOM 113  H HB2    . LEU A 1 15 ? 127.712 111.004 54.587 1.00 127.73 ? 107 LEU A HB2    1 
ATOM 114  H HB3    . LEU A 1 15 ? 128.277 110.083 53.425 1.00 127.73 ? 107 LEU A HB3    1 
ATOM 115  H HG     . LEU A 1 15 ? 127.495 111.789 51.897 1.00 169.54 ? 107 LEU A HG     1 
ATOM 116  H HD11   . LEU A 1 15 ? 127.177 113.905 52.797 1.00 190.55 ? 107 LEU A HD11   1 
ATOM 117  H HD12   . LEU A 1 15 ? 126.091 112.890 53.357 1.00 190.55 ? 107 LEU A HD12   1 
ATOM 118  H HD13   . LEU A 1 15 ? 127.332 113.301 54.258 1.00 190.55 ? 107 LEU A HD13   1 
ATOM 119  H HD21   . LEU A 1 15 ? 129.406 113.096 52.135 1.00 205.82 ? 107 LEU A HD21   1 
ATOM 120  H HD22   . LEU A 1 15 ? 129.643 112.486 53.583 1.00 205.82 ? 107 LEU A HD22   1 
ATOM 121  H HD23   . LEU A 1 15 ? 129.771 111.558 52.299 1.00 205.82 ? 107 LEU A HD23   1 
ATOM 122  N N      . CYS A 1 16 ? 126.318 107.889 54.436 1.00 117.11 ? 108 CYS A N      1 
ATOM 123  C CA     . CYS A 1 16 ? 126.402 106.443 54.423 1.00 155.42 ? 108 CYS A CA     1 
ATOM 124  C C      . CYS A 1 16 ? 125.299 105.791 53.610 1.00 143.78 ? 108 CYS A C      1 
ATOM 125  O O      . CYS A 1 16 ? 125.554 105.219 52.551 1.00 171.73 ? 108 CYS A O      1 
ATOM 126  C CB     . CYS A 1 16 ? 126.335 105.923 55.845 1.00 180.09 ? 108 CYS A CB     1 
ATOM 127  S SG     . CYS A 1 16 ? 126.337 104.158 55.968 1.00 234.08 ? 108 CYS A SG     1 
ATOM 128  H H      . CYS A 1 16 ? 126.224 108.226 55.222 1.00 140.53 ? 108 CYS A H      1 
ATOM 129  H HA     . CYS A 1 16 ? 127.254 106.177 54.043 1.00 186.50 ? 108 CYS A HA     1 
ATOM 130  H HB2    . CYS A 1 16 ? 127.104 106.254 56.335 1.00 216.11 ? 108 CYS A HB2    1 
ATOM 131  H HB3    . CYS A 1 16 ? 125.519 106.247 56.258 1.00 216.11 ? 108 CYS A HB3    1 
ATOM 132  H HG     . CYS A 1 16 ? 126.281 103.847 57.126 1.00 280.89 ? 108 CYS A HG     1 
ATOM 133  N N      . VAL A 1 17 ? 124.075 105.868 54.121 1.00 142.89 ? 109 VAL A N      1 
ATOM 134  C CA     . VAL A 1 17 ? 122.936 105.242 53.465 1.00 165.30 ? 109 VAL A CA     1 
ATOM 135  C C      . VAL A 1 17 ? 122.789 105.800 52.057 1.00 158.42 ? 109 VAL A C      1 
ATOM 136  O O      . VAL A 1 17 ? 122.434 105.072 51.126 1.00 176.76 ? 109 VAL A O      1 
ATOM 137  C CB     . VAL A 1 17 ? 121.628 105.453 54.262 1.00 155.83 ? 109 VAL A CB     1 
ATOM 138  C CG1    . VAL A 1 17 ? 121.331 106.936 54.439 1.00 144.06 ? 109 VAL A CG1    1 
ATOM 139  C CG2    . VAL A 1 17 ? 120.464 104.740 53.581 1.00 161.45 ? 109 VAL A CG2    1 
ATOM 140  H H      . VAL A 1 17 ? 123.878 106.280 54.850 1.00 171.46 ? 109 VAL A H      1 
ATOM 141  H HA     . VAL A 1 17 ? 123.096 104.288 53.396 1.00 198.36 ? 109 VAL A HA     1 
ATOM 142  H HB     . VAL A 1 17 ? 121.735 105.066 55.145 1.00 186.99 ? 109 VAL A HB     1 
ATOM 143  H HG11   . VAL A 1 17 ? 120.507 107.035 54.941 1.00 172.87 ? 109 VAL A HG11   1 
ATOM 144  H HG12   . VAL A 1 17 ? 122.064 107.349 54.922 1.00 172.87 ? 109 VAL A HG12   1 
ATOM 145  H HG13   . VAL A 1 17 ? 121.238 107.346 53.565 1.00 172.87 ? 109 VAL A HG13   1 
ATOM 146  H HG21   . VAL A 1 17 ? 119.657 104.888 54.099 1.00 193.74 ? 109 VAL A HG21   1 
ATOM 147  H HG22   . VAL A 1 17 ? 120.353 105.100 52.687 1.00 193.74 ? 109 VAL A HG22   1 
ATOM 148  H HG23   . VAL A 1 17 ? 120.658 103.791 53.535 1.00 193.74 ? 109 VAL A HG23   1 
ATOM 149  N N      . LEU A 1 18 ? 123.078 107.090 51.903 1.00 138.30 ? 110 LEU A N      1 
ATOM 150  C CA     . LEU A 1 18 ? 123.034 107.719 50.590 1.00 124.99 ? 110 LEU A CA     1 
ATOM 151  C C      . LEU A 1 18 ? 124.001 107.055 49.611 1.00 123.72 ? 110 LEU A C      1 
ATOM 152  O O      . LEU A 1 18 ? 123.592 106.578 48.551 1.00 147.92 ? 110 LEU A O      1 
ATOM 153  C CB     . LEU A 1 18 ? 123.344 109.212 50.709 1.00 121.76 ? 110 LEU A CB     1 
ATOM 154  C CG     . LEU A 1 18 ? 122.125 110.137 50.686 1.00 141.83 ? 110 LEU A CG     1 
ATOM 155  C CD1    . LEU A 1 18 ? 121.099 109.724 51.728 1.00 148.89 ? 110 LEU A CD1    1 
ATOM 156  C CD2    . LEU A 1 18 ? 122.546 111.581 50.899 1.00 143.54 ? 110 LEU A CD2    1 
ATOM 157  H H      . LEU A 1 18 ? 123.302 107.620 52.542 1.00 165.95 ? 110 LEU A H      1 
ATOM 158  H HA     . LEU A 1 18 ? 122.138 107.629 50.230 1.00 149.98 ? 110 LEU A HA     1 
ATOM 159  H HB2    . LEU A 1 18 ? 123.810 109.363 51.546 1.00 146.11 ? 110 LEU A HB2    1 
ATOM 160  H HB3    . LEU A 1 18 ? 123.917 109.467 49.968 1.00 146.11 ? 110 LEU A HB3    1 
ATOM 161  H HG     . LEU A 1 18 ? 121.703 110.077 49.815 1.00 170.20 ? 110 LEU A HG     1 
ATOM 162  H HD11   . LEU A 1 18 ? 120.344 110.331 51.685 1.00 178.67 ? 110 LEU A HD11   1 
ATOM 163  H HD12   . LEU A 1 18 ? 120.808 108.818 51.542 1.00 178.67 ? 110 LEU A HD12   1 
ATOM 164  H HD13   . LEU A 1 18 ? 121.508 109.767 52.607 1.00 178.67 ? 110 LEU A HD13   1 
ATOM 165  H HD21   . LEU A 1 18 ? 121.757 112.145 50.881 1.00 172.24 ? 110 LEU A HD21   1 
ATOM 166  H HD22   . LEU A 1 18 ? 122.988 111.657 51.759 1.00 172.24 ? 110 LEU A HD22   1 
ATOM 167  H HD23   . LEU A 1 18 ? 123.155 111.839 50.190 1.00 172.24 ? 110 LEU A HD23   1 
ATOM 168  N N      . ASN A 1 19 ? 125.281 107.030 49.965 1.00 119.11 ? 111 ASN A N      1 
ATOM 169  C CA     . ASN A 1 19 ? 126.296 106.400 49.127 1.00 119.66 ? 111 ASN A CA     1 
ATOM 170  C C      . ASN A 1 19 ? 126.001 104.922 48.876 1.00 110.38 ? 111 ASN A C      1 
ATOM 171  O O      . ASN A 1 19 ? 126.171 104.429 47.759 1.00 153.85 ? 111 ASN A O      1 
ATOM 172  C CB     . ASN A 1 19 ? 127.678 106.557 49.765 1.00 121.12 ? 111 ASN A CB     1 
ATOM 173  C CG     . ASN A 1 19 ? 128.236 107.964 49.614 1.00 148.88 ? 111 ASN A CG     1 
ATOM 174  O OD1    . ASN A 1 19 ? 127.988 108.641 48.616 1.00 179.36 ? 111 ASN A OD1    1 
ATOM 175  N ND2    . ASN A 1 19 ? 128.990 108.412 50.611 1.00 136.05 ? 111 ASN A ND2    1 
ATOM 176  H H      . ASN A 1 19 ? 125.590 107.373 50.691 1.00 142.93 ? 111 ASN A H      1 
ATOM 177  H HA     . ASN A 1 19 ? 126.313 106.849 48.267 1.00 143.60 ? 111 ASN A HA     1 
ATOM 178  H HB2    . ASN A 1 19 ? 127.613 106.360 50.713 1.00 145.35 ? 111 ASN A HB2    1 
ATOM 179  H HB3    . ASN A 1 19 ? 128.295 105.942 49.339 1.00 145.35 ? 111 ASN A HB3    1 
ATOM 180  H HD21   . ASN A 1 19 ? 129.139 107.912 51.295 1.00 163.26 ? 111 ASN A HD21   1 
ATOM 181  H HD22   . ASN A 1 19 ? 129.329 109.201 50.573 1.00 163.26 ? 111 ASN A HD22   1 
ATOM 182  N N      . ASP A 1 20 ? 125.560 104.221 49.916 1.00 119.22 ? 112 ASP A N      1 
ATOM 183  C CA     . ASP A 1 20 ? 125.226 102.806 49.794 1.00 142.33 ? 112 ASP A CA     1 
ATOM 184  C C      . ASP A 1 20 ? 124.111 102.605 48.781 1.00 161.95 ? 112 ASP A C      1 
ATOM 185  O O      . ASP A 1 20 ? 124.207 101.751 47.900 1.00 192.30 ? 112 ASP A O      1 
ATOM 186  C CB     . ASP A 1 20 ? 124.805 102.222 51.141 1.00 157.21 ? 112 ASP A CB     1 
ATOM 187  C CG     . ASP A 1 20 ? 124.528 100.733 51.066 1.00 171.48 ? 112 ASP A CG     1 
ATOM 188  O OD1    . ASP A 1 20 ? 123.469 100.346 50.526 1.00 161.73 ? 112 ASP A OD1    1 
ATOM 189  O OD2    . ASP A 1 20 ? 125.370 99.944  51.544 1.00 184.81 ? 112 ASP A OD2    1 
ATOM 190  H H      . ASP A 1 20 ? 125.446 104.542 50.706 1.00 143.07 ? 112 ASP A H      1 
ATOM 191  H HA     . ASP A 1 20 ? 126.007 102.320 49.484 1.00 170.80 ? 112 ASP A HA     1 
ATOM 192  H HB2    . ASP A 1 20 ? 125.516 102.364 51.785 1.00 188.65 ? 112 ASP A HB2    1 
ATOM 193  H HB3    . ASP A 1 20 ? 123.994 102.664 51.439 1.00 188.65 ? 112 ASP A HB3    1 
ATOM 194  N N      . ARG A 1 21 ? 123.047 103.391 48.918 1.00 155.40 ? 113 ARG A N      1 
ATOM 195  C CA     . ARG A 1 21 ? 121.926 103.317 47.991 1.00 151.63 ? 113 ARG A CA     1 
ATOM 196  C C      . ARG A 1 21 ? 122.383 103.665 46.582 1.00 136.52 ? 113 ARG A C      1 
ATOM 197  O O      . ARG A 1 21 ? 122.017 102.991 45.618 1.00 139.05 ? 113 ARG A O      1 
ATOM 198  C CB     . ARG A 1 21 ? 120.802 104.260 48.423 1.00 129.12 ? 113 ARG A CB     1 
ATOM 199  C CG     . ARG A 1 21 ? 119.536 104.158 47.580 1.00 114.45 ? 113 ARG A CG     1 
ATOM 200  C CD     . ARG A 1 21 ? 118.878 102.793 47.717 1.00 143.98 ? 113 ARG A CD     1 
ATOM 201  N NE     . ARG A 1 21 ? 117.568 102.744 47.071 1.00 124.76 ? 113 ARG A NE     1 
ATOM 202  C CZ     . ARG A 1 21 ? 116.444 103.207 47.611 1.00 155.08 ? 113 ARG A CZ     1 
ATOM 203  N NH1    . ARG A 1 21 ? 116.455 103.771 48.811 1.00 184.93 ? 113 ARG A NH1    1 
ATOM 204  N NH2    . ARG A 1 21 ? 115.302 103.113 46.943 1.00 158.38 ? 113 ARG A NH2    1 
ATOM 205  H H      . ARG A 1 21 ? 122.952 103.977 49.540 1.00 186.48 ? 113 ARG A H      1 
ATOM 206  H HA     . ARG A 1 21 ? 121.577 102.412 47.983 1.00 181.95 ? 113 ARG A HA     1 
ATOM 207  H HB2    . ARG A 1 21 ? 120.562 104.058 49.341 1.00 154.94 ? 113 ARG A HB2    1 
ATOM 208  H HB3    . ARG A 1 21 ? 121.123 105.174 48.363 1.00 154.94 ? 113 ARG A HB3    1 
ATOM 209  H HG2    . ARG A 1 21 ? 118.902 104.831 47.872 1.00 137.34 ? 113 ARG A HG2    1 
ATOM 210  H HG3    . ARG A 1 21 ? 119.762 104.294 46.646 1.00 137.34 ? 113 ARG A HG3    1 
ATOM 211  H HD2    . ARG A 1 21 ? 119.445 102.124 47.302 1.00 172.77 ? 113 ARG A HD2    1 
ATOM 212  H HD3    . ARG A 1 21 ? 118.758 102.591 48.658 1.00 172.77 ? 113 ARG A HD3    1 
ATOM 213  H HE     . ARG A 1 21 ? 117.521 102.391 46.288 1.00 149.71 ? 113 ARG A HE     1 
ATOM 214  H HH11   . ARG A 1 21 ? 117.193 103.835 49.249 1.00 221.92 ? 113 ARG A HH11   1 
ATOM 215  H HH12   . ARG A 1 21 ? 115.725 104.069 49.153 1.00 221.92 ? 113 ARG A HH12   1 
ATOM 216  H HH21   . ARG A 1 21 ? 115.288 102.750 46.164 1.00 190.06 ? 113 ARG A HH21   1 
ATOM 217  H HH22   . ARG A 1 21 ? 114.575 103.414 47.290 1.00 190.06 ? 113 ARG A HH22   1 
ATOM 218  N N      . PHE A 1 22 ? 123.181 104.723 46.469 1.00 134.27 ? 114 PHE A N      1 
ATOM 219  C CA     . PHE A 1 22 ? 123.672 105.173 45.172 1.00 103.47 ? 114 PHE A CA     1 
ATOM 220  C C      . PHE A 1 22 ? 124.498 104.101 44.472 1.00 122.38 ? 114 PHE A C      1 
ATOM 221  O O      . PHE A 1 22 ? 124.329 103.866 43.277 1.00 157.91 ? 114 PHE A O      1 
ATOM 222  C CB     . PHE A 1 22 ? 124.509 106.443 45.328 1.00 142.45 ? 114 PHE A CB     1 
ATOM 223  C CG     . PHE A 1 22 ? 125.132 106.912 44.046 1.00 167.60 ? 114 PHE A CG     1 
ATOM 224  C CD1    . PHE A 1 22 ? 124.399 107.653 43.136 1.00 153.16 ? 114 PHE A CD1    1 
ATOM 225  C CD2    . PHE A 1 22 ? 126.451 106.610 43.750 1.00 186.36 ? 114 PHE A CD2    1 
ATOM 226  C CE1    . PHE A 1 22 ? 124.969 108.082 41.955 1.00 135.47 ? 114 PHE A CE1    1 
ATOM 227  C CE2    . PHE A 1 22 ? 127.026 107.039 42.571 1.00 162.36 ? 114 PHE A CE2    1 
ATOM 228  C CZ     . PHE A 1 22 ? 126.285 107.776 41.673 1.00 130.40 ? 114 PHE A CZ     1 
ATOM 229  H H      . PHE A 1 22 ? 123.453 105.198 47.132 1.00 161.13 ? 114 PHE A H      1 
ATOM 230  H HA     . PHE A 1 22 ? 122.914 105.384 44.605 1.00 124.16 ? 114 PHE A HA     1 
ATOM 231  H HB2    . PHE A 1 22 ? 123.940 107.155 45.659 1.00 170.94 ? 114 PHE A HB2    1 
ATOM 232  H HB3    . PHE A 1 22 ? 125.224 106.271 45.961 1.00 170.94 ? 114 PHE A HB3    1 
ATOM 233  H HD1    . PHE A 1 22 ? 123.512 107.862 43.321 1.00 183.79 ? 114 PHE A HD1    1 
ATOM 234  H HD2    . PHE A 1 22 ? 126.955 106.112 44.353 1.00 223.64 ? 114 PHE A HD2    1 
ATOM 235  H HE1    . PHE A 1 22 ? 124.467 108.580 41.350 1.00 162.57 ? 114 PHE A HE1    1 
ATOM 236  H HE2    . PHE A 1 22 ? 127.913 106.831 42.382 1.00 194.83 ? 114 PHE A HE2    1 
ATOM 237  H HZ     . PHE A 1 22 ? 126.670 108.065 40.878 1.00 156.48 ? 114 PHE A HZ     1 
ATOM 238  N N      . GLN A 1 23 ? 125.399 103.466 45.214 1.00 142.68 ? 115 GLN A N      1 
ATOM 239  C CA     . GLN A 1 23 ? 126.263 102.434 44.653 1.00 149.87 ? 115 GLN A CA     1 
ATOM 240  C C      . GLN A 1 23 ? 125.441 101.316 44.012 1.00 150.59 ? 115 GLN A C      1 
ATOM 241  O O      . GLN A 1 23 ? 125.855 100.734 43.009 1.00 181.69 ? 115 GLN A O      1 
ATOM 242  C CB     . GLN A 1 23 ? 127.194 101.864 45.725 1.00 178.79 ? 115 GLN A CB     1 
ATOM 243  C CG     . GLN A 1 23 ? 128.228 100.888 45.180 1.00 203.86 ? 115 GLN A CG     1 
ATOM 244  C CD     . GLN A 1 23 ? 129.145 100.340 46.256 1.00 233.52 ? 115 GLN A CD     1 
ATOM 245  O OE1    . GLN A 1 23 ? 128.972 100.626 47.442 1.00 247.30 ? 115 GLN A OE1    1 
ATOM 246  N NE2    . GLN A 1 23 ? 130.132 99.551  45.846 1.00 234.30 ? 115 GLN A NE2    1 
ATOM 247  H H      . GLN A 1 23 ? 125.531 103.616 46.051 1.00 171.22 ? 115 GLN A H      1 
ATOM 248  H HA     . GLN A 1 23 ? 126.815 102.830 43.961 1.00 179.84 ? 115 GLN A HA     1 
ATOM 249  H HB2    . GLN A 1 23 ? 127.669 102.596 46.148 1.00 214.55 ? 115 GLN A HB2    1 
ATOM 250  H HB3    . GLN A 1 23 ? 126.660 101.393 46.384 1.00 214.55 ? 115 GLN A HB3    1 
ATOM 251  H HG2    . GLN A 1 23 ? 127.770 100.139 44.767 1.00 244.64 ? 115 GLN A HG2    1 
ATOM 252  H HG3    . GLN A 1 23 ? 128.777 101.344 44.522 1.00 244.64 ? 115 GLN A HG3    1 
ATOM 253  H HE21   . GLN A 1 23 ? 130.223 99.376  45.008 1.00 281.16 ? 115 GLN A HE21   1 
ATOM 254  H HE22   . GLN A 1 23 ? 130.680 99.215  46.417 1.00 281.16 ? 115 GLN A HE22   1 
ATOM 255  N N      . ARG A 1 24 ? 124.278 101.022 44.591 1.00 130.91 ? 116 ARG A N      1 
ATOM 256  C CA     . ARG A 1 24 ? 123.438 99.920  44.122 1.00 156.19 ? 116 ARG A CA     1 
ATOM 257  C C      . ARG A 1 24 ? 122.294 100.376 43.214 1.00 140.57 ? 116 ARG A C      1 
ATOM 258  O O      . ARG A 1 24 ? 121.672 99.555  42.541 1.00 144.89 ? 116 ARG A O      1 
ATOM 259  C CB     . ARG A 1 24 ? 122.846 99.166  45.315 1.00 191.85 ? 116 ARG A CB     1 
ATOM 260  C CG     . ARG A 1 24 ? 123.856 98.424  46.170 1.00 212.52 ? 116 ARG A CG     1 
ATOM 261  C CD     . ARG A 1 24 ? 123.169 97.751  47.349 1.00 211.75 ? 116 ARG A CD     1 
ATOM 262  N NE     . ARG A 1 24 ? 124.055 96.837  48.066 1.00 212.29 ? 116 ARG A NE     1 
ATOM 263  C CZ     . ARG A 1 24 ? 124.946 97.213  48.978 1.00 198.48 ? 116 ARG A CZ     1 
ATOM 264  N NH1    . ARG A 1 24 ? 125.087 98.493  49.289 1.00 180.92 ? 116 ARG A NH1    1 
ATOM 265  N NH2    . ARG A 1 24 ? 125.705 96.306  49.577 1.00 206.26 ? 116 ARG A NH2    1 
ATOM 266  H H      . ARG A 1 24 ? 123.951 101.448 45.263 1.00 157.09 ? 116 ARG A H      1 
ATOM 267  H HA     . ARG A 1 24 ? 123.988 99.299  43.619 1.00 187.43 ? 116 ARG A HA     1 
ATOM 268  H HB2    . ARG A 1 24 ? 122.390 99.803  45.887 1.00 230.22 ? 116 ARG A HB2    1 
ATOM 269  H HB3    . ARG A 1 24 ? 122.209 98.514  44.982 1.00 230.22 ? 116 ARG A HB3    1 
ATOM 270  H HG2    . ARG A 1 24 ? 124.290 97.740  45.636 1.00 255.02 ? 116 ARG A HG2    1 
ATOM 271  H HG3    . ARG A 1 24 ? 124.511 99.051  46.514 1.00 255.02 ? 116 ARG A HG3    1 
ATOM 272  H HD2    . ARG A 1 24 ? 122.870 98.431  47.973 1.00 254.10 ? 116 ARG A HD2    1 
ATOM 273  H HD3    . ARG A 1 24 ? 122.410 97.241  47.025 1.00 254.10 ? 116 ARG A HD3    1 
ATOM 274  H HE     . ARG A 1 24 ? 123.996 95.998  47.885 1.00 254.75 ? 116 ARG A HE     1 
ATOM 275  H HH11   . ARG A 1 24 ? 124.597 99.086  48.904 1.00 217.10 ? 116 ARG A HH11   1 
ATOM 276  H HH12   . ARG A 1 24 ? 125.666 98.731  49.879 1.00 217.10 ? 116 ARG A HH12   1 
ATOM 277  H HH21   . ARG A 1 24 ? 125.619 95.474  49.378 1.00 247.51 ? 116 ARG A HH21   1 
ATOM 278  H HH22   . ARG A 1 24 ? 126.283 96.550  50.165 1.00 247.51 ? 116 ARG A HH22   1 
ATOM 279  N N      . GLN A 1 25 ? 122.014 101.676 43.198 1.00 128.58 ? 117 GLN A N      1 
ATOM 280  C CA     . GLN A 1 25 ? 120.932 102.209 42.373 1.00 136.24 ? 117 GLN A CA     1 
ATOM 281  C C      . GLN A 1 25 ? 121.202 103.669 42.012 1.00 125.93 ? 117 GLN A C      1 
ATOM 282  O O      . GLN A 1 25 ? 121.124 104.552 42.869 1.00 125.94 ? 117 GLN A O      1 
ATOM 283  C CB     . GLN A 1 25 ? 119.589 102.078 43.099 1.00 113.21 ? 117 GLN A CB     1 
ATOM 284  C CG     . GLN A 1 25 ? 118.393 102.539 42.277 1.00 133.91 ? 117 GLN A CG     1 
ATOM 285  C CD     . GLN A 1 25 ? 117.066 102.285 42.972 1.00 139.03 ? 117 GLN A CD     1 
ATOM 286  O OE1    . GLN A 1 25 ? 117.013 101.650 44.026 1.00 124.45 ? 117 GLN A OE1    1 
ATOM 287  N NE2    . GLN A 1 25 ? 115.984 102.776 42.376 1.00 140.86 ? 117 GLN A NE2    1 
ATOM 288  H H      . GLN A 1 25 ? 122.435 102.271 43.654 1.00 154.30 ? 117 GLN A H      1 
ATOM 289  H HA     . GLN A 1 25 ? 120.880 101.699 41.550 1.00 163.49 ? 117 GLN A HA     1 
ATOM 290  H HB2    . GLN A 1 25 ? 119.449 101.146 43.330 1.00 135.85 ? 117 GLN A HB2    1 
ATOM 291  H HB3    . GLN A 1 25 ? 119.618 102.615 43.907 1.00 135.85 ? 117 GLN A HB3    1 
ATOM 292  H HG2    . GLN A 1 25 ? 118.470 103.492 42.115 1.00 160.69 ? 117 GLN A HG2    1 
ATOM 293  H HG3    . GLN A 1 25 ? 118.387 102.059 41.434 1.00 160.69 ? 117 GLN A HG3    1 
ATOM 294  H HE21   . GLN A 1 25 ? 116.059 103.210 41.637 1.00 169.03 ? 117 GLN A HE21   1 
ATOM 295  H HE22   . GLN A 1 25 ? 115.209 102.659 42.730 1.00 169.03 ? 117 GLN A HE22   1 
ATOM 296  N N      . LYS A 1 26 ? 121.512 103.922 40.743 1.00 116.79 ? 118 LYS A N      1 
ATOM 297  C CA     . LYS A 1 26 ? 121.913 105.256 40.304 1.00 110.07 ? 118 LYS A CA     1 
ATOM 298  C C      . LYS A 1 26 ? 120.729 106.157 39.950 1.00 128.70 ? 118 LYS A C      1 
ATOM 299  O O      . LYS A 1 26 ? 120.882 107.377 39.873 1.00 127.61 ? 118 LYS A O      1 
ATOM 300  C CB     . LYS A 1 26 ? 122.860 105.154 39.106 1.00 124.65 ? 118 LYS A CB     1 
ATOM 301  C CG     . LYS A 1 26 ? 124.327 104.991 39.490 1.00 114.60 ? 118 LYS A CG     1 
ATOM 302  C CD     . LYS A 1 26 ? 124.629 103.612 40.054 1.00 146.92 ? 118 LYS A CD     1 
ATOM 303  C CE     . LYS A 1 26 ? 126.095 103.487 40.444 1.00 172.85 ? 118 LYS A CE     1 
ATOM 304  N NZ     . LYS A 1 26 ? 126.468 102.093 40.812 1.00 187.74 ? 118 LYS A NZ     1 
ATOM 305  H H      . LYS A 1 26 ? 121.498 103.335 40.114 1.00 140.15 ? 118 LYS A H      1 
ATOM 306  H HA     . LYS A 1 26 ? 122.399 105.684 41.026 1.00 132.08 ? 118 LYS A HA     1 
ATOM 307  H HB2    . LYS A 1 26 ? 122.606 104.385 38.572 1.00 149.58 ? 118 LYS A HB2    1 
ATOM 308  H HB3    . LYS A 1 26 ? 122.781 105.962 38.576 1.00 149.58 ? 118 LYS A HB3    1 
ATOM 309  H HG2    . LYS A 1 26 ? 124.877 105.121 38.702 1.00 137.52 ? 118 LYS A HG2    1 
ATOM 310  H HG3    . LYS A 1 26 ? 124.553 105.649 40.166 1.00 137.52 ? 118 LYS A HG3    1 
ATOM 311  H HD2    . LYS A 1 26 ? 124.089 103.463 40.846 1.00 176.31 ? 118 LYS A HD2    1 
ATOM 312  H HD3    . LYS A 1 26 ? 124.434 102.940 39.383 1.00 176.31 ? 118 LYS A HD3    1 
ATOM 313  H HE2    . LYS A 1 26 ? 126.647 103.759 39.695 1.00 207.42 ? 118 LYS A HE2    1 
ATOM 314  H HE3    . LYS A 1 26 ? 126.269 104.057 41.210 1.00 207.42 ? 118 LYS A HE3    1 
ATOM 315  H HZ1    . LYS A 1 26 ? 125.980 101.820 41.504 1.00 225.29 ? 118 LYS A HZ1    1 
ATOM 316  H HZ2    . LYS A 1 26 ? 126.324 101.549 40.123 1.00 225.29 ? 118 LYS A HZ2    1 
ATOM 317  H HZ3    . LYS A 1 26 ? 127.329 102.058 41.034 1.00 225.29 ? 118 LYS A HZ3    1 
ATOM 318  N N      . TYR A 1 27 ? 119.560 105.562 39.726 1.00 100.49 ? 119 TYR A N      1 
ATOM 319  C CA     . TYR A 1 27 ? 118.354 106.336 39.441 1.00 112.86 ? 119 TYR A CA     1 
ATOM 320  C C      . TYR A 1 27 ? 117.220 105.907 40.363 1.00 124.54 ? 119 TYR A C      1 
ATOM 321  O O      . TYR A 1 27 ? 116.845 104.736 40.398 1.00 149.87 ? 119 TYR A O      1 
ATOM 322  C CB     . TYR A 1 27 ? 117.946 106.178 37.975 1.00 130.09 ? 119 TYR A CB     1 
ATOM 323  C CG     . TYR A 1 27 ? 118.917 106.833 37.022 1.00 138.98 ? 119 TYR A CG     1 
ATOM 324  C CD1    . TYR A 1 27 ? 120.044 106.155 36.577 1.00 136.30 ? 119 TYR A CD1    1 
ATOM 325  C CD2    . TYR A 1 27 ? 118.718 108.133 36.580 1.00 101.53 ? 119 TYR A CD2    1 
ATOM 326  C CE1    . TYR A 1 27 ? 120.941 106.750 35.713 1.00 118.94 ? 119 TYR A CE1    1 
ATOM 327  C CE2    . TYR A 1 27 ? 119.611 108.737 35.714 1.00 100.85 ? 119 TYR A CE2    1 
ATOM 328  C CZ     . TYR A 1 27 ? 120.720 108.039 35.285 1.00 127.65 ? 119 TYR A CZ     1 
ATOM 329  O OH     . TYR A 1 27 ? 121.615 108.629 34.425 1.00 139.52 ? 119 TYR A OH     1 
ATOM 330  H H      . TYR A 1 27 ? 119.438 104.711 39.733 1.00 120.58 ? 119 TYR A H      1 
ATOM 331  H HA     . TYR A 1 27 ? 118.534 107.275 39.604 1.00 135.43 ? 119 TYR A HA     1 
ATOM 332  H HB2    . TYR A 1 27 ? 117.905 105.233 37.759 1.00 156.11 ? 119 TYR A HB2    1 
ATOM 333  H HB3    . TYR A 1 27 ? 117.076 106.586 37.843 1.00 156.11 ? 119 TYR A HB3    1 
ATOM 334  H HD1    . TYR A 1 27 ? 120.196 105.284 36.865 1.00 163.56 ? 119 TYR A HD1    1 
ATOM 335  H HD2    . TYR A 1 27 ? 117.971 108.605 36.868 1.00 121.83 ? 119 TYR A HD2    1 
ATOM 336  H HE1    . TYR A 1 27 ? 121.690 106.282 35.422 1.00 142.73 ? 119 TYR A HE1    1 
ATOM 337  H HE2    . TYR A 1 27 ? 119.464 109.608 35.423 1.00 121.02 ? 119 TYR A HE2    1 
ATOM 338  H HH     . TYR A 1 27 ? 121.366 109.411 34.243 1.00 167.42 ? 119 TYR A HH     1 
ATOM 339  N N      . LEU A 1 28 ? 116.675 106.873 41.097 1.00 106.94 ? 120 LEU A N      1 
ATOM 340  C CA     . LEU A 1 28 ? 115.655 106.609 42.107 1.00 124.04 ? 120 LEU A CA     1 
ATOM 341  C C      . LEU A 1 28 ? 114.312 107.187 41.692 1.00 141.60 ? 120 LEU A C      1 
ATOM 342  O O      . LEU A 1 28 ? 114.249 108.244 41.066 1.00 100.94 ? 120 LEU A O      1 
ATOM 343  C CB     . LEU A 1 28 ? 116.075 107.199 43.458 1.00 141.80 ? 120 LEU A CB     1 
ATOM 344  C CG     . LEU A 1 28 ? 117.052 106.397 44.325 1.00 123.95 ? 120 LEU A CG     1 
ATOM 345  C CD1    . LEU A 1 28 ? 116.380 105.148 44.859 1.00 144.72 ? 120 LEU A CD1    1 
ATOM 346  C CD2    . LEU A 1 28 ? 118.319 106.036 43.566 1.00 128.90 ? 120 LEU A CD2    1 
ATOM 347  H H      . LEU A 1 28 ? 116.883 107.705 41.027 1.00 128.33 ? 120 LEU A H      1 
ATOM 348  H HA     . LEU A 1 28 ? 115.553 105.650 42.214 1.00 148.85 ? 120 LEU A HA     1 
ATOM 349  H HB2    . LEU A 1 28 ? 116.488 108.060 43.291 1.00 170.16 ? 120 LEU A HB2    1 
ATOM 350  H HB3    . LEU A 1 28 ? 115.272 107.331 43.987 1.00 170.16 ? 120 LEU A HB3    1 
ATOM 351  H HG     . LEU A 1 28 ? 117.310 106.941 45.086 1.00 148.74 ? 120 LEU A HG     1 
ATOM 352  H HD11   . LEU A 1 28 ? 117.015 104.657 45.404 1.00 173.66 ? 120 LEU A HD11   1 
ATOM 353  H HD12   . LEU A 1 28 ? 115.614 105.407 45.395 1.00 173.66 ? 120 LEU A HD12   1 
ATOM 354  H HD13   . LEU A 1 28 ? 116.092 104.601 44.111 1.00 173.66 ? 120 LEU A HD13   1 
ATOM 355  H HD21   . LEU A 1 28 ? 118.905 105.532 44.152 1.00 154.68 ? 120 LEU A HD21   1 
ATOM 356  H HD22   . LEU A 1 28 ? 118.081 105.500 42.793 1.00 154.68 ? 120 LEU A HD22   1 
ATOM 357  H HD23   . LEU A 1 28 ? 118.758 106.852 43.280 1.00 154.68 ? 120 LEU A HD23   1 
ATOM 358  N N      . SER A 1 29 ? 113.239 106.492 42.051 1.00 103.02 ? 121 SER A N      1 
ATOM 359  C CA     . SER A 1 29 ? 111.895 106.969 41.764 1.00 104.55 ? 121 SER A CA     1 
ATOM 360  C C      . SER A 1 29 ? 111.543 108.128 42.686 1.00 138.61 ? 121 SER A C      1 
ATOM 361  O O      . SER A 1 29 ? 112.293 108.459 43.602 1.00 127.74 ? 121 SER A O      1 
ATOM 362  C CB     . SER A 1 29 ? 110.870 105.847 41.929 1.00 151.23 ? 121 SER A CB     1 
ATOM 363  O OG     . SER A 1 29 ? 110.629 105.579 43.299 1.00 142.30 ? 121 SER A OG     1 
ATOM 364  H H      . SER A 1 29 ? 113.263 105.738 42.465 1.00 123.63 ? 121 SER A H      1 
ATOM 365  H HA     . SER A 1 29 ? 111.856 107.286 40.848 1.00 125.46 ? 121 SER A HA     1 
ATOM 366  H HB2    . SER A 1 29 ? 110.038 106.116 41.509 1.00 181.48 ? 121 SER A HB2    1 
ATOM 367  H HB3    . SER A 1 29 ? 111.211 105.044 41.506 1.00 181.48 ? 121 SER A HB3    1 
ATOM 368  H HG     . SER A 1 29 ? 110.065 104.962 43.376 1.00 170.76 ? 121 SER A HG     1 
ATOM 369  N N      . LEU A 1 30 ? 110.393 108.739 42.436 1.00 137.72 ? 122 LEU A N      1 
ATOM 370  C CA     . LEU A 1 30 ? 109.897 109.821 43.271 1.00 120.85 ? 122 LEU A CA     1 
ATOM 371  C C      . LEU A 1 30 ? 109.643 109.320 44.688 1.00 142.82 ? 122 LEU A C      1 
ATOM 372  O O      . LEU A 1 30 ? 110.142 109.884 45.666 1.00 149.53 ? 122 LEU A O      1 
ATOM 373  C CB     . LEU A 1 30 ? 108.615 110.395 42.668 1.00 126.33 ? 122 LEU A CB     1 
ATOM 374  C CG     . LEU A 1 30 ? 107.905 111.506 43.439 1.00 140.11 ? 122 LEU A CG     1 
ATOM 375  C CD1    . LEU A 1 30 ? 108.762 112.751 43.485 1.00 155.85 ? 122 LEU A CD1    1 
ATOM 376  C CD2    . LEU A 1 30 ? 106.556 111.799 42.802 1.00 161.08 ? 122 LEU A CD2    1 
ATOM 377  H H      . LEU A 1 30 ? 109.875 108.541 41.778 1.00 165.26 ? 122 LEU A H      1 
ATOM 378  H HA     . LEU A 1 30 ? 110.560 110.528 43.310 1.00 145.01 ? 122 LEU A HA     1 
ATOM 379  H HB2    . LEU A 1 30 ? 108.829 110.751 41.791 1.00 151.59 ? 122 LEU A HB2    1 
ATOM 380  H HB3    . LEU A 1 30 ? 107.980 109.668 42.569 1.00 151.59 ? 122 LEU A HB3    1 
ATOM 381  H HG     . LEU A 1 30 ? 107.751 111.212 44.350 1.00 168.13 ? 122 LEU A HG     1 
ATOM 382  H HD11   . LEU A 1 30 ? 108.291 113.440 43.978 1.00 187.02 ? 122 LEU A HD11   1 
ATOM 383  H HD12   . LEU A 1 30 ? 109.600 112.541 43.927 1.00 187.02 ? 122 LEU A HD12   1 
ATOM 384  H HD13   . LEU A 1 30 ? 108.933 113.050 42.578 1.00 187.02 ? 122 LEU A HD13   1 
ATOM 385  H HD21   . LEU A 1 30 ? 106.118 112.505 43.302 1.00 193.29 ? 122 LEU A HD21   1 
ATOM 386  H HD22   . LEU A 1 30 ? 106.695 112.080 41.884 1.00 193.29 ? 122 LEU A HD22   1 
ATOM 387  H HD23   . LEU A 1 30 ? 106.015 110.994 42.823 1.00 193.29 ? 122 LEU A HD23   1 
ATOM 388  N N      . GLN A 1 31 ? 108.869 108.243 44.779 1.00 158.64 ? 123 GLN A N      1 
ATOM 389  C CA     . GLN A 1 31 ? 108.495 107.655 46.058 1.00 148.40 ? 123 GLN A CA     1 
ATOM 390  C C      . GLN A 1 31 ? 109.734 107.256 46.853 1.00 151.67 ? 123 GLN A C      1 
ATOM 391  O O      . GLN A 1 31 ? 109.836 107.537 48.049 1.00 167.88 ? 123 GLN A O      1 
ATOM 392  C CB     . GLN A 1 31 ? 107.594 106.435 45.844 1.00 181.87 ? 123 GLN A CB     1 
ATOM 393  C CG     . GLN A 1 31 ? 106.472 106.647 44.833 1.00 204.65 ? 123 GLN A CG     1 
ATOM 394  C CD     . GLN A 1 31 ? 105.672 107.909 45.093 1.00 216.46 ? 123 GLN A CD     1 
ATOM 395  O OE1    . GLN A 1 31 ? 105.505 108.329 46.238 1.00 231.52 ? 123 GLN A OE1    1 
ATOM 396  N NE2    . GLN A 1 31 ? 105.177 108.525 44.026 1.00 211.95 ? 123 GLN A NE2    1 
ATOM 397  H H      . GLN A 1 31 ? 108.542 107.829 44.100 1.00 190.36 ? 123 GLN A H      1 
ATOM 398  H HA     . GLN A 1 31 ? 108.001 108.308 46.577 1.00 178.08 ? 123 GLN A HA     1 
ATOM 399  H HB2    . GLN A 1 31 ? 108.140 105.698 45.527 1.00 218.25 ? 123 GLN A HB2    1 
ATOM 400  H HB3    . GLN A 1 31 ? 107.186 106.198 46.691 1.00 218.25 ? 123 GLN A HB3    1 
ATOM 401  H HG2    . GLN A 1 31 ? 106.856 106.713 43.945 1.00 245.58 ? 123 GLN A HG2    1 
ATOM 402  H HG3    . GLN A 1 31 ? 105.863 105.893 44.875 1.00 245.58 ? 123 GLN A HG3    1 
ATOM 403  H HE21   . GLN A 1 31 ? 105.317 108.204 43.240 1.00 254.34 ? 123 GLN A HE21   1 
ATOM 404  H HE22   . GLN A 1 31 ? 104.716 109.245 44.120 1.00 254.34 ? 123 GLN A HE22   1 
ATOM 405  N N      . GLN A 1 32 ? 110.674 106.601 46.177 1.00 124.39 ? 124 GLN A N      1 
ATOM 406  C CA     . GLN A 1 32 ? 111.889 106.116 46.821 1.00 141.96 ? 124 GLN A CA     1 
ATOM 407  C C      . GLN A 1 32 ? 112.705 107.273 47.387 1.00 123.09 ? 124 GLN A C      1 
ATOM 408  O O      . GLN A 1 32 ? 113.142 107.235 48.545 1.00 139.16 ? 124 GLN A O      1 
ATOM 409  C CB     . GLN A 1 32 ? 112.730 105.307 45.830 1.00 132.77 ? 124 GLN A CB     1 
ATOM 410  C CG     . GLN A 1 32 ? 112.121 103.959 45.460 1.00 121.47 ? 124 GLN A CG     1 
ATOM 411  C CD     . GLN A 1 32 ? 112.819 103.295 44.286 1.00 142.76 ? 124 GLN A CD     1 
ATOM 412  O OE1    . GLN A 1 32 ? 113.514 103.949 43.509 1.00 144.55 ? 124 GLN A OE1    1 
ATOM 413  N NE2    . GLN A 1 32 ? 112.642 101.985 44.159 1.00 188.83 ? 124 GLN A NE2    1 
ATOM 414  H H      . GLN A 1 32 ? 110.630 106.424 45.336 1.00 149.27 ? 124 GLN A H      1 
ATOM 415  H HA     . GLN A 1 32 ? 111.645 105.532 47.557 1.00 170.35 ? 124 GLN A HA     1 
ATOM 416  H HB2    . GLN A 1 32 ? 112.830 105.821 45.014 1.00 159.32 ? 124 GLN A HB2    1 
ATOM 417  H HB3    . GLN A 1 32 ? 113.601 105.141 46.223 1.00 159.32 ? 124 GLN A HB3    1 
ATOM 418  H HG2    . GLN A 1 32 ? 112.187 103.363 46.223 1.00 145.77 ? 124 GLN A HG2    1 
ATOM 419  H HG3    . GLN A 1 32 ? 111.190 104.088 45.221 1.00 145.77 ? 124 GLN A HG3    1 
ATOM 420  H HE21   . GLN A 1 32 ? 112.154 101.560 44.725 1.00 226.60 ? 124 GLN A HE21   1 
ATOM 421  H HE22   . GLN A 1 32 ? 113.016 101.562 43.510 1.00 226.60 ? 124 GLN A HE22   1 
ATOM 422  N N      . MET A 1 33 ? 112.885 108.312 46.576 1.00 120.25 ? 125 MET A N      1 
ATOM 423  C CA     . MET A 1 33 ? 113.590 109.508 47.013 1.00 129.80 ? 125 MET A CA     1 
ATOM 424  C C      . MET A 1 33 ? 112.870 110.125 48.207 1.00 127.83 ? 125 MET A C      1 
ATOM 425  O O      . MET A 1 33 ? 113.497 110.500 49.200 1.00 142.13 ? 125 MET A O      1 
ATOM 426  C CB     . MET A 1 33 ? 113.692 110.533 45.878 1.00 149.09 ? 125 MET A CB     1 
ATOM 427  C CG     . MET A 1 33 ? 114.786 110.253 44.856 1.00 144.93 ? 125 MET A CG     1 
ATOM 428  S SD     . MET A 1 33 ? 115.030 111.645 43.730 1.00 127.77 ? 125 MET A SD     1 
ATOM 429  C CE     . MET A 1 33 ? 116.333 111.022 42.667 1.00 93.72  ? 125 MET A CE     1 
ATOM 430  H H      . MET A 1 33 ? 112.606 108.346 45.763 1.00 144.30 ? 125 MET A H      1 
ATOM 431  H HA     . MET A 1 33 ? 114.491 109.265 47.279 1.00 155.75 ? 125 MET A HA     1 
ATOM 432  H HB2    . MET A 1 33 ? 112.846 110.552 45.403 1.00 178.91 ? 125 MET A HB2    1 
ATOM 433  H HB3    . MET A 1 33 ? 113.867 111.405 46.263 1.00 178.91 ? 125 MET A HB3    1 
ATOM 434  H HG2    . MET A 1 33 ? 115.622 110.090 45.321 1.00 173.92 ? 125 MET A HG2    1 
ATOM 435  H HG3    . MET A 1 33 ? 114.540 109.477 44.329 1.00 173.92 ? 125 MET A HG3    1 
ATOM 436  H HE1    . MET A 1 33 ? 116.553 111.698 42.008 1.00 112.47 ? 125 MET A HE1    1 
ATOM 437  H HE2    . MET A 1 33 ? 117.113 110.822 43.209 1.00 112.47 ? 125 MET A HE2    1 
ATOM 438  H HE3    . MET A 1 33 ? 116.021 110.217 42.225 1.00 112.47 ? 125 MET A HE3    1 
ATOM 439  N N      . GLN A 1 34 ? 111.548 110.219 48.108 1.00 142.05 ? 126 GLN A N      1 
ATOM 440  C CA     . GLN A 1 34 ? 110.758 110.868 49.146 1.00 141.24 ? 126 GLN A CA     1 
ATOM 441  C C      . GLN A 1 34 ? 110.782 110.104 50.476 1.00 132.54 ? 126 GLN A C      1 
ATOM 442  O O      . GLN A 1 34 ? 110.893 110.717 51.542 1.00 174.56 ? 126 GLN A O      1 
ATOM 443  C CB     . GLN A 1 34 ? 109.317 111.043 48.662 1.00 165.61 ? 126 GLN A CB     1 
ATOM 444  C CG     . GLN A 1 34 ? 109.135 112.209 47.700 1.00 200.03 ? 126 GLN A CG     1 
ATOM 445  C CD     . GLN A 1 34 ? 107.681 112.469 47.356 1.00 204.21 ? 126 GLN A CD     1 
ATOM 446  O OE1    . GLN A 1 34 ? 106.829 111.590 47.495 1.00 191.76 ? 126 GLN A OE1    1 
ATOM 447  N NE2    . GLN A 1 34 ? 107.390 113.682 46.901 1.00 208.95 ? 126 GLN A NE2    1 
ATOM 448  H H      . GLN A 1 34 ? 111.085 109.915 47.450 1.00 170.46 ? 126 GLN A H      1 
ATOM 449  H HA     . GLN A 1 34 ? 111.124 111.752 49.308 1.00 169.48 ? 126 GLN A HA     1 
ATOM 450  H HB2    . GLN A 1 34 ? 109.040 110.234 48.204 1.00 198.73 ? 126 GLN A HB2    1 
ATOM 451  H HB3    . GLN A 1 34 ? 108.745 111.199 49.429 1.00 198.73 ? 126 GLN A HB3    1 
ATOM 452  H HG2    . GLN A 1 34 ? 109.495 113.012 48.106 1.00 240.03 ? 126 GLN A HG2    1 
ATOM 453  H HG3    . GLN A 1 34 ? 109.608 112.014 46.875 1.00 240.03 ? 126 GLN A HG3    1 
ATOM 454  H HE21   . GLN A 1 34 ? 108.012 114.270 46.815 1.00 250.75 ? 126 GLN A HE21   1 
ATOM 455  H HE22   . GLN A 1 34 ? 106.579 113.880 46.691 1.00 250.75 ? 126 GLN A HE22   1 
ATOM 456  N N      . GLU A 1 35 ? 110.701 108.777 50.423 1.00 125.10 ? 127 GLU A N      1 
ATOM 457  C CA     . GLU A 1 35 ? 110.748 107.978 51.648 1.00 145.37 ? 127 GLU A CA     1 
ATOM 458  C C      . GLU A 1 35 ? 112.159 108.027 52.230 1.00 131.58 ? 127 GLU A C      1 
ATOM 459  O O      . GLU A 1 35 ? 112.346 108.206 53.445 1.00 162.24 ? 127 GLU A O      1 
ATOM 460  C CB     . GLU A 1 35 ? 110.306 106.529 51.387 1.00 161.70 ? 127 GLU A CB     1 
ATOM 461  C CG     . GLU A 1 35 ? 111.411 105.556 50.983 1.00 193.71 ? 127 GLU A CG     1 
ATOM 462  C CD     . GLU A 1 35 ? 110.901 104.135 50.811 1.00 233.37 ? 127 GLU A CD     1 
ATOM 463  O OE1    . GLU A 1 35 ? 109.669 103.950 50.717 1.00 248.82 ? 127 GLU A OE1    1 
ATOM 464  O OE2    . GLU A 1 35 ? 111.732 103.203 50.773 1.00 243.03 ? 127 GLU A OE2    1 
ATOM 465  H H      . GLU A 1 35 ? 110.620 108.318 49.700 1.00 150.12 ? 127 GLU A H      1 
ATOM 466  H HA     . GLU A 1 35 ? 110.141 108.364 52.299 1.00 174.45 ? 127 GLU A HA     1 
ATOM 467  H HB2    . GLU A 1 35 ? 109.898 106.184 52.197 1.00 194.04 ? 127 GLU A HB2    1 
ATOM 468  H HB3    . GLU A 1 35 ? 109.650 106.534 50.673 1.00 194.04 ? 127 GLU A HB3    1 
ATOM 469  H HG2    . GLU A 1 35 ? 111.793 105.843 50.139 1.00 232.45 ? 127 GLU A HG2    1 
ATOM 470  H HG3    . GLU A 1 35 ? 112.094 105.549 51.672 1.00 232.45 ? 127 GLU A HG3    1 
ATOM 471  N N      . LEU A 1 36 ? 113.147 107.872 51.352 1.00 108.89 ? 128 LEU A N      1 
ATOM 472  C CA     . LEU A 1 36 ? 114.542 107.977 51.751 1.00 106.23 ? 128 LEU A CA     1 
ATOM 473  C C      . LEU A 1 36 ? 114.789 109.323 52.419 1.00 118.91 ? 128 LEU A C      1 
ATOM 474  O O      . LEU A 1 36 ? 115.525 109.412 53.399 1.00 131.55 ? 128 LEU A O      1 
ATOM 475  C CB     . LEU A 1 36 ? 115.462 107.807 50.542 1.00 119.68 ? 128 LEU A CB     1 
ATOM 476  C CG     . LEU A 1 36 ? 116.964 107.835 50.828 1.00 126.43 ? 128 LEU A CG     1 
ATOM 477  C CD1    . LEU A 1 36 ? 117.375 106.669 51.717 1.00 129.80 ? 128 LEU A CD1    1 
ATOM 478  C CD2    . LEU A 1 36 ? 117.740 107.822 49.523 1.00 115.17 ? 128 LEU A CD2    1 
ATOM 479  H H      . LEU A 1 36 ? 113.033 107.704 50.516 1.00 130.67 ? 128 LEU A H      1 
ATOM 480  H HA     . LEU A 1 36 ? 114.746 107.277 52.390 1.00 127.48 ? 128 LEU A HA     1 
ATOM 481  H HB2    . LEU A 1 36 ? 115.264 106.953 50.127 1.00 143.62 ? 128 LEU A HB2    1 
ATOM 482  H HB3    . LEU A 1 36 ? 115.274 108.521 49.914 1.00 143.62 ? 128 LEU A HB3    1 
ATOM 483  H HG     . LEU A 1 36 ? 117.180 108.658 51.295 1.00 151.71 ? 128 LEU A HG     1 
ATOM 484  H HD11   . LEU A 1 36 ? 118.330 106.717 51.879 1.00 155.76 ? 128 LEU A HD11   1 
ATOM 485  H HD12   . LEU A 1 36 ? 116.893 106.728 52.557 1.00 155.76 ? 128 LEU A HD12   1 
ATOM 486  H HD13   . LEU A 1 36 ? 117.155 105.838 51.268 1.00 155.76 ? 128 LEU A HD13   1 
ATOM 487  H HD21   . LEU A 1 36 ? 118.689 107.840 49.720 1.00 138.20 ? 128 LEU A HD21   1 
ATOM 488  H HD22   . LEU A 1 36 ? 117.519 107.014 49.033 1.00 138.20 ? 128 LEU A HD22   1 
ATOM 489  H HD23   . LEU A 1 36 ? 117.494 108.602 49.002 1.00 138.20 ? 128 LEU A HD23   1 
ATOM 490  N N      . SER A 1 37 ? 114.163 110.366 51.885 1.00 138.85 ? 129 SER A N      1 
ATOM 491  C CA     . SER A 1 37 ? 114.267 111.693 52.473 1.00 155.04 ? 129 SER A CA     1 
ATOM 492  C C      . SER A 1 37 ? 113.551 111.738 53.823 1.00 149.36 ? 129 SER A C      1 
ATOM 493  O O      . SER A 1 37 ? 114.061 112.325 54.778 1.00 130.75 ? 129 SER A O      1 
ATOM 494  C CB     . SER A 1 37 ? 113.687 112.748 51.527 1.00 169.15 ? 129 SER A CB     1 
ATOM 495  O OG     . SER A 1 37 ? 112.282 112.614 51.407 1.00 173.27 ? 129 SER A OG     1 
ATOM 496  H H      . SER A 1 37 ? 113.672 110.331 51.180 1.00 166.62 ? 129 SER A H      1 
ATOM 497  H HA     . SER A 1 37 ? 115.202 111.903 52.621 1.00 186.05 ? 129 SER A HA     1 
ATOM 498  H HB2    . SER A 1 37 ? 113.891 113.629 51.877 1.00 202.98 ? 129 SER A HB2    1 
ATOM 499  H HB3    . SER A 1 37 ? 114.089 112.639 50.651 1.00 202.98 ? 129 SER A HB3    1 
ATOM 500  H HG     . SER A 1 37 ? 111.919 112.707 52.159 1.00 207.92 ? 129 SER A HG     1 
ATOM 501  N N      . ASN A 1 38 ? 112.371 111.126 53.900 1.00 160.11 ? 130 ASN A N      1 
ATOM 502  C CA     . ASN A 1 38 ? 111.620 111.092 55.153 1.00 134.64 ? 130 ASN A CA     1 
ATOM 503  C C      . ASN A 1 38 ? 112.402 110.463 56.295 1.00 136.58 ? 130 ASN A C      1 
ATOM 504  O O      . ASN A 1 38 ? 112.517 111.057 57.369 1.00 173.24 ? 130 ASN A O      1 
ATOM 505  C CB     . ASN A 1 38 ? 110.306 110.326 54.991 1.00 133.51 ? 130 ASN A CB     1 
ATOM 506  C CG     . ASN A 1 38 ? 109.167 111.201 54.504 1.00 164.41 ? 130 ASN A CG     1 
ATOM 507  O OD1    . ASN A 1 38 ? 109.274 112.428 54.455 1.00 186.32 ? 130 ASN A OD1    1 
ATOM 508  N ND2    . ASN A 1 38 ? 108.051 110.569 54.174 1.00 172.71 ? 130 ASN A ND2    1 
ATOM 509  H H      . ASN A 1 38 ? 111.984 110.726 53.244 1.00 192.13 ? 130 ASN A H      1 
ATOM 510  H HA     . ASN A 1 38 ? 111.402 112.002 55.410 1.00 161.56 ? 130 ASN A HA     1 
ATOM 511  H HB2    . ASN A 1 38 ? 110.434 109.614 54.344 1.00 160.22 ? 130 ASN A HB2    1 
ATOM 512  H HB3    . ASN A 1 38 ? 110.051 109.953 55.849 1.00 160.22 ? 130 ASN A HB3    1 
ATOM 513  H HD21   . ASN A 1 38 ? 108.005 109.713 54.242 1.00 207.25 ? 130 ASN A HD21   1 
ATOM 514  H HD22   . ASN A 1 38 ? 107.372 111.015 53.891 1.00 207.25 ? 130 ASN A HD22   1 
ATOM 515  N N      . ILE A 1 39 ? 112.933 109.264 56.075 1.00 151.19 ? 131 ILE A N      1 
ATOM 516  C CA     . ILE A 1 39 ? 113.611 108.556 57.160 1.00 163.53 ? 131 ILE A CA     1 
ATOM 517  C C      . ILE A 1 39 ? 114.936 109.227 57.532 1.00 143.76 ? 131 ILE A C      1 
ATOM 518  O O      . ILE A 1 39 ? 115.524 108.909 58.566 1.00 190.84 ? 131 ILE A O      1 
ATOM 519  C CB     . ILE A 1 39 ? 113.869 107.072 56.809 1.00 153.47 ? 131 ILE A CB     1 
ATOM 520  C CG1    . ILE A 1 39 ? 114.802 106.939 55.604 1.00 149.11 ? 131 ILE A CG1    1 
ATOM 521  C CG2    . ILE A 1 39 ? 112.552 106.361 56.535 1.00 183.71 ? 131 ILE A CG2    1 
ATOM 522  C CD1    . ILE A 1 39 ? 115.378 105.547 55.434 1.00 152.56 ? 131 ILE A CD1    1 
ATOM 523  H H      . ILE A 1 39 ? 112.916 108.845 55.325 1.00 181.42 ? 131 ILE A H      1 
ATOM 524  H HA     . ILE A 1 39 ? 113.042 108.577 57.945 1.00 196.24 ? 131 ILE A HA     1 
ATOM 525  H HB     . ILE A 1 39 ? 114.293 106.648 57.571 1.00 184.16 ? 131 ILE A HB     1 
ATOM 526  H HG12   . ILE A 1 39 ? 114.306 107.156 54.799 1.00 178.93 ? 131 ILE A HG12   1 
ATOM 527  H HG13   . ILE A 1 39 ? 115.543 107.556 55.712 1.00 178.93 ? 131 ILE A HG13   1 
ATOM 528  H HG21   . ILE A 1 39 ? 112.733 105.434 56.317 1.00 220.45 ? 131 ILE A HG21   1 
ATOM 529  H HG22   . ILE A 1 39 ? 111.995 106.413 57.327 1.00 220.45 ? 131 ILE A HG22   1 
ATOM 530  H HG23   . ILE A 1 39 ? 112.108 106.796 55.789 1.00 220.45 ? 131 ILE A HG23   1 
ATOM 531  H HD11   . ILE A 1 39 ? 115.956 105.538 54.655 1.00 183.07 ? 131 ILE A HD11   1 
ATOM 532  H HD12   . ILE A 1 39 ? 115.887 105.317 56.227 1.00 183.07 ? 131 ILE A HD12   1 
ATOM 533  H HD13   . ILE A 1 39 ? 114.650 104.917 55.314 1.00 183.07 ? 131 ILE A HD13   1 
ATOM 534  N N      . LEU A 1 40 ? 115.398 110.151 56.693 1.00 96.51  ? 132 LEU A N      1 
ATOM 535  C CA     . LEU A 1 40 ? 116.609 110.919 56.975 1.00 122.21 ? 132 LEU A CA     1 
ATOM 536  C C      . LEU A 1 40 ? 116.297 112.343 57.435 1.00 146.50 ? 132 LEU A C      1 
ATOM 537  O O      . LEU A 1 40 ? 117.207 113.140 57.666 1.00 131.44 ? 132 LEU A O      1 
ATOM 538  C CB     . LEU A 1 40 ? 117.495 110.969 55.729 1.00 140.65 ? 132 LEU A CB     1 
ATOM 539  C CG     . LEU A 1 40 ? 118.586 109.906 55.648 1.00 130.76 ? 132 LEU A CG     1 
ATOM 540  C CD1    . LEU A 1 40 ? 117.973 108.524 55.722 1.00 108.77 ? 132 LEU A CD1    1 
ATOM 541  C CD2    . LEU A 1 40 ? 119.380 110.066 54.370 1.00 133.35 ? 132 LEU A CD2    1 
ATOM 542  H H      . LEU A 1 40 ? 115.024 110.354 55.946 1.00 115.81 ? 132 LEU A H      1 
ATOM 543  H HA     . LEU A 1 40 ? 117.107 110.477 57.681 1.00 146.66 ? 132 LEU A HA     1 
ATOM 544  H HB2    . LEU A 1 40 ? 116.930 110.864 54.948 1.00 168.78 ? 132 LEU A HB2    1 
ATOM 545  H HB3    . LEU A 1 40 ? 117.931 111.835 55.699 1.00 168.78 ? 132 LEU A HB3    1 
ATOM 546  H HG     . LEU A 1 40 ? 119.192 110.010 56.398 1.00 156.91 ? 132 LEU A HG     1 
ATOM 547  H HD11   . LEU A 1 40 ? 118.680 107.861 55.669 1.00 130.52 ? 132 LEU A HD11   1 
ATOM 548  H HD12   . LEU A 1 40 ? 117.498 108.434 56.563 1.00 130.52 ? 132 LEU A HD12   1 
ATOM 549  H HD13   . LEU A 1 40 ? 117.357 108.411 54.981 1.00 130.52 ? 132 LEU A HD13   1 
ATOM 550  H HD21   . LEU A 1 40 ? 120.067 109.382 54.337 1.00 160.02 ? 132 LEU A HD21   1 
ATOM 551  H HD22   . LEU A 1 40 ? 118.782 109.970 53.613 1.00 160.02 ? 132 LEU A HD22   1 
ATOM 552  H HD23   . LEU A 1 40 ? 119.788 110.946 54.360 1.00 160.02 ? 132 LEU A HD23   1 
ATOM 553  N N      . ASN A 1 41 ? 115.011 112.647 57.591 1.00 190.87 ? 133 ASN A N      1 
ATOM 554  C CA     . ASN A 1 41 ? 114.564 113.987 57.960 1.00 193.05 ? 133 ASN A CA     1 
ATOM 555  C C      . ASN A 1 41 ? 115.190 115.043 57.053 1.00 193.72 ? 133 ASN A C      1 
ATOM 556  O O      . ASN A 1 41 ? 115.678 116.074 57.518 1.00 192.38 ? 133 ASN A O      1 
ATOM 557  C CB     . ASN A 1 41 ? 114.893 114.285 59.424 1.00 167.31 ? 133 ASN A CB     1 
ATOM 558  C CG     . ASN A 1 41 ? 114.162 115.510 59.950 1.00 179.87 ? 133 ASN A CG     1 
ATOM 559  O OD1    . ASN A 1 41 ? 113.119 115.901 59.425 1.00 179.90 ? 133 ASN A OD1    1 
ATOM 560  N ND2    . ASN A 1 41 ? 114.714 116.126 60.988 1.00 201.77 ? 133 ASN A ND2    1 
ATOM 561  H H      . ASN A 1 41 ? 114.368 112.084 57.487 1.00 229.05 ? 133 ASN A H      1 
ATOM 562  H HA     . ASN A 1 41 ? 113.601 114.037 57.855 1.00 231.66 ? 133 ASN A HA     1 
ATOM 563  H HB2    . ASN A 1 41 ? 114.635 113.524 59.967 1.00 200.78 ? 133 ASN A HB2    1 
ATOM 564  H HB3    . ASN A 1 41 ? 115.846 114.444 59.507 1.00 200.78 ? 133 ASN A HB3    1 
ATOM 565  H HD21   . ASN A 1 41 ? 115.446 115.828 61.326 1.00 242.12 ? 133 ASN A HD21   1 
ATOM 566  H HD22   . ASN A 1 41 ? 114.339 116.824 61.323 1.00 242.12 ? 133 ASN A HD22   1 
ATOM 567  N N      . LEU A 1 42 ? 115.176 114.762 55.754 1.00 177.85 ? 134 LEU A N      1 
ATOM 568  C CA     . LEU A 1 42 ? 115.656 115.694 54.741 1.00 135.75 ? 134 LEU A CA     1 
ATOM 569  C C      . LEU A 1 42 ? 114.521 116.014 53.780 1.00 148.48 ? 134 LEU A C      1 
ATOM 570  O O      . LEU A 1 42 ? 113.517 115.302 53.742 1.00 177.98 ? 134 LEU A O      1 
ATOM 571  C CB     . LEU A 1 42 ? 116.846 115.106 53.979 1.00 110.63 ? 134 LEU A CB     1 
ATOM 572  C CG     . LEU A 1 42 ? 118.114 114.820 54.788 1.00 141.76 ? 134 LEU A CG     1 
ATOM 573  C CD1    . LEU A 1 42 ? 119.165 114.161 53.907 1.00 106.29 ? 134 LEU A CD1    1 
ATOM 574  C CD2    . LEU A 1 42 ? 118.662 116.097 55.409 1.00 159.91 ? 134 LEU A CD2    1 
ATOM 575  H H      . LEU A 1 42 ? 114.887 114.020 55.428 1.00 213.42 ? 134 LEU A H      1 
ATOM 576  H HA     . LEU A 1 42 ? 115.939 116.518 55.167 1.00 162.90 ? 134 LEU A HA     1 
ATOM 577  H HB2    . LEU A 1 42 ? 116.565 114.267 53.582 1.00 132.75 ? 134 LEU A HB2    1 
ATOM 578  H HB3    . LEU A 1 42 ? 117.090 115.727 53.275 1.00 132.75 ? 134 LEU A HB3    1 
ATOM 579  H HG     . LEU A 1 42 ? 117.898 114.206 55.507 1.00 170.11 ? 134 LEU A HG     1 
ATOM 580  H HD11   . LEU A 1 42 ? 119.958 113.989 54.437 1.00 127.55 ? 134 LEU A HD11   1 
ATOM 581  H HD12   . LEU A 1 42 ? 118.809 113.327 53.562 1.00 127.55 ? 134 LEU A HD12   1 
ATOM 582  H HD13   . LEU A 1 42 ? 119.380 114.758 53.173 1.00 127.55 ? 134 LEU A HD13   1 
ATOM 583  H HD21   . LEU A 1 42 ? 119.463 115.883 55.913 1.00 191.89 ? 134 LEU A HD21   1 
ATOM 584  H HD22   . LEU A 1 42 ? 118.874 116.725 54.701 1.00 191.89 ? 134 LEU A HD22   1 
ATOM 585  H HD23   . LEU A 1 42 ? 117.991 116.475 55.997 1.00 191.89 ? 134 LEU A HD23   1 
ATOM 586  N N      . SER A 1 43 ? 114.676 117.083 53.006 1.00 132.89 ? 135 SER A N      1 
ATOM 587  C CA     . SER A 1 43 ? 113.681 117.431 52.003 1.00 150.61 ? 135 SER A CA     1 
ATOM 588  C C      . SER A 1 43 ? 113.950 116.629 50.737 1.00 146.31 ? 135 SER A C      1 
ATOM 589  O O      . SER A 1 43 ? 115.063 116.156 50.516 1.00 132.44 ? 135 SER A O      1 
ATOM 590  C CB     . SER A 1 43 ? 113.698 118.936 51.714 1.00 173.43 ? 135 SER A CB     1 
ATOM 591  O OG     . SER A 1 43 ? 114.929 119.348 51.149 1.00 169.33 ? 135 SER A OG     1 
ATOM 592  H H      . SER A 1 43 ? 115.346 117.621 53.043 1.00 159.47 ? 135 SER A H      1 
ATOM 593  H HA     . SER A 1 43 ? 112.800 117.195 52.331 1.00 180.73 ? 135 SER A HA     1 
ATOM 594  H HB2    . SER A 1 43 ? 112.984 119.143 51.091 1.00 208.11 ? 135 SER A HB2    1 
ATOM 595  H HB3    . SER A 1 43 ? 113.559 119.417 52.545 1.00 208.11 ? 135 SER A HB3    1 
ATOM 596  H HG     . SER A 1 43 ? 114.915 120.175 51.000 1.00 203.19 ? 135 SER A HG     1 
ATOM 597  N N      . TYR A 1 44 ? 112.918 116.461 49.918 1.00 141.23 ? 136 TYR A N      1 
ATOM 598  C CA     . TYR A 1 44 ? 113.038 115.722 48.667 1.00 131.79 ? 136 TYR A CA     1 
ATOM 599  C C      . TYR A 1 44 ? 114.069 116.383 47.749 1.00 139.71 ? 136 TYR A C      1 
ATOM 600  O O      . TYR A 1 44 ? 114.881 115.708 47.099 1.00 128.20 ? 136 TYR A O      1 
ATOM 601  C CB     . TYR A 1 44 ? 111.672 115.636 47.986 1.00 116.71 ? 136 TYR A CB     1 
ATOM 602  C CG     . TYR A 1 44 ? 111.715 115.159 46.556 1.00 150.99 ? 136 TYR A CG     1 
ATOM 603  C CD1    . TYR A 1 44 ? 111.815 113.808 46.260 1.00 155.60 ? 136 TYR A CD1    1 
ATOM 604  C CD2    . TYR A 1 44 ? 111.628 116.057 45.501 1.00 174.52 ? 136 TYR A CD2    1 
ATOM 605  C CE1    . TYR A 1 44 ? 111.852 113.365 44.956 1.00 145.95 ? 136 TYR A CE1    1 
ATOM 606  C CE2    . TYR A 1 44 ? 111.659 115.623 44.191 1.00 172.21 ? 136 TYR A CE2    1 
ATOM 607  C CZ     . TYR A 1 44 ? 111.769 114.275 43.925 1.00 165.65 ? 136 TYR A CZ     1 
ATOM 608  O OH     . TYR A 1 44 ? 111.800 113.834 42.622 1.00 200.44 ? 136 TYR A OH     1 
ATOM 609  H H      . TYR A 1 44 ? 112.129 116.769 50.066 1.00 169.47 ? 136 TYR A H      1 
ATOM 610  H HA     . TYR A 1 44 ? 113.338 114.820 48.858 1.00 158.15 ? 136 TYR A HA     1 
ATOM 611  H HB2    . TYR A 1 44 ? 111.115 115.018 48.485 1.00 140.05 ? 136 TYR A HB2    1 
ATOM 612  H HB3    . TYR A 1 44 ? 111.267 116.517 47.990 1.00 140.05 ? 136 TYR A HB3    1 
ATOM 613  H HD1    . TYR A 1 44 ? 111.872 113.191 46.954 1.00 186.72 ? 136 TYR A HD1    1 
ATOM 614  H HD2    . TYR A 1 44 ? 111.555 116.967 45.679 1.00 209.42 ? 136 TYR A HD2    1 
ATOM 615  H HE1    . TYR A 1 44 ? 111.923 112.456 44.773 1.00 175.14 ? 136 TYR A HE1    1 
ATOM 616  H HE2    . TYR A 1 44 ? 111.606 116.235 43.494 1.00 206.66 ? 136 TYR A HE2    1 
ATOM 617  H HH     . TYR A 1 44 ? 111.741 114.487 42.096 1.00 240.53 ? 136 TYR A HH     1 
ATOM 618  N N      . LYS A 1 45 ? 114.028 117.711 47.723 1.00 136.36 ? 137 LYS A N      1 
ATOM 619  C CA     . LYS A 1 45 ? 114.863 118.516 46.841 1.00 134.28 ? 137 LYS A CA     1 
ATOM 620  C C      . LYS A 1 45 ? 116.354 118.213 47.027 1.00 137.10 ? 137 LYS A C      1 
ATOM 621  O O      . LYS A 1 45 ? 117.068 117.956 46.054 1.00 146.30 ? 137 LYS A O      1 
ATOM 622  C CB     . LYS A 1 45 ? 114.586 120.002 47.094 1.00 146.62 ? 137 LYS A CB     1 
ATOM 623  C CG     . LYS A 1 45 ? 115.090 120.949 46.016 1.00 157.69 ? 137 LYS A CG     1 
ATOM 624  C CD     . LYS A 1 45 ? 114.675 122.386 46.319 1.00 163.91 ? 137 LYS A CD     1 
ATOM 625  C CE     . LYS A 1 45 ? 115.116 123.349 45.227 1.00 196.85 ? 137 LYS A CE     1 
ATOM 626  N NZ     . LYS A 1 45 ? 114.728 124.757 45.531 1.00 210.70 ? 137 LYS A NZ     1 
ATOM 627  H H      . LYS A 1 45 ? 113.508 118.181 48.222 1.00 163.63 ? 137 LYS A H      1 
ATOM 628  H HA     . LYS A 1 45 ? 114.630 118.320 45.920 1.00 161.13 ? 137 LYS A HA     1 
ATOM 629  H HB2    . LYS A 1 45 ? 113.627 120.128 47.168 1.00 175.94 ? 137 LYS A HB2    1 
ATOM 630  H HB3    . LYS A 1 45 ? 115.012 120.257 47.928 1.00 175.94 ? 137 LYS A HB3    1 
ATOM 631  H HG2    . LYS A 1 45 ? 116.059 120.911 45.980 1.00 189.23 ? 137 LYS A HG2    1 
ATOM 632  H HG3    . LYS A 1 45 ? 114.710 120.695 45.160 1.00 189.23 ? 137 LYS A HG3    1 
ATOM 633  H HD2    . LYS A 1 45 ? 113.709 122.430 46.389 1.00 196.69 ? 137 LYS A HD2    1 
ATOM 634  H HD3    . LYS A 1 45 ? 115.084 122.666 47.152 1.00 196.69 ? 137 LYS A HD3    1 
ATOM 635  H HE2    . LYS A 1 45 ? 116.081 123.314 45.141 1.00 236.22 ? 137 LYS A HE2    1 
ATOM 636  H HE3    . LYS A 1 45 ? 114.697 123.095 44.390 1.00 236.22 ? 137 LYS A HE3    1 
ATOM 637  H HZ1    . LYS A 1 45 ? 113.844 124.818 45.609 1.00 252.84 ? 137 LYS A HZ1    1 
ATOM 638  H HZ2    . LYS A 1 45 ? 115.105 125.017 46.294 1.00 252.84 ? 137 LYS A HZ2    1 
ATOM 639  H HZ3    . LYS A 1 45 ? 114.999 125.295 44.876 1.00 252.84 ? 137 LYS A HZ3    1 
ATOM 640  N N      . GLN A 1 46 ? 116.816 118.228 48.275 1.00 113.57 ? 138 GLN A N      1 
ATOM 641  C CA     . GLN A 1 46 ? 118.241 118.061 48.560 1.00 160.30 ? 138 GLN A CA     1 
ATOM 642  C C      . GLN A 1 46 ? 118.719 116.638 48.247 1.00 147.81 ? 138 GLN A C      1 
ATOM 643  O O      . GLN A 1 46 ? 119.875 116.432 47.860 1.00 142.30 ? 138 GLN A O      1 
ATOM 644  C CB     . GLN A 1 46 ? 118.550 118.422 50.023 1.00 174.42 ? 138 GLN A CB     1 
ATOM 645  C CG     . GLN A 1 46 ? 117.674 117.746 51.073 1.00 187.48 ? 138 GLN A CG     1 
ATOM 646  C CD     . GLN A 1 46 ? 117.829 118.364 52.457 1.00 171.80 ? 138 GLN A CD     1 
ATOM 647  O OE1    . GLN A 1 46 ? 116.850 118.531 53.186 1.00 153.90 ? 138 GLN A OE1    1 
ATOM 648  N NE2    . GLN A 1 46 ? 119.059 118.706 52.822 1.00 167.35 ? 138 GLN A NE2    1 
ATOM 649  H H      . GLN A 1 46 ? 116.326 118.333 48.974 1.00 136.28 ? 138 GLN A H      1 
ATOM 650  H HA     . GLN A 1 46 ? 118.743 118.669 47.995 1.00 192.35 ? 138 GLN A HA     1 
ATOM 651  H HB2    . GLN A 1 46 ? 119.469 118.176 50.211 1.00 209.30 ? 138 GLN A HB2    1 
ATOM 652  H HB3    . GLN A 1 46 ? 118.444 119.380 50.130 1.00 209.30 ? 138 GLN A HB3    1 
ATOM 653  H HG2    . GLN A 1 46 ? 116.744 117.829 50.810 1.00 224.98 ? 138 GLN A HG2    1 
ATOM 654  H HG3    . GLN A 1 46 ? 117.918 116.809 51.134 1.00 224.98 ? 138 GLN A HG3    1 
ATOM 655  H HE21   . GLN A 1 46 ? 119.719 118.575 52.287 1.00 200.82 ? 138 GLN A HE21   1 
ATOM 656  H HE22   . GLN A 1 46 ? 119.195 119.059 53.595 1.00 200.82 ? 138 GLN A HE22   1 
ATOM 657  N N      . VAL A 1 47 ? 117.820 115.665 48.377 1.00 126.38 ? 139 VAL A N      1 
ATOM 658  C CA     . VAL A 1 47 ? 118.157 114.273 48.085 1.00 134.89 ? 139 VAL A CA     1 
ATOM 659  C C      . VAL A 1 47 ? 118.249 114.078 46.572 1.00 133.27 ? 139 VAL A C      1 
ATOM 660  O O      . VAL A 1 47 ? 119.220 113.500 46.061 1.00 140.18 ? 139 VAL A O      1 
ATOM 661  C CB     . VAL A 1 47 ? 117.113 113.300 48.675 1.00 123.90 ? 139 VAL A CB     1 
ATOM 662  C CG1    . VAL A 1 47 ? 117.460 111.854 48.334 1.00 116.70 ? 139 VAL A CG1    1 
ATOM 663  C CG2    . VAL A 1 47 ? 117.018 113.475 50.183 1.00 140.77 ? 139 VAL A CG2    1 
ATOM 664  H H      . VAL A 1 47 ? 117.008 115.784 48.633 1.00 151.66 ? 139 VAL A H      1 
ATOM 665  H HA     . VAL A 1 47 ? 119.021 114.065 48.472 1.00 161.87 ? 139 VAL A HA     1 
ATOM 666  H HB     . VAL A 1 47 ? 116.244 113.498 48.294 1.00 148.68 ? 139 VAL A HB     1 
ATOM 667  H HG11   . VAL A 1 47 ? 116.788 111.270 48.718 1.00 140.04 ? 139 VAL A HG11   1 
ATOM 668  H HG12   . VAL A 1 47 ? 117.475 111.753 47.369 1.00 140.04 ? 139 VAL A HG12   1 
ATOM 669  H HG13   . VAL A 1 47 ? 118.332 111.644 48.703 1.00 140.04 ? 139 VAL A HG13   1 
ATOM 670  H HG21   . VAL A 1 47 ? 116.358 112.855 50.531 1.00 168.92 ? 139 VAL A HG21   1 
ATOM 671  H HG22   . VAL A 1 47 ? 117.885 113.292 50.577 1.00 168.92 ? 139 VAL A HG22   1 
ATOM 672  H HG23   . VAL A 1 47 ? 116.751 114.387 50.378 1.00 168.92 ? 139 VAL A HG23   1 
ATOM 673  N N      . LYS A 1 48 ? 117.240 114.575 45.862 1.00 108.13 ? 140 LYS A N      1 
ATOM 674  C CA     . LYS A 1 48 ? 117.232 114.526 44.403 1.00 121.38 ? 140 LYS A CA     1 
ATOM 675  C C      . LYS A 1 48 ? 118.481 115.212 43.853 1.00 132.33 ? 140 LYS A C      1 
ATOM 676  O O      . LYS A 1 48 ? 119.185 114.676 42.977 1.00 138.37 ? 140 LYS A O      1 
ATOM 677  C CB     . LYS A 1 48 ? 115.965 115.200 43.873 1.00 99.55  ? 140 LYS A CB     1 
ATOM 678  C CG     . LYS A 1 48 ? 115.902 115.394 42.368 1.00 136.31 ? 140 LYS A CG     1 
ATOM 679  C CD     . LYS A 1 48 ? 114.756 116.325 42.002 1.00 141.88 ? 140 LYS A CD     1 
ATOM 680  C CE     . LYS A 1 48 ? 114.810 116.732 40.541 1.00 158.05 ? 140 LYS A CE     1 
ATOM 681  N NZ     . LYS A 1 48 ? 113.843 117.822 40.243 1.00 166.92 ? 140 LYS A NZ     1 
ATOM 682  H H      . LYS A 1 48 ? 116.545 114.948 46.203 1.00 129.76 ? 140 LYS A H      1 
ATOM 683  H HA     . LYS A 1 48 ? 117.234 113.601 44.110 1.00 145.66 ? 140 LYS A HA     1 
ATOM 684  H HB2    . LYS A 1 48 ? 115.201 114.660 44.128 1.00 119.46 ? 140 LYS A HB2    1 
ATOM 685  H HB3    . LYS A 1 48 ? 115.891 116.077 44.282 1.00 119.46 ? 140 LYS A HB3    1 
ATOM 686  H HG2    . LYS A 1 48 ? 116.731 115.790 42.058 1.00 163.58 ? 140 LYS A HG2    1 
ATOM 687  H HG3    . LYS A 1 48 ? 115.752 114.538 41.938 1.00 163.58 ? 140 LYS A HG3    1 
ATOM 688  H HD2    . LYS A 1 48 ? 113.913 115.873 42.161 1.00 170.25 ? 140 LYS A HD2    1 
ATOM 689  H HD3    . LYS A 1 48 ? 114.812 117.129 42.543 1.00 170.25 ? 140 LYS A HD3    1 
ATOM 690  H HE2    . LYS A 1 48 ? 115.701 117.049 40.330 1.00 189.67 ? 140 LYS A HE2    1 
ATOM 691  H HE3    . LYS A 1 48 ? 114.586 115.967 39.988 1.00 189.67 ? 140 LYS A HE3    1 
ATOM 692  H HZ1    . LYS A 1 48 ? 113.015 117.553 40.426 1.00 200.30 ? 140 LYS A HZ1    1 
ATOM 693  H HZ2    . LYS A 1 48 ? 114.030 118.538 40.737 1.00 200.30 ? 140 LYS A HZ2    1 
ATOM 694  H HZ3    . LYS A 1 48 ? 113.891 118.044 39.382 1.00 200.30 ? 140 LYS A HZ3    1 
ATOM 695  N N      . THR A 1 49 ? 118.758 116.391 44.400 1.00 125.94 ? 141 THR A N      1 
ATOM 696  C CA     . THR A 1 49 ? 119.931 117.166 44.024 1.00 131.04 ? 141 THR A CA     1 
ATOM 697  C C      . THR A 1 49 ? 121.195 116.350 44.265 1.00 141.18 ? 141 THR A C      1 
ATOM 698  O O      . THR A 1 49 ? 122.048 116.230 43.374 1.00 155.35 ? 141 THR A O      1 
ATOM 699  C CB     . THR A 1 49 ? 120.011 118.486 44.815 1.00 152.44 ? 141 THR A CB     1 
ATOM 700  O OG1    . THR A 1 49 ? 118.802 119.231 44.629 1.00 153.21 ? 141 THR A OG1    1 
ATOM 701  C CG2    . THR A 1 49 ? 121.195 119.323 44.355 1.00 184.15 ? 141 THR A CG2    1 
ATOM 702  H H      . THR A 1 49 ? 118.272 116.769 45.002 1.00 151.12 ? 141 THR A H      1 
ATOM 703  H HA     . THR A 1 49 ? 119.883 117.380 43.079 1.00 157.24 ? 141 THR A HA     1 
ATOM 704  H HB     . THR A 1 49 ? 120.124 118.288 45.758 1.00 182.93 ? 141 THR A HB     1 
ATOM 705  H HG1    . THR A 1 49 ? 118.144 118.786 44.903 1.00 183.85 ? 141 THR A HG1    1 
ATOM 706  H HG21   . THR A 1 49 ? 121.232 120.150 44.861 1.00 220.98 ? 141 THR A HG21   1 
ATOM 707  H HG22   . THR A 1 49 ? 122.020 118.832 44.492 1.00 220.98 ? 141 THR A HG22   1 
ATOM 708  H HG23   . THR A 1 49 ? 121.105 119.534 43.413 1.00 220.98 ? 141 THR A HG23   1 
ATOM 709  N N      . TRP A 1 50 ? 121.314 115.798 45.472 1.00 140.79 ? 142 TRP A N      1 
ATOM 710  C CA     . TRP A 1 50 ? 122.451 114.951 45.810 1.00 148.40 ? 142 TRP A CA     1 
ATOM 711  C C      . TRP A 1 50 ? 122.654 113.868 44.757 1.00 135.74 ? 142 TRP A C      1 
ATOM 712  O O      . TRP A 1 50 ? 123.747 113.736 44.198 1.00 163.91 ? 142 TRP A O      1 
ATOM 713  C CB     . TRP A 1 50 ? 122.268 114.302 47.183 1.00 146.63 ? 142 TRP A CB     1 
ATOM 714  C CG     . TRP A 1 50 ? 123.483 113.541 47.621 1.00 140.37 ? 142 TRP A CG     1 
ATOM 715  C CD1    . TRP A 1 50 ? 124.596 114.055 48.219 1.00 139.25 ? 142 TRP A CD1    1 
ATOM 716  C CD2    . TRP A 1 50 ? 123.714 112.133 47.486 1.00 146.12 ? 142 TRP A CD2    1 
ATOM 717  N NE1    . TRP A 1 50 ? 125.504 113.056 48.467 1.00 144.27 ? 142 TRP A NE1    1 
ATOM 718  C CE2    . TRP A 1 50 ? 124.987 111.866 48.027 1.00 147.99 ? 142 TRP A CE2    1 
ATOM 719  C CE3    . TRP A 1 50 ? 122.968 111.073 46.963 1.00 154.96 ? 142 TRP A CE3    1 
ATOM 720  C CZ2    . TRP A 1 50 ? 125.531 110.584 48.061 1.00 156.30 ? 142 TRP A CZ2    1 
ATOM 721  C CZ3    . TRP A 1 50 ? 123.510 109.799 46.998 1.00 150.85 ? 142 TRP A CZ3    1 
ATOM 722  C CH2    . TRP A 1 50 ? 124.780 109.566 47.540 1.00 153.11 ? 142 TRP A CH2    1 
ATOM 723  H H      . TRP A 1 50 ? 120.748 115.901 46.111 1.00 168.95 ? 142 TRP A H      1 
ATOM 724  H HA     . TRP A 1 50 ? 123.253 115.495 45.839 1.00 178.08 ? 142 TRP A HA     1 
ATOM 725  H HB2    . TRP A 1 50 ? 122.093 114.994 47.840 1.00 175.96 ? 142 TRP A HB2    1 
ATOM 726  H HB3    . TRP A 1 50 ? 121.522 113.683 47.145 1.00 175.96 ? 142 TRP A HB3    1 
ATOM 727  H HD1    . TRP A 1 50 ? 124.721 114.952 48.427 1.00 167.10 ? 142 TRP A HD1    1 
ATOM 728  H HE1    . TRP A 1 50 ? 126.272 113.160 48.839 1.00 173.12 ? 142 TRP A HE1    1 
ATOM 729  H HE3    . TRP A 1 50 ? 122.125 111.220 46.599 1.00 185.95 ? 142 TRP A HE3    1 
ATOM 730  H HZ2    . TRP A 1 50 ? 126.373 110.426 48.422 1.00 187.56 ? 142 TRP A HZ2    1 
ATOM 731  H HZ3    . TRP A 1 50 ? 123.024 109.086 46.651 1.00 181.02 ? 142 TRP A HZ3    1 
ATOM 732  H HH2    . TRP A 1 50 ? 125.118 108.700 47.551 1.00 183.73 ? 142 TRP A HH2    1 
ATOM 733  N N      . PHE A 1 51 ? 121.600 113.102 44.482 1.00 119.42 ? 143 PHE A N      1 
ATOM 734  C CA     . PHE A 1 51 ? 121.694 112.031 43.495 1.00 126.73 ? 143 PHE A CA     1 
ATOM 735  C C      . PHE A 1 51 ? 122.170 112.536 42.136 1.00 128.98 ? 143 PHE A C      1 
ATOM 736  O O      . PHE A 1 51 ? 123.087 111.955 41.546 1.00 136.35 ? 143 PHE A O      1 
ATOM 737  C CB     . PHE A 1 51 ? 120.353 111.323 43.343 1.00 113.03 ? 143 PHE A CB     1 
ATOM 738  C CG     . PHE A 1 51 ? 120.169 110.185 44.298 1.00 116.16 ? 143 PHE A CG     1 
ATOM 739  C CD1    . PHE A 1 51 ? 120.800 108.972 44.074 1.00 120.55 ? 143 PHE A CD1    1 
ATOM 740  C CD2    . PHE A 1 51 ? 119.370 110.324 45.420 1.00 114.80 ? 143 PHE A CD2    1 
ATOM 741  C CE1    . PHE A 1 51 ? 120.640 107.920 44.952 1.00 110.93 ? 143 PHE A CE1    1 
ATOM 742  C CE2    . PHE A 1 51 ? 119.203 109.274 46.301 1.00 128.67 ? 143 PHE A CE2    1 
ATOM 743  C CZ     . PHE A 1 51 ? 119.839 108.070 46.066 1.00 114.36 ? 143 PHE A CZ     1 
ATOM 744  H H      . PHE A 1 51 ? 120.827 113.182 44.849 1.00 143.30 ? 143 PHE A H      1 
ATOM 745  H HA     . PHE A 1 51 ? 122.338 111.376 43.808 1.00 152.07 ? 143 PHE A HA     1 
ATOM 746  H HB2    . PHE A 1 51 ? 119.641 111.963 43.502 1.00 135.63 ? 143 PHE A HB2    1 
ATOM 747  H HB3    . PHE A 1 51 ? 120.284 110.970 42.442 1.00 135.63 ? 143 PHE A HB3    1 
ATOM 748  H HD1    . PHE A 1 51 ? 121.341 108.867 43.325 1.00 144.66 ? 143 PHE A HD1    1 
ATOM 749  H HD2    . PHE A 1 51 ? 118.940 111.133 45.582 1.00 137.77 ? 143 PHE A HD2    1 
ATOM 750  H HE1    . PHE A 1 51 ? 121.068 107.110 44.791 1.00 133.12 ? 143 PHE A HE1    1 
ATOM 751  H HE2    . PHE A 1 51 ? 118.664 109.377 47.051 1.00 154.41 ? 143 PHE A HE2    1 
ATOM 752  H HZ     . PHE A 1 51 ? 119.728 107.361 46.658 1.00 137.23 ? 143 PHE A HZ     1 
ATOM 753  N N      . GLN A 1 52 ? 121.559 113.610 41.642 1.00 118.03 ? 144 GLN A N      1 
ATOM 754  C CA     . GLN A 1 52 ? 122.016 114.223 40.393 1.00 119.08 ? 144 GLN A CA     1 
ATOM 755  C C      . GLN A 1 52 ? 123.522 114.509 40.419 1.00 145.64 ? 144 GLN A C      1 
ATOM 756  O O      . GLN A 1 52 ? 124.281 114.080 39.526 1.00 144.09 ? 144 GLN A O      1 
ATOM 757  C CB     . GLN A 1 52 ? 121.251 115.517 40.121 1.00 112.31 ? 144 GLN A CB     1 
ATOM 758  C CG     . GLN A 1 52 ? 121.419 116.032 38.702 1.00 117.11 ? 144 GLN A CG     1 
ATOM 759  C CD     . GLN A 1 52 ? 120.790 115.118 37.672 1.00 137.92 ? 144 GLN A CD     1 
ATOM 760  O OE1    . GLN A 1 52 ? 119.625 114.736 37.792 1.00 109.34 ? 144 GLN A OE1    1 
ATOM 761  N NE2    . GLN A 1 52 ? 121.564 114.750 36.657 1.00 169.38 ? 144 GLN A NE2    1 
ATOM 762  H H      . GLN A 1 52 ? 120.883 114.000 42.004 1.00 141.63 ? 144 GLN A H      1 
ATOM 763  H HA     . GLN A 1 52 ? 121.841 113.612 39.660 1.00 142.90 ? 144 GLN A HA     1 
ATOM 764  H HB2    . GLN A 1 52 ? 120.305 115.359 40.269 1.00 134.78 ? 144 GLN A HB2    1 
ATOM 765  H HB3    . GLN A 1 52 ? 121.570 116.204 40.727 1.00 134.78 ? 144 GLN A HB3    1 
ATOM 766  H HG2    . GLN A 1 52 ? 120.997 116.903 38.629 1.00 140.53 ? 144 GLN A HG2    1 
ATOM 767  H HG3    . GLN A 1 52 ? 122.366 116.104 38.502 1.00 140.53 ? 144 GLN A HG3    1 
ATOM 768  H HE21   . GLN A 1 52 ? 122.376 115.030 36.611 1.00 203.26 ? 144 GLN A HE21   1 
ATOM 769  H HE22   . GLN A 1 52 ? 121.254 114.231 36.045 1.00 203.26 ? 144 GLN A HE22   1 
ATOM 770  N N      . ASN A 1 53 ? 123.944 115.239 41.449 1.00 134.07 ? 145 ASN A N      1 
ATOM 771  C CA     . ASN A 1 53 ? 125.348 115.580 41.614 1.00 109.16 ? 145 ASN A CA     1 
ATOM 772  C C      . ASN A 1 53 ? 126.218 114.327 41.610 1.00 121.20 ? 145 ASN A C      1 
ATOM 773  O O      . ASN A 1 53 ? 127.306 114.311 41.027 1.00 139.62 ? 145 ASN A O      1 
ATOM 774  C CB     . ASN A 1 53 ? 125.554 116.361 42.910 1.00 136.84 ? 145 ASN A CB     1 
ATOM 775  C CG     . ASN A 1 53 ? 124.942 117.748 42.859 1.00 141.40 ? 145 ASN A CG     1 
ATOM 776  O OD1    . ASN A 1 53 ? 124.917 118.392 41.810 1.00 129.16 ? 145 ASN A OD1    1 
ATOM 777  N ND2    . ASN A 1 53 ? 124.443 118.215 43.998 1.00 147.01 ? 145 ASN A ND2    1 
ATOM 778  H H      . ASN A 1 53 ? 123.432 115.548 42.067 1.00 160.89 ? 145 ASN A H      1 
ATOM 779  H HA     . ASN A 1 53 ? 125.627 116.143 40.875 1.00 131.00 ? 145 ASN A HA     1 
ATOM 780  H HB2    . ASN A 1 53 ? 125.139 115.876 43.641 1.00 164.21 ? 145 ASN A HB2    1 
ATOM 781  H HB3    . ASN A 1 53 ? 126.505 116.458 43.073 1.00 164.21 ? 145 ASN A HB3    1 
ATOM 782  H HD21   . ASN A 1 53 ? 124.478 117.736 44.711 1.00 176.42 ? 145 ASN A HD21   1 
ATOM 783  H HD22   . ASN A 1 53 ? 124.085 118.997 44.022 1.00 176.42 ? 145 ASN A HD22   1 
ATOM 784  N N      . GLN A 1 54 ? 125.730 113.274 42.259 1.00 121.22 ? 146 GLN A N      1 
ATOM 785  C CA     . GLN A 1 54 ? 126.462 112.016 42.306 1.00 141.39 ? 146 GLN A CA     1 
ATOM 786  C C      . GLN A 1 54 ? 126.558 111.379 40.922 1.00 155.26 ? 146 GLN A C      1 
ATOM 787  O O      . GLN A 1 54 ? 127.597 110.817 40.574 1.00 171.57 ? 146 GLN A O      1 
ATOM 788  C CB     . GLN A 1 54 ? 125.809 111.048 43.288 1.00 148.26 ? 146 GLN A CB     1 
ATOM 789  C CG     . GLN A 1 54 ? 125.946 111.475 44.736 1.00 139.60 ? 146 GLN A CG     1 
ATOM 790  C CD     . GLN A 1 54 ? 127.371 111.388 45.242 1.00 145.87 ? 146 GLN A CD     1 
ATOM 791  O OE1    . GLN A 1 54 ? 128.123 110.486 44.873 1.00 126.24 ? 146 GLN A OE1    1 
ATOM 792  N NE2    . GLN A 1 54 ? 127.752 112.336 46.090 1.00 182.17 ? 146 GLN A NE2    1 
ATOM 793  H H      . GLN A 1 54 ? 124.980 113.264 42.679 1.00 145.46 ? 146 GLN A H      1 
ATOM 794  H HA     . GLN A 1 54 ? 127.365 112.190 42.616 1.00 169.67 ? 146 GLN A HA     1 
ATOM 795  H HB2    . GLN A 1 54 ? 124.863 110.984 43.084 1.00 177.92 ? 146 GLN A HB2    1 
ATOM 796  H HB3    . GLN A 1 54 ? 126.226 110.177 43.194 1.00 177.92 ? 146 GLN A HB3    1 
ATOM 797  H HG2    . GLN A 1 54 ? 125.652 112.395 44.822 1.00 167.52 ? 146 GLN A HG2    1 
ATOM 798  H HG3    . GLN A 1 54 ? 125.396 110.898 45.288 1.00 167.52 ? 146 GLN A HG3    1 
ATOM 799  H HE21   . GLN A 1 54 ? 127.199 112.953 46.322 1.00 218.60 ? 146 GLN A HE21   1 
ATOM 800  H HE22   . GLN A 1 54 ? 128.551 112.333 46.407 1.00 218.60 ? 146 GLN A HE22   1 
ATOM 801  N N      . ARG A 1 55 ? 125.480 111.449 40.143 1.00 152.16 ? 147 ARG A N      1 
ATOM 802  C CA     . ARG A 1 55 ? 125.529 110.975 38.760 1.00 126.96 ? 147 ARG A CA     1 
ATOM 803  C C      . ARG A 1 55 ? 126.615 111.730 37.986 1.00 145.11 ? 147 ARG A C      1 
ATOM 804  O O      . ARG A 1 55 ? 127.419 111.116 37.271 1.00 164.30 ? 147 ARG A O      1 
ATOM 805  C CB     . ARG A 1 55 ? 124.167 111.123 38.071 1.00 115.34 ? 147 ARG A CB     1 
ATOM 806  C CG     . ARG A 1 55 ? 123.073 110.235 38.668 1.00 112.12 ? 147 ARG A CG     1 
ATOM 807  C CD     . ARG A 1 55 ? 121.821 110.184 37.797 1.00 96.73  ? 147 ARG A CD     1 
ATOM 808  N NE     . ARG A 1 55 ? 120.804 111.167 38.176 1.00 94.00  ? 147 ARG A NE     1 
ATOM 809  C CZ     . ARG A 1 55 ? 119.816 110.943 39.040 1.00 134.72 ? 147 ARG A CZ     1 
ATOM 810  N NH1    . ARG A 1 55 ? 119.695 109.767 39.647 1.00 114.95 ? 147 ARG A NH1    1 
ATOM 811  N NH2    . ARG A 1 55 ? 118.942 111.906 39.305 1.00 126.92 ? 147 ARG A NH2    1 
ATOM 812  H H      . ARG A 1 55 ? 124.716 111.761 40.386 1.00 182.60 ? 147 ARG A H      1 
ATOM 813  H HA     . ARG A 1 55 ? 125.763 110.034 38.759 1.00 152.35 ? 147 ARG A HA     1 
ATOM 814  H HB2    . ARG A 1 55 ? 123.876 112.045 38.149 1.00 138.41 ? 147 ARG A HB2    1 
ATOM 815  H HB3    . ARG A 1 55 ? 124.263 110.886 37.136 1.00 138.41 ? 147 ARG A HB3    1 
ATOM 816  H HG2    . ARG A 1 55 ? 123.413 109.331 38.759 1.00 134.54 ? 147 ARG A HG2    1 
ATOM 817  H HG3    . ARG A 1 55 ? 122.821 110.584 39.537 1.00 134.54 ? 147 ARG A HG3    1 
ATOM 818  H HD2    . ARG A 1 55 ? 122.072 110.356 36.876 1.00 116.08 ? 147 ARG A HD2    1 
ATOM 819  H HD3    . ARG A 1 55 ? 121.423 109.302 37.870 1.00 116.08 ? 147 ARG A HD3    1 
ATOM 820  H HE     . ARG A 1 55 ? 120.849 111.946 37.814 1.00 112.81 ? 147 ARG A HE     1 
ATOM 821  H HH11   . ARG A 1 55 ? 120.256 109.137 39.480 1.00 137.94 ? 147 ARG A HH11   1 
ATOM 822  H HH12   . ARG A 1 55 ? 119.054 109.635 40.205 1.00 137.94 ? 147 ARG A HH12   1 
ATOM 823  H HH21   . ARG A 1 55 ? 119.014 112.671 38.919 1.00 152.31 ? 147 ARG A HH21   1 
ATOM 824  H HH22   . ARG A 1 55 ? 118.305 111.766 39.866 1.00 152.31 ? 147 ARG A HH22   1 
ATOM 825  N N      . MET A 1 56 ? 126.642 113.054 38.129 1.00 139.10 ? 148 MET A N      1 
ATOM 826  C CA     . MET A 1 56 ? 127.716 113.850 37.525 1.00 115.43 ? 148 MET A CA     1 
ATOM 827  C C      . MET A 1 56 ? 129.102 113.369 37.968 1.00 169.77 ? 148 MET A C      1 
ATOM 828  O O      . MET A 1 56 ? 129.999 113.147 37.138 1.00 194.83 ? 148 MET A O      1 
ATOM 829  C CB     . MET A 1 56 ? 127.561 115.326 37.879 1.00 152.80 ? 148 MET A CB     1 
ATOM 830  C CG     . MET A 1 56 ? 126.280 115.962 37.391 1.00 175.74 ? 148 MET A CG     1 
ATOM 831  S SD     . MET A 1 56 ? 125.871 115.507 35.699 1.00 157.31 ? 148 MET A SD     1 
ATOM 832  C CE     . MET A 1 56 ? 124.645 116.746 35.349 1.00 162.47 ? 148 MET A CE     1 
ATOM 833  H H      . MET A 1 56 ? 126.059 113.512 38.564 1.00 166.93 ? 148 MET A H      1 
ATOM 834  H HA     . MET A 1 56 ? 127.655 113.771 36.560 1.00 138.52 ? 148 MET A HA     1 
ATOM 835  H HB2    . MET A 1 56 ? 127.584 115.417 38.845 1.00 183.36 ? 148 MET A HB2    1 
ATOM 836  H HB3    . MET A 1 56 ? 128.300 115.817 37.488 1.00 183.36 ? 148 MET A HB3    1 
ATOM 837  H HG2    . MET A 1 56 ? 125.549 115.677 37.962 1.00 210.88 ? 148 MET A HG2    1 
ATOM 838  H HG3    . MET A 1 56 ? 126.373 116.926 37.427 1.00 210.88 ? 148 MET A HG3    1 
ATOM 839  H HE1    . MET A 1 56 ? 124.322 116.623 34.443 1.00 194.97 ? 148 MET A HE1    1 
ATOM 840  H HE2    . MET A 1 56 ? 123.912 116.651 35.978 1.00 194.97 ? 148 MET A HE2    1 
ATOM 841  H HE3    . MET A 1 56 ? 125.048 117.624 35.441 1.00 194.97 ? 148 MET A HE3    1 
ATOM 842  N N      . LYS A 1 57 ? 129.275 113.234 39.281 1.00 157.02 ? 149 LYS A N      1 
ATOM 843  C CA     . LYS A 1 57 ? 130.523 112.734 39.841 1.00 147.68 ? 149 LYS A CA     1 
ATOM 844  C C      . LYS A 1 57 ? 130.905 111.409 39.192 1.00 160.63 ? 149 LYS A C      1 
ATOM 845  O O      . LYS A 1 57 ? 132.057 111.210 38.807 1.00 206.31 ? 149 LYS A O      1 
ATOM 846  C CB     . LYS A 1 57 ? 130.399 112.562 41.357 1.00 185.27 ? 149 LYS A CB     1 
ATOM 847  C CG     . LYS A 1 57 ? 131.647 112.001 42.027 1.00 202.48 ? 149 LYS A CG     1 
ATOM 848  C CD     . LYS A 1 57 ? 131.430 111.780 43.516 1.00 188.18 ? 149 LYS A CD     1 
ATOM 849  C CE     . LYS A 1 57 ? 132.613 111.064 44.149 1.00 199.06 ? 149 LYS A CE     1 
ATOM 850  N NZ     . LYS A 1 57 ? 132.445 110.879 45.618 1.00 196.77 ? 149 LYS A NZ     1 
ATOM 851  H H      . LYS A 1 57 ? 128.679 113.428 39.871 1.00 188.42 ? 149 LYS A H      1 
ATOM 852  H HA     . LYS A 1 57 ? 131.231 113.373 39.665 1.00 177.21 ? 149 LYS A HA     1 
ATOM 853  H HB2    . LYS A 1 57 ? 130.214 113.427 41.754 1.00 222.32 ? 149 LYS A HB2    1 
ATOM 854  H HB3    . LYS A 1 57 ? 129.666 111.954 41.542 1.00 222.32 ? 149 LYS A HB3    1 
ATOM 855  H HG2    . LYS A 1 57 ? 131.872 111.148 41.623 1.00 242.98 ? 149 LYS A HG2    1 
ATOM 856  H HG3    . LYS A 1 57 ? 132.379 112.628 41.917 1.00 242.98 ? 149 LYS A HG3    1 
ATOM 857  H HD2    . LYS A 1 57 ? 131.322 112.638 43.955 1.00 225.82 ? 149 LYS A HD2    1 
ATOM 858  H HD3    . LYS A 1 57 ? 130.638 111.234 43.647 1.00 225.82 ? 149 LYS A HD3    1 
ATOM 859  H HE2    . LYS A 1 57 ? 132.708 110.188 43.744 1.00 238.88 ? 149 LYS A HE2    1 
ATOM 860  H HE3    . LYS A 1 57 ? 133.416 111.588 44.002 1.00 238.88 ? 149 LYS A HE3    1 
ATOM 861  H HZ1    . LYS A 1 57 ? 133.154 110.459 45.954 1.00 236.12 ? 149 LYS A HZ1    1 
ATOM 862  H HZ2    . LYS A 1 57 ? 132.362 111.670 46.016 1.00 236.12 ? 149 LYS A HZ2    1 
ATOM 863  H HZ3    . LYS A 1 57 ? 131.717 110.395 45.782 1.00 236.12 ? 149 LYS A HZ3    1 
ATOM 864  N N      . SER A 1 58 ? 129.935 110.506 39.081 1.00 144.46 ? 150 SER A N      1 
ATOM 865  C CA     . SER A 1 58 ? 130.179 109.196 38.493 1.00 167.09 ? 150 SER A CA     1 
ATOM 866  C C      . SER A 1 58 ? 130.633 109.341 37.046 1.00 195.03 ? 150 SER A C      1 
ATOM 867  O O      . SER A 1 58 ? 131.559 108.658 36.605 1.00 204.19 ? 150 SER A O      1 
ATOM 868  C CB     . SER A 1 58 ? 128.920 108.331 38.566 1.00 174.19 ? 150 SER A CB     1 
ATOM 869  O OG     . SER A 1 58 ? 129.137 107.065 37.968 1.00 162.49 ? 150 SER A OG     1 
ATOM 870  H H      . SER A 1 58 ? 129.124 110.630 39.340 1.00 173.36 ? 150 SER A H      1 
ATOM 871  H HA     . SER A 1 58 ? 130.884 108.750 38.988 1.00 200.51 ? 150 SER A HA     1 
ATOM 872  H HB2    . SER A 1 58 ? 128.680 108.202 39.497 1.00 209.03 ? 150 SER A HB2    1 
ATOM 873  H HB3    . SER A 1 58 ? 128.200 108.781 38.098 1.00 209.03 ? 150 SER A HB3    1 
ATOM 874  H HG     . SER A 1 58 ? 129.759 106.662 38.365 1.00 194.98 ? 150 SER A HG     1 
ATOM 875  N N      . LYS A 1 59 ? 129.967 110.228 36.311 1.00 212.34 ? 151 LYS A N      1 
ATOM 876  C CA     . LYS A 1 59 ? 130.366 110.541 34.942 1.00 207.47 ? 151 LYS A CA     1 
ATOM 877  C C      . LYS A 1 59 ? 131.832 110.970 34.863 1.00 207.81 ? 151 LYS A C      1 
ATOM 878  O O      . LYS A 1 59 ? 132.617 110.360 34.136 1.00 215.47 ? 151 LYS A O      1 
ATOM 879  C CB     . LYS A 1 59 ? 129.466 111.623 34.347 1.00 196.28 ? 151 LYS A CB     1 
ATOM 880  C CG     . LYS A 1 59 ? 128.206 111.064 33.706 1.00 214.05 ? 151 LYS A CG     1 
ATOM 881  C CD     . LYS A 1 59 ? 127.699 111.942 32.579 1.00 219.81 ? 151 LYS A CD     1 
ATOM 882  C CE     . LYS A 1 59 ? 126.424 111.368 31.985 1.00 213.85 ? 151 LYS A CE     1 
ATOM 883  N NZ     . LYS A 1 59 ? 125.962 112.136 30.802 1.00 213.79 ? 151 LYS A NZ     1 
ATOM 884  H H      . LYS A 1 59 ? 129.278 110.665 36.583 1.00 254.81 ? 151 LYS A H      1 
ATOM 885  H HA     . LYS A 1 59 ? 130.264 109.743 34.400 1.00 248.97 ? 151 LYS A HA     1 
ATOM 886  H HB2    . LYS A 1 59 ? 129.197 112.233 35.052 1.00 235.54 ? 151 LYS A HB2    1 
ATOM 887  H HB3    . LYS A 1 59 ? 129.960 112.104 33.665 1.00 235.54 ? 151 LYS A HB3    1 
ATOM 888  H HG2    . LYS A 1 59 ? 128.398 110.186 33.342 1.00 256.86 ? 151 LYS A HG2    1 
ATOM 889  H HG3    . LYS A 1 59 ? 127.509 111.002 34.378 1.00 256.86 ? 151 LYS A HG3    1 
ATOM 890  H HD2    . LYS A 1 59 ? 127.506 112.828 32.922 1.00 263.77 ? 151 LYS A HD2    1 
ATOM 891  H HD3    . LYS A 1 59 ? 128.370 111.988 31.880 1.00 263.77 ? 151 LYS A HD3    1 
ATOM 892  H HE2    . LYS A 1 59 ? 126.587 110.453 31.706 1.00 256.62 ? 151 LYS A HE2    1 
ATOM 893  H HE3    . LYS A 1 59 ? 125.722 111.393 32.654 1.00 256.62 ? 151 LYS A HE3    1 
ATOM 894  H HZ1    . LYS A 1 59 ? 126.587 112.124 30.169 1.00 256.55 ? 151 LYS A HZ1    1 
ATOM 895  H HZ2    . LYS A 1 59 ? 125.215 111.775 30.479 1.00 256.55 ? 151 LYS A HZ2    1 
ATOM 896  H HZ3    . LYS A 1 59 ? 125.799 112.980 31.032 1.00 256.55 ? 151 LYS A HZ3    1 
ATOM 897  N N      . ARG A 1 60 ? 132.182 112.025 35.598 1.00 200.65 ? 152 ARG A N      1 
ATOM 898  C CA     . ARG A 1 60 ? 133.529 112.614 35.543 1.00 201.50 ? 152 ARG A CA     1 
ATOM 899  C C      . ARG A 1 60 ? 134.704 111.632 35.458 1.00 207.10 ? 152 ARG A C      1 
ATOM 900  O O      . ARG A 1 60 ? 135.610 111.833 34.650 1.00 223.53 ? 152 ARG A O      1 
ATOM 901  C CB     . ARG A 1 60 ? 133.755 113.514 36.754 1.00 204.96 ? 152 ARG A CB     1 
ATOM 902  C CG     . ARG A 1 60 ? 133.066 114.857 36.659 1.00 216.78 ? 152 ARG A CG     1 
ATOM 903  C CD     . ARG A 1 60 ? 132.874 115.467 38.030 1.00 233.68 ? 152 ARG A CD     1 
ATOM 904  N NE     . ARG A 1 60 ? 132.649 116.906 37.959 1.00 242.54 ? 152 ARG A NE     1 
ATOM 905  C CZ     . ARG A 1 60 ? 132.506 117.693 39.020 1.00 239.31 ? 152 ARG A CZ     1 
ATOM 906  N NH1    . ARG A 1 60 ? 132.566 117.183 40.243 1.00 234.62 ? 152 ARG A NH1    1 
ATOM 907  N NH2    . ARG A 1 60 ? 132.306 118.994 38.858 1.00 238.38 ? 152 ARG A NH2    1 
ATOM 908  H H      . ARG A 1 60 ? 131.653 112.426 36.144 1.00 240.78 ? 152 ARG A H      1 
ATOM 909  H HA     . ARG A 1 60 ? 133.575 113.178 34.755 1.00 241.80 ? 152 ARG A HA     1 
ATOM 910  H HB2    . ARG A 1 60 ? 133.419 113.064 37.545 1.00 245.95 ? 152 ARG A HB2    1 
ATOM 911  H HB3    . ARG A 1 60 ? 134.707 113.676 36.848 1.00 245.95 ? 152 ARG A HB3    1 
ATOM 912  H HG2    . ARG A 1 60 ? 133.609 115.461 36.129 1.00 260.13 ? 152 ARG A HG2    1 
ATOM 913  H HG3    . ARG A 1 60 ? 132.193 114.742 36.251 1.00 260.13 ? 152 ARG A HG3    1 
ATOM 914  H HD2    . ARG A 1 60 ? 132.102 115.060 38.455 1.00 280.42 ? 152 ARG A HD2    1 
ATOM 915  H HD3    . ARG A 1 60 ? 133.670 115.310 38.563 1.00 280.42 ? 152 ARG A HD3    1 
ATOM 916  H HE     . ARG A 1 60 ? 132.606 117.269 37.180 1.00 291.05 ? 152 ARG A HE     1 
ATOM 917  H HH11   . ARG A 1 60 ? 132.696 116.340 40.351 1.00 281.54 ? 152 ARG A HH11   1 
ATOM 918  H HH12   . ARG A 1 60 ? 132.473 117.695 40.928 1.00 281.54 ? 152 ARG A HH12   1 
ATOM 919  H HH21   . ARG A 1 60 ? 132.267 119.327 38.067 1.00 286.06 ? 152 ARG A HH21   1 
ATOM 920  H HH22   . ARG A 1 60 ? 132.214 119.503 39.545 1.00 286.06 ? 152 ARG A HH22   1 
ATOM 921  N N      . TRP A 1 61 ? 134.707 110.594 36.291 1.00 183.67 ? 153 TRP A N      1 
ATOM 922  C CA     . TRP A 1 61 ? 135.866 109.705 36.392 1.00 196.03 ? 153 TRP A CA     1 
ATOM 923  C C      . TRP A 1 61 ? 136.209 109.052 35.055 1.00 224.77 ? 153 TRP A C      1 
ATOM 924  O O      . TRP A 1 61 ? 135.590 108.066 34.653 1.00 221.63 ? 153 TRP A O      1 
ATOM 925  C CB     . TRP A 1 61 ? 135.617 108.618 37.439 1.00 182.81 ? 153 TRP A CB     1 
ATOM 926  C CG     . TRP A 1 61 ? 135.986 109.016 38.835 1.00 214.87 ? 153 TRP A CG     1 
ATOM 927  C CD1    . TRP A 1 61 ? 135.246 109.774 39.695 1.00 235.64 ? 153 TRP A CD1    1 
ATOM 928  C CD2    . TRP A 1 61 ? 137.184 108.665 39.539 1.00 235.48 ? 153 TRP A CD2    1 
ATOM 929  N NE1    . TRP A 1 61 ? 135.911 109.921 40.889 1.00 244.27 ? 153 TRP A NE1    1 
ATOM 930  C CE2    . TRP A 1 61 ? 137.103 109.249 40.819 1.00 243.92 ? 153 TRP A CE2    1 
ATOM 931  C CE3    . TRP A 1 61 ? 138.318 107.915 39.211 1.00 230.60 ? 153 TRP A CE3    1 
ATOM 932  C CZ2    . TRP A 1 61 ? 138.113 109.108 41.770 1.00 234.00 ? 153 TRP A CZ2    1 
ATOM 933  C CZ3    . TRP A 1 61 ? 139.319 107.776 40.156 1.00 230.67 ? 153 TRP A CZ3    1 
ATOM 934  C CH2    . TRP A 1 61 ? 139.210 108.370 41.420 1.00 231.18 ? 153 TRP A CH2    1 
ATOM 935  H H      . TRP A 1 61 ? 134.053 110.382 36.808 1.00 220.40 ? 153 TRP A H      1 
ATOM 936  H HA     . TRP A 1 61 ? 136.636 110.223 36.676 1.00 235.24 ? 153 TRP A HA     1 
ATOM 937  H HB2    . TRP A 1 61 ? 134.674 108.392 37.435 1.00 219.37 ? 153 TRP A HB2    1 
ATOM 938  H HB3    . TRP A 1 61 ? 136.142 107.836 37.207 1.00 219.37 ? 153 TRP A HB3    1 
ATOM 939  H HD1    . TRP A 1 61 ? 134.413 110.140 39.501 1.00 282.77 ? 153 TRP A HD1    1 
ATOM 940  H HE1    . TRP A 1 61 ? 135.625 110.363 41.569 1.00 293.12 ? 153 TRP A HE1    1 
ATOM 941  H HE3    . TRP A 1 61 ? 138.398 107.518 38.373 1.00 276.72 ? 153 TRP A HE3    1 
ATOM 942  H HZ2    . TRP A 1 61 ? 138.043 109.501 42.610 1.00 280.80 ? 153 TRP A HZ2    1 
ATOM 943  H HZ3    . TRP A 1 61 ? 140.078 107.280 39.948 1.00 276.81 ? 153 TRP A HZ3    1 
ATOM 944  H HH2    . TRP A 1 61 ? 139.898 108.260 42.035 1.00 277.41 ? 153 TRP A HH2    1 
ATOM 945  N N      . GLN A 1 62 ? 137.207 109.616 34.380 1.00 230.90 ? 154 GLN A N      1 
ATOM 946  C CA     . GLN A 1 62 ? 137.662 109.113 33.088 1.00 219.11 ? 154 GLN A CA     1 
ATOM 947  C C      . GLN A 1 62 ? 139.185 109.135 33.006 1.00 220.58 ? 154 GLN A C      1 
ATOM 948  O O      . GLN A 1 62 ? 139.845 109.871 33.740 1.00 215.04 ? 154 GLN A O      1 
ATOM 949  C CB     . GLN A 1 62 ? 137.062 109.941 31.951 1.00 194.25 ? 154 GLN A CB     1 
ATOM 950  C CG     . GLN A 1 62 ? 137.491 111.403 31.953 1.00 196.12 ? 154 GLN A CG     1 
ATOM 951  C CD     . GLN A 1 62 ? 136.706 112.246 30.966 1.00 223.59 ? 154 GLN A CD     1 
ATOM 952  O OE1    . GLN A 1 62 ? 135.715 111.792 30.394 1.00 236.59 ? 154 GLN A OE1    1 
ATOM 953  N NE2    . GLN A 1 62 ? 137.147 113.482 30.761 1.00 224.57 ? 154 GLN A NE2    1 
ATOM 954  H H      . GLN A 1 62 ? 137.644 110.304 34.654 1.00 277.08 ? 154 GLN A H      1 
ATOM 955  H HA     . GLN A 1 62 ? 137.367 108.195 32.983 1.00 262.93 ? 154 GLN A HA     1 
ATOM 956  H HB2    . GLN A 1 62 ? 137.335 109.554 31.105 1.00 233.09 ? 154 GLN A HB2    1 
ATOM 957  H HB3    . GLN A 1 62 ? 136.095 109.917 32.025 1.00 233.09 ? 154 GLN A HB3    1 
ATOM 958  H HG2    . GLN A 1 62 ? 137.353 111.772 32.839 1.00 235.34 ? 154 GLN A HG2    1 
ATOM 959  H HG3    . GLN A 1 62 ? 138.430 111.457 31.714 1.00 235.34 ? 154 GLN A HG3    1 
ATOM 960  H HE21   . GLN A 1 62 ? 137.844 113.764 31.179 1.00 269.49 ? 154 GLN A HE21   1 
ATOM 961  H HE22   . GLN A 1 62 ? 136.737 114.000 30.211 1.00 269.49 ? 154 GLN A HE22   1 
ATOM 962  O "O5'"  . DG  B 2 1  ? 107.513 120.148 38.845 1.00 162.60 ? 1   DG  B "O5'"  1 
ATOM 963  C "C5'"  . DG  B 2 1  ? 106.762 119.013 39.260 1.00 163.54 ? 1   DG  B "C5'"  1 
ATOM 964  C "C4'"  . DG  B 2 1  ? 107.129 117.778 38.455 1.00 178.96 ? 1   DG  B "C4'"  1 
ATOM 965  O "O4'"  . DG  B 2 1  ? 106.762 117.971 37.067 1.00 212.06 ? 1   DG  B "O4'"  1 
ATOM 966  C "C3'"  . DG  B 2 1  ? 108.611 117.443 38.435 1.00 187.89 ? 1   DG  B "C3'"  1 
ATOM 967  O "O3'"  . DG  B 2 1  ? 108.915 116.555 39.500 1.00 200.09 ? 1   DG  B "O3'"  1 
ATOM 968  C "C2'"  . DG  B 2 1  ? 108.809 116.783 37.072 1.00 178.22 ? 1   DG  B "C2'"  1 
ATOM 969  C "C1'"  . DG  B 2 1  ? 107.714 117.390 36.197 1.00 205.36 ? 1   DG  B "C1'"  1 
ATOM 970  N N9     . DG  B 2 1  ? 108.185 118.416 35.267 1.00 214.30 ? 1   DG  B N9     1 
ATOM 971  C C8     . DG  B 2 1  ? 108.132 119.780 35.428 1.00 221.24 ? 1   DG  B C8     1 
ATOM 972  N N7     . DG  B 2 1  ? 108.629 120.444 34.422 1.00 199.78 ? 1   DG  B N7     1 
ATOM 973  C C5     . DG  B 2 1  ? 109.036 119.457 33.534 1.00 189.13 ? 1   DG  B C5     1 
ATOM 974  C C6     . DG  B 2 1  ? 109.648 119.572 32.264 1.00 207.90 ? 1   DG  B C6     1 
ATOM 975  O O6     . DG  B 2 1  ? 109.960 120.607 31.659 1.00 225.34 ? 1   DG  B O6     1 
ATOM 976  N N1     . DG  B 2 1  ? 109.895 118.322 31.696 1.00 198.57 ? 1   DG  B N1     1 
ATOM 977  C C2     . DG  B 2 1  ? 109.586 117.118 32.288 1.00 171.88 ? 1   DG  B C2     1 
ATOM 978  N N2     . DG  B 2 1  ? 109.897 116.014 31.595 1.00 154.95 ? 1   DG  B N2     1 
ATOM 979  N N3     . DG  B 2 1  ? 109.012 116.998 33.478 1.00 161.86 ? 1   DG  B N3     1 
ATOM 980  C C4     . DG  B 2 1  ? 108.767 118.205 34.039 1.00 183.34 ? 1   DG  B C4     1 
ATOM 981  H "H5'"  . DG  B 2 1  ? 105.817 119.198 39.143 1.00 196.24 ? 1   DG  B "H5'"  1 
ATOM 982  H "H5''" . DG  B 2 1  ? 106.938 118.842 40.199 1.00 196.24 ? 1   DG  B "H5''" 1 
ATOM 983  H "H4'"  . DG  B 2 1  ? 106.640 117.018 38.806 1.00 214.75 ? 1   DG  B "H4'"  1 
ATOM 984  H "H3'"  . DG  B 2 1  ? 109.142 118.251 38.502 1.00 225.47 ? 1   DG  B "H3'"  1 
ATOM 985  H "H2'"  . DG  B 2 1  ? 109.685 116.998 36.715 1.00 213.87 ? 1   DG  B "H2'"  1 
ATOM 986  H "H2''" . DG  B 2 1  ? 108.695 115.822 37.140 1.00 213.87 ? 1   DG  B "H2''" 1 
ATOM 987  H "H1'"  . DG  B 2 1  ? 107.287 116.680 35.693 1.00 246.43 ? 1   DG  B "H1'"  1 
ATOM 988  H H8     . DG  B 2 1  ? 107.778 120.190 36.184 1.00 265.49 ? 1   DG  B H8     1 
ATOM 989  H H1     . DG  B 2 1  ? 110.267 118.303 30.921 1.00 238.28 ? 1   DG  B H1     1 
ATOM 990  H H21    . DG  B 2 1  ? 109.723 115.238 31.922 1.00 185.94 ? 1   DG  B H21    1 
ATOM 991  H H22    . DG  B 2 1  ? 110.269 116.082 30.822 1.00 185.94 ? 1   DG  B H22    1 
ATOM 992  H "HO5'" . DG  B 2 1  ? 107.410 121.002 39.314 1.00 195.12 ? 1   DG  B "HO5'" 1 
ATOM 993  P P      . DG  B 2 2  ? 110.382 116.549 40.151 1.00 164.26 ? 2   DG  B P      1 
ATOM 994  O OP1    . DG  B 2 2  ? 110.289 115.789 41.417 1.00 158.02 ? 2   DG  B OP1    1 
ATOM 995  O OP2    . DG  B 2 2  ? 110.893 117.936 40.176 1.00 164.64 ? 2   DG  B OP2    1 
ATOM 996  O "O5'"  . DG  B 2 2  ? 111.249 115.708 39.105 1.00 82.15  ? 2   DG  B "O5'"  1 
ATOM 997  C "C5'"  . DG  B 2 2  ? 110.897 114.363 38.814 1.00 93.54  ? 2   DG  B "C5'"  1 
ATOM 998  C "C4'"  . DG  B 2 2  ? 111.822 113.816 37.748 1.00 129.68 ? 2   DG  B "C4'"  1 
ATOM 999  O "O4'"  . DG  B 2 2  ? 111.624 114.595 36.540 1.00 141.53 ? 2   DG  B "O4'"  1 
ATOM 1000 C "C3'"  . DG  B 2 2  ? 113.299 113.908 38.124 1.00 142.60 ? 2   DG  B "C3'"  1 
ATOM 1001 O "O3'"  . DG  B 2 2  ? 113.970 112.655 37.981 1.00 126.04 ? 2   DG  B "O3'"  1 
ATOM 1002 C "C2'"  . DG  B 2 2  ? 113.871 114.962 37.179 1.00 178.39 ? 2   DG  B "C2'"  1 
ATOM 1003 C "C1'"  . DG  B 2 2  ? 112.851 115.097 36.053 1.00 167.56 ? 2   DG  B "C1'"  1 
ATOM 1004 N N9     . DG  B 2 2  ? 112.686 116.487 35.626 1.00 174.82 ? 2   DG  B N9     1 
ATOM 1005 C C8     . DG  B 2 2  ? 112.294 117.559 36.393 1.00 182.32 ? 2   DG  B C8     1 
ATOM 1006 N N7     . DG  B 2 2  ? 112.243 118.684 35.735 1.00 179.51 ? 2   DG  B N7     1 
ATOM 1007 C C5     . DG  B 2 2  ? 112.626 118.337 34.446 1.00 178.31 ? 2   DG  B C5     1 
ATOM 1008 C C6     . DG  B 2 2  ? 112.760 119.141 33.290 1.00 183.28 ? 2   DG  B C6     1 
ATOM 1009 O O6     . DG  B 2 2  ? 112.557 120.358 33.176 1.00 187.23 ? 2   DG  B O6     1 
ATOM 1010 N N1     . DG  B 2 2  ? 113.174 118.389 32.189 1.00 175.16 ? 2   DG  B N1     1 
ATOM 1011 C C2     . DG  B 2 2  ? 113.426 117.035 32.212 1.00 146.49 ? 2   DG  B C2     1 
ATOM 1012 N N2     . DG  B 2 2  ? 113.818 116.474 31.058 1.00 117.06 ? 2   DG  B N2     1 
ATOM 1013 N N3     . DG  B 2 2  ? 113.304 116.274 33.290 1.00 147.71 ? 2   DG  B N3     1 
ATOM 1014 C C4     . DG  B 2 2  ? 112.903 116.990 34.365 1.00 166.04 ? 2   DG  B C4     1 
ATOM 1015 H "H5'"  . DG  B 2 2  ? 109.982 114.331 38.495 1.00 112.25 ? 2   DG  B "H5'"  1 
ATOM 1016 H "H5''" . DG  B 2 2  ? 110.978 113.827 39.618 1.00 112.25 ? 2   DG  B "H5''" 1 
ATOM 1017 H "H4'"  . DG  B 2 2  ? 111.594 112.889 37.571 1.00 155.62 ? 2   DG  B "H4'"  1 
ATOM 1018 H "H3'"  . DG  B 2 2  ? 113.380 114.216 39.040 1.00 171.13 ? 2   DG  B "H3'"  1 
ATOM 1019 H "H2'"  . DG  B 2 2  ? 113.974 115.808 37.642 1.00 214.07 ? 2   DG  B "H2'"  1 
ATOM 1020 H "H2''" . DG  B 2 2  ? 114.725 114.666 36.825 1.00 214.07 ? 2   DG  B "H2''" 1 
ATOM 1021 H "H1'"  . DG  B 2 2  ? 113.137 114.562 35.297 1.00 201.08 ? 2   DG  B "H1'"  1 
ATOM 1022 H H8     . DG  B 2 2  ? 112.085 117.489 37.297 1.00 218.78 ? 2   DG  B H8     1 
ATOM 1023 H H1     . DG  B 2 2  ? 113.280 118.802 31.442 1.00 210.19 ? 2   DG  B H1     1 
ATOM 1024 H H21    . DG  B 2 2  ? 113.986 115.631 31.025 1.00 140.47 ? 2   DG  B H21    1 
ATOM 1025 H H22    . DG  B 2 2  ? 113.901 116.957 30.351 1.00 140.47 ? 2   DG  B H22    1 
ATOM 1026 P P      . DC  B 2 3  ? 115.508 112.511 38.428 1.00 146.72 ? 3   DC  B P      1 
ATOM 1027 O OP1    . DC  B 2 3  ? 115.746 111.097 38.798 1.00 147.33 ? 3   DC  B OP1    1 
ATOM 1028 O OP2    . DC  B 2 3  ? 115.792 113.586 39.405 1.00 156.85 ? 3   DC  B OP2    1 
ATOM 1029 O "O5'"  . DC  B 2 3  ? 116.333 112.845 37.101 1.00 106.25 ? 3   DC  B "O5'"  1 
ATOM 1030 C "C5'"  . DC  B 2 3  ? 116.127 112.069 35.929 1.00 109.70 ? 3   DC  B "C5'"  1 
ATOM 1031 C "C4'"  . DC  B 2 3  ? 116.799 112.700 34.726 1.00 104.91 ? 3   DC  B "C4'"  1 
ATOM 1032 O "O4'"  . DC  B 2 3  ? 116.158 113.972 34.463 1.00 126.99 ? 3   DC  B "O4'"  1 
ATOM 1033 C "C3'"  . DC  B 2 3  ? 118.286 112.993 34.909 1.00 100.08 ? 3   DC  B "C3'"  1 
ATOM 1034 O "O3'"  . DC  B 2 3  ? 119.067 112.193 34.020 1.00 96.94  ? 3   DC  B "O3'"  1 
ATOM 1035 C "C2'"  . DC  B 2 3  ? 118.431 114.486 34.609 1.00 123.19 ? 3   DC  B "C2'"  1 
ATOM 1036 C "C1'"  . DC  B 2 3  ? 117.110 114.884 33.962 1.00 100.07 ? 3   DC  B "C1'"  1 
ATOM 1037 N N1     . DC  B 2 3  ? 116.667 116.281 34.283 1.00 118.49 ? 3   DC  B N1     1 
ATOM 1038 C C2     . DC  B 2 3  ? 116.744 117.291 33.316 1.00 137.91 ? 3   DC  B C2     1 
ATOM 1039 O O2     . DC  B 2 3  ? 117.169 117.020 32.185 1.00 92.45  ? 3   DC  B O2     1 
ATOM 1040 N N3     . DC  B 2 3  ? 116.337 118.545 33.642 1.00 169.92 ? 3   DC  B N3     1 
ATOM 1041 C C4     . DC  B 2 3  ? 115.882 118.810 34.868 1.00 156.19 ? 3   DC  B C4     1 
ATOM 1042 N N4     . DC  B 2 3  ? 115.495 120.061 35.142 1.00 166.55 ? 3   DC  B N4     1 
ATOM 1043 C C5     . DC  B 2 3  ? 115.803 117.797 35.868 1.00 137.75 ? 3   DC  B C5     1 
ATOM 1044 C C6     . DC  B 2 3  ? 116.204 116.565 35.535 1.00 133.33 ? 3   DC  B C6     1 
ATOM 1045 H "H5'"  . DC  B 2 3  ? 115.174 111.996 35.760 1.00 131.63 ? 3   DC  B "H5'"  1 
ATOM 1046 H "H5''" . DC  B 2 3  ? 116.493 111.181 36.068 1.00 131.63 ? 3   DC  B "H5''" 1 
ATOM 1047 H "H4'"  . DC  B 2 3  ? 116.682 112.121 33.956 1.00 125.89 ? 3   DC  B "H4'"  1 
ATOM 1048 H "H3'"  . DC  B 2 3  ? 118.545 112.815 35.826 1.00 120.10 ? 3   DC  B "H3'"  1 
ATOM 1049 H "H2'"  . DC  B 2 3  ? 118.568 114.983 35.431 1.00 147.83 ? 3   DC  B "H2'"  1 
ATOM 1050 H "H2''" . DC  B 2 3  ? 119.167 114.637 33.995 1.00 147.83 ? 3   DC  B "H2''" 1 
ATOM 1051 H "H1'"  . DC  B 2 3  ? 117.179 114.781 32.999 1.00 120.08 ? 3   DC  B "H1'"  1 
ATOM 1052 H H41    . DC  B 2 3  ? 115.197 120.258 35.925 1.00 199.86 ? 3   DC  B H41    1 
ATOM 1053 H H42    . DC  B 2 3  ? 115.543 120.669 34.536 1.00 199.86 ? 3   DC  B H42    1 
ATOM 1054 H H5     . DC  B 2 3  ? 115.484 117.986 36.720 1.00 165.30 ? 3   DC  B H5     1 
ATOM 1055 H H6     . DC  B 2 3  ? 116.161 115.887 36.169 1.00 159.99 ? 3   DC  B H6     1 
ATOM 1056 P P      . DC  B 2 4  ? 120.669 112.158 34.155 1.00 136.63 ? 4   DC  B P      1 
ATOM 1057 O OP1    . DC  B 2 4  ? 121.138 110.925 33.487 1.00 123.84 ? 4   DC  B OP1    1 
ATOM 1058 O OP2    . DC  B 2 4  ? 121.009 112.408 35.574 1.00 148.04 ? 4   DC  B OP2    1 
ATOM 1059 O "O5'"  . DC  B 2 4  ? 121.170 113.408 33.290 1.00 104.33 ? 4   DC  B "O5'"  1 
ATOM 1060 C "C5'"  . DC  B 2 4  ? 120.998 113.389 31.877 1.00 137.71 ? 4   DC  B "C5'"  1 
ATOM 1061 C "C4'"  . DC  B 2 4  ? 121.430 114.694 31.234 1.00 153.14 ? 4   DC  B "C4'"  1 
ATOM 1062 O "O4'"  . DC  B 2 4  ? 120.568 115.763 31.699 1.00 148.18 ? 4   DC  B "O4'"  1 
ATOM 1063 C "C3'"  . DC  B 2 4  ? 122.862 115.120 31.551 1.00 76.41  ? 4   DC  B "C3'"  1 
ATOM 1064 O "O3'"  . DC  B 2 4  ? 123.640 115.219 30.359 1.00 114.76 ? 4   DC  B "O3'"  1 
ATOM 1065 C "C2'"  . DC  B 2 4  ? 122.710 116.464 32.260 1.00 86.07  ? 4   DC  B "C2'"  1 
ATOM 1066 C "C1'"  . DC  B 2 4  ? 121.333 116.939 31.836 1.00 129.16 ? 4   DC  B "C1'"  1 
ATOM 1067 N N1     . DC  B 2 4  ? 120.681 117.817 32.849 1.00 116.91 ? 4   DC  B N1     1 
ATOM 1068 C C2     . DC  B 2 4  ? 120.607 119.200 32.650 1.00 144.48 ? 4   DC  B C2     1 
ATOM 1069 O O2     . DC  B 2 4  ? 121.080 119.696 31.621 1.00 157.59 ? 4   DC  B O2     1 
ATOM 1070 N N3     . DC  B 2 4  ? 120.007 119.962 33.598 1.00 155.64 ? 4   DC  B N3     1 
ATOM 1071 C C4     . DC  B 2 4  ? 119.504 119.397 34.699 1.00 145.59 ? 4   DC  B C4     1 
ATOM 1072 N N4     . DC  B 2 4  ? 118.920 120.190 35.605 1.00 162.95 ? 4   DC  B N4     1 
ATOM 1073 C C5     . DC  B 2 4  ? 119.576 117.992 34.921 1.00 103.27 ? 4   DC  B C5     1 
ATOM 1074 C C6     . DC  B 2 4  ? 120.169 117.252 33.979 1.00 108.07 ? 4   DC  B C6     1 
ATOM 1075 H "H5'"  . DC  B 2 4  ? 120.063 113.232 31.675 1.00 165.25 ? 4   DC  B "H5'"  1 
ATOM 1076 H "H5''" . DC  B 2 4  ? 121.526 112.665 31.505 1.00 165.25 ? 4   DC  B "H5''" 1 
ATOM 1077 H "H4'"  . DC  B 2 4  ? 121.335 114.613 30.272 1.00 183.77 ? 4   DC  B "H4'"  1 
ATOM 1078 H "H3'"  . DC  B 2 4  ? 123.268 114.478 32.153 1.00 91.70  ? 4   DC  B "H3'"  1 
ATOM 1079 H "H2'"  . DC  B 2 4  ? 122.749 116.348 33.222 1.00 103.28 ? 4   DC  B "H2'"  1 
ATOM 1080 H "H2''" . DC  B 2 4  ? 123.392 117.086 31.962 1.00 103.28 ? 4   DC  B "H2''" 1 
ATOM 1081 H "H1'"  . DC  B 2 4  ? 121.389 117.399 30.983 1.00 154.99 ? 4   DC  B "H1'"  1 
ATOM 1082 H H41    . DC  B 2 4  ? 118.589 119.852 36.323 1.00 195.54 ? 4   DC  B H41    1 
ATOM 1083 H H42    . DC  B 2 4  ? 118.877 121.039 35.470 1.00 195.54 ? 4   DC  B H42    1 
ATOM 1084 H H5     . DC  B 2 4  ? 119.222 117.604 35.689 1.00 123.93 ? 4   DC  B H5     1 
ATOM 1085 H H6     . DC  B 2 4  ? 120.229 116.331 34.095 1.00 129.68 ? 4   DC  B H6     1 
ATOM 1086 P P      . DC  B 2 5  ? 125.239 115.362 30.441 1.00 147.42 ? 5   DC  B P      1 
ATOM 1087 O OP1    . DC  B 2 5  ? 125.799 114.975 29.129 1.00 144.14 ? 5   DC  B OP1    1 
ATOM 1088 O OP2    . DC  B 2 5  ? 125.701 114.660 31.659 1.00 198.95 ? 5   DC  B OP2    1 
ATOM 1089 O "O5'"  . DC  B 2 5  ? 125.471 116.925 30.670 1.00 127.15 ? 5   DC  B "O5'"  1 
ATOM 1090 C "C5'"  . DC  B 2 5  ? 125.103 117.859 29.668 1.00 181.69 ? 5   DC  B "C5'"  1 
ATOM 1091 C "C4'"  . DC  B 2 5  ? 125.314 119.274 30.171 1.00 198.28 ? 5   DC  B "C4'"  1 
ATOM 1092 O "O4'"  . DC  B 2 5  ? 124.302 119.587 31.155 1.00 180.65 ? 5   DC  B "O4'"  1 
ATOM 1093 C "C3'"  . DC  B 2 5  ? 126.649 119.533 30.865 1.00 189.62 ? 5   DC  B "C3'"  1 
ATOM 1094 O "O3'"  . DC  B 2 5  ? 127.513 120.256 30.002 1.00 181.68 ? 5   DC  B "O3'"  1 
ATOM 1095 C "C2'"  . DC  B 2 5  ? 126.295 120.337 32.115 1.00 180.21 ? 5   DC  B "C2'"  1 
ATOM 1096 C "C1'"  . DC  B 2 5  ? 124.810 120.630 31.955 1.00 167.24 ? 5   DC  B "C1'"  1 
ATOM 1097 N N1     . DC  B 2 5  ? 124.052 120.659 33.236 1.00 157.37 ? 5   DC  B N1     1 
ATOM 1098 C C2     . DC  B 2 5  ? 123.642 121.877 33.789 1.00 201.98 ? 5   DC  B C2     1 
ATOM 1099 O O2     . DC  B 2 5  ? 123.922 122.935 33.212 1.00 238.84 ? 5   DC  B O2     1 
ATOM 1100 N N3     . DC  B 2 5  ? 122.952 121.867 34.956 1.00 193.68 ? 5   DC  B N3     1 
ATOM 1101 C C4     . DC  B 2 5  ? 122.667 120.711 35.556 1.00 154.47 ? 5   DC  B C4     1 
ATOM 1102 N N4     . DC  B 2 5  ? 121.983 120.746 36.705 1.00 136.57 ? 5   DC  B N4     1 
ATOM 1103 C C5     . DC  B 2 5  ? 123.071 119.463 35.005 1.00 143.35 ? 5   DC  B C5     1 
ATOM 1104 C C6     . DC  B 2 5  ? 123.754 119.483 33.856 1.00 149.87 ? 5   DC  B C6     1 
ATOM 1105 H "H5'"  . DC  B 2 5  ? 124.169 117.735 29.441 1.00 218.02 ? 5   DC  B "H5'"  1 
ATOM 1106 H "H5''" . DC  B 2 5  ? 125.648 117.714 28.879 1.00 218.02 ? 5   DC  B "H5''" 1 
ATOM 1107 H "H4'"  . DC  B 2 5  ? 125.225 119.887 29.425 1.00 237.93 ? 5   DC  B "H4'"  1 
ATOM 1108 H "H3'"  . DC  B 2 5  ? 127.060 118.691 31.117 1.00 227.54 ? 5   DC  B "H3'"  1 
ATOM 1109 H "H2'"  . DC  B 2 5  ? 126.453 119.811 32.914 1.00 216.25 ? 5   DC  B "H2'"  1 
ATOM 1110 H "H2''" . DC  B 2 5  ? 126.803 121.163 32.143 1.00 216.25 ? 5   DC  B "H2''" 1 
ATOM 1111 H "H1'"  . DC  B 2 5  ? 124.695 121.476 31.493 1.00 200.69 ? 5   DC  B "H1'"  1 
ATOM 1112 H H41    . DC  B 2 5  ? 121.787 120.014 37.111 1.00 163.88 ? 5   DC  B H41    1 
ATOM 1113 H H42    . DC  B 2 5  ? 121.739 121.501 37.038 1.00 163.88 ? 5   DC  B H42    1 
ATOM 1114 H H5     . DC  B 2 5  ? 122.870 118.661 35.430 1.00 172.02 ? 5   DC  B H5     1 
ATOM 1115 H H6     . DC  B 2 5  ? 124.031 118.682 33.474 1.00 179.84 ? 5   DC  B H6     1 
ATOM 1116 P P      . DA  B 2 6  ? 128.992 120.653 30.486 1.00 186.18 ? 6   DA  B P      1 
ATOM 1117 O OP1    . DA  B 2 6  ? 129.881 120.607 29.304 1.00 210.79 ? 6   DA  B OP1    1 
ATOM 1118 O OP2    . DA  B 2 6  ? 129.315 119.838 31.678 1.00 179.77 ? 6   DA  B OP2    1 
ATOM 1119 O "O5'"  . DA  B 2 6  ? 128.838 122.172 30.957 1.00 180.58 ? 6   DA  B "O5'"  1 
ATOM 1120 C "C5'"  . DA  B 2 6  ? 128.268 123.134 30.083 1.00 208.24 ? 6   DA  B "C5'"  1 
ATOM 1121 C "C4'"  . DA  B 2 6  ? 127.893 124.385 30.851 1.00 222.27 ? 6   DA  B "C4'"  1 
ATOM 1122 O "O4'"  . DA  B 2 6  ? 126.958 124.042 31.907 1.00 217.35 ? 6   DA  B "O4'"  1 
ATOM 1123 C "C3'"  . DA  B 2 6  ? 129.081 125.069 31.516 1.00 231.68 ? 6   DA  B "C3'"  1 
ATOM 1124 O "O3'"  . DA  B 2 6  ? 129.050 126.464 31.251 1.00 245.52 ? 6   DA  B "O3'"  1 
ATOM 1125 C "C2'"  . DA  B 2 6  ? 128.907 124.743 32.997 1.00 224.01 ? 6   DA  B "C2'"  1 
ATOM 1126 C "C1'"  . DA  B 2 6  ? 127.399 124.582 33.136 1.00 209.42 ? 6   DA  B "C1'"  1 
ATOM 1127 N N9     . DA  B 2 6  ? 126.990 123.691 34.221 1.00 191.41 ? 6   DA  B N9     1 
ATOM 1128 C C8     . DA  B 2 6  ? 127.442 122.425 34.465 1.00 183.88 ? 6   DA  B C8     1 
ATOM 1129 N N7     . DA  B 2 6  ? 126.897 121.857 35.514 1.00 170.81 ? 6   DA  B N7     1 
ATOM 1130 C C5     . DA  B 2 6  ? 126.029 122.820 35.996 1.00 172.05 ? 6   DA  B C5     1 
ATOM 1131 C C6     . DA  B 2 6  ? 125.150 122.835 37.096 1.00 174.86 ? 6   DA  B C6     1 
ATOM 1132 N N6     . DA  B 2 6  ? 125.007 121.805 37.936 1.00 182.43 ? 6   DA  B N6     1 
ATOM 1133 N N1     . DA  B 2 6  ? 124.424 123.953 37.299 1.00 187.48 ? 6   DA  B N1     1 
ATOM 1134 C C2     . DA  B 2 6  ? 124.572 124.980 36.453 1.00 222.53 ? 6   DA  B C2     1 
ATOM 1135 N N3     . DA  B 2 6  ? 125.365 125.082 35.387 1.00 223.16 ? 6   DA  B N3     1 
ATOM 1136 C C4     . DA  B 2 6  ? 126.074 123.957 35.212 1.00 194.90 ? 6   DA  B C4     1 
ATOM 1137 H "H5'"  . DA  B 2 6  ? 127.474 122.761 29.669 1.00 249.88 ? 6   DA  B "H5'"  1 
ATOM 1138 H "H5''" . DA  B 2 6  ? 128.912 123.362 29.394 1.00 249.88 ? 6   DA  B "H5''" 1 
ATOM 1139 H "H4'"  . DA  B 2 6  ? 127.468 125.011 30.244 1.00 266.72 ? 6   DA  B "H4'"  1 
ATOM 1140 H "H3'"  . DA  B 2 6  ? 129.909 124.686 31.187 1.00 278.02 ? 6   DA  B "H3'"  1 
ATOM 1141 H "H2'"  . DA  B 2 6  ? 129.362 123.917 33.223 1.00 268.81 ? 6   DA  B "H2'"  1 
ATOM 1142 H "H2''" . DA  B 2 6  ? 129.226 125.475 33.549 1.00 268.81 ? 6   DA  B "H2''" 1 
ATOM 1143 H "H1'"  . DA  B 2 6  ? 126.994 125.454 33.267 1.00 251.30 ? 6   DA  B "H1'"  1 
ATOM 1144 H H8     . DA  B 2 6  ? 128.077 122.002 33.932 1.00 220.65 ? 6   DA  B H8     1 
ATOM 1145 H H61    . DA  B 2 6  ? 124.458 121.861 38.595 1.00 218.92 ? 6   DA  B H61    1 
ATOM 1146 H H62    . DA  B 2 6  ? 125.465 121.087 37.817 1.00 218.92 ? 6   DA  B H62    1 
ATOM 1147 H H2     . DA  B 2 6  ? 124.050 125.727 36.636 1.00 267.03 ? 6   DA  B H2     1 
ATOM 1148 P P      . DT  B 2 7  ? 130.215 127.419 31.807 1.00 227.05 ? 7   DT  B P      1 
ATOM 1149 O OP1    . DT  B 2 7  ? 130.341 128.564 30.878 1.00 254.42 ? 7   DT  B OP1    1 
ATOM 1150 O OP2    . DT  B 2 7  ? 131.394 126.571 32.092 1.00 229.61 ? 7   DT  B OP2    1 
ATOM 1151 O "O5'"  . DT  B 2 7  ? 129.645 127.945 33.204 1.00 226.37 ? 7   DT  B "O5'"  1 
ATOM 1152 C "C5'"  . DT  B 2 7  ? 128.369 128.571 33.246 1.00 246.19 ? 7   DT  B "C5'"  1 
ATOM 1153 C "C4'"  . DT  B 2 7  ? 127.877 128.719 34.673 1.00 255.64 ? 7   DT  B "C4'"  1 
ATOM 1154 O "O4'"  . DT  B 2 7  ? 127.598 127.423 35.256 1.00 251.91 ? 7   DT  B "O4'"  1 
ATOM 1155 C "C3'"  . DT  B 2 7  ? 128.879 129.393 35.607 1.00 253.48 ? 7   DT  B "C3'"  1 
ATOM 1156 O "O3'"  . DT  B 2 7  ? 128.440 130.702 35.927 1.00 261.47 ? 7   DT  B "O3'"  1 
ATOM 1157 C "C2'"  . DT  B 2 7  ? 128.927 128.494 36.843 1.00 241.13 ? 7   DT  B "C2'"  1 
ATOM 1158 C "C1'"  . DT  B 2 7  ? 127.750 127.545 36.653 1.00 239.85 ? 7   DT  B "C1'"  1 
ATOM 1159 N N1     . DT  B 2 7  ? 127.950 126.193 37.258 1.00 225.65 ? 7   DT  B N1     1 
ATOM 1160 C C2     . DT  B 2 7  ? 127.168 125.791 38.322 1.00 212.26 ? 7   DT  B C2     1 
ATOM 1161 O O2     . DT  B 2 7  ? 126.296 126.479 38.824 1.00 207.75 ? 7   DT  B O2     1 
ATOM 1162 N N3     . DT  B 2 7  ? 127.445 124.532 38.790 1.00 190.11 ? 7   DT  B N3     1 
ATOM 1163 C C4     . DT  B 2 7  ? 128.401 123.655 38.313 1.00 181.03 ? 7   DT  B C4     1 
ATOM 1164 O O4     . DT  B 2 7  ? 128.567 122.545 38.807 1.00 173.68 ? 7   DT  B O4     1 
ATOM 1165 C C5     . DT  B 2 7  ? 129.181 124.139 37.200 1.00 192.63 ? 7   DT  B C5     1 
ATOM 1166 C C7     . DT  B 2 7  ? 130.254 123.287 36.587 1.00 193.84 ? 7   DT  B C7     1 
ATOM 1167 C C6     . DT  B 2 7  ? 128.921 125.366 36.734 1.00 216.25 ? 7   DT  B C6     1 
ATOM 1168 H "H5'"  . DT  B 2 7  ? 127.735 128.034 32.746 1.00 295.43 ? 7   DT  B "H5'"  1 
ATOM 1169 H "H5''" . DT  B 2 7  ? 128.433 129.449 32.839 1.00 295.43 ? 7   DT  B "H5''" 1 
ATOM 1170 H "H4'"  . DT  B 2 7  ? 127.058 129.240 34.667 1.00 306.77 ? 7   DT  B "H4'"  1 
ATOM 1171 H "H3'"  . DT  B 2 7  ? 129.752 129.427 35.186 1.00 304.18 ? 7   DT  B "H3'"  1 
ATOM 1172 H "H2'"  . DT  B 2 7  ? 129.761 128.000 36.872 1.00 289.35 ? 7   DT  B "H2'"  1 
ATOM 1173 H "H2''" . DT  B 2 7  ? 128.813 129.020 37.650 1.00 289.35 ? 7   DT  B "H2''" 1 
ATOM 1174 H "H1'"  . DT  B 2 7  ? 126.951 127.948 37.027 1.00 287.82 ? 7   DT  B "H1'"  1 
ATOM 1175 H H3     . DT  B 2 7  ? 126.971 124.258 39.453 1.00 228.13 ? 7   DT  B H3     1 
ATOM 1176 H H71    . DT  B 2 7  ? 130.048 123.133 35.652 1.00 232.60 ? 7   DT  B H71    1 
ATOM 1177 H H72    . DT  B 2 7  ? 131.108 123.740 36.660 1.00 232.60 ? 7   DT  B H72    1 
ATOM 1178 H H73    . DT  B 2 7  ? 130.298 122.437 37.053 1.00 232.60 ? 7   DT  B H73    1 
ATOM 1179 H H6     . DT  B 2 7  ? 129.424 125.679 36.017 1.00 259.49 ? 7   DT  B H6     1 
ATOM 1180 P P      . DT  B 2 8  ? 129.364 131.671 36.814 1.00 242.78 ? 8   DT  B P      1 
ATOM 1181 O OP1    . DT  B 2 8  ? 129.155 133.056 36.337 1.00 286.12 ? 8   DT  B OP1    1 
ATOM 1182 O OP2    . DT  B 2 8  ? 130.728 131.098 36.836 1.00 241.15 ? 8   DT  B OP2    1 
ATOM 1183 O "O5'"  . DT  B 2 8  ? 128.751 131.530 38.282 1.00 221.23 ? 8   DT  B "O5'"  1 
ATOM 1184 C "C5'"  . DT  B 2 8  ? 127.374 131.807 38.493 1.00 234.65 ? 8   DT  B "C5'"  1 
ATOM 1185 C "C4'"  . DT  B 2 8  ? 126.937 131.328 39.863 1.00 240.49 ? 8   DT  B "C4'"  1 
ATOM 1186 O "O4'"  . DT  B 2 8  ? 127.178 129.903 39.965 1.00 240.54 ? 8   DT  B "O4'"  1 
ATOM 1187 C "C3'"  . DT  B 2 8  ? 127.681 131.970 41.029 1.00 231.60 ? 8   DT  B "C3'"  1 
ATOM 1188 O "O3'"  . DT  B 2 8  ? 126.776 132.782 41.770 1.00 237.18 ? 8   DT  B "O3'"  1 
ATOM 1189 C "C2'"  . DT  B 2 8  ? 128.233 130.803 41.847 1.00 214.41 ? 8   DT  B "C2'"  1 
ATOM 1190 C "C1'"  . DT  B 2 8  ? 127.505 129.583 41.299 1.00 218.27 ? 8   DT  B "C1'"  1 
ATOM 1191 N N1     . DT  B 2 8  ? 128.327 128.334 41.299 1.00 200.65 ? 8   DT  B N1     1 
ATOM 1192 C C2     . DT  B 2 8  ? 127.997 127.285 42.133 1.00 190.36 ? 8   DT  B C2     1 
ATOM 1193 O O2     . DT  B 2 8  ? 127.052 127.299 42.902 1.00 174.62 ? 8   DT  B O2     1 
ATOM 1194 N N3     . DT  B 2 8  ? 128.827 126.197 42.036 1.00 184.37 ? 8   DT  B N3     1 
ATOM 1195 C C4     . DT  B 2 8  ? 129.926 126.054 41.210 1.00 173.94 ? 8   DT  B C4     1 
ATOM 1196 O O4     . DT  B 2 8  ? 130.604 125.031 41.202 1.00 143.56 ? 8   DT  B O4     1 
ATOM 1197 C C5     . DT  B 2 8  ? 130.214 127.187 40.364 1.00 185.22 ? 8   DT  B C5     1 
ATOM 1198 C C7     . DT  B 2 8  ? 131.381 127.160 39.420 1.00 179.04 ? 8   DT  B C7     1 
ATOM 1199 C C6     . DT  B 2 8  ? 129.411 128.255 40.448 1.00 192.96 ? 8   DT  B C6     1 
ATOM 1200 H "H5'"  . DT  B 2 8  ? 126.850 131.354 37.814 1.00 281.58 ? 8   DT  B "H5'"  1 
ATOM 1201 H "H5''" . DT  B 2 8  ? 127.226 132.763 38.426 1.00 281.58 ? 8   DT  B "H5''" 1 
ATOM 1202 H "H4'"  . DT  B 2 8  ? 125.987 131.495 39.966 1.00 288.59 ? 8   DT  B "H4'"  1 
ATOM 1203 H "H3'"  . DT  B 2 8  ? 128.412 132.512 40.693 1.00 277.92 ? 8   DT  B "H3'"  1 
ATOM 1204 H "H2'"  . DT  B 2 8  ? 129.189 130.717 41.711 1.00 257.30 ? 8   DT  B "H2'"  1 
ATOM 1205 H "H2''" . DT  B 2 8  ? 128.032 130.924 42.788 1.00 257.30 ? 8   DT  B "H2''" 1 
ATOM 1206 H "H1'"  . DT  B 2 8  ? 126.691 129.436 41.806 1.00 261.92 ? 8   DT  B "H1'"  1 
ATOM 1207 H H3     . DT  B 2 8  ? 128.643 125.530 42.546 1.00 221.24 ? 8   DT  B H3     1 
ATOM 1208 H H71    . DT  B 2 8  ? 131.992 127.880 39.641 1.00 214.85 ? 8   DT  B H71    1 
ATOM 1209 H H72    . DT  B 2 8  ? 131.842 126.310 39.500 1.00 214.85 ? 8   DT  B H72    1 
ATOM 1210 H H73    . DT  B 2 8  ? 131.064 127.272 38.510 1.00 214.85 ? 8   DT  B H73    1 
ATOM 1211 H H6     . DT  B 2 8  ? 129.596 128.986 39.904 1.00 231.55 ? 8   DT  B H6     1 
ATOM 1212 P P      . DC  B 2 9  ? 127.326 133.887 42.798 1.00 251.04 ? 9   DC  B P      1 
ATOM 1213 O OP1    . DC  B 2 9  ? 126.227 134.841 43.063 1.00 261.54 ? 9   DC  B OP1    1 
ATOM 1214 O OP2    . DC  B 2 9  ? 128.627 134.383 42.296 1.00 276.61 ? 9   DC  B OP2    1 
ATOM 1215 O "O5'"  . DC  B 2 9  ? 127.607 133.053 44.128 1.00 225.84 ? 9   DC  B "O5'"  1 
ATOM 1216 C "C5'"  . DC  B 2 9  ? 126.524 132.457 44.828 1.00 228.04 ? 9   DC  B "C5'"  1 
ATOM 1217 C "C4'"  . DC  B 2 9  ? 127.062 131.533 45.898 1.00 225.00 ? 9   DC  B "C4'"  1 
ATOM 1218 O "O4'"  . DC  B 2 9  ? 127.771 130.422 45.289 1.00 219.20 ? 9   DC  B "O4'"  1 
ATOM 1219 C "C3'"  . DC  B 2 9  ? 128.048 132.217 46.837 1.00 231.71 ? 9   DC  B "C3'"  1 
ATOM 1220 O "O3'"  . DC  B 2 9  ? 127.688 131.987 48.185 1.00 234.66 ? 9   DC  B "O3'"  1 
ATOM 1221 C "C2'"  . DC  B 2 9  ? 129.386 131.574 46.489 1.00 227.61 ? 9   DC  B "C2'"  1 
ATOM 1222 C "C1'"  . DC  B 2 9  ? 128.964 130.191 46.008 1.00 206.64 ? 9   DC  B "C1'"  1 
ATOM 1223 N N1     . DC  B 2 9  ? 129.959 129.496 45.128 1.00 182.09 ? 9   DC  B N1     1 
ATOM 1224 C C2     . DC  B 2 9  ? 130.320 128.163 45.377 1.00 180.48 ? 9   DC  B C2     1 
ATOM 1225 O O2     . DC  B 2 9  ? 129.811 127.553 46.325 1.00 186.40 ? 9   DC  B O2     1 
ATOM 1226 N N3     . DC  B 2 9  ? 131.223 127.561 44.565 1.00 168.73 ? 9   DC  B N3     1 
ATOM 1227 C C4     . DC  B 2 9  ? 131.761 128.233 43.547 1.00 174.28 ? 9   DC  B C4     1 
ATOM 1228 N N4     . DC  B 2 9  ? 132.650 127.598 42.776 1.00 161.24 ? 9   DC  B N4     1 
ATOM 1229 C C5     . DC  B 2 9  ? 131.411 129.589 43.278 1.00 178.90 ? 9   DC  B C5     1 
ATOM 1230 C C6     . DC  B 2 9  ? 130.518 130.171 44.083 1.00 175.74 ? 9   DC  B C6     1 
ATOM 1231 H "H5'"  . DC  B 2 9  ? 125.978 131.950 44.207 1.00 273.65 ? 9   DC  B "H5'"  1 
ATOM 1232 H "H5''" . DC  B 2 9  ? 125.986 133.151 45.240 1.00 273.65 ? 9   DC  B "H5''" 1 
ATOM 1233 H "H4'"  . DC  B 2 9  ? 126.320 131.186 46.417 1.00 269.99 ? 9   DC  B "H4'"  1 
ATOM 1234 H "H3'"  . DC  B 2 9  ? 128.076 133.170 46.655 1.00 278.05 ? 9   DC  B "H3'"  1 
ATOM 1235 H "H2'"  . DC  B 2 9  ? 129.831 132.065 45.781 1.00 273.13 ? 9   DC  B "H2'"  1 
ATOM 1236 H "H2''" . DC  B 2 9  ? 129.951 131.508 47.275 1.00 273.13 ? 9   DC  B "H2''" 1 
ATOM 1237 H "H1'"  . DC  B 2 9  ? 128.770 129.631 46.776 1.00 247.97 ? 9   DC  B "H1'"  1 
ATOM 1238 H H41    . DC  B 2 9  ? 133.013 128.007 42.112 1.00 193.49 ? 9   DC  B H41    1 
ATOM 1239 H H42    . DC  B 2 9  ? 132.858 126.781 42.943 1.00 193.49 ? 9   DC  B H42    1 
ATOM 1240 H H5     . DC  B 2 9  ? 131.791 130.051 42.566 1.00 214.67 ? 9   DC  B H5     1 
ATOM 1241 H H6     . DC  B 2 9  ? 130.273 131.055 43.929 1.00 210.88 ? 9   DC  B H6     1 
ATOM 1242 P P      . DA  B 2 10 ? 128.054 133.067 49.314 1.00 264.72 ? 10  DA  B P      1 
ATOM 1243 O OP1    . DA  B 2 10 ? 126.886 133.960 49.482 1.00 275.01 ? 10  DA  B OP1    1 
ATOM 1244 O OP2    . DA  B 2 10 ? 129.378 133.638 48.978 1.00 274.69 ? 10  DA  B OP2    1 
ATOM 1245 O "O5'"  . DA  B 2 10 ? 128.225 132.183 50.632 1.00 233.54 ? 10  DA  B "O5'"  1 
ATOM 1246 C "C5'"  . DA  B 2 10 ? 127.149 131.356 51.048 1.00 246.17 ? 10  DA  B "C5'"  1 
ATOM 1247 C "C4'"  . DA  B 2 10 ? 127.670 130.038 51.584 1.00 248.81 ? 10  DA  B "C4'"  1 
ATOM 1248 O "O4'"  . DA  B 2 10 ? 128.448 129.378 50.549 1.00 245.22 ? 10  DA  B "O4'"  1 
ATOM 1249 C "C3'"  . DA  B 2 10 ? 128.594 130.177 52.786 1.00 244.73 ? 10  DA  B "C3'"  1 
ATOM 1250 O "O3'"  . DA  B 2 10 ? 128.311 129.168 53.743 1.00 243.27 ? 10  DA  B "O3'"  1 
ATOM 1251 C "C2'"  . DA  B 2 10 ? 129.985 130.030 52.178 1.00 234.99 ? 10  DA  B "C2'"  1 
ATOM 1252 C "C1'"  . DA  B 2 10 ? 129.729 129.045 51.047 1.00 228.59 ? 10  DA  B "C1'"  1 
ATOM 1253 N N9     . DA  B 2 10 ? 130.695 129.120 49.954 1.00 211.07 ? 10  DA  B N9     1 
ATOM 1254 C C8     . DA  B 2 10 ? 131.100 130.242 49.287 1.00 212.77 ? 10  DA  B C8     1 
ATOM 1255 N N7     . DA  B 2 10 ? 131.981 130.010 48.343 1.00 206.40 ? 10  DA  B N7     1 
ATOM 1256 C C5     . DA  B 2 10 ? 132.169 128.640 48.395 1.00 192.15 ? 10  DA  B C5     1 
ATOM 1257 C C6     . DA  B 2 10 ? 132.983 127.764 47.650 1.00 180.84 ? 10  DA  B C6     1 
ATOM 1258 N N6     . DA  B 2 10 ? 133.793 128.172 46.667 1.00 180.97 ? 10  DA  B N6     1 
ATOM 1259 N N1     . DA  B 2 10 ? 132.935 126.452 47.956 1.00 165.75 ? 10  DA  B N1     1 
ATOM 1260 C C2     . DA  B 2 10 ? 132.123 126.051 48.941 1.00 182.39 ? 10  DA  B C2     1 
ATOM 1261 N N3     . DA  B 2 10 ? 131.313 126.777 49.709 1.00 193.79 ? 10  DA  B N3     1 
ATOM 1262 C C4     . DA  B 2 10 ? 131.384 128.076 49.382 1.00 195.62 ? 10  DA  B C4     1 
ATOM 1263 H "H5'"  . DA  B 2 10 ? 126.565 131.186 50.292 1.00 295.41 ? 10  DA  B "H5'"  1 
ATOM 1264 H "H5''" . DA  B 2 10 ? 126.648 131.810 51.744 1.00 295.41 ? 10  DA  B "H5''" 1 
ATOM 1265 H "H4'"  . DA  B 2 10 ? 126.918 129.474 51.824 1.00 298.57 ? 10  DA  B "H4'"  1 
ATOM 1266 H "H3'"  . DA  B 2 10 ? 128.493 131.056 53.184 1.00 293.68 ? 10  DA  B "H3'"  1 
ATOM 1267 H "H2'"  . DA  B 2 10 ? 130.303 130.879 51.832 1.00 281.99 ? 10  DA  B "H2'"  1 
ATOM 1268 H "H2''" . DA  B 2 10 ? 130.608 129.661 52.824 1.00 281.99 ? 10  DA  B "H2''" 1 
ATOM 1269 H "H1'"  . DA  B 2 10 ? 129.712 128.142 51.402 1.00 274.31 ? 10  DA  B "H1'"  1 
ATOM 1270 H H8     . DA  B 2 10 ? 130.779 131.092 49.483 1.00 255.32 ? 10  DA  B H8     1 
ATOM 1271 H H61    . DA  B 2 10 ? 134.273 127.600 46.241 1.00 217.17 ? 10  DA  B H61    1 
ATOM 1272 H H62    . DA  B 2 10 ? 133.834 129.006 46.462 1.00 217.17 ? 10  DA  B H62    1 
ATOM 1273 H H2     . DA  B 2 10 ? 132.125 125.137 49.113 1.00 218.86 ? 10  DA  B H2     1 
ATOM 1274 P P      . DA  B 2 11 ? 128.635 129.427 55.293 1.00 257.59 ? 11  DA  B P      1 
ATOM 1275 O OP1    . DA  B 2 11 ? 128.348 128.174 56.027 1.00 258.98 ? 11  DA  B OP1    1 
ATOM 1276 O OP2    . DA  B 2 11 ? 127.956 130.680 55.692 1.00 272.27 ? 11  DA  B OP2    1 
ATOM 1277 O "O5'"  . DA  B 2 11 ? 130.209 129.702 55.303 1.00 250.29 ? 11  DA  B "O5'"  1 
ATOM 1278 C "C5'"  . DA  B 2 11 ? 131.042 129.050 56.246 1.00 249.82 ? 11  DA  B "C5'"  1 
ATOM 1279 C "C4'"  . DA  B 2 11 ? 131.335 127.616 55.844 1.00 230.14 ? 11  DA  B "C4'"  1 
ATOM 1280 O "O4'"  . DA  B 2 11 ? 131.510 127.530 54.404 1.00 215.93 ? 11  DA  B "O4'"  1 
ATOM 1281 C "C3'"  . DA  B 2 11 ? 132.599 127.057 56.487 1.00 225.77 ? 11  DA  B "C3'"  1 
ATOM 1282 O "O3'"  . DA  B 2 11 ? 132.320 125.825 57.144 1.00 214.08 ? 11  DA  B "O3'"  1 
ATOM 1283 C "C2'"  . DA  B 2 11 ? 133.580 126.882 55.332 1.00 223.89 ? 11  DA  B "C2'"  1 
ATOM 1284 C "C1'"  . DA  B 2 11 ? 132.699 126.832 54.092 1.00 213.18 ? 11  DA  B "C1'"  1 
ATOM 1285 N N9     . DA  B 2 11 ? 133.330 127.452 52.931 1.00 220.79 ? 11  DA  B N9     1 
ATOM 1286 C C8     . DA  B 2 11 ? 133.280 128.773 52.583 1.00 245.17 ? 11  DA  B C8     1 
ATOM 1287 N N7     . DA  B 2 11 ? 133.950 129.061 51.494 1.00 238.92 ? 11  DA  B N7     1 
ATOM 1288 C C5     . DA  B 2 11 ? 134.490 127.847 51.107 1.00 211.74 ? 11  DA  B C5     1 
ATOM 1289 C C6     . DA  B 2 11 ? 135.309 127.484 50.023 1.00 201.20 ? 11  DA  B C6     1 
ATOM 1290 N N6     . DA  B 2 11 ? 135.733 128.360 49.109 1.00 209.93 ? 11  DA  B N6     1 
ATOM 1291 N N1     . DA  B 2 11 ? 135.676 126.189 49.918 1.00 198.04 ? 11  DA  B N1     1 
ATOM 1292 C C2     . DA  B 2 11 ? 135.243 125.326 50.845 1.00 192.72 ? 11  DA  B C2     1 
ATOM 1293 N N3     . DA  B 2 11 ? 134.469 125.549 51.908 1.00 182.74 ? 11  DA  B N3     1 
ATOM 1294 C C4     . DA  B 2 11 ? 134.123 126.844 51.983 1.00 202.67 ? 11  DA  B C4     1 
ATOM 1295 H "H5'"  . DA  B 2 11 ? 130.602 129.053 57.110 1.00 299.78 ? 11  DA  B "H5'"  1 
ATOM 1296 H "H5''" . DA  B 2 11 ? 131.879 129.536 56.316 1.00 299.78 ? 11  DA  B "H5''" 1 
ATOM 1297 H "H4'"  . DA  B 2 11 ? 130.582 127.060 56.101 1.00 276.17 ? 11  DA  B "H4'"  1 
ATOM 1298 H "H3'"  . DA  B 2 11 ? 132.953 127.697 57.125 1.00 270.93 ? 11  DA  B "H3'"  1 
ATOM 1299 H "H2'"  . DA  B 2 11 ? 134.186 127.638 55.286 1.00 268.67 ? 11  DA  B "H2'"  1 
ATOM 1300 H "H2''" . DA  B 2 11 ? 134.074 126.054 55.430 1.00 268.67 ? 11  DA  B "H2''" 1 
ATOM 1301 H "H1'"  . DA  B 2 11 ? 132.485 125.908 53.887 1.00 255.82 ? 11  DA  B "H1'"  1 
ATOM 1302 H H8     . DA  B 2 11 ? 132.803 129.407 53.067 1.00 294.21 ? 11  DA  B H8     1 
ATOM 1303 H H61    . DA  B 2 11 ? 136.235 128.098 48.461 1.00 251.92 ? 11  DA  B H61    1 
ATOM 1304 H H62    . DA  B 2 11 ? 135.505 129.187 49.167 1.00 251.92 ? 11  DA  B H62    1 
ATOM 1305 H H2     . DA  B 2 11 ? 135.520 124.445 50.731 1.00 231.26 ? 11  DA  B H2     1 
ATOM 1306 P P      . DG  B 2 12 ? 133.424 125.153 58.098 1.00 232.63 ? 12  DG  B P      1 
ATOM 1307 O OP1    . DG  B 2 12 ? 132.714 124.268 59.048 1.00 226.03 ? 12  DG  B OP1    1 
ATOM 1308 O OP2    . DG  B 2 12 ? 134.302 126.226 58.615 1.00 244.13 ? 12  DG  B OP2    1 
ATOM 1309 O "O5'"  . DG  B 2 12 ? 134.289 124.255 57.100 1.00 183.98 ? 12  DG  B "O5'"  1 
ATOM 1310 C "C5'"  . DG  B 2 12 ? 135.412 123.539 57.581 1.00 195.26 ? 12  DG  B "C5'"  1 
ATOM 1311 C "C4'"  . DG  B 2 12 ? 135.983 122.648 56.495 1.00 212.21 ? 12  DG  B "C4'"  1 
ATOM 1312 O "O4'"  . DG  B 2 12 ? 135.897 123.320 55.211 1.00 222.81 ? 12  DG  B "O4'"  1 
ATOM 1313 C "C3'"  . DG  B 2 12 ? 137.449 122.284 56.686 1.00 217.57 ? 12  DG  B "C3'"  1 
ATOM 1314 O "O3'"  . DG  B 2 12 ? 137.703 120.961 56.224 1.00 214.95 ? 12  DG  B "O3'"  1 
ATOM 1315 C "C2'"  . DG  B 2 12 ? 138.169 123.339 55.854 1.00 226.88 ? 12  DG  B "C2'"  1 
ATOM 1316 C "C1'"  . DG  B 2 12 ? 137.193 123.581 54.706 1.00 223.49 ? 12  DG  B "C1'"  1 
ATOM 1317 N N9     . DG  B 2 12 ? 137.221 124.935 54.156 1.00 215.25 ? 12  DG  B N9     1 
ATOM 1318 C C8     . DG  B 2 12 ? 136.673 126.070 54.702 1.00 226.83 ? 12  DG  B C8     1 
ATOM 1319 N N7     . DG  B 2 12 ? 136.860 127.139 53.979 1.00 230.35 ? 12  DG  B N7     1 
ATOM 1320 C C5     . DG  B 2 12 ? 137.589 126.687 52.887 1.00 214.31 ? 12  DG  B C5     1 
ATOM 1321 C C6     . DG  B 2 12 ? 138.089 127.394 51.768 1.00 211.88 ? 12  DG  B C6     1 
ATOM 1322 O O6     . DG  B 2 12 ? 137.981 128.601 51.512 1.00 213.77 ? 12  DG  B O6     1 
ATOM 1323 N N1     . DG  B 2 12 ? 138.774 126.555 50.893 1.00 196.41 ? 12  DG  B N1     1 
ATOM 1324 C C2     . DG  B 2 12 ? 138.952 125.204 51.078 1.00 183.69 ? 12  DG  B C2     1 
ATOM 1325 N N2     . DG  B 2 12 ? 139.642 124.558 50.127 1.00 193.06 ? 12  DG  B N2     1 
ATOM 1326 N N3     . DG  B 2 12 ? 138.490 124.531 52.123 1.00 153.86 ? 12  DG  B N3     1 
ATOM 1327 C C4     . DG  B 2 12 ? 137.820 125.334 52.982 1.00 189.85 ? 12  DG  B C4     1 
ATOM 1328 H "H5'"  . DG  B 2 12 ? 135.143 122.991 58.335 1.00 234.31 ? 12  DG  B "H5'"  1 
ATOM 1329 H "H5''" . DG  B 2 12 ? 136.092 124.167 57.869 1.00 234.31 ? 12  DG  B "H5''" 1 
ATOM 1330 H "H4'"  . DG  B 2 12 ? 135.461 121.831 56.455 1.00 254.65 ? 12  DG  B "H4'"  1 
ATOM 1331 H "H3'"  . DG  B 2 12 ? 137.696 122.368 57.620 1.00 261.09 ? 12  DG  B "H3'"  1 
ATOM 1332 H "HO3'" . DG  B 2 12 ? 138.258 120.831 55.607 1.00 257.94 ? 12  DG  B "HO3'" 1 
ATOM 1333 H "H2'"  . DG  B 2 12 ? 138.302 124.151 56.368 1.00 272.26 ? 12  DG  B "H2'"  1 
ATOM 1334 H "H2''" . DG  B 2 12 ? 139.013 122.997 55.521 1.00 272.26 ? 12  DG  B "H2''" 1 
ATOM 1335 H "H1'"  . DG  B 2 12 ? 137.385 122.951 53.995 1.00 268.18 ? 12  DG  B "H1'"  1 
ATOM 1336 H H8     . DG  B 2 12 ? 136.202 126.073 55.504 1.00 272.20 ? 12  DG  B H8     1 
ATOM 1337 H H1     . DG  B 2 12 ? 139.110 126.907 50.185 1.00 235.69 ? 12  DG  B H1     1 
ATOM 1338 H H21    . DG  B 2 12 ? 139.782 123.713 50.197 1.00 231.68 ? 12  DG  B H21    1 
ATOM 1339 H H22    . DG  B 2 12 ? 139.944 124.990 49.447 1.00 231.68 ? 12  DG  B H22    1 
ATOM 1340 O "O5'"  . DC  C 3 1  ? 143.034 128.712 43.156 1.00 264.52 ? 1   DC  C "O5'"  1 
ATOM 1341 C "C5'"  . DC  C 3 1  ? 144.196 127.908 43.313 1.00 268.17 ? 1   DC  C "C5'"  1 
ATOM 1342 C "C4'"  . DC  C 3 1  ? 143.967 126.829 44.354 1.00 253.32 ? 1   DC  C "C4'"  1 
ATOM 1343 O "O4'"  . DC  C 3 1  ? 143.651 127.453 45.623 1.00 241.32 ? 1   DC  C "O4'"  1 
ATOM 1344 C "C3'"  . DC  C 3 1  ? 142.809 125.889 44.050 1.00 252.80 ? 1   DC  C "C3'"  1 
ATOM 1345 O "O3'"  . DC  C 3 1  ? 143.281 124.723 43.378 1.00 262.38 ? 1   DC  C "O3'"  1 
ATOM 1346 C "C2'"  . DC  C 3 1  ? 142.230 125.556 45.422 1.00 231.35 ? 1   DC  C "C2'"  1 
ATOM 1347 C "C1'"  . DC  C 3 1  ? 142.751 126.644 46.354 1.00 189.91 ? 1   DC  C "C1'"  1 
ATOM 1348 N N1     . DC  C 3 1  ? 141.681 127.519 46.923 1.00 163.82 ? 1   DC  C N1     1 
ATOM 1349 C C2     . DC  C 3 1  ? 140.961 127.098 48.046 1.00 174.90 ? 1   DC  C C2     1 
ATOM 1350 O O2     . DC  C 3 1  ? 141.208 125.990 48.539 1.00 139.75 ? 1   DC  C O2     1 
ATOM 1351 N N3     . DC  C 3 1  ? 139.998 127.906 48.554 1.00 196.70 ? 1   DC  C N3     1 
ATOM 1352 C C4     . DC  C 3 1  ? 139.756 129.092 47.994 1.00 211.25 ? 1   DC  C C4     1 
ATOM 1353 N N4     . DC  C 3 1  ? 138.797 129.854 48.532 1.00 192.36 ? 1   DC  C N4     1 
ATOM 1354 C C5     . DC  C 3 1  ? 140.485 129.545 46.855 1.00 226.71 ? 1   DC  C C5     1 
ATOM 1355 C C6     . DC  C 3 1  ? 141.430 128.737 46.361 1.00 211.64 ? 1   DC  C C6     1 
ATOM 1356 H "H5'"  . DC  C 3 1  ? 144.937 128.468 43.592 1.00 321.80 ? 1   DC  C "H5'"  1 
ATOM 1357 H "H5''" . DC  C 3 1  ? 144.413 127.491 42.464 1.00 321.80 ? 1   DC  C "H5''" 1 
ATOM 1358 H "H4'"  . DC  C 3 1  ? 144.780 126.307 44.453 1.00 303.98 ? 1   DC  C "H4'"  1 
ATOM 1359 H "H3'"  . DC  C 3 1  ? 142.145 126.342 43.508 1.00 303.36 ? 1   DC  C "H3'"  1 
ATOM 1360 H "H2'"  . DC  C 3 1  ? 141.261 125.575 45.391 1.00 277.62 ? 1   DC  C "H2'"  1 
ATOM 1361 H "H2''" . DC  C 3 1  ? 142.541 124.685 45.715 1.00 277.62 ? 1   DC  C "H2''" 1 
ATOM 1362 H "H1'"  . DC  C 3 1  ? 143.232 126.225 47.084 1.00 227.90 ? 1   DC  C "H1'"  1 
ATOM 1363 H H41    . DC  C 3 1  ? 138.618 130.624 48.192 1.00 230.83 ? 1   DC  C H41    1 
ATOM 1364 H H42    . DC  C 3 1  ? 138.359 129.575 49.217 1.00 230.83 ? 1   DC  C H42    1 
ATOM 1365 H H5     . DC  C 3 1  ? 140.310 130.373 46.469 1.00 272.06 ? 1   DC  C H5     1 
ATOM 1366 H H6     . DC  C 3 1  ? 141.920 129.008 45.619 1.00 253.97 ? 1   DC  C H6     1 
ATOM 1367 H "HO5'" . DC  C 3 1  ? 143.008 129.407 42.466 1.00 317.43 ? 1   DC  C "HO5'" 1 
ATOM 1368 P P      . DT  C 3 2  ? 142.262 123.781 42.566 1.00 228.72 ? 2   DT  C P      1 
ATOM 1369 O OP1    . DT  C 3 2  ? 143.071 122.813 41.793 1.00 265.92 ? 2   DT  C OP1    1 
ATOM 1370 O OP2    . DT  C 3 2  ? 141.295 124.652 41.863 1.00 238.50 ? 2   DT  C OP2    1 
ATOM 1371 O "O5'"  . DT  C 3 2  ? 141.473 122.991 43.711 1.00 196.55 ? 2   DT  C "O5'"  1 
ATOM 1372 C "C5'"  . DT  C 3 2  ? 142.169 122.118 44.596 1.00 228.60 ? 2   DT  C "C5'"  1 
ATOM 1373 C "C4'"  . DT  C 3 2  ? 141.239 121.599 45.677 1.00 220.30 ? 2   DT  C "C4'"  1 
ATOM 1374 O "O4'"  . DT  C 3 2  ? 140.642 122.719 46.382 1.00 217.01 ? 2   DT  C "O4'"  1 
ATOM 1375 C "C3'"  . DT  C 3 2  ? 140.085 120.755 45.145 1.00 206.99 ? 2   DT  C "C3'"  1 
ATOM 1376 O "O3'"  . DT  C 3 2  ? 139.999 119.509 45.832 1.00 197.66 ? 2   DT  C "O3'"  1 
ATOM 1377 C "C2'"  . DT  C 3 2  ? 138.853 121.623 45.379 1.00 206.13 ? 2   DT  C "C2'"  1 
ATOM 1378 C "C1'"  . DT  C 3 2  ? 139.260 122.489 46.563 1.00 181.30 ? 2   DT  C "C1'"  1 
ATOM 1379 N N1     . DT  C 3 2  ? 138.545 123.805 46.636 1.00 143.76 ? 2   DT  C N1     1 
ATOM 1380 C C2     . DT  C 3 2  ? 137.666 124.068 47.670 1.00 183.26 ? 2   DT  C C2     1 
ATOM 1381 O O2     . DT  C 3 2  ? 137.419 123.280 48.567 1.00 184.15 ? 2   DT  C O2     1 
ATOM 1382 N N3     . DT  C 3 2  ? 137.078 125.308 47.621 1.00 190.97 ? 2   DT  C N3     1 
ATOM 1383 C C4     . DT  C 3 2  ? 137.274 126.287 46.663 1.00 196.80 ? 2   DT  C C4     1 
ATOM 1384 O O4     . DT  C 3 2  ? 136.698 127.370 46.705 1.00 217.57 ? 2   DT  C O4     1 
ATOM 1385 C C5     . DT  C 3 2  ? 138.202 125.948 45.612 1.00 175.72 ? 2   DT  C C5     1 
ATOM 1386 C C7     . DT  C 3 2  ? 138.503 126.924 44.511 1.00 201.27 ? 2   DT  C C7     1 
ATOM 1387 C C6     . DT  C 3 2  ? 138.780 124.741 45.649 1.00 149.27 ? 2   DT  C C6     1 
ATOM 1388 H "H5'"  . DT  C 3 2  ? 142.902 122.600 45.009 1.00 274.32 ? 2   DT  C "H5'"  1 
ATOM 1389 H "H5''" . DT  C 3 2  ? 142.523 121.369 44.092 1.00 274.32 ? 2   DT  C "H5''" 1 
ATOM 1390 H "H4'"  . DT  C 3 2  ? 141.753 121.069 46.306 1.00 264.35 ? 2   DT  C "H4'"  1 
ATOM 1391 H "H3'"  . DT  C 3 2  ? 140.202 120.600 44.194 1.00 248.39 ? 2   DT  C "H3'"  1 
ATOM 1392 H "H2'"  . DT  C 3 2  ? 138.668 122.172 44.601 1.00 247.35 ? 2   DT  C "H2'"  1 
ATOM 1393 H "H2''" . DT  C 3 2  ? 138.085 121.075 45.604 1.00 247.35 ? 2   DT  C "H2''" 1 
ATOM 1394 H "H1'"  . DT  C 3 2  ? 139.119 121.997 47.387 1.00 217.55 ? 2   DT  C "H1'"  1 
ATOM 1395 H H3     . DT  C 3 2  ? 136.527 125.496 48.254 1.00 229.16 ? 2   DT  C H3     1 
ATOM 1396 H H71    . DT  C 3 2  ? 139.450 127.132 44.514 1.00 241.53 ? 2   DT  C H71    1 
ATOM 1397 H H72    . DT  C 3 2  ? 138.260 126.533 43.657 1.00 241.53 ? 2   DT  C H72    1 
ATOM 1398 H H73    . DT  C 3 2  ? 137.992 127.737 44.651 1.00 241.53 ? 2   DT  C H73    1 
ATOM 1399 H H6     . DT  C 3 2  ? 139.379 124.522 44.973 1.00 179.13 ? 2   DT  C H6     1 
ATOM 1400 P P      . DT  C 3 3  ? 139.070 118.331 45.257 1.00 231.53 ? 3   DT  C P      1 
ATOM 1401 O OP1    . DT  C 3 3  ? 139.671 117.046 45.676 1.00 238.62 ? 3   DT  C OP1    1 
ATOM 1402 O OP2    . DT  C 3 3  ? 138.820 118.593 43.822 1.00 239.77 ? 3   DT  C OP2    1 
ATOM 1403 O "O5'"  . DT  C 3 3  ? 137.688 118.525 46.035 1.00 175.89 ? 3   DT  C "O5'"  1 
ATOM 1404 C "C5'"  . DT  C 3 3  ? 137.642 118.360 47.445 1.00 202.80 ? 3   DT  C "C5'"  1 
ATOM 1405 C "C4'"  . DT  C 3 3  ? 136.349 118.913 48.012 1.00 198.45 ? 3   DT  C "C4'"  1 
ATOM 1406 O "O4'"  . DT  C 3 3  ? 136.264 120.325 47.704 1.00 202.92 ? 3   DT  C "O4'"  1 
ATOM 1407 C "C3'"  . DT  C 3 3  ? 135.076 118.288 47.451 1.00 170.37 ? 3   DT  C "C3'"  1 
ATOM 1408 O "O3'"  . DT  C 3 3  ? 134.531 117.373 48.406 1.00 166.68 ? 3   DT  C "O3'"  1 
ATOM 1409 C "C2'"  . DT  C 3 3  ? 134.149 119.470 47.158 1.00 154.15 ? 3   DT  C "C2'"  1 
ATOM 1410 C "C1'"  . DT  C 3 3  ? 134.905 120.699 47.653 1.00 147.65 ? 3   DT  C "C1'"  1 
ATOM 1411 N N1     . DT  C 3 3  ? 134.780 121.915 46.782 1.00 138.20 ? 3   DT  C N1     1 
ATOM 1412 C C2     . DT  C 3 3  ? 134.066 123.010 47.230 1.00 185.85 ? 3   DT  C C2     1 
ATOM 1413 O O2     . DT  C 3 3  ? 133.507 123.059 48.311 1.00 204.45 ? 3   DT  C O2     1 
ATOM 1414 N N3     . DT  C 3 3  ? 134.022 124.064 46.354 1.00 191.51 ? 3   DT  C N3     1 
ATOM 1415 C C4     . DT  C 3 3  ? 134.609 124.140 45.105 1.00 179.27 ? 3   DT  C C4     1 
ATOM 1416 O O4     . DT  C 3 3  ? 134.506 125.137 44.396 1.00 157.34 ? 3   DT  C O4     1 
ATOM 1417 C C5     . DT  C 3 3  ? 135.342 122.966 44.696 1.00 175.12 ? 3   DT  C C5     1 
ATOM 1418 C C7     . DT  C 3 3  ? 136.021 122.928 43.356 1.00 201.85 ? 3   DT  C C7     1 
ATOM 1419 C C6     . DT  C 3 3  ? 135.393 121.926 45.543 1.00 139.10 ? 3   DT  C C6     1 
ATOM 1420 H "H5'"  . DT  C 3 3  ? 138.391 118.828 47.846 1.00 243.36 ? 3   DT  C "H5'"  1 
ATOM 1421 H "H5''" . DT  C 3 3  ? 137.706 117.416 47.658 1.00 243.36 ? 3   DT  C "H5''" 1 
ATOM 1422 H "H4'"  . DT  C 3 3  ? 136.355 118.802 48.976 1.00 238.14 ? 3   DT  C "H4'"  1 
ATOM 1423 H "H3'"  . DT  C 3 3  ? 135.279 117.819 46.626 1.00 204.45 ? 3   DT  C "H3'"  1 
ATOM 1424 H "H2'"  . DT  C 3 3  ? 133.981 119.538 46.205 1.00 184.98 ? 3   DT  C "H2'"  1 
ATOM 1425 H "H2''" . DT  C 3 3  ? 133.314 119.371 47.642 1.00 184.98 ? 3   DT  C "H2''" 1 
ATOM 1426 H "H1'"  . DT  C 3 3  ? 134.603 120.918 48.548 1.00 177.18 ? 3   DT  C "H1'"  1 
ATOM 1427 H H3     . DT  C 3 3  ? 133.581 124.757 46.612 1.00 229.82 ? 3   DT  C H3     1 
ATOM 1428 H H71    . DT  C 3 3  ? 136.974 122.794 43.480 1.00 242.22 ? 3   DT  C H71    1 
ATOM 1429 H H72    . DT  C 3 3  ? 135.658 122.198 42.830 1.00 242.22 ? 3   DT  C H72    1 
ATOM 1430 H H73    . DT  C 3 3  ? 135.871 123.767 42.893 1.00 242.22 ? 3   DT  C H73    1 
ATOM 1431 H H6     . DT  C 3 3  ? 135.865 121.169 45.280 1.00 166.92 ? 3   DT  C H6     1 
ATOM 1432 P P      . DG  C 3 4  ? 133.548 116.189 47.939 1.00 198.74 ? 4   DG  C P      1 
ATOM 1433 O OP1    . DG  C 3 4  ? 133.541 115.171 49.011 1.00 188.58 ? 4   DG  C OP1    1 
ATOM 1434 O OP2    . DG  C 3 4  ? 133.909 115.794 46.560 1.00 208.21 ? 4   DG  C OP2    1 
ATOM 1435 O "O5'"  . DG  C 3 4  ? 132.111 116.889 47.889 1.00 139.30 ? 4   DG  C "O5'"  1 
ATOM 1436 C "C5'"  . DG  C 3 4  ? 131.564 117.419 49.092 1.00 161.13 ? 4   DG  C "C5'"  1 
ATOM 1437 C "C4'"  . DG  C 3 4  ? 130.424 118.384 48.816 1.00 156.06 ? 4   DG  C "C4'"  1 
ATOM 1438 O "O4'"  . DG  C 3 4  ? 130.908 119.533 48.069 1.00 165.65 ? 4   DG  C "O4'"  1 
ATOM 1439 C "C3'"  . DG  C 3 4  ? 129.272 117.808 48.001 1.00 145.68 ? 4   DG  C "C3'"  1 
ATOM 1440 O "O3'"  . DG  C 3 4  ? 128.035 118.250 48.534 1.00 117.59 ? 4   DG  C "O3'"  1 
ATOM 1441 C "C2'"  . DG  C 3 4  ? 129.514 118.387 46.614 1.00 172.91 ? 4   DG  C "C2'"  1 
ATOM 1442 C "C1'"  . DG  C 3 4  ? 130.039 119.768 46.982 1.00 146.88 ? 4   DG  C "C1'"  1 
ATOM 1443 N N9     . DG  C 3 4  ? 130.754 120.456 45.911 1.00 140.08 ? 4   DG  C N9     1 
ATOM 1444 C C8     . DG  C 3 4  ? 131.590 119.897 44.974 1.00 154.84 ? 4   DG  C C8     1 
ATOM 1445 N N7     . DG  C 3 4  ? 132.083 120.764 44.134 1.00 151.95 ? 4   DG  C N7     1 
ATOM 1446 C C5     . DG  C 3 4  ? 131.533 121.975 44.535 1.00 175.15 ? 4   DG  C C5     1 
ATOM 1447 C C6     . DG  C 3 4  ? 131.701 123.274 43.998 1.00 203.82 ? 4   DG  C C6     1 
ATOM 1448 O O6     . DG  C 3 4  ? 132.393 123.620 43.031 1.00 227.73 ? 4   DG  C O6     1 
ATOM 1449 N N1     . DG  C 3 4  ? 130.966 124.224 44.704 1.00 198.92 ? 4   DG  C N1     1 
ATOM 1450 C C2     . DG  C 3 4  ? 130.169 123.950 45.789 1.00 189.84 ? 4   DG  C C2     1 
ATOM 1451 N N2     . DG  C 3 4  ? 129.535 124.995 46.339 1.00 198.67 ? 4   DG  C N2     1 
ATOM 1452 N N3     . DG  C 3 4  ? 130.001 122.738 46.302 1.00 151.90 ? 4   DG  C N3     1 
ATOM 1453 C C4     . DG  C 3 4  ? 130.712 121.803 45.626 1.00 155.04 ? 4   DG  C C4     1 
ATOM 1454 H "H5'"  . DG  C 3 4  ? 132.262 117.886 49.578 1.00 193.36 ? 4   DG  C "H5'"  1 
ATOM 1455 H "H5''" . DG  C 3 4  ? 131.234 116.688 49.637 1.00 193.36 ? 4   DG  C "H5''" 1 
ATOM 1456 H "H4'"  . DG  C 3 4  ? 130.074 118.696 49.666 1.00 187.27 ? 4   DG  C "H4'"  1 
ATOM 1457 H "H3'"  . DG  C 3 4  ? 129.315 116.840 47.982 1.00 174.82 ? 4   DG  C "H3'"  1 
ATOM 1458 H "H2'"  . DG  C 3 4  ? 130.183 117.875 46.133 1.00 207.49 ? 4   DG  C "H2'"  1 
ATOM 1459 H "H2''" . DG  C 3 4  ? 128.687 118.450 46.111 1.00 207.49 ? 4   DG  C "H2''" 1 
ATOM 1460 H "H1'"  . DG  C 3 4  ? 129.299 120.321 47.279 1.00 176.26 ? 4   DG  C "H1'"  1 
ATOM 1461 H H8     . DG  C 3 4  ? 131.789 118.989 44.946 1.00 185.80 ? 4   DG  C H8     1 
ATOM 1462 H H1     . DG  C 3 4  ? 131.014 125.041 44.440 1.00 238.70 ? 4   DG  C H1     1 
ATOM 1463 H H21    . DG  C 3 4  ? 129.023 124.878 47.020 1.00 238.40 ? 4   DG  C H21    1 
ATOM 1464 H H22    . DG  C 3 4  ? 129.640 125.783 46.010 1.00 238.40 ? 4   DG  C H22    1 
ATOM 1465 P P      . DA  C 3 5  ? 126.804 117.231 48.695 1.00 145.50 ? 5   DA  C P      1 
ATOM 1466 O OP1    . DA  C 3 5  ? 127.128 116.283 49.783 1.00 131.69 ? 5   DA  C OP1    1 
ATOM 1467 O OP2    . DA  C 3 5  ? 126.474 116.711 47.350 1.00 187.09 ? 5   DA  C OP2    1 
ATOM 1468 O "O5'"  . DA  C 3 5  ? 125.599 118.172 49.161 1.00 98.17  ? 5   DA  C "O5'"  1 
ATOM 1469 C "C5'"  . DA  C 3 5  ? 125.769 119.076 50.244 1.00 131.82 ? 5   DA  C "C5'"  1 
ATOM 1470 C "C4'"  . DA  C 3 5  ? 125.292 120.461 49.854 1.00 142.82 ? 5   DA  C "C4'"  1 
ATOM 1471 O "O4'"  . DA  C 3 5  ? 126.172 120.987 48.830 1.00 159.23 ? 5   DA  C "O4'"  1 
ATOM 1472 C "C3'"  . DA  C 3 5  ? 123.880 120.518 49.277 1.00 134.80 ? 5   DA  C "C3'"  1 
ATOM 1473 O "O3'"  . DA  C 3 5  ? 123.130 121.529 49.939 1.00 124.21 ? 5   DA  C "O3'"  1 
ATOM 1474 C "C2'"  . DA  C 3 5  ? 124.092 120.820 47.796 1.00 151.64 ? 5   DA  C "C2'"  1 
ATOM 1475 C "C1'"  . DA  C 3 5  ? 125.412 121.579 47.799 1.00 148.99 ? 5   DA  C "C1'"  1 
ATOM 1476 N N9     . DA  C 3 5  ? 126.172 121.477 46.556 1.00 148.93 ? 5   DA  C N9     1 
ATOM 1477 C C8     . DA  C 3 5  ? 126.694 120.340 46.004 1.00 145.06 ? 5   DA  C C8     1 
ATOM 1478 N N7     . DA  C 3 5  ? 127.343 120.546 44.883 1.00 136.89 ? 5   DA  C N7     1 
ATOM 1479 C C5     . DA  C 3 5  ? 127.249 121.914 44.691 1.00 165.66 ? 5   DA  C C5     1 
ATOM 1480 C C6     . DA  C 3 5  ? 127.734 122.765 43.678 1.00 199.21 ? 5   DA  C C6     1 
ATOM 1481 N N6     . DA  C 3 5  ? 128.439 122.331 42.629 1.00 206.51 ? 5   DA  C N6     1 
ATOM 1482 N N1     . DA  C 3 5  ? 127.464 124.083 43.787 1.00 209.93 ? 5   DA  C N1     1 
ATOM 1483 C C2     . DA  C 3 5  ? 126.757 124.511 44.839 1.00 203.65 ? 5   DA  C C2     1 
ATOM 1484 N N3     . DA  C 3 5  ? 126.249 123.808 45.850 1.00 183.31 ? 5   DA  C N3     1 
ATOM 1485 C C4     . DA  C 3 5  ? 126.533 122.504 45.715 1.00 160.59 ? 5   DA  C C4     1 
ATOM 1486 H "H5'"  . DA  C 3 5  ? 126.708 119.116 50.483 1.00 158.19 ? 5   DA  C "H5'"  1 
ATOM 1487 H "H5''" . DA  C 3 5  ? 125.257 118.763 51.006 1.00 158.19 ? 5   DA  C "H5''" 1 
ATOM 1488 H "H4'"  . DA  C 3 5  ? 125.336 121.039 50.632 1.00 171.39 ? 5   DA  C "H4'"  1 
ATOM 1489 H "H3'"  . DA  C 3 5  ? 123.444 119.658 49.381 1.00 161.77 ? 5   DA  C "H3'"  1 
ATOM 1490 H "H2'"  . DA  C 3 5  ? 124.168 119.999 47.285 1.00 181.97 ? 5   DA  C "H2'"  1 
ATOM 1491 H "H2''" . DA  C 3 5  ? 123.376 121.377 47.453 1.00 181.97 ? 5   DA  C "H2''" 1 
ATOM 1492 H "H1'"  . DA  C 3 5  ? 125.251 122.512 48.008 1.00 178.79 ? 5   DA  C "H1'"  1 
ATOM 1493 H H8     . DA  C 3 5  ? 126.590 119.498 46.384 1.00 174.07 ? 5   DA  C H8     1 
ATOM 1494 H H61    . DA  C 3 5  ? 128.714 122.889 42.035 1.00 247.81 ? 5   DA  C H61    1 
ATOM 1495 H H62    . DA  C 3 5  ? 128.618 121.494 42.548 1.00 247.81 ? 5   DA  C H62    1 
ATOM 1496 H H2     . DA  C 3 5  ? 126.598 125.427 44.868 1.00 244.38 ? 5   DA  C H2     1 
ATOM 1497 P P      . DA  C 3 6  ? 121.547 121.660 49.700 1.00 145.35 ? 6   DA  C P      1 
ATOM 1498 O OP1    . DA  C 3 6  ? 120.958 122.288 50.903 1.00 171.57 ? 6   DA  C OP1    1 
ATOM 1499 O OP2    . DA  C 3 6  ? 121.046 120.344 49.248 1.00 130.63 ? 6   DA  C OP2    1 
ATOM 1500 O "O5'"  . DA  C 3 6  ? 121.430 122.690 48.480 1.00 154.50 ? 6   DA  C "O5'"  1 
ATOM 1501 C "C5'"  . DA  C 3 6  ? 121.934 124.013 48.644 1.00 162.24 ? 6   DA  C "C5'"  1 
ATOM 1502 C "C4'"  . DA  C 3 6  ? 121.980 124.780 47.332 1.00 165.05 ? 6   DA  C "C4'"  1 
ATOM 1503 O "O4'"  . DA  C 3 6  ? 123.007 124.209 46.479 1.00 155.92 ? 6   DA  C "O4'"  1 
ATOM 1504 C "C3'"  . DA  C 3 6  ? 120.691 124.768 46.509 1.00 171.88 ? 6   DA  C "C3'"  1 
ATOM 1505 O "O3'"  . DA  C 3 6  ? 120.143 126.084 46.407 1.00 151.66 ? 6   DA  C "O3'"  1 
ATOM 1506 C "C2'"  . DA  C 3 6  ? 121.108 124.227 45.142 1.00 191.66 ? 6   DA  C "C2'"  1 
ATOM 1507 C "C1'"  . DA  C 3 6  ? 122.618 124.417 45.140 1.00 173.27 ? 6   DA  C "C1'"  1 
ATOM 1508 N N9     . DA  C 3 6  ? 123.322 123.487 44.261 1.00 187.77 ? 6   DA  C N9     1 
ATOM 1509 C C8     . DA  C 3 6  ? 123.409 122.129 44.396 1.00 194.84 ? 6   DA  C C8     1 
ATOM 1510 N N7     . DA  C 3 6  ? 124.105 121.547 43.448 1.00 189.47 ? 6   DA  C N7     1 
ATOM 1511 C C5     . DA  C 3 6  ? 124.500 122.595 42.633 1.00 193.63 ? 6   DA  C C5     1 
ATOM 1512 C C6     . DA  C 3 6  ? 125.266 122.644 41.450 1.00 197.00 ? 6   DA  C C6     1 
ATOM 1513 N N6     . DA  C 3 6  ? 125.791 121.562 40.867 1.00 193.50 ? 6   DA  C N6     1 
ATOM 1514 N N1     . DA  C 3 6  ? 125.474 123.853 40.889 1.00 199.53 ? 6   DA  C N1     1 
ATOM 1515 C C2     . DA  C 3 6  ? 124.948 124.934 41.476 1.00 200.01 ? 6   DA  C C2     1 
ATOM 1516 N N3     . DA  C 3 6  ? 124.213 125.013 42.584 1.00 180.08 ? 6   DA  C N3     1 
ATOM 1517 C C4     . DA  C 3 6  ? 124.024 123.798 43.119 1.00 186.86 ? 6   DA  C C4     1 
ATOM 1518 H "H5'"  . DA  C 3 6  ? 122.831 123.964 49.011 1.00 194.68 ? 6   DA  C "H5'"  1 
ATOM 1519 H "H5''" . DA  C 3 6  ? 121.366 124.491 49.268 1.00 194.68 ? 6   DA  C "H5''" 1 
ATOM 1520 H "H4'"  . DA  C 3 6  ? 122.216 125.701 47.523 1.00 198.06 ? 6   DA  C "H4'"  1 
ATOM 1521 H "H3'"  . DA  C 3 6  ? 120.045 124.171 46.917 1.00 206.25 ? 6   DA  C "H3'"  1 
ATOM 1522 H "H2'"  . DA  C 3 6  ? 120.881 123.287 45.063 1.00 230.00 ? 6   DA  C "H2'"  1 
ATOM 1523 H "H2''" . DA  C 3 6  ? 120.697 124.742 44.430 1.00 230.00 ? 6   DA  C "H2''" 1 
ATOM 1524 H "H1'"  . DA  C 3 6  ? 122.829 125.328 44.881 1.00 207.93 ? 6   DA  C "H1'"  1 
ATOM 1525 H H8     . DA  C 3 6  ? 123.013 121.662 45.096 1.00 233.81 ? 6   DA  C H8     1 
ATOM 1526 H H61    . DA  C 3 6  ? 126.253 121.643 40.146 1.00 232.19 ? 6   DA  C H61    1 
ATOM 1527 H H62    . DA  C 3 6  ? 125.667 120.784 41.213 1.00 232.19 ? 6   DA  C H62    1 
ATOM 1528 H H2     . DA  C 3 6  ? 125.119 125.743 41.050 1.00 240.01 ? 6   DA  C H2     1 
ATOM 1529 P P      . DT  C 3 7  ? 118.726 126.318 45.685 1.00 175.77 ? 7   DT  C P      1 
ATOM 1530 O OP1    . DT  C 3 7  ? 117.998 127.351 46.455 1.00 192.71 ? 7   DT  C OP1    1 
ATOM 1531 O OP2    . DT  C 3 7  ? 118.104 124.994 45.465 1.00 159.97 ? 7   DT  C OP2    1 
ATOM 1532 O "O5'"  . DT  C 3 7  ? 119.115 126.923 44.254 1.00 189.13 ? 7   DT  C "O5'"  1 
ATOM 1533 C "C5'"  . DT  C 3 7  ? 119.835 128.150 44.176 1.00 203.41 ? 7   DT  C "C5'"  1 
ATOM 1534 C "C4'"  . DT  C 3 7  ? 120.272 128.473 42.756 1.00 189.34 ? 7   DT  C "C4'"  1 
ATOM 1535 O "O4'"  . DT  C 3 7  ? 121.184 127.456 42.274 1.00 175.97 ? 7   DT  C "O4'"  1 
ATOM 1536 C "C3'"  . DT  C 3 7  ? 119.144 128.542 41.731 1.00 189.12 ? 7   DT  C "C3'"  1 
ATOM 1537 O "O3'"  . DT  C 3 7  ? 118.837 129.902 41.431 1.00 197.61 ? 7   DT  C "O3'"  1 
ATOM 1538 C "C2'"  . DT  C 3 7  ? 119.668 127.801 40.503 1.00 185.93 ? 7   DT  C "C2'"  1 
ATOM 1539 C "C1'"  . DT  C 3 7  ? 121.086 127.375 40.868 1.00 178.16 ? 7   DT  C "C1'"  1 
ATOM 1540 N N1     . DT  C 3 7  ? 121.414 125.983 40.446 1.00 180.35 ? 7   DT  C N1     1 
ATOM 1541 C C2     . DT  C 3 7  ? 122.210 125.759 39.340 1.00 175.92 ? 7   DT  C C2     1 
ATOM 1542 O O2     . DT  C 3 7  ? 122.683 126.648 38.655 1.00 182.28 ? 7   DT  C O2     1 
ATOM 1543 N N3     . DT  C 3 7  ? 122.435 124.435 39.061 1.00 150.53 ? 7   DT  C N3     1 
ATOM 1544 C C4     . DT  C 3 7  ? 121.958 123.341 39.759 1.00 155.69 ? 7   DT  C C4     1 
ATOM 1545 O O4     . DT  C 3 7  ? 122.221 122.190 39.423 1.00 176.92 ? 7   DT  C O4     1 
ATOM 1546 C C5     . DT  C 3 7  ? 121.133 123.650 40.903 1.00 146.67 ? 7   DT  C C5     1 
ATOM 1547 C C7     . DT  C 3 7  ? 120.548 122.560 41.751 1.00 152.41 ? 7   DT  C C7     1 
ATOM 1548 C C6     . DT  C 3 7  ? 120.906 124.937 41.185 1.00 166.43 ? 7   DT  C C6     1 
ATOM 1549 H "H5'"  . DT  C 3 7  ? 120.621 128.089 44.741 1.00 244.10 ? 7   DT  C "H5'"  1 
ATOM 1550 H "H5''" . DT  C 3 7  ? 119.269 128.867 44.502 1.00 244.10 ? 7   DT  C "H5''" 1 
ATOM 1551 H "H4'"  . DT  C 3 7  ? 120.736 129.325 42.763 1.00 227.21 ? 7   DT  C "H4'"  1 
ATOM 1552 H "H3'"  . DT  C 3 7  ? 118.357 128.094 42.077 1.00 226.94 ? 7   DT  C "H3'"  1 
ATOM 1553 H "H2'"  . DT  C 3 7  ? 119.120 127.022 40.320 1.00 223.12 ? 7   DT  C "H2'"  1 
ATOM 1554 H "H2''" . DT  C 3 7  ? 119.682 128.392 39.734 1.00 223.12 ? 7   DT  C "H2''" 1 
ATOM 1555 H "H1'"  . DT  C 3 7  ? 121.719 127.990 40.466 1.00 213.79 ? 7   DT  C "H1'"  1 
ATOM 1556 H H3     . DT  C 3 7  ? 122.928 124.266 38.377 1.00 180.64 ? 7   DT  C H3     1 
ATOM 1557 H H71    . DT  C 3 7  ? 120.868 122.651 42.662 1.00 182.89 ? 7   DT  C H71    1 
ATOM 1558 H H72    . DT  C 3 7  ? 119.580 122.626 41.740 1.00 182.89 ? 7   DT  C H72    1 
ATOM 1559 H H73    . DT  C 3 7  ? 120.817 121.697 41.399 1.00 182.89 ? 7   DT  C H73    1 
ATOM 1560 H H6     . DT  C 3 7  ? 120.375 125.138 41.922 1.00 199.71 ? 7   DT  C H6     1 
ATOM 1561 P P      . DG  C 3 8  ? 117.465 130.280 40.685 1.00 227.33 ? 8   DG  C P      1 
ATOM 1562 O OP1    . DG  C 3 8  ? 117.184 131.704 40.970 1.00 238.07 ? 8   DG  C OP1    1 
ATOM 1563 O OP2    . DG  C 3 8  ? 116.454 129.252 41.018 1.00 218.57 ? 8   DG  C OP2    1 
ATOM 1564 O "O5'"  . DG  C 3 8  ? 117.824 130.132 39.134 1.00 175.04 ? 8   DG  C "O5'"  1 
ATOM 1565 C "C5'"  . DG  C 3 8  ? 118.833 130.947 38.553 1.00 196.27 ? 8   DG  C "C5'"  1 
ATOM 1566 C "C4'"  . DG  C 3 8  ? 119.123 130.495 37.136 1.00 216.57 ? 8   DG  C "C4'"  1 
ATOM 1567 O "O4'"  . DG  C 3 8  ? 119.691 129.162 37.168 1.00 191.11 ? 8   DG  C "O4'"  1 
ATOM 1568 C "C3'"  . DG  C 3 8  ? 117.892 130.427 36.238 1.00 232.03 ? 8   DG  C "C3'"  1 
ATOM 1569 O "O3'"  . DG  C 3 8  ? 118.142 131.088 35.006 1.00 253.61 ? 8   DG  C "O3'"  1 
ATOM 1570 C "C2'"  . DG  C 3 8  ? 117.648 128.930 36.058 1.00 196.44 ? 8   DG  C "C2'"  1 
ATOM 1571 C "C1'"  . DG  C 3 8  ? 119.045 128.348 36.212 1.00 178.80 ? 8   DG  C "C1'"  1 
ATOM 1572 N N9     . DG  C 3 8  ? 119.073 126.968 36.682 1.00 176.07 ? 8   DG  C N9     1 
ATOM 1573 C C8     . DG  C 3 8  ? 118.419 126.424 37.761 1.00 167.41 ? 8   DG  C C8     1 
ATOM 1574 N N7     . DG  C 3 8  ? 118.659 125.153 37.924 1.00 147.76 ? 8   DG  C N7     1 
ATOM 1575 C C5     . DG  C 3 8  ? 119.536 124.837 36.895 1.00 146.69 ? 8   DG  C C5     1 
ATOM 1576 C C6     . DG  C 3 8  ? 120.148 123.609 36.560 1.00 139.61 ? 8   DG  C C6     1 
ATOM 1577 O O6     . DG  C 3 8  ? 120.031 122.514 37.128 1.00 144.18 ? 8   DG  C O6     1 
ATOM 1578 N N1     . DG  C 3 8  ? 120.967 123.732 35.440 1.00 153.63 ? 8   DG  C N1     1 
ATOM 1579 C C2     . DG  C 3 8  ? 121.167 124.897 34.735 1.00 194.49 ? 8   DG  C C2     1 
ATOM 1580 N N2     . DG  C 3 8  ? 121.990 124.832 33.681 1.00 224.79 ? 8   DG  C N2     1 
ATOM 1581 N N3     . DG  C 3 8  ? 120.600 126.053 35.040 1.00 193.37 ? 8   DG  C N3     1 
ATOM 1582 C C4     . DG  C 3 8  ? 119.801 125.946 36.127 1.00 178.15 ? 8   DG  C C4     1 
ATOM 1583 H "H5'"  . DG  C 3 8  ? 119.643 130.881 39.083 1.00 235.52 ? 8   DG  C "H5'"  1 
ATOM 1584 H "H5''" . DG  C 3 8  ? 118.533 131.869 38.541 1.00 235.52 ? 8   DG  C "H5''" 1 
ATOM 1585 H "H4'"  . DG  C 3 8  ? 119.768 131.102 36.739 1.00 259.88 ? 8   DG  C "H4'"  1 
ATOM 1586 H "H3'"  . DG  C 3 8  ? 117.133 130.834 36.685 1.00 278.44 ? 8   DG  C "H3'"  1 
ATOM 1587 H "H2'"  . DG  C 3 8  ? 117.056 128.593 36.748 1.00 235.73 ? 8   DG  C "H2'"  1 
ATOM 1588 H "H2''" . DG  C 3 8  ? 117.293 128.743 35.175 1.00 235.73 ? 8   DG  C "H2''" 1 
ATOM 1589 H "H1'"  . DG  C 3 8  ? 119.516 128.410 35.366 1.00 214.56 ? 8   DG  C "H1'"  1 
ATOM 1590 H H8     . DG  C 3 8  ? 117.852 126.913 38.314 1.00 200.89 ? 8   DG  C H8     1 
ATOM 1591 H H1     . DG  C 3 8  ? 121.378 123.028 35.168 1.00 184.36 ? 8   DG  C H1     1 
ATOM 1592 H H21    . DG  C 3 8  ? 122.144 125.537 33.212 1.00 269.75 ? 8   DG  C H21    1 
ATOM 1593 H H22    . DG  C 3 8  ? 122.365 124.087 33.473 1.00 269.75 ? 8   DG  C H22    1 
ATOM 1594 P P      . DG  C 3 9  ? 116.959 131.283 33.937 1.00 231.53 ? 9   DG  C P      1 
ATOM 1595 O OP1    . DG  C 3 9  ? 116.988 132.686 33.472 1.00 263.77 ? 9   DG  C OP1    1 
ATOM 1596 O OP2    . DG  C 3 9  ? 115.720 130.730 34.530 1.00 213.01 ? 9   DG  C OP2    1 
ATOM 1597 O "O5'"  . DG  C 3 9  ? 117.383 130.327 32.731 1.00 209.67 ? 9   DG  C "O5'"  1 
ATOM 1598 C "C5'"  . DG  C 3 9  ? 118.640 130.509 32.097 1.00 222.08 ? 9   DG  C "C5'"  1 
ATOM 1599 C "C4'"  . DG  C 3 9  ? 118.912 129.352 31.161 1.00 228.39 ? 9   DG  C "C4'"  1 
ATOM 1600 O "O4'"  . DG  C 3 9  ? 119.069 128.137 31.939 1.00 219.88 ? 9   DG  C "O4'"  1 
ATOM 1601 C "C3'"  . DG  C 3 9  ? 117.776 129.088 30.179 1.00 252.40 ? 9   DG  C "C3'"  1 
ATOM 1602 O "O3'"  . DG  C 3 9  ? 118.278 128.738 28.900 1.00 268.17 ? 9   DG  C "O3'"  1 
ATOM 1603 C "C2'"  . DG  C 3 9  ? 117.039 127.924 30.829 1.00 241.82 ? 9   DG  C "C2'"  1 
ATOM 1604 C "C1'"  . DG  C 3 9  ? 118.205 127.148 31.418 1.00 219.87 ? 9   DG  C "C1'"  1 
ATOM 1605 N N9     . DG  C 3 9  ? 117.823 126.200 32.459 1.00 205.90 ? 9   DG  C N9     1 
ATOM 1606 C C8     . DG  C 3 9  ? 116.985 126.394 33.532 1.00 214.13 ? 9   DG  C C8     1 
ATOM 1607 N N7     . DG  C 3 9  ? 116.852 125.334 34.281 1.00 208.45 ? 9   DG  C N7     1 
ATOM 1608 C C5     . DG  C 3 9  ? 117.655 124.381 33.667 1.00 196.08 ? 9   DG  C C5     1 
ATOM 1609 C C6     . DG  C 3 9  ? 117.917 123.038 34.021 1.00 182.71 ? 9   DG  C C6     1 
ATOM 1610 O O6     . DG  C 3 9  ? 117.473 122.397 34.985 1.00 179.54 ? 9   DG  C O6     1 
ATOM 1611 N N1     . DG  C 3 9  ? 118.792 122.435 33.118 1.00 166.54 ? 9   DG  C N1     1 
ATOM 1612 C C2     . DG  C 3 9  ? 119.344 123.051 32.017 1.00 169.22 ? 9   DG  C C2     1 
ATOM 1613 N N2     . DG  C 3 9  ? 120.168 122.319 31.257 1.00 183.47 ? 9   DG  C N2     1 
ATOM 1614 N N3     . DG  C 3 9  ? 119.106 124.307 31.678 1.00 155.41 ? 9   DG  C N3     1 
ATOM 1615 C C4     . DG  C 3 9  ? 118.257 124.903 32.546 1.00 185.81 ? 9   DG  C C4     1 
ATOM 1616 H "H5'"  . DG  C 3 9  ? 119.338 130.550 32.770 1.00 266.50 ? 9   DG  C "H5'"  1 
ATOM 1617 H "H5''" . DG  C 3 9  ? 118.630 131.337 31.592 1.00 266.50 ? 9   DG  C "H5''" 1 
ATOM 1618 H "H4'"  . DG  C 3 9  ? 119.729 129.524 30.667 1.00 274.07 ? 9   DG  C "H4'"  1 
ATOM 1619 H "H3'"  . DG  C 3 9  ? 117.196 129.863 30.117 1.00 302.89 ? 9   DG  C "H3'"  1 
ATOM 1620 H "H2'"  . DG  C 3 9  ? 116.440 128.235 31.525 1.00 290.18 ? 9   DG  C "H2'"  1 
ATOM 1621 H "H2''" . DG  C 3 9  ? 116.567 127.396 30.166 1.00 290.18 ? 9   DG  C "H2''" 1 
ATOM 1622 H "H1'"  . DG  C 3 9  ? 118.661 126.671 30.706 1.00 263.85 ? 9   DG  C "H1'"  1 
ATOM 1623 H H8     . DG  C 3 9  ? 116.552 127.199 33.704 1.00 256.95 ? 9   DG  C H8     1 
ATOM 1624 H H1     . DG  C 3 9  ? 119.005 121.614 33.261 1.00 199.85 ? 9   DG  C H1     1 
ATOM 1625 H H21    . DG  C 3 9  ? 120.534 122.666 30.560 1.00 220.17 ? 9   DG  C H21    1 
ATOM 1626 H H22    . DG  C 3 9  ? 120.332 121.500 31.465 1.00 220.17 ? 9   DG  C H22    1 
ATOM 1627 P P      . DG  C 3 10 ? 117.317 128.803 27.614 1.00 217.36 ? 10  DG  C P      1 
ATOM 1628 O OP1    . DG  C 3 10 ? 117.611 130.064 26.899 1.00 266.90 ? 10  DG  C OP1    1 
ATOM 1629 O OP2    . DG  C 3 10 ? 115.936 128.524 28.066 1.00 192.61 ? 10  DG  C OP2    1 
ATOM 1630 O "O5'"  . DG  C 3 10 ? 117.782 127.573 26.703 1.00 207.11 ? 10  DG  C "O5'"  1 
ATOM 1631 C "C5'"  . DG  C 3 10 ? 119.009 126.855 26.863 1.00 215.37 ? 10  DG  C "C5'"  1 
ATOM 1632 C "C4'"  . DG  C 3 10 ? 118.773 125.358 26.756 1.00 213.79 ? 10  DG  C "C4'"  1 
ATOM 1633 O "O4'"  . DG  C 3 10 ? 118.491 124.829 28.078 1.00 217.80 ? 10  DG  C "O4'"  1 
ATOM 1634 C "C3'"  . DG  C 3 10 ? 117.599 124.950 25.862 1.00 203.57 ? 10  DG  C "C3'"  1 
ATOM 1635 O "O3'"  . DG  C 3 10 ? 117.998 124.074 24.819 1.00 208.88 ? 10  DG  C "O3'"  1 
ATOM 1636 C "C2'"  . DG  C 3 10 ? 116.621 124.265 26.814 1.00 205.64 ? 10  DG  C "C2'"  1 
ATOM 1637 C "C1'"  . DG  C 3 10 ? 117.518 123.816 27.959 1.00 195.95 ? 10  DG  C "C1'"  1 
ATOM 1638 N N9     . DG  C 3 10 ? 116.800 123.641 29.218 1.00 163.20 ? 10  DG  C N9     1 
ATOM 1639 C C8     . DG  C 3 10 ? 116.044 124.569 29.894 1.00 171.07 ? 10  DG  C C8     1 
ATOM 1640 N N7     . DG  C 3 10 ? 115.518 124.108 30.995 1.00 171.80 ? 10  DG  C N7     1 
ATOM 1641 C C5     . DG  C 3 10 ? 115.956 122.792 31.056 1.00 183.38 ? 10  DG  C C5     1 
ATOM 1642 C C6     . DG  C 3 10 ? 115.706 121.791 32.024 1.00 174.70 ? 10  DG  C C6     1 
ATOM 1643 O O6     . DG  C 3 10 ? 115.027 121.881 33.058 1.00 147.27 ? 10  DG  C O6     1 
ATOM 1644 N N1     . DG  C 3 10 ? 116.342 120.593 31.696 1.00 149.68 ? 10  DG  C N1     1 
ATOM 1645 C C2     . DG  C 3 10 ? 117.116 120.393 30.575 1.00 133.59 ? 10  DG  C C2     1 
ATOM 1646 N N2     . DG  C 3 10 ? 117.652 119.173 30.421 1.00 100.14 ? 10  DG  C N2     1 
ATOM 1647 N N3     . DG  C 3 10 ? 117.354 121.322 29.661 1.00 146.78 ? 10  DG  C N3     1 
ATOM 1648 C C4     . DG  C 3 10 ? 116.743 122.490 29.967 1.00 163.56 ? 10  DG  C C4     1 
ATOM 1649 H "H5'"  . DG  C 3 10 ? 119.386 127.058 27.733 1.00 258.44 ? 10  DG  C "H5'"  1 
ATOM 1650 H "H5''" . DG  C 3 10 ? 119.632 127.131 26.173 1.00 258.44 ? 10  DG  C "H5''" 1 
ATOM 1651 H "H4'"  . DG  C 3 10 ? 119.581 124.940 26.419 1.00 256.54 ? 10  DG  C "H4'"  1 
ATOM 1652 H "H3'"  . DG  C 3 10 ? 117.186 125.742 25.484 1.00 244.28 ? 10  DG  C "H3'"  1 
ATOM 1653 H "H2'"  . DG  C 3 10 ? 115.952 124.893 27.129 1.00 246.77 ? 10  DG  C "H2'"  1 
ATOM 1654 H "H2''" . DG  C 3 10 ? 116.203 123.501 26.386 1.00 246.77 ? 10  DG  C "H2''" 1 
ATOM 1655 H "H1'"  . DG  C 3 10 ? 117.951 122.983 27.718 1.00 235.14 ? 10  DG  C "H1'"  1 
ATOM 1656 H H8     . DG  C 3 10 ? 115.917 125.440 29.594 1.00 205.28 ? 10  DG  C H8     1 
ATOM 1657 H H1     . DG  C 3 10 ? 116.244 119.930 32.235 1.00 179.61 ? 10  DG  C H1     1 
ATOM 1658 H H21    . DG  C 3 10 ? 118.143 119.002 29.736 1.00 120.17 ? 10  DG  C H21    1 
ATOM 1659 H H22    . DG  C 3 10 ? 117.505 118.561 31.007 1.00 120.17 ? 10  DG  C H22    1 
ATOM 1660 P P      . DC  C 3 11 ? 116.937 123.639 23.694 1.00 198.78 ? 11  DC  C P      1 
ATOM 1661 O OP1    . DC  C 3 11 ? 117.653 123.531 22.403 1.00 239.37 ? 11  DC  C OP1    1 
ATOM 1662 O OP2    . DC  C 3 11 ? 115.760 124.528 23.815 1.00 204.15 ? 11  DC  C OP2    1 
ATOM 1663 O "O5'"  . DC  C 3 11 ? 116.473 122.185 24.160 1.00 172.40 ? 11  DC  C "O5'"  1 
ATOM 1664 C "C5'"  . DC  C 3 11 ? 117.394 121.108 24.154 1.00 186.51 ? 11  DC  C "C5'"  1 
ATOM 1665 C "C4'"  . DC  C 3 11 ? 116.759 119.869 24.751 1.00 182.92 ? 11  DC  C "C4'"  1 
ATOM 1666 O "O4'"  . DC  C 3 11 ? 116.530 120.117 26.159 1.00 186.52 ? 11  DC  C "O4'"  1 
ATOM 1667 C "C3'"  . DC  C 3 11 ? 115.395 119.501 24.173 1.00 202.74 ? 11  DC  C "C3'"  1 
ATOM 1668 O "O3'"  . DC  C 3 11 ? 115.473 118.384 23.297 1.00 213.23 ? 11  DC  C "O3'"  1 
ATOM 1669 C "C2'"  . DC  C 3 11 ? 114.524 119.171 25.382 1.00 209.61 ? 11  DC  C "C2'"  1 
ATOM 1670 C "C1'"  . DC  C 3 11 ? 115.438 119.334 26.588 1.00 189.21 ? 11  DC  C "C1'"  1 
ATOM 1671 N N1     . DC  C 3 11 ? 114.739 120.012 27.720 1.00 158.93 ? 11  DC  C N1     1 
ATOM 1672 C C2     . DC  C 3 11 ? 114.388 119.290 28.867 1.00 154.61 ? 11  DC  C C2     1 
ATOM 1673 O O2     . DC  C 3 11 ? 114.675 118.088 28.942 1.00 141.09 ? 11  DC  C O2     1 
ATOM 1674 N N3     . DC  C 3 11 ? 113.744 119.933 29.876 1.00 176.83 ? 11  DC  C N3     1 
ATOM 1675 C C4     . DC  C 3 11 ? 113.448 121.230 29.761 1.00 175.15 ? 11  DC  C C4     1 
ATOM 1676 N N4     . DC  C 3 11 ? 112.814 121.824 30.780 1.00 187.78 ? 11  DC  C N4     1 
ATOM 1677 C C5     . DC  C 3 11 ? 113.794 121.979 28.598 1.00 155.69 ? 11  DC  C C5     1 
ATOM 1678 C C6     . DC  C 3 11 ? 114.429 121.336 27.612 1.00 149.49 ? 11  DC  C C6     1 
ATOM 1679 H "H5'"  . DC  C 3 11 ? 118.175 121.351 24.675 1.00 223.81 ? 11  DC  C "H5'"  1 
ATOM 1680 H "H5''" . DC  C 3 11 ? 117.664 120.922 23.241 1.00 223.81 ? 11  DC  C "H5''" 1 
ATOM 1681 H "H4'"  . DC  C 3 11 ? 117.363 119.117 24.652 1.00 219.50 ? 11  DC  C "H4'"  1 
ATOM 1682 H "H3'"  . DC  C 3 11 ? 115.023 120.263 23.701 1.00 243.29 ? 11  DC  C "H3'"  1 
ATOM 1683 H "H2'"  . DC  C 3 11 ? 113.779 119.788 25.439 1.00 251.54 ? 11  DC  C "H2'"  1 
ATOM 1684 H "H2''" . DC  C 3 11 ? 114.203 118.257 25.325 1.00 251.54 ? 11  DC  C "H2''" 1 
ATOM 1685 H "H1'"  . DC  C 3 11 ? 115.756 118.464 26.876 1.00 227.05 ? 11  DC  C "H1'"  1 
ATOM 1686 H H41    . DC  C 3 11 ? 112.611 122.658 30.733 1.00 225.33 ? 11  DC  C H41    1 
ATOM 1687 H H42    . DC  C 3 11 ? 112.611 121.371 31.482 1.00 225.33 ? 11  DC  C H42    1 
ATOM 1688 H H5     . DC  C 3 11 ? 113.586 122.883 28.527 1.00 186.83 ? 11  DC  C H5     1 
ATOM 1689 H H6     . DC  C 3 11 ? 114.665 121.800 26.842 1.00 179.39 ? 11  DC  C H6     1 
ATOM 1690 P P      . DC  C 3 12 ? 114.175 117.921 22.468 1.00 184.68 ? 12  DC  C P      1 
ATOM 1691 O OP1    . DC  C 3 12 ? 114.639 117.282 21.218 1.00 237.15 ? 12  DC  C OP1    1 
ATOM 1692 O OP2    . DC  C 3 12 ? 113.244 119.069 22.408 1.00 182.65 ? 12  DC  C OP2    1 
ATOM 1693 O "O5'"  . DC  C 3 12 ? 113.500 116.812 23.400 1.00 167.68 ? 12  DC  C "O5'"  1 
ATOM 1694 C "C5'"  . DC  C 3 12 ? 114.194 115.615 23.726 1.00 180.33 ? 12  DC  C "C5'"  1 
ATOM 1695 C "C4'"  . DC  C 3 12 ? 113.388 114.801 24.721 1.00 196.12 ? 12  DC  C "C4'"  1 
ATOM 1696 O "O4'"  . DC  C 3 12 ? 113.257 115.549 25.956 1.00 203.75 ? 12  DC  C "O4'"  1 
ATOM 1697 C "C3'"  . DC  C 3 12 ? 111.980 114.465 24.241 1.00 205.58 ? 12  DC  C "C3'"  1 
ATOM 1698 O "O3'"  . DC  C 3 12 ? 111.841 113.058 24.055 1.00 220.11 ? 12  DC  C "O3'"  1 
ATOM 1699 C "C2'"  . DC  C 3 12 ? 111.046 114.990 25.330 1.00 202.17 ? 12  DC  C "C2'"  1 
ATOM 1700 C "C1'"  . DC  C 3 12 ? 111.957 115.390 26.484 1.00 194.43 ? 12  DC  C "C1'"  1 
ATOM 1701 N N1     . DC  C 3 12 ? 111.558 116.670 27.155 1.00 151.79 ? 12  DC  C N1     1 
ATOM 1702 C C2     . DC  C 3 12 ? 110.970 116.660 28.427 1.00 155.40 ? 12  DC  C C2     1 
ATOM 1703 O O2     . DC  C 3 12 ? 110.758 115.578 28.989 1.00 150.07 ? 12  DC  C O2     1 
ATOM 1704 N N3     . DC  C 3 12 ? 110.623 117.839 29.008 1.00 150.02 ? 12  DC  C N3     1 
ATOM 1705 C C4     . DC  C 3 12 ? 110.860 118.988 28.373 1.00 165.55 ? 12  DC  C C4     1 
ATOM 1706 N N4     . DC  C 3 12 ? 110.509 120.129 28.978 1.00 180.15 ? 12  DC  C N4     1 
ATOM 1707 C C5     . DC  C 3 12 ? 111.472 119.020 27.085 1.00 174.44 ? 12  DC  C C5     1 
ATOM 1708 C C6     . DC  C 3 12 ? 111.801 117.852 26.523 1.00 151.72 ? 12  DC  C C6     1 
ATOM 1709 H "H5'"  . DC  C 3 12 ? 115.054 115.838 24.115 1.00 216.40 ? 12  DC  C "H5'"  1 
ATOM 1710 H "H5''" . DC  C 3 12 ? 114.331 115.093 22.920 1.00 216.40 ? 12  DC  C "H5''" 1 
ATOM 1711 H "H4'"  . DC  C 3 12 ? 113.861 113.975 24.905 1.00 235.35 ? 12  DC  C "H4'"  1 
ATOM 1712 H "H3'"  . DC  C 3 12 ? 111.801 114.926 23.407 1.00 246.70 ? 12  DC  C "H3'"  1 
ATOM 1713 H "HO3'" . DC  C 3 12 ? 111.266 112.631 24.493 1.00 264.13 ? 12  DC  C "HO3'" 1 
ATOM 1714 H "H2'"  . DC  C 3 12 ? 110.554 115.762 25.007 1.00 242.61 ? 12  DC  C "H2'"  1 
ATOM 1715 H "H2''" . DC  C 3 12 ? 110.433 114.293 25.611 1.00 242.61 ? 12  DC  C "H2''" 1 
ATOM 1716 H "H1'"  . DC  C 3 12 ? 111.967 114.677 27.141 1.00 233.32 ? 12  DC  C "H1'"  1 
ATOM 1717 H H41    . DC  C 3 12 ? 110.651 120.883 28.590 1.00 216.18 ? 12  DC  C H41    1 
ATOM 1718 H H42    . DC  C 3 12 ? 110.141 120.108 29.755 1.00 216.18 ? 12  DC  C H42    1 
ATOM 1719 H H5     . DC  C 3 12 ? 111.631 119.826 26.649 1.00 209.32 ? 12  DC  C H5     1 
ATOM 1720 H H6     . DC  C 3 12 ? 112.199 117.846 25.683 1.00 182.07 ? 12  DC  C H6     1 
ATOM 1721 N N      . THR D 1 8  ? 119.145 85.759  19.080 1.00 174.98 ? 100 THR D N      1 
ATOM 1722 C CA     . THR D 1 8  ? 118.765 86.967  18.356 1.00 203.76 ? 100 THR D CA     1 
ATOM 1723 C C      . THR D 1 8  ? 119.931 87.954  18.398 1.00 200.37 ? 100 THR D C      1 
ATOM 1724 O O      . THR D 1 8  ? 120.803 87.844  19.255 1.00 190.10 ? 100 THR D O      1 
ATOM 1725 C CB     . THR D 1 8  ? 117.492 87.607  18.962 1.00 192.73 ? 100 THR D CB     1 
ATOM 1726 O OG1    . THR D 1 8  ? 116.412 86.665  18.922 1.00 205.93 ? 100 THR D OG1    1 
ATOM 1727 C CG2    . THR D 1 8  ? 117.089 88.877  18.212 1.00 157.46 ? 100 THR D CG2    1 
ATOM 1728 H HA     . THR D 1 8  ? 118.585 86.744  17.429 1.00 244.51 ? 100 THR D HA     1 
ATOM 1729 H HB     . THR D 1 8  ? 117.668 87.847  19.885 1.00 231.28 ? 100 THR D HB     1 
ATOM 1730 H HG1    . THR D 1 8  ? 116.612 85.979  19.364 1.00 247.11 ? 100 THR D HG1    1 
ATOM 1731 H HG21   . THR D 1 8  ? 116.291 89.258  18.610 1.00 188.95 ? 100 THR D HG21   1 
ATOM 1732 H HG22   . THR D 1 8  ? 117.806 89.529  18.257 1.00 188.95 ? 100 THR D HG22   1 
ATOM 1733 H HG23   . THR D 1 8  ? 116.909 88.669  17.282 1.00 188.95 ? 100 THR D HG23   1 
ATOM 1734 N N      . VAL D 1 9  ? 119.969 88.890  17.455 1.00 191.66 ? 101 VAL D N      1 
ATOM 1735 C CA     . VAL D 1 9  ? 121.011 89.913  17.434 1.00 195.30 ? 101 VAL D CA     1 
ATOM 1736 C C      . VAL D 1 9  ? 120.492 91.155  16.714 1.00 192.09 ? 101 VAL D C      1 
ATOM 1737 O O      . VAL D 1 9  ? 119.690 91.048  15.785 1.00 191.20 ? 101 VAL D O      1 
ATOM 1738 C CB     . VAL D 1 9  ? 122.306 89.405  16.754 1.00 192.08 ? 101 VAL D CB     1 
ATOM 1739 C CG1    . VAL D 1 9  ? 122.011 88.859  15.364 1.00 184.39 ? 101 VAL D CG1    1 
ATOM 1740 C CG2    . VAL D 1 9  ? 123.358 90.512  16.688 1.00 160.84 ? 101 VAL D CG2    1 
ATOM 1741 H H      . VAL D 1 9  ? 119.401 88.955  16.813 1.00 229.99 ? 101 VAL D H      1 
ATOM 1742 H HA     . VAL D 1 9  ? 121.228 90.163  18.346 1.00 234.36 ? 101 VAL D HA     1 
ATOM 1743 H HB     . VAL D 1 9  ? 122.673 88.680  17.284 1.00 230.50 ? 101 VAL D HB     1 
ATOM 1744 H HG11   . VAL D 1 9  ? 122.839 88.549  14.964 1.00 221.27 ? 101 VAL D HG11   1 
ATOM 1745 H HG12   . VAL D 1 9  ? 121.385 88.123  15.441 1.00 221.27 ? 101 VAL D HG12   1 
ATOM 1746 H HG13   . VAL D 1 9  ? 121.627 89.566  14.822 1.00 221.27 ? 101 VAL D HG13   1 
ATOM 1747 H HG21   . VAL D 1 9  ? 124.156 90.165  16.258 1.00 193.01 ? 101 VAL D HG21   1 
ATOM 1748 H HG22   . VAL D 1 9  ? 123.003 91.255  16.175 1.00 193.01 ? 101 VAL D HG22   1 
ATOM 1749 H HG23   . VAL D 1 9  ? 123.568 90.803  17.589 1.00 193.01 ? 101 VAL D HG23   1 
ATOM 1750 N N      . PHE D 1 10 ? 120.954 92.329  17.142 1.00 164.59 ? 102 PHE D N      1 
ATOM 1751 C CA     . PHE D 1 10 ? 120.492 93.587  16.562 1.00 150.76 ? 102 PHE D CA     1 
ATOM 1752 C C      . PHE D 1 10 ? 121.444 94.022  15.462 1.00 152.24 ? 102 PHE D C      1 
ATOM 1753 O O      . PHE D 1 10 ? 122.601 93.603  15.424 1.00 162.86 ? 102 PHE D O      1 
ATOM 1754 C CB     . PHE D 1 10 ? 120.389 94.709  17.606 1.00 184.29 ? 102 PHE D CB     1 
ATOM 1755 C CG     . PHE D 1 10 ? 120.409 94.240  19.032 1.00 179.64 ? 102 PHE D CG     1 
ATOM 1756 C CD1    . PHE D 1 10 ? 119.229 94.005  19.717 1.00 134.70 ? 102 PHE D CD1    1 
ATOM 1757 C CD2    . PHE D 1 10 ? 121.611 94.063  19.697 1.00 165.25 ? 102 PHE D CD2    1 
ATOM 1758 C CE1    . PHE D 1 10 ? 119.248 93.585  21.031 1.00 161.65 ? 102 PHE D CE1    1 
ATOM 1759 C CE2    . PHE D 1 10 ? 121.636 93.643  21.012 1.00 134.67 ? 102 PHE D CE2    1 
ATOM 1760 C CZ     . PHE D 1 10 ? 120.453 93.404  21.680 1.00 166.45 ? 102 PHE D CZ     1 
ATOM 1761 H H      . PHE D 1 10 ? 121.536 92.423  17.767 1.00 197.51 ? 102 PHE D H      1 
ATOM 1762 H HA     . PHE D 1 10 ? 119.615 93.456  16.170 1.00 180.91 ? 102 PHE D HA     1 
ATOM 1763 H HB2    . PHE D 1 10 ? 121.136 95.315  17.485 1.00 221.14 ? 102 PHE D HB2    1 
ATOM 1764 H HB3    . PHE D 1 10 ? 119.556 95.186  17.466 1.00 221.14 ? 102 PHE D HB3    1 
ATOM 1765 H HD1    . PHE D 1 10 ? 118.414 94.125  19.284 1.00 161.64 ? 102 PHE D HD1    1 
ATOM 1766 H HD2    . PHE D 1 10 ? 122.411 94.221  19.250 1.00 198.30 ? 102 PHE D HD2    1 
ATOM 1767 H HE1    . PHE D 1 10 ? 118.449 93.425  21.480 1.00 193.99 ? 102 PHE D HE1    1 
ATOM 1768 H HE2    . PHE D 1 10 ? 122.449 93.521  21.447 1.00 161.60 ? 102 PHE D HE2    1 
ATOM 1769 H HZ     . PHE D 1 10 ? 120.467 93.121  22.566 1.00 199.74 ? 102 PHE D HZ     1 
ATOM 1770 N N      . SER D 1 11 ? 120.948 94.876  14.575 1.00 166.24 ? 103 SER D N      1 
ATOM 1771 C CA     . SER D 1 11 ? 121.726 95.353  13.440 1.00 159.25 ? 103 SER D CA     1 
ATOM 1772 C C      . SER D 1 11 ? 122.841 96.284  13.895 1.00 142.66 ? 103 SER D C      1 
ATOM 1773 O O      . SER D 1 11 ? 122.861 96.736  15.041 1.00 143.37 ? 103 SER D O      1 
ATOM 1774 C CB     . SER D 1 11 ? 120.820 96.070  12.438 1.00 171.73 ? 103 SER D CB     1 
ATOM 1775 O OG     . SER D 1 11 ? 120.168 97.176  13.041 1.00 170.82 ? 103 SER D OG     1 
ATOM 1776 H H      . SER D 1 11 ? 120.152 95.199  14.610 1.00 199.48 ? 103 SER D H      1 
ATOM 1777 H HA     . SER D 1 11 ? 122.130 94.594  12.992 1.00 191.10 ? 103 SER D HA     1 
ATOM 1778 H HB2    . SER D 1 11 ? 121.360 96.389  11.697 1.00 206.07 ? 103 SER D HB2    1 
ATOM 1779 H HB3    . SER D 1 11 ? 120.150 95.447  12.115 1.00 206.07 ? 103 SER D HB3    1 
ATOM 1780 H HG     . SER D 1 11 ? 119.675 97.560  12.479 1.00 204.99 ? 103 SER D HG     1 
ATOM 1781 N N      . SER D 1 12 ? 123.766 96.566  12.983 1.00 182.64 ? 104 SER D N      1 
ATOM 1782 C CA     . SER D 1 12 ? 124.882 97.461  13.258 1.00 184.90 ? 104 SER D CA     1 
ATOM 1783 C C      . SER D 1 12 ? 124.408 98.894  13.492 1.00 184.02 ? 104 SER D C      1 
ATOM 1784 O O      . SER D 1 12 ? 124.989 99.622  14.306 1.00 170.74 ? 104 SER D O      1 
ATOM 1785 C CB     . SER D 1 12 ? 125.882 97.419  12.099 1.00 172.22 ? 104 SER D CB     1 
ATOM 1786 O OG     . SER D 1 12 ? 127.019 98.219  12.371 1.00 187.47 ? 104 SER D OG     1 
ATOM 1787 H H      . SER D 1 12 ? 123.767 96.245  12.185 1.00 219.17 ? 104 SER D H      1 
ATOM 1788 H HA     . SER D 1 12 ? 125.338 97.160  14.059 1.00 221.88 ? 104 SER D HA     1 
ATOM 1789 H HB2    . SER D 1 12 ? 126.168 96.502  11.964 1.00 206.66 ? 104 SER D HB2    1 
ATOM 1790 H HB3    . SER D 1 12 ? 125.449 97.751  11.298 1.00 206.66 ? 104 SER D HB3    1 
ATOM 1791 H HG     . SER D 1 12 ? 127.556 98.184  11.726 1.00 224.97 ? 104 SER D HG     1 
ATOM 1792 N N      . THR D 1 13 ? 123.341 99.285  12.797 1.00 176.68 ? 105 THR D N      1 
ATOM 1793 C CA     . THR D 1 13 ? 122.763 100.614 12.966 1.00 160.90 ? 105 THR D CA     1 
ATOM 1794 C C      . THR D 1 13 ? 122.399 100.856 14.426 1.00 181.33 ? 105 THR D C      1 
ATOM 1795 O O      . THR D 1 13 ? 122.628 101.941 14.957 1.00 212.54 ? 105 THR D O      1 
ATOM 1796 C CB     . THR D 1 13 ? 121.499 100.804 12.099 1.00 175.86 ? 105 THR D CB     1 
ATOM 1797 O OG1    . THR D 1 13 ? 120.546 99.776  12.402 1.00 195.66 ? 105 THR D OG1    1 
ATOM 1798 C CG2    . THR D 1 13 ? 121.842 100.747 10.625 1.00 188.12 ? 105 THR D CG2    1 
ATOM 1799 H H      . THR D 1 13 ? 122.933 98.796  12.219 1.00 212.01 ? 105 THR D H      1 
ATOM 1800 H HA     . THR D 1 13 ? 123.415 101.282 12.701 1.00 193.08 ? 105 THR D HA     1 
ATOM 1801 H HB     . THR D 1 13 ? 121.107 101.671 12.288 1.00 211.04 ? 105 THR D HB     1 
ATOM 1802 H HG1    . THR D 1 13 ? 120.877 99.021  12.242 1.00 234.79 ? 105 THR D HG1    1 
ATOM 1803 H HG21   . THR D 1 13 ? 121.040 100.867 10.094 1.00 225.75 ? 105 THR D HG21   1 
ATOM 1804 H HG22   . THR D 1 13 ? 122.474 101.449 10.405 1.00 225.75 ? 105 THR D HG22   1 
ATOM 1805 H HG23   . THR D 1 13 ? 122.237 99.888  10.410 1.00 225.75 ? 105 THR D HG23   1 
ATOM 1806 N N      . GLN D 1 14 ? 121.834 99.840  15.071 1.00 161.20 ? 106 GLN D N      1 
ATOM 1807 C CA     . GLN D 1 14 ? 121.420 99.958  16.466 1.00 153.60 ? 106 GLN D CA     1 
ATOM 1808 C C      . GLN D 1 14 ? 122.616 99.789  17.405 1.00 160.51 ? 106 GLN D C      1 
ATOM 1809 O O      . GLN D 1 14 ? 122.817 100.589 18.327 1.00 169.84 ? 106 GLN D O      1 
ATOM 1810 C CB     . GLN D 1 14 ? 120.335 98.930  16.796 1.00 156.92 ? 106 GLN D CB     1 
ATOM 1811 C CG     . GLN D 1 14 ? 119.048 99.108  16.000 1.00 152.63 ? 106 GLN D CG     1 
ATOM 1812 C CD     . GLN D 1 14 ? 117.928 98.201  16.486 1.00 157.71 ? 106 GLN D CD     1 
ATOM 1813 O OE1    . GLN D 1 14 ? 118.115 96.995  16.651 1.00 137.76 ? 106 GLN D OE1    1 
ATOM 1814 N NE2    . GLN D 1 14 ? 116.758 98.783  16.727 1.00 146.07 ? 106 GLN D NE2    1 
ATOM 1815 H H      . GLN D 1 14 ? 121.678 99.069  14.723 1.00 193.44 ? 106 GLN D H      1 
ATOM 1816 H HA     . GLN D 1 14 ? 121.049 100.843 16.610 1.00 184.31 ? 106 GLN D HA     1 
ATOM 1817 H HB2    . GLN D 1 14 ? 120.678 98.043  16.608 1.00 188.30 ? 106 GLN D HB2    1 
ATOM 1818 H HB3    . GLN D 1 14 ? 120.112 99.003  17.737 1.00 188.30 ? 106 GLN D HB3    1 
ATOM 1819 H HG2    . GLN D 1 14 ? 118.748 100.026 16.084 1.00 183.15 ? 106 GLN D HG2    1 
ATOM 1820 H HG3    . GLN D 1 14 ? 119.220 98.898  15.069 1.00 183.15 ? 106 GLN D HG3    1 
ATOM 1821 H HE21   . GLN D 1 14 ? 116.666 99.630  16.605 1.00 175.28 ? 106 GLN D HE21   1 
ATOM 1822 H HE22   . GLN D 1 14 ? 116.093 98.314  17.004 1.00 175.28 ? 106 GLN D HE22   1 
ATOM 1823 N N      . LEU D 1 15 ? 123.416 98.754  17.153 1.00 140.63 ? 107 LEU D N      1 
ATOM 1824 C CA     . LEU D 1 15 ? 124.579 98.458  17.987 1.00 144.17 ? 107 LEU D CA     1 
ATOM 1825 C C      . LEU D 1 15 ? 125.508 99.661  18.070 1.00 153.66 ? 107 LEU D C      1 
ATOM 1826 O O      . LEU D 1 15 ? 126.127 99.926  19.110 1.00 167.05 ? 107 LEU D O      1 
ATOM 1827 C CB     . LEU D 1 15 ? 125.337 97.250  17.429 1.00 136.95 ? 107 LEU D CB     1 
ATOM 1828 C CG     . LEU D 1 15 ? 126.646 96.871  18.129 1.00 153.11 ? 107 LEU D CG     1 
ATOM 1829 C CD1    . LEU D 1 15 ? 126.416 96.642  19.613 1.00 166.80 ? 107 LEU D CD1    1 
ATOM 1830 C CD2    . LEU D 1 15 ? 127.262 95.635  17.487 1.00 167.37 ? 107 LEU D CD2    1 
ATOM 1831 H H      . LEU D 1 15 ? 123.307 98.205  16.500 1.00 168.76 ? 107 LEU D H      1 
ATOM 1832 H HA     . LEU D 1 15 ? 124.281 98.241  18.884 1.00 173.00 ? 107 LEU D HA     1 
ATOM 1833 H HB2    . LEU D 1 15 ? 124.753 96.477  17.477 1.00 164.34 ? 107 LEU D HB2    1 
ATOM 1834 H HB3    . LEU D 1 15 ? 125.551 97.430  16.500 1.00 164.34 ? 107 LEU D HB3    1 
ATOM 1835 H HG     . LEU D 1 15 ? 127.277 97.602  18.034 1.00 183.73 ? 107 LEU D HG     1 
ATOM 1836 H HD11   . LEU D 1 15 ? 127.259 96.404  20.029 1.00 200.16 ? 107 LEU D HD11   1 
ATOM 1837 H HD12   . LEU D 1 15 ? 126.070 97.457  20.008 1.00 200.16 ? 107 LEU D HD12   1 
ATOM 1838 H HD13   . LEU D 1 15 ? 125.776 95.921  19.725 1.00 200.16 ? 107 LEU D HD13   1 
ATOM 1839 H HD21   . LEU D 1 15 ? 128.088 95.418  17.948 1.00 200.84 ? 107 LEU D HD21   1 
ATOM 1840 H HD22   . LEU D 1 15 ? 126.638 94.897  17.561 1.00 200.84 ? 107 LEU D HD22   1 
ATOM 1841 H HD23   . LEU D 1 15 ? 127.445 95.822  16.553 1.00 200.84 ? 107 LEU D HD23   1 
ATOM 1842 N N      . CYS D 1 16 ? 125.570 100.409 16.975 1.00 135.02 ? 108 CYS D N      1 
ATOM 1843 C CA     . CYS D 1 16 ? 126.369 101.628 16.930 1.00 164.32 ? 108 CYS D CA     1 
ATOM 1844 C C      . CYS D 1 16 ? 125.897 102.661 17.955 1.00 151.25 ? 108 CYS D C      1 
ATOM 1845 O O      . CYS D 1 16 ? 126.632 102.984 18.891 1.00 165.11 ? 108 CYS D O      1 
ATOM 1846 C CB     . CYS D 1 16 ? 126.350 102.236 15.527 1.00 185.69 ? 108 CYS D CB     1 
ATOM 1847 S SG     . CYS D 1 16 ? 127.294 103.774 15.445 1.00 242.41 ? 108 CYS D SG     1 
ATOM 1848 H H      . CYS D 1 16 ? 125.158 100.232 16.241 1.00 162.03 ? 108 CYS D H      1 
ATOM 1849 H HA     . CYS D 1 16 ? 127.289 101.404 17.141 1.00 197.18 ? 108 CYS D HA     1 
ATOM 1850 H HB2    . CYS D 1 16 ? 126.742 101.607 14.902 1.00 222.83 ? 108 CYS D HB2    1 
ATOM 1851 H HB3    . CYS D 1 16 ? 125.433 102.430 15.276 1.00 222.83 ? 108 CYS D HB3    1 
ATOM 1852 H HG     . CYS D 1 16 ? 127.245 104.204 14.326 1.00 290.89 ? 108 CYS D HG     1 
ATOM 1853 N N      . VAL D 1 17 ? 124.686 103.185 17.767 1.00 143.65 ? 109 VAL D N      1 
ATOM 1854 C CA     . VAL D 1 17 ? 124.148 104.215 18.655 1.00 173.54 ? 109 VAL D CA     1 
ATOM 1855 C C      . VAL D 1 17 ? 124.165 103.716 20.099 1.00 163.67 ? 109 VAL D C      1 
ATOM 1856 O O      . VAL D 1 17 ? 124.407 104.490 21.034 1.00 171.02 ? 109 VAL D O      1 
ATOM 1857 C CB     . VAL D 1 17 ? 122.705 104.629 18.254 1.00 162.13 ? 109 VAL D CB     1 
ATOM 1858 C CG1    . VAL D 1 17 ? 121.763 103.431 18.258 1.00 155.22 ? 109 VAL D CG1    1 
ATOM 1859 C CG2    . VAL D 1 17 ? 122.177 105.734 19.170 1.00 164.66 ? 109 VAL D CG2    1 
ATOM 1860 H H      . VAL D 1 17 ? 124.155 102.960 17.129 1.00 172.38 ? 109 VAL D H      1 
ATOM 1861 H HA     . VAL D 1 17 ? 124.712 105.003 18.603 1.00 208.25 ? 109 VAL D HA     1 
ATOM 1862 H HB     . VAL D 1 17 ? 122.724 104.983 17.351 1.00 194.56 ? 109 VAL D HB     1 
ATOM 1863 H HG11   . VAL D 1 17 ? 120.875 103.727 18.004 1.00 186.27 ? 109 VAL D HG11   1 
ATOM 1864 H HG12   . VAL D 1 17 ? 122.087 102.773 17.623 1.00 186.27 ? 109 VAL D HG12   1 
ATOM 1865 H HG13   . VAL D 1 17 ? 121.743 103.049 19.149 1.00 186.27 ? 109 VAL D HG13   1 
ATOM 1866 H HG21   . VAL D 1 17 ? 121.278 105.969 18.895 1.00 197.59 ? 109 VAL D HG21   1 
ATOM 1867 H HG22   . VAL D 1 17 ? 122.170 105.408 20.084 1.00 197.59 ? 109 VAL D HG22   1 
ATOM 1868 H HG23   . VAL D 1 17 ? 122.759 106.507 19.099 1.00 197.59 ? 109 VAL D HG23   1 
ATOM 1869 N N      . LEU D 1 18 ? 123.923 102.419 20.271 1.00 144.71 ? 110 LEU D N      1 
ATOM 1870 C CA     . LEU D 1 18 ? 123.997 101.805 21.590 1.00 139.37 ? 110 LEU D CA     1 
ATOM 1871 C C      . LEU D 1 18 ? 125.394 101.998 22.191 1.00 139.57 ? 110 LEU D C      1 
ATOM 1872 O O      . LEU D 1 18 ? 125.531 102.556 23.287 1.00 163.47 ? 110 LEU D O      1 
ATOM 1873 C CB     . LEU D 1 18 ? 123.641 100.321 21.508 1.00 141.48 ? 110 LEU D CB     1 
ATOM 1874 C CG     . LEU D 1 18 ? 122.210 99.959  21.913 1.00 149.83 ? 110 LEU D CG     1 
ATOM 1875 C CD1    . LEU D 1 18 ? 121.178 100.784 21.147 1.00 150.02 ? 110 LEU D CD1    1 
ATOM 1876 C CD2    . LEU D 1 18 ? 121.968 98.475  21.697 1.00 144.90 ? 110 LEU D CD2    1 
ATOM 1877 H H      . LEU D 1 18 ? 123.714 101.874 19.640 1.00 173.65 ? 110 LEU D H      1 
ATOM 1878 H HA     . LEU D 1 18 ? 123.355 102.236 22.176 1.00 167.24 ? 110 LEU D HA     1 
ATOM 1879 H HB2    . LEU D 1 18 ? 123.768 100.026 20.593 1.00 169.78 ? 110 LEU D HB2    1 
ATOM 1880 H HB3    . LEU D 1 18 ? 124.241 99.830  22.092 1.00 169.78 ? 110 LEU D HB3    1 
ATOM 1881 H HG     . LEU D 1 18 ? 122.096 100.144 22.858 1.00 179.80 ? 110 LEU D HG     1 
ATOM 1882 H HD11   . LEU D 1 18 ? 120.289 100.522 21.434 1.00 180.03 ? 110 LEU D HD11   1 
ATOM 1883 H HD12   . LEU D 1 18 ? 121.324 101.724 21.336 1.00 180.03 ? 110 LEU D HD12   1 
ATOM 1884 H HD13   . LEU D 1 18 ? 121.282 100.617 20.197 1.00 180.03 ? 110 LEU D HD13   1 
ATOM 1885 H HD21   . LEU D 1 18 ? 121.059 98.262  21.958 1.00 173.88 ? 110 LEU D HD21   1 
ATOM 1886 H HD22   . LEU D 1 18 ? 122.101 98.266  20.759 1.00 173.88 ? 110 LEU D HD22   1 
ATOM 1887 H HD23   . LEU D 1 18 ? 122.595 97.971  22.240 1.00 173.88 ? 110 LEU D HD23   1 
ATOM 1888 N N      . ASN D 1 19 ? 126.427 101.546 21.481 1.00 127.38 ? 111 ASN D N      1 
ATOM 1889 C CA     . ASN D 1 19 ? 127.800 101.732 21.951 1.00 127.31 ? 111 ASN D CA     1 
ATOM 1890 C C      . ASN D 1 19 ? 128.142 103.203 22.181 1.00 125.91 ? 111 ASN D C      1 
ATOM 1891 O O      . ASN D 1 19 ? 128.810 103.549 23.162 1.00 148.42 ? 111 ASN D O      1 
ATOM 1892 C CB     . ASN D 1 19 ? 128.796 101.133 20.956 1.00 137.43 ? 111 ASN D CB     1 
ATOM 1893 C CG     . ASN D 1 19 ? 128.868 99.621  21.038 1.00 162.83 ? 111 ASN D CG     1 
ATOM 1894 O OD1    . ASN D 1 19 ? 128.707 99.036  22.110 1.00 185.64 ? 111 ASN D OD1    1 
ATOM 1895 N ND2    . ASN D 1 19 ? 129.123 98.980  19.903 1.00 146.01 ? 111 ASN D ND2    1 
ATOM 1896 H H      . ASN D 1 19 ? 126.361 101.132 20.730 1.00 152.86 ? 111 ASN D H      1 
ATOM 1897 H HA     . ASN D 1 19 ? 127.907 101.267 22.795 1.00 152.77 ? 111 ASN D HA     1 
ATOM 1898 H HB2    . ASN D 1 19 ? 128.526 101.372 20.056 1.00 164.92 ? 111 ASN D HB2    1 
ATOM 1899 H HB3    . ASN D 1 19 ? 129.680 101.486 21.143 1.00 164.92 ? 111 ASN D HB3    1 
ATOM 1900 H HD21   . ASN D 1 19 ? 129.237 99.423  19.175 1.00 175.21 ? 111 ASN D HD21   1 
ATOM 1901 H HD22   . ASN D 1 19 ? 129.174 98.121  19.896 1.00 175.21 ? 111 ASN D HD22   1 
ATOM 1902 N N      . ASP D 1 20 ? 127.680 104.062 21.276 1.00 131.85 ? 112 ASP D N      1 
ATOM 1903 C CA     . ASP D 1 20 ? 127.939 105.492 21.387 1.00 150.73 ? 112 ASP D CA     1 
ATOM 1904 C C      . ASP D 1 20 ? 127.376 106.018 22.702 1.00 160.60 ? 112 ASP D C      1 
ATOM 1905 O O      . ASP D 1 20 ? 128.063 106.736 23.431 1.00 186.53 ? 112 ASP D O      1 
ATOM 1906 C CB     . ASP D 1 20 ? 127.333 106.254 20.208 1.00 167.86 ? 112 ASP D CB     1 
ATOM 1907 C CG     . ASP D 1 20 ? 127.677 107.732 20.233 1.00 181.59 ? 112 ASP D CG     1 
ATOM 1908 O OD1    . ASP D 1 20 ? 127.091 108.468 21.053 1.00 171.98 ? 112 ASP D OD1    1 
ATOM 1909 O OD2    . ASP D 1 20 ? 128.533 108.161 19.430 1.00 193.05 ? 112 ASP D OD2    1 
ATOM 1910 H H      . ASP D 1 20 ? 127.213 103.841 20.588 1.00 158.22 ? 112 ASP D H      1 
ATOM 1911 H HA     . ASP D 1 20 ? 128.897 105.643 21.386 1.00 180.88 ? 112 ASP D HA     1 
ATOM 1912 H HB2    . ASP D 1 20 ? 127.674 105.880 19.380 1.00 201.44 ? 112 ASP D HB2    1 
ATOM 1913 H HB3    . ASP D 1 20 ? 126.367 106.170 20.238 1.00 201.44 ? 112 ASP D HB3    1 
ATOM 1914 N N      . ARG D 1 21 ? 126.127 105.668 22.999 1.00 160.84 ? 113 ARG D N      1 
ATOM 1915 C CA     . ARG D 1 21 ? 125.518 106.068 24.263 1.00 159.21 ? 113 ARG D CA     1 
ATOM 1916 C C      . ARG D 1 21 ? 126.289 105.476 25.434 1.00 133.92 ? 113 ARG D C      1 
ATOM 1917 O O      . ARG D 1 21 ? 126.543 106.162 26.424 1.00 141.29 ? 113 ARG D O      1 
ATOM 1918 C CB     . ARG D 1 21 ? 124.052 105.635 24.337 1.00 144.93 ? 113 ARG D CB     1 
ATOM 1919 C CG     . ARG D 1 21 ? 123.323 106.121 25.590 1.00 117.51 ? 113 ARG D CG     1 
ATOM 1920 C CD     . ARG D 1 21 ? 123.237 107.640 25.629 1.00 145.17 ? 113 ARG D CD     1 
ATOM 1921 N NE     . ARG D 1 21 ? 122.374 108.131 26.702 1.00 114.84 ? 113 ARG D NE     1 
ATOM 1922 C CZ     . ARG D 1 21 ? 121.046 108.191 26.634 1.00 153.00 ? 113 ARG D CZ     1 
ATOM 1923 N NH1    . ARG D 1 21 ? 120.408 107.779 25.546 1.00 181.00 ? 113 ARG D NH1    1 
ATOM 1924 N NH2    . ARG D 1 21 ? 120.352 108.657 27.663 1.00 157.60 ? 113 ARG D NH2    1 
ATOM 1925 H H      . ARG D 1 21 ? 125.615 105.202 22.489 1.00 193.01 ? 113 ARG D H      1 
ATOM 1926 H HA     . ARG D 1 21 ? 125.550 107.035 24.339 1.00 191.06 ? 113 ARG D HA     1 
ATOM 1927 H HB2    . ARG D 1 21 ? 123.583 105.989 23.565 1.00 173.92 ? 113 ARG D HB2    1 
ATOM 1928 H HB3    . ARG D 1 21 ? 124.013 104.666 24.328 1.00 173.92 ? 113 ARG D HB3    1 
ATOM 1929 H HG2    . ARG D 1 21 ? 122.420 105.765 25.594 1.00 141.01 ? 113 ARG D HG2    1 
ATOM 1930 H HG3    . ARG D 1 21 ? 123.805 105.823 26.377 1.00 141.01 ? 113 ARG D HG3    1 
ATOM 1931 H HD2    . ARG D 1 21 ? 124.125 108.004 25.769 1.00 174.21 ? 113 ARG D HD2    1 
ATOM 1932 H HD3    . ARG D 1 21 ? 122.877 107.958 24.786 1.00 174.21 ? 113 ARG D HD3    1 
ATOM 1933 H HE     . ARG D 1 21 ? 122.751 108.399 27.428 1.00 137.81 ? 113 ARG D HE     1 
ATOM 1934 H HH11   . ARG D 1 21 ? 120.853 107.476 24.875 1.00 217.20 ? 113 ARG D HH11   1 
ATOM 1935 H HH12   . ARG D 1 21 ? 119.549 107.819 25.510 1.00 217.20 ? 113 ARG D HH12   1 
ATOM 1936 H HH21   . ARG D 1 21 ? 120.759 108.923 28.372 1.00 189.12 ? 113 ARG D HH21   1 
ATOM 1937 H HH22   . ARG D 1 21 ? 119.493 108.692 27.621 1.00 189.12 ? 113 ARG D HH22   1 
ATOM 1938 N N      . PHE D 1 22 ? 126.654 104.201 25.322 1.00 131.65 ? 114 PHE D N      1 
ATOM 1939 C CA     . PHE D 1 22 ? 127.372 103.520 26.395 1.00 120.05 ? 114 PHE D CA     1 
ATOM 1940 C C      . PHE D 1 22 ? 128.699 104.197 26.734 1.00 132.35 ? 114 PHE D C      1 
ATOM 1941 O O      . PHE D 1 22 ? 129.038 104.339 27.910 1.00 145.11 ? 114 PHE D O      1 
ATOM 1942 C CB     . PHE D 1 22 ? 127.639 102.059 26.033 1.00 151.51 ? 114 PHE D CB     1 
ATOM 1943 C CG     . PHE D 1 22 ? 128.454 101.327 27.063 1.00 172.33 ? 114 PHE D CG     1 
ATOM 1944 C CD1    . PHE D 1 22 ? 127.851 100.799 28.192 1.00 156.53 ? 114 PHE D CD1    1 
ATOM 1945 C CD2    . PHE D 1 22 ? 129.823 101.183 26.911 1.00 192.16 ? 114 PHE D CD2    1 
ATOM 1946 C CE1    . PHE D 1 22 ? 128.596 100.131 29.147 1.00 139.82 ? 114 PHE D CE1    1 
ATOM 1947 C CE2    . PHE D 1 22 ? 130.575 100.516 27.864 1.00 175.28 ? 114 PHE D CE2    1 
ATOM 1948 C CZ     . PHE D 1 22 ? 129.959 99.990  28.983 1.00 136.54 ? 114 PHE D CZ     1 
ATOM 1949 H H      . PHE D 1 22 ? 126.497 103.708 24.635 1.00 157.98 ? 114 PHE D H      1 
ATOM 1950 H HA     . PHE D 1 22 ? 126.822 103.532 27.194 1.00 144.06 ? 114 PHE D HA     1 
ATOM 1951 H HB2    . PHE D 1 22 ? 126.790 101.598 25.942 1.00 181.81 ? 114 PHE D HB2    1 
ATOM 1952 H HB3    . PHE D 1 22 ? 128.123 102.027 25.193 1.00 181.81 ? 114 PHE D HB3    1 
ATOM 1953 H HD1    . PHE D 1 22 ? 126.933 100.891 28.308 1.00 187.84 ? 114 PHE D HD1    1 
ATOM 1954 H HD2    . PHE D 1 22 ? 130.242 101.535 26.160 1.00 230.59 ? 114 PHE D HD2    1 
ATOM 1955 H HE1    . PHE D 1 22 ? 128.179 99.778  29.900 1.00 167.79 ? 114 PHE D HE1    1 
ATOM 1956 H HE2    . PHE D 1 22 ? 131.493 100.422 27.750 1.00 210.34 ? 114 PHE D HE2    1 
ATOM 1957 H HZ     . PHE D 1 22 ? 130.462 99.541  29.624 1.00 163.84 ? 114 PHE D HZ     1 
ATOM 1958 N N      . GLN D 1 23 ? 129.451 104.597 25.711 1.00 146.24 ? 115 GLN D N      1 
ATOM 1959 C CA     . GLN D 1 23 ? 130.763 105.203 25.929 1.00 160.94 ? 115 GLN D CA     1 
ATOM 1960 C C      . GLN D 1 23 ? 130.730 106.404 26.879 1.00 161.78 ? 115 GLN D C      1 
ATOM 1961 O O      . GLN D 1 23 ? 131.652 106.586 27.677 1.00 186.68 ? 115 GLN D O      1 
ATOM 1962 C CB     . GLN D 1 23 ? 131.374 105.642 24.595 1.00 181.03 ? 115 GLN D CB     1 
ATOM 1963 C CG     . GLN D 1 23 ? 132.802 106.167 24.718 1.00 206.47 ? 115 GLN D CG     1 
ATOM 1964 C CD     . GLN D 1 23 ? 133.386 106.614 23.393 1.00 232.22 ? 115 GLN D CD     1 
ATOM 1965 O OE1    . GLN D 1 23 ? 132.707 106.606 22.367 1.00 247.75 ? 115 GLN D OE1    1 
ATOM 1966 N NE2    . GLN D 1 23 ? 134.652 107.016 23.411 1.00 232.03 ? 115 GLN D NE2    1 
ATOM 1967 H H      . GLN D 1 23 ? 129.226 104.529 24.884 1.00 175.48 ? 115 GLN D H      1 
ATOM 1968 H HA     . GLN D 1 23 ? 131.352 104.537 26.318 1.00 193.13 ? 115 GLN D HA     1 
ATOM 1969 H HB2    . GLN D 1 23 ? 131.387 104.883 23.992 1.00 217.24 ? 115 GLN D HB2    1 
ATOM 1970 H HB3    . GLN D 1 23 ? 130.828 106.351 24.220 1.00 217.24 ? 115 GLN D HB3    1 
ATOM 1971 H HG2    . GLN D 1 23 ? 132.807 106.928 25.319 1.00 247.76 ? 115 GLN D HG2    1 
ATOM 1972 H HG3    . GLN D 1 23 ? 133.367 105.462 25.072 1.00 247.76 ? 115 GLN D HG3    1 
ATOM 1973 H HE21   . GLN D 1 23 ? 135.094 107.013 24.149 1.00 278.43 ? 115 GLN D HE21   1 
ATOM 1974 H HE22   . GLN D 1 23 ? 135.030 107.279 22.684 1.00 278.43 ? 115 GLN D HE22   1 
ATOM 1975 N N      . ARG D 1 24 ? 129.676 107.214 26.798 1.00 136.23 ? 116 ARG D N      1 
ATOM 1976 C CA     . ARG D 1 24 ? 129.589 108.436 27.600 1.00 157.26 ? 116 ARG D CA     1 
ATOM 1977 C C      . ARG D 1 24 ? 128.679 108.310 28.829 1.00 144.83 ? 116 ARG D C      1 
ATOM 1978 O O      . ARG D 1 24 ? 128.682 109.189 29.692 1.00 153.30 ? 116 ARG D O      1 
ATOM 1979 C CB     . ARG D 1 24 ? 129.125 109.606 26.727 1.00 188.42 ? 116 ARG D CB     1 
ATOM 1980 C CG     . ARG D 1 24 ? 127.715 109.497 26.180 1.00 209.14 ? 116 ARG D CG     1 
ATOM 1981 C CD     . ARG D 1 24 ? 127.360 110.752 25.395 1.00 214.44 ? 116 ARG D CD     1 
ATOM 1982 N NE     . ARG D 1 24 ? 125.986 110.734 24.900 1.00 212.28 ? 116 ARG D NE     1 
ATOM 1983 C CZ     . ARG D 1 24 ? 125.601 110.156 23.767 1.00 198.30 ? 116 ARG D CZ     1 
ATOM 1984 N NH1    . ARG D 1 24 ? 126.482 109.532 22.997 1.00 179.72 ? 116 ARG D NH1    1 
ATOM 1985 N NH2    . ARG D 1 24 ? 124.327 110.196 23.402 1.00 202.51 ? 116 ARG D NH2    1 
ATOM 1986 H H      . ARG D 1 24 ? 128.998 107.080 26.286 1.00 163.47 ? 116 ARG D H      1 
ATOM 1987 H HA     . ARG D 1 24 ? 130.478 108.651 27.922 1.00 188.71 ? 116 ARG D HA     1 
ATOM 1988 H HB2    . ARG D 1 24 ? 129.170 110.419 27.255 1.00 226.10 ? 116 ARG D HB2    1 
ATOM 1989 H HB3    . ARG D 1 24 ? 129.726 109.679 25.969 1.00 226.10 ? 116 ARG D HB3    1 
ATOM 1990 H HG2    . ARG D 1 24 ? 127.656 108.734 25.585 1.00 250.96 ? 116 ARG D HG2    1 
ATOM 1991 H HG3    . ARG D 1 24 ? 127.088 109.406 26.915 1.00 250.96 ? 116 ARG D HG3    1 
ATOM 1992 H HD2    . ARG D 1 24 ? 127.462 111.525 25.972 1.00 257.33 ? 116 ARG D HD2    1 
ATOM 1993 H HD3    . ARG D 1 24 ? 127.954 110.826 24.632 1.00 257.33 ? 116 ARG D HD3    1 
ATOM 1994 H HE     . ARG D 1 24 ? 125.385 111.124 25.375 1.00 254.73 ? 116 ARG D HE     1 
ATOM 1995 H HH11   . ARG D 1 24 ? 127.310 109.502 23.228 1.00 215.66 ? 116 ARG D HH11   1 
ATOM 1996 H HH12   . ARG D 1 24 ? 126.225 109.159 22.266 1.00 215.66 ? 116 ARG D HH12   1 
ATOM 1997 H HH21   . ARG D 1 24 ? 123.750 110.598 23.897 1.00 243.01 ? 116 ARG D HH21   1 
ATOM 1998 H HH22   . ARG D 1 24 ? 124.077 109.821 22.670 1.00 243.01 ? 116 ARG D HH22   1 
ATOM 1999 N N      . GLN D 1 25 ? 127.901 107.234 28.909 1.00 122.61 ? 117 GLN D N      1 
ATOM 2000 C CA     . GLN D 1 25 ? 126.979 107.037 30.031 1.00 127.74 ? 117 GLN D CA     1 
ATOM 2001 C C      . GLN D 1 25 ? 126.730 105.556 30.309 1.00 114.52 ? 117 GLN D C      1 
ATOM 2002 O O      . GLN D 1 25 ? 126.082 104.867 29.525 1.00 115.55 ? 117 GLN D O      1 
ATOM 2003 C CB     . GLN D 1 25 ? 125.651 107.748 29.761 1.00 112.82 ? 117 GLN D CB     1 
ATOM 2004 C CG     . GLN D 1 25 ? 124.638 107.621 30.890 1.00 117.28 ? 117 GLN D CG     1 
ATOM 2005 C CD     . GLN D 1 25 ? 123.387 108.448 30.653 1.00 129.89 ? 117 GLN D CD     1 
ATOM 2006 O OE1    . GLN D 1 25 ? 123.318 109.235 29.711 1.00 130.52 ? 117 GLN D OE1    1 
ATOM 2007 N NE2    . GLN D 1 25 ? 122.387 108.265 31.507 1.00 140.13 ? 117 GLN D NE2    1 
ATOM 2008 H H      . GLN D 1 25 ? 127.886 106.601 28.327 1.00 147.14 ? 117 GLN D H      1 
ATOM 2009 H HA     . GLN D 1 25 ? 127.369 107.428 30.829 1.00 153.29 ? 117 GLN D HA     1 
ATOM 2010 H HB2    . GLN D 1 25 ? 125.825 108.693 29.626 1.00 135.38 ? 117 GLN D HB2    1 
ATOM 2011 H HB3    . GLN D 1 25 ? 125.252 107.371 28.962 1.00 135.38 ? 117 GLN D HB3    1 
ATOM 2012 H HG2    . GLN D 1 25 ? 124.372 106.692 30.972 1.00 140.74 ? 117 GLN D HG2    1 
ATOM 2013 H HG3    . GLN D 1 25 ? 125.045 107.925 31.716 1.00 140.74 ? 117 GLN D HG3    1 
ATOM 2014 H HE21   . GLN D 1 25 ? 122.469 107.702 32.152 1.00 168.16 ? 117 GLN D HE21   1 
ATOM 2015 H HE22   . GLN D 1 25 ? 121.656 108.710 31.416 1.00 168.16 ? 117 GLN D HE22   1 
ATOM 2016 N N      . LYS D 1 26 ? 127.253 105.080 31.436 1.00 131.56 ? 118 LYS D N      1 
ATOM 2017 C CA     . LYS D 1 26 ? 127.209 103.660 31.773 1.00 115.59 ? 118 LYS D CA     1 
ATOM 2018 C C      . LYS D 1 26 ? 125.925 103.236 32.493 1.00 121.41 ? 118 LYS D C      1 
ATOM 2019 O O      . LYS D 1 26 ? 125.613 102.046 32.546 1.00 121.75 ? 118 LYS D O      1 
ATOM 2020 C CB     . LYS D 1 26 ? 128.416 103.294 32.639 1.00 127.70 ? 118 LYS D CB     1 
ATOM 2021 C CG     . LYS D 1 26 ? 129.676 102.959 31.850 1.00 122.58 ? 118 LYS D CG     1 
ATOM 2022 C CD     . LYS D 1 26 ? 130.305 104.197 31.223 1.00 152.65 ? 118 LYS D CD     1 
ATOM 2023 C CE     . LYS D 1 26 ? 131.561 103.838 30.439 1.00 182.17 ? 118 LYS D CE     1 
ATOM 2024 N NZ     . LYS D 1 26 ? 132.315 105.042 29.989 1.00 195.80 ? 118 LYS D NZ     1 
ATOM 2025 H H      . LYS D 1 26 ? 127.644 105.565 32.029 1.00 157.87 ? 118 LYS D H      1 
ATOM 2026 H HA     . LYS D 1 26 ? 127.268 103.146 30.953 1.00 138.70 ? 118 LYS D HA     1 
ATOM 2027 H HB2    . LYS D 1 26 ? 128.622 104.045 33.218 1.00 153.24 ? 118 LYS D HB2    1 
ATOM 2028 H HB3    . LYS D 1 26 ? 128.190 102.519 33.176 1.00 153.24 ? 118 LYS D HB3    1 
ATOM 2029 H HG2    . LYS D 1 26 ? 130.327 102.558 32.447 1.00 147.09 ? 118 LYS D HG2    1 
ATOM 2030 H HG3    . LYS D 1 26 ? 129.450 102.341 31.138 1.00 147.09 ? 118 LYS D HG3    1 
ATOM 2031 H HD2    . LYS D 1 26 ? 129.671 104.605 30.612 1.00 183.18 ? 118 LYS D HD2    1 
ATOM 2032 H HD3    . LYS D 1 26 ? 130.550 104.822 31.922 1.00 183.18 ? 118 LYS D HD3    1 
ATOM 2033 H HE2    . LYS D 1 26 ? 132.147 103.310 31.004 1.00 218.61 ? 118 LYS D HE2    1 
ATOM 2034 H HE3    . LYS D 1 26 ? 131.310 103.329 29.653 1.00 218.61 ? 118 LYS D HE3    1 
ATOM 2035 H HZ1    . LYS D 1 26 ? 133.040 104.795 29.536 1.00 234.97 ? 118 LYS D HZ1    1 
ATOM 2036 H HZ2    . LYS D 1 26 ? 131.801 105.542 29.462 1.00 234.97 ? 118 LYS D HZ2    1 
ATOM 2037 H HZ3    . LYS D 1 26 ? 132.564 105.525 30.693 1.00 234.97 ? 118 LYS D HZ3    1 
ATOM 2038 N N      . TYR D 1 27 ? 125.192 104.198 33.052 1.00 115.03 ? 119 TYR D N      1 
ATOM 2039 C CA     . TYR D 1 27 ? 123.927 103.906 33.731 1.00 115.12 ? 119 TYR D CA     1 
ATOM 2040 C C      . TYR D 1 27 ? 122.793 104.783 33.214 1.00 123.59 ? 119 TYR D C      1 
ATOM 2041 O O      . TYR D 1 27 ? 122.882 106.011 33.238 1.00 146.27 ? 119 TYR D O      1 
ATOM 2042 C CB     . TYR D 1 27 ? 124.078 104.080 35.244 1.00 122.46 ? 119 TYR D CB     1 
ATOM 2043 C CG     . TYR D 1 27 ? 124.957 103.028 35.882 1.00 142.97 ? 119 TYR D CG     1 
ATOM 2044 C CD1    . TYR D 1 27 ? 126.337 103.183 35.932 1.00 135.06 ? 119 TYR D CD1    1 
ATOM 2045 C CD2    . TYR D 1 27 ? 124.408 101.871 36.422 1.00 115.84 ? 119 TYR D CD2    1 
ATOM 2046 C CE1    . TYR D 1 27 ? 127.143 102.221 36.509 1.00 115.72 ? 119 TYR D CE1    1 
ATOM 2047 C CE2    . TYR D 1 27 ? 125.207 100.904 37.000 1.00 117.12 ? 119 TYR D CE2    1 
ATOM 2048 C CZ     . TYR D 1 27 ? 126.574 101.084 37.040 1.00 137.00 ? 119 TYR D CZ     1 
ATOM 2049 O OH     . TYR D 1 27 ? 127.374 100.123 37.614 1.00 150.59 ? 119 TYR D OH     1 
ATOM 2050 H H      . TYR D 1 27 ? 125.405 105.032 33.052 1.00 138.03 ? 119 TYR D H      1 
ATOM 2051 H HA     . TYR D 1 27 ? 123.688 102.982 33.561 1.00 138.14 ? 119 TYR D HA     1 
ATOM 2052 H HB2    . TYR D 1 27 ? 124.474 104.948 35.423 1.00 146.96 ? 119 TYR D HB2    1 
ATOM 2053 H HB3    . TYR D 1 27 ? 123.202 104.026 35.656 1.00 146.96 ? 119 TYR D HB3    1 
ATOM 2054 H HD1    . TYR D 1 27 ? 126.724 103.949 35.574 1.00 162.07 ? 119 TYR D HD1    1 
ATOM 2055 H HD2    . TYR D 1 27 ? 123.487 101.748 36.396 1.00 139.01 ? 119 TYR D HD2    1 
ATOM 2056 H HE1    . TYR D 1 27 ? 128.065 102.339 36.537 1.00 138.87 ? 119 TYR D HE1    1 
ATOM 2057 H HE2    . TYR D 1 27 ? 124.825 100.136 37.359 1.00 140.55 ? 119 TYR D HE2    1 
ATOM 2058 H HH     . TYR D 1 27 ? 128.180 100.358 37.571 1.00 180.71 ? 119 TYR D HH     1 
ATOM 2059 N N      . LEU D 1 28 ? 121.726 104.132 32.757 1.00 114.01 ? 120 LEU D N      1 
ATOM 2060 C CA     . LEU D 1 28 ? 120.597 104.810 32.128 1.00 127.50 ? 120 LEU D CA     1 
ATOM 2061 C C      . LEU D 1 28 ? 119.345 104.727 32.992 1.00 136.39 ? 120 LEU D C      1 
ATOM 2062 O O      . LEU D 1 28 ? 119.114 103.724 33.670 1.00 118.07 ? 120 LEU D O      1 
ATOM 2063 C CB     . LEU D 1 28 ? 120.305 104.197 30.756 1.00 146.72 ? 120 LEU D CB     1 
ATOM 2064 C CG     . LEU D 1 28 ? 121.165 104.625 29.562 1.00 129.69 ? 120 LEU D CG     1 
ATOM 2065 C CD1    . LEU D 1 28 ? 120.883 106.064 29.195 1.00 138.77 ? 120 LEU D CD1    1 
ATOM 2066 C CD2    . LEU D 1 28 ? 122.649 104.426 29.830 1.00 141.07 ? 120 LEU D CD2    1 
ATOM 2067 H H      . LEU D 1 28 ? 121.632 103.279 32.801 1.00 136.81 ? 120 LEU D H      1 
ATOM 2068 H HA     . LEU D 1 28 ? 120.816 105.747 32.002 1.00 153.00 ? 120 LEU D HA     1 
ATOM 2069 H HB2    . LEU D 1 28 ? 120.398 103.235 30.836 1.00 176.06 ? 120 LEU D HB2    1 
ATOM 2070 H HB3    . LEU D 1 28 ? 119.386 104.406 30.527 1.00 176.06 ? 120 LEU D HB3    1 
ATOM 2071 H HG     . LEU D 1 28 ? 120.929 104.076 28.798 1.00 155.63 ? 120 LEU D HG     1 
ATOM 2072 H HD11   . LEU D 1 28 ? 121.439 106.310 28.438 1.00 166.52 ? 120 LEU D HD11   1 
ATOM 2073 H HD12   . LEU D 1 28 ? 119.946 106.151 28.960 1.00 166.52 ? 120 LEU D HD12   1 
ATOM 2074 H HD13   . LEU D 1 28 ? 121.089 106.629 29.955 1.00 166.52 ? 120 LEU D HD13   1 
ATOM 2075 H HD21   . LEU D 1 28 ? 123.151 104.710 29.050 1.00 169.28 ? 120 LEU D HD21   1 
ATOM 2076 H HD22   . LEU D 1 28 ? 122.904 104.958 30.599 1.00 169.28 ? 120 LEU D HD22   1 
ATOM 2077 H HD23   . LEU D 1 28 ? 122.814 103.487 30.006 1.00 169.28 ? 120 LEU D HD23   1 
ATOM 2078 N N      . SER D 1 29 ? 118.539 105.784 32.961 1.00 121.82 ? 121 SER D N      1 
ATOM 2079 C CA     . SER D 1 29 ? 117.274 105.803 33.685 1.00 113.09 ? 121 SER D CA     1 
ATOM 2080 C C      . SER D 1 29 ? 116.246 104.932 32.974 1.00 147.71 ? 121 SER D C      1 
ATOM 2081 O O      . SER D 1 29 ? 116.501 104.412 31.887 1.00 127.01 ? 121 SER D O      1 
ATOM 2082 C CB     . SER D 1 29 ? 116.743 107.230 33.816 1.00 151.07 ? 121 SER D CB     1 
ATOM 2083 O OG     . SER D 1 29 ? 116.210 107.686 32.588 1.00 129.95 ? 121 SER D OG     1 
ATOM 2084 H H      . SER D 1 29 ? 118.704 106.506 32.525 1.00 146.18 ? 121 SER D H      1 
ATOM 2085 H HA     . SER D 1 29 ? 117.410 105.446 34.577 1.00 135.71 ? 121 SER D HA     1 
ATOM 2086 H HB2    . SER D 1 29 ? 116.044 107.246 34.488 1.00 181.28 ? 121 SER D HB2    1 
ATOM 2087 H HB3    . SER D 1 29 ? 117.471 107.815 34.080 1.00 181.28 ? 121 SER D HB3    1 
ATOM 2088 H HG     . SER D 1 29 ? 115.922 108.470 32.673 1.00 155.94 ? 121 SER D HG     1 
ATOM 2089 N N      . LEU D 1 30 ? 115.085 104.771 33.598 1.00 143.01 ? 122 LEU D N      1 
ATOM 2090 C CA     . LEU D 1 30 ? 113.988 104.028 32.994 1.00 126.07 ? 122 LEU D CA     1 
ATOM 2091 C C      . LEU D 1 30 ? 113.545 104.740 31.720 1.00 132.54 ? 122 LEU D C      1 
ATOM 2092 O O      . LEU D 1 30 ? 113.461 104.134 30.650 1.00 149.61 ? 122 LEU D O      1 
ATOM 2093 C CB     . LEU D 1 30 ? 112.820 103.897 33.975 1.00 122.53 ? 122 LEU D CB     1 
ATOM 2094 C CG     . LEU D 1 30 ? 111.573 103.173 33.467 1.00 133.04 ? 122 LEU D CG     1 
ATOM 2095 C CD1    . LEU D 1 30 ? 111.879 101.708 33.198 1.00 157.33 ? 122 LEU D CD1    1 
ATOM 2096 C CD2    . LEU D 1 30 ? 110.435 103.313 34.465 1.00 146.48 ? 122 LEU D CD2    1 
ATOM 2097 H H      . LEU D 1 30 ? 114.907 105.084 34.379 1.00 171.61 ? 122 LEU D H      1 
ATOM 2098 H HA     . LEU D 1 30 ? 114.292 103.137 32.758 1.00 151.29 ? 122 LEU D HA     1 
ATOM 2099 H HB2    . LEU D 1 30 ? 113.134 103.415 34.756 1.00 147.03 ? 122 LEU D HB2    1 
ATOM 2100 H HB3    . LEU D 1 30 ? 112.546 104.789 34.239 1.00 147.03 ? 122 LEU D HB3    1 
ATOM 2101 H HG     . LEU D 1 30 ? 111.291 103.578 32.632 1.00 159.65 ? 122 LEU D HG     1 
ATOM 2102 H HD11   . LEU D 1 30 ? 111.074 101.271 32.878 1.00 188.80 ? 122 LEU D HD11   1 
ATOM 2103 H HD12   . LEU D 1 30 ? 112.577 101.650 32.527 1.00 188.80 ? 122 LEU D HD12   1 
ATOM 2104 H HD13   . LEU D 1 30 ? 112.177 101.292 34.022 1.00 188.80 ? 122 LEU D HD13   1 
ATOM 2105 H HD21   . LEU D 1 30 ? 109.656 102.847 34.122 1.00 175.78 ? 122 LEU D HD21   1 
ATOM 2106 H HD22   . LEU D 1 30 ? 110.707 102.926 35.311 1.00 175.78 ? 122 LEU D HD22   1 
ATOM 2107 H HD23   . LEU D 1 30 ? 110.232 104.255 34.582 1.00 175.78 ? 122 LEU D HD23   1 
ATOM 2108 N N      . GLN D 1 31 ? 113.271 106.035 31.854 1.00 145.78 ? 123 GLN D N      1 
ATOM 2109 C CA     . GLN D 1 31 ? 112.811 106.855 30.739 1.00 149.11 ? 123 GLN D CA     1 
ATOM 2110 C C      . GLN D 1 31 ? 113.809 106.822 29.590 1.00 156.60 ? 123 GLN D C      1 
ATOM 2111 O O      . GLN D 1 31 ? 113.429 106.660 28.432 1.00 170.05 ? 123 GLN D O      1 
ATOM 2112 C CB     . GLN D 1 31 ? 112.597 108.303 31.191 1.00 181.65 ? 123 GLN D CB     1 
ATOM 2113 C CG     . GLN D 1 31 ? 112.215 109.263 30.065 1.00 205.25 ? 123 GLN D CG     1 
ATOM 2114 C CD     . GLN D 1 31 ? 112.282 110.718 30.482 1.00 217.56 ? 123 GLN D CD     1 
ATOM 2115 O OE1    . GLN D 1 31 ? 112.573 111.035 31.635 1.00 233.17 ? 123 GLN D OE1    1 
ATOM 2116 N NE2    . GLN D 1 31 ? 112.017 111.615 29.538 1.00 213.37 ? 123 GLN D NE2    1 
ATOM 2117 H H      . GLN D 1 31 ? 113.344 106.468 32.593 1.00 174.94 ? 123 GLN D H      1 
ATOM 2118 H HA     . GLN D 1 31 ? 111.965 106.509 30.416 1.00 178.93 ? 123 GLN D HA     1 
ATOM 2119 H HB2    . GLN D 1 31 ? 111.884 108.321 31.849 1.00 217.98 ? 123 GLN D HB2    1 
ATOM 2120 H HB3    . GLN D 1 31 ? 113.419 108.629 31.591 1.00 217.98 ? 123 GLN D HB3    1 
ATOM 2121 H HG2    . GLN D 1 31 ? 112.825 109.135 29.322 1.00 246.30 ? 123 GLN D HG2    1 
ATOM 2122 H HG3    . GLN D 1 31 ? 111.306 109.073 29.784 1.00 246.30 ? 123 GLN D HG3    1 
ATOM 2123 H HE21   . GLN D 1 31 ? 111.821 111.355 28.741 1.00 256.04 ? 123 GLN D HE21   1 
ATOM 2124 H HE22   . GLN D 1 31 ? 112.042 112.454 29.723 1.00 256.04 ? 123 GLN D HE22   1 
ATOM 2125 N N      . GLN D 1 32 ? 115.083 106.991 29.920 1.00 114.33 ? 124 GLN D N      1 
ATOM 2126 C CA     . GLN D 1 32 ? 116.135 107.041 28.915 1.00 144.16 ? 124 GLN D CA     1 
ATOM 2127 C C      . GLN D 1 32 ? 116.220 105.720 28.153 1.00 115.91 ? 124 GLN D C      1 
ATOM 2128 O O      . GLN D 1 32 ? 116.302 105.701 26.921 1.00 126.90 ? 124 GLN D O      1 
ATOM 2129 C CB     . GLN D 1 32 ? 117.473 107.378 29.573 1.00 134.74 ? 124 GLN D CB     1 
ATOM 2130 C CG     . GLN D 1 32 ? 117.554 108.815 30.083 1.00 126.82 ? 124 GLN D CG     1 
ATOM 2131 C CD     . GLN D 1 32 ? 118.748 109.061 30.988 1.00 150.21 ? 124 GLN D CD     1 
ATOM 2132 O OE1    . GLN D 1 32 ? 119.335 108.127 31.536 1.00 154.70 ? 124 GLN D OE1    1 
ATOM 2133 N NE2    . GLN D 1 32 ? 119.110 110.329 31.152 1.00 188.35 ? 124 GLN D NE2    1 
ATOM 2134 H H      . GLN D 1 32 ? 115.367 107.081 30.727 1.00 137.20 ? 124 GLN D H      1 
ATOM 2135 H HA     . GLN D 1 32 ? 115.929 107.742 28.277 1.00 172.99 ? 124 GLN D HA     1 
ATOM 2136 H HB2    . GLN D 1 32 ? 117.608 106.786 30.330 1.00 161.69 ? 124 GLN D HB2    1 
ATOM 2137 H HB3    . GLN D 1 32 ? 118.182 107.252 28.924 1.00 161.69 ? 124 GLN D HB3    1 
ATOM 2138 H HG2    . GLN D 1 32 ? 117.626 109.414 29.324 1.00 152.18 ? 124 GLN D HG2    1 
ATOM 2139 H HG3    . GLN D 1 32 ? 116.751 109.016 30.588 1.00 152.18 ? 124 GLN D HG3    1 
ATOM 2140 H HE21   . GLN D 1 32 ? 118.673 110.956 30.756 1.00 226.02 ? 124 GLN D HE21   1 
ATOM 2141 H HE22   . GLN D 1 32 ? 119.780 110.524 31.655 1.00 226.02 ? 124 GLN D HE22   1 
ATOM 2142 N N      . MET D 1 33 ? 116.200 104.614 28.889 1.00 119.71 ? 125 MET D N      1 
ATOM 2143 C CA     . MET D 1 33 ? 116.202 103.297 28.265 1.00 131.67 ? 125 MET D CA     1 
ATOM 2144 C C      . MET D 1 33 ? 114.965 103.115 27.387 1.00 137.07 ? 125 MET D C      1 
ATOM 2145 O O      . MET D 1 33 ? 115.066 102.639 26.255 1.00 155.46 ? 125 MET D O      1 
ATOM 2146 C CB     . MET D 1 33 ? 116.265 102.194 29.322 1.00 150.59 ? 125 MET D CB     1 
ATOM 2147 C CG     . MET D 1 33 ? 117.659 101.948 29.879 1.00 139.71 ? 125 MET D CG     1 
ATOM 2148 S SD     . MET D 1 33 ? 117.750 100.454 30.888 1.00 144.17 ? 125 MET D SD     1 
ATOM 2149 C CE     . MET D 1 33 ? 119.477 100.469 31.365 1.00 118.54 ? 125 MET D CE     1 
ATOM 2150 H H      . MET D 1 33 ? 116.185 104.599 29.749 1.00 143.65 ? 125 MET D H      1 
ATOM 2151 H HA     . MET D 1 33 ? 116.992 103.218 27.708 1.00 158.01 ? 125 MET D HA     1 
ATOM 2152 H HB2    . MET D 1 33 ? 115.689 102.439 30.063 1.00 180.71 ? 125 MET D HB2    1 
ATOM 2153 H HB3    . MET D 1 33 ? 115.955 101.364 28.926 1.00 180.71 ? 125 MET D HB3    1 
ATOM 2154 H HG2    . MET D 1 33 ? 118.282 101.852 29.142 1.00 167.65 ? 125 MET D HG2    1 
ATOM 2155 H HG3    . MET D 1 33 ? 117.915 102.701 30.435 1.00 167.65 ? 125 MET D HG3    1 
ATOM 2156 H HE1    . MET D 1 33 ? 119.656 99.697  31.924 1.00 142.24 ? 125 MET D HE1    1 
ATOM 2157 H HE2    . MET D 1 33 ? 120.025 100.435 30.566 1.00 142.24 ? 125 MET D HE2    1 
ATOM 2158 H HE3    . MET D 1 33 ? 119.661 101.284 31.858 1.00 142.24 ? 125 MET D HE3    1 
ATOM 2159 N N      . GLN D 1 34 ? 113.799 103.494 27.907 1.00 146.03 ? 126 GLN D N      1 
ATOM 2160 C CA     . GLN D 1 34 ? 112.551 103.302 27.170 1.00 141.29 ? 126 GLN D CA     1 
ATOM 2161 C C      . GLN D 1 34 ? 112.493 104.169 25.915 1.00 146.41 ? 126 GLN D C      1 
ATOM 2162 O O      . GLN D 1 34 ? 111.986 103.729 24.884 1.00 184.05 ? 126 GLN D O      1 
ATOM 2163 C CB     . GLN D 1 34 ? 111.334 103.585 28.055 1.00 154.35 ? 126 GLN D CB     1 
ATOM 2164 C CG     . GLN D 1 34 ? 110.984 102.437 28.993 1.00 193.57 ? 126 GLN D CG     1 
ATOM 2165 C CD     . GLN D 1 34 ? 109.669 102.647 29.717 1.00 199.55 ? 126 GLN D CD     1 
ATOM 2166 O OE1    . GLN D 1 34 ? 109.189 103.772 29.847 1.00 193.76 ? 126 GLN D OE1    1 
ATOM 2167 N NE2    . GLN D 1 34 ? 109.072 101.556 30.185 1.00 202.71 ? 126 GLN D NE2    1 
ATOM 2168 H H      . GLN D 1 34 ? 113.703 103.862 28.678 1.00 175.23 ? 126 GLN D H      1 
ATOM 2169 H HA     . GLN D 1 34 ? 112.499 102.375 26.888 1.00 169.55 ? 126 GLN D HA     1 
ATOM 2170 H HB2    . GLN D 1 34 ? 111.517 104.368 28.598 1.00 185.22 ? 126 GLN D HB2    1 
ATOM 2171 H HB3    . GLN D 1 34 ? 110.565 103.751 27.487 1.00 185.22 ? 126 GLN D HB3    1 
ATOM 2172 H HG2    . GLN D 1 34 ? 110.915 101.618 28.477 1.00 232.28 ? 126 GLN D HG2    1 
ATOM 2173 H HG3    . GLN D 1 34 ? 111.683 102.350 29.660 1.00 232.28 ? 126 GLN D HG3    1 
ATOM 2174 H HE21   . GLN D 1 34 ? 109.434 100.784 30.069 1.00 243.25 ? 126 GLN D HE21   1 
ATOM 2175 H HE22   . GLN D 1 34 ? 108.323 101.621 30.603 1.00 243.25 ? 126 GLN D HE22   1 
ATOM 2176 N N      . GLU D 1 35 ? 112.999 105.397 25.998 1.00 132.26 ? 127 GLU D N      1 
ATOM 2177 C CA     . GLU D 1 35 ? 113.008 106.281 24.837 1.00 150.25 ? 127 GLU D CA     1 
ATOM 2178 C C      . GLU D 1 35 ? 114.011 105.743 23.814 1.00 145.21 ? 127 GLU D C      1 
ATOM 2179 O O      . GLU D 1 35 ? 113.720 105.687 22.610 1.00 167.09 ? 127 GLU D O      1 
ATOM 2180 C CB     . GLU D 1 35 ? 113.328 107.731 25.247 1.00 161.20 ? 127 GLU D CB     1 
ATOM 2181 C CG     . GLU D 1 35 ? 114.806 108.111 25.283 1.00 199.03 ? 127 GLU D CG     1 
ATOM 2182 C CD     . GLU D 1 35 ? 115.027 109.574 25.632 1.00 233.54 ? 127 GLU D CD     1 
ATOM 2183 O OE1    . GLU D 1 35 ? 114.078 110.221 26.121 1.00 248.61 ? 127 GLU D OE1    1 
ATOM 2184 O OE2    . GLU D 1 35 ? 116.152 110.074 25.421 1.00 241.94 ? 127 GLU D OE2    1 
ATOM 2185 H H      . GLU D 1 35 ? 113.340 105.739 26.710 1.00 158.71 ? 127 GLU D H      1 
ATOM 2186 H HA     . GLU D 1 35 ? 112.129 106.273 24.427 1.00 180.30 ? 127 GLU D HA     1 
ATOM 2187 H HB2    . GLU D 1 35 ? 112.893 108.328 24.618 1.00 193.44 ? 127 GLU D HB2    1 
ATOM 2188 H HB3    . GLU D 1 35 ? 112.970 107.882 26.135 1.00 193.44 ? 127 GLU D HB3    1 
ATOM 2189 H HG2    . GLU D 1 35 ? 115.255 107.571 25.953 1.00 238.84 ? 127 GLU D HG2    1 
ATOM 2190 H HG3    . GLU D 1 35 ? 115.196 107.948 24.410 1.00 238.84 ? 127 GLU D HG3    1 
ATOM 2191 N N      . LEU D 1 36 ? 115.187 105.345 24.297 1.00 119.90 ? 128 LEU D N      1 
ATOM 2192 C CA     . LEU D 1 36 ? 116.190 104.723 23.438 1.00 120.72 ? 128 LEU D CA     1 
ATOM 2193 C C      . LEU D 1 36 ? 115.630 103.480 22.752 1.00 142.02 ? 128 LEU D C      1 
ATOM 2194 O O      . LEU D 1 36 ? 115.911 103.224 21.577 1.00 126.50 ? 128 LEU D O      1 
ATOM 2195 C CB     . LEU D 1 36 ? 117.439 104.354 24.242 1.00 123.43 ? 128 LEU D CB     1 
ATOM 2196 C CG     . LEU D 1 36 ? 118.581 103.741 23.424 1.00 133.13 ? 128 LEU D CG     1 
ATOM 2197 C CD1    . LEU D 1 36 ? 119.109 104.726 22.391 1.00 137.43 ? 128 LEU D CD1    1 
ATOM 2198 C CD2    . LEU D 1 36 ? 119.701 103.277 24.339 1.00 120.60 ? 128 LEU D CD2    1 
ATOM 2199 H H      . LEU D 1 36 ? 115.428 105.425 25.118 1.00 143.89 ? 128 LEU D H      1 
ATOM 2200 H HA     . LEU D 1 36 ? 116.452 105.354 22.749 1.00 144.87 ? 128 LEU D HA     1 
ATOM 2201 H HB2    . LEU D 1 36 ? 117.782 105.157 24.665 1.00 148.12 ? 128 LEU D HB2    1 
ATOM 2202 H HB3    . LEU D 1 36 ? 117.189 103.710 24.923 1.00 148.12 ? 128 LEU D HB3    1 
ATOM 2203 H HG     . LEU D 1 36 ? 118.244 102.965 22.949 1.00 159.75 ? 128 LEU D HG     1 
ATOM 2204 H HD11   . LEU D 1 36 ? 119.828 104.306 21.894 1.00 164.92 ? 128 LEU D HD11   1 
ATOM 2205 H HD12   . LEU D 1 36 ? 118.388 104.970 21.790 1.00 164.92 ? 128 LEU D HD12   1 
ATOM 2206 H HD13   . LEU D 1 36 ? 119.440 105.515 22.848 1.00 164.92 ? 128 LEU D HD13   1 
ATOM 2207 H HD21   . LEU D 1 36 ? 120.410 102.893 23.799 1.00 144.72 ? 128 LEU D HD21   1 
ATOM 2208 H HD22   . LEU D 1 36 ? 120.038 104.038 24.836 1.00 144.72 ? 128 LEU D HD22   1 
ATOM 2209 H HD23   . LEU D 1 36 ? 119.352 102.609 24.950 1.00 144.72 ? 128 LEU D HD23   1 
ATOM 2210 N N      . SER D 1 37 ? 114.842 102.707 23.493 1.00 137.64 ? 129 SER D N      1 
ATOM 2211 C CA     . SER D 1 37 ? 114.204 101.520 22.940 1.00 151.78 ? 129 SER D CA     1 
ATOM 2212 C C      . SER D 1 37 ? 113.141 101.925 21.926 1.00 158.12 ? 129 SER D C      1 
ATOM 2213 O O      . SER D 1 37 ? 113.014 101.314 20.864 1.00 150.50 ? 129 SER D O      1 
ATOM 2214 C CB     . SER D 1 37 ? 113.580 100.675 24.051 1.00 165.41 ? 129 SER D CB     1 
ATOM 2215 O OG     . SER D 1 37 ? 112.453 101.323 24.616 1.00 169.44 ? 129 SER D OG     1 
ATOM 2216 H H      . SER D 1 37 ? 114.660 102.850 24.321 1.00 165.17 ? 129 SER D H      1 
ATOM 2217 H HA     . SER D 1 37 ? 114.869 100.981 22.485 1.00 182.13 ? 129 SER D HA     1 
ATOM 2218 H HB2    . SER D 1 37 ? 113.299 99.824  23.679 1.00 198.49 ? 129 SER D HB2    1 
ATOM 2219 H HB3    . SER D 1 37 ? 114.241 100.530 24.746 1.00 198.49 ? 129 SER D HB3    1 
ATOM 2220 H HG     . SER D 1 37 ? 111.871 101.454 24.024 1.00 203.33 ? 129 SER D HG     1 
ATOM 2221 N N      . ASN D 1 38 ? 112.378 102.959 22.271 1.00 162.03 ? 130 ASN D N      1 
ATOM 2222 C CA     . ASN D 1 38 ? 111.325 103.467 21.403 1.00 134.88 ? 130 ASN D CA     1 
ATOM 2223 C C      . ASN D 1 38 ? 111.869 103.879 20.044 1.00 138.85 ? 130 ASN D C      1 
ATOM 2224 O O      . ASN D 1 38 ? 111.353 103.445 19.012 1.00 185.02 ? 130 ASN D O      1 
ATOM 2225 C CB     . ASN D 1 38 ? 110.615 104.658 22.056 1.00 137.45 ? 130 ASN D CB     1 
ATOM 2226 C CG     . ASN D 1 38 ? 109.478 104.239 22.975 1.00 162.64 ? 130 ASN D CG     1 
ATOM 2227 O OD1    . ASN D 1 38 ? 109.064 103.080 22.991 1.00 183.08 ? 130 ASN D OD1    1 
ATOM 2228 N ND2    . ASN D 1 38 ? 108.962 105.193 23.742 1.00 165.02 ? 130 ASN D ND2    1 
ATOM 2229 H H      . ASN D 1 38 ? 112.454 103.387 23.013 1.00 194.43 ? 130 ASN D H      1 
ATOM 2230 H HA     . ASN D 1 38 ? 110.668 102.767 21.263 1.00 161.85 ? 130 ASN D HA     1 
ATOM 2231 H HB2    . ASN D 1 38 ? 111.258 105.159 22.582 1.00 164.95 ? 130 ASN D HB2    1 
ATOM 2232 H HB3    . ASN D 1 38 ? 110.244 105.224 21.360 1.00 164.95 ? 130 ASN D HB3    1 
ATOM 2233 H HD21   . ASN D 1 38 ? 109.273 105.994 23.700 1.00 198.03 ? 130 ASN D HD21   1 
ATOM 2234 H HD22   . ASN D 1 38 ? 108.317 105.010 24.281 1.00 198.03 ? 130 ASN D HD22   1 
ATOM 2235 N N      . ILE D 1 39 ? 112.904 104.714 20.035 1.00 148.57 ? 131 ILE D N      1 
ATOM 2236 C CA     . ILE D 1 39 ? 113.425 105.224 18.766 1.00 170.24 ? 131 ILE D CA     1 
ATOM 2237 C C      . ILE D 1 39 ? 114.153 104.147 17.957 1.00 156.76 ? 131 ILE D C      1 
ATOM 2238 O O      . ILE D 1 39 ? 114.417 104.336 16.770 1.00 192.38 ? 131 ILE D O      1 
ATOM 2239 C CB     . ILE D 1 39 ? 114.377 106.421 18.980 1.00 165.64 ? 131 ILE D CB     1 
ATOM 2240 C CG1    . ILE D 1 39 ? 115.607 106.014 19.795 1.00 171.06 ? 131 ILE D CG1    1 
ATOM 2241 C CG2    . ILE D 1 39 ? 113.638 107.555 19.674 1.00 186.01 ? 131 ILE D CG2    1 
ATOM 2242 C CD1    . ILE D 1 39 ? 116.729 107.031 19.736 1.00 176.72 ? 131 ILE D CD1    1 
ATOM 2243 H H      . ILE D 1 39 ? 113.317 104.998 20.734 1.00 178.28 ? 131 ILE D H      1 
ATOM 2244 H HA     . ILE D 1 39 ? 112.679 105.536 18.232 1.00 204.29 ? 131 ILE D HA     1 
ATOM 2245 H HB     . ILE D 1 39 ? 114.674 106.734 18.112 1.00 198.76 ? 131 ILE D HB     1 
ATOM 2246 H HG12   . ILE D 1 39 ? 115.348 105.908 20.724 1.00 205.27 ? 131 ILE D HG12   1 
ATOM 2247 H HG13   . ILE D 1 39 ? 115.948 105.174 19.450 1.00 205.27 ? 131 ILE D HG13   1 
ATOM 2248 H HG21   . ILE D 1 39 ? 114.249 108.298 19.800 1.00 223.22 ? 131 ILE D HG21   1 
ATOM 2249 H HG22   . ILE D 1 39 ? 112.892 107.831 19.119 1.00 223.22 ? 131 ILE D HG22   1 
ATOM 2250 H HG23   . ILE D 1 39 ? 113.315 107.242 20.533 1.00 223.22 ? 131 ILE D HG23   1 
ATOM 2251 H HD11   . ILE D 1 39 ? 117.473 106.712 20.271 1.00 212.06 ? 131 ILE D HD11   1 
ATOM 2252 H HD12   . ILE D 1 39 ? 117.007 107.141 18.814 1.00 212.06 ? 131 ILE D HD12   1 
ATOM 2253 H HD13   . ILE D 1 39 ? 116.407 107.876 20.088 1.00 212.06 ? 131 ILE D HD13   1 
ATOM 2254 N N      . LEU D 1 40 ? 114.472 103.024 18.595 1.00 136.26 ? 132 LEU D N      1 
ATOM 2255 C CA     . LEU D 1 40 ? 115.076 101.884 17.903 1.00 140.92 ? 132 LEU D CA     1 
ATOM 2256 C C      . LEU D 1 40 ? 114.077 100.753 17.675 1.00 156.38 ? 132 LEU D C      1 
ATOM 2257 O O      . LEU D 1 40 ? 114.440 99.689  17.172 1.00 155.26 ? 132 LEU D O      1 
ATOM 2258 C CB     . LEU D 1 40 ? 116.287 101.371 18.682 1.00 157.70 ? 132 LEU D CB     1 
ATOM 2259 C CG     . LEU D 1 40 ? 117.623 101.894 18.146 1.00 156.29 ? 132 LEU D CG     1 
ATOM 2260 C CD1    . LEU D 1 40 ? 117.670 103.418 18.130 1.00 128.44 ? 132 LEU D CD1    1 
ATOM 2261 C CD2    . LEU D 1 40 ? 118.785 101.334 18.951 1.00 155.38 ? 132 LEU D CD2    1 
ATOM 2262 H H      . LEU D 1 40 ? 114.349 102.895 19.437 1.00 163.51 ? 132 LEU D H      1 
ATOM 2263 H HA     . LEU D 1 40 ? 115.388 102.180 17.034 1.00 169.11 ? 132 LEU D HA     1 
ATOM 2264 H HB2    . LEU D 1 40 ? 116.207 101.652 19.607 1.00 189.24 ? 132 LEU D HB2    1 
ATOM 2265 H HB3    . LEU D 1 40 ? 116.305 100.403 18.631 1.00 189.24 ? 132 LEU D HB3    1 
ATOM 2266 H HG     . LEU D 1 40 ? 117.728 101.590 17.231 1.00 187.55 ? 132 LEU D HG     1 
ATOM 2267 H HD11   . LEU D 1 40 ? 118.530 103.704 17.784 1.00 154.12 ? 132 LEU D HD11   1 
ATOM 2268 H HD12   . LEU D 1 40 ? 116.958 103.750 17.560 1.00 154.12 ? 132 LEU D HD12   1 
ATOM 2269 H HD13   . LEU D 1 40 ? 117.551 103.747 19.035 1.00 154.12 ? 132 LEU D HD13   1 
ATOM 2270 H HD21   . LEU D 1 40 ? 119.615 101.682 18.590 1.00 186.46 ? 132 LEU D HD21   1 
ATOM 2271 H HD22   . LEU D 1 40 ? 118.687 101.606 19.877 1.00 186.46 ? 132 LEU D HD22   1 
ATOM 2272 H HD23   . LEU D 1 40 ? 118.775 100.366 18.887 1.00 186.46 ? 132 LEU D HD23   1 
ATOM 2273 N N      . ASN D 1 41 ? 112.818 101.001 18.027 1.00 190.14 ? 133 ASN D N      1 
ATOM 2274 C CA     . ASN D 1 41 ? 111.761 100.005 17.891 1.00 193.46 ? 133 ASN D CA     1 
ATOM 2275 C C      . ASN D 1 41 ? 112.163 98.681  18.533 1.00 193.78 ? 133 ASN D C      1 
ATOM 2276 O O      . ASN D 1 41 ? 111.977 97.608  17.957 1.00 195.81 ? 133 ASN D O      1 
ATOM 2277 C CB     . ASN D 1 41 ? 111.418 99.804  16.413 1.00 174.16 ? 133 ASN D CB     1 
ATOM 2278 C CG     . ASN D 1 41 ? 110.110 99.061  16.209 1.00 183.33 ? 133 ASN D CG     1 
ATOM 2279 O OD1    . ASN D 1 41 ? 109.245 99.044  17.085 1.00 193.15 ? 133 ASN D OD1    1 
ATOM 2280 N ND2    . ASN D 1 41 ? 109.955 98.453  15.040 1.00 198.84 ? 133 ASN D ND2    1 
ATOM 2281 H H      . ASN D 1 41 ? 112.548 101.750 18.351 1.00 228.17 ? 133 ASN D H      1 
ATOM 2282 H HA     . ASN D 1 41 ? 110.965 100.327 18.343 1.00 232.16 ? 133 ASN D HA     1 
ATOM 2283 H HB2    . ASN D 1 41 ? 111.340 100.671 15.986 1.00 208.99 ? 133 ASN D HB2    1 
ATOM 2284 H HB3    . ASN D 1 41 ? 112.124 99.289  15.993 1.00 208.99 ? 133 ASN D HB3    1 
ATOM 2285 H HD21   . ASN D 1 41 ? 110.577 98.493  14.448 1.00 238.61 ? 133 ASN D HD21   1 
ATOM 2286 H HD22   . ASN D 1 41 ? 109.231 98.018  14.874 1.00 238.61 ? 133 ASN D HD22   1 
ATOM 2287 N N      . LEU D 1 42 ? 112.719 98.782  19.735 1.00 182.38 ? 134 LEU D N      1 
ATOM 2288 C CA     . LEU D 1 42 ? 113.092 97.621  20.532 1.00 142.80 ? 134 LEU D CA     1 
ATOM 2289 C C      . LEU D 1 42 ? 112.325 97.661  21.843 1.00 143.82 ? 134 LEU D C      1 
ATOM 2290 O O      . LEU D 1 42 ? 111.742 98.685  22.197 1.00 168.06 ? 134 LEU D O      1 
ATOM 2291 C CB     . LEU D 1 42 ? 114.599 97.594  20.804 1.00 129.52 ? 134 LEU D CB     1 
ATOM 2292 C CG     . LEU D 1 42 ? 115.533 97.462  19.600 1.00 151.17 ? 134 LEU D CG     1 
ATOM 2293 C CD1    . LEU D 1 42 ? 116.985 97.504  20.055 1.00 130.36 ? 134 LEU D CD1    1 
ATOM 2294 C CD2    . LEU D 1 42 ? 115.251 96.193  18.812 1.00 163.70 ? 134 LEU D CD2    1 
ATOM 2295 H H      . LEU D 1 42 ? 112.895 99.531  20.120 1.00 218.85 ? 134 LEU D H      1 
ATOM 2296 H HA     . LEU D 1 42 ? 112.850 96.811  20.058 1.00 171.37 ? 134 LEU D HA     1 
ATOM 2297 H HB2    . LEU D 1 42 ? 114.836 98.418  21.259 1.00 155.43 ? 134 LEU D HB2    1 
ATOM 2298 H HB3    . LEU D 1 42 ? 114.784 96.844  21.390 1.00 155.43 ? 134 LEU D HB3    1 
ATOM 2299 H HG     . LEU D 1 42 ? 115.386 98.216  19.008 1.00 181.40 ? 134 LEU D HG     1 
ATOM 2300 H HD11   . LEU D 1 42 ? 117.561 97.420  19.279 1.00 156.43 ? 134 LEU D HD11   1 
ATOM 2301 H HD12   . LEU D 1 42 ? 117.151 98.350  20.500 1.00 156.43 ? 134 LEU D HD12   1 
ATOM 2302 H HD13   . LEU D 1 42 ? 117.145 96.770  20.668 1.00 156.43 ? 134 LEU D HD13   1 
ATOM 2303 H HD21   . LEU D 1 42 ? 115.862 96.147  18.060 1.00 196.44 ? 134 LEU D HD21   1 
ATOM 2304 H HD22   . LEU D 1 42 ? 115.382 95.426  19.392 1.00 196.44 ? 134 LEU D HD22   1 
ATOM 2305 H HD23   . LEU D 1 42 ? 114.335 96.216  18.494 1.00 196.44 ? 134 LEU D HD23   1 
ATOM 2306 N N      . SER D 1 43 ? 112.309 96.537  22.550 1.00 134.36 ? 135 SER D N      1 
ATOM 2307 C CA     . SER D 1 43 ? 111.678 96.474  23.858 1.00 147.73 ? 135 SER D CA     1 
ATOM 2308 C C      . SER D 1 43 ? 112.654 96.980  24.911 1.00 147.61 ? 135 SER D C      1 
ATOM 2309 O O      . SER D 1 43 ? 113.865 97.004  24.689 1.00 139.56 ? 135 SER D O      1 
ATOM 2310 C CB     . SER D 1 43 ? 111.234 95.047  24.183 1.00 173.62 ? 135 SER D CB     1 
ATOM 2311 O OG     . SER D 1 43 ? 112.347 94.176  24.284 1.00 172.91 ? 135 SER D OG     1 
ATOM 2312 H H      . SER D 1 43 ? 112.659 95.795  22.292 1.00 161.23 ? 135 SER D H      1 
ATOM 2313 H HA     . SER D 1 43 ? 110.895 97.047  23.866 1.00 177.28 ? 135 SER D HA     1 
ATOM 2314 H HB2    . SER D 1 43 ? 110.760 95.050  25.030 1.00 208.34 ? 135 SER D HB2    1 
ATOM 2315 H HB3    . SER D 1 43 ? 110.649 94.730  23.478 1.00 208.34 ? 135 SER D HB3    1 
ATOM 2316 H HG     . SER D 1 43 ? 112.087 93.397  24.462 1.00 207.49 ? 135 SER D HG     1 
ATOM 2317 N N      . TYR D 1 44 ? 112.120 97.400  26.050 1.00 134.13 ? 136 TYR D N      1 
ATOM 2318 C CA     . TYR D 1 44 ? 112.943 97.881  27.149 1.00 127.12 ? 136 TYR D CA     1 
ATOM 2319 C C      . TYR D 1 44 ? 113.916 96.792  27.594 1.00 140.73 ? 136 TYR D C      1 
ATOM 2320 O O      . TYR D 1 44 ? 115.092 97.056  27.870 1.00 131.97 ? 136 TYR D O      1 
ATOM 2321 C CB     . TYR D 1 44 ? 112.058 98.308  28.320 1.00 124.08 ? 136 TYR D CB     1 
ATOM 2322 C CG     . TYR D 1 44 ? 112.815 98.514  29.609 1.00 150.23 ? 136 TYR D CG     1 
ATOM 2323 C CD1    . TYR D 1 44 ? 113.482 99.703  29.867 1.00 158.73 ? 136 TYR D CD1    1 
ATOM 2324 C CD2    . TYR D 1 44 ? 112.876 97.509  30.565 1.00 175.74 ? 136 TYR D CD2    1 
ATOM 2325 C CE1    . TYR D 1 44 ? 114.179 99.889  31.045 1.00 146.16 ? 136 TYR D CE1    1 
ATOM 2326 C CE2    . TYR D 1 44 ? 113.571 97.683  31.740 1.00 178.56 ? 136 TYR D CE2    1 
ATOM 2327 C CZ     . TYR D 1 44 ? 114.221 98.875  31.977 1.00 172.18 ? 136 TYR D CZ     1 
ATOM 2328 O OH     . TYR D 1 44 ? 114.913 99.052  33.152 1.00 207.83 ? 136 TYR D OH     1 
ATOM 2329 H H      . TYR D 1 44 ? 111.275 97.416  26.213 1.00 160.95 ? 136 TYR D H      1 
ATOM 2330 H HA     . TYR D 1 44 ? 113.457 98.650  26.856 1.00 152.55 ? 136 TYR D HA     1 
ATOM 2331 H HB2    . TYR D 1 44 ? 111.624 99.146  28.094 1.00 148.90 ? 136 TYR D HB2    1 
ATOM 2332 H HB3    . TYR D 1 44 ? 111.390 97.622  28.474 1.00 148.90 ? 136 TYR D HB3    1 
ATOM 2333 H HD1    . TYR D 1 44 ? 113.455 100.388 29.238 1.00 190.47 ? 136 TYR D HD1    1 
ATOM 2334 H HD2    . TYR D 1 44 ? 112.438 96.703  30.408 1.00 210.89 ? 136 TYR D HD2    1 
ATOM 2335 H HE1    . TYR D 1 44 ? 114.620 100.692 31.206 1.00 175.39 ? 136 TYR D HE1    1 
ATOM 2336 H HE2    . TYR D 1 44 ? 113.599 97.002  32.373 1.00 214.28 ? 136 TYR D HE2    1 
ATOM 2337 H HH     . TYR D 1 44 ? 115.259 99.817  33.170 1.00 249.40 ? 136 TYR D HH     1 
ATOM 2338 N N      . LYS D 1 45 ? 113.403 95.567  27.647 1.00 143.19 ? 137 LYS D N      1 
ATOM 2339 C CA     . LYS D 1 45 ? 114.145 94.422  28.162 1.00 137.50 ? 137 LYS D CA     1 
ATOM 2340 C C      . LYS D 1 45 ? 115.473 94.203  27.439 1.00 136.05 ? 137 LYS D C      1 
ATOM 2341 O O      . LYS D 1 45 ? 116.513 94.067  28.079 1.00 143.02 ? 137 LYS D O      1 
ATOM 2342 C CB     . LYS D 1 45 ? 113.287 93.158  28.065 1.00 151.55 ? 137 LYS D CB     1 
ATOM 2343 C CG     . LYS D 1 45 ? 113.802 92.000  28.907 1.00 168.85 ? 137 LYS D CG     1 
ATOM 2344 C CD     . LYS D 1 45 ? 112.864 90.802  28.857 1.00 171.91 ? 137 LYS D CD     1 
ATOM 2345 C CE     . LYS D 1 45 ? 113.360 89.676  29.752 1.00 197.42 ? 137 LYS D CE     1 
ATOM 2346 N NZ     . LYS D 1 45 ? 112.474 88.480  29.708 1.00 213.73 ? 137 LYS D NZ     1 
ATOM 2347 H H      . LYS D 1 45 ? 112.609 95.369  27.384 1.00 171.82 ? 137 LYS D H      1 
ATOM 2348 H HA     . LYS D 1 45 ? 114.342 94.575  29.099 1.00 165.00 ? 137 LYS D HA     1 
ATOM 2349 H HB2    . LYS D 1 45 ? 112.389 93.366  28.365 1.00 181.86 ? 137 LYS D HB2    1 
ATOM 2350 H HB3    . LYS D 1 45 ? 113.265 92.865  27.141 1.00 181.86 ? 137 LYS D HB3    1 
ATOM 2351 H HG2    . LYS D 1 45 ? 114.668 91.721  28.571 1.00 202.62 ? 137 LYS D HG2    1 
ATOM 2352 H HG3    . LYS D 1 45 ? 113.878 92.286  29.831 1.00 202.62 ? 137 LYS D HG3    1 
ATOM 2353 H HD2    . LYS D 1 45 ? 111.984 91.070  29.164 1.00 206.29 ? 137 LYS D HD2    1 
ATOM 2354 H HD3    . LYS D 1 45 ? 112.817 90.469  27.947 1.00 206.29 ? 137 LYS D HD3    1 
ATOM 2355 H HE2    . LYS D 1 45 ? 114.245 89.406  29.460 1.00 236.91 ? 137 LYS D HE2    1 
ATOM 2356 H HE3    . LYS D 1 45 ? 113.394 89.992  30.669 1.00 236.91 ? 137 LYS D HE3    1 
ATOM 2357 H HZ1    . LYS D 1 45 ? 112.795 87.844  30.242 1.00 256.47 ? 137 LYS D HZ1    1 
ATOM 2358 H HZ2    . LYS D 1 45 ? 111.655 88.699  29.978 1.00 256.47 ? 137 LYS D HZ2    1 
ATOM 2359 H HZ3    . LYS D 1 45 ? 112.430 88.165  28.877 1.00 256.47 ? 137 LYS D HZ3    1 
ATOM 2360 N N      . GLN D 1 46 ? 115.444 94.177  26.111 1.00 132.67 ? 138 GLN D N      1 
ATOM 2361 C CA     . GLN D 1 46 ? 116.648 93.856  25.348 1.00 158.21 ? 138 GLN D CA     1 
ATOM 2362 C C      . GLN D 1 46 ? 117.697 94.964  25.478 1.00 148.15 ? 138 GLN D C      1 
ATOM 2363 O O      . GLN D 1 46 ? 118.905 94.696  25.463 1.00 144.30 ? 138 GLN D O      1 
ATOM 2364 C CB     . GLN D 1 46 ? 116.307 93.606  23.871 1.00 164.97 ? 138 GLN D CB     1 
ATOM 2365 C CG     . GLN D 1 46 ? 115.466 94.682  23.192 1.00 189.85 ? 138 GLN D CG     1 
ATOM 2366 C CD     . GLN D 1 46 ? 114.925 94.236  21.838 1.00 185.72 ? 138 GLN D CD     1 
ATOM 2367 O OE1    . GLN D 1 46 ? 113.779 94.525  21.490 1.00 174.00 ? 138 GLN D OE1    1 
ATOM 2368 N NE2    . GLN D 1 46 ? 115.750 93.533  21.068 1.00 178.04 ? 138 GLN D NE2    1 
ATOM 2369 H H      . GLN D 1 46 ? 114.749 94.340  25.631 1.00 159.20 ? 138 GLN D H      1 
ATOM 2370 H HA     . GLN D 1 46 ? 117.034 93.041  25.704 1.00 189.86 ? 138 GLN D HA     1 
ATOM 2371 H HB2    . GLN D 1 46 ? 117.136 93.529  23.374 1.00 197.97 ? 138 GLN D HB2    1 
ATOM 2372 H HB3    . GLN D 1 46 ? 115.815 92.772  23.808 1.00 197.97 ? 138 GLN D HB3    1 
ATOM 2373 H HG2    . GLN D 1 46 ? 114.711 94.899  23.760 1.00 227.82 ? 138 GLN D HG2    1 
ATOM 2374 H HG3    . GLN D 1 46 ? 116.014 95.470  23.052 1.00 227.82 ? 138 GLN D HG3    1 
ATOM 2375 H HE21   . GLN D 1 46 ? 116.544 93.351  21.343 1.00 213.65 ? 138 GLN D HE21   1 
ATOM 2376 H HE22   . GLN D 1 46 ? 115.489 93.259  20.296 1.00 213.65 ? 138 GLN D HE22   1 
ATOM 2377 N N      . VAL D 1 47 ? 117.237 96.199  25.657 1.00 136.98 ? 139 VAL D N      1 
ATOM 2378 C CA     . VAL D 1 47 ? 118.144 97.334  25.807 1.00 147.58 ? 139 VAL D CA     1 
ATOM 2379 C C      . VAL D 1 47 ? 118.774 97.354  27.204 1.00 138.59 ? 139 VAL D C      1 
ATOM 2380 O O      . VAL D 1 47 ? 120.000 97.468  27.345 1.00 150.79 ? 139 VAL D O      1 
ATOM 2381 C CB     . VAL D 1 47 ? 117.409 98.666  25.551 1.00 140.21 ? 139 VAL D CB     1 
ATOM 2382 C CG1    . VAL D 1 47 ? 118.353 99.850  25.723 1.00 122.74 ? 139 VAL D CG1    1 
ATOM 2383 C CG2    . VAL D 1 47 ? 116.808 98.674  24.153 1.00 146.87 ? 139 VAL D CG2    1 
ATOM 2384 H H      . VAL D 1 47 ? 116.404 96.406  25.695 1.00 164.38 ? 139 VAL D H      1 
ATOM 2385 H HA     . VAL D 1 47 ? 118.859 97.256  25.157 1.00 177.09 ? 139 VAL D HA     1 
ATOM 2386 H HB     . VAL D 1 47 ? 116.687 98.760  26.192 1.00 168.25 ? 139 VAL D HB     1 
ATOM 2387 H HG11   . VAL D 1 47 ? 117.863 100.670 25.556 1.00 147.29 ? 139 VAL D HG11   1 
ATOM 2388 H HG12   . VAL D 1 47 ? 118.699 99.849  26.629 1.00 147.29 ? 139 VAL D HG12   1 
ATOM 2389 H HG13   . VAL D 1 47 ? 119.083 99.765  25.090 1.00 147.29 ? 139 VAL D HG13   1 
ATOM 2390 H HG21   . VAL D 1 47 ? 116.351 99.518  24.011 1.00 176.24 ? 139 VAL D HG21   1 
ATOM 2391 H HG22   . VAL D 1 47 ? 117.520 98.570  23.503 1.00 176.24 ? 139 VAL D HG22   1 
ATOM 2392 H HG23   . VAL D 1 47 ? 116.179 97.940  24.076 1.00 176.24 ? 139 VAL D HG23   1 
ATOM 2393 N N      . LYS D 1 48 ? 117.937 97.228  28.231 1.00 123.70 ? 140 LYS D N      1 
ATOM 2394 C CA     . LYS D 1 48 ? 118.432 97.158  29.608 1.00 143.26 ? 140 LYS D CA     1 
ATOM 2395 C C      . LYS D 1 48 ? 119.399 95.985  29.735 1.00 142.05 ? 140 LYS D C      1 
ATOM 2396 O O      . LYS D 1 48 ? 120.479 96.107  30.326 1.00 146.37 ? 140 LYS D O      1 
ATOM 2397 C CB     . LYS D 1 48 ? 117.278 97.012  30.604 1.00 123.19 ? 140 LYS D CB     1 
ATOM 2398 H H      . LYS D 1 48 ? 117.081 97.180  28.161 1.00 148.44 ? 140 LYS D H      1 
ATOM 2399 H HA     . LYS D 1 48 ? 118.913 97.973  29.817 1.00 171.91 ? 140 LYS D HA     1 
ATOM 2400 N N      . THR D 1 49 ? 118.995 94.853  29.166 1.00 138.86 ? 141 THR D N      1 
ATOM 2401 C CA     . THR D 1 49 ? 119.817 93.651  29.153 1.00 144.80 ? 141 THR D CA     1 
ATOM 2402 C C      . THR D 1 49 ? 121.157 93.938  28.488 1.00 145.81 ? 141 THR D C      1 
ATOM 2403 O O      . THR D 1 49 ? 122.218 93.619  29.045 1.00 157.63 ? 141 THR D O      1 
ATOM 2404 C CB     . THR D 1 49 ? 119.115 92.496  28.410 1.00 166.76 ? 141 THR D CB     1 
ATOM 2405 O OG1    . THR D 1 49 ? 117.842 92.237  29.016 1.00 162.35 ? 141 THR D OG1    1 
ATOM 2406 C CG2    . THR D 1 49 ? 119.957 91.230  28.456 1.00 193.76 ? 141 THR D CG2    1 
ATOM 2407 H H      . THR D 1 49 ? 118.235 94.755  28.776 1.00 166.63 ? 141 THR D H      1 
ATOM 2408 H HA     . THR D 1 49 ? 119.984 93.368  30.066 1.00 173.76 ? 141 THR D HA     1 
ATOM 2409 H HB     . THR D 1 49 ? 118.985 92.743  27.481 1.00 200.12 ? 141 THR D HB     1 
ATOM 2410 H HG1    . THR D 1 49 ? 117.360 92.923  28.976 1.00 194.82 ? 141 THR D HG1    1 
ATOM 2411 H HG21   . THR D 1 49 ? 119.504 90.513  27.986 1.00 232.52 ? 141 THR D HG21   1 
ATOM 2412 H HG22   . THR D 1 49 ? 120.817 91.389  28.037 1.00 232.52 ? 141 THR D HG22   1 
ATOM 2413 H HG23   . THR D 1 49 ? 120.100 90.961  29.377 1.00 232.52 ? 141 THR D HG23   1 
ATOM 2414 N N      . TRP D 1 50 ? 121.104 94.526  27.294 1.00 136.29 ? 142 TRP D N      1 
ATOM 2415 C CA     . TRP D 1 50 ? 122.320 94.903  26.583 1.00 149.41 ? 142 TRP D CA     1 
ATOM 2416 C C      . TRP D 1 50 ? 123.244 95.713  27.491 1.00 141.65 ? 142 TRP D C      1 
ATOM 2417 O O      . TRP D 1 50 ? 124.413 95.358  27.672 1.00 171.16 ? 142 TRP D O      1 
ATOM 2418 C CB     . TRP D 1 50 ? 121.994 95.704  25.322 1.00 148.39 ? 142 TRP D CB     1 
ATOM 2419 C CG     . TRP D 1 50 ? 123.207 95.986  24.491 1.00 153.04 ? 142 TRP D CG     1 
ATOM 2420 C CD1    . TRP D 1 50 ? 123.785 95.151  23.580 1.00 155.30 ? 142 TRP D CD1    1 
ATOM 2421 C CD2    . TRP D 1 50 ? 123.996 97.181  24.498 1.00 160.81 ? 142 TRP D CD2    1 
ATOM 2422 N NE1    . TRP D 1 50 ? 124.885 95.752  23.018 1.00 167.69 ? 142 TRP D NE1    1 
ATOM 2423 C CE2    . TRP D 1 50 ? 125.037 97.002  23.565 1.00 166.88 ? 142 TRP D CE2    1 
ATOM 2424 C CE3    . TRP D 1 50 ? 123.925 98.389  25.201 1.00 162.78 ? 142 TRP D CE3    1 
ATOM 2425 C CZ2    . TRP D 1 50 ? 125.998 97.979  23.315 1.00 165.12 ? 142 TRP D CZ2    1 
ATOM 2426 C CZ3    . TRP D 1 50 ? 124.880 99.362  24.950 1.00 159.55 ? 142 TRP D CZ3    1 
ATOM 2427 C CH2    . TRP D 1 50 ? 125.904 99.149  24.017 1.00 156.46 ? 142 TRP D CH2    1 
ATOM 2428 H H      . TRP D 1 50 ? 120.377 94.716  26.876 1.00 163.55 ? 142 TRP D H      1 
ATOM 2429 H HA     . TRP D 1 50 ? 122.792 94.099  26.315 1.00 179.29 ? 142 TRP D HA     1 
ATOM 2430 H HB2    . TRP D 1 50 ? 121.368 95.199  24.779 1.00 178.07 ? 142 TRP D HB2    1 
ATOM 2431 H HB3    . TRP D 1 50 ? 121.602 96.553  25.579 1.00 178.07 ? 142 TRP D HB3    1 
ATOM 2432 H HD1    . TRP D 1 50 ? 123.480 94.298  23.372 1.00 186.36 ? 142 TRP D HD1    1 
ATOM 2433 H HE1    . TRP D 1 50 ? 125.395 95.402  22.421 1.00 201.23 ? 142 TRP D HE1    1 
ATOM 2434 H HE3    . TRP D 1 50 ? 123.250 98.537  25.823 1.00 195.33 ? 142 TRP D HE3    1 
ATOM 2435 H HZ2    . TRP D 1 50 ? 126.677 97.842  22.694 1.00 198.14 ? 142 TRP D HZ2    1 
ATOM 2436 H HZ3    . TRP D 1 50 ? 124.844 100.168 25.412 1.00 191.46 ? 142 TRP D HZ3    1 
ATOM 2437 H HH2    . TRP D 1 50 ? 126.531 99.820  23.870 1.00 187.75 ? 142 TRP D HH2    1 
ATOM 2438 N N      . PHE D 1 51 ? 122.716 96.790  28.069 1.00 128.95 ? 143 PHE D N      1 
ATOM 2439 C CA     . PHE D 1 51 ? 123.511 97.634  28.962 1.00 141.28 ? 143 PHE D CA     1 
ATOM 2440 C C      . PHE D 1 51 ? 124.132 96.844  30.116 1.00 144.59 ? 143 PHE D C      1 
ATOM 2441 O O      . PHE D 1 51 ? 125.328 96.986  30.401 1.00 144.02 ? 143 PHE D O      1 
ATOM 2442 C CB     . PHE D 1 51 ? 122.661 98.776  29.517 1.00 126.29 ? 143 PHE D CB     1 
ATOM 2443 C CG     . PHE D 1 51 ? 122.681 100.009 28.662 1.00 127.34 ? 143 PHE D CG     1 
ATOM 2444 C CD1    . PHE D 1 51 ? 123.773 100.863 28.689 1.00 128.25 ? 143 PHE D CD1    1 
ATOM 2445 C CD2    . PHE D 1 51 ? 121.616 100.316 27.832 1.00 122.62 ? 143 PHE D CD2    1 
ATOM 2446 C CE1    . PHE D 1 51 ? 123.803 101.999 27.904 1.00 119.01 ? 143 PHE D CE1    1 
ATOM 2447 C CE2    . PHE D 1 51 ? 121.639 101.453 27.045 1.00 128.25 ? 143 PHE D CE2    1 
ATOM 2448 C CZ     . PHE D 1 51 ? 122.735 102.296 27.082 1.00 119.19 ? 143 PHE D CZ     1 
ATOM 2449 H H      . PHE D 1 51 ? 121.904 97.053  27.962 1.00 154.75 ? 143 PHE D H      1 
ATOM 2450 H HA     . PHE D 1 51 ? 124.236 98.027  28.451 1.00 169.53 ? 143 PHE D HA     1 
ATOM 2451 H HB2    . PHE D 1 51 ? 121.741 98.477  29.586 1.00 151.55 ? 143 PHE D HB2    1 
ATOM 2452 H HB3    . PHE D 1 51 ? 122.996 99.017  30.395 1.00 151.55 ? 143 PHE D HB3    1 
ATOM 2453 H HD1    . PHE D 1 51 ? 124.495 100.667 29.241 1.00 153.89 ? 143 PHE D HD1    1 
ATOM 2454 H HD2    . PHE D 1 51 ? 120.877 99.752  27.804 1.00 147.14 ? 143 PHE D HD2    1 
ATOM 2455 H HE1    . PHE D 1 51 ? 124.541 102.564 27.931 1.00 142.81 ? 143 PHE D HE1    1 
ATOM 2456 H HE2    . PHE D 1 51 ? 120.918 101.650 26.491 1.00 153.89 ? 143 PHE D HE2    1 
ATOM 2457 H HZ     . PHE D 1 51 ? 122.752 103.060 26.553 1.00 143.02 ? 143 PHE D HZ     1 
ATOM 2458 N N      . GLN D 1 52 ? 123.319 96.023  30.776 1.00 143.10 ? 144 GLN D N      1 
ATOM 2459 C CA     . GLN D 1 52 ? 123.810 95.153  31.843 1.00 129.03 ? 144 GLN D CA     1 
ATOM 2460 C C      . GLN D 1 52 ? 125.024 94.350  31.359 1.00 151.87 ? 144 GLN D C      1 
ATOM 2461 O O      . GLN D 1 52 ? 126.116 94.397  31.962 1.00 159.14 ? 144 GLN D O      1 
ATOM 2462 C CB     . GLN D 1 52 ? 122.697 94.210  32.304 1.00 126.49 ? 144 GLN D CB     1 
ATOM 2463 C CG     . GLN D 1 52 ? 122.946 93.554  33.647 1.00 127.41 ? 144 GLN D CG     1 
ATOM 2464 C CD     . GLN D 1 52 ? 122.903 94.553  34.783 1.00 141.67 ? 144 GLN D CD     1 
ATOM 2465 O OE1    . GLN D 1 52 ? 121.955 95.332  34.900 1.00 124.67 ? 144 GLN D OE1    1 
ATOM 2466 N NE2    . GLN D 1 52 ? 123.930 94.542  35.625 1.00 171.77 ? 144 GLN D NE2    1 
ATOM 2467 H H      . GLN D 1 52 ? 122.475 95.951  30.626 1.00 171.72 ? 144 GLN D H      1 
ATOM 2468 H HA     . GLN D 1 52 ? 124.084 95.695  32.599 1.00 154.83 ? 144 GLN D HA     1 
ATOM 2469 H HB2    . GLN D 1 52 ? 121.871 94.714  32.371 1.00 151.79 ? 144 GLN D HB2    1 
ATOM 2470 H HB3    . GLN D 1 52 ? 122.597 93.504  31.646 1.00 151.79 ? 144 GLN D HB3    1 
ATOM 2471 H HG2    . GLN D 1 52 ? 122.262 92.885  33.807 1.00 152.89 ? 144 GLN D HG2    1 
ATOM 2472 H HG3    . GLN D 1 52 ? 123.823 93.139  33.642 1.00 152.89 ? 144 GLN D HG3    1 
ATOM 2473 H HE21   . GLN D 1 52 ? 124.575 93.985  35.509 1.00 206.12 ? 144 GLN D HE21   1 
ATOM 2474 H HE22   . GLN D 1 52 ? 123.950 95.092  36.286 1.00 206.12 ? 144 GLN D HE22   1 
ATOM 2475 N N      . ASN D 1 53 ? 124.829 93.632  30.253 1.00 128.33 ? 145 ASN D N      1 
ATOM 2476 C CA     . ASN D 1 53 ? 125.899 92.841  29.657 1.00 130.12 ? 145 ASN D CA     1 
ATOM 2477 C C      . ASN D 1 53 ? 127.129 93.690  29.359 1.00 135.61 ? 145 ASN D C      1 
ATOM 2478 O O      . ASN D 1 53 ? 128.261 93.243  29.552 1.00 165.44 ? 145 ASN D O      1 
ATOM 2479 C CB     . ASN D 1 53 ? 125.420 92.166  28.370 1.00 146.25 ? 145 ASN D CB     1 
ATOM 2480 C CG     . ASN D 1 53 ? 124.415 91.060  28.626 1.00 147.62 ? 145 ASN D CG     1 
ATOM 2481 O OD1    . ASN D 1 53 ? 124.483 90.361  29.638 1.00 141.79 ? 145 ASN D OD1    1 
ATOM 2482 N ND2    . ASN D 1 53 ? 123.481 90.886  27.699 1.00 149.22 ? 145 ASN D ND2    1 
ATOM 2483 H H      . ASN D 1 53 ? 124.082 93.587  29.829 1.00 153.99 ? 145 ASN D H      1 
ATOM 2484 H HA     . ASN D 1 53 ? 126.160 92.145  30.280 1.00 156.14 ? 145 ASN D HA     1 
ATOM 2485 H HB2    . ASN D 1 53 ? 124.997 92.831  27.804 1.00 175.50 ? 145 ASN D HB2    1 
ATOM 2486 H HB3    . ASN D 1 53 ? 126.183 91.779  27.914 1.00 175.50 ? 145 ASN D HB3    1 
ATOM 2487 H HD21   . ASN D 1 53 ? 123.469 91.389  27.001 1.00 179.07 ? 145 ASN D HD21   1 
ATOM 2488 H HD22   . ASN D 1 53 ? 122.887 90.272  27.797 1.00 179.07 ? 145 ASN D HD22   1 
ATOM 2489 N N      . GLN D 1 54 ? 126.906 94.912  28.885 1.00 127.88 ? 146 GLN D N      1 
ATOM 2490 C CA     . GLN D 1 54 ? 128.013 95.810  28.573 1.00 144.48 ? 146 GLN D CA     1 
ATOM 2491 C C      . GLN D 1 54 ? 128.792 96.207  29.826 1.00 155.07 ? 146 GLN D C      1 
ATOM 2492 O O      . GLN D 1 54 ? 130.024 96.267  29.798 1.00 173.37 ? 146 GLN D O      1 
ATOM 2493 C CB     . GLN D 1 54 ? 127.495 97.055  27.858 1.00 159.20 ? 146 GLN D CB     1 
ATOM 2494 C CG     . GLN D 1 54 ? 126.995 96.783  26.450 1.00 143.06 ? 146 GLN D CG     1 
ATOM 2495 C CD     . GLN D 1 54 ? 128.114 96.447  25.487 1.00 153.78 ? 146 GLN D CD     1 
ATOM 2496 O OE1    . GLN D 1 54 ? 129.211 97.000  25.572 1.00 142.04 ? 146 GLN D OE1    1 
ATOM 2497 N NE2    . GLN D 1 54 ? 127.844 95.530  24.566 1.00 186.87 ? 146 GLN D NE2    1 
ATOM 2498 H H      . GLN D 1 54 ? 126.127 95.244  28.736 1.00 153.45 ? 146 GLN D H      1 
ATOM 2499 H HA     . GLN D 1 54 ? 128.625 95.355  27.974 1.00 173.38 ? 146 GLN D HA     1 
ATOM 2500 H HB2    . GLN D 1 54 ? 126.759 97.426  28.369 1.00 191.04 ? 146 GLN D HB2    1 
ATOM 2501 H HB3    . GLN D 1 54 ? 128.214 97.703  27.798 1.00 191.04 ? 146 GLN D HB3    1 
ATOM 2502 H HG2    . GLN D 1 54 ? 126.382 96.032  26.472 1.00 171.68 ? 146 GLN D HG2    1 
ATOM 2503 H HG3    . GLN D 1 54 ? 126.540 97.573  26.118 1.00 171.68 ? 146 GLN D HG3    1 
ATOM 2504 H HE21   . GLN D 1 54 ? 127.067 95.162  24.540 1.00 224.25 ? 146 GLN D HE21   1 
ATOM 2505 H HE22   . GLN D 1 54 ? 128.446 95.304  23.995 1.00 224.25 ? 146 GLN D HE22   1 
ATOM 2506 N N      . ARG D 1 55 ? 128.084 96.477  30.920 1.00 158.50 ? 147 ARG D N      1 
ATOM 2507 C CA     . ARG D 1 55 ? 128.753 96.731  32.195 1.00 139.80 ? 147 ARG D CA     1 
ATOM 2508 C C      . ARG D 1 55 ? 129.610 95.519  32.583 1.00 157.26 ? 147 ARG D C      1 
ATOM 2509 O O      . ARG D 1 55 ? 130.796 95.657  32.950 1.00 176.31 ? 147 ARG D O      1 
ATOM 2510 C CB     . ARG D 1 55 ? 127.734 97.046  33.299 1.00 123.34 ? 147 ARG D CB     1 
ATOM 2511 C CG     . ARG D 1 55 ? 126.952 98.350  33.090 1.00 122.31 ? 147 ARG D CG     1 
ATOM 2512 C CD     . ARG D 1 55 ? 126.154 98.746  34.332 1.00 120.30 ? 147 ARG D CD     1 
ATOM 2513 N NE     . ARG D 1 55 ? 124.773 98.258  34.304 1.00 120.71 ? 147 ARG D NE     1 
ATOM 2514 C CZ     . ARG D 1 55 ? 123.734 98.941  33.826 1.00 132.25 ? 147 ARG D CZ     1 
ATOM 2515 N NH1    . ARG D 1 55 ? 123.893 100.161 33.328 1.00 123.09 ? 147 ARG D NH1    1 
ATOM 2516 N NH2    . ARG D 1 55 ? 122.522 98.400  33.851 1.00 132.07 ? 147 ARG D NH2    1 
ATOM 2517 H H      . ARG D 1 55 ? 127.225 96.520  30.952 1.00 190.20 ? 147 ARG D H      1 
ATOM 2518 H HA     . ARG D 1 55 ? 129.340 97.497  32.099 1.00 167.76 ? 147 ARG D HA     1 
ATOM 2519 H HB2    . ARG D 1 55 ? 127.090 96.322  33.343 1.00 148.01 ? 147 ARG D HB2    1 
ATOM 2520 H HB3    . ARG D 1 55 ? 128.204 97.118  34.144 1.00 148.01 ? 147 ARG D HB3    1 
ATOM 2521 H HG2    . ARG D 1 55 ? 127.575 99.066  32.890 1.00 146.78 ? 147 ARG D HG2    1 
ATOM 2522 H HG3    . ARG D 1 55 ? 126.329 98.233  32.355 1.00 146.78 ? 147 ARG D HG3    1 
ATOM 2523 H HD2    . ARG D 1 55 ? 126.587 98.374  35.117 1.00 144.36 ? 147 ARG D HD2    1 
ATOM 2524 H HD3    . ARG D 1 55 ? 126.129 99.713  34.396 1.00 144.36 ? 147 ARG D HD3    1 
ATOM 2525 H HE     . ARG D 1 55 ? 124.622 97.472  34.619 1.00 144.85 ? 147 ARG D HE     1 
ATOM 2526 H HH11   . ARG D 1 55 ? 124.674 100.519 33.308 1.00 147.71 ? 147 ARG D HH11   1 
ATOM 2527 H HH12   . ARG D 1 55 ? 123.214 100.592 33.023 1.00 147.71 ? 147 ARG D HH12   1 
ATOM 2528 H HH21   . ARG D 1 55 ? 122.410 97.611  34.172 1.00 158.49 ? 147 ARG D HH21   1 
ATOM 2529 H HH22   . ARG D 1 55 ? 121.849 98.839  33.543 1.00 158.49 ? 147 ARG D HH22   1 
ATOM 2530 N N      . MET D 1 56 ? 129.017 94.331  32.480 1.00 160.00 ? 148 MET D N      1 
ATOM 2531 C CA     . MET D 1 56 ? 129.766 93.102  32.745 1.00 155.95 ? 148 MET D CA     1 
ATOM 2532 C C      . MET D 1 56 ? 131.028 92.985  31.895 1.00 175.87 ? 148 MET D C      1 
ATOM 2533 O O      . MET D 1 56 ? 132.110 92.733  32.427 1.00 198.08 ? 148 MET D O      1 
ATOM 2534 C CB     . MET D 1 56 ? 128.891 91.873  32.511 1.00 169.62 ? 148 MET D CB     1 
ATOM 2535 C CG     . MET D 1 56 ? 127.670 91.810  33.398 1.00 180.32 ? 148 MET D CG     1 
ATOM 2536 S SD     . MET D 1 56 ? 128.044 92.261  35.100 1.00 183.31 ? 148 MET D SD     1 
ATOM 2537 C CE     . MET D 1 56 ? 126.574 91.670  35.903 1.00 172.58 ? 148 MET D CE     1 
ATOM 2538 H H      . MET D 1 56 ? 128.194 94.209  32.262 1.00 191.99 ? 148 MET D H      1 
ATOM 2539 H HA     . MET D 1 56 ? 130.026 93.099  33.680 1.00 187.15 ? 148 MET D HA     1 
ATOM 2540 H HB2    . MET D 1 56 ? 128.587 91.878  31.590 1.00 203.55 ? 148 MET D HB2    1 
ATOM 2541 H HB3    . MET D 1 56 ? 129.419 91.077  32.678 1.00 203.55 ? 148 MET D HB3    1 
ATOM 2542 H HG2    . MET D 1 56 ? 127.001 92.427  33.062 1.00 216.38 ? 148 MET D HG2    1 
ATOM 2543 H HG3    . MET D 1 56 ? 127.321 90.905  33.395 1.00 216.38 ? 148 MET D HG3    1 
ATOM 2544 H HE1    . MET D 1 56 ? 126.495 90.715  35.753 1.00 207.10 ? 148 MET D HE1    1 
ATOM 2545 H HE2    . MET D 1 56 ? 126.640 91.852  36.853 1.00 207.10 ? 148 MET D HE2    1 
ATOM 2546 H HE3    . MET D 1 56 ? 125.806 92.129  35.530 1.00 207.10 ? 148 MET D HE3    1 
ATOM 2547 N N      . LYS D 1 57 ? 130.889 93.136  30.581 1.00 153.71 ? 149 LYS D N      1 
ATOM 2548 C CA     . LYS D 1 57 ? 132.046 93.115  29.693 1.00 159.22 ? 149 LYS D CA     1 
ATOM 2549 C C      . LYS D 1 57 ? 133.077 94.147  30.143 1.00 170.27 ? 149 LYS D C      1 
ATOM 2550 O O      . LYS D 1 57 ? 134.274 93.859  30.189 1.00 211.47 ? 149 LYS D O      1 
ATOM 2551 C CB     . LYS D 1 57 ? 131.635 93.382  28.244 1.00 185.24 ? 149 LYS D CB     1 
ATOM 2552 C CG     . LYS D 1 57 ? 132.812 93.405  27.275 1.00 195.19 ? 149 LYS D CG     1 
ATOM 2553 C CD     . LYS D 1 57 ? 132.379 93.745  25.861 1.00 187.18 ? 149 LYS D CD     1 
ATOM 2554 C CE     . LYS D 1 57 ? 133.584 93.928  24.950 1.00 196.95 ? 149 LYS D CE     1 
ATOM 2555 N NZ     . LYS D 1 57 ? 133.191 94.214  23.543 1.00 195.31 ? 149 LYS D NZ     1 
ATOM 2556 H H      . LYS D 1 57 ? 130.137 93.251  30.180 1.00 184.45 ? 149 LYS D H      1 
ATOM 2557 H HA     . LYS D 1 57 ? 132.460 92.239  29.732 1.00 191.06 ? 149 LYS D HA     1 
ATOM 2558 H HB2    . LYS D 1 57 ? 131.026 92.683  27.957 1.00 222.28 ? 149 LYS D HB2    1 
ATOM 2559 H HB3    . LYS D 1 57 ? 131.193 94.244  28.197 1.00 222.28 ? 149 LYS D HB3    1 
ATOM 2560 H HG2    . LYS D 1 57 ? 133.450 94.076  27.565 1.00 234.23 ? 149 LYS D HG2    1 
ATOM 2561 H HG3    . LYS D 1 57 ? 133.230 92.530  27.261 1.00 234.23 ? 149 LYS D HG3    1 
ATOM 2562 H HD2    . LYS D 1 57 ? 131.836 93.022  25.509 1.00 224.61 ? 149 LYS D HD2    1 
ATOM 2563 H HD3    . LYS D 1 57 ? 131.874 94.573  25.870 1.00 224.61 ? 149 LYS D HD3    1 
ATOM 2564 H HE2    . LYS D 1 57 ? 134.116 94.673  25.272 1.00 236.34 ? 149 LYS D HE2    1 
ATOM 2565 H HE3    . LYS D 1 57 ? 134.113 93.114  24.955 1.00 236.34 ? 149 LYS D HE3    1 
ATOM 2566 H HZ1    . LYS D 1 57 ? 133.917 94.316  23.039 1.00 234.37 ? 149 LYS D HZ1    1 
ATOM 2567 H HZ2    . LYS D 1 57 ? 132.706 93.542  23.220 1.00 234.37 ? 149 LYS D HZ2    1 
ATOM 2568 H HZ3    . LYS D 1 57 ? 132.709 94.962  23.509 1.00 234.37 ? 149 LYS D HZ3    1 
ATOM 2569 N N      . SER D 1 58 ? 132.599 95.345  30.470 1.00 146.65 ? 150 SER D N      1 
ATOM 2570 C CA     . SER D 1 58 ? 133.473 96.440  30.871 1.00 168.36 ? 150 SER D CA     1 
ATOM 2571 C C      . SER D 1 58 ? 134.305 96.082  32.099 1.00 198.33 ? 150 SER D C      1 
ATOM 2572 O O      . SER D 1 58 ? 135.483 96.438  32.166 1.00 207.72 ? 150 SER D O      1 
ATOM 2573 C CB     . SER D 1 58 ? 132.660 97.705  31.149 1.00 175.86 ? 150 SER D CB     1 
ATOM 2574 O OG     . SER D 1 58 ? 133.504 98.766  31.565 1.00 171.02 ? 150 SER D OG     1 
ATOM 2575 H H      . SER D 1 58 ? 131.763 95.550  30.466 1.00 175.98 ? 150 SER D H      1 
ATOM 2576 H HA     . SER D 1 58 ? 134.085 96.634  30.144 1.00 202.04 ? 150 SER D HA     1 
ATOM 2577 H HB2    . SER D 1 58 ? 132.198 97.969  30.337 1.00 211.03 ? 150 SER D HB2    1 
ATOM 2578 H HB3    . SER D 1 58 ? 132.017 97.519  31.851 1.00 211.03 ? 150 SER D HB3    1 
ATOM 2579 H HG     . SER D 1 58 ? 134.067 98.937  30.965 1.00 205.22 ? 150 SER D HG     1 
ATOM 2580 N N      . LYS D 1 59 ? 133.699 95.401  33.071 1.00 212.90 ? 151 LYS D N      1 
ATOM 2581 C CA     . LYS D 1 59 ? 134.464 94.939  34.234 1.00 210.34 ? 151 LYS D CA     1 
ATOM 2582 C C      . LYS D 1 59 ? 135.739 94.172  33.857 1.00 210.82 ? 151 LYS D C      1 
ATOM 2583 O O      . LYS D 1 59 ? 136.844 94.585  34.215 1.00 217.77 ? 151 LYS D O      1 
ATOM 2584 C CB     . LYS D 1 59 ? 133.607 94.037  35.122 1.00 202.44 ? 151 LYS D CB     1 
ATOM 2585 C CG     . LYS D 1 59 ? 132.795 94.758  36.178 1.00 216.49 ? 151 LYS D CG     1 
ATOM 2586 C CD     . LYS D 1 59 ? 132.566 93.844  37.372 1.00 220.88 ? 151 LYS D CD     1 
ATOM 2587 C CE     . LYS D 1 59 ? 131.730 94.509  38.446 1.00 214.29 ? 151 LYS D CE     1 
ATOM 2588 N NZ     . LYS D 1 59 ? 131.616 93.639  39.647 1.00 218.88 ? 151 LYS D NZ     1 
ATOM 2589 H H      . LYS D 1 59 ? 132.864 95.196  33.084 1.00 255.48 ? 151 LYS D H      1 
ATOM 2590 H HA     . LYS D 1 59 ? 134.727 95.710  34.761 1.00 252.41 ? 151 LYS D HA     1 
ATOM 2591 H HB2    . LYS D 1 59 ? 132.985 93.551  34.557 1.00 242.93 ? 151 LYS D HB2    1 
ATOM 2592 H HB3    . LYS D 1 59 ? 134.189 93.410  35.578 1.00 242.93 ? 151 LYS D HB3    1 
ATOM 2593 H HG2    . LYS D 1 59 ? 133.279 95.544  36.479 1.00 259.79 ? 151 LYS D HG2    1 
ATOM 2594 H HG3    . LYS D 1 59 ? 131.933 95.009  35.811 1.00 259.79 ? 151 LYS D HG3    1 
ATOM 2595 H HD2    . LYS D 1 59 ? 132.100 93.046  37.077 1.00 265.05 ? 151 LYS D HD2    1 
ATOM 2596 H HD3    . LYS D 1 59 ? 133.422 93.606  37.760 1.00 265.05 ? 151 LYS D HD3    1 
ATOM 2597 H HE2    . LYS D 1 59 ? 132.149 95.342  38.711 1.00 257.15 ? 151 LYS D HE2    1 
ATOM 2598 H HE3    . LYS D 1 59 ? 130.837 94.674  38.103 1.00 257.15 ? 151 LYS D HE3    1 
ATOM 2599 H HZ1    . LYS D 1 59 ? 131.123 94.042  40.268 1.00 262.65 ? 151 LYS D HZ1    1 
ATOM 2600 H HZ2    . LYS D 1 59 ? 131.231 92.867  39.428 1.00 262.65 ? 151 LYS D HZ2    1 
ATOM 2601 H HZ3    . LYS D 1 59 ? 132.425 93.475  39.981 1.00 262.65 ? 151 LYS D HZ3    1 
ATOM 2602 N N      . ARG D 1 60 ? 135.569 93.054  33.155 1.00 205.94 ? 152 ARG D N      1 
ATOM 2603 C CA     . ARG D 1 60 ? 136.667 92.156  32.785 1.00 205.62 ? 152 ARG D CA     1 
ATOM 2604 C C      . ARG D 1 60 ? 137.936 92.849  32.287 1.00 212.18 ? 152 ARG D C      1 
ATOM 2605 O O      . ARG D 1 60 ? 139.037 92.557  32.755 1.00 223.42 ? 152 ARG D O      1 
ATOM 2606 C CB     . ARG D 1 60 ? 136.180 91.194  31.706 1.00 205.34 ? 152 ARG D CB     1 
ATOM 2607 C CG     . ARG D 1 60 ? 135.268 90.099  32.218 1.00 215.81 ? 152 ARG D CG     1 
ATOM 2608 C CD     . ARG D 1 60 ? 134.386 89.591  31.097 1.00 233.31 ? 152 ARG D CD     1 
ATOM 2609 N NE     . ARG D 1 60 ? 133.814 88.278  31.373 1.00 244.51 ? 152 ARG D NE     1 
ATOM 2610 C CZ     . ARG D 1 60 ? 133.038 87.614  30.521 1.00 240.74 ? 152 ARG D CZ     1 
ATOM 2611 N NH1    . ARG D 1 60 ? 132.734 88.146  29.345 1.00 233.53 ? 152 ARG D NH1    1 
ATOM 2612 N NH2    . ARG D 1 60 ? 132.558 86.423  30.848 1.00 241.17 ? 152 ARG D NH2    1 
ATOM 2613 H H      . ARG D 1 60 ? 134.802 92.785  32.872 1.00 247.13 ? 152 ARG D H      1 
ATOM 2614 H HA     . ARG D 1 60 ? 136.908 91.628  33.562 1.00 246.75 ? 152 ARG D HA     1 
ATOM 2615 H HB2    . ARG D 1 60 ? 135.690 91.698  31.038 1.00 246.41 ? 152 ARG D HB2    1 
ATOM 2616 H HB3    . ARG D 1 60 ? 136.950 90.769  31.297 1.00 246.41 ? 152 ARG D HB3    1 
ATOM 2617 H HG2    . ARG D 1 60 ? 135.802 89.360  32.550 1.00 258.97 ? 152 ARG D HG2    1 
ATOM 2618 H HG3    . ARG D 1 60 ? 134.700 90.452  32.921 1.00 258.97 ? 152 ARG D HG3    1 
ATOM 2619 H HD2    . ARG D 1 60 ? 133.655 90.214  30.964 1.00 279.98 ? 152 ARG D HD2    1 
ATOM 2620 H HD3    . ARG D 1 60 ? 134.914 89.523  30.286 1.00 279.98 ? 152 ARG D HD3    1 
ATOM 2621 H HE     . ARG D 1 60 ? 133.916 87.952  32.162 1.00 293.41 ? 152 ARG D HE     1 
ATOM 2622 H HH11   . ARG D 1 60 ? 133.044 88.920  29.129 1.00 280.24 ? 152 ARG D HH11   1 
ATOM 2623 H HH12   . ARG D 1 60 ? 132.231 87.717  28.795 1.00 280.24 ? 152 ARG D HH12   1 
ATOM 2624 H HH21   . ARG D 1 60 ? 132.751 86.075  31.610 1.00 289.40 ? 152 ARG D HH21   1 
ATOM 2625 H HH22   . ARG D 1 60 ? 132.054 85.996  30.296 1.00 289.40 ? 152 ARG D HH22   1 
ATOM 2626 N N      . TRP D 1 61 ? 137.772 93.757  31.329 1.00 221.70 ? 153 TRP D N      1 
ATOM 2627 C CA     . TRP D 1 61 ? 138.904 94.388  30.659 1.00 205.13 ? 153 TRP D CA     1 
ATOM 2628 C C      . TRP D 1 61 ? 139.764 95.182  31.637 1.00 219.81 ? 153 TRP D C      1 
ATOM 2629 O O      . TRP D 1 61 ? 140.960 94.923  31.776 1.00 228.92 ? 153 TRP D O      1 
ATOM 2630 C CB     . TRP D 1 61 ? 138.414 95.302  29.535 1.00 179.96 ? 153 TRP D CB     1 
ATOM 2631 H H      . TRP D 1 61 ? 137.006 94.028  31.047 1.00 266.04 ? 153 TRP D H      1 
ATOM 2632 H HA     . TRP D 1 61 ? 139.460 93.698  30.264 1.00 246.15 ? 153 TRP D HA     1 
ATOM 2633 O "O5'"  . DG  E 2 1  ? 109.052 95.463  37.975 1.00 172.86 ? 1   DG  E "O5'"  1 
ATOM 2634 C "C5'"  . DG  E 2 1  ? 108.859 96.863  37.798 1.00 172.97 ? 1   DG  E "C5'"  1 
ATOM 2635 C "C4'"  . DG  E 2 1  ? 110.003 97.658  38.400 1.00 180.93 ? 1   DG  E "C4'"  1 
ATOM 2636 O "O4'"  . DG  E 2 1  ? 110.015 97.460  39.836 1.00 206.55 ? 1   DG  E "O4'"  1 
ATOM 2637 C "C3'"  . DG  E 2 1  ? 111.392 97.258  37.921 1.00 185.83 ? 1   DG  E "C3'"  1 
ATOM 2638 O "O3'"  . DG  E 2 1  ? 111.735 98.038  36.781 1.00 192.37 ? 1   DG  E "O3'"  1 
ATOM 2639 C "C2'"  . DG  E 2 1  ? 112.283 97.537  39.126 1.00 180.17 ? 1   DG  E "C2'"  1 
ATOM 2640 C "C1'"  . DG  E 2 1  ? 111.343 97.389  40.317 1.00 203.36 ? 1   DG  E "C1'"  1 
ATOM 2641 N N9     . DG  E 2 1  ? 111.493 96.118  41.020 1.00 212.91 ? 1   DG  E N9     1 
ATOM 2642 C C8     . DG  E 2 1  ? 110.711 94.997  40.879 1.00 218.58 ? 1   DG  E C8     1 
ATOM 2643 N N7     . DG  E 2 1  ? 111.083 94.005  41.639 1.00 206.15 ? 1   DG  E N7     1 
ATOM 2644 C C5     . DG  E 2 1  ? 112.186 94.497  42.325 1.00 196.56 ? 1   DG  E C5     1 
ATOM 2645 C C6     . DG  E 2 1  ? 113.012 93.874  43.291 1.00 206.45 ? 1   DG  E C6     1 
ATOM 2646 O O6     . DG  E 2 1  ? 112.932 92.724  43.745 1.00 221.32 ? 1   DG  E O6     1 
ATOM 2647 N N1     . DG  E 2 1  ? 114.020 94.729  43.732 1.00 195.05 ? 1   DG  E N1     1 
ATOM 2648 C C2     . DG  E 2 1  ? 114.203 96.021  43.296 1.00 176.81 ? 1   DG  E C2     1 
ATOM 2649 N N2     . DG  E 2 1  ? 115.229 96.695  43.836 1.00 161.01 ? 1   DG  E N2     1 
ATOM 2650 N N3     . DG  E 2 1  ? 113.435 96.616  42.393 1.00 175.62 ? 1   DG  E N3     1 
ATOM 2651 C C4     . DG  E 2 1  ? 112.451 95.796  41.954 1.00 192.33 ? 1   DG  E C4     1 
ATOM 2652 H "H5'"  . DG  E 2 1  ? 108.029 97.125  38.226 1.00 207.56 ? 1   DG  E "H5'"  1 
ATOM 2653 H "H5''" . DG  E 2 1  ? 108.802 97.057  36.849 1.00 207.56 ? 1   DG  E "H5''" 1 
ATOM 2654 H "H4'"  . DG  E 2 1  ? 109.864 98.600  38.213 1.00 217.11 ? 1   DG  E "H4'"  1 
ATOM 2655 H "H3'"  . DG  E 2 1  ? 111.411 96.314  37.701 1.00 223.00 ? 1   DG  E "H3'"  1 
ATOM 2656 H "H2'"  . DG  E 2 1  ? 113.001 96.887  39.176 1.00 216.21 ? 1   DG  E "H2'"  1 
ATOM 2657 H "H2''" . DG  E 2 1  ? 112.640 98.439  39.084 1.00 216.21 ? 1   DG  E "H2''" 1 
ATOM 2658 H "H1'"  . DG  E 2 1  ? 111.497 98.118  40.939 1.00 244.03 ? 1   DG  E "H1'"  1 
ATOM 2659 H H8     . DG  E 2 1  ? 109.983 94.952  40.302 1.00 262.29 ? 1   DG  E H8     1 
ATOM 2660 H H1     . DG  E 2 1  ? 114.568 94.426  44.321 1.00 234.06 ? 1   DG  E H1     1 
ATOM 2661 H H21    . DG  E 2 1  ? 115.385 97.506  43.595 1.00 193.21 ? 1   DG  E H21    1 
ATOM 2662 H H22    . DG  E 2 1  ? 115.732 96.316  44.422 1.00 193.21 ? 1   DG  E H22    1 
ATOM 2663 H "HO5'" . DG  E 2 1  ? 108.299 94.847  37.866 1.00 207.44 ? 1   DG  E "HO5'" 1 
ATOM 2664 P P      . DG  E 2 2  ? 112.770 97.481  35.686 1.00 174.53 ? 2   DG  E P      1 
ATOM 2665 O OP1    . DG  E 2 2  ? 112.596 98.318  34.480 1.00 159.61 ? 2   DG  E OP1    1 
ATOM 2666 O OP2    . DG  E 2 2  ? 112.618 96.011  35.593 1.00 167.76 ? 2   DG  E OP2    1 
ATOM 2667 O "O5'"  . DG  E 2 2  ? 114.205 97.785  36.325 1.00 99.01  ? 2   DG  E "O5'"  1 
ATOM 2668 C "C5'"  . DG  E 2 2  ? 114.553 99.136  36.624 1.00 114.80 ? 2   DG  E "C5'"  1 
ATOM 2669 C "C4'"  . DG  E 2 2  ? 115.918 99.212  37.279 1.00 124.58 ? 2   DG  E "C4'"  1 
ATOM 2670 O "O4'"  . DG  E 2 2  ? 115.863 98.484  38.533 1.00 144.08 ? 2   DG  E "O4'"  1 
ATOM 2671 C "C3'"  . DG  E 2 2  ? 117.045 98.604  36.451 1.00 137.58 ? 2   DG  E "C3'"  1 
ATOM 2672 O "O3'"  . DG  E 2 2  ? 118.137 99.521  36.340 1.00 128.37 ? 2   DG  E "O3'"  1 
ATOM 2673 C "C2'"  . DG  E 2 2  ? 117.433 97.329  37.193 1.00 176.34 ? 2   DG  E "C2'"  1 
ATOM 2674 C "C1'"  . DG  E 2 2  ? 116.883 97.510  38.602 1.00 165.60 ? 2   DG  E "C1'"  1 
ATOM 2675 N N9     . DG  E 2 2  ? 116.294 96.294  39.159 1.00 171.26 ? 2   DG  E N9     1 
ATOM 2676 C C8     . DG  E 2 2  ? 115.242 95.577  38.641 1.00 181.19 ? 2   DG  E C8     1 
ATOM 2677 N N7     . DG  E 2 2  ? 114.922 94.532  39.351 1.00 184.01 ? 2   DG  E N7     1 
ATOM 2678 C C5     . DG  E 2 2  ? 115.822 94.552  40.407 1.00 177.53 ? 2   DG  E C5     1 
ATOM 2679 C C6     . DG  E 2 2  ? 115.957 93.661  41.497 1.00 180.95 ? 2   DG  E C6     1 
ATOM 2680 O O6     . DG  E 2 2  ? 115.284 92.651  41.745 1.00 187.09 ? 2   DG  E O6     1 
ATOM 2681 N N1     . DG  E 2 2  ? 116.996 94.042  42.345 1.00 174.38 ? 2   DG  E N1     1 
ATOM 2682 C C2     . DG  E 2 2  ? 117.797 95.146  42.154 1.00 150.14 ? 2   DG  E C2     1 
ATOM 2683 N N2     . DG  E 2 2  ? 118.751 95.359  43.072 1.00 114.36 ? 2   DG  E N2     1 
ATOM 2684 N N3     . DG  E 2 2  ? 117.678 95.989  41.135 1.00 157.66 ? 2   DG  E N3     1 
ATOM 2685 C C4     . DG  E 2 2  ? 116.672 95.631  40.304 1.00 166.47 ? 2   DG  E C4     1 
ATOM 2686 H "H5'"  . DG  E 2 2  ? 113.890 99.510  37.226 1.00 137.76 ? 2   DG  E "H5'"  1 
ATOM 2687 H "H5''" . DG  E 2 2  ? 114.564 99.652  35.803 1.00 137.76 ? 2   DG  E "H5''" 1 
ATOM 2688 H "H4'"  . DG  E 2 2  ? 116.128 100.141 37.463 1.00 149.49 ? 2   DG  E "H4'"  1 
ATOM 2689 H "H3'"  . DG  E 2 2  ? 116.715 98.380  35.566 1.00 165.09 ? 2   DG  E "H3'"  1 
ATOM 2690 H "H2'"  . DG  E 2 2  ? 117.028 96.556  36.769 1.00 211.60 ? 2   DG  E "H2'"  1 
ATOM 2691 H "H2''" . DG  E 2 2  ? 118.398 97.234  37.217 1.00 211.60 ? 2   DG  E "H2''" 1 
ATOM 2692 H "H1'"  . DG  E 2 2  ? 117.590 97.824  39.187 1.00 198.72 ? 2   DG  E "H1'"  1 
ATOM 2693 H H8     . DG  E 2 2  ? 114.797 95.818  37.862 1.00 217.43 ? 2   DG  E H8     1 
ATOM 2694 H H1     . DG  E 2 2  ? 117.148 93.553  43.036 1.00 209.25 ? 2   DG  E H1     1 
ATOM 2695 H H21    . DG  E 2 2  ? 119.277 96.035  42.997 1.00 137.23 ? 2   DG  E H21    1 
ATOM 2696 H H22    . DG  E 2 2  ? 118.836 94.819  43.736 1.00 137.23 ? 2   DG  E H22    1 
ATOM 2697 P P      . DC  E 2 3  ? 119.418 99.154  35.440 1.00 132.05 ? 3   DC  E P      1 
ATOM 2698 O OP1    . DC  E 2 3  ? 120.034 100.425 34.995 1.00 139.49 ? 3   DC  E OP1    1 
ATOM 2699 O OP2    . DC  E 2 3  ? 118.993 98.147  34.443 1.00 156.39 ? 3   DC  E OP2    1 
ATOM 2700 O "O5'"  . DC  E 2 3  ? 120.411 98.427  36.463 1.00 96.64  ? 3   DC  E "O5'"  1 
ATOM 2701 C "C5'"  . DC  E 2 3  ? 120.867 99.107  37.634 1.00 120.60 ? 3   DC  E "C5'"  1 
ATOM 2702 C "C4'"  . DC  E 2 3  ? 121.563 98.156  38.594 1.00 122.37 ? 3   DC  E "C4'"  1 
ATOM 2703 O "O4'"  . DC  E 2 3  ? 120.602 97.201  39.118 1.00 138.56 ? 3   DC  E "O4'"  1 
ATOM 2704 C "C3'"  . DC  E 2 3  ? 122.695 97.336  37.978 1.00 109.27 ? 3   DC  E "C3'"  1 
ATOM 2705 O "O3'"  . DC  E 2 3  ? 123.942 97.684  38.568 1.00 128.18 ? 3   DC  E "O3'"  1 
ATOM 2706 C "C2'"  . DC  E 2 3  ? 122.335 95.880  38.262 1.00 121.62 ? 3   DC  E "C2'"  1 
ATOM 2707 C "C1'"  . DC  E 2 3  ? 121.242 95.957  39.316 1.00 116.84 ? 3   DC  E "C1'"  1 
ATOM 2708 N N1     . DC  E 2 3  ? 120.253 94.842  39.200 1.00 132.48 ? 3   DC  E N1     1 
ATOM 2709 C C2     . DC  E 2 3  ? 120.270 93.765  40.098 1.00 149.90 ? 3   DC  E C2     1 
ATOM 2710 O O2     . DC  E 2 3  ? 121.115 93.729  41.001 1.00 120.27 ? 3   DC  E O2     1 
ATOM 2711 N N3     . DC  E 2 3  ? 119.353 92.774  39.947 1.00 172.60 ? 3   DC  E N3     1 
ATOM 2712 C C4     . DC  E 2 3  ? 118.453 92.832  38.964 1.00 158.63 ? 3   DC  E C4     1 
ATOM 2713 N N4     . DC  E 2 3  ? 117.568 91.835  38.855 1.00 165.05 ? 3   DC  E N4     1 
ATOM 2714 C C5     . DC  E 2 3  ? 118.422 93.919  38.046 1.00 138.07 ? 3   DC  E C5     1 
ATOM 2715 C C6     . DC  E 2 3  ? 119.329 94.886  38.201 1.00 126.47 ? 3   DC  E C6     1 
ATOM 2716 H "H5'"  . DC  E 2 3  ? 120.107 99.510  38.083 1.00 144.72 ? 3   DC  E "H5'"  1 
ATOM 2717 H "H5''" . DC  E 2 3  ? 121.488 99.805  37.374 1.00 144.72 ? 3   DC  E "H5''" 1 
ATOM 2718 H "H4'"  . DC  E 2 3  ? 121.922 98.671  39.333 1.00 146.84 ? 3   DC  E "H4'"  1 
ATOM 2719 H "H3'"  . DC  E 2 3  ? 122.728 97.487  37.021 1.00 131.13 ? 3   DC  E "H3'"  1 
ATOM 2720 H "H2'"  . DC  E 2 3  ? 122.001 95.451  37.459 1.00 145.95 ? 3   DC  E "H2'"  1 
ATOM 2721 H "H2''" . DC  E 2 3  ? 123.106 95.402  38.608 1.00 145.95 ? 3   DC  E "H2''" 1 
ATOM 2722 H "H1'"  . DC  E 2 3  ? 121.645 95.940  40.199 1.00 140.20 ? 3   DC  E "H1'"  1 
ATOM 2723 H H41    . DC  E 2 3  ? 116.978 91.851  38.229 1.00 198.06 ? 3   DC  E H41    1 
ATOM 2724 H H42    . DC  E 2 3  ? 117.589 91.179  39.410 1.00 198.06 ? 3   DC  E H42    1 
ATOM 2725 H H5     . DC  E 2 3  ? 117.792 93.954  37.362 1.00 165.68 ? 3   DC  E H5     1 
ATOM 2726 H H6     . DC  E 2 3  ? 119.329 95.607  37.613 1.00 151.76 ? 3   DC  E H6     1 
ATOM 2727 P P      . DC  E 2 4  ? 125.312 97.079  37.983 1.00 142.89 ? 4   DC  E P      1 
ATOM 2728 O OP1    . DC  E 2 4  ? 126.421 97.964  38.400 1.00 123.76 ? 4   DC  E OP1    1 
ATOM 2729 O OP2    . DC  E 2 4  ? 125.104 96.796  36.546 1.00 136.83 ? 4   DC  E OP2    1 
ATOM 2730 O "O5'"  . DC  E 2 4  ? 125.454 95.676  38.736 1.00 107.69 ? 4   DC  E "O5'"  1 
ATOM 2731 C "C5'"  . DC  E 2 4  ? 125.663 95.643  40.145 1.00 138.01 ? 4   DC  E "C5'"  1 
ATOM 2732 C "C4'"  . DC  E 2 4  ? 125.658 94.214  40.655 1.00 155.26 ? 4   DC  E "C4'"  1 
ATOM 2733 O "O4'"  . DC  E 2 4  ? 124.346 93.615  40.468 1.00 157.34 ? 4   DC  E "O4'"  1 
ATOM 2734 C "C3'"  . DC  E 2 4  ? 126.662 93.315  39.942 1.00 114.24 ? 4   DC  E "C3'"  1 
ATOM 2735 O "O3'"  . DC  E 2 4  ? 127.614 92.791  40.856 1.00 129.13 ? 4   DC  E "O3'"  1 
ATOM 2736 C "C2'"  . DC  E 2 4  ? 125.800 92.224  39.314 1.00 116.44 ? 4   DC  E "C2'"  1 
ATOM 2737 C "C1'"  . DC  E 2 4  ? 124.519 92.255  40.125 1.00 149.05 ? 4   DC  E "C1'"  1 
ATOM 2738 N N1     . DC  E 2 4  ? 123.355 91.758  39.333 1.00 139.16 ? 4   DC  E N1     1 
ATOM 2739 C C2     . DC  E 2 4  ? 122.838 90.471  39.544 1.00 158.99 ? 4   DC  E C2     1 
ATOM 2740 O O2     . DC  E 2 4  ? 123.344 89.734  40.401 1.00 165.69 ? 4   DC  E O2     1 
ATOM 2741 N N3     . DC  E 2 4  ? 121.783 90.059  38.795 1.00 164.58 ? 4   DC  E N3     1 
ATOM 2742 C C4     . DC  E 2 4  ? 121.253 90.868  37.876 1.00 148.19 ? 4   DC  E C4     1 
ATOM 2743 N N4     . DC  E 2 4  ? 120.215 90.416  37.164 1.00 158.09 ? 4   DC  E N4     1 
ATOM 2744 C C5     . DC  E 2 4  ? 121.768 92.177  37.646 1.00 118.67 ? 4   DC  E C5     1 
ATOM 2745 C C6     . DC  E 2 4  ? 122.807 92.574  38.388 1.00 116.56 ? 4   DC  E C6     1 
ATOM 2746 H "H5'"  . DC  E 2 4  ? 124.956 96.142  40.584 1.00 165.61 ? 4   DC  E "H5'"  1 
ATOM 2747 H "H5''" . DC  E 2 4  ? 126.518 96.053  40.351 1.00 165.61 ? 4   DC  E "H5''" 1 
ATOM 2748 H "H4'"  . DC  E 2 4  ? 125.865 94.222  41.603 1.00 186.31 ? 4   DC  E "H4'"  1 
ATOM 2749 H "H3'"  . DC  E 2 4  ? 127.115 93.817  39.246 1.00 137.09 ? 4   DC  E "H3'"  1 
ATOM 2750 H "H2'"  . DC  E 2 4  ? 125.618 92.427  38.383 1.00 139.73 ? 4   DC  E "H2'"  1 
ATOM 2751 H "H2''" . DC  E 2 4  ? 126.233 91.359  39.397 1.00 139.73 ? 4   DC  E "H2''" 1 
ATOM 2752 H "H1'"  . DC  E 2 4  ? 124.624 91.723  40.929 1.00 178.86 ? 4   DC  E "H1'"  1 
ATOM 2753 H H41    . DC  E 2 4  ? 119.854 90.916  36.565 1.00 189.71 ? 4   DC  E H41    1 
ATOM 2754 H H42    . DC  E 2 4  ? 119.909 89.625  37.305 1.00 189.71 ? 4   DC  E H42    1 
ATOM 2755 H H5     . DC  E 2 4  ? 121.393 92.735  37.004 1.00 142.40 ? 4   DC  E H5     1 
ATOM 2756 H H6     . DC  E 2 4  ? 123.161 93.424  38.258 1.00 139.87 ? 4   DC  E H6     1 
ATOM 2757 P P      . DC  E 2 5  ? 128.943 92.067  40.314 1.00 180.84 ? 5   DC  E P      1 
ATOM 2758 O OP1    . DC  E 2 5  ? 129.924 92.034  41.423 1.00 148.06 ? 5   DC  E OP1    1 
ATOM 2759 O OP2    . DC  E 2 5  ? 129.316 92.697  39.029 1.00 196.64 ? 5   DC  E OP2    1 
ATOM 2760 O "O5'"  . DC  E 2 5  ? 128.464 90.576  40.002 1.00 141.08 ? 5   DC  E "O5'"  1 
ATOM 2761 C "C5'"  . DC  E 2 5  ? 128.027 89.747  41.068 1.00 185.21 ? 5   DC  E "C5'"  1 
ATOM 2762 C "C4'"  . DC  E 2 5  ? 127.519 88.415  40.550 1.00 201.61 ? 5   DC  E "C4'"  1 
ATOM 2763 O "O4'"  . DC  E 2 5  ? 126.239 88.602  39.899 1.00 180.74 ? 5   DC  E "O4'"  1 
ATOM 2764 C "C3'"  . DC  E 2 5  ? 128.415 87.753  39.506 1.00 195.67 ? 5   DC  E "C3'"  1 
ATOM 2765 O "O3'"  . DC  E 2 5  ? 129.171 86.706  40.108 1.00 190.75 ? 5   DC  E "O3'"  1 
ATOM 2766 C "C2'"  . DC  E 2 5  ? 127.448 87.246  38.432 1.00 182.25 ? 5   DC  E "C2'"  1 
ATOM 2767 C "C1'"  . DC  E 2 5  ? 126.063 87.522  39.011 1.00 174.76 ? 5   DC  E "C1'"  1 
ATOM 2768 N N1     . DC  E 2 5  ? 125.032 87.896  37.992 1.00 173.04 ? 5   DC  E N1     1 
ATOM 2769 C C2     . DC  E 2 5  ? 124.042 86.982  37.607 1.00 208.53 ? 5   DC  E C2     1 
ATOM 2770 O O2     . DC  E 2 5  ? 124.018 85.851  38.109 1.00 241.98 ? 5   DC  E O2     1 
ATOM 2771 N N3     . DC  E 2 5  ? 123.124 87.357  36.682 1.00 198.71 ? 5   DC  E N3     1 
ATOM 2772 C C4     . DC  E 2 5  ? 123.166 88.580  36.152 1.00 159.64 ? 5   DC  E C4     1 
ATOM 2773 N N4     . DC  E 2 5  ? 122.239 88.902  35.243 1.00 140.54 ? 5   DC  E N4     1 
ATOM 2774 C C5     . DC  E 2 5  ? 124.162 89.526  36.531 1.00 146.37 ? 5   DC  E C5     1 
ATOM 2775 C C6     . DC  E 2 5  ? 125.062 89.145  37.444 1.00 160.06 ? 5   DC  E C6     1 
ATOM 2776 H "H5'"  . DC  E 2 5  ? 127.313 90.195  41.547 1.00 222.25 ? 5   DC  E "H5'"  1 
ATOM 2777 H "H5''" . DC  E 2 5  ? 128.768 89.591  41.674 1.00 222.25 ? 5   DC  E "H5''" 1 
ATOM 2778 H "H4'"  . DC  E 2 5  ? 127.406 87.808  41.299 1.00 241.94 ? 5   DC  E "H4'"  1 
ATOM 2779 H "H3'"  . DC  E 2 5  ? 129.014 88.413  39.123 1.00 234.81 ? 5   DC  E "H3'"  1 
ATOM 2780 H "H2'"  . DC  E 2 5  ? 127.573 87.737  37.604 1.00 218.70 ? 5   DC  E "H2'"  1 
ATOM 2781 H "H2''" . DC  E 2 5  ? 127.571 86.295  38.286 1.00 218.70 ? 5   DC  E "H2''" 1 
ATOM 2782 H "H1'"  . DC  E 2 5  ? 125.760 86.744  39.506 1.00 209.71 ? 5   DC  E "H1'"  1 
ATOM 2783 H H41    . DC  E 2 5  ? 122.241 89.683  34.884 1.00 168.65 ? 5   DC  E H41    1 
ATOM 2784 H H42    . DC  E 2 5  ? 121.640 88.327  35.018 1.00 168.65 ? 5   DC  E H42    1 
ATOM 2785 H H5     . DC  E 2 5  ? 124.185 90.377  36.156 1.00 175.64 ? 5   DC  E H5     1 
ATOM 2786 H H6     . DC  E 2 5  ? 125.724 89.743  37.708 1.00 192.07 ? 5   DC  E H6     1 
ATOM 2787 P P      . DA  E 2 6  ? 130.213 85.852  39.233 1.00 198.92 ? 6   DA  E P      1 
ATOM 2788 O OP1    . DA  E 2 6  ? 131.376 85.544  40.095 1.00 213.71 ? 6   DA  E OP1    1 
ATOM 2789 O OP2    . DA  E 2 6  ? 130.413 86.564  37.950 1.00 185.74 ? 6   DA  E OP2    1 
ATOM 2790 O "O5'"  . DA  E 2 6  ? 129.428 84.497  38.914 1.00 191.42 ? 6   DA  E "O5'"  1 
ATOM 2791 C "C5'"  . DA  E 2 6  ? 128.867 83.741  39.981 1.00 211.14 ? 6   DA  E "C5'"  1 
ATOM 2792 C "C4'"  . DA  E 2 6  ? 127.878 82.729  39.439 1.00 227.40 ? 6   DA  E "C4'"  1 
ATOM 2793 O "O4'"  . DA  E 2 6  ? 126.873 83.446  38.677 1.00 221.76 ? 6   DA  E "O4'"  1 
ATOM 2794 C "C3'"  . DA  E 2 6  ? 128.479 81.687  38.499 1.00 237.90 ? 6   DA  E "C3'"  1 
ATOM 2795 O "O3'"  . DA  E 2 6  ? 128.012 80.386  38.848 1.00 249.29 ? 6   DA  E "O3'"  1 
ATOM 2796 C "C2'"  . DA  E 2 6  ? 128.018 82.134  37.113 1.00 228.92 ? 6   DA  E "C2'"  1 
ATOM 2797 C "C1'"  . DA  E 2 6  ? 126.707 82.854  37.405 1.00 218.12 ? 6   DA  E "C1'"  1 
ATOM 2798 N N9     . DA  E 2 6  ? 126.383 83.906  36.443 1.00 201.80 ? 6   DA  E N9     1 
ATOM 2799 C C8     . DA  E 2 6  ? 127.201 84.909  36.000 1.00 188.53 ? 6   DA  E C8     1 
ATOM 2800 N N7     . DA  E 2 6  ? 126.633 85.718  35.137 1.00 177.38 ? 6   DA  E N7     1 
ATOM 2801 C C5     . DA  E 2 6  ? 125.349 85.216  35.010 1.00 184.29 ? 6   DA  E C5     1 
ATOM 2802 C C6     . DA  E 2 6  ? 124.240 85.626  34.243 1.00 183.60 ? 6   DA  E C6     1 
ATOM 2803 N N6     . DA  E 2 6  ? 124.260 86.683  33.425 1.00 186.57 ? 6   DA  E N6     1 
ATOM 2804 N N1     . DA  E 2 6  ? 123.106 84.903  34.349 1.00 195.49 ? 6   DA  E N1     1 
ATOM 2805 C C2     . DA  E 2 6  ? 123.088 83.845  35.169 1.00 226.59 ? 6   DA  E C2     1 
ATOM 2806 N N3     . DA  E 2 6  ? 124.064 83.364  35.938 1.00 229.24 ? 6   DA  E N3     1 
ATOM 2807 C C4     . DA  E 2 6  ? 125.177 84.102  35.810 1.00 205.33 ? 6   DA  E C4     1 
ATOM 2808 H "H5'"  . DA  E 2 6  ? 128.411 84.339  40.593 1.00 253.37 ? 6   DA  E "H5'"  1 
ATOM 2809 H "H5''" . DA  E 2 6  ? 129.575 83.276  40.453 1.00 253.37 ? 6   DA  E "H5''" 1 
ATOM 2810 H "H4'"  . DA  E 2 6  ? 127.449 82.276  40.181 1.00 272.88 ? 6   DA  E "H4'"  1 
ATOM 2811 H "H3'"  . DA  E 2 6  ? 129.447 81.717  38.550 1.00 285.48 ? 6   DA  E "H3'"  1 
ATOM 2812 H "H2'"  . DA  E 2 6  ? 128.662 82.742  36.716 1.00 274.70 ? 6   DA  E "H2'"  1 
ATOM 2813 H "H2''" . DA  E 2 6  ? 127.867 81.368  36.538 1.00 274.70 ? 6   DA  E "H2''" 1 
ATOM 2814 H "H1'"  . DA  E 2 6  ? 125.983 82.210  37.440 1.00 261.75 ? 6   DA  E "H1'"  1 
ATOM 2815 H H8     . DA  E 2 6  ? 128.083 85.004  36.280 1.00 226.23 ? 6   DA  E H8     1 
ATOM 2816 H H61    . DA  E 2 6  ? 123.557 86.894  32.977 1.00 223.88 ? 6   DA  E H61    1 
ATOM 2817 H H62    . DA  E 2 6  ? 124.976 87.153  33.347 1.00 223.88 ? 6   DA  E H62    1 
ATOM 2818 H H2     . DA  E 2 6  ? 122.284 83.381  35.206 1.00 271.90 ? 6   DA  E H2     1 
ATOM 2819 P P      . DT  E 2 7  ? 128.516 79.095  38.034 1.00 244.26 ? 7   DT  E P      1 
ATOM 2820 O OP1    . DT  E 2 7  ? 128.447 77.930  38.944 1.00 265.36 ? 7   DT  E OP1    1 
ATOM 2821 O OP2    . DT  E 2 7  ? 129.796 79.444  37.379 1.00 240.62 ? 7   DT  E OP2    1 
ATOM 2822 O "O5'"  . DT  E 2 7  ? 127.412 78.925  36.891 1.00 237.01 ? 7   DT  E "O5'"  1 
ATOM 2823 C "C5'"  . DT  E 2 7  ? 126.038 78.844  37.249 1.00 255.18 ? 7   DT  E "C5'"  1 
ATOM 2824 C "C4'"  . DT  E 2 7  ? 125.154 79.036  36.033 1.00 263.09 ? 7   DT  E "C4'"  1 
ATOM 2825 O "O4'"  . DT  E 2 7  ? 125.319 80.388  35.537 1.00 257.54 ? 7   DT  E "O4'"  1 
ATOM 2826 C "C3'"  . DT  E 2 7  ? 125.476 78.123  34.853 1.00 263.84 ? 7   DT  E "C3'"  1 
ATOM 2827 O "O3'"  . DT  E 2 7  ? 124.463 77.133  34.706 1.00 275.09 ? 7   DT  E "O3'"  1 
ATOM 2828 C "C2'"  . DT  E 2 7  ? 125.570 79.056  33.645 1.00 250.54 ? 7   DT  E "C2'"  1 
ATOM 2829 C "C1'"  . DT  E 2 7  ? 125.026 80.384  34.158 1.00 248.37 ? 7   DT  E "C1'"  1 
ATOM 2830 N N1     . DT  E 2 7  ? 125.647 81.588  33.513 1.00 237.30 ? 7   DT  E N1     1 
ATOM 2831 C C2     . DT  E 2 7  ? 124.881 82.421  32.722 1.00 223.50 ? 7   DT  E C2     1 
ATOM 2832 O O2     . DT  E 2 7  ? 123.695 82.247  32.502 1.00 218.95 ? 7   DT  E O2     1 
ATOM 2833 N N3     . DT  E 2 7  ? 125.559 83.487  32.187 1.00 203.34 ? 7   DT  E N3     1 
ATOM 2834 C C4     . DT  E 2 7  ? 126.895 83.798  32.355 1.00 194.98 ? 7   DT  E C4     1 
ATOM 2835 O O4     . DT  E 2 7  ? 127.403 84.783  31.827 1.00 181.58 ? 7   DT  E O4     1 
ATOM 2836 C C5     . DT  E 2 7  ? 127.640 82.888  33.192 1.00 207.66 ? 7   DT  E C5     1 
ATOM 2837 C C7     . DT  E 2 7  ? 129.101 83.113  33.455 1.00 202.58 ? 7   DT  E C7     1 
ATOM 2838 C C6     . DT  E 2 7  ? 126.989 81.843  33.722 1.00 228.40 ? 7   DT  E C6     1 
ATOM 2839 H "H5'"  . DT  E 2 7  ? 125.837 79.532  37.902 1.00 306.22 ? 7   DT  E "H5'"  1 
ATOM 2840 H "H5''" . DT  E 2 7  ? 125.861 77.973  37.638 1.00 306.22 ? 7   DT  E "H5''" 1 
ATOM 2841 H "H4'"  . DT  E 2 7  ? 124.228 78.904  36.291 1.00 315.70 ? 7   DT  E "H4'"  1 
ATOM 2842 H "H3'"  . DT  E 2 7  ? 126.333 77.692  35.000 1.00 316.61 ? 7   DT  E "H3'"  1 
ATOM 2843 H "H2'"  . DT  E 2 7  ? 126.493 79.153  33.362 1.00 300.65 ? 7   DT  E "H2'"  1 
ATOM 2844 H "H2''" . DT  E 2 7  ? 125.023 78.724  32.916 1.00 300.65 ? 7   DT  E "H2''" 1 
ATOM 2845 H "H1'"  . DT  E 2 7  ? 124.065 80.410  34.032 1.00 298.05 ? 7   DT  E "H1'"  1 
ATOM 2846 H H3     . DT  E 2 7  ? 125.102 84.020  31.691 1.00 244.01 ? 7   DT  E H3     1 
ATOM 2847 H H71    . DT  E 2 7  ? 129.608 82.350  33.136 1.00 243.10 ? 7   DT  E H71    1 
ATOM 2848 H H72    . DT  E 2 7  ? 129.394 83.912  32.991 1.00 243.10 ? 7   DT  E H72    1 
ATOM 2849 H H73    . DT  E 2 7  ? 129.245 83.221  34.408 1.00 243.10 ? 7   DT  E H73    1 
ATOM 2850 H H6     . DT  E 2 7  ? 127.468 81.255  34.260 1.00 274.08 ? 7   DT  E H6     1 
ATOM 2851 P P      . DT  E 2 8  ? 124.610 75.986  33.590 1.00 265.44 ? 8   DT  E P      1 
ATOM 2852 O OP1    . DT  E 2 8  ? 124.027 74.744  34.143 1.00 298.32 ? 8   DT  E OP1    1 
ATOM 2853 O OP2    . DT  E 2 8  ? 126.013 75.991  33.118 1.00 256.34 ? 8   DT  E OP2    1 
ATOM 2854 O "O5'"  . DT  E 2 8  ? 123.688 76.503  32.390 1.00 227.89 ? 8   DT  E "O5'"  1 
ATOM 2855 C "C5'"  . DT  E 2 8  ? 122.309 76.777  32.618 1.00 238.49 ? 8   DT  E "C5'"  1 
ATOM 2856 C "C4'"  . DT  E 2 8  ? 121.716 77.525  31.439 1.00 244.70 ? 8   DT  E "C4'"  1 
ATOM 2857 O "O4'"  . DT  E 2 8  ? 122.413 78.783  31.266 1.00 244.10 ? 8   DT  E "O4'"  1 
ATOM 2858 C "C3'"  . DT  E 2 8  ? 121.823 76.776  30.114 1.00 240.62 ? 8   DT  E "C3'"  1 
ATOM 2859 O "O3'"  . DT  E 2 8  ? 120.532 76.396  29.637 1.00 248.80 ? 8   DT  E "O3'"  1 
ATOM 2860 C "C2'"  . DT  E 2 8  ? 122.517 77.757  29.170 1.00 224.92 ? 8   DT  E "C2'"  1 
ATOM 2861 C "C1'"  . DT  E 2 8  ? 122.450 79.098  29.891 1.00 224.84 ? 8   DT  E "C1'"  1 
ATOM 2862 N N1     . DT  E 2 8  ? 123.619 79.995  29.625 1.00 207.66 ? 8   DT  E N1     1 
ATOM 2863 C C2     . DT  E 2 8  ? 123.446 81.160  28.904 1.00 196.11 ? 8   DT  E C2     1 
ATOM 2864 O O2     . DT  E 2 8  ? 122.376 81.526  28.450 1.00 178.65 ? 8   DT  E O2     1 
ATOM 2865 N N3     . DT  E 2 8  ? 124.591 81.896  28.727 1.00 193.04 ? 8   DT  E N3     1 
ATOM 2866 C C4     . DT  E 2 8  ? 125.860 81.594  29.186 1.00 183.14 ? 8   DT  E C4     1 
ATOM 2867 O O4     . DT  E 2 8  ? 126.820 82.327  28.970 1.00 160.46 ? 8   DT  E O4     1 
ATOM 2868 C C5     . DT  E 2 8  ? 125.970 80.364  29.932 1.00 193.88 ? 8   DT  E C5     1 
ATOM 2869 C C7     . DT  E 2 8  ? 127.295 79.924  30.486 1.00 188.69 ? 8   DT  E C7     1 
ATOM 2870 C C6     . DT  E 2 8  ? 124.860 79.635  30.113 1.00 202.53 ? 8   DT  E C6     1 
ATOM 2871 H "H5'"  . DT  E 2 8  ? 122.217 77.318  33.418 1.00 286.19 ? 8   DT  E "H5'"  1 
ATOM 2872 H "H5''" . DT  E 2 8  ? 121.832 75.942  32.739 1.00 286.19 ? 8   DT  E "H5''" 1 
ATOM 2873 H "H4'"  . DT  E 2 8  ? 120.781 77.707  31.621 1.00 293.64 ? 8   DT  E "H4'"  1 
ATOM 2874 H "H3'"  . DT  E 2 8  ? 122.376 75.986  30.228 1.00 288.74 ? 8   DT  E "H3'"  1 
ATOM 2875 H "H2'"  . DT  E 2 8  ? 123.440 77.495  29.029 1.00 269.90 ? 8   DT  E "H2'"  1 
ATOM 2876 H "H2''" . DT  E 2 8  ? 122.044 77.804  28.324 1.00 269.90 ? 8   DT  E "H2''" 1 
ATOM 2877 H "H1'"  . DT  E 2 8  ? 121.631 79.555  29.644 1.00 269.81 ? 8   DT  E "H1'"  1 
ATOM 2878 H H3     . DT  E 2 8  ? 124.510 82.627  28.280 1.00 231.65 ? 8   DT  E H3     1 
ATOM 2879 H H71    . DT  E 2 8  ? 127.234 79.849  31.451 1.00 226.43 ? 8   DT  E H71    1 
ATOM 2880 H H72    . DT  E 2 8  ? 127.533 79.062  30.109 1.00 226.43 ? 8   DT  E H72    1 
ATOM 2881 H H73    . DT  E 2 8  ? 127.975 80.576  30.254 1.00 226.43 ? 8   DT  E H73    1 
ATOM 2882 H H6     . DT  E 2 8  ? 124.930 78.842  30.593 1.00 243.04 ? 8   DT  E H6     1 
ATOM 2883 P P      . DC  E 2 9  ? 120.383 75.257  28.511 1.00 257.01 ? 9   DC  E P      1 
ATOM 2884 O OP1    . DC  E 2 9  ? 118.984 74.778  28.547 1.00 263.25 ? 9   DC  E OP1    1 
ATOM 2885 O OP2    . DC  E 2 9  ? 121.492 74.292  28.679 1.00 276.96 ? 9   DC  E OP2    1 
ATOM 2886 O "O5'"  . DC  E 2 9  ? 120.623 76.038  27.137 1.00 228.77 ? 9   DC  E "O5'"  1 
ATOM 2887 C "C5'"  . DC  E 2 9  ? 119.704 77.034  26.705 1.00 230.10 ? 9   DC  E "C5'"  1 
ATOM 2888 C "C4'"  . DC  E 2 9  ? 120.267 77.789  25.516 1.00 225.47 ? 9   DC  E "C4'"  1 
ATOM 2889 O "O4'"  . DC  E 2 9  ? 121.461 78.501  25.930 1.00 219.51 ? 9   DC  E "O4'"  1 
ATOM 2890 C "C3'"  . DC  E 2 9  ? 120.680 76.899  24.346 1.00 232.44 ? 9   DC  E "C3'"  1 
ATOM 2891 O "O3'"  . DC  E 2 9  ? 120.108 77.371  23.129 1.00 237.54 ? 9   DC  E "O3'"  1 
ATOM 2892 C "C2'"  . DC  E 2 9  ? 122.205 76.978  24.346 1.00 228.00 ? 9   DC  E "C2'"  1 
ATOM 2893 C "C1'"  . DC  E 2 9  ? 122.458 78.359  24.942 1.00 208.85 ? 9   DC  E "C1'"  1 
ATOM 2894 N N1     . DC  E 2 9  ? 123.795 78.538  25.598 1.00 191.14 ? 9   DC  E N1     1 
ATOM 2895 C C2     . DC  E 2 9  ? 124.584 79.666  25.328 1.00 186.31 ? 9   DC  E C2     1 
ATOM 2896 O O2     . DC  E 2 9  ? 124.179 80.529  24.538 1.00 188.87 ? 9   DC  E O2     1 
ATOM 2897 N N3     . DC  E 2 9  ? 125.786 79.790  25.947 1.00 180.24 ? 9   DC  E N3     1 
ATOM 2898 C C4     . DC  E 2 9  ? 126.206 78.851  26.798 1.00 183.35 ? 9   DC  E C4     1 
ATOM 2899 N N4     . DC  E 2 9  ? 127.398 79.016  27.383 1.00 168.80 ? 9   DC  E N4     1 
ATOM 2900 C C5     . DC  E 2 9  ? 125.420 77.698  27.086 1.00 181.78 ? 9   DC  E C5     1 
ATOM 2901 C C6     . DC  E 2 9  ? 124.238 77.587  26.471 1.00 182.01 ? 9   DC  E C6     1 
ATOM 2902 H "H5'"  . DC  E 2 9  ? 119.541 77.656  27.431 1.00 276.12 ? 9   DC  E "H5'"  1 
ATOM 2903 H "H5''" . DC  E 2 9  ? 118.869 76.611  26.450 1.00 276.12 ? 9   DC  E "H5''" 1 
ATOM 2904 H "H4'"  . DC  E 2 9  ? 119.608 78.430  25.207 1.00 270.57 ? 9   DC  E "H4'"  1 
ATOM 2905 H "H3'"  . DC  E 2 9  ? 120.398 75.985  24.512 1.00 278.92 ? 9   DC  E "H3'"  1 
ATOM 2906 H "H2'"  . DC  E 2 9  ? 122.586 76.286  24.908 1.00 273.60 ? 9   DC  E "H2'"  1 
ATOM 2907 H "H2''" . DC  E 2 9  ? 122.553 76.924  23.443 1.00 273.60 ? 9   DC  E "H2''" 1 
ATOM 2908 H "H1'"  . DC  E 2 9  ? 122.336 79.036  24.258 1.00 250.63 ? 9   DC  E "H1'"  1 
ATOM 2909 H H41    . DC  E 2 9  ? 127.691 78.425  27.935 1.00 202.56 ? 9   DC  E H41    1 
ATOM 2910 H H42    . DC  E 2 9  ? 127.871 79.712  27.208 1.00 202.56 ? 9   DC  E H42    1 
ATOM 2911 H H5     . DC  E 2 9  ? 125.718 77.047  27.679 1.00 218.14 ? 9   DC  E H5     1 
ATOM 2912 H H6     . DC  E 2 9  ? 123.705 76.844  26.642 1.00 218.41 ? 9   DC  E H6     1 
ATOM 2913 P P      . DA  E 2 10 ? 119.771 76.341  21.943 1.00 270.25 ? 10  DA  E P      1 
ATOM 2914 O OP1    . DA  E 2 10 ? 118.360 75.925  22.098 1.00 276.50 ? 10  DA  E OP1    1 
ATOM 2915 O OP2    . DA  E 2 10 ? 120.843 75.321  21.918 1.00 278.36 ? 10  DA  E OP2    1 
ATOM 2916 O "O5'"  . DA  E 2 10 ? 119.907 77.222  20.615 1.00 233.73 ? 10  DA  E "O5'"  1 
ATOM 2917 C "C5'"  . DA  E 2 10 ? 119.130 78.403  20.463 1.00 246.15 ? 10  DA  E "C5'"  1 
ATOM 2918 C "C4'"  . DA  E 2 10 ? 119.941 79.488  19.780 1.00 251.22 ? 10  DA  E "C4'"  1 
ATOM 2919 O "O4'"  . DA  E 2 10 ? 121.130 79.763  20.567 1.00 249.94 ? 10  DA  E "O4'"  1 
ATOM 2920 C "C3'"  . DA  E 2 10 ? 120.435 79.137  18.380 1.00 246.63 ? 10  DA  E "C3'"  1 
ATOM 2921 O "O3'"  . DA  E 2 10 ? 120.334 80.273  17.527 1.00 247.78 ? 10  DA  E "O3'"  1 
ATOM 2922 C "C2'"  . DA  E 2 10 ? 121.883 78.724  18.616 1.00 235.61 ? 10  DA  E "C2'"  1 
ATOM 2923 C "C1'"  . DA  E 2 10 ? 122.282 79.657  19.752 1.00 231.73 ? 10  DA  E "C1'"  1 
ATOM 2924 N N9     . DA  E 2 10 ? 123.396 79.191  20.573 1.00 214.60 ? 10  DA  E N9     1 
ATOM 2925 C C8     . DA  E 2 10 ? 123.543 77.964  21.157 1.00 215.23 ? 10  DA  E C8     1 
ATOM 2926 N N7     . DA  E 2 10 ? 124.653 77.835  21.846 1.00 211.61 ? 10  DA  E N7     1 
ATOM 2927 C C5     . DA  E 2 10 ? 125.275 79.065  21.708 1.00 197.50 ? 10  DA  E C5     1 
ATOM 2928 C C6     . DA  E 2 10 ? 126.491 79.577  22.202 1.00 187.19 ? 10  DA  E C6     1 
ATOM 2929 N N6     . DA  E 2 10 ? 127.332 78.874  22.967 1.00 183.36 ? 10  DA  E N6     1 
ATOM 2930 N N1     . DA  E 2 10 ? 126.813 80.846  21.873 1.00 178.19 ? 10  DA  E N1     1 
ATOM 2931 C C2     . DA  E 2 10 ? 125.971 81.549  21.107 1.00 181.25 ? 10  DA  E C2     1 
ATOM 2932 N N3     . DA  E 2 10 ? 124.804 81.177  20.586 1.00 190.56 ? 10  DA  E N3     1 
ATOM 2933 C C4     . DA  E 2 10 ? 124.511 79.912  20.927 1.00 198.08 ? 10  DA  E C4     1 
ATOM 2934 H "H5'"  . DA  E 2 10 ? 118.849 78.716  21.337 1.00 295.38 ? 10  DA  E "H5'"  1 
ATOM 2935 H "H5''" . DA  E 2 10 ? 118.346 78.204  19.927 1.00 295.38 ? 10  DA  E "H5''" 1 
ATOM 2936 H "H4'"  . DA  E 2 10 ? 119.405 80.295  19.730 1.00 301.47 ? 10  DA  E "H4'"  1 
ATOM 2937 H "H3'"  . DA  E 2 10 ? 119.926 78.394  18.019 1.00 295.95 ? 10  DA  E "H3'"  1 
ATOM 2938 H "H2'"  . DA  E 2 10 ? 121.939 77.796  18.894 1.00 282.73 ? 10  DA  E "H2'"  1 
ATOM 2939 H "H2''" . DA  E 2 10 ? 122.424 78.888  17.827 1.00 282.73 ? 10  DA  E "H2''" 1 
ATOM 2940 H "H1'"  . DA  E 2 10 ? 122.496 80.531  19.388 1.00 278.08 ? 10  DA  E "H1'"  1 
ATOM 2941 H H8     . DA  E 2 10 ? 122.916 77.282  21.071 1.00 258.28 ? 10  DA  E H8     1 
ATOM 2942 H H61    . DA  E 2 10 ? 128.065 79.231  23.242 1.00 220.04 ? 10  DA  E H61    1 
ATOM 2943 H H62    . DA  E 2 10 ? 127.140 78.064  23.184 1.00 220.04 ? 10  DA  E H62    1 
ATOM 2944 H H2     . DA  E 2 10 ? 126.238 82.418  20.910 1.00 217.50 ? 10  DA  E H2     1 
ATOM 2945 P P      . DA  E 2 11 ? 120.161 80.088  15.940 1.00 264.67 ? 11  DA  E P      1 
ATOM 2946 O OP1    . DA  E 2 11 ? 120.229 81.431  15.322 1.00 259.22 ? 11  DA  E OP1    1 
ATOM 2947 O OP2    . DA  E 2 11 ? 118.970 79.237  15.717 1.00 273.67 ? 11  DA  E OP2    1 
ATOM 2948 O "O5'"  . DA  E 2 11 ? 121.450 79.243  15.510 1.00 256.58 ? 11  DA  E "O5'"  1 
ATOM 2949 C "C5'"  . DA  E 2 11 ? 122.259 79.642  14.410 1.00 251.12 ? 11  DA  E "C5'"  1 
ATOM 2950 C "C4'"  . DA  E 2 11 ? 123.199 80.760  14.824 1.00 233.75 ? 11  DA  E "C4'"  1 
ATOM 2951 O "O4'"  . DA  E 2 11 ? 123.660 80.500  16.176 1.00 221.93 ? 11  DA  E "O4'"  1 
ATOM 2952 C "C3'"  . DA  E 2 11 ? 124.438 80.896  13.943 1.00 230.98 ? 11  DA  E "C3'"  1 
ATOM 2953 O "O3'"  . DA  E 2 11 ? 124.605 82.237  13.476 1.00 220.32 ? 11  DA  E "O3'"  1 
ATOM 2954 C "C2'"  . DA  E 2 11 ? 125.594 80.458  14.840 1.00 228.79 ? 11  DA  E "C2'"  1 
ATOM 2955 C "C1'"  . DA  E 2 11 ? 125.066 80.609  16.261 1.00 216.03 ? 11  DA  E "C1'"  1 
ATOM 2956 N N9     . DA  E 2 11 ? 125.573 79.573  17.158 1.00 224.48 ? 11  DA  E N9     1 
ATOM 2957 C C8     . DA  E 2 11 ? 125.054 78.321  17.340 1.00 249.83 ? 11  DA  E C8     1 
ATOM 2958 N N7     . DA  E 2 11 ? 125.712 77.592  18.210 1.00 245.53 ? 11  DA  E N7     1 
ATOM 2959 C C5     . DA  E 2 11 ? 126.734 78.424  18.632 1.00 218.49 ? 11  DA  E C5     1 
ATOM 2960 C C6     . DA  E 2 11 ? 127.783 78.240  19.555 1.00 206.83 ? 11  DA  E C6     1 
ATOM 2961 N N6     . DA  E 2 11 ? 127.969 77.109  20.242 1.00 214.92 ? 11  DA  E N6     1 
ATOM 2962 N N1     . DA  E 2 11 ? 128.632 79.270  19.748 1.00 199.35 ? 11  DA  E N1     1 
ATOM 2963 C C2     . DA  E 2 11 ? 128.441 80.401  19.058 1.00 196.35 ? 11  DA  E C2     1 
ATOM 2964 N N3     . DA  E 2 11 ? 127.495 80.690  18.165 1.00 189.43 ? 11  DA  E N3     1 
ATOM 2965 C C4     . DA  E 2 11 ? 126.664 79.649  17.995 1.00 207.45 ? 11  DA  E C4     1 
ATOM 2966 H "H5'"  . DA  E 2 11 ? 121.689 79.952  13.689 1.00 301.34 ? 11  DA  E "H5'"  1 
ATOM 2967 H "H5''" . DA  E 2 11 ? 122.779 78.883  14.103 1.00 301.34 ? 11  DA  E "H5''" 1 
ATOM 2968 H "H4'"  . DA  E 2 11 ? 122.712 81.599  14.814 1.00 280.50 ? 11  DA  E "H4'"  1 
ATOM 2969 H "H3'"  . DA  E 2 11 ? 124.367 80.294  13.186 1.00 277.17 ? 11  DA  E "H3'"  1 
ATOM 2970 H "H2'"  . DA  E 2 11 ? 125.826 79.533  14.663 1.00 274.54 ? 11  DA  E "H2'"  1 
ATOM 2971 H "H2''" . DA  E 2 11 ? 126.364 81.032  14.703 1.00 274.54 ? 11  DA  E "H2''" 1 
ATOM 2972 H "H1'"  . DA  E 2 11 ? 125.304 81.484  16.605 1.00 259.23 ? 11  DA  E "H1'"  1 
ATOM 2973 H H8     . DA  E 2 11 ? 124.304 78.013  16.885 1.00 299.80 ? 11  DA  E H8     1 
ATOM 2974 H H61    . DA  E 2 11 ? 128.623 77.045  20.797 1.00 257.90 ? 11  DA  E H61    1 
ATOM 2975 H H62    . DA  E 2 11 ? 127.435 76.444  20.129 1.00 257.90 ? 11  DA  E H62    1 
ATOM 2976 H H2     . DA  E 2 11 ? 129.054 81.080  19.225 1.00 235.62 ? 11  DA  E H2     1 
ATOM 2977 P P      . DG  E 2 12 ? 125.697 82.571  12.343 1.00 241.03 ? 12  DG  E P      1 
ATOM 2978 O OP1    . DG  E 2 12 ? 125.293 83.835  11.689 1.00 227.23 ? 12  DG  E OP1    1 
ATOM 2979 O OP2    . DG  E 2 12 ? 125.898 81.353  11.526 1.00 242.96 ? 12  DG  E OP2    1 
ATOM 2980 O "O5'"  . DG  E 2 12 ? 127.038 82.828  13.173 1.00 192.48 ? 12  DG  E "O5'"  1 
ATOM 2981 C "C5'"  . DG  E 2 12 ? 128.270 83.116  12.523 1.00 201.87 ? 12  DG  E "C5'"  1 
ATOM 2982 C "C4'"  . DG  E 2 12 ? 129.326 83.437  13.563 1.00 214.72 ? 12  DG  E "C4'"  1 
ATOM 2983 O "O4'"  . DG  E 2 12 ? 129.126 82.559  14.700 1.00 222.72 ? 12  DG  E "O4'"  1 
ATOM 2984 C "C3'"  . DG  E 2 12 ? 130.765 83.225  13.112 1.00 219.94 ? 12  DG  E "C3'"  1 
ATOM 2985 O "O3'"  . DG  E 2 12 ? 131.633 84.191  13.697 1.00 215.98 ? 12  DG  E "O3'"  1 
ATOM 2986 C "C2'"  . DG  E 2 12 ? 131.059 81.809  13.593 1.00 225.84 ? 12  DG  E "C2'"  1 
ATOM 2987 C "C1'"  . DG  E 2 12 ? 130.228 81.688  14.864 1.00 223.11 ? 12  DG  E "C1'"  1 
ATOM 2988 N N9     . DG  E 2 12 ? 129.707 80.343  15.097 1.00 216.22 ? 12  DG  E N9     1 
ATOM 2989 C C8     . DG  E 2 12 ? 128.691 79.724  14.411 1.00 227.02 ? 12  DG  E C8     1 
ATOM 2990 N N7     . DG  E 2 12 ? 128.425 78.523  14.843 1.00 234.59 ? 12  DG  E N7     1 
ATOM 2991 C C5     . DG  E 2 12 ? 129.314 78.333  15.892 1.00 221.31 ? 12  DG  E C5     1 
ATOM 2992 C C6     . DG  E 2 12 ? 129.494 77.216  16.743 1.00 218.60 ? 12  DG  E C6     1 
ATOM 2993 O O6     . DG  E 2 12 ? 128.882 76.137  16.740 1.00 218.12 ? 12  DG  E O6     1 
ATOM 2994 N N1     . DG  E 2 12 ? 130.506 77.439  17.671 1.00 201.93 ? 12  DG  E N1     1 
ATOM 2995 C C2     . DG  E 2 12 ? 131.246 78.594  17.762 1.00 186.63 ? 12  DG  E C2     1 
ATOM 2996 N N2     . DG  E 2 12 ? 132.174 78.619  18.725 1.00 193.61 ? 12  DG  E N2     1 
ATOM 2997 N N3     . DG  E 2 12 ? 131.091 79.647  16.973 1.00 165.00 ? 12  DG  E N3     1 
ATOM 2998 C C4     . DG  E 2 12 ? 130.109 79.447  16.062 1.00 196.87 ? 12  DG  E C4     1 
ATOM 2999 H "H5'"  . DG  E 2 12 ? 128.154 83.877  11.933 1.00 242.24 ? 12  DG  E "H5'"  1 
ATOM 3000 H "H5''" . DG  E 2 12 ? 128.550 82.345  12.005 1.00 242.24 ? 12  DG  E "H5''" 1 
ATOM 3001 H "H4'"  . DG  E 2 12 ? 129.217 84.357  13.850 1.00 257.66 ? 12  DG  E "H4'"  1 
ATOM 3002 H "H3'"  . DG  E 2 12 ? 130.820 83.267  12.144 1.00 263.92 ? 12  DG  E "H3'"  1 
ATOM 3003 H "HO3'" . DG  E 2 12 ? 132.269 83.942  14.187 1.00 259.17 ? 12  DG  E "HO3'" 1 
ATOM 3004 H "H2'"  . DG  E 2 12 ? 130.772 81.157  12.933 1.00 271.00 ? 12  DG  E "H2'"  1 
ATOM 3005 H "H2''" . DG  E 2 12 ? 132.003 81.704  13.790 1.00 271.00 ? 12  DG  E "H2''" 1 
ATOM 3006 H "H1'"  . DG  E 2 12 ? 130.756 81.971  15.627 1.00 267.73 ? 12  DG  E "H1'"  1 
ATOM 3007 H H8     . DG  E 2 12 ? 128.241 80.120  13.701 1.00 272.43 ? 12  DG  E H8     1 
ATOM 3008 H H1     . DG  E 2 12 ? 130.681 76.809  18.230 1.00 242.32 ? 12  DG  E H1     1 
ATOM 3009 H H21    . DG  E 2 12 ? 132.666 79.317  18.829 1.00 232.33 ? 12  DG  E H21    1 
ATOM 3010 H H22    . DG  E 2 12 ? 132.278 77.938  19.239 1.00 232.33 ? 12  DG  E H22    1 
ATOM 3011 O "O5'"  . DC  F 3 1  ? 137.541 74.584  23.945 1.00 266.28 ? 1   DC  F "O5'"  1 
ATOM 3012 C "C5'"  . DC  F 3 1  ? 138.729 75.083  23.342 1.00 270.87 ? 1   DC  F "C5'"  1 
ATOM 3013 C "C4'"  . DC  F 3 1  ? 138.428 76.227  22.391 1.00 259.03 ? 1   DC  F "C4'"  1 
ATOM 3014 O "O4'"  . DC  F 3 1  ? 137.500 75.753  21.385 1.00 250.54 ? 1   DC  F "O4'"  1 
ATOM 3015 C "C3'"  . DC  F 3 1  ? 137.731 77.421  23.027 1.00 253.76 ? 1   DC  F "C3'"  1 
ATOM 3016 O "O3'"  . DC  F 3 1  ? 138.653 78.413  23.456 1.00 264.20 ? 1   DC  F "O3'"  1 
ATOM 3017 C "C2'"  . DC  F 3 1  ? 136.842 77.967  21.913 1.00 231.05 ? 1   DC  F "C2'"  1 
ATOM 3018 C "C1'"  . DC  F 3 1  ? 136.654 76.800  20.955 1.00 209.93 ? 1   DC  F "C1'"  1 
ATOM 3019 N N1     . DC  F 3 1  ? 135.237 76.349  20.982 1.00 208.99 ? 1   DC  F N1     1 
ATOM 3020 C C2     . DC  F 3 1  ? 134.303 76.958  20.139 1.00 205.26 ? 1   DC  F C2     1 
ATOM 3021 O O2     . DC  F 3 1  ? 134.670 77.848  19.360 1.00 202.82 ? 1   DC  F O2     1 
ATOM 3022 N N3     . DC  F 3 1  ? 133.012 76.547  20.186 1.00 204.43 ? 1   DC  F N3     1 
ATOM 3023 C C4     . DC  F 3 1  ? 132.644 75.585  21.036 1.00 219.27 ? 1   DC  F C4     1 
ATOM 3024 N N4     . DC  F 3 1  ? 131.359 75.215  21.047 1.00 206.20 ? 1   DC  F N4     1 
ATOM 3025 C C5     . DC  F 3 1  ? 133.580 74.961  21.911 1.00 231.13 ? 1   DC  F C5     1 
ATOM 3026 C C6     . DC  F 3 1  ? 134.850 75.376  21.856 1.00 221.73 ? 1   DC  F C6     1 
ATOM 3027 H "H5'"  . DC  F 3 1  ? 139.161 74.367  22.850 1.00 325.04 ? 1   DC  F "H5'"  1 
ATOM 3028 H "H5''" . DC  F 3 1  ? 139.330 75.397  24.036 1.00 325.04 ? 1   DC  F "H5''" 1 
ATOM 3029 H "H4'"  . DC  F 3 1  ? 139.248 76.519  21.963 1.00 310.84 ? 1   DC  F "H4'"  1 
ATOM 3030 H "H3'"  . DC  F 3 1  ? 137.185 77.128  23.773 1.00 304.51 ? 1   DC  F "H3'"  1 
ATOM 3031 H "H2'"  . DC  F 3 1  ? 135.986 78.249  22.272 1.00 277.25 ? 1   DC  F "H2'"  1 
ATOM 3032 H "H2''" . DC  F 3 1  ? 137.281 78.705  21.463 1.00 277.25 ? 1   DC  F "H2''" 1 
ATOM 3033 H "H1'"  . DC  F 3 1  ? 136.897 77.070  20.055 1.00 251.91 ? 1   DC  F "H1'"  1 
ATOM 3034 H H41    . DC  F 3 1  ? 131.094 74.598  21.584 1.00 247.44 ? 1   DC  F H41    1 
ATOM 3035 H H42    . DC  F 3 1  ? 130.798 75.594  20.516 1.00 247.44 ? 1   DC  F H42    1 
ATOM 3036 H H5     . DC  F 3 1  ? 133.317 74.291  22.500 1.00 277.35 ? 1   DC  F H5     1 
ATOM 3037 H H6     . DC  F 3 1  ? 135.483 74.985  22.414 1.00 266.07 ? 1   DC  F H6     1 
ATOM 3038 H "HO5'" . DC  F 3 1  ? 137.599 73.995  24.727 1.00 319.53 ? 1   DC  F "HO5'" 1 
ATOM 3039 P P      . DT  F 3 2  ? 138.198 79.527  24.521 1.00 251.44 ? 2   DT  F P      1 
ATOM 3040 O OP1    . DT  F 3 2  ? 139.410 80.261  24.944 1.00 274.28 ? 2   DT  F OP1    1 
ATOM 3041 O OP2    . DT  F 3 2  ? 137.348 78.869  25.539 1.00 247.07 ? 2   DT  F OP2    1 
ATOM 3042 O "O5'"  . DT  F 3 2  ? 137.267 80.512  23.671 1.00 213.17 ? 2   DT  F "O5'"  1 
ATOM 3043 C "C5'"  . DT  F 3 2  ? 137.795 81.241  22.566 1.00 233.19 ? 2   DT  F "C5'"  1 
ATOM 3044 C "C4'"  . DT  F 3 2  ? 136.687 81.984  21.843 1.00 227.11 ? 2   DT  F "C4'"  1 
ATOM 3045 O "O4'"  . DT  F 3 2  ? 135.629 81.053  21.498 1.00 226.07 ? 2   DT  F "O4'"  1 
ATOM 3046 C "C3'"  . DT  F 3 2  ? 136.039 83.094  22.668 1.00 210.52 ? 2   DT  F "C3'"  1 
ATOM 3047 O "O3'"  . DT  F 3 2  ? 136.248 84.363  22.046 1.00 199.23 ? 2   DT  F "O3'"  1 
ATOM 3048 C "C2'"  . DT  F 3 2  ? 134.561 82.717  22.747 1.00 204.73 ? 2   DT  F "C2'"  1 
ATOM 3049 C "C1'"  . DT  F 3 2  ? 134.378 81.695  21.631 1.00 194.61 ? 2   DT  F "C1'"  1 
ATOM 3050 N N1     . DT  F 3 2  ? 133.332 80.664  21.921 1.00 195.91 ? 2   DT  F N1     1 
ATOM 3051 C C2     . DT  F 3 2  ? 132.166 80.629  21.182 1.00 194.02 ? 2   DT  F C2     1 
ATOM 3052 O O2     . DT  F 3 2  ? 131.913 81.402  20.274 1.00 195.47 ? 2   DT  F O2     1 
ATOM 3053 N N3     . DT  F 3 2  ? 131.288 79.639  21.546 1.00 195.09 ? 2   DT  F N3     1 
ATOM 3054 C C4     . DT  F 3 2  ? 131.453 78.703  22.550 1.00 201.15 ? 2   DT  F C4     1 
ATOM 3055 O O4     . DT  F 3 2  ? 130.598 77.857  22.792 1.00 217.81 ? 2   DT  F O4     1 
ATOM 3056 C C5     . DT  F 3 2  ? 132.693 78.796  23.283 1.00 201.01 ? 2   DT  F C5     1 
ATOM 3057 C C7     . DT  F 3 2  ? 132.997 77.840  24.400 1.00 216.33 ? 2   DT  F C7     1 
ATOM 3058 C C6     . DT  F 3 2  ? 133.559 79.758  22.938 1.00 199.52 ? 2   DT  F C6     1 
ATOM 3059 H "H5'"  . DT  F 3 2  ? 138.223 80.625  21.951 1.00 279.82 ? 2   DT  F "H5'"  1 
ATOM 3060 H "H5''" . DT  F 3 2  ? 138.451 81.879  22.888 1.00 279.82 ? 2   DT  F "H5''" 1 
ATOM 3061 H "H4'"  . DT  F 3 2  ? 137.046 82.367  21.027 1.00 272.53 ? 2   DT  F "H4'"  1 
ATOM 3062 H "H3'"  . DT  F 3 2  ? 136.421 83.101  23.559 1.00 252.62 ? 2   DT  F "H3'"  1 
ATOM 3063 H "H2'"  . DT  F 3 2  ? 134.357 82.319  23.608 1.00 245.68 ? 2   DT  F "H2'"  1 
ATOM 3064 H "H2''" . DT  F 3 2  ? 134.003 83.495  22.589 1.00 245.68 ? 2   DT  F "H2''" 1 
ATOM 3065 H "H1'"  . DT  F 3 2  ? 134.161 82.154  20.804 1.00 233.53 ? 2   DT  F "H1'"  1 
ATOM 3066 H H3     . DT  F 3 2  ? 130.554 79.596  21.100 1.00 234.10 ? 2   DT  F H3     1 
ATOM 3067 H H71    . DT  F 3 2  ? 133.122 78.335  25.225 1.00 259.60 ? 2   DT  F H71    1 
ATOM 3068 H H72    . DT  F 3 2  ? 132.259 77.219  24.505 1.00 259.60 ? 2   DT  F H72    1 
ATOM 3069 H H73    . DT  F 3 2  ? 133.807 77.348  24.193 1.00 259.60 ? 2   DT  F H73    1 
ATOM 3070 H H6     . DT  F 3 2  ? 134.358 79.819  23.410 1.00 239.43 ? 2   DT  F H6     1 
ATOM 3071 P P      . DT  F 3 3  ? 135.887 85.720  22.828 1.00 244.13 ? 3   DT  F P      1 
ATOM 3072 O OP1    . DT  F 3 3  ? 136.814 86.773  22.358 1.00 244.98 ? 3   DT  F OP1    1 
ATOM 3073 O OP2    . DT  F 3 3  ? 135.801 85.407  24.272 1.00 245.66 ? 3   DT  F OP2    1 
ATOM 3074 O "O5'"  . DT  F 3 3  ? 134.411 86.071  22.326 1.00 190.35 ? 3   DT  F "O5'"  1 
ATOM 3075 C "C5'"  . DT  F 3 3  ? 134.168 86.368  20.956 1.00 208.76 ? 3   DT  F "C5'"  1 
ATOM 3076 C "C4'"  . DT  F 3 3  ? 132.678 86.346  20.674 1.00 203.66 ? 3   DT  F "C4'"  1 
ATOM 3077 O "O4'"  . DT  F 3 3  ? 132.163 85.035  21.005 1.00 208.99 ? 3   DT  F "O4'"  1 
ATOM 3078 C "C3'"  . DT  F 3 3  ? 131.862 87.337  21.498 1.00 176.19 ? 3   DT  F "C3'"  1 
ATOM 3079 O "O3'"  . DT  F 3 3  ? 131.485 88.460  20.695 1.00 171.96 ? 3   DT  F "O3'"  1 
ATOM 3080 C "C2'"  . DT  F 3 3  ? 130.650 86.536  21.982 1.00 176.78 ? 3   DT  F "C2'"  1 
ATOM 3081 C "C1'"  . DT  F 3 3  ? 130.801 85.156  21.347 1.00 179.94 ? 3   DT  F "C1'"  1 
ATOM 3082 N N1     . DT  F 3 3  ? 130.443 84.011  22.246 1.00 183.18 ? 3   DT  F N1     1 
ATOM 3083 C C2     . DT  F 3 3  ? 129.325 83.247  21.973 1.00 196.63 ? 3   DT  F C2     1 
ATOM 3084 O O2     . DT  F 3 3  ? 128.585 83.441  21.024 1.00 212.06 ? 3   DT  F O2     1 
ATOM 3085 N N3     . DT  F 3 3  ? 129.097 82.226  22.860 1.00 199.58 ? 3   DT  F N3     1 
ATOM 3086 C C4     . DT  F 3 3  ? 129.853 81.897  23.969 1.00 189.37 ? 3   DT  F C4     1 
ATOM 3087 O O4     . DT  F 3 3  ? 129.554 80.958  24.702 1.00 192.04 ? 3   DT  F O4     1 
ATOM 3088 C C5     . DT  F 3 3  ? 131.006 82.734  24.201 1.00 189.20 ? 3   DT  F C5     1 
ATOM 3089 C C7     . DT  F 3 3  ? 131.905 82.478  25.378 1.00 207.06 ? 3   DT  F C7     1 
ATOM 3090 C C6     . DT  F 3 3  ? 131.242 83.736  23.340 1.00 186.17 ? 3   DT  F C6     1 
ATOM 3091 H "H5'"  . DT  F 3 3  ? 134.610 85.707  20.400 1.00 250.51 ? 3   DT  F "H5'"  1 
ATOM 3092 H "H5''" . DT  F 3 3  ? 134.521 87.248  20.750 1.00 250.51 ? 3   DT  F "H5''" 1 
ATOM 3093 H "H4'"  . DT  F 3 3  ? 132.530 86.518  19.731 1.00 244.39 ? 3   DT  F "H4'"  1 
ATOM 3094 H "H3'"  . DT  F 3 3  ? 132.382 87.637  22.260 1.00 211.42 ? 3   DT  F "H3'"  1 
ATOM 3095 H "H2'"  . DT  F 3 3  ? 130.659 86.464  22.949 1.00 212.13 ? 3   DT  F "H2'"  1 
ATOM 3096 H "H2''" . DT  F 3 3  ? 129.829 86.956  21.682 1.00 212.13 ? 3   DT  F "H2''" 1 
ATOM 3097 H "H1'"  . DT  F 3 3  ? 130.263 85.113  20.541 1.00 215.93 ? 3   DT  F "H1'"  1 
ATOM 3098 H H3     . DT  F 3 3  ? 128.406 81.737  22.710 1.00 239.50 ? 3   DT  F H3     1 
ATOM 3099 H H71    . DT  F 3 3  ? 132.803 82.290  25.063 1.00 248.47 ? 3   DT  F H71    1 
ATOM 3100 H H72    . DT  F 3 3  ? 131.919 83.262  25.950 1.00 248.47 ? 3   DT  F H72    1 
ATOM 3101 H H73    . DT  F 3 3  ? 131.572 81.718  25.879 1.00 248.47 ? 3   DT  F H73    1 
ATOM 3102 H H6     . DT  F 3 3  ? 131.984 84.276  23.488 1.00 223.41 ? 3   DT  F H6     1 
ATOM 3103 P P      . DG  F 3 4  ? 131.154 89.880  21.376 1.00 222.76 ? 4   DG  F P      1 
ATOM 3104 O OP1    . DG  F 3 4  ? 131.235 90.904  20.311 1.00 199.02 ? 4   DG  F OP1    1 
ATOM 3105 O OP2    . DG  F 3 4  ? 131.983 90.025  22.592 1.00 218.10 ? 4   DG  F OP2    1 
ATOM 3106 O "O5'"  . DG  F 3 4  ? 129.628 89.748  21.835 1.00 166.80 ? 4   DG  F "O5'"  1 
ATOM 3107 C "C5'"  . DG  F 3 4  ? 128.609 89.539  20.867 1.00 172.15 ? 4   DG  F "C5'"  1 
ATOM 3108 C "C4'"  . DG  F 3 4  ? 127.330 89.054  21.523 1.00 165.23 ? 4   DG  F "C4'"  1 
ATOM 3109 O "O4'"  . DG  F 3 4  ? 127.571 87.773  22.168 1.00 168.91 ? 4   DG  F "O4'"  1 
ATOM 3110 C "C3'"  . DG  F 3 4  ? 126.781 89.975  22.608 1.00 162.41 ? 4   DG  F "C3'"  1 
ATOM 3111 O "O3'"  . DG  F 3 4  ? 125.375 90.085  22.489 1.00 159.75 ? 4   DG  F "O3'"  1 
ATOM 3112 C "C2'"  . DG  F 3 4  ? 127.187 89.269  23.894 1.00 167.82 ? 4   DG  F "C2'"  1 
ATOM 3113 C "C1'"  . DG  F 3 4  ? 127.044 87.811  23.478 1.00 169.26 ? 4   DG  F "C1'"  1 
ATOM 3114 N N9     . DG  F 3 4  ? 127.763 86.871  24.336 1.00 173.67 ? 4   DG  F N9     1 
ATOM 3115 C C8     . DG  F 3 4  ? 128.971 87.071  24.960 1.00 175.67 ? 4   DG  F C8     1 
ATOM 3116 N N7     . DG  F 3 4  ? 129.368 86.048  25.666 1.00 179.60 ? 4   DG  F N7     1 
ATOM 3117 C C5     . DG  F 3 4  ? 128.361 85.108  25.498 1.00 183.55 ? 4   DG  F C5     1 
ATOM 3118 C C6     . DG  F 3 4  ? 128.241 83.800  26.026 1.00 208.00 ? 4   DG  F C6     1 
ATOM 3119 O O6     . DG  F 3 4  ? 129.028 83.196  26.769 1.00 228.02 ? 4   DG  F O6     1 
ATOM 3120 N N1     . DG  F 3 4  ? 127.065 83.182  25.607 1.00 204.46 ? 4   DG  F N1     1 
ATOM 3121 C C2     . DG  F 3 4  ? 126.125 83.757  24.784 1.00 195.81 ? 4   DG  F C2     1 
ATOM 3122 N N2     . DG  F 3 4  ? 125.054 83.006  24.492 1.00 203.70 ? 4   DG  F N2     1 
ATOM 3123 N N3     . DG  F 3 4  ? 126.226 84.983  24.283 1.00 176.10 ? 4   DG  F N3     1 
ATOM 3124 C C4     . DG  F 3 4  ? 127.366 85.598  24.681 1.00 176.67 ? 4   DG  F C4     1 
ATOM 3125 H "H5'"  . DG  F 3 4  ? 128.910 88.877  20.225 1.00 206.58 ? 4   DG  F "H5'"  1 
ATOM 3126 H "H5''" . DG  F 3 4  ? 128.433 90.374  20.404 1.00 206.58 ? 4   DG  F "H5''" 1 
ATOM 3127 H "H4'"  . DG  F 3 4  ? 126.652 88.937  20.838 1.00 198.27 ? 4   DG  F "H4'"  1 
ATOM 3128 H "H3'"  . DG  F 3 4  ? 127.198 90.849  22.553 1.00 194.89 ? 4   DG  F "H3'"  1 
ATOM 3129 H "H2'"  . DG  F 3 4  ? 128.105 89.476  24.130 1.00 201.39 ? 4   DG  F "H2'"  1 
ATOM 3130 H "H2''" . DG  F 3 4  ? 126.579 89.487  24.618 1.00 201.39 ? 4   DG  F "H2''" 1 
ATOM 3131 H "H1'"  . DG  F 3 4  ? 126.104 87.573  23.454 1.00 203.12 ? 4   DG  F "H1'"  1 
ATOM 3132 H H8     . DG  F 3 4  ? 129.457 87.860  24.890 1.00 210.80 ? 4   DG  F H8     1 
ATOM 3133 H H1     . DG  F 3 4  ? 126.915 82.382  25.885 1.00 245.35 ? 4   DG  F H1     1 
ATOM 3134 H H21    . DG  F 3 4  ? 124.436 83.318  23.982 1.00 244.43 ? 4   DG  F H21    1 
ATOM 3135 H H22    . DG  F 3 4  ? 124.985 82.212  24.814 1.00 244.43 ? 4   DG  F H22    1 
ATOM 3136 P P      . DA  F 3 5  ? 124.656 91.511  22.660 1.00 188.40 ? 5   DA  F P      1 
ATOM 3137 O OP1    . DA  F 3 5  ? 125.008 92.341  21.485 1.00 152.31 ? 5   DA  F OP1    1 
ATOM 3138 O OP2    . DA  F 3 5  ? 124.955 91.996  24.024 1.00 194.74 ? 5   DA  F OP2    1 
ATOM 3139 O "O5'"  . DA  F 3 5  ? 123.101 91.154  22.598 1.00 153.41 ? 5   DA  F "O5'"  1 
ATOM 3140 C "C5'"  . DA  F 3 5  ? 122.619 90.373  21.515 1.00 153.57 ? 5   DA  F "C5'"  1 
ATOM 3141 C "C4'"  . DA  F 3 5  ? 121.801 89.213  22.039 1.00 155.82 ? 5   DA  F "C4'"  1 
ATOM 3142 O "O4'"  . DA  F 3 5  ? 122.675 88.284  22.731 1.00 165.29 ? 5   DA  F "O4'"  1 
ATOM 3143 C "C3'"  . DA  F 3 5  ? 120.699 89.600  23.017 1.00 154.03 ? 5   DA  F "C3'"  1 
ATOM 3144 O "O3'"  . DA  F 3 5  ? 119.477 88.986  22.620 1.00 153.28 ? 5   DA  F "O3'"  1 
ATOM 3145 C "C2'"  . DA  F 3 5  ? 121.205 89.079  24.360 1.00 165.02 ? 5   DA  F "C2'"  1 
ATOM 3146 C "C1'"  . DA  F 3 5  ? 122.073 87.897  23.947 1.00 161.64 ? 5   DA  F "C1'"  1 
ATOM 3147 N N9     . DA  F 3 5  ? 123.125 87.558  24.898 1.00 165.15 ? 5   DA  F N9     1 
ATOM 3148 C C8     . DA  F 3 5  ? 124.194 88.331  25.252 1.00 165.19 ? 5   DA  F C8     1 
ATOM 3149 N N7     . DA  F 3 5  ? 124.984 87.769  26.136 1.00 168.78 ? 5   DA  F N7     1 
ATOM 3150 C C5     . DA  F 3 5  ? 124.387 86.544  26.384 1.00 175.88 ? 5   DA  F C5     1 
ATOM 3151 C C6     . DA  F 3 5  ? 124.732 85.472  27.232 1.00 203.16 ? 5   DA  F C6     1 
ATOM 3152 N N6     . DA  F 3 5  ? 125.813 85.476  28.019 1.00 208.68 ? 5   DA  F N6     1 
ATOM 3153 N N1     . DA  F 3 5  ? 123.919 84.394  27.241 1.00 214.02 ? 5   DA  F N1     1 
ATOM 3154 C C2     . DA  F 3 5  ? 122.839 84.393  26.451 1.00 210.81 ? 5   DA  F C2     1 
ATOM 3155 N N3     . DA  F 3 5  ? 122.411 85.340  25.616 1.00 194.55 ? 5   DA  F N3     1 
ATOM 3156 C C4     . DA  F 3 5  ? 123.238 86.397  25.629 1.00 172.58 ? 5   DA  F C4     1 
ATOM 3157 H "H5'"  . DA  F 3 5  ? 123.370 90.033  21.004 1.00 184.29 ? 5   DA  F "H5'"  1 
ATOM 3158 H "H5''" . DA  F 3 5  ? 122.064 90.926  20.942 1.00 184.29 ? 5   DA  F "H5''" 1 
ATOM 3159 H "H4'"  . DA  F 3 5  ? 121.397 88.755  21.285 1.00 186.99 ? 5   DA  F "H4'"  1 
ATOM 3160 H "H3'"  . DA  F 3 5  ? 120.599 90.564  23.047 1.00 184.84 ? 5   DA  F "H3'"  1 
ATOM 3161 H "H2'"  . DA  F 3 5  ? 121.734 89.753  24.813 1.00 198.02 ? 5   DA  F "H2'"  1 
ATOM 3162 H "H2''" . DA  F 3 5  ? 120.466 88.786  24.915 1.00 198.02 ? 5   DA  F "H2''" 1 
ATOM 3163 H "H1'"  . DA  F 3 5  ? 121.511 87.121  23.796 1.00 193.96 ? 5   DA  F "H1'"  1 
ATOM 3164 H H8     . DA  F 3 5  ? 124.351 89.175  24.895 1.00 198.22 ? 5   DA  F H8     1 
ATOM 3165 H H61    . DA  F 3 5  ? 125.982 84.798  28.522 1.00 250.42 ? 5   DA  F H61    1 
ATOM 3166 H H62    . DA  F 3 5  ? 126.340 86.155  28.023 1.00 250.42 ? 5   DA  F H62    1 
ATOM 3167 H H2     . DA  F 3 5  ? 122.311 83.628  26.494 1.00 252.97 ? 5   DA  F H2     1 
ATOM 3168 P P      . DA  F 3 6  ? 118.093 89.398  23.324 1.00 167.11 ? 6   DA  F P      1 
ATOM 3169 O OP1    . DA  F 3 6  ? 117.009 89.112  22.359 1.00 176.10 ? 6   DA  F OP1    1 
ATOM 3170 O OP2    . DA  F 3 6  ? 118.243 90.768  23.866 1.00 147.88 ? 6   DA  F OP2    1 
ATOM 3171 O "O5'"  . DA  F 3 6  ? 117.973 88.376  24.551 1.00 154.49 ? 6   DA  F "O5'"  1 
ATOM 3172 C "C5'"  . DA  F 3 6  ? 117.898 86.979  24.286 1.00 158.69 ? 6   DA  F "C5'"  1 
ATOM 3173 C "C4'"  . DA  F 3 6  ? 118.048 86.132  25.541 1.00 172.43 ? 6   DA  F "C4'"  1 
ATOM 3174 O "O4'"  . DA  F 3 6  ? 119.417 86.209  26.022 1.00 170.23 ? 6   DA  F "O4'"  1 
ATOM 3175 C "C3'"  . DA  F 3 6  ? 117.161 86.536  26.719 1.00 178.39 ? 6   DA  F "C3'"  1 
ATOM 3176 O "O3'"  . DA  F 3 6  ? 116.209 85.520  27.022 1.00 161.89 ? 6   DA  F "O3'"  1 
ATOM 3177 C "C2'"  . DA  F 3 6  ? 118.132 86.745  27.880 1.00 193.43 ? 6   DA  F "C2'"  1 
ATOM 3178 C "C1'"  . DA  F 3 6  ? 119.390 86.023  27.421 1.00 176.03 ? 6   DA  F "C1'"  1 
ATOM 3179 N N9     . DA  F 3 6  ? 120.611 86.551  28.024 1.00 190.46 ? 6   DA  F N9     1 
ATOM 3180 C C8     . DA  F 3 6  ? 121.146 87.797  27.846 1.00 194.12 ? 6   DA  F C8     1 
ATOM 3181 N N7     . DA  F 3 6  ? 122.252 88.001  28.522 1.00 188.81 ? 6   DA  F N7     1 
ATOM 3182 C C5     . DA  F 3 6  ? 122.455 86.808  29.193 1.00 197.88 ? 6   DA  F C5     1 
ATOM 3183 C C6     . DA  F 3 6  ? 123.461 86.380  30.081 1.00 202.12 ? 6   DA  F C6     1 
ATOM 3184 N N6     . DA  F 3 6  ? 124.491 87.149  30.450 1.00 193.68 ? 6   DA  F N6     1 
ATOM 3185 N N1     . DA  F 3 6  ? 123.370 85.127  30.572 1.00 205.83 ? 6   DA  F N1     1 
ATOM 3186 C C2     . DA  F 3 6  ? 122.338 84.361  30.197 1.00 203.78 ? 6   DA  F C2     1 
ATOM 3187 N N3     . DA  F 3 6  ? 121.333 84.651  29.372 1.00 184.65 ? 6   DA  F N3     1 
ATOM 3188 C C4     . DA  F 3 6  ? 121.451 85.903  28.901 1.00 192.38 ? 6   DA  F C4     1 
ATOM 3189 H "H5'"  . DA  F 3 6  ? 118.601 86.742  23.661 1.00 190.43 ? 6   DA  F "H5'"  1 
ATOM 3190 H "H5''" . DA  F 3 6  ? 117.039 86.785  23.878 1.00 190.43 ? 6   DA  F "H5''" 1 
ATOM 3191 H "H4'"  . DA  F 3 6  ? 117.854 85.209  25.313 1.00 206.91 ? 6   DA  F "H4'"  1 
ATOM 3192 H "H3'"  . DA  F 3 6  ? 116.704 87.368  26.518 1.00 214.07 ? 6   DA  F "H3'"  1 
ATOM 3193 H "H2'"  . DA  F 3 6  ? 118.309 87.690  28.012 1.00 232.11 ? 6   DA  F "H2'"  1 
ATOM 3194 H "H2''" . DA  F 3 6  ? 117.785 86.344  28.692 1.00 232.11 ? 6   DA  F "H2''" 1 
ATOM 3195 H "H1'"  . DA  F 3 6  ? 119.313 85.077  27.620 1.00 211.24 ? 6   DA  F "H1'"  1 
ATOM 3196 H H8     . DA  F 3 6  ? 120.762 88.440  27.295 1.00 232.94 ? 6   DA  F H8     1 
ATOM 3197 H H61    . DA  F 3 6  ? 125.083 86.844  30.994 1.00 232.41 ? 6   DA  F H61    1 
ATOM 3198 H H62    . DA  F 3 6  ? 124.560 87.950  30.144 1.00 232.41 ? 6   DA  F H62    1 
ATOM 3199 H H2     . DA  F 3 6  ? 122.320 83.506  30.565 1.00 244.53 ? 6   DA  F H2     1 
ATOM 3200 P P      . DT  F 3 7  ? 115.094 85.773  28.152 1.00 196.22 ? 7   DT  F P      1 
ATOM 3201 O OP1    . DT  F 3 7  ? 113.827 85.177  27.675 1.00 203.15 ? 7   DT  F OP1    1 
ATOM 3202 O OP2    . DT  F 3 7  ? 115.136 87.206  28.520 1.00 169.72 ? 7   DT  F OP2    1 
ATOM 3203 O "O5'"  . DT  F 3 7  ? 115.616 84.934  29.409 1.00 182.80 ? 7   DT  F "O5'"  1 
ATOM 3204 C "C5'"  . DT  F 3 7  ? 115.788 83.526  29.300 1.00 200.56 ? 7   DT  F "C5'"  1 
ATOM 3205 C "C4'"  . DT  F 3 7  ? 116.455 82.964  30.541 1.00 192.31 ? 7   DT  F "C4'"  1 
ATOM 3206 O "O4'"  . DT  F 3 7  ? 117.774 83.541  30.676 1.00 184.69 ? 7   DT  F "O4'"  1 
ATOM 3207 C "C3'"  . DT  F 3 7  ? 115.723 83.274  31.843 1.00 192.86 ? 7   DT  F "C3'"  1 
ATOM 3208 O "O3'"  . DT  F 3 7  ? 114.995 82.129  32.278 1.00 197.14 ? 7   DT  F "O3'"  1 
ATOM 3209 C "C2'"  . DT  F 3 7  ? 116.822 83.675  32.829 1.00 189.75 ? 7   DT  F "C2'"  1 
ATOM 3210 C "C1'"  . DT  F 3 7  ? 118.125 83.567  32.043 1.00 187.06 ? 7   DT  F "C1'"  1 
ATOM 3211 N N1     . DT  F 3 7  ? 119.045 84.722  32.253 1.00 187.29 ? 7   DT  F N1     1 
ATOM 3212 C C2     . DT  F 3 7  ? 120.156 84.585  33.058 1.00 184.23 ? 7   DT  F C2     1 
ATOM 3213 O O2     . DT  F 3 7  ? 120.450 83.552  33.632 1.00 186.88 ? 7   DT  F O2     1 
ATOM 3214 N N3     . DT  F 3 7  ? 120.921 85.719  33.168 1.00 175.12 ? 7   DT  F N3     1 
ATOM 3215 C C4     . DT  F 3 7  ? 120.692 86.944  32.569 1.00 170.93 ? 7   DT  F C4     1 
ATOM 3216 O O4     . DT  F 3 7  ? 121.445 87.899  32.736 1.00 181.78 ? 7   DT  F O4     1 
ATOM 3217 C C5     . DT  F 3 7  ? 119.513 87.016  31.741 1.00 168.05 ? 7   DT  F C5     1 
ATOM 3218 C C7     . DT  F 3 7  ? 119.149 88.289  31.034 1.00 163.39 ? 7   DT  F C7     1 
ATOM 3219 C C6     . DT  F 3 7  ? 118.758 85.917  31.625 1.00 169.65 ? 7   DT  F C6     1 
ATOM 3220 H "H5'"  . DT  F 3 7  ? 116.339 83.331  28.526 1.00 240.67 ? 7   DT  F "H5'"  1 
ATOM 3221 H "H5''" . DT  F 3 7  ? 114.920 83.107  29.187 1.00 240.67 ? 7   DT  F "H5''" 1 
ATOM 3222 H "H4'"  . DT  F 3 7  ? 116.538 82.002  30.447 1.00 230.78 ? 7   DT  F "H4'"  1 
ATOM 3223 H "H3'"  . DT  F 3 7  ? 115.116 84.019  31.708 1.00 231.43 ? 7   DT  F "H3'"  1 
ATOM 3224 H "H2'"  . DT  F 3 7  ? 116.687 84.586  33.132 1.00 227.70 ? 7   DT  F "H2'"  1 
ATOM 3225 H "H2''" . DT  F 3 7  ? 116.834 83.066  33.584 1.00 227.70 ? 7   DT  F "H2''" 1 
ATOM 3226 H "H1'"  . DT  F 3 7  ? 118.579 82.743  32.277 1.00 224.47 ? 7   DT  F "H1'"  1 
ATOM 3227 H H3     . DT  F 3 7  ? 121.621 85.661  33.665 1.00 210.14 ? 7   DT  F H3     1 
ATOM 3228 H H71    . DT  F 3 7  ? 119.128 88.133  30.077 1.00 196.07 ? 7   DT  F H71    1 
ATOM 3229 H H72    . DT  F 3 7  ? 118.275 88.586  31.332 1.00 196.07 ? 7   DT  F H72    1 
ATOM 3230 H H73    . DT  F 3 7  ? 119.808 88.971  31.237 1.00 196.07 ? 7   DT  F H73    1 
ATOM 3231 H H6     . DT  F 3 7  ? 117.997 85.961  31.092 1.00 203.58 ? 7   DT  F H6     1 
ATOM 3232 P P      . DG  F 3 8  ? 113.839 82.271  33.386 1.00 229.45 ? 8   DG  F P      1 
ATOM 3233 O OP1    . DG  F 3 8  ? 112.938 81.106  33.247 1.00 241.64 ? 8   DG  F OP1    1 
ATOM 3234 O OP2    . DG  F 3 8  ? 113.283 83.640  33.304 1.00 217.09 ? 8   DG  F OP2    1 
ATOM 3235 O "O5'"  . DG  F 3 8  ? 114.623 82.151  34.772 1.00 179.50 ? 8   DG  F "O5'"  1 
ATOM 3236 C "C5'"  . DG  F 3 8  ? 115.350 80.967  35.073 1.00 201.56 ? 8   DG  F "C5'"  1 
ATOM 3237 C "C4'"  . DG  F 3 8  ? 116.141 81.159  36.351 1.00 220.70 ? 8   DG  F "C4'"  1 
ATOM 3238 O "O4'"  . DG  F 3 8  ? 117.126 82.203  36.141 1.00 203.40 ? 8   DG  F "O4'"  1 
ATOM 3239 C "C3'"  . DG  F 3 8  ? 115.302 81.583  37.551 1.00 233.51 ? 8   DG  F "C3'"  1 
ATOM 3240 O "O3'"  . DG  F 3 8  ? 115.637 80.761  38.665 1.00 255.00 ? 8   DG  F "O3'"  1 
ATOM 3241 C "C2'"  . DG  F 3 8  ? 115.661 83.054  37.755 1.00 202.56 ? 8   DG  F "C2'"  1 
ATOM 3242 C "C1'"  . DG  F 3 8  ? 117.084 83.119  37.215 1.00 189.60 ? 8   DG  F "C1'"  1 
ATOM 3243 N N9     . DG  F 3 8  ? 117.497 84.421  36.699 1.00 184.43 ? 8   DG  F N9     1 
ATOM 3244 C C8     . DG  F 3 8  ? 116.842 85.212  35.786 1.00 177.92 ? 8   DG  F C8     1 
ATOM 3245 N N7     . DG  F 3 8  ? 117.469 86.324  35.516 1.00 170.80 ? 8   DG  F N7     1 
ATOM 3246 C C5     . DG  F 3 8  ? 118.613 86.267  36.301 1.00 173.54 ? 8   DG  F C5     1 
ATOM 3247 C C6     . DG  F 3 8  ? 119.675 87.191  36.434 1.00 172.89 ? 8   DG  F C6     1 
ATOM 3248 O O6     . DG  F 3 8  ? 119.820 88.281  35.861 1.00 169.65 ? 8   DG  F O6     1 
ATOM 3249 N N1     . DG  F 3 8  ? 120.636 86.740  37.340 1.00 176.50 ? 8   DG  F N1     1 
ATOM 3250 C C2     . DG  F 3 8  ? 120.574 85.549  38.026 1.00 193.15 ? 8   DG  F C2     1 
ATOM 3251 N N2     . DG  F 3 8  ? 121.590 85.277  38.857 1.00 223.17 ? 8   DG  F N2     1 
ATOM 3252 N N3     . DG  F 3 8  ? 119.584 84.676  37.909 1.00 193.17 ? 8   DG  F N3     1 
ATOM 3253 C C4     . DG  F 3 8  ? 118.644 85.101  37.033 1.00 187.60 ? 8   DG  F C4     1 
ATOM 3254 H "H5'"  . DG  F 3 8  ? 115.958 80.768  34.344 1.00 241.87 ? 8   DG  F "H5'"  1 
ATOM 3255 H "H5''" . DG  F 3 8  ? 114.731 80.229  35.186 1.00 241.87 ? 8   DG  F "H5''" 1 
ATOM 3256 H "H4'"  . DG  F 3 8  ? 116.600 80.331  36.564 1.00 264.84 ? 8   DG  F "H4'"  1 
ATOM 3257 H "H3'"  . DG  F 3 8  ? 114.359 81.496  37.344 1.00 280.21 ? 8   DG  F "H3'"  1 
ATOM 3258 H "H2'"  . DG  F 3 8  ? 115.071 83.627  37.241 1.00 243.08 ? 8   DG  F "H2'"  1 
ATOM 3259 H "H2''" . DG  F 3 8  ? 115.639 83.287  38.696 1.00 243.08 ? 8   DG  F "H2''" 1 
ATOM 3260 H "H1'"  . DG  F 3 8  ? 117.703 82.834  37.905 1.00 227.52 ? 8   DG  F "H1'"  1 
ATOM 3261 H H8     . DG  F 3 8  ? 116.031 84.976  35.396 1.00 213.50 ? 8   DG  F H8     1 
ATOM 3262 H H1     . DG  F 3 8  ? 121.319 87.244  37.479 1.00 211.80 ? 8   DG  F H1     1 
ATOM 3263 H H21    . DG  F 3 8  ? 121.594 84.543  39.306 1.00 267.81 ? 8   DG  F H21    1 
ATOM 3264 H H22    . DG  F 3 8  ? 122.238 85.835  38.942 1.00 267.81 ? 8   DG  F H22    1 
ATOM 3265 P P      . DG  F 3 9  ? 114.805 80.865  40.036 1.00 236.17 ? 9   DG  F P      1 
ATOM 3266 O OP1    . DG  F 3 9  ? 114.500 79.487  40.481 1.00 263.44 ? 9   DG  F OP1    1 
ATOM 3267 O OP2    . DG  F 3 9  ? 113.704 81.833  39.829 1.00 214.00 ? 9   DG  F OP2    1 
ATOM 3268 O "O5'"  . DG  F 3 9  ? 115.846 81.519  41.057 1.00 214.90 ? 9   DG  F "O5'"  1 
ATOM 3269 C "C5'"  . DG  F 3 9  ? 117.100 80.892  41.307 1.00 226.97 ? 9   DG  F "C5'"  1 
ATOM 3270 C "C4'"  . DG  F 3 9  ? 117.991 81.822  42.107 1.00 235.00 ? 9   DG  F "C4'"  1 
ATOM 3271 O "O4'"  . DG  F 3 9  ? 118.319 82.979  41.291 1.00 220.93 ? 9   DG  F "O4'"  1 
ATOM 3272 C "C3'"  . DG  F 3 9  ? 117.345 82.365  43.378 1.00 255.77 ? 9   DG  F "C3'"  1 
ATOM 3273 O "O3'"  . DG  F 3 9  ? 118.284 82.445  44.444 1.00 270.45 ? 9   DG  F "O3'"  1 
ATOM 3274 C "C2'"  . DG  F 3 9  ? 116.871 83.745  42.942 1.00 243.29 ? 9   DG  F "C2'"  1 
ATOM 3275 C "C1'"  . DG  F 3 9  ? 118.009 84.150  42.019 1.00 219.15 ? 9   DG  F "C1'"  1 
ATOM 3276 N N9     . DG  F 3 9  ? 117.673 85.235  41.102 1.00 210.43 ? 9   DG  F N9     1 
ATOM 3277 C C8     . DG  F 3 9  ? 116.549 85.361  40.321 1.00 218.92 ? 9   DG  F C8     1 
ATOM 3278 N N7     . DG  F 3 9  ? 116.533 86.453  39.605 1.00 212.55 ? 9   DG  F N7     1 
ATOM 3279 C C5     . DG  F 3 9  ? 117.721 87.092  39.937 1.00 201.82 ? 9   DG  F C5     1 
ATOM 3280 C C6     . DG  F 3 9  ? 118.258 88.319  39.481 1.00 183.85 ? 9   DG  F C6     1 
ATOM 3281 O O6     . DG  F 3 9  ? 117.769 89.113  38.664 1.00 180.60 ? 9   DG  F O6     1 
ATOM 3282 N N1     . DG  F 3 9  ? 119.490 88.594  40.077 1.00 172.97 ? 9   DG  F N1     1 
ATOM 3283 C C2     . DG  F 3 9  ? 120.121 87.784  40.995 1.00 177.03 ? 9   DG  F C2     1 
ATOM 3284 N N2     . DG  F 3 9  ? 121.303 88.210  41.463 1.00 189.05 ? 9   DG  F N2     1 
ATOM 3285 N N3     . DG  F 3 9  ? 119.628 86.634  41.428 1.00 179.76 ? 9   DG  F N3     1 
ATOM 3286 C C4     . DG  F 3 9  ? 118.431 86.355  40.858 1.00 198.94 ? 9   DG  F C4     1 
ATOM 3287 H "H5'"  . DG  F 3 9  ? 117.529 80.681  40.463 1.00 272.37 ? 9   DG  F "H5'"  1 
ATOM 3288 H "H5''" . DG  F 3 9  ? 116.956 80.073  41.808 1.00 272.37 ? 9   DG  F "H5''" 1 
ATOM 3289 H "H4'"  . DG  F 3 9  ? 118.809 81.355  42.340 1.00 282.00 ? 9   DG  F "H4'"  1 
ATOM 3290 H "H3'"  . DG  F 3 9  ? 116.588 81.814  43.633 1.00 306.92 ? 9   DG  F "H3'"  1 
ATOM 3291 H "H2'"  . DG  F 3 9  ? 116.032 83.691  42.459 1.00 291.95 ? 9   DG  F "H2'"  1 
ATOM 3292 H "H2''" . DG  F 3 9  ? 116.805 84.347  43.700 1.00 291.95 ? 9   DG  F "H2''" 1 
ATOM 3293 H "H1'"  . DG  F 3 9  ? 118.778 84.408  42.552 1.00 262.98 ? 9   DG  F "H1'"  1 
ATOM 3294 H H8     . DG  F 3 9  ? 115.868 84.728  40.301 1.00 262.71 ? 9   DG  F H8     1 
ATOM 3295 H H1     . DG  F 3 9  ? 119.885 89.324  39.854 1.00 207.56 ? 9   DG  F H1     1 
ATOM 3296 H H21    . DG  F 3 9  ? 121.733 87.737  42.038 1.00 226.86 ? 9   DG  F H21    1 
ATOM 3297 H H22    . DG  F 3 9  ? 121.632 88.955  41.187 1.00 226.86 ? 9   DG  F H22    1 
ATOM 3298 P P      . DG  F 3 10 ? 117.774 82.591  45.961 1.00 226.43 ? 10  DG  F P      1 
ATOM 3299 O OP1    . DG  F 3 10 ? 117.856 81.251  46.581 1.00 269.17 ? 10  DG  F OP1    1 
ATOM 3300 O OP2    . DG  F 3 10 ? 116.479 83.307  45.937 1.00 194.34 ? 10  DG  F OP2    1 
ATOM 3301 O "O5'"  . DG  F 3 10 ? 118.851 83.549  46.664 1.00 211.59 ? 10  DG  F "O5'"  1 
ATOM 3302 C "C5'"  . DG  F 3 10 ? 120.137 83.868  46.117 1.00 218.95 ? 10  DG  F "C5'"  1 
ATOM 3303 C "C4'"  . DG  F 3 10 ? 120.454 85.348  46.269 1.00 217.37 ? 10  DG  F "C4'"  1 
ATOM 3304 O "O4'"  . DG  F 3 10 ? 119.959 86.057  45.105 1.00 224.22 ? 10  DG  F "O4'"  1 
ATOM 3305 C "C3'"  . DG  F 3 10 ? 119.839 86.045  47.486 1.00 209.23 ? 10  DG  F "C3'"  1 
ATOM 3306 O "O3'"  . DG  F 3 10 ? 120.861 86.647  48.278 1.00 224.33 ? 10  DG  F "O3'"  1 
ATOM 3307 C "C2'"  . DG  F 3 10 ? 118.875 87.075  46.898 1.00 207.60 ? 10  DG  F "C2'"  1 
ATOM 3308 C "C1'"  . DG  F 3 10 ? 119.456 87.310  45.512 1.00 202.84 ? 10  DG  F "C1'"  1 
ATOM 3309 N N9     . DG  F 3 10 ? 118.489 87.766  44.520 1.00 178.59 ? 10  DG  F N9     1 
ATOM 3310 C C8     . DG  F 3 10 ? 117.323 87.144  44.142 1.00 178.05 ? 10  DG  F C8     1 
ATOM 3311 N N7     . DG  F 3 10 ? 116.664 87.793  43.223 1.00 179.37 ? 10  DG  F N7     1 
ATOM 3312 C C5     . DG  F 3 10 ? 117.444 88.916  42.975 1.00 187.14 ? 10  DG  F C5     1 
ATOM 3313 C C6     . DG  F 3 10 ? 117.239 89.989  42.076 1.00 179.41 ? 10  DG  F C6     1 
ATOM 3314 O O6     . DG  F 3 10 ? 116.294 90.158  41.291 1.00 165.40 ? 10  DG  F O6     1 
ATOM 3315 N N1     . DG  F 3 10 ? 118.276 90.920  42.142 1.00 167.42 ? 10  DG  F N1     1 
ATOM 3316 C C2     . DG  F 3 10 ? 119.370 90.824  42.974 1.00 170.27 ? 10  DG  F C2     1 
ATOM 3317 N N2     . DG  F 3 10 ? 120.272 91.816  42.904 1.00 169.02 ? 10  DG  F N2     1 
ATOM 3318 N N3     . DG  F 3 10 ? 119.572 89.823  43.822 1.00 174.11 ? 10  DG  F N3     1 
ATOM 3319 C C4     . DG  F 3 10 ? 118.572 88.912  43.765 1.00 174.90 ? 10  DG  F C4     1 
ATOM 3320 H "H5'"  . DG  F 3 10 ? 120.147 83.637  45.175 1.00 262.75 ? 10  DG  F "H5'"  1 
ATOM 3321 H "H5''" . DG  F 3 10 ? 120.815 83.350  46.579 1.00 262.75 ? 10  DG  F "H5''" 1 
ATOM 3322 H "H4'"  . DG  F 3 10 ? 121.417 85.454  46.308 1.00 260.85 ? 10  DG  F "H4'"  1 
ATOM 3323 H "H3'"  . DG  F 3 10 ? 119.346 85.402  48.018 1.00 251.08 ? 10  DG  F "H3'"  1 
ATOM 3324 H "H2'"  . DG  F 3 10 ? 117.978 86.713  46.838 1.00 249.12 ? 10  DG  F "H2'"  1 
ATOM 3325 H "H2''" . DG  F 3 10 ? 118.886 87.893  47.419 1.00 249.12 ? 10  DG  F "H2''" 1 
ATOM 3326 H "H1'"  . DG  F 3 10 ? 120.185 87.948  45.570 1.00 243.41 ? 10  DG  F "H1'"  1 
ATOM 3327 H H8     . DG  F 3 10 ? 117.033 86.339  44.507 1.00 213.66 ? 10  DG  F H8     1 
ATOM 3328 H H1     . DG  F 3 10 ? 118.229 91.605  41.625 1.00 200.90 ? 10  DG  F H1     1 
ATOM 3329 H H21    . DG  F 3 10 ? 120.970 91.798  43.406 1.00 202.83 ? 10  DG  F H21    1 
ATOM 3330 H H22    . DG  F 3 10 ? 120.151 92.469  42.358 1.00 202.83 ? 10  DG  F H22    1 
ATOM 3331 P P      . DC  F 3 11 ? 120.498 87.330  49.687 1.00 226.77 ? 11  DC  F P      1 
ATOM 3332 O OP1    . DC  F 3 11 ? 121.613 87.062  50.622 1.00 245.50 ? 11  DC  F OP1    1 
ATOM 3333 O OP2    . DC  F 3 11 ? 119.123 86.922  50.046 1.00 217.99 ? 11  DC  F OP2    1 
ATOM 3334 O "O5'"  . DC  F 3 11 ? 120.459 88.893  49.356 1.00 188.94 ? 11  DC  F "O5'"  1 
ATOM 3335 C "C5'"  . DC  F 3 11 ? 121.647 89.578  48.982 1.00 194.65 ? 11  DC  F "C5'"  1 
ATOM 3336 C "C4'"  . DC  F 3 11 ? 121.342 91.021  48.631 1.00 187.11 ? 11  DC  F "C4'"  1 
ATOM 3337 O "O4'"  . DC  F 3 11 ? 120.573 91.048  47.406 1.00 191.51 ? 11  DC  F "O4'"  1 
ATOM 3338 C "C3'"  . DC  F 3 11 ? 120.504 91.753  49.676 1.00 202.70 ? 11  DC  F "C3'"  1 
ATOM 3339 O "O3'"  . DC  F 3 11 ? 121.312 92.646  50.446 1.00 215.54 ? 11  DC  F "O3'"  1 
ATOM 3340 C "C2'"  . DC  F 3 11 ? 119.443 92.502  48.868 1.00 207.79 ? 11  DC  F "C2'"  1 
ATOM 3341 C "C1'"  . DC  F 3 11 ? 119.763 92.203  47.405 1.00 194.71 ? 11  DC  F "C1'"  1 
ATOM 3342 N N1     . DC  F 3 11 ? 118.556 91.960  46.542 1.00 170.20 ? 11  DC  F N1     1 
ATOM 3343 C C2     . DC  F 3 11 ? 118.156 92.926  45.609 1.00 166.03 ? 11  DC  F C2     1 
ATOM 3344 O O2     . DC  F 3 11 ? 118.804 93.975  45.509 1.00 164.22 ? 11  DC  F O2     1 
ATOM 3345 N N3     . DC  F 3 11 ? 117.064 92.688  44.837 1.00 181.47 ? 11  DC  F N3     1 
ATOM 3346 C C4     . DC  F 3 11 ? 116.384 91.546  44.972 1.00 174.90 ? 11  DC  F C4     1 
ATOM 3347 N N4     . DC  F 3 11 ? 115.314 91.358  44.188 1.00 179.54 ? 11  DC  F N4     1 
ATOM 3348 C C5     . DC  F 3 11 ? 116.775 90.549  45.916 1.00 170.42 ? 11  DC  F C5     1 
ATOM 3349 C C6     . DC  F 3 11 ? 117.854 90.795  46.669 1.00 172.28 ? 11  DC  F C6     1 
ATOM 3350 H "H5'"  . DC  F 3 11 ? 122.041 89.138  48.213 1.00 233.58 ? 11  DC  F "H5'"  1 
ATOM 3351 H "H5''" . DC  F 3 11 ? 122.276 89.554  49.720 1.00 233.58 ? 11  DC  F "H5''" 1 
ATOM 3352 H "H4'"  . DC  F 3 11 ? 122.175 91.501  48.496 1.00 224.53 ? 11  DC  F "H4'"  1 
ATOM 3353 H "H3'"  . DC  F 3 11 ? 120.076 91.109  50.262 1.00 243.24 ? 11  DC  F "H3'"  1 
ATOM 3354 H "H2'"  . DC  F 3 11 ? 118.557 92.174  49.091 1.00 249.35 ? 11  DC  F "H2'"  1 
ATOM 3355 H "H2''" . DC  F 3 11 ? 119.502 93.455  49.037 1.00 249.35 ? 11  DC  F "H2''" 1 
ATOM 3356 H "H1'"  . DC  F 3 11 ? 120.271 92.943  47.036 1.00 233.66 ? 11  DC  F "H1'"  1 
ATOM 3357 H H41    . DC  F 3 11 ? 114.856 90.633  44.252 1.00 215.45 ? 11  DC  F H41    1 
ATOM 3358 H H42    . DC  F 3 11 ? 115.085 91.963  43.621 1.00 215.45 ? 11  DC  F H42    1 
ATOM 3359 H H5     . DC  F 3 11 ? 116.298 89.756  46.003 1.00 204.50 ? 11  DC  F H5     1 
ATOM 3360 H H6     . DC  F 3 11 ? 118.130 90.162  47.292 1.00 206.74 ? 11  DC  F H6     1 
ATOM 3361 P P      . DC  F 3 12 ? 120.693 93.404  51.723 1.00 213.50 ? 12  DC  F P      1 
ATOM 3362 O OP1    . DC  F 3 12 ? 121.800 93.651  52.672 1.00 242.24 ? 12  DC  F OP1    1 
ATOM 3363 O OP2    . DC  F 3 12 ? 119.499 92.652  52.165 1.00 195.82 ? 12  DC  F OP2    1 
ATOM 3364 O "O5'"  . DC  F 3 12 ? 120.193 94.804  51.137 1.00 170.81 ? 12  DC  F "O5'"  1 
ATOM 3365 C "C5'"  . DC  F 3 12 ? 121.121 95.719  50.575 1.00 183.50 ? 12  DC  F "C5'"  1 
ATOM 3366 C "C4'"  . DC  F 3 12 ? 120.380 96.885  49.951 1.00 201.70 ? 12  DC  F "C4'"  1 
ATOM 3367 O "O4'"  . DC  F 3 12 ? 119.541 96.350  48.903 1.00 217.86 ? 12  DC  F "O4'"  1 
ATOM 3368 C "C3'"  . DC  F 3 12 ? 119.460 97.653  50.895 1.00 201.81 ? 12  DC  F "C3'"  1 
ATOM 3369 O "O3'"  . DC  F 3 12 ? 119.939 98.983  51.070 1.00 211.76 ? 12  DC  F "O3'"  1 
ATOM 3370 C "C2'"  . DC  F 3 12 ? 118.075 97.616  50.244 1.00 203.59 ? 12  DC  F "C2'"  1 
ATOM 3371 C "C1'"  . DC  F 3 12 ? 118.294 97.008  48.861 1.00 211.84 ? 12  DC  F "C1'"  1 
ATOM 3372 N N1     . DC  F 3 12 ? 117.260 95.991  48.479 1.00 192.88 ? 12  DC  F N1     1 
ATOM 3373 C C2     . DC  F 3 12 ? 116.350 96.248  47.442 1.00 168.21 ? 12  DC  F C2     1 
ATOM 3374 O O2     . DC  F 3 12 ? 116.412 97.315  46.817 1.00 153.50 ? 12  DC  F O2     1 
ATOM 3375 N N3     . DC  F 3 12 ? 115.430 95.299  47.131 1.00 159.15 ? 12  DC  F N3     1 
ATOM 3376 C C4     . DC  F 3 12 ? 115.385 94.152  47.815 1.00 179.48 ? 12  DC  F C4     1 
ATOM 3377 N N4     . DC  F 3 12 ? 114.454 93.254  47.471 1.00 183.13 ? 12  DC  F N4     1 
ATOM 3378 C C5     . DC  F 3 12 ? 116.292 93.879  48.880 1.00 180.74 ? 12  DC  F C5     1 
ATOM 3379 C C6     . DC  F 3 12 ? 117.198 94.818  49.176 1.00 172.02 ? 12  DC  F C6     1 
ATOM 3380 H "H5'"  . DC  F 3 12 ? 121.645 95.269  49.894 1.00 220.19 ? 12  DC  F "H5'"  1 
ATOM 3381 H "H5''" . DC  F 3 12 ? 121.712 96.048  51.271 1.00 220.19 ? 12  DC  F "H5''" 1 
ATOM 3382 H "H4'"  . DC  F 3 12 ? 121.022 97.500  49.563 1.00 242.04 ? 12  DC  F "H4'"  1 
ATOM 3383 H "H3'"  . DC  F 3 12 ? 119.427 97.203  51.754 1.00 242.18 ? 12  DC  F "H3'"  1 
ATOM 3384 H "HO3'" . DC  F 3 12 ? 119.457 99.636  50.854 1.00 254.11 ? 12  DC  F "HO3'" 1 
ATOM 3385 H "H2'"  . DC  F 3 12 ? 117.474 97.060  50.764 1.00 244.31 ? 12  DC  F "H2'"  1 
ATOM 3386 H "H2''" . DC  F 3 12 ? 117.719 98.515  50.163 1.00 244.31 ? 12  DC  F "H2''" 1 
ATOM 3387 H "H1'"  . DC  F 3 12 ? 118.320 97.712  48.195 1.00 254.20 ? 12  DC  F "H1'"  1 
ATOM 3388 H H41    . DC  F 3 12 ? 114.401 92.507  47.893 1.00 219.75 ? 12  DC  F H41    1 
ATOM 3389 H H42    . DC  F 3 12 ? 113.910 93.424  46.827 1.00 219.75 ? 12  DC  F H42    1 
ATOM 3390 H H5     . DC  F 3 12 ? 116.256 93.078  49.351 1.00 216.89 ? 12  DC  F H5     1 
ATOM 3391 H H6     . DC  F 3 12 ? 117.804 94.665  49.865 1.00 206.43 ? 12  DC  F H6     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . THR A 8  ? 1.4354 2.1627 2.2167 0.2547  -0.1599 0.0447  100 THR A N     
2    C CA    . THR A 8  ? 1.7992 2.5187 2.5733 0.2504  -0.1729 0.0323  100 THR A CA    
3    C C     . THR A 8  ? 1.9007 2.5993 2.6488 0.2617  -0.1783 0.0205  100 THR A C     
4    O O     . THR A 8  ? 1.8373 2.5282 2.5753 0.2715  -0.1763 0.0250  100 THR A O     
5    C CB    . THR A 8  ? 1.7980 2.5332 2.5764 0.2433  -0.1904 0.0362  100 THR A CB    
6    O OG1   . THR A 8  ? 2.0838 2.8448 2.8816 0.2364  -0.1834 0.0467  100 THR A OG1   
7    C CG2   . THR A 8  ? 1.1950 1.9247 1.9603 0.2391  -0.2061 0.0197  100 THR A CG2   
14   N N     . VAL A 9  ? 1.9191 2.6100 2.6533 0.2625  -0.1840 0.0053  101 VAL A N     
15   C CA    . VAL A 9  ? 1.9495 2.6244 2.6509 0.2786  -0.1872 -0.0062 101 VAL A CA    
16   C C     . VAL A 9  ? 1.8839 2.5525 2.5642 0.2779  -0.1992 -0.0213 101 VAL A C     
17   O O     . VAL A 9  ? 1.8880 2.5667 2.5891 0.2654  -0.2013 -0.0269 101 VAL A O     
18   C CB    . VAL A 9  ? 1.8998 2.5685 2.6012 0.2821  -0.1712 -0.0063 101 VAL A CB    
19   C CG1   . VAL A 9  ? 1.9366 2.6114 2.6584 0.2678  -0.1637 -0.0103 101 VAL A CG1   
20   C CG2   . VAL A 9  ? 1.4867 2.1423 2.1520 0.3012  -0.1721 -0.0148 101 VAL A CG2   
30   N N     . PHE A 10 ? 1.5649 2.1948 2.1836 0.2820  -0.1985 -0.0216 102 PHE A N     
31   C CA    . PHE A 10 ? 1.5001 2.0946 2.0686 0.2698  -0.2005 -0.0292 102 PHE A CA    
32   C C     . PHE A 10 ? 1.5225 2.0987 2.0668 0.2829  -0.1910 -0.0390 102 PHE A C     
33   O O     . PHE A 10 ? 1.5916 2.1755 2.1412 0.3033  -0.1828 -0.0368 102 PHE A O     
34   C CB    . PHE A 10 ? 1.9204 2.4754 2.4264 0.2628  -0.2030 -0.0234 102 PHE A CB    
35   C CG    . PHE A 10 ? 1.8793 2.4535 2.4032 0.2455  -0.2139 -0.0128 102 PHE A CG    
36   C CD1   . PHE A 10 ? 1.5217 2.1155 2.0651 0.2228  -0.2233 -0.0123 102 PHE A CD1   
37   C CD2   . PHE A 10 ? 1.6064 2.1823 2.1283 0.2523  -0.2144 -0.0018 102 PHE A CD2   
38   C CE1   . PHE A 10 ? 1.5523 2.1707 2.1138 0.2076  -0.2330 0.0006  102 PHE A CE1   
39   C CE2   . PHE A 10 ? 1.0859 1.6828 1.6249 0.2363  -0.2245 0.0095  102 PHE A CE2   
40   C CZ    . PHE A 10 ? 1.5709 2.1910 2.1302 0.2142  -0.2337 0.0116  102 PHE A CZ    
50   N N     . SER A 11 ? 1.6366 2.1911 2.1542 0.2707  -0.1922 -0.0486 103 SER A N     
51   C CA    . SER A 11 ? 1.4682 2.0047 1.9611 0.2821  -0.1833 -0.0575 103 SER A CA    
52   C C     . SER A 11 ? 1.2977 1.7876 1.7207 0.2982  -0.1733 -0.0537 103 SER A C     
53   O O     . SER A 11 ? 1.5809 2.0439 1.9664 0.2941  -0.1744 -0.0471 103 SER A O     
54   C CB    . SER A 11 ? 1.6620 2.1863 2.1445 0.2635  -0.1874 -0.0690 103 SER A CB    
55   O OG    . SER A 11 ? 1.7561 2.3123 2.2866 0.2441  -0.1975 -0.0684 103 SER A OG    
61   N N     . SER A 12 ? 1.7557 2.2357 2.1596 0.3166  -0.1623 -0.0565 104 SER A N     
62   C CA    . SER A 12 ? 1.7883 2.2198 2.1215 0.3350  -0.1490 -0.0514 104 SER A CA    
63   C C     . SER A 12 ? 1.8864 2.2609 2.1531 0.3169  -0.1486 -0.0590 104 SER A C     
64   O O     . SER A 12 ? 1.8751 2.1982 2.0750 0.3198  -0.1404 -0.0545 104 SER A O     
65   C CB    . SER A 12 ? 1.8075 2.2491 2.1399 0.3601  -0.1366 -0.0500 104 SER A CB    
66   O OG    . SER A 12 ? 2.0982 2.4940 2.3630 0.3826  -0.1206 -0.0417 104 SER A OG    
72   N N     . THR A 13 ? 1.8287 2.2112 2.1120 0.2967  -0.1566 -0.0706 105 THR A N     
73   C CA    . THR A 13 ? 1.7916 2.1275 2.0179 0.2735  -0.1586 -0.0790 105 THR A CA    
74   C C     . THR A 13 ? 1.9972 2.3185 2.2007 0.2515  -0.1671 -0.0734 105 THR A C     
75   O O     . THR A 13 ? 2.4621 2.7278 2.5910 0.2381  -0.1627 -0.0753 105 THR A O     
76   C CB    . THR A 13 ? 1.9439 2.3035 2.2061 0.2535  -0.1685 -0.0910 105 THR A CB    
77   O OG1   . THR A 13 ? 2.1163 2.5327 2.4542 0.2423  -0.1816 -0.0877 105 THR A OG1   
78   C CG2   . THR A 13 ? 2.1771 2.5448 2.4519 0.2708  -0.1601 -0.0978 105 THR A CG2   
86   N N     . GLN A 14 ? 1.7475 2.1186 2.0137 0.2462  -0.1786 -0.0661 106 GLN A N     
87   C CA    . GLN A 14 ? 1.5672 1.9378 1.8238 0.2236  -0.1889 -0.0588 106 GLN A CA    
88   C C     . GLN A 14 ? 1.6696 2.0045 1.8772 0.2347  -0.1807 -0.0493 106 GLN A C     
89   O O     . GLN A 14 ? 1.9539 2.2460 2.0982 0.2154  -0.1808 -0.0477 106 GLN A O     
90   C CB    . GLN A 14 ? 1.4482 1.8855 1.7907 0.2176  -0.2017 -0.0526 106 GLN A CB    
91   C CG    . GLN A 14 ? 1.4461 1.9157 1.8348 0.2053  -0.2083 -0.0606 106 GLN A CG    
92   C CD    . GLN A 14 ? 1.4567 1.9852 1.9222 0.1986  -0.2179 -0.0523 106 GLN A CD    
93   O OE1   . GLN A 14 ? 1.2552 1.8122 1.7648 0.2148  -0.2156 -0.0453 106 GLN A OE1   
94   N NE2   . GLN A 14 ? 1.2268 1.7739 1.7077 0.1752  -0.2273 -0.0522 106 GLN A NE2   
103  N N     . LEU A 15 ? 1.3256 1.6769 1.5590 0.2644  -0.1728 -0.0429 107 LEU A N     
104  C CA    . LEU A 15 ? 1.3949 1.7154 1.5870 0.2793  -0.1635 -0.0329 107 LEU A CA    
105  C C     . LEU A 15 ? 1.5787 1.8218 1.6729 0.2802  -0.1482 -0.0358 107 LEU A C     
106  O O     . LEU A 15 ? 1.9692 2.1691 2.0072 0.2783  -0.1415 -0.0293 107 LEU A O     
107  C CB    . LEU A 15 ? 1.1539 1.5048 1.3854 0.3130  -0.1554 -0.0259 107 LEU A CB    
108  C CG    . LEU A 15 ? 1.5619 1.9573 1.8490 0.3153  -0.1639 -0.0162 107 LEU A CG    
109  C CD1   . LEU A 15 ? 1.7386 2.1916 2.1031 0.3004  -0.1779 -0.0198 107 LEU A CD1   
110  C CD2   . LEU A 15 ? 1.9348 2.3456 2.2366 0.3477  -0.1531 -0.0077 107 LEU A CD2   
122  N N     . CYS A 16 ? 1.3849 1.6079 1.4566 0.2833  -0.1411 -0.0455 108 CYS A N     
123  C CA    . CYS A 16 ? 1.9281 2.0733 1.9038 0.2841  -0.1240 -0.0493 108 CYS A CA    
124  C C     . CYS A 16 ? 1.8172 1.9163 1.7296 0.2470  -0.1289 -0.0528 108 CYS A C     
125  O O     . CYS A 16 ? 2.2104 2.2575 2.0571 0.2453  -0.1185 -0.0467 108 CYS A O     
126  C CB    . CYS A 16 ? 2.2433 2.3834 2.2158 0.2898  -0.1186 -0.0601 108 CYS A CB    
127  S SG    . CYS A 16 ? 2.9994 3.0414 2.8531 0.2901  -0.0959 -0.0659 108 CYS A SG    
133  N N     . VAL A 17 ? 1.7934 1.9120 1.7236 0.2160  -0.1438 -0.0618 109 VAL A N     
134  C CA    . VAL A 17 ? 2.1089 2.1918 1.9800 0.1756  -0.1501 -0.0647 109 VAL A CA    
135  C C     . VAL A 17 ? 2.0146 2.1120 1.8926 0.1624  -0.1591 -0.0527 109 VAL A C     
136  O O     . VAL A 17 ? 2.2895 2.3349 2.0915 0.1387  -0.1552 -0.0509 109 VAL A O     
137  C CB    . VAL A 17 ? 1.9647 2.0848 1.8712 0.1454  -0.1675 -0.0734 109 VAL A CB    
138  C CG1   . VAL A 17 ? 1.7499 1.9584 1.7654 0.1477  -0.1856 -0.0672 109 VAL A CG1   
139  C CG2   . VAL A 17 ? 2.0695 2.1555 1.9094 0.1005  -0.1740 -0.0750 109 VAL A CG2   
149  N N     . LEU A 18 ? 1.7076 1.8734 1.6736 0.1768  -0.1700 -0.0443 110 LEU A N     
150  C CA    . LEU A 18 ? 1.5280 1.7127 1.5081 0.1686  -0.1781 -0.0319 110 LEU A CA    
151  C C     . LEU A 18 ? 1.5566 1.6787 1.4653 0.1837  -0.1605 -0.0262 110 LEU A C     
152  O O     . LEU A 18 ? 1.8958 1.9798 1.7447 0.1589  -0.1605 -0.0222 110 LEU A O     
153  C CB    . LEU A 18 ? 1.4264 1.6893 1.5107 0.1871  -0.1887 -0.0247 110 LEU A CB    
154  C CG    . LEU A 18 ? 1.6379 1.9642 1.7868 0.1617  -0.2090 -0.0204 110 LEU A CG    
155  C CD1   . LEU A 18 ? 1.7266 2.0571 1.8734 0.1406  -0.2148 -0.0305 110 LEU A CD1   
156  C CD2   . LEU A 18 ? 1.6055 1.9984 1.8498 0.1835  -0.2141 -0.0143 110 LEU A CD2   
168  N N     . ASN A 19 ? 1.4996 1.6126 1.4136 0.2235  -0.1449 -0.0244 111 ASN A N     
169  C CA    . ASN A 19 ? 1.5479 1.6024 1.3963 0.2439  -0.1249 -0.0171 111 ASN A CA    
170  C C     . ASN A 19 ? 1.4997 1.4614 1.2328 0.2271  -0.1082 -0.0227 111 ASN A C     
171  O O     . ASN A 19 ? 2.0905 1.9984 1.7567 0.2197  -0.0982 -0.0169 111 ASN A O     
172  C CB    . ASN A 19 ? 1.5531 1.6207 1.4284 0.2903  -0.1103 -0.0129 111 ASN A CB    
173  C CG    . ASN A 19 ? 1.8478 1.9917 1.8171 0.3075  -0.1218 -0.0047 111 ASN A CG    
174  O OD1   . ASN A 19 ? 2.2191 2.3843 2.2115 0.2951  -0.1330 0.0018  111 ASN A OD1   
175  N ND2   . ASN A 19 ? 1.6541 1.8393 1.6758 0.3345  -0.1187 -0.0048 111 ASN A ND2   
182  N N     . ASP A 20 ? 1.6279 1.5674 1.3346 0.2200  -0.1039 -0.0342 112 ASP A N     
183  C CA    . ASP A 20 ? 1.9889 1.8367 1.5825 0.2019  -0.0865 -0.0411 112 ASP A CA    
184  C C     . ASP A 20 ? 2.2592 2.0864 1.8077 0.1524  -0.0981 -0.0416 112 ASP A C     
185  O O     . ASP A 20 ? 2.7009 2.4511 2.1545 0.1402  -0.0820 -0.0398 112 ASP A O     
186  C CB    . ASP A 20 ? 2.1838 2.0218 1.7675 0.1990  -0.0837 -0.0542 112 ASP A CB    
187  C CG    . ASP A 20 ? 2.4390 2.1760 1.9003 0.1823  -0.0625 -0.0619 112 ASP A CG    
188  O OD1   . ASP A 20 ? 2.3410 2.0512 1.7527 0.1367  -0.0705 -0.0669 112 ASP A OD1   
189  O OD2   . ASP A 20 ? 2.6418 2.3263 2.0539 0.2141  -0.0367 -0.0618 112 ASP A OD2   
194  N N     . ARG A 21 ? 2.1312 2.0275 1.7458 0.1235  -0.1249 -0.0429 113 ARG A N     
195  C CA    . ARG A 21 ? 2.0945 1.9889 1.6779 0.0746  -0.1391 -0.0403 113 ARG A CA    
196  C C     . ARG A 21 ? 1.9091 1.7966 1.4816 0.0756  -0.1381 -0.0275 113 ARG A C     
197  O O     . ARG A 21 ? 1.9870 1.8195 1.4767 0.0441  -0.1331 -0.0258 113 ARG A O     
198  C CB    . ARG A 21 ? 1.7501 1.7340 1.4217 0.0515  -0.1673 -0.0394 113 ARG A CB    
199  C CG    . ARG A 21 ? 1.5711 1.5641 1.2135 -0.0015 -0.1835 -0.0344 113 ARG A CG    
200  C CD    . ARG A 21 ? 2.0057 1.9244 1.5404 -0.0379 -0.1742 -0.0454 113 ARG A CD    
201  N NE    . ARG A 21 ? 1.7616 1.7029 1.2758 -0.0930 -0.1925 -0.0399 113 ARG A NE    
202  C CZ    . ARG A 21 ? 2.1034 2.1147 1.6742 -0.1168 -0.2138 -0.0383 113 ARG A CZ    
203  N NH1   . ARG A 21 ? 2.4385 2.4991 2.0890 -0.0910 -0.2190 -0.0434 113 ARG A NH1   
204  N NH2   . ARG A 21 ? 2.1457 2.1795 1.6927 -0.1674 -0.2294 -0.0303 113 ARG A NH2   
218  N N     . PHE A 22 ? 1.8351 1.7775 1.4891 0.1099  -0.1425 -0.0188 114 PHE A N     
219  C CA    . PHE A 22 ? 1.4447 1.3877 1.0990 0.1144  -0.1425 -0.0065 114 PHE A CA    
220  C C     . PHE A 22 ? 1.7517 1.5977 1.3007 0.1249  -0.1151 -0.0052 114 PHE A C     
221  O O     . PHE A 22 ? 2.2312 2.0420 1.7267 0.1018  -0.1135 0.0006  114 PHE A O     
222  C CB    . PHE A 22 ? 1.8807 1.8947 1.6372 0.1530  -0.1488 0.0011  114 PHE A CB    
223  C CG    . PHE A 22 ? 2.1986 2.2124 1.9570 0.1620  -0.1475 0.0134  114 PHE A CG    
224  C CD1   . PHE A 22 ? 1.9900 2.0475 1.7819 0.1347  -0.1671 0.0220  114 PHE A CD1   
225  C CD2   . PHE A 22 ? 2.4606 2.4326 2.1877 0.1985  -0.1261 0.0178  114 PHE A CD2   
226  C CE1   . PHE A 22 ? 1.7659 1.8224 1.5591 0.1425  -0.1660 0.0329  114 PHE A CE1   
227  C CE2   . PHE A 22 ? 2.1564 2.1275 1.8849 0.2067  -0.1247 0.0290  114 PHE A CE2   
228  C CZ    . PHE A 22 ? 1.7271 1.7391 1.4883 0.1781  -0.1450 0.0356  114 PHE A CZ    
238  N N     . GLN A 23 ? 2.0331 1.8362 1.5520 0.1605  -0.0923 -0.0094 115 GLN A N     
239  C CA    . GLN A 23 ? 2.1891 1.8974 1.6078 0.1778  -0.0614 -0.0062 115 GLN A CA    
240  C C     . GLN A 23 ? 2.2653 1.8885 1.5680 0.1321  -0.0524 -0.0121 115 GLN A C     
241  O O     . GLN A 23 ? 2.7102 2.2616 1.9318 0.1297  -0.0334 -0.0068 115 GLN A O     
242  C CB    . GLN A 23 ? 2.5690 2.2502 1.9741 0.2214  -0.0382 -0.0086 115 GLN A CB    
243  C CG    . GLN A 23 ? 2.9492 2.5379 2.2588 0.2491  -0.0027 -0.0012 115 GLN A CG    
244  C CD    . GLN A 23 ? 3.3346 2.9040 2.6341 0.2946  0.0207  0.0000  115 GLN A CD    
245  O OE1   . GLN A 23 ? 3.4721 3.0932 2.8310 0.3019  0.0099  -0.0067 115 GLN A OE1   
246  N NE2   . GLN A 23 ? 3.3943 2.8899 2.6180 0.3262  0.0541  0.0099  115 GLN A NE2   
255  N N     . ARG A 24 ? 2.0168 1.6475 1.3097 0.0944  -0.0653 -0.0228 116 ARG A N     
256  C CA    . ARG A 24 ? 2.4014 1.9528 1.5805 0.0461  -0.0570 -0.0298 116 ARG A CA    
257  C C     . ARG A 24 ? 2.1868 1.7782 1.3761 -0.0078 -0.0833 -0.0255 116 ARG A C     
258  O O     . ARG A 24 ? 2.2953 1.8232 1.3867 -0.0525 -0.0772 -0.0283 116 ARG A O     
259  C CB    . ARG A 24 ? 2.8713 2.3990 2.0192 0.0342  -0.0530 -0.0442 116 ARG A CB    
260  C CG    . ARG A 24 ? 3.1645 2.6350 2.2752 0.0805  -0.0227 -0.0481 116 ARG A CG    
261  C CD    . ARG A 24 ? 3.1688 2.6222 2.2544 0.0654  -0.0217 -0.0628 116 ARG A CD    
262  N NE    . ARG A 24 ? 3.2181 2.6016 2.2463 0.1049  0.0111  -0.0658 116 ARG A NE    
263  C CZ    . ARG A 24 ? 3.0071 2.4317 2.1027 0.1555  0.0158  -0.0622 116 ARG A CZ    
264  N NH1   . ARG A 24 ? 2.7080 2.2381 1.9278 0.1714  -0.0094 -0.0572 116 ARG A NH1   
265  N NH2   . ARG A 24 ? 3.1470 2.5067 2.1832 0.1898  0.0470  -0.0625 116 ARG A NH2   
279  N N     . GLN A 25 ? 1.9616 1.6578 1.2663 -0.0046 -0.1112 -0.0177 117 GLN A N     
280  C CA    . GLN A 25 ? 2.0344 1.7818 1.3605 -0.0515 -0.1368 -0.0099 117 GLN A CA    
281  C C     . GLN A 25 ? 1.8337 1.6751 1.2760 -0.0290 -0.1562 0.0031  117 GLN A C     
282  O O     . GLN A 25 ? 1.7751 1.6931 1.3170 -0.0082 -0.1700 0.0031  117 GLN A O     
283  C CB    . GLN A 25 ? 1.7266 1.5110 1.0638 -0.0914 -0.1551 -0.0165 117 GLN A CB    
284  C CG    . GLN A 25 ? 1.9642 1.8054 1.3183 -0.1425 -0.1809 -0.0055 117 GLN A CG    
285  C CD    . GLN A 25 ? 2.0181 1.8918 1.3725 -0.1835 -0.1967 -0.0104 117 GLN A CD    
286  O OE1   . GLN A 25 ? 1.8524 1.6942 1.1820 -0.1777 -0.1873 -0.0243 117 GLN A OE1   
287  N NE2   . GLN A 25 ? 2.0099 1.9497 1.3924 -0.2252 -0.2208 0.0024  117 GLN A NE2   
296  N N     . LYS A 26 ? 1.7265 1.5583 1.1526 -0.0343 -0.1560 0.0139  118 LYS A N     
297  C CA    . LYS A 26 ? 1.5821 1.4915 1.1085 -0.0099 -0.1704 0.0263  118 LYS A CA    
298  C C     . LYS A 26 ? 1.7663 1.7642 1.3597 -0.0440 -0.2001 0.0368  118 LYS A C     
299  O O     . LYS A 26 ? 1.6945 1.7686 1.3855 -0.0231 -0.2136 0.0462  118 LYS A O     
300  C CB    . LYS A 26 ? 1.7980 1.6582 1.2800 0.0040  -0.1557 0.0338  118 LYS A CB    
301  C CG    . LYS A 26 ? 1.6845 1.5065 1.1633 0.0598  -0.1314 0.0314  118 LYS A CG    
302  C CD    . LYS A 26 ? 2.1590 1.8858 1.5375 0.0650  -0.1039 0.0205  118 LYS A CD    
303  C CE    . LYS A 26 ? 2.4957 2.1950 1.8768 0.1233  -0.0797 0.0223  118 LYS A CE    
304  N NZ    . LYS A 26 ? 2.7543 2.3517 2.0273 0.1316  -0.0481 0.0153  118 LYS A NZ    
318  N N     . TYR A 27 ? 1.4300 1.4184 0.9696 -0.0964 -0.2091 0.0366  119 TYR A N     
319  C CA    . TYR A 27 ? 1.5369 1.6140 1.1372 -0.1301 -0.2366 0.0497  119 TYR A CA    
320  C C     . TYR A 27 ? 1.6806 1.7769 1.2743 -0.1609 -0.2460 0.0433  119 TYR A C     
321  O O     . TYR A 27 ? 2.0570 2.0855 1.5519 -0.1940 -0.2368 0.0338  119 TYR A O     
322  C CB    . TYR A 27 ? 1.7774 1.8420 1.3235 -0.1717 -0.2428 0.0621  119 TYR A CB    
323  C CG    . TYR A 27 ? 1.8812 1.9465 1.4528 -0.1429 -0.2385 0.0711  119 TYR A CG    
324  C CD1   . TYR A 27 ? 1.9023 1.8767 1.3997 -0.1225 -0.2137 0.0644  119 TYR A CD1   
325  C CD2   . TYR A 27 ? 1.3441 1.5000 1.0134 -0.1343 -0.2575 0.0873  119 TYR A CD2   
326  C CE1   . TYR A 27 ? 1.6741 1.6502 1.1950 -0.0960 -0.2097 0.0729  119 TYR A CE1   
327  C CE2   . TYR A 27 ? 1.3281 1.4838 1.0199 -0.1085 -0.2536 0.0948  119 TYR A CE2   
328  C CZ    . TYR A 27 ? 1.7218 1.7886 1.3399 -0.0901 -0.2305 0.0873  119 TYR A CZ    
329  O OH    . TYR A 27 ? 1.8645 1.9318 1.5046 -0.0645 -0.2265 0.0951  119 TYR A OH    
339  N N     . LEU A 28 ? 1.3932 1.5800 1.0902 -0.1500 -0.2631 0.0488  120 LEU A N     
340  C CA    . LEU A 28 ? 1.5973 1.8116 1.3040 -0.1719 -0.2721 0.0434  120 LEU A CA    
341  C C     . LEU A 28 ? 1.7766 2.0771 1.5263 -0.2111 -0.2966 0.0621  120 LEU A C     
342  O O     . LEU A 28 ? 1.2161 1.5828 1.0364 -0.2021 -0.3083 0.0795  120 LEU A O     
343  C CB    . LEU A 28 ? 1.7839 2.0310 1.5728 -0.1269 -0.2694 0.0347  120 LEU A CB    
344  C CG    . LEU A 28 ? 1.5985 1.7696 1.3416 -0.0964 -0.2469 0.0151  120 LEU A CG    
345  C CD1   . LEU A 28 ? 1.9083 2.0246 1.5658 -0.1302 -0.2415 0.0021  120 LEU A CD1   
346  C CD2   . LEU A 28 ? 1.7021 1.8040 1.3916 -0.0721 -0.2273 0.0137  120 LEU A CD2   
358  N N     . SER A 29 ? 1.3022 1.6033 1.0089 -0.2541 -0.3038 0.0596  121 SER A N     
359  C CA    . SER A 29 ? 1.2788 1.6681 1.0255 -0.2925 -0.3269 0.0795  121 SER A CA    
360  C C     . SER A 29 ? 1.6389 2.1197 1.5079 -0.2616 -0.3373 0.0874  121 SER A C     
361  O O     . SER A 29 ? 1.4897 1.9601 1.4036 -0.2166 -0.3271 0.0747  121 SER A O     
362  C CB    . SER A 29 ? 1.9073 2.2704 1.5684 -0.3490 -0.3308 0.0744  121 SER A CB    
363  O OG    . SER A 29 ? 1.7895 2.1506 1.4666 -0.3381 -0.3279 0.0599  121 SER A OG    
369  N N     . LEU A 30 ? 1.5804 2.1513 1.5008 -0.2869 -0.3566 0.1096  122 LEU A N     
370  C CA    . LEU A 30 ? 1.3008 1.9588 1.3319 -0.2616 -0.3648 0.1201  122 LEU A CA    
371  C C     . LEU A 30 ? 1.5865 2.2262 1.6139 -0.2577 -0.3601 0.1019  122 LEU A C     
372  O O     . LEU A 30 ? 1.6479 2.2955 1.7379 -0.2154 -0.3526 0.0927  122 LEU A O     
373  C CB    . LEU A 30 ? 1.3240 2.0792 1.3967 -0.2942 -0.3847 0.1506  122 LEU A CB    
374  C CG    . LEU A 30 ? 1.4301 2.2803 1.6131 -0.2723 -0.3921 0.1668  122 LEU A CG    
375  C CD1   . LEU A 30 ? 1.5937 2.4653 1.8626 -0.2175 -0.3841 0.1702  122 LEU A CD1   
376  C CD2   . LEU A 30 ? 1.6580 2.5995 1.8627 -0.3113 -0.4108 0.1990  122 LEU A CD2   
388  N N     . GLN A 31 ? 1.8213 2.4350 1.7712 -0.3045 -0.3641 0.0966  123 GLN A N     
389  C CA    . GLN A 31 ? 1.7021 2.2976 1.6387 -0.3082 -0.3609 0.0798  123 GLN A CA    
390  C C     . GLN A 31 ? 1.7778 2.2920 1.6930 -0.2674 -0.3406 0.0530  123 GLN A C     
391  O O     . GLN A 31 ? 1.9620 2.4887 1.9279 -0.2395 -0.3368 0.0429  123 GLN A O     
392  C CB    . GLN A 31 ? 2.1692 2.7346 2.0065 -0.3694 -0.3663 0.0768  123 GLN A CB    
393  C CG    . GLN A 31 ? 2.4334 3.0715 2.2708 -0.4175 -0.3858 0.1048  123 GLN A CG    
394  C CD    . GLN A 31 ? 2.5032 3.2614 2.4597 -0.4030 -0.4008 0.1307  123 GLN A CD    
395  O OE1   . GLN A 31 ? 2.6630 3.4504 2.6833 -0.3759 -0.3992 0.1260  123 GLN A OE1   
396  N NE2   . GLN A 31 ? 2.4134 3.2407 2.3989 -0.4203 -0.4139 0.1593  123 GLN A NE2   
405  N N     . GLN A 32 ? 1.4851 1.9173 1.3239 -0.2642 -0.3268 0.0429  124 GLN A N     
406  C CA    . GLN A 32 ? 1.7439 2.0973 1.5525 -0.2263 -0.3058 0.0206  124 GLN A CA    
407  C C     . GLN A 32 ? 1.4573 1.8512 1.3683 -0.1704 -0.3025 0.0214  124 GLN A C     
408  O O     . GLN A 32 ? 1.6582 2.0377 1.5917 -0.1419 -0.2937 0.0068  124 GLN A O     
409  C CB    . GLN A 32 ? 1.6896 1.9539 1.4012 -0.2314 -0.2904 0.0151  124 GLN A CB    
410  C CG    . GLN A 32 ? 1.6096 1.8067 1.1990 -0.2848 -0.2863 0.0080  124 GLN A CG    
411  C CD    . GLN A 32 ? 1.9380 2.0532 1.4330 -0.2948 -0.2714 0.0070  124 GLN A CD    
412  O OE1   . GLN A 32 ? 1.9459 2.0732 1.4734 -0.2712 -0.2704 0.0168  124 GLN A OE1   
413  N NE2   . GLN A 32 ? 2.5912 2.6185 1.9651 -0.3302 -0.2581 -0.0051 124 GLN A NE2   
422  N N     . MET A 33 ? 1.3841 1.8296 1.3553 -0.1572 -0.3096 0.0388  125 MET A N     
423  C CA    . MET A 33 ? 1.4588 1.9466 1.5263 -0.1090 -0.3068 0.0413  125 MET A CA    
424  C C     . MET A 33 ? 1.3880 1.9370 1.5320 -0.1017 -0.3137 0.0420  125 MET A C     
425  O O     . MET A 33 ? 1.5551 2.1023 1.7428 -0.0668 -0.3049 0.0308  125 MET A O     
426  C CB    . MET A 33 ? 1.6702 2.2076 1.7871 -0.1025 -0.3145 0.0620  125 MET A CB    
427  C CG    . MET A 33 ? 1.6537 2.1334 1.7196 -0.0914 -0.3041 0.0600  125 MET A CG    
428  S SD    . MET A 33 ? 1.3902 1.9334 1.5311 -0.0746 -0.3121 0.0824  125 MET A SD    
429  C CE    . MET A 33 ? 1.0129 1.4724 1.0757 -0.0645 -0.2976 0.0759  125 MET A CE    
439  N N     . GLN A 34 ? 1.5449 2.1491 1.7033 -0.1359 -0.3287 0.0562  126 GLN A N     
440  C CA    . GLN A 34 ? 1.4884 2.1561 1.7218 -0.1298 -0.3348 0.0607  126 GLN A CA    
441  C C     . GLN A 34 ? 1.4012 2.0272 1.6075 -0.1275 -0.3274 0.0379  126 GLN A C     
442  O O     . GLN A 34 ? 1.9039 2.5543 2.1743 -0.1003 -0.3233 0.0325  126 GLN A O     
443  C CB    . GLN A 34 ? 1.7686 2.5068 2.0168 -0.1687 -0.3521 0.0842  126 GLN A CB    
444  C CG    . GLN A 34 ? 2.1597 2.9673 2.4731 -0.1603 -0.3595 0.1112  126 GLN A CG    
445  C CD    . GLN A 34 ? 2.1766 3.0666 2.5159 -0.1942 -0.3758 0.1383  126 GLN A CD    
446  O OE1   . GLN A 34 ? 2.0370 2.9249 2.3242 -0.2348 -0.3838 0.1374  126 GLN A OE1   
447  N NE2   . GLN A 34 ? 2.1853 3.1499 2.6041 -0.1777 -0.3800 0.1638  126 GLN A NE2   
456  N N     . GLU A 35 ? 1.3614 1.9214 1.4705 -0.1561 -0.3241 0.0244  127 GLU A N     
457  C CA    . GLU A 35 ? 1.6440 2.1590 1.7205 -0.1542 -0.3160 0.0026  127 GLU A CA    
458  C C     . GLU A 35 ? 1.4828 1.9502 1.5665 -0.1081 -0.2988 -0.0139 127 GLU A C     
459  O O     . GLU A 35 ? 1.8567 2.3290 1.9785 -0.0860 -0.2937 -0.0253 127 GLU A O     
460  C CB    . GLU A 35 ? 1.9099 2.3608 1.8730 -0.1978 -0.3146 -0.0072 127 GLU A CB    
461  C CG    . GLU A 35 ? 2.3795 2.7306 2.2500 -0.1895 -0.2963 -0.0224 127 GLU A CG    
462  C CD    . GLU A 35 ? 2.9436 3.2259 2.6974 -0.2344 -0.2920 -0.0327 127 GLU A CD    
463  O OE1   . GLU A 35 ? 3.1309 3.4499 2.8731 -0.2786 -0.3067 -0.0250 127 GLU A OE1   
464  O OE2   . GLU A 35 ? 3.1237 3.3151 2.7953 -0.2258 -0.2728 -0.0476 127 GLU A OE2   
471  N N     . LEU A 36 ? 1.2221 1.6463 1.2690 -0.0945 -0.2897 -0.0137 128 LEU A N     
472  C CA    . LEU A 36 ? 1.1977 1.5853 1.2534 -0.0503 -0.2736 -0.0247 128 LEU A CA    
473  C C     . LEU A 36 ? 1.3002 1.7534 1.4644 -0.0172 -0.2762 -0.0201 128 LEU A C     
474  O O     . LEU A 36 ? 1.4572 1.8979 1.6434 0.0121  -0.2662 -0.0322 128 LEU A O     
475  C CB    . LEU A 36 ? 1.3967 1.7427 1.4080 -0.0413 -0.2653 -0.0198 128 LEU A CB    
476  C CG    . LEU A 36 ? 1.4940 1.8027 1.5070 0.0038  -0.2478 -0.0281 128 LEU A CG    
477  C CD1   . LEU A 36 ? 1.5820 1.8215 1.5284 0.0106  -0.2321 -0.0461 128 LEU A CD1   
478  C CD2   . LEU A 36 ? 1.3726 1.6519 1.3514 0.0110  -0.2415 -0.0196 128 LEU A CD2   
490  N N     . SER A 37 ? 1.5081 2.0305 1.7371 -0.0229 -0.2885 -0.0016 129 SER A N     
491  C CA    . SER A 37 ? 1.6600 2.2425 1.9882 0.0051  -0.2891 0.0043  129 SER A CA    
492  C C     . SER A 37 ? 1.5695 2.1749 1.9307 0.0018  -0.2907 -0.0034 129 SER A C     
493  O O     . SER A 37 ? 1.3136 1.9293 1.7251 0.0292  -0.2832 -0.0112 129 SER A O     
494  C CB    . SER A 37 ? 1.7986 2.4464 2.1819 -0.0007 -0.2996 0.0281  129 SER A CB    
495  O OG    . SER A 37 ? 1.8369 2.5256 2.2210 -0.0352 -0.3128 0.0406  129 SER A OG    
501  N N     . ASN A 38 ? 1.7124 2.3267 2.0443 -0.0335 -0.3004 -0.0009 130 ASN A N     
502  C CA    . ASN A 38 ? 1.3741 2.0088 1.7327 -0.0391 -0.3024 -0.0078 130 ASN A CA    
503  C C     . ASN A 38 ? 1.4254 2.0060 1.7579 -0.0210 -0.2901 -0.0319 130 ASN A C     
504  O O     . ASN A 38 ? 1.8639 2.4658 2.2527 -0.0009 -0.2858 -0.0379 130 ASN A O     
505  C CB    . ASN A 38 ? 1.3709 2.0158 1.6862 -0.0835 -0.3145 -0.0025 130 ASN A CB    
506  C CG    . ASN A 38 ? 1.7145 2.4430 2.0893 -0.0985 -0.3276 0.0239  130 ASN A CG    
507  O OD1   . ASN A 38 ? 1.9492 2.7274 2.4026 -0.0733 -0.3260 0.0373  130 ASN A OD1   
508  N ND2   . ASN A 38 ? 1.8270 2.5724 2.1628 -0.1402 -0.3396 0.0325  130 ASN A ND2   
515  N N     . ILE A 39 ? 1.6632 2.1728 1.9084 -0.0282 -0.2832 -0.0447 131 ILE A N     
516  C CA    . ILE A 39 ? 1.8470 2.3051 2.0614 -0.0119 -0.2708 -0.0655 131 ILE A CA    
517  C C     . ILE A 39 ? 1.5820 2.0400 1.8402 0.0309  -0.2594 -0.0694 131 ILE A C     
518  O O     . ILE A 39 ? 2.1880 2.6211 2.4417 0.0487  -0.2498 -0.0837 131 ILE A O     
519  C CB    . ILE A 39 ? 1.7837 2.1600 1.8874 -0.0280 -0.2624 -0.0767 131 ILE A CB    
520  C CG1   . ILE A 39 ? 1.7536 2.0944 1.8175 -0.0169 -0.2547 -0.0704 131 ILE A CG1   
521  C CG2   . ILE A 39 ? 2.1839 2.5584 2.2378 -0.0752 -0.2734 -0.0746 131 ILE A CG2   
522  C CD1   . ILE A 39 ? 1.8633 2.1130 1.8201 -0.0201 -0.2390 -0.0824 131 ILE A CD1   
534  N N     . LEU A 40 ? 0.9598 1.4478 1.2593 0.0457  -0.2606 -0.0560 132 LEU A N     
535  C CA    . LEU A 40 ? 1.2671 1.7638 1.6126 0.0828  -0.2510 -0.0575 132 LEU A CA    
536  C C     . LEU A 40 ? 1.5206 2.0839 1.9617 0.0934  -0.2549 -0.0497 132 LEU A C     
537  O O     . LEU A 40 ? 1.3109 1.8880 1.7953 0.1200  -0.2475 -0.0499 132 LEU A O     
538  C CB    . LEU A 40 ? 1.5151 1.9926 1.8362 0.0946  -0.2469 -0.0490 132 LEU A CB    
539  C CG    . LEU A 40 ? 1.4375 1.8463 1.6845 0.1092  -0.2326 -0.0585 132 LEU A CG    
540  C CD1   . LEU A 40 ? 1.2059 1.5595 1.3671 0.0827  -0.2310 -0.0675 132 LEU A CD1   
541  C CD2   . LEU A 40 ? 1.4808 1.8760 1.7099 0.1205  -0.2287 -0.0480 132 LEU A CD2   
553  N N     . ASN A 41 ? 2.0596 2.6626 2.5301 0.0721  -0.2649 -0.0421 133 ASN A N     
554  C CA    . ASN A 41 ? 2.0383 2.7017 2.5949 0.0813  -0.2660 -0.0318 133 ASN A CA    
555  C C     . ASN A 41 ? 2.0252 2.7134 2.6218 0.0999  -0.2635 -0.0183 133 ASN A C     
556  O O     . ASN A 41 ? 1.9819 2.6923 2.6353 0.1216  -0.2557 -0.0179 133 ASN A O     
557  C CB    . ASN A 41 ? 1.7010 2.3642 2.2920 0.0974  -0.2571 -0.0460 133 ASN A CB    
558  C CG    . ASN A 41 ? 1.8159 2.5334 2.4851 0.1009  -0.2563 -0.0363 133 ASN A CG    
559  O OD1   . ASN A 41 ? 1.7952 2.5521 2.4879 0.0873  -0.2638 -0.0192 133 ASN A OD1   
560  N ND2   . ASN A 41 ? 2.0795 2.7995 2.7873 0.1191  -0.2458 -0.0458 133 ASN A ND2   
567  N N     . LEU A 42 ? 1.8380 2.5193 2.4003 0.0894  -0.2696 -0.0076 134 LEU A N     
568  C CA    . LEU A 42 ? 1.2859 1.9908 1.8811 0.1036  -0.2689 0.0067  134 LEU A CA    
569  C C     . LEU A 42 ? 1.4281 2.1763 2.0372 0.0820  -0.2808 0.0283  134 LEU A C     
570  O O     . LEU A 42 ? 1.8112 2.5626 2.3887 0.0534  -0.2900 0.0312  134 LEU A O     
571  C CB    . LEU A 42 ? 1.0018 1.6585 1.5431 0.1139  -0.2639 0.0013  134 LEU A CB    
572  C CG    . LEU A 42 ? 1.4126 2.0328 1.9406 0.1387  -0.2513 -0.0155 134 LEU A CG    
573  C CD1   . LEU A 42 ? 0.9982 1.5723 1.4681 0.1482  -0.2457 -0.0166 134 LEU A CD1   
574  C CD2   . LEU A 42 ? 1.6061 2.2619 2.2077 0.1627  -0.2443 -0.0151 134 LEU A CD2   
586  N N     . SER A 43 ? 1.2034 1.9869 1.8589 0.0947  -0.2803 0.0444  135 SER A N     
587  C CA    . SER A 43 ? 1.4076 2.2369 2.0781 0.0765  -0.2911 0.0681  135 SER A CA    
588  C C     . SER A 43 ? 1.3856 2.1839 1.9897 0.0594  -0.2980 0.0709  135 SER A C     
589  O O     . SER A 43 ? 1.2407 1.9879 1.8036 0.0711  -0.2914 0.0580  135 SER A O     
590  C CB    . SER A 43 ? 1.6543 2.5334 2.4016 0.0984  -0.2859 0.0854  135 SER A CB    
591  O OG    . SER A 43 ? 1.6093 2.4669 2.3574 0.1202  -0.2790 0.0816  135 SER A OG    
597  N N     . TYR A 44 ? 1.3147 2.1446 1.9067 0.0307  -0.3104 0.0890  136 TYR A N     
598  C CA    . TYR A 44 ? 1.2264 2.0286 1.7525 0.0085  -0.3171 0.0934  136 TYR A CA    
599  C C     . TYR A 44 ? 1.3240 2.1195 1.8650 0.0321  -0.3120 0.0984  136 TYR A C     
600  O O     . TYR A 44 ? 1.2159 1.9580 1.6971 0.0310  -0.3087 0.0901  136 TYR A O     
601  C CB    . TYR A 44 ? 1.0196 1.8726 1.5423 -0.0277 -0.3322 0.1158  136 TYR A CB    
602  C CG    . TYR A 44 ? 1.4775 2.3152 1.9442 -0.0521 -0.3397 0.1255  136 TYR A CG    
603  C CD1   . TYR A 44 ? 1.5892 2.3632 1.9598 -0.0808 -0.3406 0.1124  136 TYR A CD1   
604  C CD2   . TYR A 44 ? 1.7465 2.6311 2.2532 -0.0476 -0.3446 0.1482  136 TYR A CD2   
605  C CE1   . TYR A 44 ? 1.4921 2.2471 1.8063 -0.1056 -0.3458 0.1208  136 TYR A CE1   
606  C CE2   . TYR A 44 ? 1.7395 2.6100 2.1938 -0.0718 -0.3516 0.1571  136 TYR A CE2   
607  C CZ    . TYR A 44 ? 1.7105 2.5155 2.0678 -0.1018 -0.3522 0.1431  136 TYR A CZ    
608  O OH    . TYR A 44 ? 2.1766 2.9626 2.4765 -0.1284 -0.3575 0.1516  136 TYR A OH    
618  N N     . LYS A 45 ? 1.2378 2.0857 1.8575 0.0540  -0.3096 0.1122  137 LYS A N     
619  C CA    . LYS A 45 ? 1.2019 2.0543 1.8457 0.0755  -0.3054 0.1198  137 LYS A CA    
620  C C     . LYS A 45 ? 1.2671 2.0602 1.8817 0.0990  -0.2940 0.0992  137 LYS A C     
621  O O     . LYS A 45 ? 1.4056 2.1696 1.9837 0.1007  -0.2934 0.0997  137 LYS A O     
622  C CB    . LYS A 45 ? 1.3089 2.2203 2.0416 0.0979  -0.3003 0.1347  137 LYS A CB    
623  C CG    . LYS A 45 ? 1.4326 2.3634 2.1956 0.1139  -0.2984 0.1491  137 LYS A CG    
624  C CD    . LYS A 45 ? 1.4919 2.4325 2.3034 0.1314  -0.2808 0.1492  137 LYS A CD    
625  C CE    . LYS A 45 ? 1.9075 2.8435 2.7283 0.1442  -0.2733 0.1552  137 LYS A CE    
626  N NZ    . LYS A 45 ? 2.0725 3.0078 2.9252 0.1598  -0.2538 0.1526  137 LYS A NZ    
640  N N     . GLN A 46 ? 0.9693 1.7467 1.5991 0.1167  -0.2845 0.0824  138 GLN A N     
641  C CA    . GLN A 46 ? 1.5818 2.3151 2.1936 0.1416  -0.2730 0.0661  138 GLN A CA    
642  C C     . GLN A 46 ? 1.4747 2.1434 1.9980 0.1310  -0.2716 0.0547  138 GLN A C     
643  O O     . GLN A 46 ? 1.4257 2.0591 1.9221 0.1485  -0.2636 0.0494  138 GLN A O     
644  C CB    . GLN A 46 ? 1.7468 2.4841 2.3963 0.1597  -0.2636 0.0525  138 GLN A CB    
645  C CG    . GLN A 46 ? 1.9179 2.6515 2.5541 0.1428  -0.2665 0.0439  138 GLN A CG    
646  C CD    . GLN A 46 ? 1.6979 2.4461 2.3837 0.1592  -0.2577 0.0340  138 GLN A CD    
647  O OE1   . GLN A 46 ? 1.4537 2.2273 2.1665 0.1491  -0.2600 0.0358  138 GLN A OE1   
648  N NE2   . GLN A 46 ? 1.6429 2.3760 2.3395 0.1832  -0.2471 0.0244  138 GLN A NE2   
657  N N     . VAL A 47 ? 1.2245 1.8772 1.7003 0.1019  -0.2782 0.0522  139 VAL A N     
658  C CA    . VAL A 47 ? 1.3856 1.9704 1.7692 0.0888  -0.2743 0.0417  139 VAL A CA    
659  C C     . VAL A 47 ? 1.3839 1.9533 1.7265 0.0750  -0.2782 0.0534  139 VAL A C     
660  O O     . VAL A 47 ? 1.5073 2.0227 1.7964 0.0853  -0.2685 0.0478  139 VAL A O     
661  C CB    . VAL A 47 ? 1.2656 1.8358 1.6061 0.0579  -0.2795 0.0351  139 VAL A CB    
662  C CG1   . VAL A 47 ? 1.2352 1.7269 1.4721 0.0434  -0.2723 0.0243  139 VAL A CG1   
663  C CG2   . VAL A 47 ? 1.4616 2.0453 1.8416 0.0711  -0.2755 0.0231  139 VAL A CG2   
673  N N     . LYS A 48 ? 1.0406 1.6592 1.4087 0.0524  -0.2915 0.0712  140 LYS A N     
674  C CA    . LYS A 48 ? 1.2203 1.8342 1.5574 0.0367  -0.2969 0.0845  140 LYS A CA    
675  C C     . LYS A 48 ? 1.3532 1.9599 1.7147 0.0701  -0.2887 0.0858  140 LYS A C     
676  O O     . LYS A 48 ? 1.4645 2.0233 1.7695 0.0700  -0.2833 0.0844  140 LYS A O     
677  C CB    . LYS A 48 ? 0.9053 1.5910 1.2862 0.0129  -0.3125 0.1068  140 LYS A CB    
678  C CG    . LYS A 48 ? 1.3726 2.0690 1.7377 -0.0021 -0.3197 0.1240  140 LYS A CG    
679  C CD    . LYS A 48 ? 1.3932 2.1750 1.8225 -0.0151 -0.3331 0.1493  140 LYS A CD    
680  C CE    . LYS A 48 ? 1.5924 2.3928 2.0202 -0.0235 -0.3396 0.1678  140 LYS A CE    
681  N NZ    . LYS A 48 ? 1.6502 2.5391 2.1528 -0.0260 -0.3495 0.1948  140 LYS A NZ    
695  N N     . THR A 49 ? 1.2300 1.8819 1.6731 0.0981  -0.2863 0.0882  141 THR A N     
696  C CA    . THR A 49 ? 1.2842 1.9364 1.7582 0.1298  -0.2784 0.0890  141 THR A CA    
697  C C     . THR A 49 ? 1.4519 2.0400 1.8722 0.1483  -0.2649 0.0730  141 THR A C     
698  O O     . THR A 49 ? 1.6505 2.2101 2.0418 0.1583  -0.2598 0.0754  141 THR A O     
699  C CB    . THR A 49 ? 1.5086 2.2123 2.0712 0.1540  -0.2751 0.0909  141 THR A CB    
700  O OG1   . THR A 49 ? 1.4822 2.2450 2.0941 0.1401  -0.2846 0.1082  141 THR A OG1   
701  C CG2   . THR A 49 ? 1.8997 2.6056 2.4915 0.1828  -0.2674 0.0924  141 THR A CG2   
709  N N     . TRP A 50 ? 1.4580 2.0254 1.8661 0.1542  -0.2584 0.0584  142 TRP A N     
710  C CA    . TRP A 50 ? 1.5909 2.1005 1.9470 0.1730  -0.2442 0.0455  142 TRP A CA    
711  C C     . TRP A 50 ? 1.4804 1.9289 1.7480 0.1592  -0.2400 0.0469  142 TRP A C     
712  O O     . TRP A 50 ? 1.8559 2.2733 2.0985 0.1796  -0.2297 0.0477  142 TRP A O     
713  C CB    . TRP A 50 ? 1.5783 2.0716 1.9215 0.1730  -0.2394 0.0310  142 TRP A CB    
714  C CG    . TRP A 50 ? 1.5307 1.9733 1.8295 0.1974  -0.2233 0.0206  142 TRP A CG    
715  C CD1   . TRP A 50 ? 1.4996 1.9559 1.8355 0.2295  -0.2142 0.0175  142 TRP A CD1   
716  C CD2   . TRP A 50 ? 1.6578 2.0292 1.8648 0.1917  -0.2128 0.0141  142 TRP A CD2   
717  N NE1   . TRP A 50 ? 1.6001 2.0042 1.8772 0.2462  -0.1994 0.0113  142 TRP A NE1   
718  C CE2   . TRP A 50 ? 1.6929 2.0408 1.8893 0.2250  -0.1970 0.0089  142 TRP A CE2   
719  C CE3   . TRP A 50 ? 1.8113 2.1355 1.9408 0.1607  -0.2138 0.0128  142 TRP A CE3   
720  C CZ2   . TRP A 50 ? 1.8493 2.1273 1.9621 0.2322  -0.1807 0.0039  142 TRP A CZ2   
721  C CZ3   . TRP A 50 ? 1.8137 2.0622 1.8558 0.1653  -0.1971 0.0055  142 TRP A CZ3   
722  C CH2   . TRP A 50 ? 1.8523 2.0778 1.8874 0.2028  -0.1800 0.0017  142 TRP A CH2   
733  N N     . PHE A 51 ? 1.2962 1.7270 1.5141 0.1234  -0.2472 0.0477  143 PHE A N     
734  C CA    . PHE A 51 ? 1.4415 1.8077 1.5660 0.1043  -0.2417 0.0483  143 PHE A CA    
735  C C     . PHE A 51 ? 1.4678 1.8378 1.5949 0.1085  -0.2432 0.0609  143 PHE A C     
736  O O     . PHE A 51 ? 1.5992 1.9123 1.6691 0.1204  -0.2298 0.0592  143 PHE A O     
737  C CB    . PHE A 51 ? 1.2857 1.6450 1.3638 0.0585  -0.2519 0.0495  143 PHE A CB    
738  C CG    . PHE A 51 ? 1.3616 1.6709 1.3811 0.0499  -0.2432 0.0340  143 PHE A CG    
739  C CD1   . PHE A 51 ? 1.4782 1.7007 1.4013 0.0505  -0.2255 0.0253  143 PHE A CD1   
740  C CD2   . PHE A 51 ? 1.3191 1.6652 1.3778 0.0422  -0.2509 0.0286  143 PHE A CD2   
741  C CE1   . PHE A 51 ? 1.3918 1.5650 1.2581 0.0439  -0.2157 0.0114  143 PHE A CE1   
742  C CE2   . PHE A 51 ? 1.5286 1.8278 1.5327 0.0342  -0.2429 0.0140  143 PHE A CE2   
743  C CZ    . PHE A 51 ? 1.4084 1.6209 1.3158 0.0351  -0.2252 0.0053  143 PHE A CZ    
753  N N     . GLN A 52 ? 1.2853 1.7214 1.4778 0.1003  -0.2580 0.0746  144 GLN A N     
754  C CA    . GLN A 52 ? 1.2912 1.7376 1.4957 0.1063  -0.2601 0.0869  144 GLN A CA    
755  C C     . GLN A 52 ? 1.6304 2.0566 1.8466 0.1477  -0.2459 0.0823  144 GLN A C     
756  O O     . GLN A 52 ? 1.6433 2.0231 1.8083 0.1536  -0.2371 0.0842  144 GLN A O     
757  C CB    . GLN A 52 ? 1.1501 1.6783 1.4390 0.1013  -0.2754 0.1025  144 GLN A CB    
758  C CG    . GLN A 52 ? 1.2056 1.7458 1.4982 0.0974  -0.2805 0.1173  144 GLN A CG    
759  C CD    . GLN A 52 ? 1.5063 2.0136 1.7205 0.0570  -0.2862 0.1235  144 GLN A CD    
760  O OE1   . GLN A 52 ? 1.1438 1.6685 1.3420 0.0226  -0.2965 0.1278  144 GLN A OE1   
761  N NE2   . GLN A 52 ? 1.9385 2.3969 2.1004 0.0592  -0.2788 0.1242  144 GLN A NE2   
770  N N     . ASN A 53 ? 1.4502 1.9119 1.7321 0.1750  -0.2431 0.0771  145 ASN A N     
771  C CA    . ASN A 53 ? 1.1315 1.5853 1.4309 0.2125  -0.2307 0.0737  145 ASN A CA    
772  C C     . ASN A 53 ? 1.3359 1.7160 1.5529 0.2235  -0.2140 0.0662  145 ASN A C     
773  O O     . ASN A 53 ? 1.5827 1.9399 1.7825 0.2457  -0.2036 0.0697  145 ASN A O     
774  C CB    . ASN A 53 ? 1.4439 1.9415 1.8140 0.2328  -0.2294 0.0673  145 ASN A CB    
775  C CG    . ASN A 53 ? 1.4514 2.0169 1.9044 0.2302  -0.2403 0.0763  145 ASN A CG    
776  O OD1   . ASN A 53 ? 1.2836 1.8686 1.7551 0.2283  -0.2456 0.0880  145 ASN A OD1   
777  N ND2   . ASN A 53 ? 1.4949 2.0946 1.9963 0.2310  -0.2421 0.0714  145 ASN A ND2   
784  N N     . GLN A 54 ? 1.3663 1.7084 1.5309 0.2088  -0.2099 0.0570  146 GLN A N     
785  C CA    . GLN A 54 ? 1.6753 1.9418 1.7551 0.2194  -0.1910 0.0508  146 GLN A CA    
786  C C     . GLN A 54 ? 1.8946 2.1056 1.8989 0.2047  -0.1854 0.0574  146 GLN A C     
787  O O     . GLN A 54 ? 2.1349 2.2944 2.0894 0.2269  -0.1673 0.0585  146 GLN A O     
788  C CB    . GLN A 54 ? 1.7864 2.0226 1.8243 0.2038  -0.1878 0.0392  146 GLN A CB    
789  C CG    . GLN A 54 ? 1.6429 1.9196 1.7417 0.2227  -0.1885 0.0313  146 GLN A CG    
790  C CD    . GLN A 54 ? 1.7258 1.9900 1.8265 0.2636  -0.1715 0.0299  146 GLN A CD    
791  O OE1   . GLN A 54 ? 1.5203 1.7245 1.5517 0.2773  -0.1542 0.0313  146 GLN A OE1   
792  N NE2   . GLN A 54 ? 2.1404 2.4620 2.3191 0.2828  -0.1752 0.0286  146 GLN A NE2   
801  N N     . ARG A 55 ? 1.8554 2.0770 1.8491 0.1669  -0.1999 0.0631  147 ARG A N     
802  C CA    . ARG A 55 ? 1.5743 1.7488 1.5006 0.1489  -0.1962 0.0702  147 ARG A CA    
803  C C     . ARG A 55 ? 1.7889 1.9766 1.7478 0.1787  -0.1921 0.0790  147 ARG A C     
804  O O     . ARG A 55 ? 2.0734 2.2005 1.9686 0.1892  -0.1760 0.0810  147 ARG A O     
805  C CB    . ARG A 55 ? 1.4187 1.6210 1.3426 0.1021  -0.2155 0.0777  147 ARG A CB    
806  C CG    . ARG A 55 ? 1.4005 1.5828 1.2767 0.0665  -0.2190 0.0701  147 ARG A CG    
807  C CD    . ARG A 55 ? 1.2065 1.4081 1.0609 0.0161  -0.2359 0.0800  147 ARG A CD    
808  N NE    . ARG A 55 ? 1.1118 1.4055 1.0545 0.0049  -0.2573 0.0886  147 ARG A NE    
809  C CZ    . ARG A 55 ? 1.6164 1.9344 1.5681 -0.0158 -0.2655 0.0848  147 ARG A CZ    
810  N NH1   . ARG A 55 ? 1.4109 1.6679 1.2887 -0.0289 -0.2552 0.0708  147 ARG A NH1   
811  N NH2   . ARG A 55 ? 1.4617 1.8647 1.4960 -0.0220 -0.2828 0.0956  147 ARG A NH2   
825  N N     . MET A 56 ? 1.6555 1.9194 1.7105 0.1925  -0.2049 0.0844  148 MET A N     
826  C CA    . MET A 56 ? 1.3376 1.6189 1.4296 0.2222  -0.2011 0.0916  148 MET A CA    
827  C C     . MET A 56 ? 2.0473 2.2899 2.1132 0.2604  -0.1800 0.0872  148 MET A C     
828  O O     . MET A 56 ? 2.3887 2.5954 2.4186 0.2762  -0.1682 0.0930  148 MET A O     
829  C CB    . MET A 56 ? 1.7477 2.1129 1.9452 0.2329  -0.2146 0.0958  148 MET A CB    
830  C CG    . MET A 56 ? 2.0102 2.4234 2.2437 0.2019  -0.2337 0.1048  148 MET A CG    
831  S SD    . MET A 56 ? 1.8092 2.1893 1.9787 0.1703  -0.2389 0.1161  148 MET A SD    
832  C CE    . MET A 56 ? 1.8186 2.2859 2.0686 0.1496  -0.2610 0.1311  148 MET A CE    
842  N N     . LYS A 57 ? 1.8752 2.1291 1.9616 0.2759  -0.1752 0.0787  149 LYS A N     
843  C CA    . LYS A 57 ? 1.7742 1.9992 1.8377 0.3119  -0.1553 0.0766  149 LYS A CA    
844  C C     . LYS A 57 ? 2.0027 2.1393 1.9612 0.3123  -0.1355 0.0782  149 LYS A C     
845  O O     . LYS A 57 ? 2.5978 2.7083 2.5327 0.3417  -0.1191 0.0849  149 LYS A O     
846  C CB    . LYS A 57 ? 2.2368 2.4793 2.3232 0.3195  -0.1536 0.0667  149 LYS A CB    
847  C CG    . LYS A 57 ? 2.4703 2.6893 2.5339 0.3564  -0.1330 0.0668  149 LYS A CG    
848  C CD    . LYS A 57 ? 2.2774 2.5126 2.3601 0.3599  -0.1324 0.0569  149 LYS A CD    
849  C CE    . LYS A 57 ? 2.4348 2.6436 2.4851 0.3953  -0.1105 0.0594  149 LYS A CE    
850  N NZ    . LYS A 57 ? 2.3925 2.6203 2.4635 0.3990  -0.1102 0.0503  149 LYS A NZ    
864  N N     . SER A 58 ? 1.8353 1.9250 1.7286 0.2792  -0.1358 0.0727  150 SER A N     
865  C CA    . SER A 58 ? 2.1899 2.1858 1.9729 0.2747  -0.1146 0.0729  150 SER A CA    
866  C C     . SER A 58 ? 2.5611 2.5324 2.3167 0.2743  -0.1107 0.0833  150 SER A C     
867  O O     . SER A 58 ? 2.7188 2.6281 2.4115 0.2963  -0.0874 0.0881  150 SER A O     
868  C CB    . SER A 58 ? 2.3143 2.2700 2.0342 0.2308  -0.1185 0.0647  150 SER A CB    
869  O OG    . SER A 58 ? 2.2371 2.0943 1.8423 0.2233  -0.0956 0.0643  150 SER A OG    
875  N N     . LYS A 59 ? 2.7486 2.7685 2.5510 0.2500  -0.1324 0.0880  151 LYS A N     
876  C CA    . LYS A 59 ? 2.6952 2.7032 2.4846 0.2491  -0.1320 0.0981  151 LYS A CA    
877  C C     . LYS A 59 ? 2.6868 2.7040 2.5052 0.2964  -0.1189 0.1047  151 LYS A C     
878  O O     . LYS A 59 ? 2.8255 2.7816 2.5798 0.3105  -0.0993 0.1104  151 LYS A O     
879  C CB    . LYS A 59 ? 2.5090 2.5852 2.3636 0.2217  -0.1588 0.1037  151 LYS A CB    
880  C CG    . LYS A 59 ? 2.7612 2.8124 2.5594 0.1702  -0.1684 0.1041  151 LYS A CG    
881  C CD    . LYS A 59 ? 2.8064 2.9034 2.6420 0.1484  -0.1873 0.1156  151 LYS A CD    
882  C CE    . LYS A 59 ? 2.7555 2.8352 2.5346 0.0939  -0.1978 0.1180  151 LYS A CE    
883  N NZ    . LYS A 59 ? 2.7310 2.8530 2.5389 0.0718  -0.2149 0.1317  151 LYS A NZ    
897  N N     . ARG A 60 ? 2.5394 2.6325 2.4519 0.3190  -0.1290 0.1048  152 ARG A N     
898  C CA    . ARG A 60 ? 2.5290 2.6467 2.4804 0.3599  -0.1203 0.1120  152 ARG A CA    
899  C C     . ARG A 60 ? 2.6447 2.6978 2.5263 0.3920  -0.0918 0.1173  152 ARG A C     
900  O O     . ARG A 60 ? 2.8576 2.9021 2.7334 0.4125  -0.0830 0.1271  152 ARG A O     
901  C CB    . ARG A 60 ? 2.5181 2.7106 2.5587 0.3782  -0.1290 0.1082  152 ARG A CB    
902  C CG    . ARG A 60 ? 2.6150 2.8807 2.7409 0.3618  -0.1523 0.1082  152 ARG A CG    
903  C CD    . ARG A 60 ? 2.7876 3.1099 2.9815 0.3678  -0.1595 0.1009  152 ARG A CD    
904  N NE    . ARG A 60 ? 2.8481 3.2399 3.1275 0.3651  -0.1748 0.1034  152 ARG A NE    
905  C CZ    . ARG A 60 ? 2.7674 3.2122 3.1131 0.3693  -0.1807 0.0982  152 ARG A CZ    
906  N NH1   . ARG A 60 ? 2.7114 3.1520 3.0510 0.3757  -0.1746 0.0900  152 ARG A NH1   
907  N NH2   . ARG A 60 ? 2.7143 3.2135 3.1296 0.3669  -0.1913 0.1013  152 ARG A NH2   
921  N N     . TRP A 61 ? 2.3799 2.3891 2.2097 0.3983  -0.0762 0.1122  153 TRP A N     
922  C CA    . TRP A 61 ? 2.5741 2.5295 2.3447 0.4351  -0.0465 0.1197  153 TRP A CA    
923  C C     . TRP A 61 ? 2.9916 2.8698 2.6788 0.4340  -0.0289 0.1279  153 TRP A C     
924  O O     . TRP A 61 ? 3.0064 2.8081 2.6063 0.4088  -0.0187 0.1236  153 TRP A O     
925  C CB    . TRP A 61 ? 2.4382 2.3505 2.1572 0.4369  -0.0321 0.1125  153 TRP A CB    
926  C CG    . TRP A 61 ? 2.8011 2.7759 2.5870 0.4600  -0.0358 0.1101  153 TRP A CG    
927  C CD1   . TRP A 61 ? 3.0174 3.0585 2.8774 0.4426  -0.0588 0.1001  153 TRP A CD1   
928  C CD2   . TRP A 61 ? 3.0624 3.0396 2.8451 0.5039  -0.0149 0.1193  153 TRP A CD2   
929  N NE1   . TRP A 61 ? 3.0994 3.1812 3.0005 0.4706  -0.0539 0.1008  153 TRP A NE1   
930  C CE2   . TRP A 61 ? 3.1215 3.1688 2.9777 0.5080  -0.0279 0.1132  153 TRP A CE2   
931  C CE3   . TRP A 61 ? 3.0362 2.9649 2.7606 0.5406  0.0147  0.1339  153 TRP A CE3   
932  C CZ2   . TRP A 61 ? 2.9813 3.0549 2.8547 0.5448  -0.0142 0.1210  153 TRP A CZ2   
933  C CZ3   . TRP A 61 ? 3.0209 2.9787 2.7649 0.5802  0.0290  0.1434  153 TRP A CZ3   
934  C CH2   . TRP A 61 ? 2.9781 3.0094 2.7962 0.5807  0.0136  0.1369  153 TRP A CH2   
945  N N     . GLN A 62 ? 3.0542 2.9521 2.7669 0.4603  -0.0245 0.1396  154 GLN A N     
946  C CA    . GLN A 62 ? 2.9517 2.7810 2.5923 0.4633  -0.0070 0.1487  154 GLN A CA    
947  C C     . GLN A 62 ? 2.9678 2.8004 2.6127 0.5140  0.0143  0.1641  154 GLN A C     
948  O O     . GLN A 62 ? 2.8474 2.7543 2.5690 0.5404  0.0079  0.1681  154 GLN A O     
949  C CB    . GLN A 62 ? 2.6193 2.4727 2.2884 0.4316  -0.0295 0.1482  154 GLN A CB    
950  C CG    . GLN A 62 ? 2.5753 2.5238 2.3525 0.4462  -0.0497 0.1521  154 GLN A CG    
951  C CD    . GLN A 62 ? 2.9024 2.8802 2.7127 0.4125  -0.0735 0.1512  154 GLN A CD    
952  O OE1   . GLN A 62 ? 3.0964 3.0354 2.8575 0.3742  -0.0791 0.1473  154 GLN A OE1   
953  N NE2   . GLN A 62 ? 2.8643 2.9119 2.7566 0.4257  -0.0872 0.1557  154 GLN A NE2   
962  O "O5'" . DG  B 1  ? 1.6660 2.1886 2.3234 0.0993  -0.2497 0.2576  1   DG  B "O5'" 
963  C "C5'" . DG  B 1  ? 1.6591 2.2196 2.3349 0.1045  -0.2373 0.2375  1   DG  B "C5'" 
964  C "C4'" . DG  B 1  ? 1.8411 2.4550 2.5036 0.0569  -0.2277 0.2107  1   DG  B "C4'" 
965  O "O4'" . DG  B 1  ? 2.2411 2.9197 2.8966 0.0223  -0.2434 0.2395  1   DG  B "O4'" 
966  C "C3'" . DG  B 1  ? 1.9742 2.5526 2.6121 0.0337  -0.2160 0.1790  1   DG  B "C3'" 
967  O "O3'" . DG  B 1  ? 2.1359 2.6873 2.7795 0.0495  -0.1927 0.1412  1   DG  B "O3'" 
968  C "C2'" . DG  B 1  ? 1.8377 2.4767 2.4573 -0.0191 -0.2159 0.1762  1   DG  B "C2'" 
969  C "C1'" . DG  B 1  ? 2.1592 2.8546 2.7889 -0.0250 -0.2378 0.2190  1   DG  B "C1'" 
970  N N9    . DG  B 1  ? 2.2770 2.9726 2.8927 -0.0417 -0.2576 0.2489  1   DG  B N9    
971  C C8    . DG  B 1  ? 2.3759 3.0338 2.9964 -0.0131 -0.2734 0.2827  1   DG  B C8    
972  N N7    . DG  B 1  ? 2.1062 2.7739 2.7105 -0.0379 -0.2878 0.3039  1   DG  B N7    
973  C C5    . DG  B 1  ? 1.9605 2.6768 2.5489 -0.0865 -0.2821 0.2827  1   DG  B C5    
974  C C6    . DG  B 1  ? 2.1950 2.9419 2.7623 -0.1303 -0.2919 0.2911  1   DG  B C6    
975  O O6    . DG  B 1  ? 2.4212 3.1597 2.9810 -0.1340 -0.3090 0.3201  1   DG  B O6    
976  N N1    . DG  B 1  ? 2.0682 2.8558 2.6206 -0.1729 -0.2774 0.2615  1   DG  B N1    
977  C C2    . DG  B 1  ? 1.7261 2.5217 2.2828 -0.1724 -0.2548 0.2283  1   DG  B C2    
978  N N2    . DG  B 1  ? 1.5074 2.3368 2.0432 -0.2174 -0.2385 0.2027  1   DG  B N2    
979  N N3    . DG  B 1  ? 1.6008 2.3702 2.1790 -0.1308 -0.2465 0.2204  1   DG  B N3    
980  C C4    . DG  B 1  ? 1.8803 2.6119 2.4739 -0.0897 -0.2620 0.2488  1   DG  B C4    
993  P P     . DG  B 2  ? 1.7065 2.2004 2.3343 0.0515  -0.1798 0.1144  2   DG  B P     
994  O OP1   . DG  B 2  ? 1.6293 2.1018 2.2731 0.0804  -0.1583 0.0853  2   DG  B OP1   
995  O OP2   . DG  B 2  ? 1.7300 2.1780 2.3474 0.0608  -0.1981 0.1377  2   DG  B OP2   
996  O "O5'" . DG  B 2  ? 0.6636 1.1907 1.2669 0.0028  -0.1686 0.0973  2   DG  B "O5'" 
997  C "C5'" . DG  B 2  ? 0.7940 1.3635 1.3967 -0.0175 -0.1474 0.0747  2   DG  B "C5'" 
998  C "C4'" . DG  B 2  ? 1.2544 1.8444 1.8284 -0.0640 -0.1374 0.0638  2   DG  B "C4'" 
999  O "O4'" . DG  B 2  ? 1.3977 2.0180 1.9617 -0.0909 -0.1634 0.0947  2   DG  B "O4'" 
1000 C "C3'" . DG  B 2  ? 1.4373 1.9845 1.9966 -0.0629 -0.1269 0.0491  2   DG  B "C3'" 
1001 O "O3'" . DG  B 2  ? 1.2293 1.7859 1.7738 -0.0834 -0.0943 0.0200  2   DG  B "O3'" 
1002 C "C2'" . DG  B 2  ? 1.8969 2.4427 2.4385 -0.0857 -0.1523 0.0747  2   DG  B "C2'" 
1003 C "C1'" . DG  B 2  ? 1.7419 2.3405 2.2842 -0.1097 -0.1694 0.0979  2   DG  B "C1'" 
1004 N N9    . DG  B 2  ? 1.8357 2.4275 2.3792 -0.1049 -0.2006 0.1345  2   DG  B N9    
1005 C C8    . DG  B 2  ? 1.9382 2.4920 2.4972 -0.0658 -0.2155 0.1546  2   DG  B C8    
1006 N N7    . DG  B 2  ? 1.9048 2.4574 2.4583 -0.0704 -0.2387 0.1877  2   DG  B N7    
1007 C C5    . DG  B 2  ? 1.8810 2.4778 2.4161 -0.1161 -0.2420 0.1895  2   DG  B C5    
1008 C C6    . DG  B 2  ? 1.9410 2.5589 2.4640 -0.1406 -0.2633 0.2192  2   DG  B C6    
1009 O O6    . DG  B 2  ? 1.9961 2.5956 2.5222 -0.1248 -0.2825 0.2518  2   DG  B O6    
1010 N N1    . DG  B 2  ? 1.8293 2.4921 2.3338 -0.1878 -0.2583 0.2087  2   DG  B N1    
1011 C C2    . DG  B 2  ? 1.4636 2.1429 1.9594 -0.2082 -0.2325 0.1739  2   DG  B C2    
1012 N N2    . DG  B 2  ? 1.0855 1.8028 1.5593 -0.2552 -0.2279 0.1681  2   DG  B N2    
1013 N N3    . DG  B 2  ? 1.4826 2.1405 1.9893 -0.1840 -0.2104 0.1468  2   DG  B N3    
1014 C C4    . DG  B 2  ? 1.7206 2.3401 2.2481 -0.1385 -0.2182 0.1564  2   DG  B C4    
1026 P P     . DC  B 3  ? 1.5067 2.0302 2.0378 -0.0809 -0.0767 0.0047  3   DC  B P     
1027 O OP1   . DC  B 3  ? 1.5134 2.0421 2.0425 -0.0804 -0.0358 -0.0253 3   DC  B OP1   
1028 O OP2   . DC  B 3  ? 1.6449 2.1269 2.1879 -0.0477 -0.0944 0.0152  3   DC  B OP2   
1029 O "O5'" . DC  B 3  ? 0.9988 1.5370 1.5012 -0.1236 -0.0873 0.0174  3   DC  B "O5'" 
1030 C "C5'" . DC  B 3  ? 1.0356 1.6126 1.5197 -0.1642 -0.0760 0.0125  3   DC  B "C5'" 
1031 C "C4'" . DC  B 3  ? 0.9788 1.5672 1.4399 -0.1999 -0.0950 0.0306  3   DC  B "C4'" 
1032 O "O4'" . DC  B 3  ? 1.2538 1.8459 1.7255 -0.1934 -0.1334 0.0615  3   DC  B "O4'" 
1033 C "C3'" . DC  B 3  ? 0.9322 1.4914 1.3790 -0.1997 -0.0906 0.0285  3   DC  B "C3'" 
1034 O "O3'" . DC  B 3  ? 0.8960 1.4714 1.3161 -0.2357 -0.0681 0.0179  3   DC  B "O3'" 
1035 C "C2'" . DC  B 3  ? 1.2297 1.7757 1.6752 -0.1997 -0.1296 0.0575  3   DC  B "C2'" 
1036 C "C1'" . DC  B 3  ? 0.9232 1.4998 1.3790 -0.2068 -0.1521 0.0776  3   DC  B "C1'" 
1037 N N1    . DC  B 3  ? 1.1596 1.7137 1.6288 -0.1819 -0.1837 0.1053  3   DC  B N1    
1038 C C2    . DC  B 3  ? 1.4062 1.9689 1.8648 -0.2012 -0.2110 0.1339  3   DC  B C2    
1039 O O2    . DC  B 3  ? 0.8269 1.4195 1.2663 -0.2401 -0.2116 0.1356  3   DC  B O2    
1040 N N3    . DC  B 3  ? 1.8172 2.3531 2.2857 -0.1762 -0.2341 0.1598  3   DC  B N3    
1041 C C4    . DC  B 3  ? 1.6491 2.1497 2.1359 -0.1352 -0.2311 0.1569  3   DC  B C4    
1042 N N4    . DC  B 3  ? 1.7890 2.2576 2.2814 -0.1116 -0.2501 0.1833  3   DC  B N4    
1043 C C5    . DC  B 3  ? 1.4135 1.9078 1.9126 -0.1161 -0.2061 0.1272  3   DC  B C5    
1044 C C6    . DC  B 3  ? 1.3511 1.8732 1.8415 -0.1397 -0.1831 0.1029  3   DC  B C6    
1056 P P     . DC  B 4  ? 1.4109 1.9663 1.8142 -0.2383 -0.0538 0.0137  4   DC  B P     
1057 O OP1   . DC  B 4  ? 1.2512 1.8220 1.6319 -0.2659 -0.0164 -0.0032 4   DC  B OP1   
1058 O OP2   . DC  B 4  ? 1.5589 2.0848 1.9810 -0.1970 -0.0502 0.0086  4   DC  B OP2   
1059 O "O5'" . DC  B 4  ? 1.0064 1.5619 1.3957 -0.2604 -0.0908 0.0396  4   DC  B "O5'" 
1060 C "C5'" . DC  B 4  ? 1.4254 2.0110 1.7961 -0.3019 -0.1001 0.0491  4   DC  B "C5'" 
1061 C "C4'" . DC  B 4  ? 1.6251 2.2065 1.9870 -0.3153 -0.1368 0.0754  4   DC  B "C4'" 
1062 O "O4'" . DC  B 4  ? 1.5596 2.1284 1.9422 -0.2899 -0.1666 0.0940  4   DC  B "O4'" 
1063 C "C3'" . DC  B 4  ? 0.6664 1.2218 1.0152 -0.3121 -0.1366 0.0771  4   DC  B "C3'" 
1064 O "O3'" . DC  B 4  ? 1.1554 1.7263 1.4788 -0.3499 -0.1418 0.0856  4   DC  B "O3'" 
1065 C "C2'" . DC  B 4  ? 0.7951 1.3192 1.1560 -0.2861 -0.1669 0.0940  4   DC  B "C2'" 
1066 C "C1'" . DC  B 4  ? 1.3311 1.8700 1.7063 -0.2845 -0.1889 0.1103  4   DC  B "C1'" 
1067 N N1    . DC  B 4  ? 1.1800 1.6868 1.5753 -0.2466 -0.2045 0.1201  4   DC  B N1    
1068 C C2    . DC  B 4  ? 1.5377 2.0223 1.9294 -0.2431 -0.2341 0.1465  4   DC  B C2    
1069 O O2    . DC  B 4  ? 1.7061 2.2015 2.0800 -0.2717 -0.2494 0.1618  4   DC  B O2    
1070 N N3    . DC  B 4  ? 1.6859 2.1350 2.0926 -0.2080 -0.2430 0.1550  4   DC  B N3    
1071 C C4    . DC  B 4  ? 1.5555 1.9945 1.9818 -0.1777 -0.2265 0.1379  4   DC  B C4    
1072 N N4    . DC  B 4  ? 1.7838 2.1848 2.2228 -0.1438 -0.2350 0.1471  4   DC  B N4    
1073 C C5    . DC  B 4  ? 1.0091 1.4734 1.4414 -0.1803 -0.1982 0.1109  4   DC  B C5    
1074 C C6    . DC  B 4  ? 1.0651 1.5607 1.4804 -0.2148 -0.1869 0.1032  4   DC  B C6    
1086 P P     . DC  B 5  ? 1.5800 2.1368 1.8843 -0.3561 -0.1348 0.0862  5   DC  B P     
1087 O OP1   . DC  B 5  ? 1.5392 2.1193 1.8182 -0.3967 -0.1284 0.0887  5   DC  B OP1   
1088 O OP2   . DC  B 5  ? 2.2339 2.7775 2.5477 -0.3266 -0.1044 0.0687  5   DC  B OP2   
1089 O "O5'" . DC  B 5  ? 1.3318 1.8630 1.6364 -0.3478 -0.1732 0.1079  5   DC  B "O5'" 
1090 C "C5'" . DC  B 5  ? 2.0225 2.5605 2.3204 -0.3687 -0.2052 0.1299  5   DC  B "C5'" 
1091 C "C4'" . DC  B 5  ? 2.2450 2.7464 2.5422 -0.3535 -0.2329 0.1471  5   DC  B "C4'" 
1092 O "O4'" . DC  B 5  ? 2.0213 2.5010 2.3416 -0.3182 -0.2367 0.1470  5   DC  B "O4'" 
1093 C "C3'" . DC  B 5  ? 2.1480 2.6260 2.4306 -0.3497 -0.2273 0.1422  5   DC  B "C3'" 
1094 O "O3'" . DC  B 5  ? 2.0555 2.5334 2.3140 -0.3784 -0.2457 0.1576  5   DC  B "O3'" 
1095 C "C2'" . DC  B 5  ? 2.0387 2.4757 2.3326 -0.3167 -0.2363 0.1437  5   DC  B "C2'" 
1096 C "C1'" . DC  B 5  ? 1.8681 2.3045 2.1820 -0.3024 -0.2491 0.1538  5   DC  B "C1'" 
1097 N N1    . DC  B 5  ? 1.7445 2.1551 2.0800 -0.2638 -0.2424 0.1457  5   DC  B N1    
1098 C C2    . DC  B 5  ? 2.3236 2.6906 2.6600 -0.2440 -0.2604 0.1604  5   DC  B C2    
1099 O O2    . DC  B 5  ? 2.8025 3.1513 3.1211 -0.2585 -0.2808 0.1802  5   DC  B O2    
1100 N N3    . DC  B 5  ? 2.2204 2.5630 2.5757 -0.2090 -0.2527 0.1526  5   DC  B N3    
1101 C C4    . DC  B 5  ? 1.7107 2.0734 2.0851 -0.1938 -0.2300 0.1313  5   DC  B C4    
1102 N N4    . DC  B 5  ? 1.4859 1.8239 1.8791 -0.1591 -0.2237 0.1243  5   DC  B N4    
1103 C C5    . DC  B 5  ? 1.5560 1.9617 1.9291 -0.2132 -0.2102 0.1163  5   DC  B C5    
1104 C C6    . DC  B 5  ? 1.6382 2.0652 1.9909 -0.2479 -0.2164 0.1242  5   DC  B C6    
1116 P P     . DA  B 6  ? 2.1247 2.5869 2.3622 -0.3839 -0.2446 0.1574  6   DA  B P     
1117 O OP1   . DA  B 6  ? 2.4364 2.9214 2.6513 -0.4195 -0.2490 0.1658  6   DA  B OP1   
1118 O OP2   . DA  B 6  ? 2.0396 2.5028 2.2880 -0.3600 -0.2164 0.1389  6   DA  B OP2   
1119 O "O5'" . DA  B 6  ? 2.0713 2.4878 2.3022 -0.3744 -0.2721 0.1722  6   DA  B "O5'" 
1120 C "C5'" . DA  B 6  ? 2.4266 2.8328 2.6526 -0.3856 -0.2986 0.1932  6   DA  B "C5'" 
1121 C "C4'" . DA  B 6  ? 2.6229 2.9763 2.8461 -0.3655 -0.3134 0.2035  6   DA  B "C4'" 
1122 O "O4'" . DA  B 6  ? 2.5566 2.8969 2.8047 -0.3304 -0.3011 0.1927  6   DA  B "O4'" 
1123 C "C3'" . DA  B 6  ? 2.7616 3.0830 2.9582 -0.3730 -0.3155 0.2011  6   DA  B "C3'" 
1124 O "O3'" . DA  B 6  ? 2.9578 3.2366 3.1343 -0.3801 -0.3369 0.2203  6   DA  B "O3'" 
1125 C "C2'" . DA  B 6  ? 2.6663 2.9690 2.8758 -0.3431 -0.2980 0.1836  6   DA  B "C2'" 
1126 C "C1'" . DA  B 6  ? 2.4734 2.7713 2.7122 -0.3150 -0.2973 0.1855  6   DA  B "C1'" 
1127 N N9    . DA  B 6  ? 2.2355 2.5394 2.4978 -0.2867 -0.2758 0.1656  6   DA  B N9    
1128 C C8    . DA  B 6  ? 2.1244 2.4657 2.3965 -0.2861 -0.2524 0.1471  6   DA  B C8    
1129 N N7    . DA  B 6  ? 1.9530 2.2901 2.2471 -0.2563 -0.2358 0.1322  6   DA  B N7    
1130 C C5    . DA  B 6  ? 1.9816 2.2753 2.2804 -0.2363 -0.2499 0.1413  6   DA  B C5    
1131 C C6    . DA  B 6  ? 2.0189 2.2870 2.3379 -0.2016 -0.2431 0.1340  6   DA  B C6    
1132 N N6    . DA  B 6  ? 2.1020 2.3876 2.4420 -0.1811 -0.2209 0.1141  6   DA  B N6    
1133 N N1    . DA  B 6  ? 2.1949 2.4171 2.5112 -0.1876 -0.2580 0.1490  6   DA  B N1    
1134 C C2    . DA  B 6  ? 2.6522 2.8557 2.9471 -0.2066 -0.2775 0.1703  6   DA  B C2    
1135 N N3    . DA  B 6  ? 2.6591 2.8849 2.9348 -0.2400 -0.2872 0.1784  6   DA  B N3    
1136 C C4    . DA  B 6  ? 2.2850 2.5565 2.5638 -0.2539 -0.2731 0.1626  6   DA  B C4    
1148 P P     . DT  B 7  ? 2.7492 2.9881 2.8896 -0.3954 -0.3422 0.2204  7   DT  B P     
1149 O OP1   . DT  B 7  ? 3.1117 3.3263 3.2288 -0.4159 -0.3635 0.2422  7   DT  B OP1   
1150 O OP2   . DT  B 7  ? 2.7716 3.0473 2.9053 -0.4092 -0.3280 0.2054  7   DT  B OP2   
1151 O "O5'" . DT  B 7  ? 2.7576 2.9430 2.9006 -0.3653 -0.3349 0.2135  7   DT  B "O5'" 
1152 C "C5'" . DT  B 7  ? 3.0161 3.1658 3.1721 -0.3406 -0.3405 0.2266  7   DT  B "C5'" 
1153 C "C4'" . DT  B 7  ? 3.1476 3.2554 3.3102 -0.3101 -0.3276 0.2148  7   DT  B "C4'" 
1154 O "O4'" . DT  B 7  ? 3.0765 3.2247 3.2703 -0.2913 -0.3109 0.1954  7   DT  B "O4'" 
1155 C "C3'" . DT  B 7  ? 3.1460 3.2117 3.2735 -0.3231 -0.3235 0.2052  7   DT  B "C3'" 
1156 O "O3'" . DT  B 7  ? 3.2791 3.2712 3.3844 -0.3154 -0.3275 0.2173  7   DT  B "O3'" 
1157 C "C2'" . DT  B 7  ? 2.9778 3.0601 3.1238 -0.3037 -0.3046 0.1820  7   DT  B "C2'" 
1158 C "C1'" . DT  B 7  ? 2.9363 3.0514 3.1256 -0.2751 -0.2985 0.1803  7   DT  B "C1'" 
1159 N N1    . DT  B 7  ? 2.7327 2.8948 2.9463 -0.2639 -0.2795 0.1591  7   DT  B N1    
1160 C C2    . DT  B 7  ? 2.5588 2.7095 2.7967 -0.2304 -0.2661 0.1467  7   DT  B C2    
1161 O O2    . DT  B 7  ? 2.5164 2.6199 2.7573 -0.2085 -0.2690 0.1522  7   DT  B O2    
1162 N N3    . DT  B 7  ? 2.2563 2.4523 2.5147 -0.2219 -0.2469 0.1287  7   DT  B N3    
1163 C C4    . DT  B 7  ? 2.1245 2.3728 2.3808 -0.2415 -0.2374 0.1234  7   DT  B C4    
1164 O O4    . DT  B 7  ? 2.0135 2.2968 2.2888 -0.2290 -0.2159 0.1089  7   DT  B O4    
1165 C C5    . DT  B 7  ? 2.2773 2.5344 2.5074 -0.2761 -0.2524 0.1374  7   DT  B C5    
1166 C C7    . DT  B 7  ? 2.2768 2.5871 2.5011 -0.2985 -0.2421 0.1352  7   DT  B C7    
1167 C C6    . DT  B 7  ? 2.5969 2.8119 2.8076 -0.2861 -0.2735 0.1536  7   DT  B C6    
1180 P P     . DT  B 8  ? 3.0773 3.0115 3.1359 -0.3348 -0.3233 0.2094  8   DT  B P     
1181 O OP1   . DT  B 8  ? 3.6585 3.5273 3.6857 -0.3425 -0.3314 0.2299  8   DT  B OP1   
1182 O OP2   . DT  B 8  ? 3.0447 3.0278 3.0899 -0.3654 -0.3229 0.1966  8   DT  B OP2   
1183 O "O5'" . DT  B 8  ? 2.8112 2.7130 2.8816 -0.3036 -0.3062 0.1936  8   DT  B "O5'" 
1184 C "C5'" . DT  B 8  ? 2.9864 2.8511 3.0780 -0.2666 -0.3021 0.2035  8   DT  B "C5'" 
1185 C "C4'" . DT  B 8  ? 3.0582 2.9119 3.1674 -0.2387 -0.2857 0.1843  8   DT  B "C4'" 
1186 O "O4'" . DT  B 8  ? 3.0224 2.9520 3.1650 -0.2348 -0.2807 0.1678  8   DT  B "O4'" 
1187 C "C3'" . DT  B 8  ? 2.9755 2.7787 3.0455 -0.2535 -0.2755 0.1693  8   DT  B "C3'" 
1188 O "O3'" . DT  B 8  ? 3.0748 2.8008 3.1362 -0.2279 -0.2653 0.1733  8   DT  B "O3'" 
1189 C "C2'" . DT  B 8  ? 2.7317 2.5930 2.8220 -0.2522 -0.2656 0.1458  8   DT  B "C2'" 
1190 C "C1'" . DT  B 8  ? 2.7424 2.6666 2.8842 -0.2274 -0.2660 0.1467  8   DT  B "C1'" 
1191 N N1    . DT  B 8  ? 2.4880 2.4890 2.6469 -0.2376 -0.2597 0.1327  8   DT  B N1    
1192 C C2    . DT  B 8  ? 2.3360 2.3685 2.5284 -0.2114 -0.2440 0.1163  8   DT  B C2    
1193 O O2    . DT  B 8  ? 2.1407 2.1435 2.3507 -0.1805 -0.2367 0.1110  8   DT  B O2    
1194 N N3    . DT  B 8  ? 2.2336 2.3338 2.4378 -0.2214 -0.2350 0.1073  8   DT  B N3    
1195 C C4    . DT  B 8  ? 2.0942 2.2337 2.2810 -0.2539 -0.2404 0.1136  8   DT  B C4    
1196 O O4    . DT  B 8  ? 1.6858 1.8841 1.8849 -0.2576 -0.2278 0.1072  8   DT  B O4    
1197 C C5    . DT  B 8  ? 2.2599 2.3652 2.4126 -0.2814 -0.2595 0.1296  8   DT  B C5    
1198 C C7    . DT  B 8  ? 2.1763 2.3191 2.3074 -0.3178 -0.2678 0.1380  8   DT  B C7    
1199 C C6    . DT  B 8  ? 2.3843 2.4225 2.5248 -0.2721 -0.2678 0.1380  8   DT  B C6    
1212 P P     . DC  B 9  ? 3.2955 2.9404 3.3025 -0.2468 -0.2534 0.1637  9   DC  B P     
1213 O OP1   . DC  B 9  ? 3.4600 3.0197 3.4577 -0.2185 -0.2432 0.1779  9   DC  B OP1   
1214 O OP2   . DC  B 9  ? 3.6324 3.2816 3.5958 -0.2949 -0.2621 0.1640  9   DC  B OP2   
1215 O "O5'" . DC  B 9  ? 2.9619 2.6358 2.9831 -0.2399 -0.2410 0.1367  9   DC  B "O5'" 
1216 C "C5'" . DC  B 9  ? 2.9759 2.6509 3.0377 -0.1967 -0.2311 0.1306  9   DC  B "C5'" 
1217 C "C4'" . DC  B 9  ? 2.9170 2.6385 2.9932 -0.1970 -0.2214 0.1060  9   DC  B "C4'" 
1218 O "O4'" . DC  B 9  ? 2.8051 2.6180 2.9055 -0.2094 -0.2280 0.1026  9   DC  B "O4'" 
1219 C "C3'" . DC  B 9  ? 3.0304 2.7169 3.0567 -0.2304 -0.2133 0.0923  9   DC  B "C3'" 
1220 O "O3'" . DC  B 9  ? 3.0701 2.7401 3.1056 -0.2103 -0.1980 0.0751  9   DC  B "O3'" 
1221 C "C2'" . DC  B 9  ? 2.9529 2.7198 2.9753 -0.2648 -0.2203 0.0873  9   DC  B "C2'" 
1222 C "C1'" . DC  B 9  ? 2.6421 2.4863 2.7231 -0.2363 -0.2220 0.0877  9   DC  B "C1'" 
1223 N N1    . DC  B 9  ? 2.3037 2.2250 2.3900 -0.2607 -0.2297 0.0919  9   DC  B N1    
1224 C C2    . DC  B 9  ? 2.2454 2.2456 2.3665 -0.2504 -0.2200 0.0823  9   DC  B C2    
1225 O O2    . DC  B 9  ? 2.3083 2.3167 2.4572 -0.2215 -0.2065 0.0697  9   DC  B O2    
1226 N N3    . DC  B 9  ? 2.0743 2.1390 2.1974 -0.2713 -0.2236 0.0882  9   DC  B N3    
1227 C C4    . DC  B 9  ? 2.1577 2.2131 2.2511 -0.3023 -0.2388 0.1017  9   DC  B C4    
1228 N N4    . DC  B 9  ? 1.9703 2.0898 2.0664 -0.3215 -0.2409 0.1076  9   DC  B N4    
1229 C C5    . DC  B 9  ? 2.2536 2.2312 2.3124 -0.3139 -0.2503 0.1109  9   DC  B C5    
1230 C C6    . DC  B 9  ? 2.2364 2.1484 2.2923 -0.2919 -0.2439 0.1061  9   DC  B C6    
1242 P P     . DA  B 10 ? 3.4955 3.0876 3.4749 -0.2335 -0.1845 0.0634  10  DA  B P     
1243 O OP1   . DA  B 10 ? 3.6613 3.1575 3.6303 -0.2060 -0.1753 0.0727  10  DA  B OP1   
1244 O OP2   . DA  B 10 ? 3.6363 3.2350 3.5655 -0.2873 -0.1911 0.0638  10  DA  B OP2   
1245 O "O5'" . DA  B 10 ? 3.0778 2.7149 3.0807 -0.2227 -0.1726 0.0414  10  DA  B "O5'" 
1246 C "C5'" . DA  B 10 ? 3.2148 2.8675 3.2712 -0.1737 -0.1664 0.0371  10  DA  B "C5'" 
1247 C "C4'" . DA  B 10 ? 3.2047 2.9506 3.2984 -0.1682 -0.1621 0.0231  10  DA  B "C4'" 
1248 O "O4'" . DA  B 10 ? 3.1297 2.9519 3.2355 -0.1857 -0.1728 0.0313  10  DA  B "O4'" 
1249 C "C3'" . DA  B 10 ? 3.1595 2.9152 3.2240 -0.1960 -0.1516 0.0068  10  DA  B "C3'" 
1250 O "O3'" . DA  B 10 ? 3.1118 2.9131 3.2184 -0.1664 -0.1400 -0.0067 10  DA  B "O3'" 
1251 C "C2'" . DA  B 10 ? 3.0212 2.8419 3.0655 -0.2390 -0.1604 0.0123  10  DA  B "C2'" 
1252 C "C1'" . DA  B 10 ? 2.9046 2.7852 2.9957 -0.2166 -0.1687 0.0232  10  DA  B "C1'" 
1253 N N9    . DA  B 10 ? 2.6764 2.5948 2.7487 -0.2507 -0.1811 0.0357  10  DA  B N9    
1254 C C8    . DA  B 10 ? 2.7297 2.6005 2.7541 -0.2851 -0.1923 0.0458  10  DA  B C8    
1255 N N7    . DA  B 10 ? 2.6333 2.5568 2.6520 -0.3106 -0.2026 0.0560  10  DA  B N7    
1256 C C5    . DA  B 10 ? 2.4089 2.4183 2.4736 -0.2911 -0.1955 0.0530  10  DA  B C5    
1257 C C6    . DA  B 10 ? 2.2329 2.3242 2.3141 -0.3010 -0.1971 0.0609  10  DA  B C6    
1258 N N6    . DA  B 10 ? 2.2398 2.3433 2.2930 -0.3353 -0.2100 0.0736  10  DA  B N6    
1259 N N1    . DA  B 10 ? 2.0047 2.1623 2.1307 -0.2737 -0.1826 0.0559  10  DA  B N1    
1260 C C2    . DA  B 10 ? 2.2102 2.3555 2.3642 -0.2395 -0.1700 0.0430  10  DA  B C2    
1261 N N3    . DA  B 10 ? 2.3815 2.4559 2.5257 -0.2271 -0.1695 0.0343  10  DA  B N3    
1262 C C4    . DA  B 10 ? 2.4426 2.4496 2.5406 -0.2543 -0.1819 0.0403  10  DA  B C4    
1274 P P     . DA  B 11 ? 3.3057 3.0915 3.3900 -0.1782 -0.1254 -0.0247 11  DA  B P     
1275 O OP1   . DA  B 11 ? 3.2837 3.1338 3.4224 -0.1429 -0.1152 -0.0348 11  DA  B OP1   
1276 O OP2   . DA  B 11 ? 3.5426 3.2160 3.5865 -0.1796 -0.1200 -0.0268 11  DA  B OP2   
1277 O "O5'" . DA  B 11 ? 3.2122 3.0444 3.2533 -0.2351 -0.1287 -0.0241 11  DA  B "O5'" 
1278 C "C5'" . DA  B 11 ? 3.1782 3.0866 3.2271 -0.2474 -0.1195 -0.0330 11  DA  B "C5'" 
1279 C "C4'" . DA  B 11 ? 2.8756 2.8885 2.9803 -0.2242 -0.1182 -0.0266 11  DA  B "C4'" 
1280 O "O4'" . DA  B 11 ? 2.6900 2.7170 2.7976 -0.2301 -0.1314 -0.0113 11  DA  B "O4'" 
1281 C "C3'" . DA  B 11 ? 2.7891 2.8970 2.8923 -0.2488 -0.1101 -0.0263 11  DA  B "C3'" 
1282 O "O3'" . DA  B 11 ? 2.6020 2.7720 2.7603 -0.2092 -0.0953 -0.0315 11  DA  B "O3'" 
1283 C "C2'" . DA  B 11 ? 2.7497 2.9133 2.8439 -0.2751 -0.1201 -0.0092 11  DA  B "C2'" 
1284 C "C1'" . DA  B 11 ? 2.6215 2.7432 2.7352 -0.2502 -0.1305 -0.0026 11  DA  B "C1'" 
1285 N N9    . DA  B 11 ? 2.7321 2.8455 2.8114 -0.2853 -0.1460 0.0110  11  DA  B N9    
1286 C C8    . DA  B 11 ? 3.0848 3.1174 3.1132 -0.3144 -0.1574 0.0130  11  DA  B C8    
1287 N N7    . DA  B 11 ? 3.0081 3.0546 3.0151 -0.3427 -0.1703 0.0264  11  DA  B N7    
1288 C C5    . DA  B 11 ? 2.6191 2.7615 2.6646 -0.3319 -0.1667 0.0339  11  DA  B C5    
1289 C C6    . DA  B 11 ? 2.4666 2.6657 2.5124 -0.3496 -0.1742 0.0489  11  DA  B C6    
1290 N N6    . DA  B 11 ? 2.6007 2.7689 2.6069 -0.3838 -0.1903 0.0587  11  DA  B N6    
1291 N N1    . DA  B 11 ? 2.3840 2.6698 2.4710 -0.3303 -0.1624 0.0540  11  DA  B N1    
1292 C C2    . DA  B 11 ? 2.2941 2.6082 2.4199 -0.2954 -0.1447 0.0444  11  DA  B C2    
1293 N N3    . DA  B 11 ? 2.1805 2.4508 2.3121 -0.2763 -0.1384 0.0295  11  DA  B N3    
1294 C C4    . DA  B 11 ? 2.4759 2.6594 2.5653 -0.2964 -0.1503 0.0249  11  DA  B C4    
1306 P P     . DG  B 12 ? 2.8003 3.0719 2.9667 -0.2230 -0.0814 -0.0300 12  DG  B P     
1307 O OP1   . DG  B 12 ? 2.6937 2.9854 2.9089 -0.1777 -0.0651 -0.0409 12  DG  B OP1   
1308 O OP2   . DG  B 12 ? 2.9704 3.2296 3.0757 -0.2786 -0.0863 -0.0313 12  DG  B OP2   
1309 O "O5'" . DG  B 12 ? 2.1469 2.5086 2.3347 -0.2249 -0.0804 -0.0110 12  DG  B "O5'" 
1310 C "C5'" . DG  B 12 ? 2.2508 2.7187 2.4495 -0.2352 -0.0673 -0.0001 12  DG  B "C5'" 
1311 C "C4'" . DG  B 12 ? 2.4351 2.9703 2.6575 -0.2272 -0.0630 0.0182  12  DG  B "C4'" 
1312 O "O4'" . DG  B 12 ? 2.5964 3.0780 2.7915 -0.2471 -0.0827 0.0231  12  DG  B "O4'" 
1313 C "C3'" . DG  B 12 ? 2.4701 3.1119 2.6847 -0.2538 -0.0540 0.0378  12  DG  B "C3'" 
1314 O "O3'" . DG  B 12 ? 2.3976 3.1128 2.6568 -0.2217 -0.0346 0.0518  12  DG  B "O3'" 
1315 C "C2'" . DG  B 12 ? 2.6140 3.2325 2.7741 -0.3055 -0.0756 0.0467  12  DG  B "C2'" 
1316 C "C1'" . DG  B 12 ? 2.5978 3.1322 2.7615 -0.2891 -0.0890 0.0405  12  DG  B "C1'" 
1317 N N9    . DG  B 12 ? 2.5367 2.9952 2.6466 -0.3288 -0.1115 0.0385  12  DG  B N9    
1318 C C8    . DG  B 12 ? 2.7251 3.0949 2.7986 -0.3445 -0.1198 0.0236  12  DG  B C8    
1319 N N7    . DG  B 12 ? 2.8044 3.1170 2.8310 -0.3795 -0.1365 0.0268  12  DG  B N7    
1320 C C5    . DG  B 12 ? 2.5796 2.9501 2.6131 -0.3887 -0.1422 0.0444  12  DG  B C5    
1321 C C6    . DG  B 12 ? 2.5680 2.9173 2.5652 -0.4228 -0.1594 0.0553  12  DG  B C6    
1322 O O6    . DG  B 12 ? 2.6336 2.9052 2.5834 -0.4521 -0.1723 0.0517  12  DG  B O6    
1323 N N1    . DG  B 12 ? 2.3388 2.7654 2.3582 -0.4201 -0.1583 0.0724  12  DG  B N1    
1324 C C2    . DG  B 12 ? 2.1337 2.6434 2.2021 -0.3878 -0.1397 0.0788  12  DG  B C2    
1325 N N2    . DG  B 12 ? 2.2283 2.7988 2.3084 -0.3900 -0.1376 0.0963  12  DG  B N2    
1326 N N3    . DG  B 12 ? 1.7379 2.2676 1.8405 -0.3550 -0.1220 0.0692  12  DG  B N3    
1327 C C4    . DG  B 12 ? 2.2237 2.6825 2.3072 -0.3579 -0.1260 0.0519  12  DG  B C4    
1340 O "O5'" . DC  C 1  ? 3.4773 3.5320 3.0414 -0.7781 -0.0856 -0.4069 1   DC  C "O5'" 
1341 C "C5'" . DC  C 1  ? 3.4652 3.6664 3.0576 -0.7919 -0.0796 -0.3732 1   DC  C "C5'" 
1342 C "C4'" . DC  C 1  ? 3.1889 3.5664 2.8695 -0.7569 -0.0831 -0.3274 1   DC  C "C4'" 
1343 O "O4'" . DC  C 1  ? 3.0078 3.4726 2.6885 -0.7788 -0.0709 -0.3625 1   DC  C "O4'" 
1344 C "C3'" . DC  C 1  ? 3.1795 3.5037 2.9220 -0.6875 -0.1068 -0.2821 1   DC  C "C3'" 
1345 O "O3'" . DC  C 1  ? 3.2819 3.6269 3.0605 -0.6603 -0.1123 -0.2263 1   DC  C "O3'" 
1346 C "C2'" . DC  C 1  ? 2.8395 3.3074 2.6435 -0.6677 -0.1058 -0.2722 1   DC  C "C2'" 
1347 C "C1'" . DC  C 1  ? 2.3046 2.8477 2.0636 -0.7277 -0.0832 -0.3272 1   DC  C "C1'" 
1348 N N1    . DC  C 1  ? 2.0017 2.4807 1.7419 -0.7263 -0.0823 -0.3693 1   DC  C N1    
1349 C C2    . DC  C 1  ? 2.0841 2.6745 1.8869 -0.6976 -0.0862 -0.3542 1   DC  C C2    
1350 O O2    . DC  C 1  ? 1.5652 2.3051 1.4397 -0.6728 -0.0909 -0.3054 1   DC  C O2    
1351 N N3    . DC  C 1  ? 2.3871 2.9158 2.1707 -0.6954 -0.0831 -0.3913 1   DC  C N3    
1352 C C4    . DC  C 1  ? 2.6524 3.0162 2.3578 -0.7194 -0.0732 -0.4404 1   DC  C C4    
1353 N N4    . DC  C 1  ? 2.4382 2.7441 2.1266 -0.7132 -0.0657 -0.4726 1   DC  C N4    
1354 C C5    . DC  C 1  ? 2.9078 3.1574 2.5489 -0.7491 -0.0686 -0.4570 1   DC  C C5    
1355 C C6    . DC  C 1  ? 2.6891 3.0021 2.3502 -0.7523 -0.0747 -0.4214 1   DC  C C6    
1368 P P     . DT  C 2  ? 2.8776 3.1169 2.6959 -0.5992 -0.1354 -0.1817 2   DT  C P     
1369 O OP1   . DT  C 2  ? 3.3412 3.5900 3.1724 -0.5893 -0.1309 -0.1358 2   DT  C OP1   
1370 O OP2   . DT  C 2  ? 3.0788 3.1330 2.8501 -0.5959 -0.1503 -0.2165 2   DT  C OP2   
1371 O "O5'" . DT  C 2  ? 2.4002 2.7682 2.2995 -0.5573 -0.1405 -0.1503 2   DT  C "O5'" 
1372 C "C5'" . DT  C 2  ? 2.7219 3.2845 2.6795 -0.5512 -0.1258 -0.1124 2   DT  C "C5'" 
1373 C "C4'" . DT  C 2  ? 2.5608 3.2218 2.5876 -0.5133 -0.1329 -0.0931 2   DT  C "C4'" 
1374 O "O4'" . DT  C 2  ? 2.5327 3.1796 2.5329 -0.5347 -0.1349 -0.1464 2   DT  C "O4'" 
1375 C "C3'" . DT  C 2  ? 2.4101 2.9799 2.4748 -0.4569 -0.1538 -0.0563 2   DT  C "C3'" 
1376 O "O3'" . DT  C 2  ? 2.2196 2.9273 2.3634 -0.4177 -0.1493 -0.0027 2   DT  C "O3'" 
1377 C "C2'" . DT  C 2  ? 2.4345 2.9157 2.4817 -0.4509 -0.1705 -0.0950 2   DT  C "C2'" 
1378 C "C1'" . DT  C 2  ? 2.0856 2.6817 2.1211 -0.4896 -0.1544 -0.1366 2   DT  C "C1'" 
1379 N N1    . DT  C 2  ? 1.6646 2.1512 1.6466 -0.5083 -0.1574 -0.1932 2   DT  C N1    
1380 C C2    . DT  C 2  ? 2.1387 2.6762 2.1483 -0.4937 -0.1601 -0.2066 2   DT  C C2    
1381 O O2    . DT  C 2  ? 2.0819 2.7549 2.1600 -0.4668 -0.1628 -0.1758 2   DT  C O2    
1382 N N3    . DT  C 2  ? 2.2941 2.7149 2.2468 -0.5107 -0.1571 -0.2570 2   DT  C N3    
1383 C C4    . DT  C 2  ? 2.4468 2.7099 2.3208 -0.5396 -0.1514 -0.2940 2   DT  C C4    
1384 O O4    . DT  C 2  ? 2.7584 2.9227 2.5854 -0.5502 -0.1442 -0.3357 2   DT  C O4    
1385 C C5    . DT  C 2  ? 2.2015 2.4227 2.0524 -0.5546 -0.1519 -0.2787 2   DT  C C5    
1386 C C7    . DT  C 2  ? 2.6078 2.6633 2.3763 -0.5857 -0.1467 -0.3152 2   DT  C C7    
1387 C C6    . DT  C 2  ? 1.8115 2.1440 1.7162 -0.5385 -0.1549 -0.2299 2   DT  C C6    
1400 P P     . DT  C 3  ? 2.6577 3.2954 2.8440 -0.3622 -0.1639 0.0471  3   DT  C P     
1401 O OP1   . DT  C 3  ? 2.6800 3.4584 2.9281 -0.3367 -0.1444 0.1047  3   DT  C OP1   
1402 O OP2   . DT  C 3  ? 2.8459 3.2882 2.9759 -0.3674 -0.1768 0.0370  3   DT  C OP2   
1403 O "O5'" . DT  C 3  ? 1.9401 2.5840 2.1590 -0.3354 -0.1836 0.0355  3   DT  C "O5'" 
1404 C "C5'" . DT  C 3  ? 2.2051 3.0215 2.4788 -0.3275 -0.1764 0.0403  3   DT  C "C5'" 
1405 C "C4'" . DT  C 3  ? 2.1579 2.9420 2.4402 -0.3118 -0.1958 0.0149  3   DT  C "C4'" 
1406 O "O4'" . DT  C 3  ? 2.2756 2.9484 2.4858 -0.3487 -0.1982 -0.0436 3   DT  C "O4'" 
1407 C "C3'" . DT  C 3  ? 1.8295 2.5101 2.1338 -0.2659 -0.2194 0.0431  3   DT  C "C3'" 
1408 O "O3'" . DT  C 3  ? 1.7159 2.5208 2.0964 -0.2271 -0.2221 0.0789  3   DT  C "O3'" 
1409 C "C2'" . DT  C 3  ? 1.6857 2.2304 1.9409 -0.2740 -0.2363 -0.0014 3   DT  C "C2'" 
1410 C "C1'" . DT  C 3  ? 1.6088 2.1843 1.8170 -0.3232 -0.2187 -0.0553 3   DT  C "C1'" 
1411 N N1    . DT  C 3  ? 1.5717 1.9790 1.7001 -0.3507 -0.2210 -0.1003 3   DT  C N1    
1412 C C2    . DT  C 3  ? 2.2005 2.5602 2.3009 -0.3576 -0.2213 -0.1419 3   DT  C C2    
1413 O O2    . DT  C 3  ? 2.3952 2.8413 2.5316 -0.3437 -0.2213 -0.1460 3   DT  C O2    
1414 N N3    . DT  C 3  ? 2.3491 2.5515 2.3761 -0.3805 -0.2192 -0.1782 3   DT  C N3    
1415 C C4    . DT  C 3  ? 2.2456 2.3393 2.2266 -0.3983 -0.2197 -0.1784 3   DT  C C4    
1416 O O4    . DT  C 3  ? 2.0348 1.9913 1.9521 -0.4171 -0.2169 -0.2117 3   DT  C O4    
1417 C C5    . DT  C 3  ? 2.1634 2.3141 2.1762 -0.3915 -0.2210 -0.1353 3   DT  C C5    
1418 C C7    . DT  C 3  ? 2.5539 2.5948 2.5208 -0.4095 -0.2208 -0.1314 3   DT  C C7    
1419 C C6    . DT  C 3  ? 1.6336 1.9346 1.7168 -0.3678 -0.2200 -0.0983 3   DT  C C6    
1432 P P     . DG  C 4  ? 2.1258 2.8788 2.5465 -0.1779 -0.2379 0.1283  4   DG  C P     
1433 O OP1   . DG  C 4  ? 1.9154 2.8350 2.4147 -0.1471 -0.2283 0.1676  4   DG  C OP1   
1434 O OP2   . DG  C 4  ? 2.3004 2.9279 2.6827 -0.1836 -0.2357 0.1455  4   DG  C OP2   
1435 O "O5'" . DG  C 4  ? 1.4122 2.0627 1.8179 -0.1639 -0.2658 0.1041  4   DG  C "O5'" 
1436 C "C5'" . DG  C 4  ? 1.6512 2.3876 2.0835 -0.1579 -0.2700 0.0824  4   DG  C "C5'" 
1437 C "C4'" . DG  C 4  ? 1.6410 2.2515 2.0371 -0.1534 -0.2901 0.0525  4   DG  C "C4'" 
1438 O "O4'" . DG  C 4  ? 1.8269 2.3209 2.1461 -0.1925 -0.2832 0.0096  4   DG  C "O4'" 
1439 C "C3'" . DG  C 4  ? 1.5427 2.0466 1.9459 -0.1189 -0.3149 0.0846  4   DG  C "C3'" 
1440 O "O3'" . DG  C 4  ? 1.1856 1.6790 1.6033 -0.0951 -0.3321 0.0765  4   DG  C "O3'" 
1441 C "C2'" . DG  C 4  ? 1.9657 2.3065 2.2976 -0.1437 -0.3173 0.0679  4   DG  C "C2'" 
1442 C "C1'" . DG  C 4  ? 1.6543 1.9872 1.9393 -0.1799 -0.3027 0.0127  4   DG  C "C1'" 
1443 N N9    . DG  C 4  ? 1.6308 1.8458 1.8460 -0.2154 -0.2948 -0.0128 4   DG  C N9    
1444 C C8    . DG  C 4  ? 1.8362 2.0132 2.0337 -0.2293 -0.2893 0.0050  4   DG  C C8    
1445 N N7    . DG  C 4  ? 1.8583 1.9253 1.9897 -0.2616 -0.2838 -0.0263 4   DG  C N7    
1446 C C5    . DG  C 4  ? 2.1755 2.2016 2.2776 -0.2690 -0.2835 -0.0671 4   DG  C C5    
1447 C C6    . DG  C 4  ? 2.6016 2.5105 2.6321 -0.2991 -0.2752 -0.1120 4   DG  C C6    
1448 O O6    . DG  C 4  ? 2.9514 2.7708 2.9305 -0.3267 -0.2695 -0.1257 4   DG  C O6    
1449 N N1    . DG  C 4  ? 2.5466 2.4448 2.5665 -0.2945 -0.2711 -0.1422 4   DG  C N1    
1450 C C2    . DG  C 4  ? 2.3829 2.3743 2.4559 -0.2647 -0.2770 -0.1305 4   DG  C C2    
1451 N N2    . DG  C 4  ? 2.5128 2.4722 2.5635 -0.2640 -0.2685 -0.1631 4   DG  C N2    
1452 N N3    . DG  C 4  ? 1.8412 1.9467 1.9836 -0.2368 -0.2880 -0.0891 4   DG  C N3    
1453 C C4    . DG  C 4  ? 1.8746 1.9895 2.0269 -0.2407 -0.2896 -0.0591 4   DG  C C4    
1465 P P     . DA  C 5  ? 1.5133 2.0278 1.9872 -0.0478 -0.3548 0.1221  5   DA  C P     
1466 O OP1   . DA  C 5  ? 1.2595 1.9411 1.8031 -0.0306 -0.3448 0.1475  5   DA  C OP1   
1467 O OP2   . DA  C 5  ? 2.0902 2.4798 2.5384 -0.0434 -0.3679 0.1486  5   DA  C OP2   
1468 O "O5'" . DA  C 5  ? 0.9277 1.4068 1.3957 -0.0315 -0.3701 0.1006  5   DA  C "O5'" 
1469 C "C5'" . DA  C 5  ? 1.3309 1.8793 1.7984 -0.0438 -0.3564 0.0621  5   DA  C "C5'" 
1470 C "C4'" . DA  C 5  ? 1.5336 1.9544 1.9387 -0.0556 -0.3558 0.0239  5   DA  C "C4'" 
1471 O "O4'" . DA  C 5  ? 1.7962 2.1163 2.1373 -0.0925 -0.3439 0.0016  5   DA  C "O4'" 
1472 C "C3'" . DA  C 5  ? 1.4663 1.7870 1.8686 -0.0212 -0.3808 0.0465  5   DA  C "C3'" 
1473 O "O3'" . DA  C 5  ? 1.3403 1.6468 1.7322 -0.0104 -0.3770 0.0215  5   DA  C "O3'" 
1474 C "C2'" . DA  C 5  ? 1.7494 1.9207 2.0916 -0.0397 -0.3839 0.0448  5   DA  C "C2'" 
1475 C "C1'" . DA  C 5  ? 1.7332 1.8989 2.0290 -0.0854 -0.3564 0.0004  5   DA  C "C1'" 
1476 N N9    . DA  C 5  ? 1.7769 1.8521 2.0295 -0.1108 -0.3541 0.0016  5   DA  C N9    
1477 C C8    . DA  C 5  ? 1.7146 1.8103 1.9867 -0.1117 -0.3585 0.0348  5   DA  C C8    
1478 N N7    . DA  C 5  ? 1.6611 1.6573 1.8826 -0.1380 -0.3539 0.0268  5   DA  C N7    
1479 C C5    . DA  C 5  ? 2.0740 1.9802 2.2399 -0.1555 -0.3464 -0.0147 5   DA  C C5    
1480 C C6    . DA  C 5  ? 2.5639 2.3439 2.6612 -0.1853 -0.3384 -0.0417 5   DA  C C6    
1481 N N6    . DA  C 5  ? 2.6830 2.4068 2.7566 -0.2038 -0.3392 -0.0305 5   DA  C N6    
1482 N N1    . DA  C 5  ? 2.7377 2.4483 2.7904 -0.1947 -0.3270 -0.0802 5   DA  C N1    
1483 C C2    . DA  C 5  ? 2.6337 2.3963 2.7079 -0.1759 -0.3232 -0.0910 5   DA  C C2    
1484 N N3    . DA  C 5  ? 2.3150 2.1969 2.4530 -0.1481 -0.3319 -0.0687 5   DA  C N3    
1485 C C4    . DA  C 5  ? 1.9894 1.9402 2.1721 -0.1390 -0.3443 -0.0305 5   DA  C C4    
1497 P P     . DA  C 6  ? 1.6279 1.8666 2.0283 0.0320  -0.4006 0.0478  6   DA  C P     
1498 O OP1   . DA  C 6  ? 1.9348 2.2309 2.3532 0.0484  -0.3923 0.0293  6   DA  C OP1   
1499 O OP2   . DA  C 6  ? 1.4199 1.6804 1.8631 0.0568  -0.4270 0.0998  6   DA  C OP2   
1500 O "O5'" . DA  C 6  ? 1.8251 1.8943 2.1508 0.0177  -0.3963 0.0310  6   DA  C "O5'" 
1501 C "C5'" . DA  C 6  ? 1.9602 1.9744 2.2297 -0.0102 -0.3673 -0.0198 6   DA  C "C5'" 
1502 C "C4'" . DA  C 6  ? 2.0711 1.9268 2.2731 -0.0248 -0.3633 -0.0297 6   DA  C "C4'" 
1503 O "O4'" . DA  C 6  ? 1.9664 1.8046 2.1533 -0.0544 -0.3657 -0.0262 6   DA  C "O4'" 
1504 C "C3'" . DA  C 6  ? 2.1876 1.9547 2.3882 0.0111  -0.3869 0.0089  6   DA  C "C3'" 
1505 O "O3'" . DA  C 6  ? 1.9797 1.6487 2.1340 0.0189  -0.3691 -0.0119 6   DA  C "O3'" 
1506 C "C2'" . DA  C 6  ? 2.4697 2.1645 2.6482 -0.0061 -0.4011 0.0285  6   DA  C "C2'" 
1507 C "C1'" . DA  C 6  ? 2.2432 1.9488 2.3916 -0.0518 -0.3777 -0.0106 6   DA  C "C1'" 
1508 N N9    . DA  C 6  ? 2.4294 2.1264 2.5785 -0.0696 -0.3883 0.0095  6   DA  C N9    
1509 C C8    . DA  C 6  ? 2.4730 2.2563 2.6739 -0.0595 -0.4029 0.0451  6   DA  C C8    
1510 N N7    . DA  C 6  ? 2.4242 2.1670 2.6078 -0.0801 -0.4048 0.0566  6   DA  C N7    
1511 C C5    . DA  C 6  ? 2.5377 2.1636 2.6559 -0.1057 -0.3939 0.0262  6   DA  C C5    
1512 C C6    . DA  C 6  ? 2.6262 2.1609 2.6979 -0.1353 -0.3905 0.0204  6   DA  C C6    
1513 N N6    . DA  C 6  ? 2.5743 2.1200 2.6576 -0.1443 -0.3962 0.0465  6   DA  C N6    
1514 N N1    . DA  C 6  ? 2.7140 2.1421 2.7252 -0.1549 -0.3784 -0.0130 6   DA  C N1    
1515 C C2    . DA  C 6  ? 2.7311 2.1410 2.7272 -0.1451 -0.3669 -0.0383 6   DA  C C2    
1516 N N3    . DA  C 6  ? 2.4410 1.9263 2.4747 -0.1179 -0.3668 -0.0360 6   DA  C N3    
1517 C C4    . DA  C 6  ? 2.4696 2.0648 2.5655 -0.0994 -0.3827 -0.0029 6   DA  C C4    
1529 P P     . DT  C 7  ? 2.3148 1.8987 2.4650 0.0594  -0.3876 0.0286  7   DT  C P     
1530 O OP1   . DT  C 7  ? 2.5383 2.1054 2.6782 0.0834  -0.3660 0.0135  7   DT  C OP1   
1531 O OP2   . DT  C 7  ? 2.0758 1.7216 2.2806 0.0820  -0.4247 0.0809  7   DT  C OP2   
1532 O "O5'" . DT  C 7  ? 2.5527 1.9951 2.6382 0.0363  -0.3815 0.0209  7   DT  C "O5'" 
1533 C "C5'" . DT  C 7  ? 2.7815 2.1430 2.8043 0.0079  -0.3455 -0.0289 7   DT  C "C5'" 
1534 C "C4'" . DT  C 7  ? 2.6611 1.9017 2.6313 -0.0146 -0.3455 -0.0306 7   DT  C "C4'" 
1535 O "O4'" . DT  C 7  ? 2.4752 1.7530 2.4580 -0.0430 -0.3623 -0.0245 7   DT  C "O4'" 
1536 C "C3'" . DT  C 7  ? 2.6870 1.8466 2.6520 0.0165  -0.3656 0.0150  7   DT  C "C3'" 
1537 O "O3'" . DT  C 7  ? 2.8492 1.8976 2.7613 0.0242  -0.3371 -0.0022 7   DT  C "O3'" 
1538 C "C2'" . DT  C 7  ? 2.6621 1.7854 2.6171 -0.0080 -0.3878 0.0327  7   DT  C "C2'" 
1539 C "C1'" . DT  C 7  ? 2.5451 1.7246 2.4995 -0.0485 -0.3772 -0.0024 7   DT  C "C1'" 
1540 N N1    . DT  C 7  ? 2.5437 1.7768 2.5318 -0.0578 -0.4036 0.0277  7   DT  C N1    
1541 C C2    . DT  C 7  ? 2.5204 1.6883 2.4753 -0.0890 -0.4063 0.0252  7   DT  C C2    
1542 O O2    . DT  C 7  ? 2.6520 1.7217 2.5520 -0.1103 -0.3907 -0.0009 7   DT  C O2    
1543 N N3    . DT  C 7  ? 2.1709 1.3904 2.1582 -0.0943 -0.4258 0.0550  7   DT  C N3    
1544 C C4    . DT  C 7  ? 2.1806 1.5068 2.2282 -0.0720 -0.4418 0.0860  7   DT  C C4    
1545 O O4    . DT  C 7  ? 2.4321 1.7894 2.5007 -0.0792 -0.4535 0.1113  7   DT  C O4    
1546 C C5    . DT  C 7  ? 2.0323 1.4261 2.1142 -0.0399 -0.4409 0.0866  7   DT  C C5    
1547 C C7    . DT  C 7  ? 2.0434 1.5555 2.1920 -0.0130 -0.4577 0.1186  7   DT  C C7    
1548 C C6    . DT  C 7  ? 2.3093 1.6539 2.3602 -0.0344 -0.4222 0.0579  7   DT  C C6    
1561 P P     . DG  C 8  ? 3.2505 2.2279 3.1591 0.0669  -0.3480 0.0464  8   DG  C P     
1562 O OP1   . DG  C 8  ? 3.4284 2.3244 3.2930 0.0814  -0.3061 0.0219  8   DG  C OP1   
1563 O OP2   . DG  C 8  ? 3.0867 2.1589 3.0591 0.1006  -0.3835 0.0971  8   DG  C OP2   
1564 O "O5'" . DG  C 8  ? 2.6285 1.5183 2.5040 0.0439  -0.3632 0.0607  8   DG  C "O5'" 
1565 C "C5'" . DG  C 8  ? 2.9495 1.7438 2.7640 0.0083  -0.3365 0.0182  8   DG  C "C5'" 
1566 C "C4'" . DG  C 8  ? 3.2319 1.9679 3.0288 -0.0125 -0.3596 0.0390  8   DG  C "C4'" 
1567 O "O4'" . DG  C 8  ? 2.8699 1.6888 2.7026 -0.0340 -0.3864 0.0474  8   DG  C "O4'" 
1568 C "C3'" . DG  C 8  ? 3.4378 2.1357 3.2427 0.0193  -0.3825 0.0965  8   DG  C "C3'" 
1569 O "O3'" . DG  C 8  ? 3.7570 2.3637 3.5153 0.0041  -0.3674 0.0927  8   DG  C "O3'" 
1570 C "C2'" . DG  C 8  ? 2.9426 1.7252 2.7961 0.0164  -0.4244 0.1354  8   DG  C "C2'" 
1571 C "C1'" . DG  C 8  ? 2.7106 1.5227 2.5603 -0.0263 -0.4208 0.0978  8   DG  C "C1'" 
1572 N N9    . DG  C 8  ? 2.6224 1.5426 2.5247 -0.0275 -0.4451 0.1181  8   DG  C N9    
1573 C C8    . DG  C 8  ? 2.4600 1.4847 2.4160 0.0009  -0.4547 0.1354  8   DG  C C8    
1574 N N7    . DG  C 8  ? 2.1727 1.2753 2.1663 -0.0079 -0.4736 0.1519  8   DG  C N7    
1575 C C5    . DG  C 8  ? 2.1891 1.2335 2.1509 -0.0443 -0.4752 0.1451  8   DG  C C5    
1576 C C6    . DG  C 8  ? 2.0833 1.1614 2.0599 -0.0670 -0.4870 0.1575  8   DG  C C6    
1577 O O6    . DG  C 8  ? 2.0955 1.2648 2.1181 -0.0589 -0.4979 0.1777  8   DG  C O6    
1578 N N1    . DG  C 8  ? 2.3057 1.2957 2.2358 -0.1012 -0.4822 0.1449  8   DG  C N1    
1579 C C2    . DG  C 8  ? 2.8666 1.7770 2.7463 -0.1101 -0.4614 0.1200  8   DG  C C2    
1580 N N2    . DG  C 8  ? 3.2628 2.1669 3.1113 -0.1353 -0.4387 0.1049  8   DG  C N2    
1581 N N3    . DG  C 8  ? 2.8746 1.7343 2.7384 -0.0902 -0.4540 0.1105  8   DG  C N3    
1582 C C4    . DG  C 8  ? 2.6427 1.5769 2.5492 -0.0572 -0.4596 0.1237  8   DG  C C4    
1594 P P     . DG  C 9  ? 3.4724 2.0862 3.2385 0.0313  -0.3661 0.1435  9   DG  C P     
1595 O OP1   . DG  C 9  ? 3.9222 2.4535 3.6463 0.0376  -0.3227 0.1263  9   DG  C OP1   
1596 O OP2   . DG  C 9  ? 3.2026 1.8767 3.0143 0.0703  -0.3946 0.1910  9   DG  C OP2   
1597 O "O5'" . DG  C 9  ? 3.1768 1.8403 2.9494 -0.0016 -0.3800 0.1539  9   DG  C "O5'" 
1598 C "C5'" . DG  C 9  ? 3.3512 1.9928 3.0941 -0.0393 -0.3584 0.1151  9   DG  C "C5'" 
1599 C "C4'" . DG  C 9  ? 3.4067 2.1077 3.1633 -0.0627 -0.3762 0.1304  9   DG  C "C4'" 
1600 O "O4'" . DG  C 9  ? 3.2686 2.0288 3.0571 -0.0686 -0.4051 0.1374  9   DG  C "O4'" 
1601 C "C3'" . DG  C 9  ? 3.6993 2.4235 3.4674 -0.0489 -0.3892 0.1751  9   DG  C "C3'" 
1602 O "O3'" . DG  C 9  ? 3.8992 2.6356 3.6543 -0.0751 -0.3833 0.1711  9   DG  C "O3'" 
1603 C "C2'" . DG  C 9  ? 3.5288 2.3219 3.3374 -0.0377 -0.4245 0.2069  9   DG  C "C2'" 
1604 C "C1'" . DG  C 9  ? 3.2408 2.0576 3.0558 -0.0629 -0.4300 0.1787  9   DG  C "C1'" 
1605 N N9    . DG  C 9  ? 3.0307 1.9049 2.8877 -0.0512 -0.4583 0.1977  9   DG  C N9    
1606 C C8    . DG  C 9  ? 3.1203 2.0098 3.0058 -0.0172 -0.4717 0.2158  9   DG  C C8    
1607 N N7    . DG  C 9  ? 3.0117 1.9696 2.9390 -0.0128 -0.4956 0.2318  9   DG  C N7    
1608 C C5    . DG  C 9  ? 2.8493 1.8288 2.7720 -0.0471 -0.4962 0.2238  9   DG  C C5    
1609 C C6    . DG  C 9  ? 2.6474 1.6919 2.6028 -0.0576 -0.5116 0.2354  9   DG  C C6    
1610 O O6    . DG  C 9  ? 2.5719 1.6778 2.5719 -0.0385 -0.5298 0.2556  9   DG  C O6    
1611 N N1    . DG  C 9  ? 2.4513 1.4922 2.3844 -0.0906 -0.4993 0.2221  9   DG  C N1    
1612 C C2    . DG  C 9  ? 2.5159 1.5088 2.4050 -0.1088 -0.4765 0.2004  9   DG  C C2    
1613 N N2    . DG  C 9  ? 2.6965 1.7029 2.5718 -0.1339 -0.4640 0.1914  9   DG  C N2    
1614 N N3    . DG  C 9  ? 2.3680 1.3067 2.2302 -0.0998 -0.4631 0.1900  9   DG  C N3    
1615 C C4    . DG  C 9  ? 2.7500 1.6807 2.6293 -0.0697 -0.4734 0.2025  9   DG  C C4    
1627 P P     . DG  C 10 ? 3.2549 1.9959 3.0078 -0.0695 -0.3878 0.2062  10  DG  C P     
1628 O OP1   . DG  C 10 ? 3.9113 2.5922 3.6373 -0.0679 -0.3557 0.1910  10  DG  C OP1   
1629 O OP2   . DG  C 10 ? 2.9221 1.6949 2.7014 -0.0419 -0.4106 0.2488  10  DG  C OP2   
1630 O "O5'" . DG  C 10 ? 3.1080 1.8983 2.8630 -0.1008 -0.4003 0.2062  10  DG  C "O5'" 
1631 C "C5'" . DG  C 10 ? 3.2054 2.0186 2.9590 -0.1243 -0.3951 0.1779  10  DG  C "C5'" 
1632 C "C4'" . DG  C 10 ? 3.1587 2.0324 2.9317 -0.1365 -0.4187 0.1970  10  DG  C "C4'" 
1633 O "O4'" . DG  C 10 ? 3.1908 2.0927 2.9920 -0.1244 -0.4374 0.2057  10  DG  C "O4'" 
1634 C "C3'" . DG  C 10 ? 3.0210 1.9155 2.7981 -0.1370 -0.4370 0.2317  10  DG  C "C3'" 
1635 O "O3'" . DG  C 10 ? 3.0840 2.0018 2.8509 -0.1621 -0.4354 0.2288  10  DG  C "O3'" 
1636 C "C2'" . DG  C 10 ? 3.0220 1.9594 2.8320 -0.1227 -0.4634 0.2598  10  DG  C "C2'" 
1637 C "C1'" . DG  C 10 ? 2.8900 1.8412 2.7139 -0.1239 -0.4619 0.2385  10  DG  C "C1'" 
1638 N N9    . DG  C 10 ? 2.4545 1.4343 2.3122 -0.1008 -0.4806 0.2568  10  DG  C N9    
1639 C C8    . DG  C 10 ? 2.5569 1.5192 2.4236 -0.0695 -0.4822 0.2687  10  DG  C C8    
1640 N N7    . DG  C 10 ? 2.5389 1.5470 2.4418 -0.0502 -0.4988 0.2849  10  DG  C N7    
1641 C C5    . DG  C 10 ? 2.6644 1.7196 2.5834 -0.0720 -0.5089 0.2840  10  DG  C C5    
1642 C C6    . DG  C 10 ? 2.5191 1.6394 2.4792 -0.0644 -0.5247 0.2982  10  DG  C C6    
1643 O O6    . DG  C 10 ? 2.1479 1.3067 2.1410 -0.0351 -0.5343 0.3134  10  DG  C O6    
1644 N N1    . DG  C 10 ? 2.1933 1.3388 2.1549 -0.0917 -0.5241 0.2934  10  DG  C N1    
1645 C C2    . DG  C 10 ? 2.0111 1.1269 1.9380 -0.1201 -0.5094 0.2764  10  DG  C C2    
1646 N N2    . DG  C 10 ? 1.5760 0.7214 1.5076 -0.1391 -0.5052 0.2753  10  DG  C N2    
1647 N N3    . DG  C 10 ? 2.2073 1.2716 2.0982 -0.1262 -0.4955 0.2621  10  DG  C N3    
1648 C C4    . DG  C 10 ? 2.4299 1.4650 2.3195 -0.1025 -0.4967 0.2671  10  DG  C C4    
1660 P P     . DC  C 11 ? 2.9515 1.8865 2.7148 -0.1725 -0.4529 0.2589  11  DC  C P     
1661 O OP1   . DC  C 11 ? 3.4767 2.4026 3.2156 -0.1931 -0.4370 0.2432  11  DC  C OP1   
1662 O OP2   . DC  C 11 ? 3.0227 1.9413 2.7926 -0.1503 -0.4623 0.2865  11  DC  C OP2   
1663 O "O5'" . DC  C 11 ? 2.5916 1.5817 2.3772 -0.1817 -0.4744 0.2761  11  DC  C "O5'" 
1664 C "C5'" . DC  C 11 ? 2.7633 1.7762 2.5471 -0.1982 -0.4647 0.2591  11  DC  C "C5'" 
1665 C "C4'" . DC  C 11 ? 2.6938 1.7542 2.5021 -0.2022 -0.4838 0.2794  11  DC  C "C4'" 
1666 O "O4'" . DC  C 11 ? 2.7255 1.7978 2.5635 -0.1799 -0.4933 0.2846  11  DC  C "O4'" 
1667 C "C3'" . DC  C 11 ? 2.9363 2.0186 2.7483 -0.2113 -0.5070 0.3115  11  DC  C "C3'" 
1668 O "O3'" . DC  C 11 ? 3.0691 2.1675 2.8653 -0.2379 -0.5054 0.3123  11  DC  C "O3'" 
1669 C "C2'" . DC  C 11 ? 2.9976 2.1196 2.8472 -0.1950 -0.5255 0.3337  11  DC  C "C2'" 
1670 C "C1'" . DC  C 11 ? 2.7352 1.8534 2.6004 -0.1778 -0.5149 0.3132  11  DC  C "C1'" 
1671 N N1    . DC  C 11 ? 2.3384 1.4679 2.2324 -0.1470 -0.5255 0.3274  11  DC  C N1    
1672 C C2    . DC  C 11 ? 2.2541 1.4346 2.1859 -0.1349 -0.5359 0.3396  11  DC  C C2    
1673 O O2    . DC  C 11 ? 2.0700 1.2806 2.0103 -0.1515 -0.5359 0.3390  11  DC  C O2    
1674 N N3    . DC  C 11 ? 2.5211 1.7189 2.4788 -0.1021 -0.5417 0.3519  11  DC  C N3    
1675 C C4    . DC  C 11 ? 2.5170 1.6765 2.4614 -0.0816 -0.5361 0.3535  11  DC  C C4    
1676 N N4    . DC  C 11 ? 2.6624 1.8415 2.6307 -0.0453 -0.5376 0.3657  11  DC  C N4    
1677 C C5    . DC  C 11 ? 2.3028 1.4042 2.2086 -0.0948 -0.5248 0.3427  11  DC  C C5    
1678 C C6    . DC  C 11 ? 2.2348 1.3269 2.1182 -0.1276 -0.5209 0.3295  11  DC  C C6    
1690 P P     . DC  C 12 ? 2.7024 1.8212 2.4936 -0.2579 -0.5288 0.3428  12  DC  C P     
1691 O OP1   . DC  C 12 ? 3.3811 2.4902 3.1392 -0.2840 -0.5175 0.3320  12  DC  C OP1   
1692 O OP2   . DC  C 12 ? 2.6773 1.7864 2.4762 -0.2431 -0.5422 0.3645  12  DC  C OP2   
1693 O "O5'" . DC  C 12 ? 2.4606 1.6286 2.2817 -0.2594 -0.5433 0.3613  12  DC  C "O5'" 
1694 C "C5'" . DC  C 12 ? 2.6157 1.7989 2.4373 -0.2677 -0.5293 0.3484  12  DC  C "C5'" 
1695 C "C4'" . DC  C 12 ? 2.7884 2.0190 2.6444 -0.2642 -0.5441 0.3696  12  DC  C "C4'" 
1696 O "O4'" . DC  C 12 ? 2.8693 2.1122 2.7602 -0.2331 -0.5494 0.3729  12  DC  C "O4'" 
1697 C "C3'" . DC  C 12 ? 2.8978 2.1571 2.7563 -0.2824 -0.5677 0.4006  12  DC  C "C3'" 
1698 O "O3'" . DC  C 12 ? 3.0777 2.3578 2.9277 -0.3064 -0.5658 0.4051  12  DC  C "O3'" 
1699 C "C2'" . DC  C 12 ? 2.8282 2.1243 2.7291 -0.2553 -0.5808 0.4224  12  DC  C "C2'" 
1700 C "C1'" . DC  C 12 ? 2.7260 2.0146 2.6470 -0.2255 -0.5675 0.4023  12  DC  C "C1'" 
1701 N N1    . DC  C 12 ? 2.1798 1.4676 2.1200 -0.1905 -0.5701 0.4091  12  DC  C N1    
1702 C C2    . DC  C 12 ? 2.1963 1.5323 2.1759 -0.1612 -0.5726 0.4218  12  DC  C C2    
1703 O O2    . DC  C 12 ? 2.1066 1.4871 2.1081 -0.1663 -0.5739 0.4281  12  DC  C O2    
1704 N N3    . DC  C 12 ? 2.1249 1.4591 2.1159 -0.1252 -0.5702 0.4269  12  DC  C N3    
1705 C C4    . DC  C 12 ? 2.3481 1.6288 2.3131 -0.1198 -0.5654 0.4209  12  DC  C C4    
1706 N N4    . DC  C 12 ? 2.5323 1.8068 2.5057 -0.0821 -0.5595 0.4271  12  DC  C N4    
1707 C C5    . DC  C 12 ? 2.4895 1.7213 2.4169 -0.1507 -0.5629 0.4077  12  DC  C C5    
1708 C C6    . DC  C 12 ? 2.2027 1.4430 2.1191 -0.1843 -0.5654 0.4016  12  DC  C C6    
1721 N N     . THR D 8  ? 3.2795 2.0705 1.2983 -0.5287 0.4686  0.0209  100 THR D N     
1722 C CA    . THR D 8  ? 3.6209 2.4623 1.6588 -0.5633 0.4391  0.0319  100 THR D CA    
1723 C C     . THR D 8  ? 3.5450 2.4266 1.6415 -0.5321 0.4292  0.0227  100 THR D C     
1724 O O     . THR D 8  ? 3.4028 2.2848 1.5353 -0.4766 0.4360  0.0119  100 THR D O     
1725 C CB    . THR D 8  ? 3.4583 2.3454 1.5193 -0.5665 0.3998  0.0560  100 THR D CB    
1726 O OG1   . THR D 8  ? 3.6370 2.5025 1.6849 -0.5874 0.4024  0.0597  100 THR D OG1   
1727 C CG2   . THR D 8  ? 2.9863 1.9238 1.0727 -0.6017 0.3632  0.0670  100 THR D CG2   
1734 N N     . VAL D 9  ? 3.4219 2.3336 1.5266 -0.5685 0.4130  0.0267  101 VAL D N     
1735 C CA    . VAL D 9  ? 3.4348 2.3878 1.5979 -0.5442 0.4015  0.0203  101 VAL D CA    
1736 C C     . VAL D 9  ? 3.3738 2.3726 1.5523 -0.5847 0.3640  0.0383  101 VAL D C     
1737 O O     . VAL D 9  ? 3.3853 2.3670 1.5126 -0.6427 0.3608  0.0472  101 VAL D O     
1738 C CB    . VAL D 9  ? 3.4108 2.3285 1.5590 -0.5460 0.4436  -0.0077 101 VAL D CB    
1739 C CG1   . VAL D 9  ? 3.3514 2.2289 1.4258 -0.6141 0.4684  -0.0134 101 VAL D CG1   
1740 C CG2   . VAL D 9  ? 2.9789 1.9416 1.1907 -0.5247 0.4321  -0.0142 101 VAL D CG2   
1750 N N     . PHE D 10 ? 2.9831 2.0377 1.2330 -0.5539 0.3334  0.0435  102 PHE D N     
1751 C CA    . PHE D 10 ? 2.7847 1.8848 1.0587 -0.5876 0.2913  0.0619  102 PHE D CA    
1752 C C     . PHE D 10 ? 2.8072 1.9033 1.0739 -0.6173 0.3058  0.0537  102 PHE D C     
1753 O O     . PHE D 10 ? 2.9469 2.0234 1.2175 -0.5956 0.3423  0.0316  102 PHE D O     
1754 C CB    . PHE D 10 ? 3.1580 2.3255 1.5186 -0.5409 0.2448  0.0730  102 PHE D CB    
1755 C CG    . PHE D 10 ? 3.0876 2.2607 1.4772 -0.4779 0.2485  0.0673  102 PHE D CG    
1756 C CD1   . PHE D 10 ? 2.5177 1.6997 0.9006 -0.4751 0.2313  0.0790  102 PHE D CD1   
1757 C CD2   . PHE D 10 ? 2.8947 2.0648 1.3193 -0.4220 0.2679  0.0497  102 PHE D CD2   
1758 C CE1   . PHE D 10 ? 2.8507 2.0371 1.2543 -0.4198 0.2353  0.0752  102 PHE D CE1   
1759 C CE2   . PHE D 10 ? 2.4997 1.6715 0.9456 -0.3647 0.2687  0.0458  102 PHE D CE2   
1760 C CZ    . PHE D 10 ? 2.9041 2.0837 1.3364 -0.3644 0.2530  0.0596  102 PHE D CZ    
1770 N N     . SER D 11 ? 2.9814 2.0962 1.2386 -0.6677 0.2759  0.0711  103 SER D N     
1771 C CA    . SER D 11 ? 2.8995 2.0104 1.1408 -0.7057 0.2874  0.0676  103 SER D CA    
1772 C C     . SER D 11 ? 2.6473 1.8031 0.9699 -0.6625 0.2773  0.0623  103 SER D C     
1773 O O     . SER D 11 ? 2.6194 1.8151 1.0129 -0.6067 0.2510  0.0652  103 SER D O     
1774 C CB    . SER D 11 ? 3.0664 2.1835 1.2749 -0.7709 0.2509  0.0913  103 SER D CB    
1775 O OG    . SER D 11 ? 3.0148 2.1864 1.2893 -0.7544 0.1919  0.1122  103 SER D OG    
1781 N N     . SER D 12 ? 3.1594 2.3090 1.4711 -0.6895 0.2989  0.0536  104 SER D N     
1782 C CA    . SER D 12 ? 3.1491 2.3391 1.5371 -0.6554 0.2923  0.0475  104 SER D CA    
1783 C C     . SER D 12 ? 3.0977 2.3455 1.5487 -0.6534 0.2292  0.0747  104 SER D C     
1784 O O     . SER D 12 ? 2.8861 2.1785 1.4226 -0.6015 0.2084  0.0725  104 SER D O     
1785 C CB    . SER D 12 ? 3.0067 2.1757 1.3612 -0.6954 0.3323  0.0324  104 SER D CB    
1786 O OG    . SER D 12 ? 3.1619 2.3682 1.5930 -0.6619 0.3304  0.0237  104 SER D OG    
1792 N N     . THR D 13 ? 3.0184 2.2645 1.4301 -0.7083 0.1963  0.0988  105 THR D N     
1793 C CA    . THR D 13 ? 2.7818 2.0795 1.2520 -0.7110 0.1312  0.1243  105 THR D CA    
1794 C C     . THR D 13 ? 3.0000 2.3416 1.5482 -0.6443 0.0999  0.1241  105 THR D C     
1795 O O     . THR D 13 ? 3.3494 2.7446 1.9814 -0.6130 0.0596  0.1313  105 THR D O     
1796 C CB    . THR D 13 ? 2.9961 2.2777 1.4082 -0.7775 0.0985  0.1477  105 THR D CB    
1797 O OG1   . THR D 13 ? 3.2723 2.5241 1.6378 -0.7789 0.1104  0.1435  105 THR D OG1   
1798 C CG2   . THR D 13 ? 3.1902 2.4326 1.5250 -0.8463 0.1220  0.1511  105 THR D CG2   
1806 N N     . GLN D 14 ? 2.7621 2.0810 1.2819 -0.6236 0.1185  0.1155  106 GLN D N     
1807 C CA    . GLN D 14 ? 2.6323 1.9893 1.2142 -0.5638 0.0933  0.1147  106 GLN D CA    
1808 C C     . GLN D 14 ? 2.6988 2.0668 1.3333 -0.4945 0.1170  0.0939  106 GLN D C     
1809 O O     . GLN D 14 ? 2.7716 2.1922 1.4893 -0.4442 0.0838  0.0946  106 GLN D O     
1810 C CB    . GLN D 14 ? 2.7024 2.0291 1.2306 -0.5714 0.1049  0.1150  106 GLN D CB    
1811 C CG    . GLN D 14 ? 2.6650 1.9838 1.1505 -0.6344 0.0758  0.1335  106 GLN D CG    
1812 C CD    . GLN D 14 ? 2.7483 2.0467 1.1973 -0.6359 0.0826  0.1333  106 GLN D CD    
1813 O OE1   . GLN D 14 ? 2.5276 1.7801 0.9267 -0.6270 0.1294  0.1204  106 GLN D OE1   
1814 N NE2   . GLN D 14 ? 2.5797 1.9129 1.0574 -0.6474 0.0349  0.1464  106 GLN D NE2   
1823 N N     . LEU D 15 ? 2.4790 1.7970 1.0674 -0.4918 0.1727  0.0737  107 LEU D N     
1824 C CA    . LEU D 15 ? 2.5087 1.8274 1.1415 -0.4276 0.1975  0.0509  107 LEU D CA    
1825 C C     . LEU D 15 ? 2.5844 1.9524 1.3015 -0.4025 0.1744  0.0494  107 LEU D C     
1826 O O     . LEU D 15 ? 2.7212 2.1178 1.5082 -0.3376 0.1650  0.0383  107 LEU D O     
1827 C CB    . LEU D 15 ? 2.4586 1.7149 1.0300 -0.4405 0.2589  0.0274  107 LEU D CB    
1828 C CG    . LEU D 15 ? 2.6513 1.8999 1.2662 -0.3792 0.2872  -0.0005 107 LEU D CG    
1829 C CD1   . LEU D 15 ? 2.8081 2.0697 1.4600 -0.3126 0.2701  -0.0014 107 LEU D CD1   
1830 C CD2   . LEU D 15 ? 2.8737 2.0594 1.4262 -0.3986 0.3456  -0.0256 107 LEU D CD2   
1842 N N     . CYS D 16 ? 2.3479 1.7249 1.0574 -0.4551 0.1628  0.0617  108 CYS D N     
1843 C CA    . CYS D 16 ? 2.6772 2.1008 1.4652 -0.4405 0.1379  0.0642  108 CYS D CA    
1844 C C     . CYS D 16 ? 2.4613 1.9488 1.3369 -0.3965 0.0776  0.0772  108 CYS D C     
1845 O O     . CYS D 16 ? 2.6012 2.1199 1.5524 -0.3331 0.0703  0.0640  108 CYS D O     
1846 C CB    . CYS D 16 ? 2.9616 2.3793 1.7146 -0.5131 0.1327  0.0802  108 CYS D CB    
1847 S SG    . CYS D 16 ? 3.6285 3.1028 2.4792 -0.4996 0.0998  0.0867  108 CYS D SG    
1853 N N     . VAL D 17 ? 2.3608 1.8682 1.2292 -0.4297 0.0333  0.1008  109 VAL D N     
1854 C CA    . VAL D 17 ? 2.6893 2.2612 1.6431 -0.3938 -0.0272 0.1114  109 VAL D CA    
1855 C C     . VAL D 17 ? 2.5485 2.1344 1.5357 -0.3220 -0.0219 0.0955  109 VAL D C     
1856 O O     . VAL D 17 ? 2.5945 2.2342 1.6694 -0.2680 -0.0560 0.0918  109 VAL D O     
1857 C CB    . VAL D 17 ? 2.5478 2.1316 1.4809 -0.4423 -0.0722 0.1347  109 VAL D CB    
1858 C CG1   . VAL D 17 ? 2.5026 2.0421 1.3530 -0.4635 -0.0457 0.1330  109 VAL D CG1   
1859 C CG2   . VAL D 17 ? 2.5236 2.1789 1.5538 -0.4045 -0.1362 0.1415  109 VAL D CG2   
1869 N N     . LEU D 18 ? 2.3487 1.8848 1.2648 -0.3219 0.0203  0.0860  110 LEU D N     
1870 C CA    . LEU D 18 ? 2.2748 1.8127 1.2078 -0.2577 0.0309  0.0719  110 LEU D CA    
1871 C C     . LEU D 18 ? 2.2525 1.8025 1.2480 -0.1968 0.0425  0.0519  110 LEU D C     
1872 O O     . LEU D 18 ? 2.5155 2.1118 1.5840 -0.1383 0.0125  0.0474  110 LEU D O     
1873 C CB    . LEU D 18 ? 2.3543 1.8267 1.1947 -0.2743 0.0783  0.0658  110 LEU D CB    
1874 C CG    . LEU D 18 ? 2.4704 1.9447 1.2778 -0.2887 0.0626  0.0782  110 LEU D CG    
1875 C CD1   . LEU D 18 ? 2.4630 1.9647 1.2724 -0.3446 0.0211  0.0986  110 LEU D CD1   
1876 C CD2   . LEU D 18 ? 2.4620 1.8662 1.1774 -0.3096 0.1121  0.0724  110 LEU D CD2   
1888 N N     . ASN D 19 ? 2.1202 1.6301 1.0897 -0.2101 0.0853  0.0378  111 ASN D N     
1889 C CA    . ASN D 19 ? 2.0951 1.6145 1.1276 -0.1557 0.0974  0.0159  111 ASN D CA    
1890 C C     . ASN D 19 ? 2.0214 1.6085 1.1541 -0.1325 0.0493  0.0223  111 ASN D C     
1891 O O     . ASN D 19 ? 2.2718 1.8889 1.4784 -0.0666 0.0353  0.0085  111 ASN D O     
1892 C CB    . ASN D 19 ? 2.2528 1.7238 1.2453 -0.1851 0.1498  -0.0014 111 ASN D CB    
1893 C CG    . ASN D 19 ? 2.6209 2.0262 1.5397 -0.1826 0.1992  -0.0182 111 ASN D CG    
1894 O OD1   . ASN D 19 ? 2.9127 2.3080 1.8328 -0.1344 0.1988  -0.0244 111 ASN D OD1   
1895 N ND2   . ASN D 19 ? 2.4450 1.8042 1.2985 -0.2350 0.2415  -0.0261 111 ASN D ND2   
1902 N N     . ASP D 20 ? 2.0883 1.6977 1.2235 -0.1866 0.0219  0.0432  112 ASP D N     
1903 C CA    . ASP D 20 ? 2.2752 1.9471 1.5049 -0.1719 -0.0273 0.0519  112 ASP D CA    
1904 C C     . ASP D 20 ? 2.3590 2.0855 1.6576 -0.1146 -0.0751 0.0533  112 ASP D C     
1905 O O     . ASP D 20 ? 2.6430 2.4129 2.0312 -0.0595 -0.0987 0.0432  112 ASP D O     
1906 C CB    . ASP D 20 ? 2.4959 2.1762 1.7060 -0.2446 -0.0541 0.0779  112 ASP D CB    
1907 C CG    . ASP D 20 ? 2.6170 2.3573 1.9253 -0.2333 -0.1050 0.0879  112 ASP D CG    
1908 O OD1   . ASP D 20 ? 2.4552 2.2485 1.8309 -0.2001 -0.1575 0.0941  112 ASP D OD1   
1909 O OD2   . ASP D 20 ? 2.7602 2.4953 2.0795 -0.2586 -0.0924 0.0887  112 ASP D OD2   
1914 N N     . ARG D 21 ? 2.3756 2.1015 1.6342 -0.1281 -0.0889 0.0640  113 ARG D N     
1915 C CA    . ARG D 21 ? 2.3185 2.0961 1.6347 -0.0767 -0.1294 0.0627  113 ARG D CA    
1916 C C     . ARG D 21 ? 1.9943 1.7643 1.3299 -0.0031 -0.1067 0.0400  113 ARG D C     
1917 O O     . ARG D 21 ? 2.0431 1.8646 1.4606 0.0552  -0.1400 0.0319  113 ARG D O     
1918 C CB    . ARG D 21 ? 2.1577 1.9298 1.4193 -0.1082 -0.1391 0.0751  113 ARG D CB    
1919 C CG    . ARG D 21 ? 1.7700 1.6023 1.0925 -0.0617 -0.1819 0.0725  113 ARG D CG    
1920 C CD    . ARG D 21 ? 2.0625 1.9672 1.4862 -0.0540 -0.2449 0.0789  113 ARG D CD    
1921 N NE    . ARG D 21 ? 1.6391 1.6050 1.1192 -0.0192 -0.2881 0.0751  113 ARG D NE    
1922 C CZ    . ARG D 21 ? 2.1222 2.1047 1.5864 -0.0534 -0.3121 0.0841  113 ARG D CZ    
1923 N NH1   . ARG D 21 ? 2.5157 2.4548 1.9068 -0.1225 -0.2990 0.0990  113 ARG D NH1   
1924 N NH2   . ARG D 21 ? 2.1408 2.1839 1.6634 -0.0180 -0.3491 0.0760  113 ARG D NH2   
1938 N N     . PHE D 22 ? 2.0124 1.7170 1.2729 -0.0058 -0.0524 0.0292  114 PHE D N     
1939 C CA    . PHE D 22 ? 1.8687 1.5550 1.1377 0.0609  -0.0307 0.0083  114 PHE D CA    
1940 C C     . PHE D 22 ? 1.9864 1.6992 1.3431 0.1129  -0.0398 -0.0093 114 PHE D C     
1941 O O     . PHE D 22 ? 2.1227 1.8598 1.5309 0.1803  -0.0568 -0.0219 114 PHE D O     
1942 C CB    . PHE D 22 ? 2.3244 1.9309 1.5013 0.0429  0.0282  -0.0012 114 PHE D CB    
1943 C CG    . PHE D 22 ? 2.5948 2.1742 1.7785 0.1094  0.0490  -0.0230 114 PHE D CG    
1944 C CD1   . PHE D 22 ? 2.4031 1.9790 1.5654 0.1453  0.0427  -0.0214 114 PHE D CD1   
1945 C CD2   . PHE D 22 ? 2.8438 2.4010 2.0564 0.1354  0.0734  -0.0455 114 PHE D CD2   
1946 C CE1   . PHE D 22 ? 2.2006 1.7470 1.3650 0.2058  0.0581  -0.0395 114 PHE D CE1   
1947 C CE2   . PHE D 22 ? 2.6366 2.1656 1.8577 0.1976  0.0880  -0.0665 114 PHE D CE2   
1948 C CZ    . PHE D 22 ? 2.1571 1.6788 1.3518 0.2328  0.0790  -0.0622 114 PHE D CZ    
1958 N N     . GLN D 23 ? 2.1590 1.8660 1.5313 0.0813  -0.0278 -0.0110 115 GLN D N     
1959 C CA    . GLN D 23 ? 2.3097 2.0388 1.7665 0.1260  -0.0318 -0.0294 115 GLN D CA    
1960 C C     . GLN D 23 ? 2.2607 2.0641 1.8220 0.1792  -0.0899 -0.0282 115 GLN D C     
1961 O O     . GLN D 23 ? 2.5494 2.3675 2.1761 0.2435  -0.0952 -0.0485 115 GLN D O     
1962 C CB    . GLN D 23 ? 2.5656 2.2876 2.0251 0.0724  -0.0159 -0.0262 115 GLN D CB    
1963 C CG    . GLN D 23 ? 2.8538 2.5931 2.3980 0.1133  -0.0118 -0.0479 115 GLN D CG    
1964 C CD    . GLN D 23 ? 3.1818 2.9156 2.7260 0.0562  0.0066  -0.0441 115 GLN D CD    
1965 O OE1   . GLN D 23 ? 3.4051 3.1234 2.8851 -0.0146 0.0119  -0.0233 115 GLN D OE1   
1966 N NE2   . GLN D 23 ? 3.1512 2.8975 2.7672 0.0861  0.0159  -0.0646 115 GLN D NE2   
1975 N N     . ARG D 24 ? 1.9154 1.7652 1.4954 0.1535  -0.1348 -0.0067 116 ARG D N     
1976 C CA    . ARG D 24 ? 2.1217 2.0469 1.8064 0.1985  -0.1937 -0.0064 116 ARG D CA    
1977 C C     . ARG D 24 ? 1.9532 1.9079 1.6417 0.2388  -0.2195 -0.0076 116 ARG D C     
1978 O O     . ARG D 24 ? 2.0109 2.0276 1.7863 0.2878  -0.2647 -0.0136 116 ARG D O     
1979 C CB    . ARG D 24 ? 2.4900 2.4557 2.2133 0.1477  -0.2349 0.0154  116 ARG D CB    
1980 C CG    . ARG D 24 ? 2.7748 2.7356 2.4357 0.0861  -0.2481 0.0380  116 ARG D CG    
1981 C CD    . ARG D 24 ? 2.8120 2.8133 2.5225 0.0426  -0.2968 0.0585  116 ARG D CD    
1982 N NE    . ARG D 24 ? 2.8020 2.8012 2.4624 -0.0140 -0.3170 0.0785  116 ARG D NE    
1983 C CZ    . ARG D 24 ? 2.6736 2.6195 2.2415 -0.0838 -0.2886 0.0927  116 ARG D CZ    
1984 N NH1   . ARG D 24 ? 2.4745 2.3664 1.9876 -0.1073 -0.2364 0.0885  116 ARG D NH1   
1985 N NH2   . ARG D 24 ? 2.7384 2.6857 2.2702 -0.1301 -0.3129 0.1089  116 ARG D NH2   
1999 N N     . GLN D 25 ? 1.7168 1.6289 1.3130 0.2175  -0.1907 -0.0028 117 GLN D N     
2000 C CA    . GLN D 25 ? 1.7755 1.7127 1.3654 0.2485  -0.2094 -0.0034 117 GLN D CA    
2001 C C     . GLN D 25 ? 1.6641 1.5345 1.1526 0.2460  -0.1608 -0.0061 117 GLN D C     
2002 O O     . GLN D 25 ? 1.7183 1.5461 1.1260 0.1874  -0.1343 0.0063  117 GLN D O     
2003 C CB    . GLN D 25 ? 1.5664 1.5507 1.1695 0.2065  -0.2511 0.0144  117 GLN D CB    
2004 C CG    . GLN D 25 ? 1.6118 1.6300 1.2144 0.2342  -0.2705 0.0116  117 GLN D CG    
2005 C CD    . GLN D 25 ? 1.7426 1.8154 1.3772 0.1970  -0.3171 0.0239  117 GLN D CD    
2006 O OE1   . GLN D 25 ? 1.7349 1.8236 1.4008 0.1559  -0.3428 0.0358  117 GLN D OE1   
2007 N NE2   . GLN D 25 ? 1.8657 1.9664 1.4924 0.2101  -0.3288 0.0206  117 GLN D NE2   
2016 N N     . LYS D 26 ? 1.8817 1.7416 1.3754 0.3102  -0.1516 -0.0222 118 LYS D N     
2017 C CA    . LYS D 26 ? 1.7327 1.5237 1.1354 0.3148  -0.1068 -0.0257 118 LYS D CA    
2018 C C     . LYS D 26 ? 1.8192 1.6190 1.1749 0.3102  -0.1127 -0.0156 118 LYS D C     
2019 O O     . LYS D 26 ? 1.8723 1.6126 1.1412 0.2949  -0.0755 -0.0120 118 LYS D O     
2020 C CB    . LYS D 26 ? 1.8861 1.6538 1.3120 0.3854  -0.0952 -0.0476 118 LYS D CB    
2021 C CG    . LYS D 26 ? 1.8369 1.5570 1.2635 0.3800  -0.0616 -0.0615 118 LYS D CG    
2022 C CD    . LYS D 26 ? 2.1719 1.9407 1.6873 0.3747  -0.0865 -0.0643 118 LYS D CD    
2023 C CE    . LYS D 26 ? 2.5607 2.2841 2.0769 0.3670  -0.0487 -0.0808 118 LYS D CE    
2024 N NZ    . LYS D 26 ? 2.6863 2.4572 2.2962 0.3708  -0.0722 -0.0856 118 LYS D NZ    
2038 N N     . TYR D 27 ? 1.6937 1.5679 1.1090 0.3233  -0.1588 -0.0124 119 TYR D N     
2039 C CA    . TYR D 27 ? 1.7006 1.5929 1.0805 0.3166  -0.1657 -0.0053 119 TYR D CA    
2040 C C     . TYR D 27 ? 1.7776 1.7271 1.1911 0.2699  -0.2023 0.0063  119 TYR D C     
2041 O O     . TYR D 27 ? 2.0126 2.0280 1.5172 0.2839  -0.2480 0.0028  119 TYR D O     
2042 C CB    . TYR D 27 ? 1.7691 1.6979 1.1860 0.3893  -0.1855 -0.0188 119 TYR D CB    
2043 C CG    . TYR D 27 ? 2.0674 1.9309 1.4340 0.4327  -0.1503 -0.0281 119 TYR D CG    
2044 C CD1   . TYR D 27 ? 1.9581 1.8057 1.3678 0.4764  -0.1488 -0.0432 119 TYR D CD1   
2045 C CD2   . TYR D 27 ? 1.7694 1.5849 1.0470 0.4290  -0.1199 -0.0221 119 TYR D CD2   
2046 C CE1   . TYR D 27 ? 1.7481 1.5334 1.1155 0.5166  -0.1205 -0.0536 119 TYR D CE1   
2047 C CE2   . TYR D 27 ? 1.8225 1.5738 1.0538 0.4678  -0.0919 -0.0296 119 TYR D CE2   
2048 C CZ    . TYR D 27 ? 2.0641 1.8001 1.3412 0.5121  -0.0936 -0.0460 119 TYR D CZ    
2049 O OH    . TYR D 27 ? 2.2723 1.9422 1.5072 0.5516  -0.0695 -0.0553 119 TYR D OH    
2059 N N     . LEU D 28 ? 1.6891 1.6115 1.0311 0.2150  -0.1838 0.0191  120 LEU D N     
2060 C CA    . LEU D 28 ? 1.8393 1.8030 1.2022 0.1627  -0.2156 0.0298  120 LEU D CA    
2061 C C     . LEU D 28 ? 1.9404 1.9428 1.2989 0.1656  -0.2290 0.0281  120 LEU D C     
2062 O O     . LEU D 28 ? 1.7412 1.7092 1.0357 0.1788  -0.1959 0.0268  120 LEU D O     
2063 C CB    . LEU D 28 ? 2.1279 2.0309 1.4158 0.0896  -0.1864 0.0447  120 LEU D CB    
2064 C CG    . LEU D 28 ? 1.9143 1.7976 1.2159 0.0619  -0.1852 0.0496  120 LEU D CG    
2065 C CD1   . LEU D 28 ? 1.9777 1.9287 1.3663 0.0485  -0.2428 0.0549  120 LEU D CD1   
2066 C CD2   . LEU D 28 ? 2.0616 1.9196 1.3787 0.1107  -0.1621 0.0364  120 LEU D CD2   
2078 N N     . SER D 29 ? 1.7088 1.7826 1.1372 0.1521  -0.2780 0.0272  121 SER D N     
2079 C CA    . SER D 29 ? 1.5816 1.7001 1.0153 0.1486  -0.2929 0.0223  121 SER D CA    
2080 C C     . SER D 29 ? 2.0636 2.1349 1.4138 0.0824  -0.2648 0.0350  121 SER D C     
2081 O O     . SER D 29 ? 1.8415 1.8500 1.1344 0.0392  -0.2387 0.0476  121 SER D O     
2082 C CB    . SER D 29 ? 1.9955 2.2060 1.5384 0.1538  -0.3572 0.0139  121 SER D CB    
2083 O OG    . SER D 29 ? 1.7258 1.9343 1.2773 0.0916  -0.3796 0.0262  121 SER D OG    
2089 N N     . LEU D 30 ? 1.9952 2.0982 1.3402 0.0747  -0.2693 0.0299  122 LEU D N     
2090 C CA    . LEU D 30 ? 1.8152 1.8822 1.0927 0.0127  -0.2477 0.0397  122 LEU D CA    
2091 C C     . LEU D 30 ? 1.8843 1.9608 1.1910 -0.0435 -0.2813 0.0481  122 LEU D C     
2092 O O     . LEU D 30 ? 2.1436 2.1572 1.3837 -0.0948 -0.2571 0.0617  122 LEU D O     
2093 C CB    . LEU D 30 ? 1.7529 1.8656 1.0369 0.0178  -0.2516 0.0290  122 LEU D CB    
2094 C CG    . LEU D 30 ? 1.9152 1.9993 1.1404 -0.0442 -0.2319 0.0360  122 LEU D CG    
2095 C CD1   . LEU D 30 ? 2.2924 2.2807 1.4049 -0.0615 -0.1707 0.0497  122 LEU D CD1   
2096 C CD2   . LEU D 30 ? 2.0543 2.2018 1.3097 -0.0369 -0.2436 0.0209  122 LEU D CD2   
2108 N N     . GLN D 31 ? 1.9926 2.1472 1.3993 -0.0328 -0.3393 0.0393  123 GLN D N     
2109 C CA    . GLN D 31 ? 2.0170 2.1867 1.4616 -0.0830 -0.3816 0.0472  123 GLN D CA    
2110 C C     . GLN D 31 ? 2.1421 2.2542 1.5536 -0.1061 -0.3686 0.0635  123 GLN D C     
2111 O O     . GLN D 31 ? 2.3402 2.4122 1.7087 -0.1662 -0.3672 0.0772  123 GLN D O     
2112 C CB    . GLN D 31 ? 2.3568 2.6204 1.9246 -0.0560 -0.4487 0.0336  123 GLN D CB    
2113 C CG    . GLN D 31 ? 2.6348 2.9139 2.2498 -0.1044 -0.5006 0.0429  123 GLN D CG    
2114 C CD    . GLN D 31 ? 2.7194 3.0855 2.4615 -0.0715 -0.5679 0.0304  123 GLN D CD    
2115 O OE1   . GLN D 31 ? 2.8804 3.3004 2.6784 -0.0116 -0.5763 0.0125  123 GLN D OE1   
2116 N NE2   . GLN D 31 ? 2.6469 3.0256 2.4346 -0.1109 -0.6182 0.0399  123 GLN D NE2   
2125 N N     . GLN D 32 ? 1.6004 1.7100 1.0336 -0.0584 -0.3595 0.0605  124 GLN D N     
2126 C CA    . GLN D 32 ? 2.0006 2.0637 1.4131 -0.0753 -0.3464 0.0721  124 GLN D CA    
2127 C C     . GLN D 32 ? 1.7113 1.6844 1.0082 -0.1167 -0.2872 0.0825  124 GLN D C     
2128 O O     . GLN D 32 ? 1.8759 1.8096 1.1361 -0.1690 -0.2826 0.0955  124 GLN D O     
2129 C CB    . GLN D 32 ? 1.8597 1.9388 1.3212 -0.0102 -0.3442 0.0623  124 GLN D CB    
2130 C CG    . GLN D 32 ? 1.6901 1.8556 1.2730 0.0262  -0.4069 0.0533  124 GLN D CG    
2131 C CD    . GLN D 32 ? 1.9625 2.1487 1.5959 0.0993  -0.4048 0.0395  124 GLN D CD    
2132 O OE1   . GLN D 32 ? 2.0509 2.1953 1.6317 0.1313  -0.3598 0.0335  124 GLN D OE1   
2133 N NE2   . GLN D 32 ? 2.3895 2.6391 2.1279 0.1265  -0.4563 0.0339  124 GLN D NE2   
2142 N N     . MET D 33 ? 1.7900 1.7299 1.0286 -0.0939 -0.2430 0.0766  125 MET D N     
2143 C CA    . MET D 33 ? 2.0050 1.8609 1.1370 -0.1306 -0.1880 0.0843  125 MET D CA    
2144 C C     . MET D 33 ? 2.0918 1.9323 1.1839 -0.2001 -0.1950 0.0948  125 MET D C     
2145 O O     . MET D 33 ? 2.3646 2.1477 1.3943 -0.2489 -0.1726 0.1047  125 MET D O     
2146 C CB    . MET D 33 ? 2.2707 2.0977 1.3534 -0.0931 -0.1466 0.0772  125 MET D CB    
2147 C CG    . MET D 33 ? 2.1381 1.9442 1.2260 -0.0354 -0.1242 0.0684  125 MET D CG    
2148 S SD    . MET D 33 ? 2.2402 1.9892 1.2484 -0.0035 -0.0724 0.0645  125 MET D SD    
2149 C CE    . MET D 33 ? 1.9123 1.6434 0.9481 0.0632  -0.0608 0.0519  125 MET D CE    
2159 N N     . GLN D 34 ? 2.1754 2.0678 1.3051 -0.2044 -0.2264 0.0904  126 GLN D N     
2160 C CA    . GLN D 34 ? 2.1304 2.0100 1.2280 -0.2673 -0.2352 0.0973  126 GLN D CA    
2161 C C     . GLN D 34 ? 2.1866 2.0690 1.3072 -0.3145 -0.2743 0.1082  126 GLN D C     
2162 O O     . GLN D 34 ? 2.6994 2.5342 1.7594 -0.3729 -0.2646 0.1183  126 GLN D O     
2163 C CB    . GLN D 34 ? 2.2596 2.2010 1.4039 -0.2592 -0.2621 0.0860  126 GLN D CB    
2164 C CG    . GLN D 34 ? 2.7823 2.7013 1.8710 -0.2405 -0.2159 0.0804  126 GLN D CG    
2165 C CD    . GLN D 34 ? 2.8260 2.8029 1.9531 -0.2444 -0.2374 0.0685  126 GLN D CD    
2166 O OE1   . GLN D 34 ? 2.6997 2.7483 1.9142 -0.2412 -0.2907 0.0590  126 GLN D OE1   
2167 N NE2   . GLN D 34 ? 2.8973 2.8433 1.9613 -0.2527 -0.1961 0.0680  126 GLN D NE2   
2176 N N     . GLU D 35 ? 1.9609 1.8971 1.1673 -0.2902 -0.3198 0.1067  127 GLU D N     
2177 C CA    . GLU D 35 ? 2.1805 2.1184 1.4099 -0.3341 -0.3601 0.1195  127 GLU D CA    
2178 C C     . GLU D 35 ? 2.1652 2.0312 1.3208 -0.3597 -0.3190 0.1314  127 GLU D C     
2179 O O     . GLU D 35 ? 2.4717 2.2980 1.5790 -0.4201 -0.3220 0.1447  127 GLU D O     
2180 C CB    . GLU D 35 ? 2.2552 2.2696 1.6002 -0.2991 -0.4200 0.1148  127 GLU D CB    
2181 C CG    . GLU D 35 ? 2.7255 2.7391 2.0977 -0.2612 -0.4113 0.1160  127 GLU D CG    
2182 C CD    . GLU D 35 ? 3.0977 3.1874 2.5883 -0.2307 -0.4750 0.1120  127 GLU D CD    
2183 O OE1   . GLU D 35 ? 3.2464 3.3963 2.8033 -0.2257 -0.5226 0.1035  127 GLU D OE1   
2184 O OE2   . GLU D 35 ? 3.1937 3.2841 2.7147 -0.2118 -0.4776 0.1158  127 GLU D OE2   
2191 N N     . LEU D 36 ? 1.8529 1.7027 1.0002 -0.3140 -0.2811 0.1248  128 LEU D N     
2192 C CA    . LEU D 36 ? 1.9080 1.6913 0.9876 -0.3332 -0.2354 0.1302  128 LEU D CA    
2193 C C     . LEU D 36 ? 2.2368 1.9493 1.2102 -0.3832 -0.1918 0.1350  128 LEU D C     
2194 O O     . LEU D 36 ? 2.0759 1.7389 0.9915 -0.4308 -0.1736 0.1437  128 LEU D O     
2195 C CB    . LEU D 36 ? 1.9408 1.7175 1.0316 -0.2705 -0.2006 0.1173  128 LEU D CB    
2196 C CG    . LEU D 36 ? 2.1038 1.8175 1.1369 -0.2849 -0.1528 0.1173  128 LEU D CG    
2197 C CD1   . LEU D 36 ? 2.1451 1.8690 1.2076 -0.3164 -0.1783 0.1276  128 LEU D CD1   
2198 C CD2   . LEU D 36 ? 1.9435 1.6488 0.9900 -0.2196 -0.1203 0.1011  128 LEU D CD2   
2210 N N     . SER D 37 ? 2.1912 1.8995 1.1391 -0.3726 -0.1748 0.1288  129 SER D N     
2211 C CA    . SER D 37 ? 2.4227 2.0674 1.2768 -0.4177 -0.1363 0.1325  129 SER D CA    
2212 C C     . SER D 37 ? 2.5071 2.1508 1.3499 -0.4830 -0.1709 0.1435  129 SER D C     
2213 O O     . SER D 37 ? 2.4554 2.0405 1.2226 -0.5345 -0.1479 0.1506  129 SER D O     
2214 C CB    . SER D 37 ? 2.6010 2.2461 1.4377 -0.3901 -0.1133 0.1243  129 SER D CB    
2215 O OG    . SER D 37 ? 2.6123 2.3190 1.5066 -0.3892 -0.1565 0.1216  129 SER D OG    
2221 N N     . ASN D 38 ? 2.5090 2.2181 1.4292 -0.4796 -0.2280 0.1431  130 ASN D N     
2222 C CA    . ASN D 38 ? 2.1626 1.8764 1.0858 -0.5372 -0.2710 0.1518  130 ASN D CA    
2223 C C     . ASN D 38 ? 2.2346 1.9136 1.1276 -0.5826 -0.2809 0.1668  130 ASN D C     
2224 O O     . ASN D 38 ? 2.8585 2.4880 1.6834 -0.6405 -0.2743 0.1753  130 ASN D O     
2225 C CB    . ASN D 38 ? 2.1325 1.9292 1.1609 -0.5181 -0.3360 0.1456  130 ASN D CB    
2226 C CG    . ASN D 38 ? 2.4372 2.2624 1.4800 -0.5069 -0.3350 0.1321  130 ASN D CG    
2227 O OD1   . ASN D 38 ? 2.7356 2.5145 1.7060 -0.5230 -0.2903 0.1308  130 ASN D OD1   
2228 N ND2   . ASN D 38 ? 2.4093 2.3125 1.5483 -0.4802 -0.3845 0.1209  130 ASN D ND2   
2235 N N     . ILE D 39 ? 2.3329 2.0370 1.2750 -0.5575 -0.2965 0.1699  131 ILE D N     
2236 C CA    . ILE D 39 ? 2.6246 2.3011 1.5427 -0.6022 -0.3088 0.1853  131 ILE D CA    
2237 C C     . ILE D 39 ? 2.5132 2.1136 1.3294 -0.6286 -0.2445 0.1868  131 ILE D C     
2238 O O     . ILE D 39 ? 2.9904 2.5565 1.7628 -0.6778 -0.2460 0.1991  131 ILE D O     
2239 C CB    . ILE D 39 ? 2.5220 2.2470 1.5244 -0.5687 -0.3414 0.1881  131 ILE D CB    
2240 C CG1   . ILE D 39 ? 2.5857 2.3129 1.6009 -0.5072 -0.2962 0.1746  131 ILE D CG1   
2241 C CG2   . ILE D 39 ? 2.7196 2.5211 1.8270 -0.5467 -0.4105 0.1854  131 ILE D CG2   
2242 C CD1   . ILE D 39 ? 2.6249 2.3833 1.7062 -0.4833 -0.3167 0.1777  131 ILE D CD1   
2254 N N     . LEU D 40 ? 2.2749 1.8487 1.0534 -0.5968 -0.1894 0.1736  132 LEU D N     
2255 C CA    . LEU D 40 ? 2.3893 1.8911 1.0741 -0.6198 -0.1276 0.1706  132 LEU D CA    
2256 C C     . LEU D 40 ? 2.6258 2.0809 1.2350 -0.6539 -0.1022 0.1692  132 LEU D C     
2257 O O     . LEU D 40 ? 2.6580 2.0524 1.1889 -0.6722 -0.0508 0.1643  132 LEU D O     
2258 C CB    . LEU D 40 ? 2.6004 2.0964 1.2950 -0.5611 -0.0829 0.1558  132 LEU D CB    
2259 C CG    . LEU D 40 ? 2.5778 2.0720 1.2886 -0.5567 -0.0739 0.1553  132 LEU D CG    
2260 C CD1   . LEU D 40 ? 2.1760 1.7314 0.9726 -0.5523 -0.1349 0.1663  132 LEU D CD1   
2261 C CD2   . LEU D 40 ? 2.5643 2.0508 1.2887 -0.4967 -0.0313 0.1373  132 LEU D CD2   
2273 N N     . ASN D 41 ? 3.0344 2.5190 1.6711 -0.6633 -0.1392 0.1717  133 ASN D N     
2274 C CA    . ASN D 41 ? 3.1090 2.5561 1.6857 -0.6945 -0.1200 0.1697  133 ASN D CA    
2275 C C     . ASN D 41 ? 3.1417 2.5501 1.6711 -0.6638 -0.0578 0.1584  133 ASN D C     
2276 O O     . ASN D 41 ? 3.2143 2.5617 1.6640 -0.6961 -0.0192 0.1571  133 ASN D O     
2277 C CB    . ASN D 41 ? 2.9067 2.3006 1.4100 -0.7660 -0.1206 0.1795  133 ASN D CB    
2278 C CG    . ASN D 41 ? 3.0468 2.4128 1.5062 -0.8032 -0.1188 0.1784  133 ASN D CG    
2279 O OD1   . ASN D 41 ? 3.1460 2.5462 1.6467 -0.7839 -0.1341 0.1726  133 ASN D OD1   
2280 N ND2   . ASN D 41 ? 3.2914 2.5960 1.6677 -0.8577 -0.0997 0.1825  133 ASN D ND2   
2287 N N     . LEU D 42 ? 2.9686 2.4121 1.5488 -0.6006 -0.0511 0.1503  134 LEU D N     
2288 C CA    . LEU D 42 ? 2.4898 1.9013 1.0348 -0.5643 0.0000  0.1405  134 LEU D CA    
2289 C C     . LEU D 42 ? 2.4726 1.9295 1.0624 -0.5276 -0.0146 0.1363  134 LEU D C     
2290 O O     . LEU D 42 ? 2.7350 2.2554 1.3950 -0.5210 -0.0634 0.1373  134 LEU D O     
2291 C CB    . LEU D 42 ? 2.3202 1.7238 0.8773 -0.5192 0.0262  0.1328  134 LEU D CB    
2292 C CG    . LEU D 42 ? 2.6238 1.9830 1.1369 -0.5503 0.0504  0.1324  134 LEU D CG    
2293 C CD1   . LEU D 42 ? 2.3498 1.7111 0.8921 -0.4985 0.0728  0.1208  134 LEU D CD1   
2294 C CD2   . LEU D 42 ? 2.8385 2.1247 1.2565 -0.5949 0.0940  0.1303  134 LEU D CD2   
2306 N N     . SER D 43 ? 2.3776 1.8015 0.9261 -0.5057 0.0274  0.1311  135 SER D N     
2307 C CA    . SER D 43 ? 2.5228 1.9858 1.1045 -0.4696 0.0210  0.1270  135 SER D CA    
2308 C C     . SER D 43 ? 2.4892 1.9916 1.1275 -0.4013 0.0149  0.1201  135 SER D C     
2309 O O     . SER D 43 ? 2.3947 1.8768 1.0312 -0.3801 0.0297  0.1173  135 SER D O     
2310 C CB    . SER D 43 ? 2.8931 2.3006 1.4029 -0.4772 0.0675  0.1267  135 SER D CB    
2311 O OG    . SER D 43 ? 2.9176 2.2699 1.3821 -0.4516 0.1116  0.1233  135 SER D OG    
2317 N N     . TYR D 44 ? 2.2817 1.8420 0.9725 -0.3671 -0.0073 0.1154  136 TYR D N     
2318 C CA    . TYR D 44 ? 2.1613 1.7621 0.9067 -0.2999 -0.0160 0.1077  136 TYR D CA    
2319 C C     . TYR D 44 ? 2.3719 1.9127 1.0626 -0.2659 0.0332  0.1050  136 TYR D C     
2320 O O     . TYR D 44 ? 2.2514 1.7943 0.9686 -0.2225 0.0350  0.0990  136 TYR D O     
2321 C CB    . TYR D 44 ? 2.0834 1.7510 0.8801 -0.2742 -0.0414 0.1014  136 TYR D CB    
2322 C CG    . TYR D 44 ? 2.3916 2.0906 1.2259 -0.2031 -0.0418 0.0927  136 TYR D CG    
2323 C CD1   . TYR D 44 ? 2.4520 2.2093 1.3696 -0.1650 -0.0804 0.0859  136 TYR D CD1   
2324 C CD2   . TYR D 44 ? 2.7415 2.4090 1.5269 -0.1744 -0.0049 0.0917  136 TYR D CD2   
2325 C CE1   . TYR D 44 ? 2.2720 2.0571 1.2242 -0.0987 -0.0825 0.0766  136 TYR D CE1   
2326 C CE2   . TYR D 44 ? 2.7593 2.4514 1.5739 -0.1096 -0.0073 0.0841  136 TYR D CE2   
2327 C CZ    . TYR D 44 ? 2.6307 2.3822 1.5292 -0.0712 -0.0461 0.0756  136 TYR D CZ    
2328 O OH    . TYR D 44 ? 3.0643 2.8399 1.9925 -0.0052 -0.0502 0.0666  136 TYR D OH    
2338 N N     . LYS D 45 ? 2.4458 1.9318 1.0628 -0.2867 0.0711  0.1088  137 LYS D N     
2339 C CA    . LYS D 45 ? 2.4124 1.8374 0.9744 -0.2566 0.1155  0.1068  137 LYS D CA    
2340 C C     . LYS D 45 ? 2.4153 1.7938 0.9603 -0.2505 0.1363  0.1016  137 LYS D C     
2341 O O     . LYS D 45 ? 2.5030 1.8712 1.0600 -0.1992 0.1469  0.0939  137 LYS D O     
2342 C CB    . LYS D 45 ? 2.6350 2.0039 1.1195 -0.2932 0.1502  0.1135  137 LYS D CB    
2343 C CG    . LYS D 45 ? 2.8893 2.2033 1.3230 -0.2580 0.1888  0.1134  137 LYS D CG    
2344 C CD    . LYS D 45 ? 2.9688 2.2315 1.3316 -0.2956 0.2199  0.1216  137 LYS D CD    
2345 C CE    . LYS D 45 ? 3.3272 2.5337 1.6402 -0.2603 0.2539  0.1236  137 LYS D CE    
2346 N NZ    . LYS D 45 ? 3.5741 2.7276 1.8189 -0.2975 0.2845  0.1329  137 LYS D NZ    
2360 N N     . GLN D 46 ? 2.3904 1.7417 0.9085 -0.3029 0.1416  0.1042  138 GLN D N     
2361 C CA    . GLN D 46 ? 2.7373 2.0418 1.2323 -0.3042 0.1678  0.0968  138 GLN D CA    
2362 C C     . GLN D 46 ? 2.5701 1.9203 1.1385 -0.2656 0.1429  0.0897  138 GLN D C     
2363 O O     . GLN D 46 ? 2.5307 1.8528 1.0992 -0.2373 0.1649  0.0785  138 GLN D O     
2364 C CB    . GLN D 46 ? 2.8518 2.1194 1.2970 -0.3731 0.1788  0.1008  138 GLN D CB    
2365 C CG    . GLN D 46 ? 3.1401 2.4557 1.6177 -0.4150 0.1356  0.1105  138 GLN D CG    
2366 C CD    . GLN D 46 ? 3.1240 2.3945 1.5379 -0.4849 0.1478  0.1157  138 GLN D CD    
2367 O OE1   . GLN D 46 ? 2.9703 2.2578 1.3832 -0.5244 0.1223  0.1242  138 GLN D OE1   
2368 N NE2   . GLN D 46 ? 3.0630 2.2763 1.4255 -0.5000 0.1858  0.1083  138 GLN D NE2   
2377 N N     . VAL D 47 ? 2.3824 1.8040 1.0184 -0.2623 0.0959  0.0946  139 VAL D N     
2378 C CA    . VAL D 47 ? 2.4744 1.9449 1.1880 -0.2264 0.0672  0.0890  139 VAL D CA    
2379 C C     . VAL D 47 ? 2.3400 1.8319 1.0938 -0.1520 0.0656  0.0790  139 VAL D C     
2380 O O     . VAL D 47 ? 2.4883 1.9727 1.2681 -0.1139 0.0738  0.0682  139 VAL D O     
2381 C CB    . VAL D 47 ? 2.3366 1.8766 1.1141 -0.2472 0.0127  0.0971  139 VAL D CB    
2382 C CG1   . VAL D 47 ? 2.0703 1.6610 0.9323 -0.2095 -0.0185 0.0920  139 VAL D CG1   
2383 C CG2   . VAL D 47 ? 2.4435 1.9583 1.1785 -0.3209 0.0103  0.1078  139 VAL D CG2   
2393 N N     . LYS D 48 ? 2.1417 1.6592 0.8993 -0.1324 0.0554  0.0814  140 LYS D N     
2394 C CA    . LYS D 48 ? 2.3754 1.9088 1.1590 -0.0639 0.0545  0.0730  140 LYS D CA    
2395 C C     . LYS D 48 ? 2.4040 1.8615 1.1316 -0.0417 0.0994  0.0663  140 LYS D C     
2396 O O     . LYS D 48 ? 2.4481 1.9054 1.2078 0.0127  0.0991  0.0550  140 LYS D O     
2397 C CB    . LYS D 48 ? 2.1130 1.6767 0.8910 -0.0567 0.0451  0.0773  140 LYS D CB    
2400 N N     . THR D 49 ? 2.4121 1.8046 1.0594 -0.0840 0.1357  0.0719  141 THR D N     
2401 C CA    . THR D 49 ? 2.5319 1.8466 1.1231 -0.0710 0.1781  0.0647  141 THR D CA    
2402 C C     . THR D 49 ? 2.5395 1.8414 1.1592 -0.0594 0.1852  0.0505  141 THR D C     
2403 O O     . THR D 49 ? 2.6936 1.9711 1.3244 -0.0101 0.1969  0.0373  141 THR D O     
2404 C CB    . THR D 49 ? 2.8594 2.1107 1.3662 -0.1277 0.2125  0.0722  141 THR D CB    
2405 O OG1   . THR D 49 ? 2.8068 2.0715 1.2903 -0.1410 0.2072  0.0846  141 THR D OG1   
2406 C CG2   . THR D 49 ? 3.2459 2.4168 1.6995 -0.1119 0.2535  0.0629  141 THR D CG2   
2414 N N     . TRP D 50 ? 2.4104 1.7270 1.0410 -0.1060 0.1780  0.0527  142 TRP D N     
2415 C CA    . TRP D 50 ? 2.5685 1.8797 1.2287 -0.1019 0.1851  0.0396  142 TRP D CA    
2416 C C     . TRP D 50 ? 2.4285 1.7840 1.1696 -0.0344 0.1606  0.0288  142 TRP D C     
2417 O O     . TRP D 50 ? 2.8089 2.1344 1.5601 0.0019  0.1801  0.0117  142 TRP D O     
2418 C CB    . TRP D 50 ? 2.5441 1.8805 1.2136 -0.1598 0.1694  0.0480  142 TRP D CB    
2419 C CG    . TRP D 50 ? 2.6003 1.9257 1.2889 -0.1647 0.1837  0.0351  142 TRP D CG    
2420 C CD1   . TRP D 50 ? 2.6666 1.9326 1.3016 -0.1946 0.2264  0.0237  142 TRP D CD1   
2421 C CD2   . TRP D 50 ? 2.6546 2.0315 1.4239 -0.1396 0.1565  0.0303  142 TRP D CD2   
2422 N NE1   . TRP D 50 ? 2.8058 2.0841 1.4816 -0.1910 0.2297  0.0115  142 TRP D NE1   
2423 C CE2   . TRP D 50 ? 2.7457 2.0907 1.5043 -0.1577 0.1870  0.0165  142 TRP D CE2   
2424 C CE3   . TRP D 50 ? 2.6281 2.0762 1.4804 -0.1039 0.1093  0.0351  142 TRP D CE3   
2425 C CZ2   . TRP D 50 ? 2.6889 2.0694 1.5155 -0.1427 0.1733  0.0090  142 TRP D CZ2   
2426 C CZ3   . TRP D 50 ? 2.5528 2.0352 1.4743 -0.0876 0.0931  0.0282  142 TRP D CZ3   
2427 C CH2   . TRP D 50 ? 2.5298 1.9777 1.4374 -0.1075 0.1257  0.0161  142 TRP D CH2   
2438 N N     . PHE D 51 ? 2.2237 1.6505 1.0255 -0.0168 0.1168  0.0366  143 PHE D N     
2439 C CA    . PHE D 51 ? 2.3364 1.8113 1.2202 0.0481  0.0888  0.0261  143 PHE D CA    
2440 C C     . PHE D 51 ? 2.3942 1.8350 1.2645 0.1092  0.1057  0.0145  143 PHE D C     
2441 O O     . PHE D 51 ? 2.3751 1.8108 1.2863 0.1551  0.1072  -0.0019 143 PHE D O     
2442 C CB    . PHE D 51 ? 2.0990 1.6550 1.0445 0.0573  0.0390  0.0351  143 PHE D CB    
2443 C CG    . PHE D 51 ? 2.0761 1.6815 1.0808 0.0289  0.0063  0.0400  143 PHE D CG    
2444 C CD1   . PHE D 51 ? 2.0525 1.6884 1.1318 0.0638  -0.0111 0.0296  143 PHE D CD1   
2445 C CD2   . PHE D 51 ? 2.0177 1.6367 1.0044 -0.0331 -0.0088 0.0551  143 PHE D CD2   
2446 C CE1   . PHE D 51 ? 1.9035 1.5819 1.0363 0.0360  -0.0423 0.0362  143 PHE D CE1   
2447 C CE2   . PHE D 51 ? 2.0583 1.7179 1.0965 -0.0605 -0.0424 0.0615  143 PHE D CE2   
2448 C CZ    . PHE D 51 ? 1.9096 1.5988 1.0200 -0.0266 -0.0588 0.0531  143 PHE D CZ    
2458 N N     . GLN D 52 ? 2.4023 1.8187 1.2161 0.1089  0.1171  0.0231  144 GLN D N     
2459 C CA    . GLN D 52 ? 2.2476 1.6211 1.0338 0.1603  0.1335  0.0158  144 GLN D CA    
2460 C C     . GLN D 52 ? 2.5675 1.8718 1.3313 0.1685  0.1679  -0.0006 144 GLN D C     
2461 O O     . GLN D 52 ? 2.6497 1.9461 1.4508 0.2252  0.1642  -0.0170 144 GLN D O     
2462 C CB    . GLN D 52 ? 2.2507 1.5935 0.9620 0.1397  0.1497  0.0305  144 GLN D CB    
2463 C CG    . GLN D 52 ? 2.2794 1.5945 0.9671 0.1948  0.1543  0.0285  144 GLN D CG    
2464 C CD    . GLN D 52 ? 2.4144 1.8018 1.1667 0.2473  0.1148  0.0259  144 GLN D CD    
2465 O OE1   . GLN D 52 ? 2.1673 1.6204 0.9493 0.2309  0.0895  0.0335  144 GLN D OE1   
2466 N NE2   . GLN D 52 ? 2.7910 2.1672 1.5683 0.3114  0.1077  0.0130  144 GLN D NE2   
2475 N N     . ASN D 53 ? 2.3045 1.5604 1.0109 0.1118  0.2000  0.0016  145 ASN D N     
2476 C CA    . ASN D 53 ? 2.3557 1.5479 1.0404 0.1113  0.2350  -0.0170 145 ASN D CA    
2477 C C     . ASN D 53 ? 2.3903 1.6114 1.1509 0.1378  0.2254  -0.0361 145 ASN D C     
2478 O O     . ASN D 53 ? 2.7759 1.9601 1.5501 0.1746  0.2413  -0.0575 145 ASN D O     
2479 C CB    . ASN D 53 ? 2.5956 1.7459 1.2154 0.0398  0.2665  -0.0126 145 ASN D CB    
2480 C CG    . ASN D 53 ? 2.6546 1.7588 1.1956 0.0162  0.2845  0.0015  145 ASN D CG    
2481 O OD1   . ASN D 53 ? 2.5987 1.6709 1.1176 0.0547  0.2891  0.0019  145 ASN D OD1   
2482 N ND2   . ASN D 53 ? 2.6914 1.7897 1.1887 -0.0483 0.2940  0.0136  145 ASN D ND2   
2489 N N     . GLN D 54 ? 2.2534 1.5393 1.0660 0.1185  0.1982  -0.0288 146 GLN D N     
2490 C CA    . GLN D 54 ? 2.4276 1.7459 1.3163 0.1395  0.1874  -0.0445 146 GLN D CA    
2491 C C     . GLN D 54 ? 2.5316 1.8739 1.4866 0.2191  0.1636  -0.0577 146 GLN D C     
2492 O O     . GLN D 54 ? 2.7529 2.0836 1.7510 0.2516  0.1719  -0.0801 146 GLN D O     
2493 C CB    . GLN D 54 ? 2.5794 1.9614 1.5081 0.1004  0.1580  -0.0300 146 GLN D CB    
2494 C CG    . GLN D 54 ? 2.4031 1.7595 1.2732 0.0219  0.1806  -0.0207 146 GLN D CG    
2495 C CD    . GLN D 54 ? 2.5540 1.8722 1.4167 0.0042  0.2171  -0.0405 146 GLN D CD    
2496 O OE1   . GLN D 54 ? 2.3772 1.7149 1.3048 0.0379  0.2130  -0.0571 146 GLN D OE1   
2497 N NE2   . GLN D 54 ? 3.0168 2.2814 1.8021 -0.0489 0.2536  -0.0410 146 GLN D NE2   
2506 N N     . ARG D 55 ? 2.5606 1.9368 1.5250 0.2502  0.1342  -0.0458 147 ARG D N     
2507 C CA    . ARG D 55 ? 2.3012 1.6940 1.3167 0.3271  0.1120  -0.0581 147 ARG D CA    
2508 C C     . ARG D 55 ? 2.5613 1.8759 1.5379 0.3600  0.1422  -0.0752 147 ARG D C     
2509 O O     . ARG D 55 ? 2.7875 2.0954 1.8162 0.4114  0.1378  -0.0974 147 ARG D O     
2510 C CB    . ARG D 55 ? 2.0784 1.5144 1.0936 0.3488  0.0813  -0.0428 147 ARG D CB    
2511 C CG    . ARG D 55 ? 2.0186 1.5390 1.0898 0.3275  0.0429  -0.0307 147 ARG D CG    
2512 C CD    . ARG D 55 ? 1.9706 1.5417 1.0587 0.3618  0.0107  -0.0238 147 ARG D CD    
2513 N NE    . ARG D 55 ? 1.9991 1.5654 1.0220 0.3163  0.0193  -0.0055 147 ARG D NE    
2514 C CZ    . ARG D 55 ? 2.1227 1.7399 1.1623 0.2721  -0.0014 0.0066  147 ARG D CZ    
2515 N NH1   . ARG D 55 ? 1.9612 1.6373 1.0783 0.2659  -0.0342 0.0047  147 ARG D NH1   
2516 N NH2   . ARG D 55 ? 2.1433 1.7511 1.1238 0.2336  0.0091  0.0203  147 ARG D NH2   
2530 N N     . MET D 56 ? 2.6454 1.8995 1.5341 0.3300  0.1712  -0.0659 148 MET D N     
2531 C CA    . MET D 56 ? 2.6348 1.8082 1.4826 0.3543  0.1993  -0.0813 148 MET D CA    
2532 C C     . MET D 56 ? 2.8853 2.0315 1.7655 0.3532  0.2219  -0.1089 148 MET D C     
2533 O O     . MET D 56 ? 3.1652 2.2839 2.0772 0.4063  0.2215  -0.1316 148 MET D O     
2534 C CB    . MET D 56 ? 2.8605 1.9737 1.6107 0.3100  0.2288  -0.0664 148 MET D CB    
2535 C CG    . MET D 56 ? 3.0026 2.1341 1.7147 0.3103  0.2128  -0.0414 148 MET D CG    
2536 S SD    . MET D 56 ? 3.0172 2.1769 1.7710 0.3949  0.1763  -0.0445 148 MET D SD    
2537 C CE    . MET D 56 ? 2.9095 2.0624 1.5854 0.3767  0.1773  -0.0164 148 MET D CE    
2547 N N     . LYS D 57 ? 2.6060 1.7580 1.4764 0.2923  0.2419  -0.1083 149 LYS D N     
2548 C CA    . LYS D 57 ? 2.6707 1.8054 1.5734 0.2847  0.2659  -0.1355 149 LYS D CA    
2549 C C     . LYS D 57 ? 2.7618 1.9439 1.7639 0.3394  0.2397  -0.1529 149 LYS D C     
2550 O O     . LYS D 57 ? 3.2813 2.4348 2.3188 0.3731  0.2528  -0.1825 149 LYS D O     
2551 C CB    . LYS D 57 ? 3.0033 2.1516 1.8833 0.2089  0.2846  -0.1280 149 LYS D CB    
2552 C CG    . LYS D 57 ? 3.1232 2.2586 2.0344 0.1956  0.3126  -0.1568 149 LYS D CG    
2553 C CD    . LYS D 57 ? 3.0258 2.1766 1.9095 0.1193  0.3285  -0.1471 149 LYS D CD    
2554 C CE    . LYS D 57 ? 3.1379 2.2861 2.0593 0.1070  0.3553  -0.1760 149 LYS D CE    
2555 N NZ    . LYS D 57 ? 3.1258 2.2841 2.0111 0.0299  0.3725  -0.1662 149 LYS D NZ    
2569 N N     . SER D 58 ? 2.4221 1.6770 1.4730 0.3478  0.2016  -0.1363 150 SER D N     
2570 C CA    . SER D 58 ? 2.6463 1.9537 1.7970 0.3968  0.1726  -0.1506 150 SER D CA    
2571 C C     . SER D 58 ? 3.0244 2.3068 2.2043 0.4756  0.1612  -0.1705 150 SER D C     
2572 O O     . SER D 58 ? 3.1175 2.4062 2.3687 0.5143  0.1578  -0.1965 150 SER D O     
2573 C CB    . SER D 58 ? 2.6998 2.0881 1.8940 0.3948  0.1290  -0.1281 150 SER D CB    
2574 O OG    . SER D 58 ? 2.5879 2.0274 1.8824 0.4441  0.0989  -0.1421 150 SER D OG    
2580 N N     . LYS D 59 ? 3.2364 2.4903 2.3625 0.4989  0.1543  -0.1585 151 LYS D N     
2581 C CA    . LYS D 59 ? 3.2110 2.4297 2.3513 0.5712  0.1433  -0.1757 151 LYS D CA    
2582 C C     . LYS D 59 ? 3.2343 2.3903 2.3858 0.5864  0.1719  -0.2090 151 LYS D C     
2583 O O     . LYS D 59 ? 3.2938 2.4593 2.5211 0.6384  0.1581  -0.2347 151 LYS D O     
2584 C CB    . LYS D 59 ? 3.1521 2.3303 2.2094 0.5788  0.1427  -0.1564 151 LYS D CB    
2585 C CG    . LYS D 59 ? 3.3069 2.5431 2.3758 0.6064  0.1042  -0.1366 151 LYS D CG    
2586 C CD    . LYS D 59 ? 3.4003 2.5854 2.4067 0.6433  0.1009  -0.1296 151 LYS D CD    
2587 C CE    . LYS D 59 ? 3.2954 2.5391 2.3075 0.6686  0.0662  -0.1120 151 LYS D CE    
2588 N NZ    . LYS D 59 ? 3.3917 2.5833 2.3413 0.7068  0.0630  -0.1056 151 LYS D NZ    
2602 N N     . ARG D 60 ? 3.2174 2.3104 2.2971 0.5421  0.2106  -0.2104 152 ARG D N     
2603 C CA    . ARG D 60 ? 3.2343 2.2619 2.3166 0.5519  0.2401  -0.2438 152 ARG D CA    
2604 C C     . ARG D 60 ? 3.2769 2.3319 2.4531 0.5698  0.2432  -0.2769 152 ARG D C     
2605 O O     . ARG D 60 ? 3.4147 2.4387 2.6355 0.6223  0.2405  -0.3080 152 ARG D O     
2606 C CB    . ARG D 60 ? 3.2725 2.2528 2.2768 0.4828  0.2824  -0.2399 152 ARG D CB    
2607 C CG    . ARG D 60 ? 3.4544 2.3795 2.3660 0.4729  0.2880  -0.2181 152 ARG D CG    
2608 C CD    . ARG D 60 ? 3.7048 2.6141 2.5460 0.3944  0.3201  -0.2033 152 ARG D CD    
2609 N NE    . ARG D 60 ? 3.8985 2.7369 2.6549 0.3823  0.3358  -0.1926 152 ARG D NE    
2610 C CZ    . ARG D 60 ? 3.8823 2.6939 2.5707 0.3192  0.3638  -0.1811 152 ARG D CZ    
2611 N NH1   . ARG D 60 ? 3.7777 2.6266 2.4688 0.2624  0.3783  -0.1784 152 ARG D NH1   
2612 N NH2   . ARG D 60 ? 3.9334 2.6794 2.5504 0.3122  0.3758  -0.1715 152 ARG D NH2   
2626 N N     . TRP D 61 ? 3.3687 2.4802 2.5746 0.5245  0.2483  -0.2704 153 TRP D N     
2627 C CA    . TRP D 61 ? 3.1231 2.2604 2.4104 0.5271  0.2585  -0.2998 153 TRP D CA    
2628 C C     . TRP D 61 ? 3.2655 2.4370 2.6493 0.6030  0.2219  -0.3165 153 TRP D C     
2629 O O     . TRP D 61 ? 3.3724 2.5173 2.8083 0.6425  0.2297  -0.3530 153 TRP D O     
2630 C CB    . TRP D 61 ? 2.7835 1.9770 2.0772 0.4624  0.2644  -0.2818 153 TRP D CB    
2633 O "O5'" . DG  E 1  ? 2.0726 1.9891 2.5064 0.0334  0.0217  0.0360  1   DG  E "O5'" 
2634 C "C5'" . DG  E 1  ? 2.0499 2.0371 2.4849 0.0067  -0.0374 0.0121  1   DG  E "C5'" 
2635 C "C4'" . DG  E 1  ? 2.1516 2.2005 2.5222 0.0552  -0.0790 0.0185  1   DG  E "C4'" 
2636 O "O4'" . DG  E 1  ? 2.4971 2.5285 2.8224 0.1216  -0.0460 0.0634  1   DG  E "O4'" 
2637 C "C3'" . DG  E 1  ? 2.2204 2.2789 2.5616 0.0747  -0.0915 0.0097  1   DG  E "C3'" 
2638 O "O3'" . DG  E 1  ? 2.2779 2.3919 2.6395 0.0269  -0.1494 -0.0323 1   DG  E "O3'" 
2639 C "C2'" . DG  E 1  ? 2.1634 2.2466 2.4358 0.1477  -0.0981 0.0410  1   DG  E "C2'" 
2640 C "C1'" . DG  E 1  ? 2.4706 2.5204 2.7358 0.1782  -0.0566 0.0772  1   DG  E "C1'" 
2641 N N9    . DG  E 1  ? 2.6201 2.6035 2.8659 0.2257  0.0092  0.1148  1   DG  E N9    
2642 C C8    . DG  E 1  ? 2.7019 2.6143 2.9888 0.2093  0.0683  0.1275  1   DG  E C8    
2643 N N7    . DG  E 1  ? 2.5701 2.4348 2.8279 0.2622  0.1185  0.1634  1   DG  E N7    
2644 C C5    . DG  E 1  ? 2.4570 2.3629 2.6485 0.3174  0.0915  0.1744  1   DG  E C5    
2645 C C6    . DG  E 1  ? 2.6085 2.4917 2.7440 0.3881  0.1218  0.2098  1   DG  E C6    
2646 O O6    . DG  E 1  ? 2.8181 2.6394 2.9515 0.4167  0.1813  0.2397  1   DG  E O6    
2647 N N1    . DG  E 1  ? 2.4638 2.4041 2.5430 0.4268  0.0743  0.2086  1   DG  E N1    
2648 C C2    . DG  E 1  ? 2.2091 2.2203 2.2886 0.4001  0.0053  0.1783  1   DG  E C2    
2649 N N2    . DG  E 1  ? 2.0118 2.0696 2.0362 0.4452  -0.0354 0.1834  1   DG  E N2    
2650 N N3    . DG  E 1  ? 2.1689 2.2034 2.3006 0.3336  -0.0231 0.1454  1   DG  E N3    
2651 C C4    . DG  E 1  ? 2.3815 2.3601 2.5661 0.2956  0.0233  0.1451  1   DG  E C4    
2664 P P     . DG  E 2  ? 2.0513 2.1657 2.4143 0.0150  -0.1584 -0.0551 2   DG  E P     
2665 O OP1   . DG  E 2  ? 1.8328 1.9970 2.2345 -0.0480 -0.2110 -0.0986 2   DG  E OP1   
2666 O OP2   . DG  E 2  ? 1.9888 2.0211 2.3641 0.0236  -0.0953 -0.0416 2   DG  E OP2   
2667 O "O5'" . DG  E 2  ? 1.1018 1.2596 1.4004 0.0762  -0.1830 -0.0371 2   DG  E "O5'" 
2668 C "C5'" . DG  E 2  ? 1.2833 1.5179 1.5607 0.0829  -0.2441 -0.0426 2   DG  E "C5'" 
2669 C "C4'" . DG  E 2  ? 1.4177 1.6799 1.6357 0.1455  -0.2596 -0.0212 2   DG  E "C4'" 
2670 O "O4'" . DG  E 2  ? 1.6948 1.9051 1.8747 0.2052  -0.2076 0.0195  2   DG  E "O4'" 
2671 C "C3'" . DG  E 2  ? 1.5836 1.8479 1.7958 0.1477  -0.2608 -0.0318 2   DG  E "C3'" 
2672 O "O3'" . DG  E 2  ? 1.4499 1.7892 1.6383 0.1615  -0.3212 -0.0380 2   DG  E "O3'" 
2673 C "C2'" . DG  E 2  ? 2.1083 2.3059 2.2858 0.2027  -0.1989 0.0018  2   DG  E "C2'" 
2674 C "C1'" . DG  E 2  ? 1.9875 2.1680 2.1367 0.2450  -0.1784 0.0351  2   DG  E "C1'" 
2675 N N9    . DG  E 2  ? 2.0857 2.1851 2.2362 0.2660  -0.1061 0.0618  2   DG  E N9    
2676 C C8    . DG  E 2  ? 2.2130 2.2574 2.4140 0.2240  -0.0660 0.0538  2   DG  E C8    
2677 N N7    . DG  E 2  ? 2.2735 2.2511 2.4669 0.2563  -0.0043 0.0855  2   DG  E N7    
2678 C C5    . DG  E 2  ? 2.2086 2.1971 2.3396 0.3248  -0.0021 0.1156  2   DG  E C5    
2679 C C6    . DG  E 2  ? 2.2808 2.2175 2.3768 0.3843  0.0524  0.1570  2   DG  E C6    
2680 O O6    . DG  E 2  ? 2.3741 2.2443 2.4904 0.3873  0.1110  0.1770  2   DG  E O6    
2681 N N1    . DG  E 2  ? 2.2078 2.1766 2.2411 0.4448  0.0324  0.1761  2   DG  E N1    
2682 C C2    . DG  E 2  ? 1.8841 1.9257 1.8950 0.4464  -0.0337 0.1582  2   DG  E C2    
2683 N N2    . DG  E 2  ? 1.4444 1.5052 1.3956 0.5096  -0.0460 0.1813  2   DG  E N2    
2684 N N3    . DG  E 2  ? 1.9505 2.0430 1.9967 0.3903  -0.0853 0.1210  2   DG  E N3    
2685 C C4    . DG  E 2  ? 2.0529 2.1151 2.1571 0.3317  -0.0651 0.1011  2   DG  E C4    
2697 P P     . DC  E 3  ? 1.4913 1.8526 1.6733 0.1638  -0.3352 -0.0493 3   DC  E P     
2698 O OP1   . DC  E 3  ? 1.5542 2.0045 1.7411 0.1472  -0.4089 -0.0665 3   DC  E OP1   
2699 O OP2   . DC  E 3  ? 1.8050 2.1141 2.0232 0.1259  -0.2962 -0.0683 3   DC  E OP2   
2700 O "O5'" . DC  E 3  ? 1.0718 1.4049 1.1950 0.2395  -0.3040 -0.0116 3   DC  E "O5'" 
2701 C "C5'" . DC  E 3  ? 1.3801 1.7437 1.4585 0.2910  -0.3286 0.0136  3   DC  E "C5'" 
2702 C "C4'" . DC  E 3  ? 1.4354 1.7517 1.4624 0.3594  -0.2832 0.0494  3   DC  E "C4'" 
2703 O "O4'" . DC  E 3  ? 1.6650 1.9034 1.6962 0.3668  -0.2165 0.0660  3   DC  E "O4'" 
2704 C "C3'" . DC  E 3  ? 1.2761 1.5840 1.2917 0.3732  -0.2701 0.0488  3   DC  E "C3'" 
2705 O "O3'" . DC  E 3  ? 1.5182 1.8643 1.4879 0.4257  -0.2992 0.0681  3   DC  E "O3'" 
2706 C "C2'" . DC  E 3  ? 1.4642 1.6832 1.4736 0.3919  -0.1938 0.0659  3   DC  E "C2'" 
2707 C "C1'" . DC  E 3  ? 1.4162 1.6013 1.4217 0.4052  -0.1667 0.0858  3   DC  E "C1'" 
2708 N N1    . DC  E 3  ? 1.6308 1.7375 1.6654 0.3866  -0.1024 0.0895  3   DC  E N1    
2709 C C2    . DC  E 3  ? 1.8829 1.9237 1.8890 0.4355  -0.0418 0.1237  3   DC  E C2    
2710 O O2    . DC  E 3  ? 1.5233 1.5697 1.4767 0.4956  -0.0404 0.1501  3   DC  E O2    
2711 N N3    . DC  E 3  ? 2.1825 2.1537 2.2217 0.4157  0.0134  0.1275  3   DC  E N3    
2712 C C4    . DC  E 3  ? 1.9887 1.9531 2.0854 0.3511  0.0090  0.0982  3   DC  E C4    
2713 N N4    . DC  E 3  ? 2.0823 1.9757 2.2132 0.3337  0.0622  0.1042  3   DC  E N4    
2714 C C5    . DC  E 3  ? 1.6976 1.7275 1.8208 0.3014  -0.0513 0.0621  3   DC  E C5    
2715 C C6    . DC  E 3  ? 1.5380 1.6377 1.6294 0.3211  -0.1046 0.0596  3   DC  E C6    
2727 P P     . DC  E 4  ? 1.7067 2.0623 1.6601 0.4452  -0.2987 0.0695  4   DC  E P     
2728 O OP1   . DC  E 4  ? 1.4526 1.8738 1.3761 0.4803  -0.3539 0.0814  4   DC  E OP1   
2729 O OP2   . DC  E 4  ? 1.6135 1.9721 1.6132 0.3874  -0.2983 0.0370  4   DC  E OP2   
2730 O "O5'" . DC  E 4  ? 1.3003 1.5735 1.2179 0.4951  -0.2266 0.0985  4   DC  E "O5'" 
2731 C "C5'" . DC  E 4  ? 1.7070 1.9613 1.5753 0.5575  -0.2120 0.1328  4   DC  E "C5'" 
2732 C "C4'" . DC  E 4  ? 1.9605 2.1328 1.8056 0.5938  -0.1391 0.1565  4   DC  E "C4'" 
2733 O "O4'" . DC  E 4  ? 1.9937 2.1090 1.8755 0.5587  -0.0933 0.1502  4   DC  E "O4'" 
2734 C "C3'" . DC  E 4  ? 1.4479 1.6064 1.2863 0.6014  -0.1221 0.1528  4   DC  E "C3'" 
2735 O "O3'" . DC  E 4  ? 1.6612 1.7995 1.4456 0.6684  -0.1016 0.1842  4   DC  E "O3'" 
2736 C "C2'" . DC  E 4  ? 1.4866 1.5771 1.3605 0.5666  -0.0680 0.1411  4   DC  E "C2'" 
2737 C "C1'" . DC  E 4  ? 1.9090 1.9614 1.7929 0.5642  -0.0395 0.1543  4   DC  E "C1'" 
2738 N N1    . DC  E 4  ? 1.7794 1.7898 1.7182 0.5077  -0.0114 0.1334  4   DC  E N1    
2739 C C2    . DC  E 4  ? 2.0556 1.9836 2.0018 0.5164  0.0543  0.1483  4   DC  E C2    
2740 O O2    . DC  E 4  ? 2.1663 2.0568 2.0723 0.5715  0.0911  0.1792  4   DC  E O2    
2741 N N3    . DC  E 4  ? 2.1210 2.0113 2.1208 0.4637  0.0750  0.1288  4   DC  E N3    
2742 C C4    . DC  E 4  ? 1.8859 1.8170 1.9277 0.4051  0.0346  0.0950  4   DC  E C4    
2743 N N4    . DC  E 4  ? 2.0078 1.8971 2.1019 0.3551  0.0559  0.0764  4   DC  E N4    
2744 C C5    . DC  E 4  ? 1.4864 1.5024 1.5201 0.3951  -0.0310 0.0794  4   DC  E C5    
2745 C C6    . DC  E 4  ? 1.4642 1.5170 1.4476 0.4470  -0.0521 0.0998  4   DC  E C6    
2757 P P     . DC  E 5  ? 2.3223 2.4613 2.0873 0.6900  -0.0954 0.1855  5   DC  E P     
2758 O OP1   . DC  E 5  ? 1.9256 2.0666 1.6335 0.7593  -0.0960 0.2178  5   DC  E OP1   
2759 O OP2   . DC  E 5  ? 2.4900 2.6923 2.2892 0.6435  -0.1446 0.1546  5   DC  E OP2   
2760 O "O5'" . DC  E 5  ? 1.8430 1.8972 1.6202 0.6826  -0.0254 0.1855  5   DC  E "O5'" 
2761 C "C5'" . DC  E 5  ? 2.4329 2.4177 2.1863 0.7212  0.0314  0.2148  5   DC  E "C5'" 
2762 C "C4'" . DC  E 5  ? 2.6576 2.5676 2.4352 0.7027  0.0892  0.2097  5   DC  E "C4'" 
2763 O "O4'" . DC  E 5  ? 2.3781 2.2778 2.2112 0.6418  0.0901  0.1861  5   DC  E "O4'" 
2764 C "C3'" . DC  E 5  ? 2.5822 2.4912 2.3614 0.6955  0.0899  0.1928  5   DC  E "C3'" 
2765 O "O3'" . DC  E 5  ? 2.5494 2.4113 2.2868 0.7500  0.1317  0.2189  5   DC  E "O3'" 
2766 C "C2'" . DC  E 5  ? 2.4062 2.2788 2.2398 0.6365  0.1084  0.1641  5   DC  E "C2'" 
2767 C "C1'" . DC  E 5  ? 2.3106 2.1586 2.1708 0.6164  0.1241  0.1707  5   DC  E "C1'" 
2768 N N1    . DC  E 5  ? 2.2666 2.1224 2.1857 0.5468  0.1071  0.1368  5   DC  E N1    
2769 C C2    . DC  E 5  ? 2.7261 2.5122 2.6850 0.5166  0.1501  0.1296  5   DC  E C2    
2770 O O2    . DC  E 5  ? 3.1765 2.8948 3.1231 0.5472  0.2026  0.1522  5   DC  E O2    
2771 N N3    . DC  E 5  ? 2.5814 2.3751 2.5934 0.4538  0.1319  0.0982  5   DC  E N3    
2772 C C4    . DC  E 5  ? 2.0574 1.9253 2.0827 0.4214  0.0750  0.0746  5   DC  E C4    
2773 N N4    . DC  E 5  ? 1.7969 1.6686 1.8745 0.3598  0.0594  0.0435  5   DC  E N4    
2774 C C5    . DC  E 5  ? 1.8778 1.8185 1.8650 0.4508  0.0303  0.0823  5   DC  E C5    
2775 C C6    . DC  E 5  ? 2.0716 2.0028 2.0072 0.5130  0.0476  0.1133  5   DC  E C6    
2787 P P     . DA  E 6  ? 2.6595 2.5115 2.3870 0.7571  0.1406  0.2082  6   DA  E P     
2788 O OP1   . DA  E 6  ? 2.8662 2.7169 2.5371 0.8227  0.1500  0.2380  6   DA  E OP1   
2789 O OP2   . DA  E 6  ? 2.4615 2.3754 2.2202 0.7095  0.0912  0.1736  6   DA  E OP2   
2790 O "O5'" . DA  E 6  ? 2.5858 2.3488 2.3385 0.7407  0.2003  0.2043  6   DA  E "O5'" 
2791 C "C5'" . DA  E 6  ? 2.8620 2.5573 2.6029 0.7714  0.2534  0.2346  6   DA  E "C5'" 
2792 C "C4'" . DA  E 6  ? 3.0777 2.7004 2.8622 0.7370  0.2961  0.2237  6   DA  E "C4'" 
2793 O "O4'" . DA  E 6  ? 2.9807 2.6274 2.8177 0.6744  0.2686  0.1947  6   DA  E "O4'" 
2794 C "C3'" . DA  E 6  ? 3.2215 2.8102 3.0073 0.7340  0.3123  0.2072  6   DA  E "C3'" 
2795 O "O3'" . DA  E 6  ? 3.3927 2.8939 3.1853 0.7482  0.3710  0.2240  6   DA  E "O3'" 
2796 C "C2'" . DA  E 6  ? 3.0826 2.6992 2.9160 0.6700  0.2781  0.1648  6   DA  E "C2'" 
2797 C "C1'" . DA  E 6  ? 2.9312 2.5533 2.8032 0.6337  0.2714  0.1633  6   DA  E "C1'" 
2798 N N9    . DA  E 6  ? 2.6929 2.3756 2.5992 0.5797  0.2202  0.1287  6   DA  E N9    
2799 C C8    . DA  E 6  ? 2.5019 2.2667 2.3945 0.5756  0.1662  0.1143  6   DA  E C8    
2800 N N7    . DA  E 6  ? 2.3338 2.1392 2.2667 0.5210  0.1286  0.0835  6   DA  E N7    
2801 C C5    . DA  E 6  ? 2.4274 2.1721 2.4027 0.4868  0.1597  0.0766  6   DA  E C5    
2802 C C6    . DA  E 6  ? 2.4000 2.1464 2.4297 0.4250  0.1442  0.0477  6   DA  E C6    
2803 N N6    . DA  E 6  ? 2.4079 2.2233 2.4576 0.3854  0.0915  0.0188  6   DA  E N6    
2804 N N1    . DA  E 6  ? 2.5627 2.2372 2.6279 0.4053  0.1846  0.0508  6   DA  E N1    
2805 C C2    . DA  E 6  ? 2.9847 2.5919 3.0326 0.4449  0.2370  0.0816  6   DA  E C2    
2806 N N3    . DA  E 6  ? 3.0384 2.6367 3.0350 0.5040  0.2572  0.1100  6   DA  E N3    
2807 C C4    . DA  E 6  ? 2.7237 2.3931 2.6849 0.5222  0.2160  0.1051  6   DA  E C4    
2819 P P     . DT  E 7  ? 3.3469 2.7946 3.1394 0.7514  0.3968  0.2109  7   DT  E P     
2820 O OP1   . DT  E 7  ? 3.6450 3.0170 3.4206 0.7928  0.4542  0.2442  7   DT  E OP1   
2821 O OP2   . DT  E 7  ? 3.2917 2.7972 3.0537 0.7629  0.3595  0.1949  7   DT  E OP2   
2822 O "O5'" . DT  E 7  ? 3.2429 2.6631 3.0991 0.6859  0.3935  0.1763  7   DT  E "O5'" 
2823 C "C5'" . DT  E 7  ? 3.4722 2.8511 3.3724 0.6587  0.4170  0.1842  7   DT  E "C5'" 
2824 C "C4'" . DT  E 7  ? 3.5539 2.9300 3.5121 0.5925  0.3963  0.1453  7   DT  E "C4'" 
2825 O "O4'" . DT  E 7  ? 3.4543 2.9162 3.4148 0.5648  0.3402  0.1221  7   DT  E "O4'" 
2826 C "C3'" . DT  E 7  ? 3.5724 2.9106 3.5418 0.5779  0.4000  0.1166  7   DT  E "C3'" 
2827 O "O3'" . DT  E 7  ? 3.7279 2.9821 3.7421 0.5565  0.4371  0.1165  7   DT  E "O3'" 
2828 C "C2'" . DT  E 7  ? 3.3764 2.7797 3.3635 0.5330  0.3461  0.0753  7   DT  E "C2'" 
2829 C "C1'" . DT  E 7  ? 3.3250 2.7887 3.3233 0.5143  0.3176  0.0809  7   DT  E "C1'" 
2830 N N1    . DT  E 7  ? 3.1573 2.7131 3.1461 0.4972  0.2596  0.0576  7   DT  E N1    
2831 C C2    . DT  E 7  ? 2.9564 2.5465 2.9890 0.4399  0.2246  0.0270  7   DT  E C2    
2832 O O2    . DT  E 7  ? 2.8969 2.4458 2.9763 0.4008  0.2376  0.0167  7   DT  E O2    
2833 N N3    . DT  E 7  ? 2.6761 2.3523 2.6978 0.4295  0.1724  0.0095  7   DT  E N3    
2834 C C4    . DT  E 7  ? 2.5676 2.2982 2.5426 0.4693  0.1515  0.0205  7   DT  E C4    
2835 O O4    . DT  E 7  ? 2.3722 2.1808 2.3462 0.4549  0.1031  0.0052  7   DT  E O4    
2836 C C5    . DT  E 7  ? 2.7567 2.4464 2.6870 0.5283  0.1900  0.0520  7   DT  E C5    
2837 C C7    . DT  E 7  ? 2.6924 2.4332 2.5715 0.5756  0.1719  0.0672  7   DT  E C7    
2838 C C6    . DT  E 7  ? 3.0448 2.6503 2.9831 0.5393  0.2417  0.0682  7   DT  E C6    
2851 P P     . DT  E 8  ? 3.6203 2.8150 3.6501 0.5441  0.4474  0.0893  8   DT  E P     
2852 O OP1   . DT  E 8  ? 4.0609 3.1635 4.1104 0.5586  0.4998  0.1138  8   DT  E OP1   
2853 O OP2   . DT  E 8  ? 3.5082 2.7435 3.4880 0.5733  0.4264  0.0775  8   DT  E OP2   
2854 O "O5'" . DT  E 8  ? 3.1224 2.3280 3.2084 0.4762  0.4145  0.0471  8   DT  E "O5'" 
2855 C "C5'" . DT  E 8  ? 3.2459 2.4298 3.3860 0.4371  0.4222  0.0507  8   DT  E "C5'" 
2856 C "C4'" . DT  E 8  ? 3.3001 2.5163 3.4812 0.3763  0.3800  0.0075  8   DT  E "C4'" 
2857 O "O4'" . DT  E 8  ? 3.2701 2.5827 3.4220 0.3753  0.3341  -0.0042 8   DT  E "O4'" 
2858 C "C3'" . DT  E 8  ? 3.2560 2.4327 3.4538 0.3550  0.3720  -0.0303 8   DT  E "C3'" 
2859 O "O3'" . DT  E 8  ? 3.3580 2.4751 3.6201 0.3083  0.3806  -0.0456 8   DT  E "O3'" 
2860 C "C2'" . DT  E 8  ? 3.0353 2.2957 3.2149 0.3381  0.3198  -0.0638 8   DT  E "C2'" 
2861 C "C1'" . DT  E 8  ? 3.0112 2.3496 3.1822 0.3350  0.2965  -0.0485 8   DT  E "C1'" 
2862 N N1    . DT  E 8  ? 2.7776 2.2063 2.9063 0.3507  0.2556  -0.0569 8   DT  E N1    
2863 C C2    . DT  E 8  ? 2.6014 2.1005 2.7494 0.3093  0.2074  -0.0847 8   DT  E C2    
2864 O O2    . DT  E 8  ? 2.3666 1.8585 2.5628 0.2592  0.1955  -0.1052 8   DT  E O2    
2865 N N3    . DT  E 8  ? 2.5482 2.1281 2.6583 0.3287  0.1724  -0.0869 8   DT  E N3    
2866 C C4    . DT  E 8  ? 2.4352 2.0318 2.4915 0.3839  0.1805  -0.0648 8   DT  E C4    
2867 O O4    . DT  E 8  ? 2.1315 1.8040 2.1612 0.3965  0.1455  -0.0671 8   DT  E O4    
2868 C C5    . DT  E 8  ? 2.6037 2.1229 2.6399 0.4250  0.2320  -0.0379 8   DT  E C5    
2869 C C7    . DT  E 8  ? 2.5546 2.0821 2.5326 0.4862  0.2456  -0.0127 8   DT  E C7    
2870 C C6    . DT  E 8  ? 2.7272 2.1678 2.8003 0.4066  0.2665  -0.0351 8   DT  E C6    
2883 P P     . DC  E 9  ? 3.4786 2.5210 3.7656 0.2922  0.3860  -0.0765 9   DC  E P     
2884 O OP1   . DC  E 9  ? 3.5591 2.5302 3.9128 0.2560  0.4069  -0.0736 9   DC  E OP1   
2885 O OP2   . DC  E 9  ? 3.7570 2.7713 3.9949 0.3454  0.4079  -0.0642 9   DC  E OP2   
2886 O "O5'" . DC  E 9  ? 3.1010 2.2009 3.3902 0.2554  0.3336  -0.1258 9   DC  E "O5'" 
2887 C "C5'" . DC  E 9  ? 3.0916 2.2271 3.4242 0.2009  0.3035  -0.1472 9   DC  E "C5'" 
2888 C "C4'" . DC  E 9  ? 3.0150 2.2176 3.3343 0.1798  0.2547  -0.1881 9   DC  E "C4'" 
2889 O "O4'" . DC  E 9  ? 2.9307 2.2156 3.1943 0.2159  0.2381  -0.1733 9   DC  E "O4'" 
2890 C "C3'" . DC  E 9  ? 3.1193 2.2795 3.4327 0.1820  0.2497  -0.2209 9   DC  E "C3'" 
2891 O "O3'" . DC  E 9  ? 3.1675 2.3412 3.5166 0.1305  0.2138  -0.2648 9   DC  E "O3'" 
2892 C "C2'" . DC  E 9  ? 3.0667 2.2822 3.3140 0.2301  0.2407  -0.2146 9   DC  E "C2'" 
2893 C "C1'" . DC  E 9  ? 2.7973 2.1083 3.0300 0.2281  0.2160  -0.1992 9   DC  E "C1'" 
2894 N N1    . DC  E 9  ? 2.5758 1.9391 2.7475 0.2822  0.2173  -0.1723 9   DC  E N1    
2895 C C2    . DC  E 9  ? 2.4897 1.9521 2.6373 0.2829  0.1760  -0.1791 9   DC  E C2    
2896 O O2    . DC  E 9  ? 2.4973 2.0059 2.6730 0.2386  0.1387  -0.2076 9   DC  E O2    
2897 N N3    . DC  E 9  ? 2.4156 1.9214 2.5111 0.3326  0.1771  -0.1529 9   DC  E N3    
2898 C C4    . DC  E 9  ? 2.4822 1.9367 2.5474 0.3801  0.2178  -0.1226 9   DC  E C4    
2899 N N4    . DC  E 9  ? 2.3001 1.7991 2.3145 0.4281  0.2164  -0.0980 9   DC  E N4    
2900 C C5    . DC  E 9  ? 2.4880 1.8429 2.5761 0.3802  0.2609  -0.1154 9   DC  E C5    
2901 C C6    . DC  E 9  ? 2.4867 1.8000 2.6288 0.3308  0.2585  -0.1400 9   DC  E C6    
2913 P P     . DA  E 10 ? 3.5998 2.6951 3.9732 0.1136  0.2132  -0.3018 10  DA  E P     
2914 O OP1   . DA  E 10 ? 3.6827 2.7025 4.1203 0.0769  0.2311  -0.3005 10  DA  E OP1   
2915 O OP2   . DA  E 10 ? 3.7290 2.7935 4.0540 0.1662  0.2325  -0.2948 10  DA  E OP2   
2916 O "O5'" . DA  E 10 ? 3.1151 2.2744 3.4914 0.0783  0.1626  -0.3477 10  DA  E "O5'" 
2917 C "C5'" . DA  E 10 ? 3.2430 2.4538 3.6558 0.0289  0.1339  -0.3601 10  DA  E "C5'" 
2918 C "C4'" . DA  E 10 ? 3.2826 2.5954 3.6672 0.0241  0.0901  -0.3803 10  DA  E "C4'" 
2919 O "O4'" . DA  E 10 ? 3.2649 2.6364 3.5952 0.0731  0.0954  -0.3481 10  DA  E "O4'" 
2920 C "C3'" . DA  E 10 ? 3.2298 2.5400 3.6010 0.0228  0.0676  -0.4208 10  DA  E "C3'" 
2921 O "O3'" . DA  E 10 ? 3.2148 2.6000 3.5997 -0.0157 0.0228  -0.4503 10  DA  E "O3'" 
2922 C "C2'" . DA  E 10 ? 3.1030 2.4385 3.4107 0.0832  0.0784  -0.4019 10  DA  E "C2'" 
2923 C "C1'" . DA  E 10 ? 3.0357 2.4445 3.3246 0.0985  0.0773  -0.3647 10  DA  E "C1'" 
2924 N N9    . DA  E 10 ? 2.8343 2.2491 3.0706 0.1584  0.1017  -0.3300 10  DA  E N9    
2925 C C8    . DA  E 10 ? 2.8738 2.2102 3.0940 0.1957  0.1440  -0.3092 10  DA  E C8    
2926 N N7    . DA  E 10 ? 2.8354 2.1998 3.0052 0.2470  0.1570  -0.2796 10  DA  E N7    
2927 C C5    . DA  E 10 ? 2.6275 2.0957 2.7810 0.2431  0.1198  -0.2804 10  DA  E C5    
2928 C C6    . DA  E 10 ? 2.4878 2.0298 2.5948 0.2828  0.1101  -0.2559 10  DA  E C6    
2929 N N6    . DA  E 10 ? 2.4608 1.9813 2.5249 0.3370  0.1398  -0.2256 10  DA  E N6    
2930 N N1    . DA  E 10 ? 2.3411 1.9798 2.4495 0.2645  0.0673  -0.2633 10  DA  E N1    
2931 C C2    . DA  E 10 ? 2.3585 2.0187 2.5097 0.2101  0.0376  -0.2938 10  DA  E C2    
2932 N N3    . DA  E 10 ? 2.4828 2.0798 2.6778 0.1691  0.0436  -0.3198 10  DA  E N3    
2933 C C4    . DA  E 10 ? 2.6103 2.1113 2.8046 0.1886  0.0855  -0.3111 10  DA  E C4    
2945 P P     . DA  E 11 ? 3.4292 2.7992 3.8278 -0.0427 -0.0053 -0.5016 11  DA  E P     
2946 O OP1   . DA  E 11 ? 3.3256 2.7920 3.7318 -0.0757 -0.0499 -0.5213 11  DA  E OP1   
2947 O OP2   . DA  E 11 ? 3.5621 2.8280 4.0081 -0.0705 0.0116  -0.5176 11  DA  E OP2   
2948 O "O5'" . DA  E 11 ? 3.3478 2.7112 3.6897 0.0119  0.0031  -0.5033 11  DA  E "O5'" 
2949 C "C5'" . DA  E 11 ? 3.2665 2.6933 3.5814 0.0174  -0.0297 -0.5297 11  DA  E "C5'" 
2950 C "C4'" . DA  E 11 ? 3.0183 2.5587 3.3043 0.0328  -0.0493 -0.5064 11  DA  E "C4'" 
2951 O "O4'" . DA  E 11 ? 2.8791 2.4132 3.1399 0.0724  -0.0178 -0.4611 11  DA  E "O4'" 
2952 C "C3'" . DA  E 11 ? 2.9759 2.5810 3.2191 0.0617  -0.0712 -0.5181 11  DA  E "C3'" 
2953 O "O3'" . DA  E 11 ? 2.8032 2.5112 3.0566 0.0340  -0.1130 -0.5274 11  DA  E "O3'" 
2954 C "C2'" . DA  E 11 ? 2.9611 2.5778 3.1540 0.1218  -0.0456 -0.4786 11  DA  E "C2'" 
2955 C "C1'" . DA  E 11 ? 2.8010 2.3977 3.0094 0.1194  -0.0221 -0.4432 11  DA  E "C1'" 
2956 N N9    . DA  E 11 ? 2.9378 2.4783 3.1132 0.1697  0.0195  -0.4122 11  DA  E N9    
2957 C C8    . DA  E 11 ? 3.2916 2.7256 3.4753 0.1791  0.0548  -0.4128 11  DA  E C8    
2958 N N7    . DA  E 11 ? 3.2584 2.6638 3.4068 0.2280  0.0879  -0.3805 11  DA  E N7    
2959 C C5    . DA  E 11 ? 2.8965 2.3949 3.0103 0.2528  0.0731  -0.3574 11  DA  E C5    
2960 C C6    . DA  E 11 ? 2.7570 2.2768 2.8248 0.3054  0.0920  -0.3198 11  DA  E C6    
2961 N N6    . DA  E 11 ? 2.8909 2.3372 2.9378 0.3436  0.1331  -0.2985 11  DA  E N6    
2962 N N1    . DA  E 11 ? 2.6364 2.2558 2.6823 0.3173  0.0658  -0.3044 11  DA  E N1    
2963 C C2    . DA  E 11 ? 2.5658 2.2593 2.6354 0.2785  0.0239  -0.3249 11  DA  E C2    
2964 N N3    . DA  E 11 ? 2.4674 2.1512 2.5788 0.2276  0.0036  -0.3606 11  DA  E N3    
2965 C C4    . DA  E 11 ? 2.7227 2.3055 2.8540 0.2174  0.0303  -0.3759 11  DA  E C4    
2977 P P     . DG  E 12 ? 3.0501 2.8355 3.2723 0.0518  -0.1430 -0.5443 12  DG  E P     
2978 O OP1   . DG  E 12 ? 2.8389 2.7005 3.0942 0.0034  -0.1858 -0.5651 12  DG  E OP1   
2979 O OP2   . DG  E 12 ? 3.1056 2.8201 3.3057 0.0767  -0.1278 -0.5680 12  DG  E OP2   
2980 O "O5'" . DG  E 12 ? 2.4273 2.2810 2.6049 0.1024  -0.1373 -0.5013 12  DG  E "O5'" 
2981 C "C5'" . DG  E 12 ? 2.5313 2.4638 2.6749 0.1318  -0.1574 -0.4995 12  DG  E "C5'" 
2982 C "C4'" . DG  E 12 ? 2.6857 2.6751 2.7975 0.1730  -0.1513 -0.4543 12  DG  E "C4'" 
2983 O "O4'" . DG  E 12 ? 2.8181 2.7266 2.9175 0.1982  -0.1091 -0.4301 12  DG  E "O4'" 
2984 C "C3'" . DG  E 12 ? 2.7497 2.7915 2.8154 0.2224  -0.1550 -0.4434 12  DG  E "C3'" 
2985 O "O3'" . DG  E 12 ? 2.6705 2.8094 2.7263 0.2378  -0.1751 -0.4098 12  DG  E "O3'" 
2986 C "C2'" . DG  E 12 ? 2.8666 2.8174 2.8968 0.2683  -0.1101 -0.4320 12  DG  E "C2'" 
2987 C "C1'" . DG  E 12 ? 2.8446 2.7378 2.8946 0.2562  -0.0853 -0.4120 12  DG  E "C1'" 
2988 N N9    . DG  E 12 ? 2.7977 2.5742 2.8435 0.2691  -0.0452 -0.4176 12  DG  E N9    
2989 C C8    . DG  E 12 ? 2.9515 2.6488 3.0256 0.2392  -0.0398 -0.4525 12  DG  E C8    
2990 N N7    . DG  E 12 ? 3.0825 2.6817 3.1493 0.2598  -0.0026 -0.4472 12  DG  E N7    
2991 C C5    . DG  E 12 ? 2.9214 2.5361 2.9511 0.3063  0.0197  -0.4065 12  DG  E C5    
2992 C C6    . DG  E 12 ? 2.9202 2.4584 2.9272 0.3453  0.0619  -0.3828 12  DG  E C6    
2993 O O6    . DG  E 12 ? 2.9436 2.3827 2.9613 0.3460  0.0882  -0.3925 12  DG  E O6    
2994 N N1    . DG  E 12 ? 2.7053 2.2919 2.6753 0.3869  0.0714  -0.3436 12  DG  E N1    
2995 C C2    . DG  E 12 ? 2.4794 2.1734 2.4381 0.3901  0.0419  -0.3288 12  DG  E C2    
2996 N N2    . DG  E 12 ? 2.5701 2.2930 2.4932 0.4337  0.0550  -0.2905 12  DG  E N2    
2997 N N3    . DG  E 12 ? 2.1733 1.9406 2.1555 0.3535  0.0014  -0.3494 12  DG  E N3    
2998 C C4    . DG  E 12 ? 2.5806 2.3029 2.5967 0.3129  -0.0066 -0.3882 12  DG  E C4    
3011 O "O5'" . DC  F 1  ? 3.7075 2.6086 3.8013 0.1598  0.6381  0.0115  1   DC  F "O5'" 
3012 C "C5'" . DC  F 1  ? 3.7478 2.6840 3.8600 0.1655  0.6429  -0.0260 1   DC  F "C5'" 
3013 C "C4'" . DC  F 1  ? 3.6089 2.5483 3.6848 0.1317  0.6521  -0.0707 1   DC  F "C4'" 
3014 O "O4'" . DC  F 1  ? 3.5288 2.3948 3.5959 0.1108  0.6679  -0.0861 1   DC  F "O4'" 
3015 C "C3'" . DC  F 1  ? 3.5467 2.5249 3.5702 0.1093  0.6408  -0.0637 1   DC  F "C3'" 
3016 O "O3'" . DC  F 1  ? 3.6552 2.7077 3.6757 0.1158  0.6302  -0.0744 1   DC  F "O3'" 
3017 C "C2'" . DC  F 1  ? 3.2840 2.2223 3.2723 0.0721  0.6551  -0.0989 1   DC  F "C2'" 
3018 C "C1'" . DC  F 1  ? 3.0314 1.8958 3.0490 0.0752  0.6717  -0.1085 1   DC  F "C1'" 
3019 N N1    . DC  F 1  ? 3.0472 1.8536 3.0398 0.0577  0.6745  -0.0880 1   DC  F N1    
3020 C C2    . DC  F 1  ? 3.0237 1.7984 2.9769 0.0223  0.6852  -0.1158 1   DC  F C2    
3021 O O2    . DC  F 1  ? 2.9904 1.7850 2.9309 0.0062  0.6927  -0.1575 1   DC  F O2    
3022 N N3    . DC  F 1  ? 3.0382 1.7603 2.9688 0.0066  0.6874  -0.0962 1   DC  F N3    
3023 C C4    . DC  F 1  ? 3.2276 1.9299 3.1737 0.0247  0.6791  -0.0504 1   DC  F C4    
3024 N N4    . DC  F 1  ? 3.0869 1.7375 3.0104 0.0081  0.6815  -0.0320 1   DC  F N4    
3025 C C5    . DC  F 1  ? 3.3535 2.0886 3.3397 0.0609  0.6682  -0.0214 1   DC  F C5    
3026 C C6    . DC  F 1  ? 3.2103 1.9966 3.2177 0.0760  0.6662  -0.0416 1   DC  F C6    
3039 P P     . DT  F 2  ? 3.4899 2.5981 3.4655 0.1048  0.6122  -0.0555 2   DT  F P     
3040 O OP1   . DT  F 2  ? 3.7505 2.9321 3.7387 0.1204  0.6015  -0.0650 2   DT  F OP1   
3041 O OP2   . DT  F 2  ? 3.4436 2.5334 3.4106 0.1132  0.6022  -0.0061 2   DT  F OP2   
3042 O "O5'" . DT  F 2  ? 3.0276 2.1177 2.9541 0.0631  0.6213  -0.0889 2   DT  F "O5'" 
3043 C "C5'" . DT  F 2  ? 3.2783 2.3780 3.2037 0.0474  0.6328  -0.1388 2   DT  F "C5'" 
3044 C "C4'" . DT  F 2  ? 3.2267 2.2984 3.1041 0.0079  0.6418  -0.1632 2   DT  F "C4'" 
3045 O "O4'" . DT  F 2  ? 3.2396 2.2369 3.1132 -0.0008 0.6519  -0.1500 2   DT  F "O4'" 
3046 C "C3'" . DT  F 2  ? 3.0190 2.1334 2.8463 -0.0098 0.6267  -0.1501 2   DT  F "C3'" 
3047 O "O3'" . DT  F 2  ? 2.8734 2.0208 2.6758 -0.0332 0.6297  -0.1910 2   DT  F "O3'" 
3048 C "C2'" . DT  F 2  ? 2.9749 2.0339 2.7700 -0.0289 0.6296  -0.1289 2   DT  F "C2'" 
3049 C "C1'" . DT  F 2  ? 2.8625 1.8482 2.6836 -0.0307 0.6496  -0.1454 2   DT  F "C1'" 
3050 N N1    . DT  F 2  ? 2.8994 1.8258 2.7186 -0.0297 0.6510  -0.1106 2   DT  F N1    
3051 C C2    . DT  F 2  ? 2.9046 1.7727 2.6948 -0.0587 0.6632  -0.1228 2   DT  F C2    
3052 O O2    . DT  F 2  ? 2.9337 1.7949 2.6984 -0.0860 0.6736  -0.1615 2   DT  F O2    
3053 N N3    . DT  F 2  ? 2.9341 1.7515 2.7268 -0.0545 0.6628  -0.0873 2   DT  F N3    
3054 C C4    . DT  F 2  ? 3.0007 1.8204 2.8217 -0.0249 0.6519  -0.0418 2   DT  F C4    
3055 O O4    . DT  F 2  ? 3.2274 1.9991 3.0491 -0.0239 0.6525  -0.0121 2   DT  F O4    
3056 C C5    . DT  F 2  ? 2.9685 1.8506 2.8182 0.0045  0.6399  -0.0318 2   DT  F C5    
3057 C C7    . DT  F 2  ? 3.1488 2.0402 3.0306 0.0385  0.6276  0.0161  2   DT  F C7    
3058 C C6    . DT  F 2  ? 2.9341 1.8655 2.7814 0.0007  0.6399  -0.0663 2   DT  F C6    
3071 P P     . DT  F 3  ? 3.4385 2.6446 3.1927 -0.0499 0.6128  -0.1859 3   DT  F P     
3072 O OP1   . DT  F 3  ? 3.4314 2.6890 3.1879 -0.0556 0.6129  -0.2244 3   DT  F OP1   
3073 O OP2   . DT  F 3  ? 3.4486 2.6822 3.2031 -0.0275 0.5934  -0.1363 3   DT  F OP2   
3074 O "O5'" . DT  F 3  ? 2.7897 1.9494 2.4934 -0.0875 0.6212  -0.1945 3   DT  F "O5'" 
3075 C "C5'" . DT  F 3  ? 3.0380 2.1620 2.7320 -0.1139 0.6405  -0.2391 3   DT  F "C5'" 
3076 C "C4'" . DT  F 3  ? 3.0055 2.0753 2.6572 -0.1433 0.6475  -0.2351 3   DT  F "C4'" 
3077 O "O4'" . DT  F 3  ? 3.0843 2.1017 2.7546 -0.1282 0.6492  -0.1995 3   DT  F "O4'" 
3078 C "C3'" . DT  F 3  ? 2.6643 1.7675 2.2626 -0.1622 0.6325  -0.2189 3   DT  F "C3'" 
3079 O "O3'" . DT  F 3  ? 2.6216 1.7299 2.1821 -0.1964 0.6400  -0.2587 3   DT  F "O3'" 
3080 C "C2'" . DT  F 3  ? 2.6942 1.7464 2.2762 -0.1650 0.6312  -0.1805 3   DT  F "C2'" 
3081 C "C1'" . DT  F 3  ? 2.7403 1.7302 2.3665 -0.1496 0.6462  -0.1791 3   DT  F "C1'" 
3082 N N1    . DT  F 3  ? 2.7836 1.7487 2.4278 -0.1268 0.6385  -0.1291 3   DT  F N1    
3083 C C2    . DT  F 3  ? 2.9801 1.8765 2.6146 -0.1383 0.6474  -0.1150 3   DT  F C2    
3084 O O2    . DT  F 3  ? 3.1978 2.0504 2.8090 -0.1664 0.6614  -0.1415 3   DT  F O2    
3085 N N3    . DT  F 3  ? 3.0163 1.8965 2.6704 -0.1152 0.6390  -0.0679 3   DT  F N3    
3086 C C4    . DT  F 3  ? 2.8631 1.7879 2.5442 -0.0824 0.6235  -0.0344 3   DT  F C4    
3087 O O4    . DT  F 3  ? 2.8980 1.8033 2.5954 -0.0636 0.6174  0.0074  3   DT  F O4    
3088 C C5    . DT  F 3  ? 2.8348 1.8301 2.5239 -0.0718 0.6149  -0.0519 3   DT  F C5    
3089 C C7    . DT  F 3  ? 3.0338 2.0821 2.7515 -0.0364 0.5979  -0.0192 3   DT  F C7    
3090 C C6    . DT  F 3  ? 2.7970 1.8088 2.4679 -0.0943 0.6226  -0.0975 3   DT  F C6    
3103 P P     . DG  F 4  ? 3.2619 2.4295 2.7724 -0.2150 0.6235  -0.2581 4   DG  F P     
3104 O OP1   . DG  F 4  ? 2.9649 2.1411 2.4558 -0.2432 0.6346  -0.3079 4   DG  F OP1   
3105 O OP2   . DG  F 4  ? 3.1757 2.4082 2.7028 -0.1863 0.6024  -0.2301 4   DG  F OP2   
3106 O "O5'" . DG  F 4  ? 2.5808 1.7105 2.0463 -0.2337 0.6203  -0.2290 4   DG  F "O5'" 
3107 C "C5'" . DG  F 4  ? 2.6779 1.7412 2.1219 -0.2614 0.6382  -0.2470 4   DG  F "C5'" 
3108 C "C4'" . DG  F 4  ? 2.6120 1.6381 2.0277 -0.2678 0.6331  -0.2074 4   DG  F "C4'" 
3109 O "O4'" . DG  F 4  ? 2.6516 1.6589 2.1073 -0.2353 0.6288  -0.1680 4   DG  F "O4'" 
3110 C "C3'" . DG  F 4  ? 2.5761 1.6495 1.9451 -0.2766 0.6133  -0.1839 4   DG  F "C3'" 
3111 O "O3'" . DG  F 4  ? 2.5717 1.6028 1.8951 -0.3046 0.6175  -0.1769 4   DG  F "O3'" 
3112 C "C2'" . DG  F 4  ? 2.6272 1.7263 2.0229 -0.2408 0.5964  -0.1354 4   DG  F "C2'" 
3113 C "C1'" . DG  F 4  ? 2.6553 1.6867 2.0892 -0.2271 0.6101  -0.1226 4   DG  F "C1'" 
3114 N N9    . DG  F 4  ? 2.6915 1.7373 2.1698 -0.1884 0.6004  -0.0864 4   DG  F N9    
3115 C C8    . DG  F 4  ? 2.6869 1.7946 2.1932 -0.1615 0.5878  -0.0814 4   DG  F C8    
3116 N N7    . DG  F 4  ? 2.7251 1.8301 2.2689 -0.1293 0.5817  -0.0458 4   DG  F N7    
3117 C C5    . DG  F 4  ? 2.7984 1.8358 2.3400 -0.1351 0.5905  -0.0256 4   DG  F C5    
3118 C C6    . DG  F 4  ? 3.1082 2.1129 2.6820 -0.1102 0.5891  0.0144  4   DG  F C6    
3119 O O6    . DG  F 4  ? 3.3410 2.3708 2.9521 -0.0769 0.5798  0.0404  4   DG  F O6    
3120 N N1    . DG  F 4  ? 3.0911 2.0266 2.6508 -0.1273 0.5998  0.0232  4   DG  F N1    
3121 C C2    . DG  F 4  ? 3.0064 1.9084 2.5252 -0.1638 0.6107  -0.0036 4   DG  F C2    
3122 N N2    . DG  F 4  ? 3.1310 1.9658 2.6426 -0.1751 0.6198  0.0105  4   DG  F N2    
3123 N N3    . DG  F 4  ? 2.7570 1.6893 2.2446 -0.1875 0.6126  -0.0415 4   DG  F N3    
3124 C C4    . DG  F 4  ? 2.7371 1.7370 2.2386 -0.1713 0.6020  -0.0502 4   DG  F C4    
3136 P P     . DA  F 5  ? 2.9445 2.0088 2.2051 -0.3366 0.6092  -0.1892 5   DA  F P     
3137 O OP1   . DA  F 5  ? 2.4879 1.5577 1.7416 -0.3595 0.6225  -0.2433 5   DA  F OP1   
3138 O OP2   . DA  F 5  ? 3.0060 2.1369 2.2563 -0.3191 0.5847  -0.1571 5   DA  F OP2   
3139 O "O5'" . DA  F 5  ? 2.5346 1.5372 1.7573 -0.3593 0.6153  -0.1709 5   DA  F "O5'" 
3140 C "C5'" . DA  F 5  ? 2.5575 1.4854 1.7922 -0.3710 0.6368  -0.1877 5   DA  F "C5'" 
3141 C "C4'" . DA  F 5  ? 2.6005 1.4782 1.8418 -0.3604 0.6358  -0.1434 5   DA  F "C4'" 
3142 O "O4'" . DA  F 5  ? 2.6985 1.5913 1.9907 -0.3212 0.6277  -0.1135 5   DA  F "O4'" 
3143 C "C3'" . DA  F 5  ? 2.5909 1.4784 1.7833 -0.3718 0.6214  -0.1079 5   DA  F "C3'" 
3144 O "O3'" . DA  F 5  ? 2.6108 1.4272 1.7860 -0.3895 0.6327  -0.0983 5   DA  F "O3'" 
3145 C "C2'" . DA  F 5  ? 2.7088 1.6346 1.9266 -0.3356 0.6024  -0.0604 5   DA  F "C2'" 
3146 C "C1'" . DA  F 5  ? 2.6542 1.5523 1.9349 -0.3086 0.6124  -0.0618 5   DA  F "C1'" 
3147 N N9    . DA  F 5  ? 2.6697 1.6171 1.9882 -0.2713 0.5977  -0.0356 5   DA  F N9    
3148 C C8    . DA  F 5  ? 2.6442 1.6614 1.9707 -0.2592 0.5866  -0.0481 5   DA  F C8    
3149 N N7    . DA  F 5  ? 2.6672 1.7156 2.0302 -0.2240 0.5746  -0.0179 5   DA  F N7    
3150 C C5    . DA  F 5  ? 2.7689 1.7646 2.1491 -0.2124 0.5781  0.0172  5   DA  F C5    
3151 C C6    . DA  F 5  ? 3.1016 2.0970 2.5207 -0.1778 0.5702  0.0595  5   DA  F C6    
3152 N N6    . DA  F 5  ? 3.1432 2.1950 2.5907 -0.1473 0.5567  0.0735  5   DA  F N6    
3153 N N1    . DA  F 5  ? 3.2565 2.1909 2.6842 -0.1757 0.5765  0.0870  5   DA  F N1    
3154 C C2    . DA  F 5  ? 3.2443 2.1218 2.6438 -0.2061 0.5898  0.0727  5   DA  F C2    
3155 N N3    . DA  F 5  ? 3.0531 1.9243 2.4144 -0.2399 0.5986  0.0334  5   DA  F N3    
3156 C C4    . DA  F 5  ? 2.7569 1.6899 2.1105 -0.2412 0.5921  0.0070  5   DA  F C4    
3168 P P     . DA  F 6  ? 2.8070 1.6174 1.9248 -0.4100 0.6230  -0.0687 6   DA  F P     
3169 O OP1   . DA  F 6  ? 2.9521 1.6890 2.0497 -0.4385 0.6411  -0.0846 6   DA  F OP1   
3170 O OP2   . DA  F 6  ? 2.5535 1.4333 1.6320 -0.4202 0.6080  -0.0767 6   DA  F OP2   
3171 O "O5'" . DA  F 6  ? 2.6399 1.4493 1.7806 -0.3785 0.6093  -0.0091 6   DA  F "O5'" 
3172 C "C5'" . DA  F 6  ? 2.6988 1.4489 1.8819 -0.3625 0.6195  0.0077  6   DA  F "C5'" 
3173 C "C4'" . DA  F 6  ? 2.8590 1.6241 2.0683 -0.3285 0.6043  0.0627  6   DA  F "C4'" 
3174 O "O4'" . DA  F 6  ? 2.7994 1.6237 2.0448 -0.2987 0.5943  0.0627  6   DA  F "O4'" 
3175 C "C3'" . DA  F 6  ? 2.9406 1.7309 2.1066 -0.3320 0.5869  0.1041  6   DA  F "C3'" 
3176 O "O3'" . DA  F 6  ? 2.7483 1.4849 1.9179 -0.3286 0.5886  0.1432  6   DA  F "O3'" 
3177 C "C2'" . DA  F 6  ? 3.1006 1.9646 2.2842 -0.3003 0.5669  0.1282  6   DA  F "C2'" 
3178 C "C1'" . DA  F 6  ? 2.8605 1.7222 2.1057 -0.2751 0.5747  0.1123  6   DA  F "C1'" 
3179 N N9    . DA  F 6  ? 3.0129 1.9484 2.2753 -0.2525 0.5610  0.1095  6   DA  F N9    
3180 C C8    . DA  F 6  ? 3.0488 2.0373 2.2895 -0.2646 0.5564  0.0758  6   DA  F C8    
3181 N N7    . DA  F 6  ? 2.9531 2.0027 2.2180 -0.2379 0.5430  0.0824  6   DA  F N7    
3182 C C5    . DA  F 6  ? 3.0594 2.0952 2.3639 -0.2062 0.5389  0.1231  6   DA  F C5    
3183 C C6    . DA  F 6  ? 3.0857 2.1645 2.4296 -0.1685 0.5262  0.1486  6   DA  F C6    
3184 N N6    . DA  F 6  ? 2.9541 2.1009 2.3039 -0.1561 0.5145  0.1357  6   DA  F N6    
3185 N N1    . DA  F 6  ? 3.1314 2.1804 2.5090 -0.1439 0.5257  0.1878  6   DA  F N1    
3186 C C2    . DA  F 6  ? 3.1297 2.1105 2.5024 -0.1564 0.5369  0.2007  6   DA  F C2    
3187 N N3    . DA  F 6  ? 2.9145 1.8493 2.2521 -0.1909 0.5492  0.1796  6   DA  F N3    
3188 C C4    . DA  F 6  ? 3.0133 1.9792 2.3171 -0.2148 0.5497  0.1406  6   DA  F C4    
3200 P P     . DT  F 7  ? 3.1939 1.9431 2.3185 -0.3338 0.5731  0.1891  7   DT  F P     
3201 O OP1   . DT  F 7  ? 3.3115 1.9866 2.4207 -0.3543 0.5849  0.1985  7   DT  F OP1   
3202 O OP2   . DT  F 7  ? 2.8531 1.6648 1.9306 -0.3485 0.5610  0.1746  7   DT  F OP2   
3203 O "O5'" . DT  F 7  ? 3.0018 1.7793 2.1647 -0.2923 0.5576  0.2407  7   DT  F "O5'" 
3204 C "C5'" . DT  F 7  ? 3.2249 1.9556 2.4398 -0.2703 0.5651  0.2610  7   DT  F "C5'" 
3205 C "C4'" . DT  F 7  ? 3.0953 1.8680 2.3437 -0.2306 0.5487  0.3053  7   DT  F "C4'" 
3206 O "O4'" . DT  F 7  ? 2.9719 1.8073 2.2382 -0.2143 0.5419  0.2835  7   DT  F "O4'" 
3207 C "C3'" . DT  F 7  ? 3.1031 1.9089 2.3158 -0.2259 0.5301  0.3522  7   DT  F "C3'" 
3208 O "O3'" . DT  F 7  ? 3.1668 1.9275 2.3963 -0.2143 0.5303  0.3974  7   DT  F "O3'" 
3209 C "C2'" . DT  F 7  ? 3.0326 1.9171 2.2599 -0.1964 0.5122  0.3645  7   DT  F "C2'" 
3210 C "C1'" . DT  F 7  ? 2.9815 1.8736 2.2523 -0.1861 0.5217  0.3245  7   DT  F "C1'" 
3211 N N1    . DT  F 7  ? 2.9642 1.9291 2.2231 -0.1837 0.5113  0.2993  7   DT  F N1    
3212 C C2    . DT  F 7  ? 2.8962 1.9151 2.1887 -0.1492 0.4984  0.3153  7   DT  F C2    
3213 O O2    . DT  F 7  ? 2.9190 1.9305 2.2512 -0.1197 0.4950  0.3498  7   DT  F O2    
3214 N N3    . DT  F 7  ? 2.7642 1.8470 2.0425 -0.1507 0.4892  0.2892  7   DT  F N3    
3215 C C4    . DT  F 7  ? 2.7205 1.8185 1.9557 -0.1824 0.4916  0.2499  7   DT  F C4    
3216 O O4    . DT  F 7  ? 2.8407 1.9983 2.0680 -0.1805 0.4821  0.2293  7   DT  F O4    
3217 C C5    . DT  F 7  ? 2.7148 1.7542 1.9160 -0.2176 0.5057  0.2349  7   DT  F C5    
3218 C C7    . DT  F 7  ? 2.6687 1.7178 1.8217 -0.2542 0.5099  0.1926  7   DT  F C7    
3219 C C6    . DT  F 7  ? 2.7518 1.7280 1.9661 -0.2165 0.5147  0.2599  7   DT  F C6    
3232 P P     . DG  F 8  ? 3.5865 2.3566 2.7749 -0.2169 0.5160  0.4470  8   DG  F P     
3233 O OP1   . DG  F 8  ? 3.7589 2.4590 2.9633 -0.2176 0.5246  0.4759  8   DG  F OP1   
3234 O OP2   . DG  F 8  ? 3.4418 2.2392 2.5674 -0.2474 0.5117  0.4253  8   DG  F OP2   
3235 O "O5'" . DG  F 8  ? 2.9245 1.7612 2.1346 -0.1777 0.4958  0.4865  8   DG  F "O5'" 
3236 C "C5'" . DG  F 8  ? 3.1866 2.0148 2.4569 -0.1433 0.4961  0.5099  8   DG  F "C5'" 
3237 C "C4'" . DG  F 8  ? 3.4008 2.3024 2.6824 -0.1100 0.4761  0.5393  8   DG  F "C4'" 
3238 O "O4'" . DG  F 8  ? 3.1658 2.1227 2.4399 -0.1121 0.4722  0.4997  8   DG  F "O4'" 
3239 C "C3'" . DG  F 8  ? 3.5662 2.5004 2.8059 -0.1079 0.4586  0.5830  8   DG  F "C3'" 
3240 O "O3'" . DG  F 8  ? 3.8198 2.7754 3.0938 -0.0701 0.4469  0.6322  8   DG  F "O3'" 
3241 C "C2'" . DG  F 8  ? 3.1660 2.1663 2.3643 -0.1188 0.4472  0.5569  8   DG  F "C2'" 
3242 C "C1'" . DG  F 8  ? 2.9808 2.0042 2.2191 -0.1061 0.4521  0.5189  8   DG  F "C1'" 
3243 N N9    . DG  F 8  ? 2.9129 1.9736 2.1211 -0.1270 0.4515  0.4716  8   DG  F N9    
3244 C C8    . DG  F 8  ? 2.8522 1.8895 2.0183 -0.1658 0.4614  0.4344  8   DG  F C8    
3245 N N7    . DG  F 8  ? 2.7526 1.8358 1.9013 -0.1760 0.4578  0.3967  8   DG  F N7    
3246 C C5    . DG  F 8  ? 2.7575 1.8977 1.9387 -0.1416 0.4444  0.4096  8   DG  F C5    
3247 C C6    . DG  F 8  ? 2.7270 1.9326 1.9094 -0.1344 0.4347  0.3837  8   DG  F C6    
3248 O O6    . DG  F 8  ? 2.6882 1.9153 1.8424 -0.1578 0.4361  0.3428  8   DG  F O6    
3249 N N1    . DG  F 8  ? 2.7456 1.9934 1.9673 -0.0952 0.4223  0.4100  8   DG  F N1    
3250 C C2    . DG  F 8  ? 2.9512 2.1809 2.2069 -0.0669 0.4199  0.4556  8   DG  F C2    
3251 N N2    . DG  F 8  ? 3.3039 2.5808 2.5948 -0.0306 0.4076  0.4752  8   DG  F N2    
3252 N N3    . DG  F 8  ? 2.9717 2.1407 2.2273 -0.0734 0.4288  0.4806  8   DG  F N3    
3253 C C4    . DG  F 8  ? 2.9278 2.0548 2.1454 -0.1112 0.4406  0.4554  8   DG  F C4    
3265 P P     . DG  F 9  ? 3.5819 2.5668 2.8249 -0.0592 0.4287  0.6883  9   DG  F P     
3266 O OP1   . DG  F 9  ? 3.9267 2.8739 3.2090 -0.0366 0.4304  0.7347  9   DG  F OP1   
3267 O OP2   . DG  F 9  ? 3.3244 2.3033 2.5032 -0.0947 0.4280  0.6775  9   DG  F OP2   
3268 O "O5'" . DG  F 9  ? 3.2826 2.3542 2.5283 -0.0313 0.4091  0.6959  9   DG  F "O5'" 
3269 C "C5'" . DG  F 9  ? 3.4094 2.5036 2.7110 0.0028  0.4073  0.6993  9   DG  F "C5'" 
3270 C "C4'" . DG  F 9  ? 3.4866 2.6641 2.7784 0.0204  0.3892  0.6959  9   DG  F "C4'" 
3271 O "O4'" . DG  F 9  ? 3.3116 2.5071 2.5758 -0.0060 0.3930  0.6418  9   DG  F "O4'" 
3272 C "C3'" . DG  F 9  ? 3.7481 2.9712 2.9987 0.0281  0.3690  0.7369  9   DG  F "C3'" 
3273 O "O3'" . DG  F 9  ? 3.9053 3.1944 3.1761 0.0641  0.3519  0.7579  9   DG  F "O3'" 
3274 C "C2'" . DG  F 9  ? 3.6044 2.8442 2.7955 -0.0071 0.3671  0.7018  9   DG  F "C2'" 
3275 C "C1'" . DG  F 9  ? 3.2875 2.5386 2.5007 -0.0126 0.3757  0.6475  9   DG  F "C1'" 
3276 N N9    . DG  F 9  ? 3.1933 2.4386 2.3634 -0.0512 0.3824  0.6004  9   DG  F N9    
3277 C C8    . DG  F 9  ? 3.3303 2.5215 2.4663 -0.0869 0.3950  0.5869  9   DG  F C8    
3278 N N7    . DG  F 9  ? 3.2575 2.4594 2.3589 -0.1162 0.3985  0.5421  9   DG  F N7    
3279 C C5    . DG  F 9  ? 3.0956 2.3630 2.2096 -0.0989 0.3871  0.5254  9   DG  F C5    
3280 C C6    . DG  F 9  ? 2.8623 2.1695 1.9539 -0.1158 0.3845  0.4799  9   DG  F C6    
3281 O O6    . DG  F 9  ? 2.8386 2.1307 1.8929 -0.1509 0.3924  0.4440  9   DG  F O6    
3282 N N1    . DG  F 9  ? 2.6946 2.0652 1.8120 -0.0875 0.3711  0.4786  9   DG  F N1    
3283 C C2    . DG  F 9  ? 2.7251 2.1176 1.8838 -0.0478 0.3619  0.5160  9   DG  F C2    
3284 N N2    . DG  F 9  ? 2.8499 2.3046 2.0286 -0.0247 0.3494  0.5081  9   DG  F N2    
3285 N N3    . DG  F 9  ? 2.7647 2.1207 1.9445 -0.0316 0.3645  0.5586  9   DG  F N3    
3286 C C4    . DG  F 9  ? 3.0362 2.3306 2.1920 -0.0589 0.3771  0.5608  9   DG  F C4    
3298 P P     . DG  F 10 ? 3.3407 2.6757 2.5870 0.0856  0.3303  0.8130  10  DG  F P     
3299 O OP1   . DG  F 10 ? 3.8725 3.1890 3.1657 0.1178  0.3306  0.8593  10  DG  F OP1   
3300 O OP2   . DG  F 10 ? 2.9588 2.2818 2.1435 0.0547  0.3280  0.8166  10  DG  F OP2   
3301 O "O5'" . DG  F 10 ? 3.1261 2.5458 2.3675 0.1053  0.3118  0.8022  10  DG  F "O5'" 
3302 C "C5'" . DG  F 10 ? 3.2019 2.6462 2.4712 0.1102  0.3150  0.7598  10  DG  F "C5'" 
3303 C "C4'" . DG  F 10 ? 3.1750 2.6809 2.4033 0.0991  0.3013  0.7313  10  DG  F "C4'" 
3304 O "O4'" . DG  F 10 ? 3.2834 2.7580 2.4781 0.0570  0.3139  0.6860  10  DG  F "O4'" 
3305 C "C3'" . DG  F 10 ? 3.0705 2.6262 2.2531 0.1063  0.2793  0.7661  10  DG  F "C3'" 
3306 O "O3'" . DG  F 10 ? 3.2346 2.8646 2.4243 0.1323  0.2609  0.7659  10  DG  F "O3'" 
3307 C "C2'" . DG  F 10 ? 3.0744 2.6171 2.1963 0.0644  0.2817  0.7398  10  DG  F "C2'" 
3308 C "C1'" . DG  F 10 ? 3.0180 2.5344 2.1547 0.0409  0.2993  0.6817  10  DG  F "C1'" 
3309 N N9    . DG  F 10 ? 2.7395 2.2100 1.8362 -0.0020 0.3125  0.6533  10  DG  F N9    
3310 C C8    . DG  F 10 ? 2.7584 2.1640 1.8426 -0.0207 0.3251  0.6689  10  DG  F C8    
3311 N N7    . DG  F 10 ? 2.7975 2.1741 1.8438 -0.0594 0.3353  0.6346  10  DG  F N7    
3312 C C5    . DG  F 10 ? 2.8838 2.3096 1.9172 -0.0669 0.3291  0.5939  10  DG  F C5    
3313 C C6    . DG  F 10 ? 2.7991 2.2232 1.7945 -0.1034 0.3352  0.5461  10  DG  F C6    
3314 O O6    . DG  F 10 ? 2.6479 2.0245 1.6121 -0.1374 0.3479  0.5293  10  DG  F O6    
3315 N N1    . DG  F 10 ? 2.6263 2.1116 1.6231 -0.0976 0.3248  0.5167  10  DG  F N1    
3316 C C2    . DG  F 10 ? 2.6330 2.1734 1.6631 -0.0610 0.3104  0.5315  10  DG  F C2    
3317 N N2    . DG  F 10 ? 2.6001 2.1950 1.6269 -0.0610 0.3015  0.4986  10  DG  F N2    
3318 N N3    . DG  F 10 ? 2.6694 2.2117 1.7343 -0.0265 0.3049  0.5759  10  DG  F N3    
3319 C C4    . DG  F 10 ? 2.6991 2.1827 1.7635 -0.0319 0.3149  0.6050  10  DG  F C4    
3331 P P     . DC  F 11 ? 3.2575 2.9505 2.4084 0.1492  0.2350  0.8034  11  DC  F P     
3332 O OP1   . DC  F 11 ? 3.4641 3.2107 2.6533 0.1917  0.2213  0.8234  11  DC  F OP1   
3333 O OP2   . DC  F 11 ? 3.1676 2.8251 2.2899 0.1405  0.2358  0.8429  11  DC  F OP2   
3334 O "O5'" . DC  F 11 ? 2.7830 2.5133 1.8825 0.1210  0.2267  0.7621  11  DC  F "O5'" 
3335 C "C5'" . DC  F 11 ? 2.8372 2.6068 1.9519 0.1228  0.2239  0.7200  11  DC  F "C5'" 
3336 C "C4'" . DC  F 11 ? 2.7510 2.5469 1.8115 0.0913  0.2171  0.6843  11  DC  F "C4'" 
3337 O "O4'" . DC  F 11 ? 2.8339 2.5676 1.8750 0.0511  0.2374  0.6548  11  DC  F "O4'" 
3338 C "C3'" . DC  F 11 ? 2.9535 2.7882 1.9599 0.0922  0.1960  0.7149  11  DC  F "C3'" 
3339 O "O3'" . DC  F 11 ? 3.0928 3.0043 2.0925 0.1116  0.1737  0.7107  11  DC  F "O3'" 
3340 C "C2'" . DC  F 11 ? 3.0465 2.8494 1.9992 0.0469  0.2041  0.6885  11  DC  F "C2'" 
3341 C "C1'" . DC  F 11 ? 2.8898 2.6398 1.8686 0.0229  0.2290  0.6428  11  DC  F "C1'" 
3342 N N1    . DC  F 11 ? 2.6113 2.2915 1.5641 -0.0128 0.2473  0.6359  11  DC  F N1    
3343 C C2    . DC  F 11 ? 2.5757 2.2440 1.4888 -0.0526 0.2544  0.5919  11  DC  F C2    
3344 O O2    . DC  F 11 ? 2.5410 2.2572 1.4414 -0.0581 0.2453  0.5594  11  DC  F O2    
3345 N N3    . DC  F 11 ? 2.8003 2.4047 1.6901 -0.0842 0.2711  0.5859  11  DC  F N3    
3346 C C4    . DC  F 11 ? 2.7287 2.2824 1.6342 -0.0771 0.2800  0.6220  11  DC  F C4    
3347 N N4    . DC  F 11 ? 2.8163 2.3075 1.6981 -0.1091 0.2960  0.6143  11  DC  F N4    
3348 C C5    . DC  F 11 ? 2.6545 2.2196 1.6011 -0.0369 0.2728  0.6676  11  DC  F C5    
3349 C C6    . DC  F 11 ? 2.6497 2.2780 1.6182 -0.0060 0.2568  0.6726  11  DC  F C6    
3361 P P     . DC  F 12 ? 3.0655 3.0309 2.0157 0.1221  0.1476  0.7450  12  DC  F P     
3362 O OP1   . DC  F 12 ? 3.3986 3.4336 2.3718 0.1594  0.1275  0.7549  12  DC  F OP1   
3363 O OP2   . DC  F 12 ? 2.8596 2.7865 1.7944 0.1231  0.1507  0.7911  12  DC  F OP2   
3364 O "O5'" . DC  F 12 ? 2.5403 2.5170 1.4326 0.0823  0.1441  0.7050  12  DC  F "O5'" 
3365 C "C5'" . DC  F 12 ? 2.6887 2.6986 1.5847 0.0723  0.1418  0.6562  12  DC  F "C5'" 
3366 C "C4'" . DC  F 12 ? 2.9395 2.9463 1.7781 0.0307  0.1419  0.6231  12  DC  F "C4'" 
3367 O "O4'" . DC  F 12 ? 3.1712 3.1024 2.0042 -0.0005 0.1665  0.6116  12  DC  F "O4'" 
3368 C "C3'" . DC  F 12 ? 2.9491 2.9902 1.7287 0.0285  0.1207  0.6501  12  DC  F "C3'" 
3369 O "O3'" . DC  F 12 ? 3.0634 3.1658 1.8166 0.0235  0.1024  0.6224  12  DC  F "O3'" 
3370 C "C2'" . DC  F 12 ? 3.0052 2.9868 1.7435 -0.0089 0.1353  0.6488  12  DC  F "C2'" 
3371 C "C1'" . DC  F 12 ? 3.1195 3.0382 1.8911 -0.0302 0.1637  0.6137  12  DC  F "C1'" 
3372 N N1    . DC  F 12 ? 2.9036 2.7491 1.6758 -0.0427 0.1824  0.6357  12  DC  F N1    
3373 C C2    . DC  F 12 ? 2.6194 2.4129 1.3587 -0.0847 0.1991  0.6093  12  DC  F C2    
3374 O O2    . DC  F 12 ? 2.4381 2.2460 1.1482 -0.1120 0.1990  0.5669  12  DC  F O2    
3375 N N3    . DC  F 12 ? 2.5260 2.2533 1.2678 -0.0943 0.2152  0.6307  12  DC  F N3    
3376 C C4    . DC  F 12 ? 2.7771 2.4903 1.5520 -0.0644 0.2148  0.6768  12  DC  F C4    
3377 N N4    . DC  F 12 ? 2.8446 2.4919 1.6215 -0.0756 0.2305  0.6966  12  DC  F N4    
3378 C C5    . DC  F 12 ? 2.7644 2.5306 1.5723 -0.0216 0.1983  0.7046  12  DC  F C5    
3379 C C6    . DC  F 12 ? 2.6336 2.4642 1.4384 -0.0122 0.1826  0.6828  12  DC  F C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  0   ?   ?   ?   A . n 
A 1 2  LYS 2  94  ?   ?   ?   A . n 
A 1 3  LYS 3  95  ?   ?   ?   A . n 
A 1 4  GLN 4  96  ?   ?   ?   A . n 
A 1 5  LYS 5  97  ?   ?   ?   A . n 
A 1 6  THR 6  98  ?   ?   ?   A . n 
A 1 7  ARG 7  99  ?   ?   ?   A . n 
A 1 8  THR 8  100 100 THR THR A . n 
A 1 9  VAL 9  101 101 VAL VAL A . n 
A 1 10 PHE 10 102 102 PHE PHE A . n 
A 1 11 SER 11 103 103 SER SER A . n 
A 1 12 SER 12 104 104 SER SER A . n 
A 1 13 THR 13 105 105 THR THR A . n 
A 1 14 GLN 14 106 106 GLN GLN A . n 
A 1 15 LEU 15 107 107 LEU LEU A . n 
A 1 16 CYS 16 108 108 CYS CYS A . n 
A 1 17 VAL 17 109 109 VAL VAL A . n 
A 1 18 LEU 18 110 110 LEU LEU A . n 
A 1 19 ASN 19 111 111 ASN ASN A . n 
A 1 20 ASP 20 112 112 ASP ASP A . n 
A 1 21 ARG 21 113 113 ARG ARG A . n 
A 1 22 PHE 22 114 114 PHE PHE A . n 
A 1 23 GLN 23 115 115 GLN GLN A . n 
A 1 24 ARG 24 116 116 ARG ARG A . n 
A 1 25 GLN 25 117 117 GLN GLN A . n 
A 1 26 LYS 26 118 118 LYS LYS A . n 
A 1 27 TYR 27 119 119 TYR TYR A . n 
A 1 28 LEU 28 120 120 LEU LEU A . n 
A 1 29 SER 29 121 121 SER SER A . n 
A 1 30 LEU 30 122 122 LEU LEU A . n 
A 1 31 GLN 31 123 123 GLN GLN A . n 
A 1 32 GLN 32 124 124 GLN GLN A . n 
A 1 33 MET 33 125 125 MET MET A . n 
A 1 34 GLN 34 126 126 GLN GLN A . n 
A 1 35 GLU 35 127 127 GLU GLU A . n 
A 1 36 LEU 36 128 128 LEU LEU A . n 
A 1 37 SER 37 129 129 SER SER A . n 
A 1 38 ASN 38 130 130 ASN ASN A . n 
A 1 39 ILE 39 131 131 ILE ILE A . n 
A 1 40 LEU 40 132 132 LEU LEU A . n 
A 1 41 ASN 41 133 133 ASN ASN A . n 
A 1 42 LEU 42 134 134 LEU LEU A . n 
A 1 43 SER 43 135 135 SER SER A . n 
A 1 44 TYR 44 136 136 TYR TYR A . n 
A 1 45 LYS 45 137 137 LYS LYS A . n 
A 1 46 GLN 46 138 138 GLN GLN A . n 
A 1 47 VAL 47 139 139 VAL VAL A . n 
A 1 48 LYS 48 140 140 LYS LYS A . n 
A 1 49 THR 49 141 141 THR THR A . n 
A 1 50 TRP 50 142 142 TRP TRP A . n 
A 1 51 PHE 51 143 143 PHE PHE A . n 
A 1 52 GLN 52 144 144 GLN GLN A . n 
A 1 53 ASN 53 145 145 ASN ASN A . n 
A 1 54 GLN 54 146 146 GLN GLN A . n 
A 1 55 ARG 55 147 147 ARG ARG A . n 
A 1 56 MET 56 148 148 MET MET A . n 
A 1 57 LYS 57 149 149 LYS LYS A . n 
A 1 58 SER 58 150 150 SER SER A . n 
A 1 59 LYS 59 151 151 LYS LYS A . n 
A 1 60 ARG 60 152 152 ARG ARG A . n 
A 1 61 TRP 61 153 153 TRP TRP A . n 
A 1 62 GLN 62 154 154 GLN GLN A . n 
A 1 63 LYS 63 155 ?   ?   ?   A . n 
A 1 64 ASN 64 156 ?   ?   ?   A . n 
A 1 65 ASN 65 157 ?   ?   ?   A . n 
A 1 66 TRP 66 158 ?   ?   ?   A . n 
A 1 67 PRO 67 159 ?   ?   ?   A . n 
A 1 68 LYS 68 160 ?   ?   ?   A . n 
A 1 69 ASN 69 161 ?   ?   ?   A . n 
A 1 70 SER 70 162 ?   ?   ?   A . n 
B 2 1  DG  1  1   1   DG  DG  B . n 
B 2 2  DG  2  2   2   DG  DG  B . n 
B 2 3  DC  3  3   3   DC  DC  B . n 
B 2 4  DC  4  4   4   DC  DC  B . n 
B 2 5  DC  5  5   5   DC  DC  B . n 
B 2 6  DA  6  6   6   DA  DA  B . n 
B 2 7  DT  7  7   7   DT  DT  B . n 
B 2 8  DT  8  8   8   DT  DT  B . n 
B 2 9  DC  9  9   9   DC  DC  B . n 
B 2 10 DA  10 10  10  DA  DA  B . n 
B 2 11 DA  11 11  11  DA  DA  B . n 
B 2 12 DG  12 12  12  DG  DG  B . n 
C 3 1  DC  1  1   1   DC  DC  C . n 
C 3 2  DT  2  2   2   DT  DT  C . n 
C 3 3  DT  3  3   3   DT  DT  C . n 
C 3 4  DG  4  4   4   DG  DG  C . n 
C 3 5  DA  5  5   5   DA  DA  C . n 
C 3 6  DA  6  6   6   DA  DA  C . n 
C 3 7  DT  7  7   7   DT  DT  C . n 
C 3 8  DG  8  8   8   DG  DG  C . n 
C 3 9  DG  9  9   9   DG  DG  C . n 
C 3 10 DG  10 10  10  DG  DG  C . n 
C 3 11 DC  11 11  11  DC  DC  C . n 
C 3 12 DC  12 12  12  DC  DC  C . n 
D 1 1  GLY 1  0   ?   ?   ?   D . n 
D 1 2  LYS 2  94  ?   ?   ?   D . n 
D 1 3  LYS 3  95  ?   ?   ?   D . n 
D 1 4  GLN 4  96  ?   ?   ?   D . n 
D 1 5  LYS 5  97  ?   ?   ?   D . n 
D 1 6  THR 6  98  ?   ?   ?   D . n 
D 1 7  ARG 7  99  ?   ?   ?   D . n 
D 1 8  THR 8  100 100 THR THR D . n 
D 1 9  VAL 9  101 101 VAL VAL D . n 
D 1 10 PHE 10 102 102 PHE PHE D . n 
D 1 11 SER 11 103 103 SER SER D . n 
D 1 12 SER 12 104 104 SER SER D . n 
D 1 13 THR 13 105 105 THR THR D . n 
D 1 14 GLN 14 106 106 GLN GLN D . n 
D 1 15 LEU 15 107 107 LEU LEU D . n 
D 1 16 CYS 16 108 108 CYS CYS D . n 
D 1 17 VAL 17 109 109 VAL VAL D . n 
D 1 18 LEU 18 110 110 LEU LEU D . n 
D 1 19 ASN 19 111 111 ASN ASN D . n 
D 1 20 ASP 20 112 112 ASP ASP D . n 
D 1 21 ARG 21 113 113 ARG ARG D . n 
D 1 22 PHE 22 114 114 PHE PHE D . n 
D 1 23 GLN 23 115 115 GLN GLN D . n 
D 1 24 ARG 24 116 116 ARG ARG D . n 
D 1 25 GLN 25 117 117 GLN GLN D . n 
D 1 26 LYS 26 118 118 LYS LYS D . n 
D 1 27 TYR 27 119 119 TYR TYR D . n 
D 1 28 LEU 28 120 120 LEU LEU D . n 
D 1 29 SER 29 121 121 SER SER D . n 
D 1 30 LEU 30 122 122 LEU LEU D . n 
D 1 31 GLN 31 123 123 GLN GLN D . n 
D 1 32 GLN 32 124 124 GLN GLN D . n 
D 1 33 MET 33 125 125 MET MET D . n 
D 1 34 GLN 34 126 126 GLN GLN D . n 
D 1 35 GLU 35 127 127 GLU GLU D . n 
D 1 36 LEU 36 128 128 LEU LEU D . n 
D 1 37 SER 37 129 129 SER SER D . n 
D 1 38 ASN 38 130 130 ASN ASN D . n 
D 1 39 ILE 39 131 131 ILE ILE D . n 
D 1 40 LEU 40 132 132 LEU LEU D . n 
D 1 41 ASN 41 133 133 ASN ASN D . n 
D 1 42 LEU 42 134 134 LEU LEU D . n 
D 1 43 SER 43 135 135 SER SER D . n 
D 1 44 TYR 44 136 136 TYR TYR D . n 
D 1 45 LYS 45 137 137 LYS LYS D . n 
D 1 46 GLN 46 138 138 GLN GLN D . n 
D 1 47 VAL 47 139 139 VAL VAL D . n 
D 1 48 LYS 48 140 140 LYS LYS D . n 
D 1 49 THR 49 141 141 THR THR D . n 
D 1 50 TRP 50 142 142 TRP TRP D . n 
D 1 51 PHE 51 143 143 PHE PHE D . n 
D 1 52 GLN 52 144 144 GLN GLN D . n 
D 1 53 ASN 53 145 145 ASN ASN D . n 
D 1 54 GLN 54 146 146 GLN GLN D . n 
D 1 55 ARG 55 147 147 ARG ARG D . n 
D 1 56 MET 56 148 148 MET MET D . n 
D 1 57 LYS 57 149 149 LYS LYS D . n 
D 1 58 SER 58 150 150 SER SER D . n 
D 1 59 LYS 59 151 151 LYS LYS D . n 
D 1 60 ARG 60 152 152 ARG ARG D . n 
D 1 61 TRP 61 153 153 TRP TRP D . n 
D 1 62 GLN 62 154 ?   ?   ?   D . n 
D 1 63 LYS 63 155 ?   ?   ?   D . n 
D 1 64 ASN 64 156 ?   ?   ?   D . n 
D 1 65 ASN 65 157 ?   ?   ?   D . n 
D 1 66 TRP 66 158 ?   ?   ?   D . n 
D 1 67 PRO 67 159 ?   ?   ?   D . n 
D 1 68 LYS 68 160 ?   ?   ?   D . n 
D 1 69 ASN 69 161 ?   ?   ?   D . n 
D 1 70 SER 70 162 ?   ?   ?   D . n 
E 2 1  DG  1  1   1   DG  DG  E . n 
E 2 2  DG  2  2   2   DG  DG  E . n 
E 2 3  DC  3  3   3   DC  DC  E . n 
E 2 4  DC  4  4   4   DC  DC  E . n 
E 2 5  DC  5  5   5   DC  DC  E . n 
E 2 6  DA  6  6   6   DA  DA  E . n 
E 2 7  DT  7  7   7   DT  DT  E . n 
E 2 8  DT  8  8   8   DT  DT  E . n 
E 2 9  DC  9  9   9   DC  DC  E . n 
E 2 10 DA  10 10  10  DA  DA  E . n 
E 2 11 DA  11 11  11  DA  DA  E . n 
E 2 12 DG  12 12  12  DG  DG  E . n 
F 3 1  DC  1  1   1   DC  DC  F . n 
F 3 2  DT  2  2   2   DT  DT  F . n 
F 3 3  DT  3  3   3   DT  DT  F . n 
F 3 4  DG  4  4   4   DG  DG  F . n 
F 3 5  DA  5  5   5   DA  DA  F . n 
F 3 6  DA  6  6   6   DA  DA  F . n 
F 3 7  DT  7  7   7   DT  DT  F . n 
F 3 8  DG  8  8   8   DG  DG  F . n 
F 3 9  DG  9  9   9   DG  DG  F . n 
F 3 10 DG  10 10  10  DG  DG  F . n 
F 3 11 DC  11 11  11  DC  DC  F . n 
F 3 12 DC  12 12  12  DC  DC  F . n 
# 
loop_
_pdbx_SG_project.project_name 
_pdbx_SG_project.full_name_of_center 
_pdbx_SG_project.id 
_pdbx_SG_project.initial_of_center 
PSI:Biology 'Joint Center for Structural Genomics' 1 JCSG     
PSI:Biology 'Partnership for Stem Cell Biology'    2 STEMCELL 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C 
2 1 D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2370 ? 
1 MORE         -21  ? 
1 'SSA (A^2)'  7730 ? 
2 'ABSA (A^2)' 2290 ? 
2 MORE         -19  ? 
2 'SSA (A^2)'  7560 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-10-01 
2 'Structure model' 1 1 2015-04-08 
3 'Structure model' 1 2 2015-04-29 
4 'Structure model' 1 3 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Database references'    
3 4 'Structure model' 'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 121.2803 110.5140 46.7518 0.9485 1.2723 1.0420 0.1095  -0.2282 0.0135  0.3914 0.6299 3.4839  
0.7958  -1.6096 -1.3960 -0.3275 0.2215 -0.0082 0.3694  0.4547  0.1144  -0.6281 1.5177  -0.5774 
'X-RAY DIFFRACTION' 2 ? refined 124.8855 123.2258 40.6024 0.7894 0.9774 1.1227 -0.1378 -0.2192 0.1046  1.4647 0.2148 3.4663  
0.9129  -2.4538 -1.5656 -0.5546 0.3736 -0.0005 0.6171  0.5751  0.4921  -0.1187 -1.0788 0.2675  
'X-RAY DIFFRACTION' 3 ? refined 124.6114 123.1968 39.0230 1.4261 0.7221 1.4195 -0.1448 -0.4113 0.0385  1.9168 0.0404 4.0348  
1.1172  -2.9601 -1.8493 0.0137  0.5776 0.2563  -1.5123 0.5008  0.4078  -0.8117 -1.4029 0.2991  
'X-RAY DIFFRACTION' 4 ? refined 122.0444 99.8007  25.7571 2.0677 1.6145 0.9790 -0.1177 0.0319  0.0603  2.5578 3.0781 0.5826  
0.6460  1.4700  1.6177  -1.5164 1.0540 -0.0011 0.1908  0.2798  -0.4985 -0.7582 1.4063  -0.3094 
'X-RAY DIFFRACTION' 5 ? refined 123.0005 85.8029  31.0926 1.6453 1.3955 1.7822 0.2892  0.0975  -0.0475 1.2662 1.3320 0.3969  
-1.4690 1.2116  -0.8824 -1.2382 0.4635 0.0001  -0.3223 -1.6123 0.9773  0.5553  1.6906  0.8096  
'X-RAY DIFFRACTION' 6 ? refined 123.2159 86.0311  32.8668 2.7525 1.9018 2.0894 -0.1215 0.4876  0.2474  0.3115 0.0014 -0.0503 
-0.5227 0.2961  -0.1807 -0.4334 0.5401 -0.0012 -1.0354 -1.8512 -0.8408 0.1070  0.9698  0.8207  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 0 A 0 
;chain 'A' and (resid 100 through 154)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 B 0 B 0 
;chain 'B' and (resid 1 through 12)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 C 0 C 0 
;chain 'C' and (resid 1 through 12)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 D 0 D 0 
;chain 'D' and (resid 100 through 153)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 E 0 E 0 
;chain 'E' and (resid 1 through 12)
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6 6 F 0 F 0 
;chain 'F' and (resid 1 through 12)
;
? ? ? ? ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MolProbity  3beta29           ?               package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu 
'model building'  http://kinemage.biochem.duke.edu/molprobity/ ?   ? 
2 PDB_EXTRACT 3.10              'June 10, 2010' package PDB                          deposit@deposit.rcsb.org             
'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++ ? 
3 PHASER      2.3.0             ?               program 'Randy J. Read'              cimr-phaser@lists.cam.ac.uk          phasing 
http://www-structmed.cimr.cam.ac.uk/phaser/  ?   ? 
4 SCALA       3.3.20            ?               package 'Phil Evans'                 pre@mrc-lmb.cam.ac.uk                
'data scaling'    ?                                            ?   ? 
5 PHENIX      '(phenix.refine:' ?               package 'P.D. Adams'                 PDAdams@lbl.gov                      
refinement        http://www.phenix-online.org/                C++ ? 
6 MOSFLM      .                 ?               ?       ?                            ?                                    
'data reduction'  ?                                            ?   ? 
# 
_pdbx_entry_details.entry_id             4RBO 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THIS CONSTRUCT WAS EXPRESSED WITH AN N-TERMINAL PURIFICATION TAG MAHHHHHHVDDDDKMSENLYFQ. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY RESIDUES 94-162 OF THE TARGET SEQUENCE.
;
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 SG A CYS 108 ? ? 1_555 HG D CYS 108 ? ? 1_556 1.10 
2 1 HG A CYS 108 ? ? 1_555 HG D CYS 108 ? ? 1_556 1.16 
3 1 HG A CYS 108 ? ? 1_555 SG D CYS 108 ? ? 1_556 1.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DA 6  ? ? "C1'" C DA 6  ? ? N9 C DA 6  ? ? 110.16 108.30 1.86 0.30 N 
2 1 "O4'" C DG 9  ? ? "C1'" C DG 9  ? ? N9 C DG 9  ? ? 110.60 108.30 2.30 0.30 N 
3 1 "O4'" C DG 10 ? ? "C1'" C DG 10 ? ? N9 C DG 10 ? ? 110.66 108.30 2.36 0.30 N 
4 1 "O4'" E DC 3  ? ? "C1'" E DC 3  ? ? N1 E DC 3  ? ? 110.25 108.30 1.95 0.30 N 
5 1 "O4'" E DC 4  ? ? "C1'" E DC 4  ? ? N1 E DC 4  ? ? 110.71 108.30 2.41 0.30 N 
6 1 "O4'" F DA 6  ? ? "C1'" F DA 6  ? ? N9 F DA 6  ? ? 110.22 108.30 1.92 0.30 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    TRP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     153 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -58.86 
_pdbx_validate_torsion.psi             99.56 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 D LYS 140 ? CG  ? D LYS 48 CG  
2  1 Y 1 D LYS 140 ? CD  ? D LYS 48 CD  
3  1 Y 1 D LYS 140 ? CE  ? D LYS 48 CE  
4  1 Y 1 D LYS 140 ? NZ  ? D LYS 48 NZ  
5  1 Y 1 D TRP 153 ? CG  ? D TRP 61 CG  
6  1 Y 1 D TRP 153 ? CD1 ? D TRP 61 CD1 
7  1 Y 1 D TRP 153 ? CD2 ? D TRP 61 CD2 
8  1 Y 1 D TRP 153 ? NE1 ? D TRP 61 NE1 
9  1 Y 1 D TRP 153 ? CE2 ? D TRP 61 CE2 
10 1 Y 1 D TRP 153 ? CE3 ? D TRP 61 CE3 
11 1 Y 1 D TRP 153 ? CZ2 ? D TRP 61 CZ2 
12 1 Y 1 D TRP 153 ? CZ3 ? D TRP 61 CZ3 
13 1 Y 1 D TRP 153 ? CH2 ? D TRP 61 CH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 0   ? A GLY 1  
2  1 Y 1 A LYS 94  ? A LYS 2  
3  1 Y 1 A LYS 95  ? A LYS 3  
4  1 Y 1 A GLN 96  ? A GLN 4  
5  1 Y 1 A LYS 97  ? A LYS 5  
6  1 Y 1 A THR 98  ? A THR 6  
7  1 Y 1 A ARG 99  ? A ARG 7  
8  1 Y 1 A LYS 155 ? A LYS 63 
9  1 Y 1 A ASN 156 ? A ASN 64 
10 1 Y 1 A ASN 157 ? A ASN 65 
11 1 Y 1 A TRP 158 ? A TRP 66 
12 1 Y 1 A PRO 159 ? A PRO 67 
13 1 Y 1 A LYS 160 ? A LYS 68 
14 1 Y 1 A ASN 161 ? A ASN 69 
15 1 Y 1 A SER 162 ? A SER 70 
16 1 Y 1 D GLY 0   ? D GLY 1  
17 1 Y 1 D LYS 94  ? D LYS 2  
18 1 Y 1 D LYS 95  ? D LYS 3  
19 1 Y 1 D GLN 96  ? D GLN 4  
20 1 Y 1 D LYS 97  ? D LYS 5  
21 1 Y 1 D THR 98  ? D THR 6  
22 1 Y 1 D ARG 99  ? D ARG 7  
23 1 Y 1 D GLN 154 ? D GLN 62 
24 1 Y 1 D LYS 155 ? D LYS 63 
25 1 Y 1 D ASN 156 ? D ASN 64 
26 1 Y 1 D ASN 157 ? D ASN 65 
27 1 Y 1 D TRP 158 ? D TRP 66 
28 1 Y 1 D PRO 159 ? D PRO 67 
29 1 Y 1 D LYS 160 ? D LYS 68 
30 1 Y 1 D ASN 161 ? D ASN 69 
31 1 Y 1 D SER 162 ? D SER 70 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4RBO 'double helix'         
4RBO 'b-form double helix'  
4RBO 'mismatched base pair' 
4RBO 'triple helix'         
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 12 1_555 0.408  -0.224 0.542  0.247   -3.879  -2.693  1  B_DG1:DC12_C B 1  ? C 12 ? 19 1 
1 B DG 2  1_555 C DC 11 1_555 -0.215 -0.200 0.107  9.022   -7.204  -1.078  2  B_DG2:DC11_C B 2  ? C 11 ? 19 1 
1 B DC 3  1_555 C DG 10 1_555 0.023  -0.226 0.327  3.598   -13.976 -3.230  3  B_DC3:DG10_C B 3  ? C 10 ? 19 1 
1 B DC 4  1_555 C DG 9  1_555 -0.366 -0.329 0.964  -11.258 -6.685  -5.178  4  B_DC4:DG9_C  B 4  ? C 9  ? 19 1 
1 B DC 5  1_555 C DG 8  1_555 -0.241 -0.466 1.262  -11.820 1.225   -3.219  5  B_DC5:DG8_C  B 5  ? C 8  ? 19 1 
1 B DA 6  1_555 C DT 7  1_555 0.208  -0.241 0.733  7.971   -19.347 3.329   6  B_DA6:DT7_C  B 6  ? C 7  ? 20 1 
1 B DT 7  1_555 C DA 6  1_555 0.188  0.051  0.544  3.966   -18.703 8.989   7  B_DT7:DA6_C  B 7  ? C 6  ? ?  1 
1 B DT 8  1_555 C DA 5  1_555 0.418  0.093  0.726  -2.070  -23.700 7.911   8  B_DT8:DA5_C  B 8  ? C 5  ? ?  1 
1 B DC 9  1_555 C DG 4  1_555 0.248  0.423  1.036  -9.407  -0.622  16.086  9  B_DC9:DG4_C  B 9  ? C 4  ? ?  1 
1 B DA 10 1_555 C DT 3  1_555 -0.214 0.152  0.911  4.709   -20.388 10.957  10 B_DA10:DT3_C B 10 ? C 3  ? ?  1 
1 B DA 11 1_555 C DT 2  1_555 0.165  -0.210 0.572  5.896   -10.074 -7.908  11 B_DA11:DT2_C B 11 ? C 2  ? 20 1 
1 B DG 12 1_555 C DC 1  1_555 -0.546 -0.032 0.228  7.126   -16.817 7.651   12 B_DG12:DC1_C B 12 ? C 1  ? 19 1 
1 E DG 1  1_555 F DC 12 1_555 0.612  0.394  1.657  -5.237  -4.353  7.917   13 E_DG1:DC12_F E 1  ? F 12 ? ?  ? 
1 E DG 2  1_555 F DC 11 1_555 -0.121 -0.312 0.994  12.116  1.146   -2.525  14 E_DG2:DC11_F E 2  ? F 11 ? 19 1 
1 E DC 3  1_555 F DG 10 1_555 -0.554 -0.146 1.184  2.295   -9.504  -0.301  15 E_DC3:DG10_F E 3  ? F 10 ? 19 1 
1 E DC 4  1_555 F DG 8  1_555 -0.528 0.185  -1.640 -9.568  -3.417  -35.915 16 E_DC4:DG8_F  E 4  ? F 8  ? ?  ? 
1 E DA 6  1_555 F DT 7  1_555 -0.289 -0.370 0.718  9.796   -19.796 4.888   17 E_DA6:DT7_F  E 6  ? F 7  ? 20 1 
1 E DT 7  1_555 F DA 6  1_555 0.384  0.320  0.487  3.537   -21.085 13.889  18 E_DT7:DA6_F  E 7  ? F 6  ? ?  1 
1 E DT 8  1_555 F DA 5  1_555 0.231  0.029  0.410  -0.326  -21.657 4.284   19 E_DT8:DA5_F  E 8  ? F 5  ? 20 1 
1 E DC 9  1_555 F DG 4  1_555 0.301  0.873  0.684  -7.464  2.038   22.574  20 E_DC9:DG4_F  E 9  ? F 4  ? ?  ? 
1 E DA 10 1_555 F DT 3  1_555 -0.319 -0.057 0.445  3.048   -22.369 9.673   21 E_DA10:DT3_F E 10 ? F 3  ? ?  1 
1 E DA 11 1_555 F DT 2  1_555 0.242  0.361  0.358  6.548   -17.551 7.441   22 E_DA11:DT2_F E 11 ? F 2  ? ?  ? 
1 E DG 12 1_555 F DC 1  1_555 0.818  0.979  0.780  8.821   -32.144 32.737  23 E_DG12:DC1_F E 12 ? F 1  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 12 1_555 B DG 2  1_555 C DC 11 1_555 0.183  -0.394 3.220 7.228  10.442 31.555 -2.306 0.816  2.919 18.301 
-12.668 33.955 1  BB_DG1DG2:DC11DC12_CC B 1  ? C 12 ? B 2  ? C 11 ? 
1 B DG 2  1_555 C DC 11 1_555 B DC 3  1_555 C DG 10 1_555 -0.039 -0.740 3.257 -2.118 5.524  35.214 -1.990 -0.237 3.106 9.052  
3.470   35.692 2  BB_DG2DC3:DG10DC11_CC B 2  ? C 11 ? B 3  ? C 10 ? 
1 B DC 3  1_555 C DG 10 1_555 B DC 4  1_555 C DG 9  1_555 -0.133 -0.738 3.540 -4.304 5.678  35.167 -2.067 -0.442 3.376 9.281  
7.035   35.859 3  BB_DC3DC4:DG9DG10_CC  B 3  ? C 10 ? B 4  ? C 9  ? 
1 B DC 4  1_555 C DG 9  1_555 B DC 5  1_555 C DG 8  1_555 0.277  -0.730 3.406 -2.739 3.763  33.290 -1.895 -0.938 3.274 6.528  
4.751   33.605 4  BB_DC4DC5:DG8DG9_CC   B 4  ? C 9  ? B 5  ? C 8  ? 
1 B DC 5  1_555 C DG 8  1_555 B DA 6  1_555 C DT 7  1_555 0.097  0.196  2.896 4.170  -1.159 35.352 0.469  0.379  2.881 -1.899 
-6.835  35.608 5  BB_DC5DA6:DT7DG8_CC   B 5  ? C 8  ? B 6  ? C 7  ? 
1 B DA 6  1_555 C DT 7  1_555 B DT 7  1_555 C DA 6  1_555 0.867  -0.977 3.380 1.076  -3.219 34.276 -1.123 -1.289 3.479 -5.445 
-1.820  34.439 6  BB_DA6DT7:DA6DT7_CC   B 6  ? C 7  ? B 7  ? C 6  ? 
1 B DT 7  1_555 C DA 6  1_555 B DT 8  1_555 C DA 5  1_555 -0.303 -0.627 3.453 1.443  -2.090 35.364 -0.705 0.722  3.469 -3.434 
-2.371  35.453 7  BB_DT7DT8:DA5DA6_CC   B 7  ? C 6  ? B 8  ? C 5  ? 
1 B DT 8  1_555 C DA 5  1_555 B DC 9  1_555 C DG 4  1_555 1.283  0.542  3.521 1.166  2.608  35.869 0.474  -1.897 3.589 4.226  
-1.889  35.979 8  BB_DT8DC9:DG4DA5_CC   B 8  ? C 5  ? B 9  ? C 4  ? 
1 B DC 9  1_555 C DG 4  1_555 B DA 10 1_555 C DT 3  1_555 -1.154 0.904  2.973 -0.211 4.189  32.280 0.935  2.026  3.070 7.494  
0.377   32.544 9  BB_DC9DA10:DT3DG4_CC  B 9  ? C 4  ? B 10 ? C 3  ? 
1 B DA 10 1_555 C DT 3  1_555 B DA 11 1_555 C DT 2  1_555 -0.880 -0.251 3.268 -1.544 0.870  34.261 -0.563 1.248  3.297 1.475  
2.618   34.305 10 BB_DA10DA11:DT2DT3_CC B 10 ? C 3  ? B 11 ? C 2  ? 
1 B DA 11 1_555 C DT 2  1_555 B DG 12 1_555 C DC 1  1_555 0.295  -0.654 3.268 -0.707 1.275  36.701 -1.211 -0.564 3.238 2.023  
1.122   36.729 11 BB_DA11DG12:DC1DT2_CC B 11 ? C 2  ? B 12 ? C 1  ? 
1 E DG 1  1_555 F DC 12 1_555 E DG 2  1_555 F DC 11 1_555 -0.560 -0.166 3.137 5.533  6.044  31.336 -1.301 1.924  2.916 10.957 
-10.030 32.363 12 EE_DG1DG2:DC11DC12_FF E 1  ? F 12 ? E 2  ? F 11 ? 
1 E DG 2  1_555 F DC 11 1_555 E DC 3  1_555 F DG 10 1_555 0.249  -0.934 3.504 -1.889 3.252  32.196 -2.277 -0.798 3.376 5.839  
3.391   32.409 13 EE_DG2DC3:DG10DC11_FF E 2  ? F 11 ? E 3  ? F 10 ? 
1 E DC 3  1_555 F DG 10 1_555 E DC 4  1_555 F DG 8  1_555 0.093  -0.958 5.195 -5.029 3.199  53.457 -1.374 -0.598 5.107 3.543  
5.571   53.763 14 EE_DC3DC4:DG8DG10_FF  E 3  ? F 10 ? E 4  ? F 8  ? 
1 E DC 4  1_555 F DG 8  1_555 E DA 6  1_555 F DT 7  1_555 0.111  -0.206 4.788 8.578  1.732  51.549 -0.402 0.707  4.740 1.976  
-9.782  52.237 15 EE_DC4DA6:DT7DG8_FF   E 4  ? F 8  ? E 6  ? F 7  ? 
1 E DA 6  1_555 F DT 7  1_555 E DT 7  1_555 F DA 6  1_555 1.048  -0.614 3.409 1.982  -1.486 37.360 -0.752 -1.359 3.479 -2.317 
-3.089  37.439 16 EE_DA6DT7:DA6DT7_FF   E 6  ? F 7  ? E 7  ? F 6  ? 
1 E DT 7  1_555 F DA 6  1_555 E DT 8  1_555 F DA 5  1_555 -0.792 -0.786 3.224 0.195  -1.246 33.628 -1.156 1.399  3.246 -2.153 
-0.338  33.651 17 EE_DT7DT8:DA5DA6_FF   E 7  ? F 6  ? E 8  ? F 5  ? 
1 E DT 8  1_555 F DA 5  1_555 E DC 9  1_555 F DG 4  1_555 1.753  0.619  3.411 2.389  5.167  36.103 0.223  -2.442 3.567 8.273  
-3.826  36.534 18 EE_DT8DC9:DG4DA5_FF   E 8  ? F 5  ? E 9  ? F 4  ? 
1 E DC 9  1_555 F DG 4  1_555 E DA 10 1_555 F DT 3  1_555 -1.700 1.027  3.106 0.219  6.476  31.161 0.713  3.142  3.237 11.894 
-0.402  31.811 19 EE_DC9DA10:DT3DG4_FF  E 9  ? F 4  ? E 10 ? F 3  ? 
1 E DA 10 1_555 F DT 3  1_555 E DA 11 1_555 F DT 2  1_555 0.165  0.047  3.203 -0.609 0.527  35.160 0.001  -0.362 3.200 0.872  
1.008   35.169 20 EE_DA10DA11:DT2DT3_FF E 10 ? F 3  ? E 11 ? F 2  ? 
1 E DA 11 1_555 F DT 2  1_555 E DG 12 1_555 F DC 1  1_555 0.377  -0.282 3.213 -1.860 5.090  39.098 -1.003 -0.772 3.133 7.561  
2.763   39.457 21 EE_DA11DG12:DC1DT2_FF E 11 ? F 2  ? E 12 ? F 1  ? 
#