data_4RDU
# 
_entry.id   4RDU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4RDU         
NDB   NA3178       
RCSB  RCSB087222   
WWPDB D_1000087222 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.db_id          JCSG-430652 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.entry_id                        4RDU 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-19 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Joint Center for Structural Genomics (JCSG)'  1 
'Partnership for Stem Cell Biology (STEMCELL)' 2 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution' 
_citation.journal_abbrev            'To be published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Joint Center for Structural Genomics (JCSG)'  1 
primary 'Partnership for Stem Cell Biology (STEMCELL)' 2 
# 
_cell.entry_id           4RDU 
_cell.length_a           34.182 
_cell.length_b           42.913 
_cell.length_c           56.104 
_cell.angle_alpha        84.130 
_cell.angle_beta         77.330 
_cell.angle_gamma        67.130 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RDU 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Homeobox protein DLX-5'                                   7663.090 2   ? ? 'DNA binding residues 137-198' ? 
2 polymer syn '(DC)(DG)(DA)(DC)(DT)(DA)(DA)(DT)(DT)(DA)(DG)(DT)(DC)(DG)' 4279.804 4   ? ? ?                              ? 
3 water   nat water                                                      18.015   233 ? ? ?                              ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no GHMVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKN 
GHMVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKN A,D     JCSG-430652 
2 polydeoxyribonucleotide no no '(DC)(DG)(DA)(DC)(DT)(DA)(DA)(DT)(DT)(DA)(DG)(DT)(DC)(DG)'        CGACTAATTAGTCG B,C,E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  HIS n 
1 3  MET n 
1 4  VAL n 
1 5  ARG n 
1 6  LYS n 
1 7  PRO n 
1 8  ARG n 
1 9  THR n 
1 10 ILE n 
1 11 TYR n 
1 12 SER n 
1 13 SER n 
1 14 PHE n 
1 15 GLN n 
1 16 LEU n 
1 17 ALA n 
1 18 ALA n 
1 19 LEU n 
1 20 GLN n 
1 21 ARG n 
1 22 ARG n 
1 23 PHE n 
1 24 GLN n 
1 25 LYS n 
1 26 THR n 
1 27 GLN n 
1 28 TYR n 
1 29 LEU n 
1 30 ALA n 
1 31 LEU n 
1 32 PRO n 
1 33 GLU n 
1 34 ARG n 
1 35 ALA n 
1 36 GLU n 
1 37 LEU n 
1 38 ALA n 
1 39 ALA n 
1 40 SER n 
1 41 LEU n 
1 42 GLY n 
1 43 LEU n 
1 44 THR n 
1 45 GLN n 
1 46 THR n 
1 47 GLN n 
1 48 VAL n 
1 49 LYS n 
1 50 ILE n 
1 51 TRP n 
1 52 PHE n 
1 53 GLN n 
1 54 ASN n 
1 55 LYS n 
1 56 ARG n 
1 57 SER n 
1 58 LYS n 
1 59 ILE n 
1 60 LYS n 
1 61 LYS n 
1 62 ILE n 
1 63 MET n 
1 64 LYS n 
1 65 ASN n 
2 1  DC  n 
2 2  DG  n 
2 3  DA  n 
2 4  DC  n 
2 5  DT  n 
2 6  DA  n 
2 7  DA  n 
2 8  DT  n 
2 9  DT  n 
2 10 DA  n 
2 11 DG  n 
2 12 DT  n 
2 13 DC  n 
2 14 DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BC006226, DLX5' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia Coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28bGB1Tev 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DLX5_HUMAN P56178 1 KKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKN 135 ? 
2 PDB 4RDU       4RDU   2 ?                                                                ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4RDU A 2 ? 65 ? P56178 135 ? 198 ? 135 198 
2 1 4RDU D 2 ? 65 ? P56178 135 ? 198 ? 135 198 
3 2 4RDU B 1 ? 14 ? 4RDU   1   ? 14  ? 1   14  
4 2 4RDU C 1 ? 14 ? 4RDU   1   ? 14  ? 1   14  
5 2 4RDU E 1 ? 14 ? 4RDU   1   ? 14  ? 1   14  
6 2 4RDU F 1 ? 14 ? 4RDU   1   ? 14  ? 1   14  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4RDU GLY A 1 ? UNP P56178 ?   ?   'LEADER SEQUENCE'     0   1 
1 4RDU HIS A 2 ? UNP P56178 LYS 135 'ENGINEERED MUTATION' 135 2 
1 4RDU MET A 3 ? UNP P56178 LYS 136 'ENGINEERED MUTATION' 136 3 
2 4RDU GLY D 1 ? UNP P56178 ?   ?   'LEADER SEQUENCE'     0   4 
2 4RDU HIS D 2 ? UNP P56178 LYS 135 'ENGINEERED MUTATION' 135 5 
2 4RDU MET D 3 ? UNP P56178 LYS 136 'ENGINEERED MUTATION' 136 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.entry_id          4RDU 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.28 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   46.05 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.pdbx_details    
;0.08M sodium chloride, 45.00% 2-methyl-2,4-pentanediol, 0.012M spermine tetrahydrochloride, 0.1M sodium cacodylate pH 6.0, NANODROP, VAPOR DIFFUSION, SITTING DROP, temperature 289K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.details                'Vertical focusing mirror; double crystal Si(111) monochromator' 
_diffrn_detector.pdbx_collection_date   2014-07-24 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.pdbx_synchrotron_beamline   BL14-1 
_diffrn_source.type                        'SSRL BEAMLINE BL14-1' 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.entry_id                     4RDU 
_reflns.d_resolution_high            1.85 
_reflns.d_resolution_low             22.303 
_reflns.number_all                   23348 
_reflns.number_obs                   23348 
_reflns.pdbx_netI_over_sigmaI        8.000 
_reflns.pdbx_Rsym_value              0.046 
_reflns.pdbx_redundancy              1.900 
_reflns.percent_possible_obs         95.500 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.B_iso_Wilson_estimate        33.646 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
1.850 1.900  ? 3315 ? 0.271 2.5  0.271 ? 1.900 ? 1723 94.100 1  1 
1.900 1.950  ? 3173 ? 0.230 3.0  0.230 ? 1.900 ? 1655 95.000 2  1 
1.950 2.010  ? 3145 ? 0.184 3.5  0.184 ? 1.900 ? 1635 95.100 3  1 
2.010 2.070  ? 3048 ? 0.141 4.6  0.141 ? 1.900 ? 1590 94.900 4  1 
2.070 2.140  ? 2954 ? 0.114 5.8  0.114 ? 1.900 ? 1533 95.200 5  1 
2.140 2.210  ? 2825 ? 0.094 6.7  0.094 ? 1.900 ? 1468 95.800 6  1 
2.210 2.290  ? 2789 ? 0.093 5.6  0.093 ? 1.900 ? 1452 95.700 7  1 
2.290 2.390  ? 2722 ? 0.075 8.7  0.075 ? 1.900 ? 1422 96.300 8  1 
2.390 2.490  ? 2530 ? 0.067 8.5  0.067 ? 1.900 ? 1305 95.600 9  1 
2.490 2.620  ? 2460 ? 0.062 9.9  0.062 ? 1.900 ? 1280 96.000 10 1 
2.620 2.760  ? 2296 ? 0.055 10.4 0.055 ? 1.900 ? 1195 96.400 11 1 
2.760 2.930  ? 2256 ? 0.052 11.1 0.052 ? 1.900 ? 1172 96.700 12 1 
2.930 3.130  ? 2123 ? 0.042 14.2 0.042 ? 1.900 ? 1099 96.600 13 1 
3.130 3.380  ? 1912 ? 0.043 5.1  0.043 ? 1.900 ? 997  96.900 14 1 
3.380 3.700  ? 1806 ? 0.040 7.6  0.040 ? 1.900 ? 934  97.100 15 1 
3.700 4.140  ? 1624 ? 0.030 18.2 0.030 ? 1.900 ? 843  97.100 16 1 
4.140 4.780  ? 1477 ? 0.038 13.3 0.038 ? 1.900 ? 763  97.700 17 1 
4.780 5.850  ? 1189 ? 0.038 13.3 0.038 ? 1.900 ? 616  97.300 18 1 
5.850 8.270  ? 938  ? 0.050 10.9 0.050 ? 1.900 ? 486  96.400 19 1 
8.270 22.303 ? 322  ? 0.047 14.4 0.047 ? 1.800 ? 180  66.100 20 1 
# 
_refine.entry_id                                 4RDU 
_refine.ls_d_res_high                            1.8500 
_refine.ls_d_res_low                             22.303 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    95.1400 
_refine.ls_number_reflns_obs                     23315 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;1. HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS 2. ATOM RECORD CONTAINS SUM OF TLS AND RESIDUAL B FACTORS. ANISOU RECORD CONTAINS SUM OF TLS AND RESIDUAL U FACTORS. 3.TLS GROUPS WERE ASSIGNED WITH THE AID OF THE TLSMD (MOTION DETERMINATION) SERVER. 4. WATERS WERE EXCLUDED FROM TLS ASSIGNMENT.
;
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1850 
_refine.ls_R_factor_R_work                       0.1829 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2252 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  1188 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               47.0789 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            1.7900 
_refine.aniso_B[2][2]                            -3.4400 
_refine.aniso_B[3][3]                            3.5300 
_refine.aniso_B[1][2]                            1.6800 
_refine.aniso_B[1][3]                            0.9400 
_refine.aniso_B[2][3]                            -1.4100 
_refine.correlation_coeff_Fo_to_Fc               0.9710 
_refine.correlation_coeff_Fo_to_Fc_free          0.9560 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.1530 
_refine.pdbx_overall_ESU_R_Free                  0.1420 
_refine.overall_SU_ML                            0.1020 
_refine.overall_SU_B                             6.4920 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      1IG7 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                158.200 
_refine.B_iso_min                                20.440 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.330 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1008 
_refine_hist.pdbx_number_atoms_nucleic_acid   1114 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             233 
_refine_hist.number_atoms_total               2355 
_refine_hist.d_res_high                       1.8500 
_refine_hist.d_res_low                        22.303 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       2313 0.011  0.015  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         1732 0.002  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    3352 1.316  1.515  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      4015 1.409  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 133  4.955  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 47   30.428 21.915 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 224  13.370 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 13   23.005 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         324  0.100  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   1830 0.009  0.020  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     527  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
'X-RAY DIFFRACTION' 1 1 'MEDIUM POSITIONAL' A 916 0.370  0.500 1 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 1 1 'MEDIUM THERMAL'    A 916 5.210  2.000 2 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 'MEDIUM POSITIONAL' B 443 0.380  0.500 3 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 1 'MEDIUM THERMAL'    B 443 11.360 2.000 4 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 1 'MEDIUM POSITIONAL' C 410 0.350  0.500 5 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 1 'MEDIUM THERMAL'    C 410 6.410  2.000 6 ? ? ? ? ? ? 
# 
_refine_ls_shell.d_res_high                       1.850 
_refine_ls_shell.d_res_low                        1.8970 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               90.8400 
_refine_ls_shell.number_reflns_R_work             1571 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3070 
_refine_ls_shell.R_factor_R_free                  0.2930 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             85 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1656 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 D 
2 1 B 
2 2 E 
3 1 C 
3 2 F 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 4 A 138 A 198 ? . . . . . . . . 
1 2 1 4 D 138 D 198 ? . . . . . . . . 
2 1 1 4 B 1   B 14  ? . . . . . . . . 
2 2 1 4 E 1   E 14  ? . . . . . . . . 
3 1 1 4 C 1   C 13  ? . . . . . . . . 
3 2 1 4 F 1   F 13  ? . . . . . . . . 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                  4RDU 
_struct.title                     
'Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution' 
_struct.pdbx_descriptor           'Homeobox protein DLX-5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.text            
;PF00046 family, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, TRANSCRIPTION, TRANSCRIPTION-DNA complex, Partnership for Stem Cell Biology, STEMCELL
;
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.entry_id        4RDU 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 12 ? THR A 26 ? SER A 145 THR A 159 1 ? 15 
HELX_P HELX_P2 2 ALA A 30 ? LEU A 41 ? ALA A 163 LEU A 174 1 ? 12 
HELX_P HELX_P3 3 THR A 44 ? LYS A 64 ? THR A 177 LYS A 197 1 ? 21 
HELX_P HELX_P4 4 SER D 12 ? THR D 26 ? SER D 145 THR D 159 1 ? 15 
HELX_P HELX_P5 5 ALA D 30 ? LEU D 41 ? ALA D 163 LEU D 174 1 ? 12 
HELX_P HELX_P6 6 THR D 44 ? ASN D 65 ? THR D 177 ASN D 198 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DG 2  N1 ? ? ? 1_555 C DC 13 N3 ? ? B DG 2  C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DG 2  N2 ? ? ? 1_555 C DC 13 O2 ? ? B DG 2  C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DG 2  O6 ? ? ? 1_555 C DC 13 N4 ? ? B DG 2  C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DA 3  N1 ? ? ? 1_555 C DT 12 N3 ? ? B DA 3  C DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DA 3  N6 ? ? ? 1_555 C DT 12 O4 ? ? B DA 3  C DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DC 4  N3 ? ? ? 1_555 C DG 11 N1 ? ? B DC 4  C DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DC 4  N4 ? ? ? 1_555 C DG 11 O6 ? ? B DC 4  C DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DC 4  O2 ? ? ? 1_555 C DG 11 N2 ? ? B DC 4  C DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DT 5  N3 ? ? ? 1_555 C DA 10 N1 ? ? B DT 5  C DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DT 5  O4 ? ? ? 1_555 C DA 10 N6 ? ? B DT 5  C DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DA 6  N1 ? ? ? 1_555 C DT 9  N3 ? ? B DA 6  C DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DA 6  N6 ? ? ? 1_555 C DT 9  O4 ? ? B DA 6  C DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DA 7  N1 ? ? ? 1_555 C DT 8  N3 ? ? B DA 7  C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DA 7  N6 ? ? ? 1_555 C DT 8  O4 ? ? B DA 7  C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DT 8  N3 ? ? ? 1_555 C DA 7  N1 ? ? B DT 8  C DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DT 8  O4 ? ? ? 1_555 C DA 7  N6 ? ? B DT 8  C DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? B DT 9  N3 ? ? ? 1_555 C DA 6  N1 ? ? B DT 9  C DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DT 9  O4 ? ? ? 1_555 C DA 6  N6 ? ? B DT 9  C DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 5  N3 ? ? B DA 10 C DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DA 10 N6 ? ? ? 1_555 C DT 5  O4 ? ? B DA 10 C DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DG 11 N1 ? ? ? 1_555 C DC 4  N3 ? ? B DG 11 C DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DG 11 N2 ? ? ? 1_555 C DC 4  O2 ? ? B DG 11 C DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DG 11 O6 ? ? ? 1_555 C DC 4  N4 ? ? B DG 11 C DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? B DT 12 N3 ? ? ? 1_555 C DA 3  N1 ? ? B DT 12 C DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? B DT 12 O4 ? ? ? 1_555 C DA 3  N6 ? ? B DT 12 C DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? B DC 13 N3 ? ? ? 1_555 C DG 2  N1 ? ? B DC 13 C DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? B DC 13 N4 ? ? ? 1_555 C DG 2  O6 ? ? B DC 13 C DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? B DC 13 O2 ? ? ? 1_555 C DG 2  N2 ? ? B DC 13 C DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? B DG 14 N1 ? ? ? 1_555 C DC 1  N3 ? ? B DG 14 C DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? B DG 14 N2 ? ? ? 1_555 C DC 1  O2 ? ? B DG 14 C DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? B DG 14 O6 ? ? ? 1_555 C DC 1  N4 ? ? B DG 14 C DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? E DG 2  N1 ? ? ? 1_555 F DC 13 N3 ? ? E DG 2  F DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? E DG 2  N2 ? ? ? 1_555 F DC 13 O2 ? ? E DG 2  F DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? E DG 2  O6 ? ? ? 1_555 F DC 13 N4 ? ? E DG 2  F DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? E DA 3  N1 ? ? ? 1_555 F DT 12 N3 ? ? E DA 3  F DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? E DA 3  N6 ? ? ? 1_555 F DT 12 O4 ? ? E DA 3  F DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? E DC 4  N3 ? ? ? 1_555 F DG 11 N1 ? ? E DC 4  F DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? E DC 4  N4 ? ? ? 1_555 F DG 11 O6 ? ? E DC 4  F DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? E DC 4  O2 ? ? ? 1_555 F DG 11 N2 ? ? E DC 4  F DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? E DT 5  N3 ? ? ? 1_555 F DA 10 N1 ? ? E DT 5  F DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? E DT 5  O4 ? ? ? 1_555 F DA 10 N6 ? ? E DT 5  F DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? E DA 6  N1 ? ? ? 1_555 F DT 9  N3 ? ? E DA 6  F DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? E DA 6  N6 ? ? ? 1_555 F DT 9  O4 ? ? E DA 6  F DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? E DA 7  N1 ? ? ? 1_555 F DT 8  N3 ? ? E DA 7  F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? E DA 7  N6 ? ? ? 1_555 F DT 8  O4 ? ? E DA 7  F DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? E DT 8  N3 ? ? ? 1_555 F DA 7  N1 ? ? E DT 8  F DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? E DT 8  O4 ? ? ? 1_555 F DA 7  N6 ? ? E DT 8  F DA 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? E DT 9  N3 ? ? ? 1_555 F DA 6  N1 ? ? E DT 9  F DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? E DT 9  O4 ? ? ? 1_555 F DA 6  N6 ? ? E DT 9  F DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? E DA 10 N1 ? ? ? 1_555 F DT 5  N3 ? ? E DA 10 F DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? E DA 10 N6 ? ? ? 1_555 F DT 5  O4 ? ? E DA 10 F DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? E DG 11 N1 ? ? ? 1_555 F DC 4  N3 ? ? E DG 11 F DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? E DG 11 N2 ? ? ? 1_555 F DC 4  O2 ? ? E DG 11 F DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? E DG 11 O6 ? ? ? 1_555 F DC 4  N4 ? ? E DG 11 F DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? E DT 12 N3 ? ? ? 1_555 F DA 3  N1 ? ? E DT 12 F DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? E DT 12 O4 ? ? ? 1_555 F DA 3  N6 ? ? E DT 12 F DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? E DC 13 N3 ? ? ? 1_555 F DG 2  N1 ? ? E DC 13 F DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? E DC 13 N4 ? ? ? 1_555 F DG 2  O6 ? ? E DC 13 F DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? E DC 13 O2 ? ? ? 1_555 F DG 2  N2 ? ? E DC 13 F DG 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? E DG 14 N1 ? ? ? 1_555 F DC 1  N3 ? ? E DG 14 F DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? E DG 14 N2 ? ? ? 1_555 F DC 1  O2 ? ? E DG 14 F DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? E DG 14 O6 ? ? ? 1_555 F DC 1  N4 ? ? E DG 14 F DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    4RDU 
_atom_sites.fract_transf_matrix[1][1]   0.029255 
_atom_sites.fract_transf_matrix[1][2]   -0.012341 
_atom_sites.fract_transf_matrix[1][3]   -0.006344 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025291 
_atom_sites.fract_transf_matrix[2][3]   -0.000479 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018272 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ARG A 1 5  ? 37.882 23.815  45.202  1.00 47.17  ? 138 ARG A N     1 
ATOM   2    C CA    . ARG A 1 5  ? 38.245 23.421  46.617  1.00 41.75  ? 138 ARG A CA    1 
ATOM   3    C C     . ARG A 1 5  ? 37.569 24.285  47.699  1.00 40.02  ? 138 ARG A C     1 
ATOM   4    O O     . ARG A 1 5  ? 37.237 25.451  47.460  1.00 45.79  ? 138 ARG A O     1 
ATOM   5    C CB    . ARG A 1 5  ? 39.769 23.336  46.800  1.00 47.76  ? 138 ARG A CB    1 
ATOM   6    C CG    . ARG A 1 5  ? 40.602 24.574  46.499  1.00 51.29  ? 138 ARG A CG    1 
ATOM   7    C CD    . ARG A 1 5  ? 42.099 24.235  46.427  1.00 52.88  ? 138 ARG A CD    1 
ATOM   8    N NE    . ARG A 1 5  ? 42.715 23.944  47.741  1.00 50.02  ? 138 ARG A NE    1 
ATOM   9    C CZ    . ARG A 1 5  ? 43.512 22.909  48.041  1.00 51.21  ? 138 ARG A CZ    1 
ATOM   10   N NH1   . ARG A 1 5  ? 43.862 22.007  47.135  1.00 55.18  ? 138 ARG A NH1   1 
ATOM   11   N NH2   . ARG A 1 5  ? 43.992 22.775  49.284  1.00 44.67  ? 138 ARG A NH2   1 
ATOM   12   N N     . LYS A 1 6  ? 37.373 23.684  48.873  1.00 37.54  ? 139 LYS A N     1 
ATOM   13   C CA    . LYS A 1 6  ? 36.815 24.317  50.069  1.00 39.83  ? 139 LYS A CA    1 
ATOM   14   C C     . LYS A 1 6  ? 37.762 25.469  50.482  1.00 43.37  ? 139 LYS A C     1 
ATOM   15   O O     . LYS A 1 6  ? 39.008 25.283  50.530  1.00 38.81  ? 139 LYS A O     1 
ATOM   16   C CB    . LYS A 1 6  ? 36.667 23.248  51.198  1.00 45.19  ? 139 LYS A CB    1 
ATOM   17   C CG    . LYS A 1 6  ? 36.361 23.698  52.645  1.00 51.44  ? 139 LYS A CG    1 
ATOM   18   C CD    . LYS A 1 6  ? 36.901 22.672  53.680  1.00 51.06  ? 139 LYS A CD    1 
ATOM   19   C CE    . LYS A 1 6  ? 36.214 22.643  55.058  1.00 43.18  ? 139 LYS A CE    1 
ATOM   20   N NZ    . LYS A 1 6  ? 36.034 21.258  55.685  1.00 33.89  ? 139 LYS A NZ    1 
ATOM   21   N N     . PRO A 1 7  ? 37.194 26.643  50.802  1.00 42.68  ? 140 PRO A N     1 
ATOM   22   C CA    . PRO A 1 7  ? 38.066 27.737  51.219  1.00 44.14  ? 140 PRO A CA    1 
ATOM   23   C C     . PRO A 1 7  ? 38.796 27.342  52.496  1.00 33.71  ? 140 PRO A C     1 
ATOM   24   O O     . PRO A 1 7  ? 38.332 26.514  53.266  1.00 32.40  ? 140 PRO A O     1 
ATOM   25   C CB    . PRO A 1 7  ? 37.098 28.896  51.495  1.00 45.65  ? 140 PRO A CB    1 
ATOM   26   C CG    . PRO A 1 7  ? 35.818 28.511  50.818  1.00 51.20  ? 140 PRO A CG    1 
ATOM   27   C CD    . PRO A 1 7  ? 35.766 27.020  50.892  1.00 46.26  ? 140 PRO A CD    1 
ATOM   28   N N     . ARG A 1 8  ? 39.963 27.906  52.676  1.00 37.73  ? 141 ARG A N     1 
ATOM   29   C CA    . ARG A 1 8  ? 40.790 27.526  53.806  1.00 35.33  ? 141 ARG A CA    1 
ATOM   30   C C     . ARG A 1 8  ? 40.192 28.080  55.102  1.00 34.71  ? 141 ARG A C     1 
ATOM   31   O O     . ARG A 1 8  ? 40.002 29.285  55.219  1.00 37.43  ? 141 ARG A O     1 
ATOM   32   C CB    . ARG A 1 8  ? 42.160 28.125  53.541  1.00 40.24  ? 141 ARG A CB    1 
ATOM   33   C CG    . ARG A 1 8  ? 43.224 27.671  54.443  1.00 41.15  ? 141 ARG A CG    1 
ATOM   34   C CD    . ARG A 1 8  ? 44.493 28.398  54.081  1.00 40.83  ? 141 ARG A CD    1 
ATOM   35   N NE    . ARG A 1 8  ? 45.392 28.222  55.192  1.00 39.03  ? 141 ARG A NE    1 
ATOM   36   C CZ    . ARG A 1 8  ? 46.443 27.422  55.206  1.00 33.01  ? 141 ARG A CZ    1 
ATOM   37   N NH1   . ARG A 1 8  ? 46.791 26.701  54.133  1.00 32.01  ? 141 ARG A NH1   1 
ATOM   38   N NH2   . ARG A 1 8  ? 47.156 27.362  56.326  1.00 34.71  ? 141 ARG A NH2   1 
ATOM   39   N N     . THR A 1 9  ? 39.898 27.211  56.063  1.00 34.03  ? 142 THR A N     1 
ATOM   40   C CA    . THR A 1 9  ? 39.461 27.608  57.415  1.00 34.41  ? 142 THR A CA    1 
ATOM   41   C C     . THR A 1 9  ? 40.501 28.482  58.100  1.00 41.65  ? 142 THR A C     1 
ATOM   42   O O     . THR A 1 9  ? 41.716 28.233  57.987  1.00 37.55  ? 142 THR A O     1 
ATOM   43   C CB    . THR A 1 9  ? 39.192 26.384  58.331  1.00 33.46  ? 142 THR A CB    1 
ATOM   44   O OG1   . THR A 1 9  ? 38.141 25.560  57.802  1.00 31.43  ? 142 THR A OG1   1 
ATOM   45   C CG2   . THR A 1 9  ? 38.795 26.799  59.756  1.00 36.16  ? 142 THR A CG2   1 
ATOM   46   N N     . ILE A 1 10 ? 40.028 29.491  58.817  1.00 42.01  ? 143 ILE A N     1 
ATOM   47   C CA    . ILE A 1 10 ? 40.899 30.345  59.607  1.00 47.06  ? 143 ILE A CA    1 
ATOM   48   C C     . ILE A 1 10 ? 40.480 30.053  61.036  1.00 41.70  ? 143 ILE A C     1 
ATOM   49   O O     . ILE A 1 10 ? 39.368 30.351  61.443  1.00 45.66  ? 143 ILE A O     1 
ATOM   50   C CB    . ILE A 1 10 ? 40.746 31.853  59.262  1.00 54.22  ? 143 ILE A CB    1 
ATOM   51   C CG1   . ILE A 1 10 ? 41.066 32.127  57.780  1.00 57.54  ? 143 ILE A CG1   1 
ATOM   52   C CG2   . ILE A 1 10 ? 41.637 32.712  60.155  1.00 53.68  ? 143 ILE A CG2   1 
ATOM   53   C CD1   . ILE A 1 10 ? 42.542 32.076  57.424  1.00 57.82  ? 143 ILE A CD1   1 
ATOM   54   N N     . TYR A 1 11 ? 41.345 29.376  61.770  1.00 39.73  ? 144 TYR A N     1 
ATOM   55   C CA    . TYR A 1 11 ? 41.051 29.050  63.141  1.00 39.79  ? 144 TYR A CA    1 
ATOM   56   C C     . TYR A 1 11 ? 41.334 30.285  63.986  1.00 41.97  ? 144 TYR A C     1 
ATOM   57   O O     . TYR A 1 11 ? 42.313 31.005  63.739  1.00 44.25  ? 144 TYR A O     1 
ATOM   58   C CB    . TYR A 1 11 ? 41.912 27.842  63.600  1.00 37.26  ? 144 TYR A CB    1 
ATOM   59   C CG    . TYR A 1 11 ? 41.481 26.552  62.939  1.00 35.70  ? 144 TYR A CG    1 
ATOM   60   C CD1   . TYR A 1 11 ? 40.292 25.960  63.287  1.00 36.71  ? 144 TYR A CD1   1 
ATOM   61   C CD2   . TYR A 1 11 ? 42.245 25.945  61.951  1.00 33.45  ? 144 TYR A CD2   1 
ATOM   62   C CE1   . TYR A 1 11 ? 39.867 24.795  62.705  1.00 34.16  ? 144 TYR A CE1   1 
ATOM   63   C CE2   . TYR A 1 11 ? 41.827 24.766  61.356  1.00 28.15  ? 144 TYR A CE2   1 
ATOM   64   C CZ    . TYR A 1 11 ? 40.629 24.203  61.735  1.00 31.75  ? 144 TYR A CZ    1 
ATOM   65   O OH    . TYR A 1 11 ? 40.181 23.038  61.150  1.00 32.82  ? 144 TYR A OH    1 
ATOM   66   N N     . SER A 1 12 ? 40.476 30.525  64.971  1.00 38.88  ? 145 SER A N     1 
ATOM   67   C CA    . SER A 1 12 ? 40.714 31.565  65.948  1.00 40.49  ? 145 SER A CA    1 
ATOM   68   C C     . SER A 1 12 ? 41.765 31.068  66.918  1.00 47.91  ? 145 SER A C     1 
ATOM   69   O O     . SER A 1 12 ? 41.958 29.856  67.082  1.00 44.51  ? 145 SER A O     1 
ATOM   70   C CB    . SER A 1 12 ? 39.442 31.861  66.718  1.00 40.25  ? 145 SER A CB    1 
ATOM   71   O OG    . SER A 1 12 ? 38.979 30.708  67.384  1.00 41.73  ? 145 SER A OG    1 
ATOM   72   N N     . SER A 1 13 ? 42.449 31.995  67.578  1.00 48.89  ? 146 SER A N     1 
ATOM   73   C CA    . SER A 1 13 ? 43.401 31.607  68.621  1.00 47.95  ? 146 SER A CA    1 
ATOM   74   C C     . SER A 1 13 ? 42.777 30.647  69.661  1.00 41.72  ? 146 SER A C     1 
ATOM   75   O O     . SER A 1 13 ? 43.450 29.737  70.097  1.00 43.91  ? 146 SER A O     1 
ATOM   76   C CB    . SER A 1 13 ? 44.015 32.836  69.293  1.00 53.08  ? 146 SER A CB    1 
ATOM   77   O OG    . SER A 1 13 ? 43.000 33.666  69.819  1.00 61.76  ? 146 SER A OG    1 
ATOM   78   N N     . PHE A 1 14 ? 41.499 30.828  70.014  1.00 38.21  ? 147 PHE A N     1 
ATOM   79   C CA    . PHE A 1 14 ? 40.772 29.914  70.930  1.00 38.21  ? 147 PHE A CA    1 
ATOM   80   C C     . PHE A 1 14 ? 40.660 28.461  70.449  1.00 41.99  ? 147 PHE A C     1 
ATOM   81   O O     . PHE A 1 14 ? 40.893 27.502  71.220  1.00 37.50  ? 147 PHE A O     1 
ATOM   82   C CB    . PHE A 1 14 ? 39.369 30.475  71.222  1.00 41.08  ? 147 PHE A CB    1 
ATOM   83   C CG    . PHE A 1 14 ? 38.443 29.510  71.927  1.00 43.12  ? 147 PHE A CG    1 
ATOM   84   C CD1   . PHE A 1 14 ? 38.559 29.286  73.292  1.00 54.93  ? 147 PHE A CD1   1 
ATOM   85   C CD2   . PHE A 1 14 ? 37.438 28.852  71.233  1.00 51.26  ? 147 PHE A CD2   1 
ATOM   86   C CE1   . PHE A 1 14 ? 37.706 28.408  73.946  1.00 54.10  ? 147 PHE A CE1   1 
ATOM   87   C CE2   . PHE A 1 14 ? 36.574 27.981  71.882  1.00 49.26  ? 147 PHE A CE2   1 
ATOM   88   C CZ    . PHE A 1 14 ? 36.719 27.752  73.239  1.00 53.82  ? 147 PHE A CZ    1 
ATOM   89   N N     . GLN A 1 15 ? 40.254 28.279  69.188  1.00 36.65  ? 148 GLN A N     1 
ATOM   90   C CA    . GLN A 1 15 ? 40.155 26.963  68.593  1.00 34.50  ? 148 GLN A CA    1 
ATOM   91   C C     . GLN A 1 15 ? 41.555 26.317  68.482  1.00 30.88  ? 148 GLN A C     1 
ATOM   92   O O     . GLN A 1 15 ? 41.730 25.165  68.852  1.00 29.66  ? 148 GLN A O     1 
ATOM   93   C CB    . GLN A 1 15 ? 39.490 27.052  67.206  1.00 31.80  ? 148 GLN A CB    1 
ATOM   94   C CG    . GLN A 1 15 ? 38.032 27.496  67.249  1.00 33.76  ? 148 GLN A CG    1 
ATOM   95   C CD    . GLN A 1 15 ? 37.481 27.858  65.862  1.00 36.92  ? 148 GLN A CD    1 
ATOM   96   O OE1   . GLN A 1 15 ? 38.195 28.343  64.992  1.00 36.29  ? 148 GLN A OE1   1 
ATOM   97   N NE2   . GLN A 1 15 ? 36.225 27.638  65.677  1.00 36.76  ? 148 GLN A NE2   1 
ATOM   98   N N     . LEU A 1 16 ? 42.558 27.075  68.039  1.00 30.11  ? 149 LEU A N     1 
ATOM   99   C CA    . LEU A 1 16 ? 43.903 26.530  67.937  1.00 30.57  ? 149 LEU A CA    1 
ATOM   100  C C     . LEU A 1 16 ? 44.471 26.108  69.322  1.00 33.07  ? 149 LEU A C     1 
ATOM   101  O O     . LEU A 1 16 ? 45.096 25.059  69.448  1.00 34.51  ? 149 LEU A O     1 
ATOM   102  C CB    . LEU A 1 16 ? 44.850 27.515  67.265  1.00 34.34  ? 149 LEU A CB    1 
ATOM   103  C CG    . LEU A 1 16 ? 44.565 27.834  65.796  1.00 36.51  ? 149 LEU A CG    1 
ATOM   104  C CD1   . LEU A 1 16 ? 45.443 28.968  65.316  1.00 41.69  ? 149 LEU A CD1   1 
ATOM   105  C CD2   . LEU A 1 16 ? 44.761 26.625  64.915  1.00 38.70  ? 149 LEU A CD2   1 
ATOM   106  N N     . ALA A 1 17 ? 44.258 26.937  70.336  1.00 36.83  ? 150 ALA A N     1 
ATOM   107  C CA    . ALA A 1 17 ? 44.736 26.618  71.700  1.00 35.55  ? 150 ALA A CA    1 
ATOM   108  C C     . ALA A 1 17 ? 44.088 25.328  72.171  1.00 34.82  ? 150 ALA A C     1 
ATOM   109  O O     . ALA A 1 17 ? 44.738 24.426  72.704  1.00 34.00  ? 150 ALA A O     1 
ATOM   110  C CB    . ALA A 1 17 ? 44.414 27.754  72.642  1.00 36.07  ? 150 ALA A CB    1 
ATOM   111  N N     . ALA A 1 18 ? 42.787 25.224  71.947  1.00 31.21  ? 151 ALA A N     1 
ATOM   112  C CA    . ALA A 1 18 ? 42.056 24.004  72.300  1.00 32.67  ? 151 ALA A CA    1 
ATOM   113  C C     . ALA A 1 18 ? 42.483 22.741  71.589  1.00 27.77  ? 151 ALA A C     1 
ATOM   114  O O     . ALA A 1 18 ? 42.532 21.682  72.206  1.00 28.77  ? 151 ALA A O     1 
ATOM   115  C CB    . ALA A 1 18 ? 40.535 24.210  72.165  1.00 31.77  ? 151 ALA A CB    1 
ATOM   116  N N     . LEU A 1 19 ? 42.719 22.822  70.266  1.00 27.80  ? 152 LEU A N     1 
ATOM   117  C CA    . LEU A 1 19 ? 43.168 21.706  69.488  1.00 26.40  ? 152 LEU A CA    1 
ATOM   118  C C     . LEU A 1 19 ? 44.574 21.292  69.946  1.00 27.51  ? 152 LEU A C     1 
ATOM   119  O O     . LEU A 1 19 ? 44.806 20.124  70.216  1.00 25.40  ? 152 LEU A O     1 
ATOM   120  C CB    . LEU A 1 19 ? 43.191 22.082  68.024  1.00 27.02  ? 152 LEU A CB    1 
ATOM   121  C CG    . LEU A 1 19 ? 41.763 22.177  67.487  1.00 27.21  ? 152 LEU A CG    1 
ATOM   122  C CD1   . LEU A 1 19 ? 41.813 23.009  66.224  1.00 28.80  ? 152 LEU A CD1   1 
ATOM   123  C CD2   . LEU A 1 19 ? 41.144 20.822  67.198  1.00 30.60  ? 152 LEU A CD2   1 
ATOM   124  N N     . GLN A 1 20 ? 45.421 22.281  70.118  1.00 31.41  ? 153 GLN A N     1 
ATOM   125  C CA    . GLN A 1 20 ? 46.802 22.029  70.568  1.00 31.54  ? 153 GLN A CA    1 
ATOM   126  C C     . GLN A 1 20 ? 46.800 21.411  71.981  1.00 34.29  ? 153 GLN A C     1 
ATOM   127  O O     . GLN A 1 20 ? 47.507 20.440  72.209  1.00 34.97  ? 153 GLN A O     1 
ATOM   128  C CB    . GLN A 1 20 ? 47.617 23.329  70.548  1.00 35.31  ? 153 GLN A CB    1 
ATOM   129  C CG    . GLN A 1 20 ? 47.734 24.004  69.182  1.00 36.53  ? 153 GLN A CG    1 
ATOM   130  C CD    . GLN A 1 20 ? 48.809 23.384  68.321  1.00 39.23  ? 153 GLN A CD    1 
ATOM   131  O OE1   . GLN A 1 20 ? 49.178 22.228  68.515  1.00 44.11  ? 153 GLN A OE1   1 
ATOM   132  N NE2   . GLN A 1 20 ? 49.335 24.155  67.384  1.00 41.71  ? 153 GLN A NE2   1 
ATOM   133  N N     . ARG A 1 21 ? 46.012 21.958  72.917  1.00 32.75  ? 154 ARG A N     1 
ATOM   134  C CA    . ARG A 1 21 ? 45.936 21.367  74.254  1.00 39.81  ? 154 ARG A CA    1 
ATOM   135  C C     . ARG A 1 21 ? 45.454 19.927  74.200  1.00 34.93  ? 154 ARG A C     1 
ATOM   136  O O     . ARG A 1 21 ? 46.051 19.064  74.845  1.00 32.32  ? 154 ARG A O     1 
ATOM   137  C CB    . ARG A 1 21 ? 45.056 22.152  75.241  1.00 40.65  ? 154 ARG A CB    1 
ATOM   138  C CG    . ARG A 1 21 ? 45.063 21.500  76.614  1.00 45.13  ? 154 ARG A CG    1 
ATOM   139  N N     . ARG A 1 22 ? 44.413 19.650  73.411  1.00 37.09  ? 155 ARG A N     1 
ATOM   140  C CA    A ARG A 1 22 ? 43.914 18.296  73.287  0.50 32.02  ? 155 ARG A CA    1 
ATOM   141  C CA    B ARG A 1 22 ? 43.914 18.283  73.283  0.50 32.80  ? 155 ARG A CA    1 
ATOM   142  C C     . ARG A 1 22 ? 44.997 17.389  72.683  1.00 28.48  ? 155 ARG A C     1 
ATOM   143  O O     . ARG A 1 22 ? 45.183 16.264  73.118  1.00 28.32  ? 155 ARG A O     1 
ATOM   144  C CB    A ARG A 1 22 ? 42.656 18.252  72.419  0.50 29.37  ? 155 ARG A CB    1 
ATOM   145  C CB    B ARG A 1 22 ? 42.661 18.188  72.403  0.50 31.02  ? 155 ARG A CB    1 
ATOM   146  C CG    A ARG A 1 22 ? 41.973 16.897  72.407  0.50 26.65  ? 155 ARG A CG    1 
ATOM   147  C CG    B ARG A 1 22 ? 42.184 16.752  72.164  0.50 28.74  ? 155 ARG A CG    1 
ATOM   148  C CD    A ARG A 1 22 ? 41.676 16.425  73.821  0.50 28.39  ? 155 ARG A CD    1 
ATOM   149  C CD    B ARG A 1 22 ? 41.708 16.127  73.460  0.50 33.36  ? 155 ARG A CD    1 
ATOM   150  N NE    A ARG A 1 22 ? 40.983 15.144  73.804  0.50 26.98  ? 155 ARG A NE    1 
ATOM   151  N NE    B ARG A 1 22 ? 40.618 16.928  73.983  0.50 36.19  ? 155 ARG A NE    1 
ATOM   152  C CZ    A ARG A 1 22 ? 39.664 15.008  73.841  0.50 30.19  ? 155 ARG A CZ    1 
ATOM   153  C CZ    B ARG A 1 22 ? 39.341 16.724  73.694  0.50 36.19  ? 155 ARG A CZ    1 
ATOM   154  N NH1   A ARG A 1 22 ? 38.898 16.072  73.909  0.50 32.26  ? 155 ARG A NH1   1 
ATOM   155  N NH1   B ARG A 1 22 ? 38.995 15.700  72.919  0.50 34.18  ? 155 ARG A NH1   1 
ATOM   156  N NH2   A ARG A 1 22 ? 39.119 13.806  73.790  0.50 30.92  ? 155 ARG A NH2   1 
ATOM   157  N NH2   B ARG A 1 22 ? 38.417 17.538  74.193  0.50 35.66  ? 155 ARG A NH2   1 
ATOM   158  N N     . PHE A 1 23 ? 45.706 17.873  71.672  1.00 28.93  ? 156 PHE A N     1 
ATOM   159  C CA    . PHE A 1 23 ? 46.675 17.004  71.002  1.00 28.03  ? 156 PHE A CA    1 
ATOM   160  C C     . PHE A 1 23 ? 47.816 16.579  71.929  1.00 31.67  ? 156 PHE A C     1 
ATOM   161  O O     . PHE A 1 23 ? 48.347 15.493  71.771  1.00 32.67  ? 156 PHE A O     1 
ATOM   162  C CB    . PHE A 1 23 ? 47.231 17.671  69.768  1.00 25.53  ? 156 PHE A CB    1 
ATOM   163  C CG    . PHE A 1 23 ? 48.075 16.779  68.910  1.00 28.65  ? 156 PHE A CG    1 
ATOM   164  C CD1   . PHE A 1 23 ? 47.503 15.952  67.939  1.00 30.33  ? 156 PHE A CD1   1 
ATOM   165  C CD2   . PHE A 1 23 ? 49.458 16.817  68.997  1.00 28.62  ? 156 PHE A CD2   1 
ATOM   166  C CE1   . PHE A 1 23 ? 48.267 15.148  67.129  1.00 27.25  ? 156 PHE A CE1   1 
ATOM   167  C CE2   . PHE A 1 23 ? 50.224 16.009  68.194  1.00 32.25  ? 156 PHE A CE2   1 
ATOM   168  C CZ    . PHE A 1 23 ? 49.648 15.174  67.261  1.00 31.43  ? 156 PHE A CZ    1 
ATOM   169  N N     . GLN A 1 24 ? 48.175 17.434  72.870  1.00 32.12  ? 157 GLN A N     1 
ATOM   170  C CA    . GLN A 1 24 ? 49.164 17.068  73.926  1.00 35.03  ? 157 GLN A CA    1 
ATOM   171  C C     . GLN A 1 24 ? 48.794 15.763  74.661  1.00 36.43  ? 157 GLN A C     1 
ATOM   172  O O     . GLN A 1 24 ? 49.668 14.983  75.015  1.00 40.22  ? 157 GLN A O     1 
ATOM   173  C CB    . GLN A 1 24 ? 49.333 18.188  74.915  1.00 39.75  ? 157 GLN A CB    1 
ATOM   174  C CG    . GLN A 1 24 ? 49.996 19.454  74.387  1.00 50.94  ? 157 GLN A CG    1 
ATOM   175  C CD    . GLN A 1 24 ? 50.340 20.438  75.516  1.00 69.31  ? 157 GLN A CD    1 
ATOM   176  O OE1   . GLN A 1 24 ? 49.486 20.807  76.342  1.00 65.81  ? 157 GLN A OE1   1 
ATOM   177  N NE2   . GLN A 1 24 ? 51.601 20.860  75.558  1.00 83.39  ? 157 GLN A NE2   1 
ATOM   178  N N     . LYS A 1 25 ? 47.511 15.501  74.842  1.00 31.84  ? 158 LYS A N     1 
ATOM   179  C CA    . LYS A 1 25 ? 47.065 14.297  75.512  1.00 34.75  ? 158 LYS A CA    1 
ATOM   180  C C     . LYS A 1 25 ? 46.516 13.189  74.617  1.00 32.91  ? 158 LYS A C     1 
ATOM   181  O O     . LYS A 1 25 ? 46.654 11.999  74.942  1.00 29.12  ? 158 LYS A O     1 
ATOM   182  C CB    . LYS A 1 25 ? 46.020 14.660  76.581  1.00 41.96  ? 158 LYS A CB    1 
ATOM   183  C CG    . LYS A 1 25 ? 46.605 15.448  77.749  1.00 50.82  ? 158 LYS A CG    1 
ATOM   184  C CD    . LYS A 1 25 ? 45.761 15.307  79.001  1.00 55.34  ? 158 LYS A CD    1 
ATOM   185  C CE    . LYS A 1 25 ? 46.343 16.124  80.139  1.00 67.42  ? 158 LYS A CE    1 
ATOM   186  N NZ    . LYS A 1 25 ? 45.330 16.341  81.208  1.00 82.23  ? 158 LYS A NZ    1 
ATOM   187  N N     . THR A 1 26 ? 45.957 13.570  73.460  1.00 30.93  ? 159 THR A N     1 
ATOM   188  C CA    . THR A 1 26 ? 45.249 12.651  72.562  1.00 29.62  ? 159 THR A CA    1 
ATOM   189  C C     . THR A 1 26 ? 45.717 12.929  71.106  1.00 26.26  ? 159 THR A C     1 
ATOM   190  O O     . THR A 1 26 ? 45.412 14.003  70.566  1.00 28.83  ? 159 THR A O     1 
ATOM   191  C CB    . THR A 1 26 ? 43.712 12.904  72.629  1.00 34.94  ? 159 THR A CB    1 
ATOM   192  O OG1   . THR A 1 26 ? 43.286 13.032  74.000  1.00 33.00  ? 159 THR A OG1   1 
ATOM   193  C CG2   . THR A 1 26 ? 42.961 11.762  72.008  1.00 35.25  ? 159 THR A CG2   1 
ATOM   194  N N     . GLN A 1 27 ? 46.556 12.058  70.546  1.00 24.62  ? 160 GLN A N     1 
ATOM   195  C CA    A GLN A 1 27 ? 47.077 12.218  69.190  0.67 30.47  ? 160 GLN A CA    1 
ATOM   196  C CA    B GLN A 1 27 ? 47.015 12.280  69.184  0.33 27.78  ? 160 GLN A CA    1 
ATOM   197  C C     . GLN A 1 27 ? 46.109 11.604  68.167  1.00 24.85  ? 160 GLN A C     1 
ATOM   198  O O     . GLN A 1 27 ? 46.138 11.997  66.969  1.00 24.40  ? 160 GLN A O     1 
ATOM   199  C CB    A GLN A 1 27 ? 48.461 11.568  69.049  0.67 34.54  ? 160 GLN A CB    1 
ATOM   200  C CB    B GLN A 1 27 ? 48.454 11.838  69.007  0.33 29.77  ? 160 GLN A CB    1 
ATOM   201  C CG    A GLN A 1 27 ? 49.546 12.274  69.868  0.67 39.44  ? 160 GLN A CG    1 
ATOM   202  C CG    B GLN A 1 27 ? 49.388 12.573  69.954  0.33 29.92  ? 160 GLN A CG    1 
ATOM   203  C CD    A GLN A 1 27 ? 50.982 12.116  69.321  0.67 37.68  ? 160 GLN A CD    1 
ATOM   204  C CD    B GLN A 1 27 ? 49.664 11.764  71.196  0.33 32.83  ? 160 GLN A CD    1 
ATOM   205  O OE1   A GLN A 1 27 ? 51.245 11.392  68.364  0.67 37.93  ? 160 GLN A OE1   1 
ATOM   206  O OE1   B GLN A 1 27 ? 48.799 11.598  72.054  0.33 32.94  ? 160 GLN A OE1   1 
ATOM   207  N NE2   A GLN A 1 27 ? 51.890 12.847  69.914  0.67 37.08  ? 160 GLN A NE2   1 
ATOM   208  N NE2   B GLN A 1 27 ? 50.871 11.231  71.284  0.33 30.23  ? 160 GLN A NE2   1 
ATOM   209  N N     . TYR A 1 28 ? 45.378 10.568  68.609  1.00 24.44  ? 161 TYR A N     1 
ATOM   210  C CA    . TYR A 1 28 ? 44.323 9.914   67.764  1.00 25.74  ? 161 TYR A CA    1 
ATOM   211  C C     . TYR A 1 28 ? 43.025 9.972   68.578  1.00 31.03  ? 161 TYR A C     1 
ATOM   212  O O     . TYR A 1 28 ? 42.978 9.605   69.745  1.00 28.13  ? 161 TYR A O     1 
ATOM   213  C CB    . TYR A 1 28 ? 44.656 8.483   67.438  1.00 22.86  ? 161 TYR A CB    1 
ATOM   214  C CG    . TYR A 1 28 ? 45.854 8.343   66.518  1.00 21.01  ? 161 TYR A CG    1 
ATOM   215  C CD1   . TYR A 1 28 ? 45.695 8.383   65.125  1.00 24.85  ? 161 TYR A CD1   1 
ATOM   216  C CD2   . TYR A 1 28 ? 47.117 8.172   67.005  1.00 24.03  ? 161 TYR A CD2   1 
ATOM   217  C CE1   . TYR A 1 28 ? 46.772 8.288   64.289  1.00 23.80  ? 161 TYR A CE1   1 
ATOM   218  C CE2   . TYR A 1 28 ? 48.204 8.068   66.169  1.00 26.19  ? 161 TYR A CE2   1 
ATOM   219  C CZ    . TYR A 1 28 ? 48.033 8.087   64.814  1.00 26.12  ? 161 TYR A CZ    1 
ATOM   220  O OH    . TYR A 1 28 ? 49.098 8.001   63.980  1.00 26.77  ? 161 TYR A OH    1 
ATOM   221  N N     . LEU A 1 29 ? 41.995 10.479  67.951  1.00 24.76  ? 162 LEU A N     1 
ATOM   222  C CA    . LEU A 1 29 ? 40.674 10.629  68.562  1.00 25.97  ? 162 LEU A CA    1 
ATOM   223  C C     . LEU A 1 29 ? 39.739 9.465   68.250  1.00 31.55  ? 162 LEU A C     1 
ATOM   224  O O     . LEU A 1 29 ? 39.666 8.988   67.080  1.00 25.80  ? 162 LEU A O     1 
ATOM   225  C CB    . LEU A 1 29 ? 40.044 11.919  68.031  1.00 25.05  ? 162 LEU A CB    1 
ATOM   226  C CG    . LEU A 1 29 ? 40.693 13.267  68.324  1.00 28.93  ? 162 LEU A CG    1 
ATOM   227  C CD1   . LEU A 1 29 ? 39.909 14.342  67.586  1.00 32.39  ? 162 LEU A CD1   1 
ATOM   228  C CD2   . LEU A 1 29 ? 40.723 13.575  69.817  1.00 33.61  ? 162 LEU A CD2   1 
ATOM   229  N N     . ALA A 1 30 ? 39.019 9.004   69.269  1.00 30.36  ? 163 ALA A N     1 
ATOM   230  C CA    . ALA A 1 30 ? 37.901 8.057   69.065  1.00 30.79  ? 163 ALA A CA    1 
ATOM   231  C C     . ALA A 1 30 ? 36.764 8.863   68.419  1.00 28.15  ? 163 ALA A C     1 
ATOM   232  O O     . ALA A 1 30 ? 36.750 10.072  68.503  1.00 25.84  ? 163 ALA A O     1 
ATOM   233  C CB    . ALA A 1 30 ? 37.455 7.449   70.363  1.00 30.76  ? 163 ALA A CB    1 
ATOM   234  N N     . LEU A 1 31 ? 35.879 8.211   67.694  1.00 28.65  ? 164 LEU A N     1 
ATOM   235  C CA    . LEU A 1 31 ? 34.750 8.956   67.066  1.00 32.06  ? 164 LEU A CA    1 
ATOM   236  C C     . LEU A 1 31 ? 33.955 9.856   68.035  1.00 29.29  ? 164 LEU A C     1 
ATOM   237  O O     . LEU A 1 31 ? 33.718 11.023  67.743  1.00 31.61  ? 164 LEU A O     1 
ATOM   238  C CB    . LEU A 1 31 ? 33.832 7.973   66.319  1.00 33.88  ? 164 LEU A CB    1 
ATOM   239  C CG    . LEU A 1 31 ? 34.473 7.416   65.026  1.00 39.39  ? 164 LEU A CG    1 
ATOM   240  C CD1   . LEU A 1 31 ? 33.501 6.496   64.291  1.00 47.02  ? 164 LEU A CD1   1 
ATOM   241  C CD2   . LEU A 1 31 ? 34.926 8.531   64.078  1.00 40.22  ? 164 LEU A CD2   1 
ATOM   242  N N     . PRO A 1 32 ? 33.556 9.332   69.208  1.00 32.39  ? 165 PRO A N     1 
ATOM   243  C CA    . PRO A 1 32 ? 32.769 10.183  70.132  1.00 36.62  ? 165 PRO A CA    1 
ATOM   244  C C     . PRO A 1 32 ? 33.556 11.387  70.637  1.00 35.12  ? 165 PRO A C     1 
ATOM   245  O O     . PRO A 1 32 ? 32.990 12.442  70.853  1.00 30.13  ? 165 PRO A O     1 
ATOM   246  C CB    . PRO A 1 32 ? 32.471 9.249   71.296  1.00 38.54  ? 165 PRO A CB    1 
ATOM   247  C CG    . PRO A 1 32 ? 32.610 7.887   70.744  1.00 40.05  ? 165 PRO A CG    1 
ATOM   248  C CD    . PRO A 1 32 ? 33.698 7.963   69.722  1.00 33.65  ? 165 PRO A CD    1 
ATOM   249  N N     . GLU A 1 33 ? 34.879 11.227  70.770  1.00 29.74  ? 166 GLU A N     1 
ATOM   250  C CA    . GLU A 1 33 ? 35.734 12.332  71.140  1.00 29.49  ? 166 GLU A CA    1 
ATOM   251  C C     . GLU A 1 33 ? 35.823 13.375  70.103  1.00 25.98  ? 166 GLU A C     1 
ATOM   252  O O     . GLU A 1 33 ? 35.926 14.540  70.455  1.00 29.51  ? 166 GLU A O     1 
ATOM   253  C CB    . GLU A 1 33 ? 37.157 11.848  71.432  1.00 30.43  ? 166 GLU A CB    1 
ATOM   254  C CG    . GLU A 1 33 ? 37.220 10.944  72.661  1.00 33.68  ? 166 GLU A CG    1 
ATOM   255  C CD    . GLU A 1 33 ? 38.622 10.376  72.927  1.00 39.83  ? 166 GLU A CD    1 
ATOM   256  O OE1   . GLU A 1 33 ? 39.346 10.006  71.993  1.00 32.13  ? 166 GLU A OE1   1 
ATOM   257  O OE2   . GLU A 1 33 ? 38.971 10.216  74.092  1.00 37.40  ? 166 GLU A OE2   1 
ATOM   258  N N     . ARG A 1 34 ? 35.903 12.961  68.823  1.00 26.29  ? 167 ARG A N     1 
ATOM   259  C CA    . ARG A 1 34 ? 36.050 13.863  67.770  1.00 23.40  ? 167 ARG A CA    1 
ATOM   260  C C     . ARG A 1 34 ? 34.716 14.673  67.705  1.00 23.07  ? 167 ARG A C     1 
ATOM   261  O O     . ARG A 1 34 ? 34.702 15.890  67.531  1.00 23.74  ? 167 ARG A O     1 
ATOM   262  C CB    . ARG A 1 34 ? 36.284 13.087  66.447  1.00 22.02  ? 167 ARG A CB    1 
ATOM   263  C CG    . ARG A 1 34 ? 36.422 13.974  65.251  1.00 24.95  ? 167 ARG A CG    1 
ATOM   264  C CD    . ARG A 1 34 ? 36.609 13.058  64.066  1.00 23.10  ? 167 ARG A CD    1 
ATOM   265  N NE    . ARG A 1 34 ? 35.301 12.584  63.538  1.00 25.12  ? 167 ARG A NE    1 
ATOM   266  C CZ    . ARG A 1 34 ? 35.204 11.779  62.499  1.00 30.08  ? 167 ARG A CZ    1 
ATOM   267  N NH1   . ARG A 1 34 ? 36.339 11.296  61.940  1.00 28.89  ? 167 ARG A NH1   1 
ATOM   268  N NH2   . ARG A 1 34 ? 33.967 11.440  62.017  1.00 25.68  ? 167 ARG A NH2   1 
ATOM   269  N N     . ALA A 1 35 ? 33.629 13.968  67.779  1.00 27.77  ? 168 ALA A N     1 
ATOM   270  C CA    . ALA A 1 35 ? 32.301 14.649  67.772  1.00 28.38  ? 168 ALA A CA    1 
ATOM   271  C C     . ALA A 1 35 ? 32.182 15.700  68.879  1.00 31.04  ? 168 ALA A C     1 
ATOM   272  O O     . ALA A 1 35 ? 31.889 16.836  68.606  1.00 31.79  ? 168 ALA A O     1 
ATOM   273  C CB    . ALA A 1 35 ? 31.199 13.624  67.876  1.00 33.50  ? 168 ALA A CB    1 
ATOM   274  N N     . GLU A 1 36 ? 32.476 15.316  70.121  1.00 30.78  ? 169 GLU A N     1 
ATOM   275  C CA    . GLU A 1 36 ? 32.419 16.221  71.266  1.00 33.34  ? 169 GLU A CA    1 
ATOM   276  C C     . GLU A 1 36 ? 33.339 17.421  71.118  1.00 30.26  ? 169 GLU A C     1 
ATOM   277  O O     . GLU A 1 36 ? 32.957 18.530  71.436  1.00 29.61  ? 169 GLU A O     1 
ATOM   278  C CB    . GLU A 1 36 ? 32.801 15.464  72.550  1.00 36.60  ? 169 GLU A CB    1 
ATOM   279  C CG    . GLU A 1 36 ? 32.581 16.242  73.817  1.00 45.69  ? 169 GLU A CG    1 
ATOM   280  C CD    . GLU A 1 36 ? 33.082 15.479  75.027  1.00 49.70  ? 169 GLU A CD    1 
ATOM   281  O OE1   . GLU A 1 36 ? 34.183 14.892  74.941  1.00 47.12  ? 169 GLU A OE1   1 
ATOM   282  O OE2   . GLU A 1 36 ? 32.387 15.464  76.059  1.00 58.04  ? 169 GLU A OE2   1 
ATOM   283  N N     . LEU A 1 37 ? 34.580 17.196  70.676  1.00 29.62  ? 170 LEU A N     1 
ATOM   284  C CA    . LEU A 1 37 ? 35.541 18.276  70.486  1.00 27.75  ? 170 LEU A CA    1 
ATOM   285  C C     . LEU A 1 37 ? 35.156 19.288  69.402  1.00 27.17  ? 170 LEU A C     1 
ATOM   286  O O     . LEU A 1 37 ? 35.263 20.512  69.590  1.00 27.43  ? 170 LEU A O     1 
ATOM   287  C CB    . LEU A 1 37 ? 36.914 17.659  70.135  1.00 27.52  ? 170 LEU A CB    1 
ATOM   288  C CG    . LEU A 1 37 ? 38.067 18.629  69.847  1.00 29.29  ? 170 LEU A CG    1 
ATOM   289  C CD1   . LEU A 1 37 ? 38.309 19.466  71.107  1.00 36.65  ? 170 LEU A CD1   1 
ATOM   290  C CD2   . LEU A 1 37 ? 39.333 17.862  69.433  1.00 27.87  ? 170 LEU A CD2   1 
ATOM   291  N N     . ALA A 1 38 ? 34.749 18.763  68.254  1.00 26.97  ? 171 ALA A N     1 
ATOM   292  C CA    . ALA A 1 38 ? 34.301 19.574  67.155  1.00 27.00  ? 171 ALA A CA    1 
ATOM   293  C C     . ALA A 1 38 ? 33.094 20.468  67.590  1.00 26.65  ? 171 ALA A C     1 
ATOM   294  O O     . ALA A 1 38 ? 33.112 21.684  67.427  1.00 27.59  ? 171 ALA A O     1 
ATOM   295  C CB    . ALA A 1 38 ? 33.907 18.660  65.965  1.00 26.37  ? 171 ALA A CB    1 
ATOM   296  N N     . ALA A 1 39 ? 32.081 19.854  68.160  1.00 28.74  ? 172 ALA A N     1 
ATOM   297  C CA    . ALA A 1 39 ? 30.893 20.618  68.656  1.00 33.70  ? 172 ALA A CA    1 
ATOM   298  C C     . ALA A 1 39 ? 31.284 21.700  69.689  1.00 34.28  ? 172 ALA A C     1 
ATOM   299  O O     . ALA A 1 39 ? 30.850 22.829  69.575  1.00 35.97  ? 172 ALA A O     1 
ATOM   300  C CB    . ALA A 1 39 ? 29.829 19.677  69.204  1.00 35.09  ? 172 ALA A CB    1 
ATOM   301  N N     . SER A 1 40 ? 32.246 21.399  70.556  1.00 33.95  ? 173 SER A N     1 
ATOM   302  C CA    . SER A 1 40 ? 32.704 22.346  71.578  1.00 33.16  ? 173 SER A CA    1 
ATOM   303  C C     . SER A 1 40 ? 33.394 23.574  71.008  1.00 33.46  ? 173 SER A C     1 
ATOM   304  O O     . SER A 1 40 ? 33.491 24.607  71.669  1.00 33.87  ? 173 SER A O     1 
ATOM   305  C CB    . SER A 1 40 ? 33.647 21.663  72.593  1.00 37.66  ? 173 SER A CB    1 
ATOM   306  O OG    . SER A 1 40 ? 34.967 21.565  72.066  1.00 41.14  ? 173 SER A OG    1 
ATOM   307  N N     . LEU A 1 41 ? 33.881 23.462  69.782  1.00 32.80  ? 174 LEU A N     1 
ATOM   308  C CA    . LEU A 1 41 ? 34.681 24.504  69.154  1.00 34.04  ? 174 LEU A CA    1 
ATOM   309  C C     . LEU A 1 41 ? 33.953 25.135  67.951  1.00 33.53  ? 174 LEU A C     1 
ATOM   310  O O     . LEU A 1 41 ? 34.479 26.026  67.303  1.00 39.63  ? 174 LEU A O     1 
ATOM   311  C CB    . LEU A 1 41 ? 36.019 23.913  68.696  1.00 35.93  ? 174 LEU A CB    1 
ATOM   312  C CG    . LEU A 1 41 ? 36.979 23.380  69.782  1.00 35.73  ? 174 LEU A CG    1 
ATOM   313  C CD1   . LEU A 1 41 ? 38.269 22.866  69.156  1.00 38.58  ? 174 LEU A CD1   1 
ATOM   314  C CD2   . LEU A 1 41 ? 37.294 24.445  70.824  1.00 38.33  ? 174 LEU A CD2   1 
ATOM   315  N N     . GLY A 1 42 ? 32.733 24.703  67.673  1.00 37.65  ? 175 GLY A N     1 
ATOM   316  C CA    . GLY A 1 42 ? 32.008 25.269  66.566  1.00 36.94  ? 175 GLY A CA    1 
ATOM   317  C C     . GLY A 1 42 ? 32.594 24.840  65.255  1.00 30.44  ? 175 GLY A C     1 
ATOM   318  O O     . GLY A 1 42 ? 32.580 25.606  64.277  1.00 35.17  ? 175 GLY A O     1 
ATOM   319  N N     . LEU A 1 43 ? 33.123 23.620  65.215  1.00 27.63  ? 176 LEU A N     1 
ATOM   320  C CA    . LEU A 1 43 ? 33.727 23.078  64.014  1.00 27.01  ? 176 LEU A CA    1 
ATOM   321  C C     . LEU A 1 43 ? 33.039 21.848  63.549  1.00 25.06  ? 176 LEU A C     1 
ATOM   322  O O     . LEU A 1 43 ? 32.411 21.161  64.331  1.00 29.95  ? 176 LEU A O     1 
ATOM   323  C CB    . LEU A 1 43 ? 35.204 22.702  64.239  1.00 26.42  ? 176 LEU A CB    1 
ATOM   324  C CG    . LEU A 1 43 ? 36.136 23.891  64.553  1.00 32.49  ? 176 LEU A CG    1 
ATOM   325  C CD1   . LEU A 1 43 ? 37.513 23.345  64.948  1.00 31.42  ? 176 LEU A CD1   1 
ATOM   326  C CD2   . LEU A 1 43 ? 36.263 24.899  63.422  1.00 36.04  ? 176 LEU A CD2   1 
ATOM   327  N N     . THR A 1 44 ? 33.222 21.512  62.271  1.00 25.54  ? 177 THR A N     1 
ATOM   328  C CA    . THR A 1 44 ? 32.847 20.180  61.838  1.00 26.03  ? 177 THR A CA    1 
ATOM   329  C C     . THR A 1 44 ? 33.861 19.124  62.247  1.00 26.85  ? 177 THR A C     1 
ATOM   330  O O     . THR A 1 44 ? 35.040 19.409  62.423  1.00 25.91  ? 177 THR A O     1 
ATOM   331  C CB    . THR A 1 44 ? 32.649 20.086  60.310  1.00 25.00  ? 177 THR A CB    1 
ATOM   332  O OG1   . THR A 1 44 ? 33.929 20.119  59.637  1.00 23.79  ? 177 THR A OG1   1 
ATOM   333  C CG2   . THR A 1 44 ? 31.785 21.223  59.826  1.00 28.63  ? 177 THR A CG2   1 
ATOM   334  N N     . GLN A 1 45 ? 33.405 17.889  62.353  1.00 26.84  ? 178 GLN A N     1 
ATOM   335  C CA    . GLN A 1 45 ? 34.301 16.747  62.514  1.00 24.64  ? 178 GLN A CA    1 
ATOM   336  C C     . GLN A 1 45 ? 35.301 16.631  61.406  1.00 26.99  ? 178 GLN A C     1 
ATOM   337  O O     . GLN A 1 45 ? 36.418 16.187  61.653  1.00 21.85  ? 178 GLN A O     1 
ATOM   338  C CB    . GLN A 1 45 ? 33.498 15.473  62.657  1.00 27.30  ? 178 GLN A CB    1 
ATOM   339  C CG    . GLN A 1 45 ? 32.750 15.441  63.978  1.00 28.66  ? 178 GLN A CG    1 
ATOM   340  C CD    . GLN A 1 45 ? 32.029 14.159  64.161  1.00 32.06  ? 178 GLN A CD    1 
ATOM   341  O OE1   . GLN A 1 45 ? 32.631 13.116  64.382  1.00 30.16  ? 178 GLN A OE1   1 
ATOM   342  N NE2   . GLN A 1 45 ? 30.707 14.203  63.973  1.00 30.34  ? 178 GLN A NE2   1 
ATOM   343  N N     . THR A 1 46 ? 34.942 17.011  60.157  1.00 21.78  ? 179 THR A N     1 
ATOM   344  C CA    . THR A 1 46 ? 35.928 17.048  59.104  1.00 24.75  ? 179 THR A CA    1 
ATOM   345  C C     . THR A 1 46 ? 37.052 18.046  59.310  1.00 26.95  ? 179 THR A C     1 
ATOM   346  O O     . THR A 1 46 ? 38.262 17.713  59.048  1.00 24.68  ? 179 THR A O     1 
ATOM   347  C CB    . THR A 1 46 ? 35.267 17.277  57.746  1.00 31.23  ? 179 THR A CB    1 
ATOM   348  O OG1   . THR A 1 46 ? 34.318 16.233  57.586  1.00 28.98  ? 179 THR A OG1   1 
ATOM   349  C CG2   . THR A 1 46 ? 36.274 17.179  56.642  1.00 33.31  ? 179 THR A CG2   1 
ATOM   350  N N     . GLN A 1 47 ? 36.705 19.231  59.755  1.00 24.35  ? 180 GLN A N     1 
ATOM   351  C CA    . GLN A 1 47 ? 37.721 20.243  60.040  1.00 29.93  ? 180 GLN A CA    1 
ATOM   352  C C     . GLN A 1 47 ? 38.602 19.660  61.158  1.00 27.75  ? 180 GLN A C     1 
ATOM   353  O O     . GLN A 1 47 ? 39.833 19.733  61.059  1.00 25.02  ? 180 GLN A O     1 
ATOM   354  C CB    . GLN A 1 47 ? 37.123 21.538  60.502  1.00 31.60  ? 180 GLN A CB    1 
ATOM   355  C CG    . GLN A 1 47 ? 36.482 22.338  59.379  1.00 32.71  ? 180 GLN A CG    1 
ATOM   356  C CD    . GLN A 1 47 ? 35.760 23.517  59.933  1.00 31.42  ? 180 GLN A CD    1 
ATOM   357  O OE1   . GLN A 1 47 ? 34.793 23.365  60.676  1.00 27.84  ? 180 GLN A OE1   1 
ATOM   358  N NE2   . GLN A 1 47 ? 36.208 24.714  59.563  1.00 36.04  ? 180 GLN A NE2   1 
ATOM   359  N N     . VAL A 1 48 ? 37.983 19.112  62.201  1.00 26.07  ? 181 VAL A N     1 
ATOM   360  C CA    . VAL A 1 48 ? 38.854 18.504  63.312  1.00 25.27  ? 181 VAL A CA    1 
ATOM   361  C C     . VAL A 1 48 ? 39.745 17.339  62.814  1.00 28.37  ? 181 VAL A C     1 
ATOM   362  O O     . VAL A 1 48 ? 40.929 17.246  63.145  1.00 25.62  ? 181 VAL A O     1 
ATOM   363  C CB    . VAL A 1 48 ? 37.990 18.110  64.554  1.00 27.04  ? 181 VAL A CB    1 
ATOM   364  C CG1   . VAL A 1 48 ? 38.775 17.321  65.568  1.00 25.44  ? 181 VAL A CG1   1 
ATOM   365  C CG2   . VAL A 1 48 ? 37.351 19.341  65.181  1.00 28.00  ? 181 VAL A CG2   1 
ATOM   366  N N     . LYS A 1 49 ? 39.182 16.427  62.018  1.00 23.76  ? 182 LYS A N     1 
ATOM   367  C CA    . LYS A 1 49 ? 39.882 15.282  61.493  1.00 28.72  ? 182 LYS A CA    1 
ATOM   368  C C     . LYS A 1 49 ? 41.068 15.712  60.686  1.00 23.51  ? 182 LYS A C     1 
ATOM   369  O O     . LYS A 1 49 ? 42.135 15.107  60.783  1.00 23.61  ? 182 LYS A O     1 
ATOM   370  C CB    . LYS A 1 49 ? 38.922 14.455  60.601  1.00 30.74  ? 182 LYS A CB    1 
ATOM   371  C CG    . LYS A 1 49 ? 39.505 13.193  59.998  1.00 31.19  ? 182 LYS A CG    1 
ATOM   372  C CD    . LYS A 1 49 ? 38.442 12.565  59.062  1.00 32.89  ? 182 LYS A CD    1 
ATOM   373  C CE    . LYS A 1 49 ? 38.406 13.265  57.724  1.00 40.85  ? 182 LYS A CE    1 
ATOM   374  N NZ    . LYS A 1 49 ? 37.430 12.555  56.864  1.00 45.69  ? 182 LYS A NZ    1 
ATOM   375  N N     . ILE A 1 50 ? 40.888 16.744  59.855  1.00 24.28  ? 183 ILE A N     1 
ATOM   376  C CA    . ILE A 1 50 ? 41.975 17.244  58.985  1.00 24.17  ? 183 ILE A CA    1 
ATOM   377  C C     . ILE A 1 50 ? 43.048 17.953  59.789  1.00 24.67  ? 183 ILE A C     1 
ATOM   378  O O     . ILE A 1 50 ? 44.261 17.774  59.494  1.00 23.51  ? 183 ILE A O     1 
ATOM   379  C CB    . ILE A 1 50 ? 41.439 18.151  57.828  1.00 24.38  ? 183 ILE A CB    1 
ATOM   380  C CG1   . ILE A 1 50 ? 40.596 17.293  56.902  1.00 28.98  ? 183 ILE A CG1   1 
ATOM   381  C CG2   . ILE A 1 50 ? 42.577 18.786  57.040  1.00 23.72  ? 183 ILE A CG2   1 
ATOM   382  C CD1   . ILE A 1 50 ? 41.241 16.029  56.455  1.00 34.16  ? 183 ILE A CD1   1 
ATOM   383  N N     . TRP A 1 51 ? 42.640 18.627  60.848  1.00 23.48  ? 184 TRP A N     1 
ATOM   384  C CA    . TRP A 1 51 ? 43.623 19.308  61.745  1.00 24.39  ? 184 TRP A CA    1 
ATOM   385  C C     . TRP A 1 51 ? 44.527 18.268  62.428  1.00 23.15  ? 184 TRP A C     1 
ATOM   386  O O     . TRP A 1 51 ? 45.802 18.390  62.415  1.00 23.20  ? 184 TRP A O     1 
ATOM   387  C CB    . TRP A 1 51 ? 42.952 20.191  62.758  1.00 24.46  ? 184 TRP A CB    1 
ATOM   388  C CG    . TRP A 1 51 ? 43.912 21.028  63.506  1.00 21.50  ? 184 TRP A CG    1 
ATOM   389  C CD1   . TRP A 1 51 ? 44.286 22.270  63.222  1.00 25.77  ? 184 TRP A CD1   1 
ATOM   390  C CD2   . TRP A 1 51 ? 44.669 20.627  64.665  1.00 21.97  ? 184 TRP A CD2   1 
ATOM   391  N NE1   . TRP A 1 51 ? 45.232 22.713  64.138  1.00 27.66  ? 184 TRP A NE1   1 
ATOM   392  C CE2   . TRP A 1 51 ? 45.500 21.710  65.015  1.00 25.04  ? 184 TRP A CE2   1 
ATOM   393  C CE3   . TRP A 1 51 ? 44.734 19.459  65.409  1.00 22.48  ? 184 TRP A CE3   1 
ATOM   394  C CZ2   . TRP A 1 51 ? 46.384 21.686  66.131  1.00 23.27  ? 184 TRP A CZ2   1 
ATOM   395  C CZ3   . TRP A 1 51 ? 45.671 19.431  66.552  1.00 23.01  ? 184 TRP A CZ3   1 
ATOM   396  C CH2   . TRP A 1 51 ? 46.423 20.542  66.871  1.00 22.06  ? 184 TRP A CH2   1 
ATOM   397  N N     . PHE A 1 52 ? 43.908 17.227  62.943  1.00 21.22  ? 185 PHE A N     1 
ATOM   398  C CA    . PHE A 1 52 ? 44.655 16.088  63.505  1.00 23.53  ? 185 PHE A CA    1 
ATOM   399  C C     . PHE A 1 52 ? 45.564 15.373  62.504  1.00 25.34  ? 185 PHE A C     1 
ATOM   400  O O     . PHE A 1 52 ? 46.722 15.079  62.848  1.00 20.44  ? 185 PHE A O     1 
ATOM   401  C CB    . PHE A 1 52 ? 43.726 15.154  64.237  1.00 22.59  ? 185 PHE A CB    1 
ATOM   402  C CG    . PHE A 1 52 ? 43.480 15.577  65.667  1.00 26.16  ? 185 PHE A CG    1 
ATOM   403  C CD1   . PHE A 1 52 ? 42.570 16.610  66.000  1.00 25.11  ? 185 PHE A CD1   1 
ATOM   404  C CD2   . PHE A 1 52 ? 44.190 14.958  66.676  1.00 25.93  ? 185 PHE A CD2   1 
ATOM   405  C CE1   . PHE A 1 52 ? 42.404 17.011  67.323  1.00 26.82  ? 185 PHE A CE1   1 
ATOM   406  C CE2   . PHE A 1 52 ? 43.986 15.318  68.003  1.00 24.81  ? 185 PHE A CE2   1 
ATOM   407  C CZ    . PHE A 1 52 ? 43.137 16.338  68.334  1.00 24.78  ? 185 PHE A CZ    1 
ATOM   408  N N     . GLN A 1 53 ? 45.115 15.129  61.259  1.00 23.16  ? 186 GLN A N     1 
ATOM   409  C CA    . GLN A 1 53 ? 45.978 14.636  60.188  1.00 24.26  ? 186 GLN A CA    1 
ATOM   410  C C     . GLN A 1 53 ? 47.174 15.545  59.979  1.00 23.95  ? 186 GLN A C     1 
ATOM   411  O O     . GLN A 1 53 ? 48.346 15.069  59.904  1.00 29.02  ? 186 GLN A O     1 
ATOM   412  C CB    . GLN A 1 53 ? 45.240 14.529  58.830  1.00 27.67  ? 186 GLN A CB    1 
ATOM   413  C CG    . GLN A 1 53 ? 44.099 13.549  58.797  1.00 29.17  ? 186 GLN A CG    1 
ATOM   414  C CD    . GLN A 1 53 ? 43.471 13.352  57.436  1.00 28.42  ? 186 GLN A CD    1 
ATOM   415  O OE1   . GLN A 1 53 ? 43.846 13.963  56.382  1.00 29.89  ? 186 GLN A OE1   1 
ATOM   416  N NE2   . GLN A 1 53 ? 42.537 12.459  57.427  1.00 28.93  ? 186 GLN A NE2   1 
ATOM   417  N N     . ASN A 1 54 ? 46.922 16.843  59.840  1.00 23.10  ? 187 ASN A N     1 
ATOM   418  C CA    . ASN A 1 54 ? 47.999 17.739  59.517  1.00 26.72  ? 187 ASN A CA    1 
ATOM   419  C C     . ASN A 1 54 ? 48.964 17.889  60.702  1.00 22.74  ? 187 ASN A C     1 
ATOM   420  O O     . ASN A 1 54 ? 50.173 17.951  60.518  1.00 30.32  ? 187 ASN A O     1 
ATOM   421  C CB    . ASN A 1 54 ? 47.462 19.064  59.037  1.00 25.24  ? 187 ASN A CB    1 
ATOM   422  C CG    . ASN A 1 54 ? 46.906 18.968  57.581  1.00 26.02  ? 187 ASN A CG    1 
ATOM   423  O OD1   . ASN A 1 54 ? 47.444 18.269  56.768  1.00 26.80  ? 187 ASN A OD1   1 
ATOM   424  N ND2   . ASN A 1 54 ? 45.835 19.662  57.301  1.00 32.46  ? 187 ASN A ND2   1 
ATOM   425  N N     . LYS A 1 55 ? 48.427 17.884  61.906  1.00 22.47  ? 188 LYS A N     1 
ATOM   426  C CA    . LYS A 1 55 ? 49.288 18.011  63.103  1.00 27.17  ? 188 LYS A CA    1 
ATOM   427  C C     . LYS A 1 55 ? 50.177 16.765  63.264  1.00 24.88  ? 188 LYS A C     1 
ATOM   428  O O     . LYS A 1 55 ? 51.321 16.903  63.549  1.00 29.31  ? 188 LYS A O     1 
ATOM   429  C CB    . LYS A 1 55 ? 48.418 18.261  64.337  1.00 24.89  ? 188 LYS A CB    1 
ATOM   430  C CG    . LYS A 1 55 ? 49.224 18.429  65.643  1.00 25.59  ? 188 LYS A CG    1 
ATOM   431  C CD    . LYS A 1 55 ? 50.071 19.712  65.640  1.00 28.44  ? 188 LYS A CD    1 
ATOM   432  C CE    . LYS A 1 55 ? 50.933 19.835  66.932  1.00 30.25  ? 188 LYS A CE    1 
ATOM   433  N NZ    . LYS A 1 55 ? 51.555 21.181  67.028  1.00 28.14  ? 188 LYS A NZ    1 
ATOM   434  N N     . ARG A 1 56 ? 49.649 15.554  62.986  1.00 25.65  ? 189 ARG A N     1 
ATOM   435  C CA    . ARG A 1 56 ? 50.406 14.342  63.045  1.00 27.49  ? 189 ARG A CA    1 
ATOM   436  C C     . ARG A 1 56 ? 51.512 14.346  61.980  1.00 30.12  ? 189 ARG A C     1 
ATOM   437  O O     . ARG A 1 56 ? 52.674 13.924  62.213  1.00 25.22  ? 189 ARG A O     1 
ATOM   438  C CB    . ARG A 1 56 ? 49.490 13.123  62.956  1.00 24.28  ? 189 ARG A CB    1 
ATOM   439  C CG    . ARG A 1 56 ? 48.699 12.892  64.227  1.00 21.82  ? 189 ARG A CG    1 
ATOM   440  C CD    . ARG A 1 56 ? 48.126 11.488  64.296  1.00 22.09  ? 189 ARG A CD    1 
ATOM   441  N NE    . ARG A 1 56 ? 47.129 11.333  63.173  1.00 20.52  ? 189 ARG A NE    1 
ATOM   442  C CZ    . ARG A 1 56 ? 45.817 11.532  63.243  1.00 26.21  ? 189 ARG A CZ    1 
ATOM   443  N NH1   . ARG A 1 56 ? 45.191 11.823  64.388  1.00 21.95  ? 189 ARG A NH1   1 
ATOM   444  N NH2   . ARG A 1 56 ? 45.113 11.362  62.109  1.00 23.45  ? 189 ARG A NH2   1 
ATOM   445  N N     . SER A 1 57 ? 51.185 14.909  60.822  1.00 27.07  ? 190 SER A N     1 
ATOM   446  C CA    . SER A 1 57 ? 52.137 15.026  59.764  1.00 28.83  ? 190 SER A CA    1 
ATOM   447  C C     . SER A 1 57 ? 53.244 16.008  60.108  1.00 26.17  ? 190 SER A C     1 
ATOM   448  O O     . SER A 1 57 ? 54.436 15.788  59.744  1.00 32.14  ? 190 SER A O     1 
ATOM   449  C CB    . SER A 1 57 ? 51.400 15.499  58.484  1.00 31.66  ? 190 SER A CB    1 
ATOM   450  O OG    . SER A 1 57 ? 52.325 15.483  57.423  1.00 48.79  ? 190 SER A OG    1 
ATOM   451  N N     . LYS A 1 58 ? 52.905 17.100  60.790  1.00 25.84  ? 191 LYS A N     1 
ATOM   452  C CA    . LYS A 1 58 ? 53.924 18.079  61.244  1.00 32.14  ? 191 LYS A CA    1 
ATOM   453  C C     . LYS A 1 58 ? 54.973 17.391  62.127  1.00 31.35  ? 191 LYS A C     1 
ATOM   454  O O     . LYS A 1 58 ? 56.200 17.541  61.892  1.00 29.02  ? 191 LYS A O     1 
ATOM   455  C CB    . LYS A 1 58 ? 53.305 19.186  62.064  1.00 30.89  ? 191 LYS A CB    1 
ATOM   456  C CG    . LYS A 1 58 ? 54.231 20.341  62.392  1.00 32.84  ? 191 LYS A CG    1 
ATOM   457  C CD    . LYS A 1 58 ? 53.730 21.088  63.617  1.00 34.28  ? 191 LYS A CD    1 
ATOM   458  C CE    . LYS A 1 58 ? 54.700 22.153  64.078  1.00 41.76  ? 191 LYS A CE    1 
ATOM   459  N NZ    . LYS A 1 58 ? 54.707 23.387  63.284  1.00 37.39  ? 191 LYS A NZ    1 
ATOM   460  N N     . ILE A 1 59 ? 54.475 16.642  63.091  1.00 31.25  ? 192 ILE A N     1 
ATOM   461  C CA    . ILE A 1 59 ? 55.359 15.873  64.020  1.00 33.41  ? 192 ILE A CA    1 
ATOM   462  C C     . ILE A 1 59 ? 56.224 14.851  63.281  1.00 36.57  ? 192 ILE A C     1 
ATOM   463  O O     . ILE A 1 59 ? 57.429 14.708  63.596  1.00 30.54  ? 192 ILE A O     1 
ATOM   464  C CB    . ILE A 1 59 ? 54.543 15.085  65.095  1.00 36.33  ? 192 ILE A CB    1 
ATOM   465  C CG1   . ILE A 1 59 ? 53.689 15.980  65.989  1.00 33.44  ? 192 ILE A CG1   1 
ATOM   466  C CG2   . ILE A 1 59 ? 55.471 14.269  65.982  1.00 37.26  ? 192 ILE A CG2   1 
ATOM   467  C CD1   . ILE A 1 59 ? 54.142 17.379  66.196  1.00 32.92  ? 192 ILE A CD1   1 
ATOM   468  N N     . LYS A 1 60 ? 55.638 14.108  62.327  1.00 27.77  ? 193 LYS A N     1 
ATOM   469  C CA    . LYS A 1 60 ? 56.368 13.089  61.628  1.00 30.77  ? 193 LYS A CA    1 
ATOM   470  C C     . LYS A 1 60 ? 57.491 13.707  60.824  1.00 32.69  ? 193 LYS A C     1 
ATOM   471  O O     . LYS A 1 60 ? 58.559 13.122  60.755  1.00 35.30  ? 193 LYS A O     1 
ATOM   472  C CB    . LYS A 1 60 ? 55.457 12.283  60.681  1.00 30.94  ? 193 LYS A CB    1 
ATOM   473  C CG    . LYS A 1 60 ? 56.076 11.000  60.166  1.00 33.80  ? 193 LYS A CG    1 
ATOM   474  C CD    . LYS A 1 60 ? 56.036 9.871   61.198  1.00 43.53  ? 193 LYS A CD    1 
ATOM   475  N N     . LYS A 1 61 ? 57.215 14.843  60.161  1.00 32.67  ? 194 LYS A N     1 
ATOM   476  C CA    A LYS A 1 61 ? 58.234 15.494  59.364  0.50 35.10  ? 194 LYS A CA    1 
ATOM   477  C CA    B LYS A 1 61 ? 58.212 15.546  59.368  0.50 34.91  ? 194 LYS A CA    1 
ATOM   478  C C     . LYS A 1 61 ? 59.367 16.013  60.239  1.00 34.31  ? 194 LYS A C     1 
ATOM   479  O O     . LYS A 1 61 ? 60.536 15.932  59.839  1.00 34.31  ? 194 LYS A O     1 
ATOM   480  C CB    A LYS A 1 61 ? 57.649 16.587  58.481  0.50 37.41  ? 194 LYS A CB    1 
ATOM   481  C CB    B LYS A 1 61 ? 57.593 16.736  58.641  0.50 36.83  ? 194 LYS A CB    1 
ATOM   482  C CG    A LYS A 1 61 ? 56.852 16.021  57.300  0.50 41.56  ? 194 LYS A CG    1 
ATOM   483  C CG    B LYS A 1 61 ? 56.680 16.335  57.481  0.50 42.33  ? 194 LYS A CG    1 
ATOM   484  C CD    A LYS A 1 61 ? 56.276 17.138  56.438  0.50 46.06  ? 194 LYS A CD    1 
ATOM   485  C CD    B LYS A 1 61 ? 55.687 17.444  57.137  0.50 42.50  ? 194 LYS A CD    1 
ATOM   486  C CE    A LYS A 1 61 ? 55.103 16.665  55.591  0.50 50.10  ? 194 LYS A CE    1 
ATOM   487  C CE    B LYS A 1 61 ? 54.841 17.084  55.914  0.50 47.93  ? 194 LYS A CE    1 
ATOM   488  N NZ    A LYS A 1 61 ? 55.543 15.917  54.386  0.50 45.51  ? 194 LYS A NZ    1 
ATOM   489  N NZ    B LYS A 1 61 ? 53.740 18.045  55.613  0.50 42.67  ? 194 LYS A NZ    1 
ATOM   490  N N     . ILE A 1 62 ? 59.057 16.519  61.422  1.00 29.52  ? 195 ILE A N     1 
ATOM   491  C CA    . ILE A 1 62 ? 60.170 16.880  62.362  1.00 34.39  ? 195 ILE A CA    1 
ATOM   492  C C     . ILE A 1 62 ? 60.992 15.638  62.680  1.00 32.07  ? 195 ILE A C     1 
ATOM   493  O O     . ILE A 1 62 ? 62.240 15.653  62.566  1.00 33.89  ? 195 ILE A O     1 
ATOM   494  C CB    . ILE A 1 62 ? 59.648 17.502  63.669  1.00 35.45  ? 195 ILE A CB    1 
ATOM   495  C CG1   . ILE A 1 62 ? 59.039 18.851  63.371  1.00 39.93  ? 195 ILE A CG1   1 
ATOM   496  C CG2   . ILE A 1 62 ? 60.759 17.676  64.721  1.00 37.03  ? 195 ILE A CG2   1 
ATOM   497  C CD1   . ILE A 1 62 ? 57.927 19.138  64.330  1.00 40.20  ? 195 ILE A CD1   1 
ATOM   498  N N     . MET A 1 63 ? 60.315 14.535  63.010  1.00 33.13  ? 196 MET A N     1 
ATOM   499  C CA    . MET A 1 63 ? 61.005 13.279  63.329  1.00 39.38  ? 196 MET A CA    1 
ATOM   500  C C     . MET A 1 63 ? 62.000 12.861  62.245  1.00 39.32  ? 196 MET A C     1 
ATOM   501  O O     . MET A 1 63 ? 63.084 12.381  62.590  1.00 35.14  ? 196 MET A O     1 
ATOM   502  C CB    . MET A 1 63 ? 60.034 12.123  63.599  1.00 43.03  ? 196 MET A CB    1 
ATOM   503  C CG    . MET A 1 63 ? 59.296 12.194  64.923  1.00 52.13  ? 196 MET A CG    1 
ATOM   504  S SD    . MET A 1 63 ? 58.030 10.918  65.165  1.00 64.82  ? 196 MET A SD    1 
ATOM   505  C CE    . MET A 1 63 ? 58.745 9.514   64.299  1.00 62.33  ? 196 MET A CE    1 
ATOM   506  N N     . LYS A 1 64 ? 61.634 13.050  60.967  1.00 38.08  ? 197 LYS A N     1 
ATOM   507  C CA    . LYS A 1 64 ? 62.469 12.666  59.809  1.00 38.27  ? 197 LYS A CA    1 
ATOM   508  C C     . LYS A 1 64 ? 63.264 13.817  59.208  1.00 37.61  ? 197 LYS A C     1 
ATOM   509  O O     . LYS A 1 64 ? 63.785 13.703  58.070  1.00 37.62  ? 197 LYS A O     1 
ATOM   510  C CB    . LYS A 1 64 ? 61.601 12.032  58.694  1.00 41.54  ? 197 LYS A CB    1 
ATOM   511  C CG    . LYS A 1 64 ? 60.618 10.950  59.153  1.00 48.20  ? 197 LYS A CG    1 
ATOM   512  C CD    . LYS A 1 64 ? 61.261 9.861   60.021  1.00 58.33  ? 197 LYS A CD    1 
ATOM   513  C CE    . LYS A 1 64 ? 60.307 8.698   60.305  1.00 62.63  ? 197 LYS A CE    1 
ATOM   514  N NZ    . LYS A 1 64 ? 60.861 7.693   61.259  1.00 67.07  ? 197 LYS A NZ    1 
ATOM   515  N N     . ASN A 1 65 ? 63.406 14.920  59.928  1.00 35.51  ? 198 ASN A N     1 
ATOM   516  C CA    . ASN A 1 65 ? 64.120 16.051  59.351  1.00 34.44  ? 198 ASN A CA    1 
ATOM   517  C C     . ASN A 1 65 ? 65.644 15.882  59.361  1.00 38.77  ? 198 ASN A C     1 
ATOM   518  O O     . ASN A 1 65 ? 66.151 14.792  59.748  1.00 37.56  ? 198 ASN A O     1 
ATOM   519  C CB    . ASN A 1 65 ? 63.640 17.392  59.926  1.00 33.47  ? 198 ASN A CB    1 
ATOM   520  C CG    . ASN A 1 65 ? 64.096 17.672  61.356  1.00 34.15  ? 198 ASN A CG    1 
ATOM   521  O OD1   . ASN A 1 65 ? 64.943 16.956  61.963  1.00 31.63  ? 198 ASN A OD1   1 
ATOM   522  N ND2   . ASN A 1 65 ? 63.548 18.757  61.906  1.00 32.19  ? 198 ASN A ND2   1 
ATOM   523  O OXT   . ASN A 1 65 ? 66.359 16.820  58.948  1.00 36.27  ? 198 ASN A OXT   1 
ATOM   524  O "O5'" . DC  B 2 1  ? 29.700 4.083   52.634  1.00 131.88 ? 1   DC  B "O5'" 1 
ATOM   525  C "C5'" . DC  B 2 1  ? 30.513 2.895   52.556  1.00 124.21 ? 1   DC  B "C5'" 1 
ATOM   526  C "C4'" . DC  B 2 1  ? 31.025 2.515   53.928  1.00 116.57 ? 1   DC  B "C4'" 1 
ATOM   527  O "O4'" . DC  B 2 1  ? 31.680 1.226   53.857  1.00 120.15 ? 1   DC  B "O4'" 1 
ATOM   528  C "C3'" . DC  B 2 1  ? 32.034 3.498   54.529  1.00 101.19 ? 1   DC  B "C3'" 1 
ATOM   529  O "O3'" . DC  B 2 1  ? 31.389 4.244   55.573  1.00 81.06  ? 1   DC  B "O3'" 1 
ATOM   530  C "C2'" . DC  B 2 1  ? 33.142 2.622   55.095  1.00 94.66  ? 1   DC  B "C2'" 1 
ATOM   531  C "C1'" . DC  B 2 1  ? 32.976 1.259   54.440  1.00 99.24  ? 1   DC  B "C1'" 1 
ATOM   532  N N1    . DC  B 2 1  ? 33.960 0.912   53.392  1.00 84.62  ? 1   DC  B N1    1 
ATOM   533  C C2    . DC  B 2 1  ? 35.224 0.464   53.784  1.00 72.30  ? 1   DC  B C2    1 
ATOM   534  O O2    . DC  B 2 1  ? 35.491 0.408   54.993  1.00 64.79  ? 1   DC  B O2    1 
ATOM   535  N N3    . DC  B 2 1  ? 36.126 0.116   52.835  1.00 77.18  ? 1   DC  B N3    1 
ATOM   536  C C4    . DC  B 2 1  ? 35.798 0.194   51.542  1.00 87.35  ? 1   DC  B C4    1 
ATOM   537  N N4    . DC  B 2 1  ? 36.719 -0.154  50.638  1.00 88.06  ? 1   DC  B N4    1 
ATOM   538  C C5    . DC  B 2 1  ? 34.512 0.633   51.117  1.00 89.14  ? 1   DC  B C5    1 
ATOM   539  C C6    . DC  B 2 1  ? 33.630 0.973   52.066  1.00 92.11  ? 1   DC  B C6    1 
ATOM   540  P P     . DG  B 2 2  ? 31.408 5.853   55.582  1.00 80.37  ? 2   DG  B P     1 
ATOM   541  O OP1   . DG  B 2 2  ? 30.173 6.325   56.249  1.00 73.62  ? 2   DG  B OP1   1 
ATOM   542  O OP2   . DG  B 2 2  ? 31.786 6.347   54.229  1.00 74.36  ? 2   DG  B OP2   1 
ATOM   543  O "O5'" . DG  B 2 2  ? 32.615 6.212   56.561  1.00 61.31  ? 2   DG  B "O5'" 1 
ATOM   544  C "C5'" . DG  B 2 2  ? 32.750 5.536   57.816  1.00 55.53  ? 2   DG  B "C5'" 1 
ATOM   545  C "C4'" . DG  B 2 2  ? 34.212 5.519   58.169  1.00 51.81  ? 2   DG  B "C4'" 1 
ATOM   546  O "O4'" . DG  B 2 2  ? 34.855 4.530   57.323  1.00 47.61  ? 2   DG  B "O4'" 1 
ATOM   547  C "C3'" . DG  B 2 2  ? 34.898 6.859   57.869  1.00 48.74  ? 2   DG  B "C3'" 1 
ATOM   548  O "O3'" . DG  B 2 2  ? 35.824 7.218   58.895  1.00 44.26  ? 2   DG  B "O3'" 1 
ATOM   549  C "C2'" . DG  B 2 2  ? 35.632 6.587   56.572  1.00 45.57  ? 2   DG  B "C2'" 1 
ATOM   550  C "C1'" . DG  B 2 2  ? 35.995 5.138   56.783  1.00 47.10  ? 2   DG  B "C1'" 1 
ATOM   551  N N9    . DG  B 2 2  ? 36.408 4.410   55.596  1.00 47.76  ? 2   DG  B N9    1 
ATOM   552  C C8    . DG  B 2 2  ? 35.988 4.590   54.300  1.00 50.78  ? 2   DG  B C8    1 
ATOM   553  N N7    . DG  B 2 2  ? 36.626 3.836   53.449  1.00 49.53  ? 2   DG  B N7    1 
ATOM   554  C C5    . DG  B 2 2  ? 37.543 3.143   54.225  1.00 46.29  ? 2   DG  B C5    1 
ATOM   555  C C6    . DG  B 2 2  ? 38.535 2.203   53.852  1.00 45.18  ? 2   DG  B C6    1 
ATOM   556  O O6    . DG  B 2 2  ? 38.792 1.760   52.725  1.00 45.49  ? 2   DG  B O6    1 
ATOM   557  N N1    . DG  B 2 2  ? 39.253 1.752   54.956  1.00 42.28  ? 2   DG  B N1    1 
ATOM   558  C C2    . DG  B 2 2  ? 39.051 2.164   56.252  1.00 42.08  ? 2   DG  B C2    1 
ATOM   559  N N2    . DG  B 2 2  ? 39.839 1.609   57.184  1.00 40.69  ? 2   DG  B N2    1 
ATOM   560  N N3    . DG  B 2 2  ? 38.125 3.036   56.611  1.00 42.36  ? 2   DG  B N3    1 
ATOM   561  C C4    . DG  B 2 2  ? 37.431 3.500   55.550  1.00 46.42  ? 2   DG  B C4    1 
ATOM   562  P P     . DA  B 2 3  ? 36.383 8.696   59.017  1.00 40.76  ? 3   DA  B P     1 
ATOM   563  O OP1   . DA  B 2 3  ? 35.499 9.432   59.900  1.00 37.54  ? 3   DA  B OP1   1 
ATOM   564  O OP2   . DA  B 2 3  ? 36.777 9.265   57.685  1.00 37.60  ? 3   DA  B OP2   1 
ATOM   565  O "O5'" . DA  B 2 3  ? 37.775 8.464   59.776  1.00 36.80  ? 3   DA  B "O5'" 1 
ATOM   566  C "C5'" . DA  B 2 3  ? 37.769 7.729   61.019  1.00 36.09  ? 3   DA  B "C5'" 1 
ATOM   567  C "C4'" . DA  B 2 3  ? 38.949 6.788   61.092  1.00 34.53  ? 3   DA  B "C4'" 1 
ATOM   568  O "O4'" . DA  B 2 3  ? 38.794 5.722   60.131  1.00 34.49  ? 3   DA  B "O4'" 1 
ATOM   569  C "C3'" . DA  B 2 3  ? 40.309 7.404   60.775  1.00 32.46  ? 3   DA  B "C3'" 1 
ATOM   570  O "O3'" . DA  B 2 3  ? 40.937 7.891   61.963  1.00 27.53  ? 3   DA  B "O3'" 1 
ATOM   571  C "C2'" . DA  B 2 3  ? 41.115 6.206   60.323  1.00 31.43  ? 3   DA  B "C2'" 1 
ATOM   572  C "C1'" . DA  B 2 3  ? 40.079 5.371   59.598  1.00 35.41  ? 3   DA  B "C1'" 1 
ATOM   573  N N9    . DA  B 2 3  ? 40.039 5.542   58.149  1.00 34.82  ? 3   DA  B N9    1 
ATOM   574  C C8    . DA  B 2 3  ? 39.161 6.292   57.403  1.00 37.93  ? 3   DA  B C8    1 
ATOM   575  N N7    . DA  B 2 3  ? 39.353 6.197   56.108  1.00 34.11  ? 3   DA  B N7    1 
ATOM   576  C C5    . DA  B 2 3  ? 40.414 5.311   55.993  1.00 33.71  ? 3   DA  B C5    1 
ATOM   577  C C6    . DA  B 2 3  ? 41.094 4.789   54.875  1.00 37.72  ? 3   DA  B C6    1 
ATOM   578  N N6    . DA  B 2 3  ? 40.772 5.084   53.613  1.00 36.05  ? 3   DA  B N6    1 
ATOM   579  N N1    . DA  B 2 3  ? 42.133 3.953   55.103  1.00 34.99  ? 3   DA  B N1    1 
ATOM   580  C C2    . DA  B 2 3  ? 42.447 3.657   56.372  1.00 36.37  ? 3   DA  B C2    1 
ATOM   581  N N3    . DA  B 2 3  ? 41.878 4.076   57.502  1.00 32.48  ? 3   DA  B N3    1 
ATOM   582  C C4    . DA  B 2 3  ? 40.860 4.914   57.241  1.00 34.66  ? 3   DA  B C4    1 
ATOM   583  P P     . DC  B 2 4  ? 41.890 9.145   61.919  1.00 26.51  ? 4   DC  B P     1 
ATOM   584  O OP1   . DC  B 2 4  ? 42.415 9.329   63.349  1.00 27.09  ? 4   DC  B OP1   1 
ATOM   585  O OP2   . DC  B 2 4  ? 41.265 10.301  61.273  1.00 27.98  ? 4   DC  B OP2   1 
ATOM   586  O "O5'" . DC  B 2 4  ? 43.135 8.612   61.100  1.00 26.67  ? 4   DC  B "O5'" 1 
ATOM   587  C "C5'" . DC  B 2 4  ? 43.933 7.554   61.692  1.00 28.18  ? 4   DC  B "C5'" 1 
ATOM   588  C "C4'" . DC  B 2 4  ? 44.855 6.898   60.698  1.00 30.00  ? 4   DC  B "C4'" 1 
ATOM   589  O "O4'" . DC  B 2 4  ? 44.109 6.299   59.615  1.00 32.14  ? 4   DC  B "O4'" 1 
ATOM   590  C "C3'" . DC  B 2 4  ? 45.863 7.814   60.025  1.00 29.67  ? 4   DC  B "C3'" 1 
ATOM   591  O "O3'" . DC  B 2 4  ? 47.055 7.965   60.812  1.00 29.94  ? 4   DC  B "O3'" 1 
ATOM   592  C "C2'" . DC  B 2 4  ? 46.204 7.044   58.768  1.00 32.12  ? 4   DC  B "C2'" 1 
ATOM   593  C "C1'" . DC  B 2 4  ? 44.921 6.277   58.450  1.00 31.46  ? 4   DC  B "C1'" 1 
ATOM   594  N N1    . DC  B 2 4  ? 44.138 6.830   57.328  1.00 31.15  ? 4   DC  B N1    1 
ATOM   595  C C2    . DC  B 2 4  ? 44.534 6.485   56.033  1.00 31.95  ? 4   DC  B C2    1 
ATOM   596  O O2    . DC  B 2 4  ? 45.525 5.756   55.884  1.00 31.62  ? 4   DC  B O2    1 
ATOM   597  N N3    . DC  B 2 4  ? 43.833 6.953   54.977  1.00 30.97  ? 4   DC  B N3    1 
ATOM   598  C C4    . DC  B 2 4  ? 42.758 7.718   55.175  1.00 31.92  ? 4   DC  B C4    1 
ATOM   599  N N4    . DC  B 2 4  ? 42.103 8.157   54.098  1.00 30.44  ? 4   DC  B N4    1 
ATOM   600  C C5    . DC  B 2 4  ? 42.340 8.107   56.482  1.00 32.19  ? 4   DC  B C5    1 
ATOM   601  C C6    . DC  B 2 4  ? 43.045 7.629   57.524  1.00 29.99  ? 4   DC  B C6    1 
ATOM   602  P P     . DT  B 2 5  ? 48.001 9.204   60.560  1.00 26.82  ? 5   DT  B P     1 
ATOM   603  O OP1   . DT  B 2 5  ? 49.045 9.264   61.672  1.00 27.06  ? 5   DT  B OP1   1 
ATOM   604  O OP2   . DT  B 2 5  ? 47.259 10.386  60.287  1.00 24.17  ? 5   DT  B OP2   1 
ATOM   605  O "O5'" . DT  B 2 5  ? 48.816 8.806   59.236  1.00 27.30  ? 5   DT  B "O5'" 1 
ATOM   606  C "C5'" . DT  B 2 5  ? 49.745 7.713   59.211  1.00 32.34  ? 5   DT  B "C5'" 1 
ATOM   607  C "C4'" . DT  B 2 5  ? 50.249 7.513   57.800  1.00 35.19  ? 5   DT  B "C4'" 1 
ATOM   608  O "O4'" . DT  B 2 5  ? 49.160 7.204   56.916  1.00 33.69  ? 5   DT  B "O4'" 1 
ATOM   609  C "C3'" . DT  B 2 5  ? 50.927 8.733   57.197  1.00 33.61  ? 5   DT  B "C3'" 1 
ATOM   610  O "O3'" . DT  B 2 5  ? 52.320 8.550   57.444  1.00 37.94  ? 5   DT  B "O3'" 1 
ATOM   611  C "C2'" . DT  B 2 5  ? 50.617 8.623   55.719  1.00 34.01  ? 5   DT  B "C2'" 1 
ATOM   612  C "C1'" . DT  B 2 5  ? 49.359 7.790   55.648  1.00 33.64  ? 5   DT  B "C1'" 1 
ATOM   613  N N1    . DT  B 2 5  ? 48.126 8.539   55.285  1.00 29.96  ? 5   DT  B N1    1 
ATOM   614  C C2    . DT  B 2 5  ? 47.748 8.490   53.966  1.00 33.26  ? 5   DT  B C2    1 
ATOM   615  O O2    . DT  B 2 5  ? 48.424 7.950   53.110  1.00 32.21  ? 5   DT  B O2    1 
ATOM   616  N N3    . DT  B 2 5  ? 46.585 9.163   53.675  1.00 31.07  ? 5   DT  B N3    1 
ATOM   617  C C4    . DT  B 2 5  ? 45.766 9.833   54.567  1.00 30.67  ? 5   DT  B C4    1 
ATOM   618  O O4    . DT  B 2 5  ? 44.742 10.386  54.169  1.00 29.97  ? 5   DT  B O4    1 
ATOM   619  C C5    . DT  B 2 5  ? 46.228 9.849   55.936  1.00 28.45  ? 5   DT  B C5    1 
ATOM   620  C C7    . DT  B 2 5  ? 45.414 10.572  56.963  1.00 25.55  ? 5   DT  B C7    1 
ATOM   621  C C6    . DT  B 2 5  ? 47.362 9.198   56.226  1.00 30.33  ? 5   DT  B C6    1 
ATOM   622  P P     . DA  B 2 6  ? 53.360 9.681   57.080  1.00 41.54  ? 6   DA  B P     1 
ATOM   623  O OP1   . DA  B 2 6  ? 54.679 9.267   57.634  1.00 40.24  ? 6   DA  B OP1   1 
ATOM   624  O OP2   . DA  B 2 6  ? 52.782 11.008  57.372  1.00 32.39  ? 6   DA  B OP2   1 
ATOM   625  O "O5'" . DA  B 2 6  ? 53.456 9.626   55.489  1.00 36.35  ? 6   DA  B "O5'" 1 
ATOM   626  C "C5'" . DA  B 2 6  ? 53.907 8.469   54.783  1.00 38.59  ? 6   DA  B "C5'" 1 
ATOM   627  C "C4'" . DA  B 2 6  ? 54.088 8.843   53.334  1.00 42.16  ? 6   DA  B "C4'" 1 
ATOM   628  O "O4'" . DA  B 2 6  ? 52.809 9.208   52.773  1.00 41.12  ? 6   DA  B "O4'" 1 
ATOM   629  C "C3'" . DA  B 2 6  ? 54.995 10.043  53.093  1.00 46.01  ? 6   DA  B "C3'" 1 
ATOM   630  O "O3'" . DA  B 2 6  ? 55.670 9.869   51.843  1.00 50.28  ? 6   DA  B "O3'" 1 
ATOM   631  C "C2'" . DA  B 2 6  ? 54.029 11.210  53.058  1.00 43.36  ? 6   DA  B "C2'" 1 
ATOM   632  C "C1'" . DA  B 2 6  ? 52.767 10.590  52.463  1.00 42.14  ? 6   DA  B "C1'" 1 
ATOM   633  N N9    . DA  B 2 6  ? 51.504 11.121  52.983  1.00 40.33  ? 6   DA  B N9    1 
ATOM   634  C C8    . DA  B 2 6  ? 51.210 11.540  54.259  1.00 37.23  ? 6   DA  B C8    1 
ATOM   635  N N7    . DA  B 2 6  ? 49.973 11.946  54.409  1.00 34.01  ? 6   DA  B N7    1 
ATOM   636  C C5    . DA  B 2 6  ? 49.413 11.778  53.150  1.00 35.43  ? 6   DA  B C5    1 
ATOM   637  C C6    . DA  B 2 6  ? 48.134 12.049  52.646  1.00 33.03  ? 6   DA  B C6    1 
ATOM   638  N N6    . DA  B 2 6  ? 47.138 12.546  53.389  1.00 32.66  ? 6   DA  B N6    1 
ATOM   639  N N1    . DA  B 2 6  ? 47.907 11.800  51.335  1.00 32.90  ? 6   DA  B N1    1 
ATOM   640  C C2    . DA  B 2 6  ? 48.908 11.306  50.596  1.00 38.69  ? 6   DA  B C2    1 
ATOM   641  N N3    . DA  B 2 6  ? 50.154 11.006  50.960  1.00 37.19  ? 6   DA  B N3    1 
ATOM   642  C C4    . DA  B 2 6  ? 50.351 11.293  52.258  1.00 36.48  ? 6   DA  B C4    1 
ATOM   643  P P     . DA  B 2 7  ? 56.664 10.991  51.311  1.00 56.80  ? 7   DA  B P     1 
ATOM   644  O OP1   . DA  B 2 7  ? 57.767 10.315  50.583  1.00 52.01  ? 7   DA  B OP1   1 
ATOM   645  O OP2   . DA  B 2 7  ? 56.950 11.941  52.418  1.00 58.99  ? 7   DA  B OP2   1 
ATOM   646  O "O5'" . DA  B 2 7  ? 55.797 11.748  50.219  1.00 51.84  ? 7   DA  B "O5'" 1 
ATOM   647  C "C5'" . DA  B 2 7  ? 55.170 11.015  49.153  1.00 50.22  ? 7   DA  B "C5'" 1 
ATOM   648  C "C4'" . DA  B 2 7  ? 54.217 11.930  48.422  1.00 49.07  ? 7   DA  B "C4'" 1 
ATOM   649  O "O4'" . DA  B 2 7  ? 53.074 12.227  49.266  1.00 44.47  ? 7   DA  B "O4'" 1 
ATOM   650  C "C3'" . DA  B 2 7  ? 54.831 13.278  48.033  1.00 49.81  ? 7   DA  B "C3'" 1 
ATOM   651  O "O3'" . DA  B 2 7  ? 54.826 13.349  46.603  1.00 53.55  ? 7   DA  B "O3'" 1 
ATOM   652  C "C2'" . DA  B 2 7  ? 53.975 14.306  48.764  1.00 46.74  ? 7   DA  B "C2'" 1 
ATOM   653  C "C1'" . DA  B 2 7  ? 52.679 13.558  49.022  1.00 41.35  ? 7   DA  B "C1'" 1 
ATOM   654  N N9    . DA  B 2 7  ? 51.897 14.016  50.173  1.00 38.38  ? 7   DA  B N9    1 
ATOM   655  C C8    . DA  B 2 7  ? 52.307 14.161  51.476  1.00 37.03  ? 7   DA  B C8    1 
ATOM   656  N N7    . DA  B 2 7  ? 51.360 14.575  52.282  1.00 36.94  ? 7   DA  B N7    1 
ATOM   657  C C5    . DA  B 2 7  ? 50.254 14.710  51.457  1.00 30.86  ? 7   DA  B C5    1 
ATOM   658  C C6    . DA  B 2 7  ? 48.941 15.153  51.701  1.00 32.61  ? 7   DA  B C6    1 
ATOM   659  N N6    . DA  B 2 7  ? 48.495 15.512  52.905  1.00 30.93  ? 7   DA  B N6    1 
ATOM   660  N N1    . DA  B 2 7  ? 48.072 15.142  50.669  1.00 29.86  ? 7   DA  B N1    1 
ATOM   661  C C2    . DA  B 2 7  ? 48.525 14.787  49.457  1.00 35.52  ? 7   DA  B C2    1 
ATOM   662  N N3    . DA  B 2 7  ? 49.741 14.382  49.098  1.00 33.13  ? 7   DA  B N3    1 
ATOM   663  C C4    . DA  B 2 7  ? 50.567 14.362  50.158  1.00 37.11  ? 7   DA  B C4    1 
ATOM   664  P P     . DT  B 2 8  ? 55.362 14.652  45.853  1.00 60.53  ? 8   DT  B P     1 
ATOM   665  O OP1   . DT  B 2 8  ? 55.779 14.249  44.489  1.00 66.52  ? 8   DT  B OP1   1 
ATOM   666  O OP2   . DT  B 2 8  ? 56.324 15.355  46.744  1.00 57.49  ? 8   DT  B OP2   1 
ATOM   667  O "O5'" . DT  B 2 8  ? 54.049 15.540  45.740  1.00 56.04  ? 8   DT  B "O5'" 1 
ATOM   668  C "C5'" . DT  B 2 8  ? 52.837 14.998  45.196  1.00 49.99  ? 8   DT  B "C5'" 1 
ATOM   669  C "C4'" . DT  B 2 8  ? 51.719 15.992  45.398  1.00 50.08  ? 8   DT  B "C4'" 1 
ATOM   670  O "O4'" . DT  B 2 8  ? 51.413 16.076  46.810  1.00 44.00  ? 8   DT  B "O4'" 1 
ATOM   671  C "C3'" . DT  B 2 8  ? 52.032 17.425  44.948  1.00 48.40  ? 8   DT  B "C3'" 1 
ATOM   672  O "O3'" . DT  B 2 8  ? 51.279 17.659  43.748  1.00 54.21  ? 8   DT  B "O3'" 1 
ATOM   673  C "C2'" . DT  B 2 8  ? 51.667 18.286  46.155  1.00 46.04  ? 8   DT  B "C2'" 1 
ATOM   674  C "C1'" . DT  B 2 8  ? 50.863 17.349  47.037  1.00 43.14  ? 8   DT  B "C1'" 1 
ATOM   675  N N1    . DT  B 2 8  ? 50.872 17.600  48.504  1.00 41.39  ? 8   DT  B N1    1 
ATOM   676  C C2    . DT  B 2 8  ? 49.672 17.929  49.093  1.00 38.22  ? 8   DT  B C2    1 
ATOM   677  O O2    . DT  B 2 8  ? 48.640 18.066  48.463  1.00 37.59  ? 8   DT  B O2    1 
ATOM   678  N N3    . DT  B 2 8  ? 49.730 18.116  50.454  1.00 35.78  ? 8   DT  B N3    1 
ATOM   679  C C4    . DT  B 2 8  ? 50.840 18.017  51.261  1.00 35.63  ? 8   DT  B C4    1 
ATOM   680  O O4    . DT  B 2 8  ? 50.732 18.216  52.472  1.00 32.98  ? 8   DT  B O4    1 
ATOM   681  C C5    . DT  B 2 8  ? 52.068 17.651  50.578  1.00 37.52  ? 8   DT  B C5    1 
ATOM   682  C C7    . DT  B 2 8  ? 53.327 17.505  51.371  1.00 39.94  ? 8   DT  B C7    1 
ATOM   683  C C6    . DT  B 2 8  ? 52.016 17.444  49.255  1.00 38.98  ? 8   DT  B C6    1 
ATOM   684  P P     . DT  B 2 9  ? 51.403 19.024  42.947  1.00 55.65  ? 9   DT  B P     1 
ATOM   685  O OP1   . DT  B 2 9  ? 51.002 18.754  41.540  1.00 56.55  ? 9   DT  B OP1   1 
ATOM   686  O OP2   . DT  B 2 9  ? 52.721 19.638  43.253  1.00 57.53  ? 9   DT  B OP2   1 
ATOM   687  O "O5'" . DT  B 2 9  ? 50.275 19.930  43.607  1.00 52.27  ? 9   DT  B "O5'" 1 
ATOM   688  C "C5'" . DT  B 2 9  ? 48.919 19.457  43.705  1.00 45.51  ? 9   DT  B "C5'" 1 
ATOM   689  C "C4'" . DT  B 2 9  ? 48.054 20.526  44.330  1.00 45.84  ? 9   DT  B "C4'" 1 
ATOM   690  O "O4'" . DT  B 2 9  ? 48.216 20.516  45.772  1.00 44.61  ? 9   DT  B "O4'" 1 
ATOM   691  C "C3'" . DT  B 2 9  ? 48.365 21.957  43.884  1.00 46.45  ? 9   DT  B "C3'" 1 
ATOM   692  O "O3'" . DT  B 2 9  ? 47.101 22.566  43.661  1.00 46.22  ? 9   DT  B "O3'" 1 
ATOM   693  C "C2'" . DT  B 2 9  ? 49.108 22.557  45.070  1.00 43.09  ? 9   DT  B "C2'" 1 
ATOM   694  C "C1'" . DT  B 2 9  ? 48.453 21.834  46.230  1.00 40.34  ? 9   DT  B "C1'" 1 
ATOM   695  N N1    . DT  B 2 9  ? 49.213 21.731  47.495  1.00 36.80  ? 9   DT  B N1    1 
ATOM   696  C C2    . DT  B 2 9  ? 48.482 21.813  48.655  1.00 36.53  ? 9   DT  B C2    1 
ATOM   697  O O2    . DT  B 2 9  ? 47.278 22.019  48.665  1.00 35.95  ? 9   DT  B O2    1 
ATOM   698  N N3    . DT  B 2 9  ? 49.222 21.676  49.811  1.00 32.23  ? 9   DT  B N3    1 
ATOM   699  C C4    . DT  B 2 9  ? 50.574 21.400  49.906  1.00 33.01  ? 9   DT  B C4    1 
ATOM   700  O O4    . DT  B 2 9  ? 51.100 21.267  51.015  1.00 33.98  ? 9   DT  B O4    1 
ATOM   701  C C5    . DT  B 2 9  ? 51.274 21.309  48.644  1.00 36.10  ? 9   DT  B C5    1 
ATOM   702  C C7    . DT  B 2 9  ? 52.747 21.041  48.648  1.00 37.92  ? 9   DT  B C7    1 
ATOM   703  C C6    . DT  B 2 9  ? 50.564 21.453  47.516  1.00 37.11  ? 9   DT  B C6    1 
ATOM   704  P P     . DA  B 2 10 ? 47.002 24.008  43.002  1.00 53.02  ? 10  DA  B P     1 
ATOM   705  O OP1   . DA  B 2 10 ? 45.723 24.063  42.265  1.00 48.77  ? 10  DA  B OP1   1 
ATOM   706  O OP2   . DA  B 2 10 ? 48.295 24.323  42.334  1.00 55.14  ? 10  DA  B OP2   1 
ATOM   707  O "O5'" . DA  B 2 10 ? 46.883 24.947  44.280  1.00 47.75  ? 10  DA  B "O5'" 1 
ATOM   708  C "C5'" . DA  B 2 10 ? 45.653 24.988  45.012  1.00 43.66  ? 10  DA  B "C5'" 1 
ATOM   709  C "C4'" . DA  B 2 10 ? 45.829 25.813  46.261  1.00 42.99  ? 10  DA  B "C4'" 1 
ATOM   710  O "O4'" . DA  B 2 10 ? 46.861 25.229  47.095  1.00 40.02  ? 10  DA  B "O4'" 1 
ATOM   711  C "C3'" . DA  B 2 10 ? 46.268 27.258  46.009  1.00 44.58  ? 10  DA  B "C3'" 1 
ATOM   712  O "O3'" . DA  B 2 10 ? 45.557 28.109  46.901  1.00 45.59  ? 10  DA  B "O3'" 1 
ATOM   713  C "C2'" . DA  B 2 10 ? 47.737 27.247  46.378  1.00 39.97  ? 10  DA  B "C2'" 1 
ATOM   714  C "C1'" . DA  B 2 10 ? 47.668 26.295  47.550  1.00 39.90  ? 10  DA  B "C1'" 1 
ATOM   715  N N9    . DA  B 2 10 ? 48.938 25.746  48.000  1.00 37.36  ? 10  DA  B N9    1 
ATOM   716  C C8    . DA  B 2 10 ? 50.048 25.377  47.282  1.00 38.48  ? 10  DA  B C8    1 
ATOM   717  N N7    . DA  B 2 10 ? 51.029 24.921  48.025  1.00 38.64  ? 10  DA  B N7    1 
ATOM   718  C C5    . DA  B 2 10 ? 50.541 25.026  49.320  1.00 33.37  ? 10  DA  B C5    1 
ATOM   719  C C6    . DA  B 2 10 ? 51.091 24.692  50.568  1.00 34.20  ? 10  DA  B C6    1 
ATOM   720  N N6    . DA  B 2 10 ? 52.325 24.210  50.723  1.00 37.63  ? 10  DA  B N6    1 
ATOM   721  N N1    . DA  B 2 10 ? 50.331 24.897  51.667  1.00 31.76  ? 10  DA  B N1    1 
ATOM   722  C C2    . DA  B 2 10 ? 49.102 25.403  51.510  1.00 36.09  ? 10  DA  B C2    1 
ATOM   723  N N3    . DA  B 2 10 ? 48.468 25.739  50.387  1.00 34.62  ? 10  DA  B N3    1 
ATOM   724  C C4    . DA  B 2 10 ? 49.249 25.518  49.317  1.00 34.45  ? 10  DA  B C4    1 
ATOM   725  P P     . DG  B 2 11 ? 45.099 29.564  46.458  1.00 54.47  ? 11  DG  B P     1 
ATOM   726  O OP1   . DG  B 2 11 ? 43.834 29.428  45.725  1.00 55.16  ? 11  DG  B OP1   1 
ATOM   727  O OP2   . DG  B 2 11 ? 46.262 30.261  45.851  1.00 47.58  ? 11  DG  B OP2   1 
ATOM   728  O "O5'" . DG  B 2 11 ? 44.772 30.256  47.856  1.00 51.41  ? 11  DG  B "O5'" 1 
ATOM   729  C "C5'" . DG  B 2 11 ? 43.793 29.707  48.755  1.00 49.07  ? 11  DG  B "C5'" 1 
ATOM   730  C "C4'" . DG  B 2 11 ? 44.181 30.047  50.176  1.00 47.87  ? 11  DG  B "C4'" 1 
ATOM   731  O "O4'" . DG  B 2 11 ? 45.381 29.327  50.541  1.00 50.26  ? 11  DG  B "O4'" 1 
ATOM   732  C "C3'" . DG  B 2 11 ? 44.489 31.524  50.427  1.00 48.09  ? 11  DG  B "C3'" 1 
ATOM   733  O "O3'" . DG  B 2 11 ? 43.915 31.851  51.701  1.00 50.96  ? 11  DG  B "O3'" 1 
ATOM   734  C "C2'" . DG  B 2 11 ? 46.010 31.579  50.391  1.00 47.11  ? 11  DG  B "C2'" 1 
ATOM   735  C "C1'" . DG  B 2 11 ? 46.366 30.243  51.014  1.00 42.87  ? 11  DG  B "C1'" 1 
ATOM   736  N N9    . DG  B 2 11 ? 47.681 29.686  50.702  1.00 40.61  ? 11  DG  B N9    1 
ATOM   737  C C8    . DG  B 2 11 ? 48.197 29.361  49.470  1.00 39.03  ? 11  DG  B C8    1 
ATOM   738  N N7    . DG  B 2 11 ? 49.390 28.833  49.539  1.00 38.10  ? 11  DG  B N7    1 
ATOM   739  C C5    . DG  B 2 11 ? 49.681 28.815  50.898  1.00 34.77  ? 11  DG  B C5    1 
ATOM   740  C C6    . DG  B 2 11 ? 50.844 28.368  51.590  1.00 34.73  ? 11  DG  B C6    1 
ATOM   741  O O6    . DG  B 2 11 ? 51.880 27.882  51.125  1.00 37.84  ? 11  DG  B O6    1 
ATOM   742  N N1    . DG  B 2 11 ? 50.715 28.533  52.966  1.00 36.25  ? 11  DG  B N1    1 
ATOM   743  C C2    . DG  B 2 11 ? 49.624 29.071  53.598  1.00 33.31  ? 11  DG  B C2    1 
ATOM   744  N N2    . DG  B 2 11 ? 49.696 29.157  54.930  1.00 32.38  ? 11  DG  B N2    1 
ATOM   745  N N3    . DG  B 2 11 ? 48.535 29.492  52.966  1.00 37.88  ? 11  DG  B N3    1 
ATOM   746  C C4    . DG  B 2 11 ? 48.635 29.335  51.628  1.00 35.23  ? 11  DG  B C4    1 
ATOM   747  P P     . DT  B 2 12 ? 43.984 33.343  52.268  1.00 60.09  ? 12  DT  B P     1 
ATOM   748  O OP1   . DT  B 2 12 ? 42.750 33.574  53.068  1.00 67.41  ? 12  DT  B OP1   1 
ATOM   749  O OP2   . DT  B 2 12 ? 44.323 34.252  51.136  1.00 70.90  ? 12  DT  B OP2   1 
ATOM   750  O "O5'" . DT  B 2 12 ? 45.215 33.301  53.277  1.00 56.01  ? 12  DT  B "O5'" 1 
ATOM   751  C "C5'" . DT  B 2 12 ? 45.243 32.325  54.323  1.00 54.94  ? 12  DT  B "C5'" 1 
ATOM   752  C "C4'" . DT  B 2 12 ? 46.185 32.752  55.424  1.00 55.91  ? 12  DT  B "C4'" 1 
ATOM   753  O "O4'" . DT  B 2 12 ? 47.510 32.243  55.155  1.00 50.99  ? 12  DT  B "O4'" 1 
ATOM   754  C "C3'" . DT  B 2 12 ? 46.348 34.256  55.630  1.00 58.66  ? 12  DT  B "C3'" 1 
ATOM   755  O "O3'" . DT  B 2 12 ? 46.441 34.422  57.050  1.00 62.84  ? 12  DT  B "O3'" 1 
ATOM   756  C "C2'" . DT  B 2 12 ? 47.625 34.583  54.870  1.00 53.65  ? 12  DT  B "C2'" 1 
ATOM   757  C "C1'" . DT  B 2 12 ? 48.446 33.313  55.062  1.00 50.30  ? 12  DT  B "C1'" 1 
ATOM   758  N N1    . DT  B 2 12 ? 49.404 32.947  54.008  1.00 45.76  ? 12  DT  B N1    1 
ATOM   759  C C2    . DT  B 2 12 ? 50.574 32.346  54.407  1.00 43.29  ? 12  DT  B C2    1 
ATOM   760  O O2    . DT  B 2 12 ? 50.884 32.201  55.581  1.00 45.23  ? 12  DT  B O2    1 
ATOM   761  N N3    . DT  B 2 12 ? 51.394 31.953  53.382  1.00 44.53  ? 12  DT  B N3    1 
ATOM   762  C C4    . DT  B 2 12 ? 51.148 32.061  52.028  1.00 42.73  ? 12  DT  B C4    1 
ATOM   763  O O4    . DT  B 2 12 ? 51.971 31.638  51.226  1.00 43.60  ? 12  DT  B O4    1 
ATOM   764  C C5    . DT  B 2 12 ? 49.878 32.659  51.677  1.00 45.01  ? 12  DT  B C5    1 
ATOM   765  C C7    . DT  B 2 12 ? 49.527 32.825  50.231  1.00 45.00  ? 12  DT  B C7    1 
ATOM   766  C C6    . DT  B 2 12 ? 49.077 33.061  52.673  1.00 44.80  ? 12  DT  B C6    1 
ATOM   767  P P     . DC  B 2 13 ? 46.517 35.872  57.701  1.00 63.82  ? 13  DC  B P     1 
ATOM   768  O OP1   . DC  B 2 13 ? 45.889 35.794  59.045  1.00 69.73  ? 13  DC  B OP1   1 
ATOM   769  O OP2   . DC  B 2 13 ? 46.036 36.876  56.718  1.00 54.09  ? 13  DC  B OP2   1 
ATOM   770  O "O5'" . DC  B 2 13 ? 48.082 36.089  57.882  1.00 60.84  ? 13  DC  B "O5'" 1 
ATOM   771  C "C5'" . DC  B 2 13 ? 48.844 35.215  58.732  1.00 56.10  ? 13  DC  B "C5'" 1 
ATOM   772  C "C4'" . DC  B 2 13 ? 50.293 35.635  58.717  1.00 56.20  ? 13  DC  B "C4'" 1 
ATOM   773  O "O4'" . DC  B 2 13 ? 50.909 35.219  57.472  1.00 53.26  ? 13  DC  B "O4'" 1 
ATOM   774  C "C3'" . DC  B 2 13 ? 50.511 37.146  58.790  1.00 57.06  ? 13  DC  B "C3'" 1 
ATOM   775  O "O3'" . DC  B 2 13 ? 51.742 37.384  59.456  1.00 60.74  ? 13  DC  B "O3'" 1 
ATOM   776  C "C2'" . DC  B 2 13 ? 50.692 37.535  57.339  1.00 54.76  ? 13  DC  B "C2'" 1 
ATOM   777  C "C1'" . DC  B 2 13 ? 51.518 36.355  56.878  1.00 53.18  ? 13  DC  B "C1'" 1 
ATOM   778  N N1    . DC  B 2 13 ? 51.612 36.123  55.432  1.00 47.76  ? 13  DC  B N1    1 
ATOM   779  C C2    . DC  B 2 13 ? 52.652 35.321  54.965  1.00 45.71  ? 13  DC  B C2    1 
ATOM   780  O O2    . DC  B 2 13 ? 53.432 34.821  55.784  1.00 50.81  ? 13  DC  B O2    1 
ATOM   781  N N3    . DC  B 2 13 ? 52.763 35.085  53.640  1.00 45.52  ? 13  DC  B N3    1 
ATOM   782  C C4    . DC  B 2 13 ? 51.902 35.645  52.790  1.00 46.44  ? 13  DC  B C4    1 
ATOM   783  N N4    . DC  B 2 13 ? 52.056 35.393  51.487  1.00 49.82  ? 13  DC  B N4    1 
ATOM   784  C C5    . DC  B 2 13 ? 50.838 36.480  53.237  1.00 48.68  ? 13  DC  B C5    1 
ATOM   785  C C6    . DC  B 2 13 ? 50.735 36.697  54.555  1.00 47.81  ? 13  DC  B C6    1 
ATOM   786  P P     . DG  B 2 14 ? 51.789 38.390  60.666  1.00 70.33  ? 14  DG  B P     1 
ATOM   787  O OP1   . DG  B 2 14 ? 50.799 37.919  61.673  1.00 67.63  ? 14  DG  B OP1   1 
ATOM   788  O OP2   . DG  B 2 14 ? 51.717 39.765  60.109  1.00 61.03  ? 14  DG  B OP2   1 
ATOM   789  O "O5'" . DG  B 2 14 ? 53.249 38.156  61.263  1.00 68.14  ? 14  DG  B "O5'" 1 
ATOM   790  C "C5'" . DG  B 2 14 ? 53.730 36.836  61.596  1.00 62.83  ? 14  DG  B "C5'" 1 
ATOM   791  C "C4'" . DG  B 2 14 ? 55.162 36.683  61.137  1.00 62.14  ? 14  DG  B "C4'" 1 
ATOM   792  O "O4'" . DG  B 2 14 ? 55.190 36.545  59.696  1.00 56.57  ? 14  DG  B "O4'" 1 
ATOM   793  C "C3'" . DG  B 2 14 ? 56.084 37.865  61.453  1.00 63.66  ? 14  DG  B "C3'" 1 
ATOM   794  O "O3'" . DG  B 2 14 ? 57.409 37.396  61.723  1.00 66.38  ? 14  DG  B "O3'" 1 
ATOM   795  C "C2'" . DG  B 2 14 ? 56.087 38.661  60.161  1.00 60.70  ? 14  DG  B "C2'" 1 
ATOM   796  C "C1'" . DG  B 2 14 ? 56.037 37.540  59.140  1.00 56.96  ? 14  DG  B "C1'" 1 
ATOM   797  N N9    . DG  B 2 14 ? 55.501 37.883  57.832  1.00 51.53  ? 14  DG  B N9    1 
ATOM   798  C C8    . DG  B 2 14 ? 54.408 38.666  57.551  1.00 49.70  ? 14  DG  B C8    1 
ATOM   799  N N7    . DG  B 2 14 ? 54.151 38.744  56.275  1.00 49.41  ? 14  DG  B N7    1 
ATOM   800  C C5    . DG  B 2 14 ? 55.119 37.947  55.680  1.00 48.30  ? 14  DG  B C5    1 
ATOM   801  C C6    . DG  B 2 14 ? 55.348 37.646  54.312  1.00 49.69  ? 14  DG  B C6    1 
ATOM   802  O O6    . DG  B 2 14 ? 54.715 38.033  53.321  1.00 49.83  ? 14  DG  B O6    1 
ATOM   803  N N1    . DG  B 2 14 ? 56.431 36.786  54.152  1.00 48.50  ? 14  DG  B N1    1 
ATOM   804  C C2    . DG  B 2 14 ? 57.211 36.300  55.175  1.00 49.65  ? 14  DG  B C2    1 
ATOM   805  N N2    . DG  B 2 14 ? 58.221 35.494  54.820  1.00 50.02  ? 14  DG  B N2    1 
ATOM   806  N N3    . DG  B 2 14 ? 57.017 36.588  56.452  1.00 50.42  ? 14  DG  B N3    1 
ATOM   807  C C4    . DG  B 2 14 ? 55.953 37.399  56.630  1.00 50.93  ? 14  DG  B C4    1 
ATOM   808  O "O5'" . DC  C 2 1  ? 60.754 36.472  45.636  1.00 98.08  ? 1   DC  C "O5'" 1 
ATOM   809  C "C5'" . DC  C 2 1  ? 61.343 35.183  45.885  1.00 96.97  ? 1   DC  C "C5'" 1 
ATOM   810  C "C4'" . DC  C 2 1  ? 61.217 34.820  47.349  1.00 93.11  ? 1   DC  C "C4'" 1 
ATOM   811  O "O4'" . DC  C 2 1  ? 60.356 35.608  48.209  1.00 89.00  ? 1   DC  C "O4'" 1 
ATOM   812  C "C3'" . DC  C 2 1  ? 61.202 33.383  47.855  1.00 91.63  ? 1   DC  C "C3'" 1 
ATOM   813  O "O3'" . DC  C 2 1  ? 62.426 33.105  48.552  1.00 97.34  ? 1   DC  C "O3'" 1 
ATOM   814  C "C2'" . DC  C 2 1  ? 59.986 33.353  48.768  1.00 84.14  ? 1   DC  C "C2'" 1 
ATOM   815  C "C1'" . DC  C 2 1  ? 59.918 34.784  49.286  1.00 81.02  ? 1   DC  C "C1'" 1 
ATOM   816  N N1    . DC  C 2 1  ? 58.582 35.250  49.703  1.00 72.17  ? 1   DC  C N1    1 
ATOM   817  C C2    . DC  C 2 1  ? 58.324 35.454  51.065  1.00 67.61  ? 1   DC  C C2    1 
ATOM   818  O O2    . DC  C 2 1  ? 59.220 35.214  51.890  1.00 67.99  ? 1   DC  C O2    1 
ATOM   819  N N3    . DC  C 2 1  ? 57.107 35.908  51.447  1.00 61.48  ? 1   DC  C N3    1 
ATOM   820  C C4    . DC  C 2 1  ? 56.175 36.171  50.527  1.00 64.42  ? 1   DC  C C4    1 
ATOM   821  N N4    . DC  C 2 1  ? 54.987 36.611  50.947  1.00 62.22  ? 1   DC  C N4    1 
ATOM   822  C C5    . DC  C 2 1  ? 56.411 35.968  49.135  1.00 64.04  ? 1   DC  C C5    1 
ATOM   823  C C6    . DC  C 2 1  ? 57.617 35.512  48.771  1.00 68.75  ? 1   DC  C C6    1 
ATOM   824  P P     . DG  C 2 2  ? 62.820 31.592  48.941  1.00 91.36  ? 2   DG  C P     1 
ATOM   825  O OP1   . DG  C 2 2  ? 64.262 31.562  49.289  1.00 92.35  ? 2   DG  C OP1   1 
ATOM   826  O OP2   . DG  C 2 2  ? 62.280 30.688  47.894  1.00 84.37  ? 2   DG  C OP2   1 
ATOM   827  O "O5'" . DG  C 2 2  ? 62.024 31.337  50.296  1.00 85.23  ? 2   DG  C "O5'" 1 
ATOM   828  C "C5'" . DG  C 2 2  ? 62.684 31.472  51.569  1.00 88.52  ? 2   DG  C "C5'" 1 
ATOM   829  C "C4'" . DG  C 2 2  ? 61.739 31.078  52.679  1.00 79.93  ? 2   DG  C "C4'" 1 
ATOM   830  O "O4'" . DG  C 2 2  ? 60.498 31.810  52.539  1.00 74.17  ? 2   DG  C "O4'" 1 
ATOM   831  C "C3'" . DG  C 2 2  ? 61.349 29.601  52.677  1.00 79.18  ? 2   DG  C "C3'" 1 
ATOM   832  O "O3'" . DG  C 2 2  ? 61.243 29.128  54.015  1.00 82.23  ? 2   DG  C "O3'" 1 
ATOM   833  C "C2'" . DG  C 2 2  ? 59.976 29.601  52.039  1.00 69.07  ? 2   DG  C "C2'" 1 
ATOM   834  C "C1'" . DG  C 2 2  ? 59.421 30.894  52.592  1.00 66.35  ? 2   DG  C "C1'" 1 
ATOM   835  N N9    . DG  C 2 2  ? 58.296 31.472  51.867  1.00 62.35  ? 2   DG  C N9    1 
ATOM   836  C C8    . DG  C 2 2  ? 58.041 31.417  50.517  1.00 62.66  ? 2   DG  C C8    1 
ATOM   837  N N7    . DG  C 2 2  ? 56.937 32.028  50.179  1.00 57.80  ? 2   DG  C N7    1 
ATOM   838  C C5    . DG  C 2 2  ? 56.432 32.511  51.378  1.00 55.81  ? 2   DG  C C5    1 
ATOM   839  C C6    . DG  C 2 2  ? 55.255 33.254  51.647  1.00 54.72  ? 2   DG  C C6    1 
ATOM   840  O O6    . DG  C 2 2  ? 54.399 33.655  50.850  1.00 54.45  ? 2   DG  C O6    1 
ATOM   841  N N1    . DG  C 2 2  ? 55.132 33.548  53.003  1.00 51.68  ? 2   DG  C N1    1 
ATOM   842  C C2    . DG  C 2 2  ? 56.015 33.155  53.979  1.00 51.29  ? 2   DG  C C2    1 
ATOM   843  N N2    . DG  C 2 2  ? 55.718 33.525  55.235  1.00 50.54  ? 2   DG  C N2    1 
ATOM   844  N N3    . DG  C 2 2  ? 57.116 32.461  53.741  1.00 54.70  ? 2   DG  C N3    1 
ATOM   845  C C4    . DG  C 2 2  ? 57.260 32.176  52.429  1.00 56.83  ? 2   DG  C C4    1 
ATOM   846  P P     . DA  C 2 3  ? 61.616 27.632  54.328  1.00 88.49  ? 3   DA  C P     1 
ATOM   847  O OP1   . DA  C 2 3  ? 63.097 27.548  54.445  1.00 83.88  ? 3   DA  C OP1   1 
ATOM   848  O OP2   . DA  C 2 3  ? 60.897 26.779  53.348  1.00 90.56  ? 3   DA  C OP2   1 
ATOM   849  O "O5'" . DA  C 2 3  ? 60.955 27.386  55.755  1.00 73.80  ? 3   DA  C "O5'" 1 
ATOM   850  C "C5'" . DA  C 2 3  ? 61.189 28.277  56.860  1.00 73.18  ? 3   DA  C "C5'" 1 
ATOM   851  C "C4'" . DA  C 2 3  ? 59.921 28.428  57.668  1.00 67.46  ? 3   DA  C "C4'" 1 
ATOM   852  O "O4'" . DA  C 2 3  ? 58.916 29.107  56.876  1.00 62.72  ? 3   DA  C "O4'" 1 
ATOM   853  C "C3'" . DA  C 2 3  ? 59.290 27.110  58.126  1.00 61.04  ? 3   DA  C "C3'" 1 
ATOM   854  O "O3'" . DA  C 2 3  ? 58.999 27.233  59.526  1.00 56.73  ? 3   DA  C "O3'" 1 
ATOM   855  C "C2'" . DA  C 2 3  ? 58.107 26.934  57.184  1.00 59.08  ? 3   DA  C "C2'" 1 
ATOM   856  C "C1'" . DA  C 2 3  ? 57.708 28.365  56.875  1.00 56.19  ? 3   DA  C "C1'" 1 
ATOM   857  N N9    . DA  C 2 3  ? 57.069 28.577  55.580  1.00 51.75  ? 3   DA  C N9    1 
ATOM   858  C C8    . DA  C 2 3  ? 57.494 28.133  54.353  1.00 51.11  ? 3   DA  C C8    1 
ATOM   859  N N7    . DA  C 2 3  ? 56.729 28.516  53.359  1.00 48.47  ? 3   DA  C N7    1 
ATOM   860  C C5    . DA  C 2 3  ? 55.757 29.298  53.967  1.00 44.28  ? 3   DA  C C5    1 
ATOM   861  C C6    . DA  C 2 3  ? 54.633 29.980  53.458  1.00 44.96  ? 3   DA  C C6    1 
ATOM   862  N N6    . DA  C 2 3  ? 54.308 30.016  52.163  1.00 42.04  ? 3   DA  C N6    1 
ATOM   863  N N1    . DA  C 2 3  ? 53.854 30.648  54.337  1.00 42.89  ? 3   DA  C N1    1 
ATOM   864  C C2    . DA  C 2 3  ? 54.180 30.615  55.638  1.00 42.29  ? 3   DA  C C2    1 
ATOM   865  N N3    . DA  C 2 3  ? 55.194 29.990  56.238  1.00 44.72  ? 3   DA  C N3    1 
ATOM   866  C C4    . DA  C 2 3  ? 55.951 29.339  55.336  1.00 47.19  ? 3   DA  C C4    1 
ATOM   867  P P     . DC  C 2 4  ? 58.249 26.061  60.310  1.00 60.00  ? 4   DC  C P     1 
ATOM   868  O OP1   . DC  C 2 4  ? 58.457 26.254  61.766  1.00 59.23  ? 4   DC  C OP1   1 
ATOM   869  O OP2   . DC  C 2 4  ? 58.541 24.769  59.637  1.00 52.76  ? 4   DC  C OP2   1 
ATOM   870  O "O5'" . DC  C 2 4  ? 56.711 26.345  60.005  1.00 45.26  ? 4   DC  C "O5'" 1 
ATOM   871  C "C5'" . DC  C 2 4  ? 56.074 27.527  60.487  1.00 42.10  ? 4   DC  C "C5'" 1 
ATOM   872  C "C4'" . DC  C 2 4  ? 54.649 27.529  59.988  1.00 39.77  ? 4   DC  C "C4'" 1 
ATOM   873  O "O4'" . DC  C 2 4  ? 54.688 27.669  58.556  1.00 39.19  ? 4   DC  C "O4'" 1 
ATOM   874  C "C3'" . DC  C 2 4  ? 53.870 26.229  60.258  1.00 35.77  ? 4   DC  C "C3'" 1 
ATOM   875  O "O3'" . DC  C 2 4  ? 52.879 26.600  61.215  1.00 37.12  ? 4   DC  C "O3'" 1 
ATOM   876  C "C2'" . DC  C 2 4  ? 53.349 25.813  58.884  1.00 36.97  ? 4   DC  C "C2'" 1 
ATOM   877  C "C1'" . DC  C 2 4  ? 53.498 27.080  58.066  1.00 38.25  ? 4   DC  C "C1'" 1 
ATOM   878  N N1    . DC  C 2 4  ? 53.639 26.897  56.610  1.00 35.21  ? 4   DC  C N1    1 
ATOM   879  C C2    . DC  C 2 4  ? 52.711 27.522  55.771  1.00 38.95  ? 4   DC  C C2    1 
ATOM   880  O O2    . DC  C 2 4  ? 51.831 28.231  56.278  1.00 36.24  ? 4   DC  C O2    1 
ATOM   881  N N3    . DC  C 2 4  ? 52.818 27.366  54.429  1.00 37.35  ? 4   DC  C N3    1 
ATOM   882  C C4    . DC  C 2 4  ? 53.804 26.619  53.922  1.00 39.55  ? 4   DC  C C4    1 
ATOM   883  N N4    . DC  C 2 4  ? 53.869 26.484  52.598  1.00 42.84  ? 4   DC  C N4    1 
ATOM   884  C C5    . DC  C 2 4  ? 54.761 25.965  54.756  1.00 41.23  ? 4   DC  C C5    1 
ATOM   885  C C6    . DC  C 2 4  ? 54.640 26.129  56.083  1.00 41.04  ? 4   DC  C C6    1 
ATOM   886  P P     . DT  C 2 5  ? 51.946 25.541  61.935  1.00 37.91  ? 5   DT  C P     1 
ATOM   887  O OP1   . DT  C 2 5  ? 51.342 26.220  63.098  1.00 34.60  ? 5   DT  C OP1   1 
ATOM   888  O OP2   . DT  C 2 5  ? 52.671 24.255  62.085  1.00 34.87  ? 5   DT  C OP2   1 
ATOM   889  O "O5'" . DT  C 2 5  ? 50.775 25.316  60.853  1.00 33.56  ? 5   DT  C "O5'" 1 
ATOM   890  C "C5'" . DT  C 2 5  ? 50.019 26.439  60.372  1.00 37.22  ? 5   DT  C "C5'" 1 
ATOM   891  C "C4'" . DT  C 2 5  ? 49.031 25.996  59.314  1.00 32.25  ? 5   DT  C "C4'" 1 
ATOM   892  O "O4'" . DT  C 2 5  ? 49.713 25.893  58.048  1.00 32.84  ? 5   DT  C "O4'" 1 
ATOM   893  C "C3'" . DT  C 2 5  ? 48.418 24.613  59.560  1.00 32.93  ? 5   DT  C "C3'" 1 
ATOM   894  O "O3'" . DT  C 2 5  ? 47.065 24.575  59.077  1.00 30.28  ? 5   DT  C "O3'" 1 
ATOM   895  C "C2'" . DT  C 2 5  ? 49.238 23.718  58.661  1.00 31.64  ? 5   DT  C "C2'" 1 
ATOM   896  C "C1'" . DT  C 2 5  ? 49.377 24.648  57.471  1.00 31.19  ? 5   DT  C "C1'" 1 
ATOM   897  N N1    . DT  C 2 5  ? 50.382 24.317  56.434  1.00 32.77  ? 5   DT  C N1    1 
ATOM   898  C C2    . DT  C 2 5  ? 50.128 24.734  55.143  1.00 32.36  ? 5   DT  C C2    1 
ATOM   899  O O2    . DT  C 2 5  ? 49.142 25.382  54.832  1.00 32.35  ? 5   DT  C O2    1 
ATOM   900  N N3    . DT  C 2 5  ? 51.084 24.373  54.229  1.00 32.82  ? 5   DT  C N3    1 
ATOM   901  C C4    . DT  C 2 5  ? 52.226 23.628  54.462  1.00 32.36  ? 5   DT  C C4    1 
ATOM   902  O O4    . DT  C 2 5  ? 52.989 23.382  53.538  1.00 36.23  ? 5   DT  C O4    1 
ATOM   903  C C5    . DT  C 2 5  ? 52.421 23.209  55.832  1.00 34.00  ? 5   DT  C C5    1 
ATOM   904  C C7    . DT  C 2 5  ? 53.663 22.451  56.192  1.00 36.66  ? 5   DT  C C7    1 
ATOM   905  C C6    . DT  C 2 5  ? 51.512 23.585  56.740  1.00 33.44  ? 5   DT  C C6    1 
ATOM   906  P P     . DA  C 2 6  ? 45.875 24.260  60.073  1.00 29.26  ? 6   DA  C P     1 
ATOM   907  O OP1   . DA  C 2 6  ? 45.837 25.291  61.112  1.00 30.18  ? 6   DA  C OP1   1 
ATOM   908  O OP2   . DA  C 2 6  ? 45.904 22.813  60.435  1.00 29.81  ? 6   DA  C OP2   1 
ATOM   909  O "O5'" . DA  C 2 6  ? 44.621 24.335  59.086  1.00 27.54  ? 6   DA  C "O5'" 1 
ATOM   910  C "C5'" . DA  C 2 6  ? 44.219 25.571  58.505  1.00 29.26  ? 6   DA  C "C5'" 1 
ATOM   911  C "C4'" . DA  C 2 6  ? 43.531 25.309  57.187  1.00 30.54  ? 6   DA  C "C4'" 1 
ATOM   912  O "O4'" . DA  C 2 6  ? 44.524 25.074  56.163  1.00 34.31  ? 6   DA  C "O4'" 1 
ATOM   913  C "C3'" . DA  C 2 6  ? 42.607 24.095  57.156  1.00 29.16  ? 6   DA  C "C3'" 1 
ATOM   914  O "O3'" . DA  C 2 6  ? 41.426 24.398  56.376  1.00 29.11  ? 6   DA  C "O3'" 1 
ATOM   915  C "C2'" . DA  C 2 6  ? 43.466 23.019  56.540  1.00 26.20  ? 6   DA  C "C2'" 1 
ATOM   916  C "C1'" . DA  C 2 6  ? 44.334 23.800  55.578  1.00 29.23  ? 6   DA  C "C1'" 1 
ATOM   917  N N9    . DA  C 2 6  ? 45.654 23.201  55.408  1.00 26.08  ? 6   DA  C N9    1 
ATOM   918  C C8    . DA  C 2 6  ? 46.486 22.690  56.377  1.00 27.47  ? 6   DA  C C8    1 
ATOM   919  N N7    . DA  C 2 6  ? 47.605 22.197  55.902  1.00 25.57  ? 6   DA  C N7    1 
ATOM   920  C C5    . DA  C 2 6  ? 47.499 22.389  54.531  1.00 24.22  ? 6   DA  C C5    1 
ATOM   921  C C6    . DA  C 2 6  ? 48.349 22.066  53.460  1.00 25.94  ? 6   DA  C C6    1 
ATOM   922  N N6    . DA  C 2 6  ? 49.551 21.503  53.608  1.00 30.68  ? 6   DA  C N6    1 
ATOM   923  N N1    . DA  C 2 6  ? 47.946 22.404  52.215  1.00 29.37  ? 6   DA  C N1    1 
ATOM   924  C C2    . DA  C 2 6  ? 46.745 22.985  52.061  1.00 27.06  ? 6   DA  C C2    1 
ATOM   925  N N3    . DA  C 2 6  ? 45.849 23.319  52.984  1.00 25.24  ? 6   DA  C N3    1 
ATOM   926  C C4    . DA  C 2 6  ? 46.285 22.975  54.213  1.00 24.21  ? 6   DA  C C4    1 
ATOM   927  P P     . DA  C 2 7  ? 40.335 23.307  56.063  1.00 30.81  ? 7   DA  C P     1 
ATOM   928  O OP1   . DA  C 2 7  ? 39.007 23.993  55.949  1.00 30.64  ? 7   DA  C OP1   1 
ATOM   929  O OP2   . DA  C 2 7  ? 40.438 22.132  56.975  1.00 28.11  ? 7   DA  C OP2   1 
ATOM   930  O "O5'" . DA  C 2 7  ? 40.795 22.756  54.634  1.00 28.98  ? 7   DA  C "O5'" 1 
ATOM   931  C "C5'" . DA  C 2 7  ? 40.777 23.605  53.474  1.00 33.67  ? 7   DA  C "C5'" 1 
ATOM   932  C "C4'" . DA  C 2 7  ? 41.064 22.800  52.228  1.00 30.44  ? 7   DA  C "C4'" 1 
ATOM   933  O "O4'" . DA  C 2 7  ? 42.463 22.402  52.179  1.00 25.72  ? 7   DA  C "O4'" 1 
ATOM   934  C "C3'" . DA  C 2 7  ? 40.238 21.520  52.075  1.00 31.70  ? 7   DA  C "C3'" 1 
ATOM   935  O "O3'" . DA  C 2 7  ? 39.740 21.515  50.733  1.00 39.06  ? 7   DA  C "O3'" 1 
ATOM   936  C "C2'" . DA  C 2 7  ? 41.221 20.398  52.336  1.00 28.38  ? 7   DA  C "C2'" 1 
ATOM   937  C "C1'" . DA  C 2 7  ? 42.558 21.011  51.945  1.00 27.14  ? 7   DA  C "C1'" 1 
ATOM   938  N N9    . DA  C 2 7  ? 43.703 20.498  52.687  1.00 27.30  ? 7   DA  C N9    1 
ATOM   939  C C8    . DA  C 2 7  ? 43.868 20.357  54.045  1.00 29.25  ? 7   DA  C C8    1 
ATOM   940  N N7    . DA  C 2 7  ? 45.038 19.876  54.386  1.00 28.04  ? 7   DA  C N7    1 
ATOM   941  C C5    . DA  C 2 7  ? 45.670 19.645  53.169  1.00 27.14  ? 7   DA  C C5    1 
ATOM   942  C C6    . DA  C 2 7  ? 46.928 19.116  52.845  1.00 29.53  ? 7   DA  C C6    1 
ATOM   943  N N6    . DA  C 2 7  ? 47.805 18.686  53.756  1.00 28.00  ? 7   DA  C N6    1 
ATOM   944  N N1    . DA  C 2 7  ? 47.260 19.035  51.538  1.00 28.44  ? 7   DA  C N1    1 
ATOM   945  C C2    . DA  C 2 7  ? 46.373 19.459  50.623  1.00 28.74  ? 7   DA  C C2    1 
ATOM   946  N N3    . DA  C 2 7  ? 45.154 19.962  50.806  1.00 27.26  ? 7   DA  C N3    1 
ATOM   947  C C4    . DA  C 2 7  ? 44.859 20.024  52.117  1.00 27.52  ? 7   DA  C C4    1 
ATOM   948  P P     . DT  C 2 8  ? 39.021 20.236  50.101  1.00 34.81  ? 8   DT  C P     1 
ATOM   949  O OP1   . DT  C 2 8  ? 38.080 20.757  49.059  1.00 36.41  ? 8   DT  C OP1   1 
ATOM   950  O OP2   . DT  C 2 8  ? 38.490 19.349  51.155  1.00 34.84  ? 8   DT  C OP2   1 
ATOM   951  O "O5'" . DT  C 2 8  ? 40.207 19.499  49.350  1.00 35.44  ? 8   DT  C "O5'" 1 
ATOM   952  C "C5'" . DT  C 2 8  ? 40.696 20.026  48.094  1.00 39.85  ? 8   DT  C "C5'" 1 
ATOM   953  C "C4'" . DT  C 2 8  ? 41.692 19.070  47.484  1.00 40.04  ? 8   DT  C "C4'" 1 
ATOM   954  O "O4'" . DT  C 2 8  ? 42.751 18.771  48.431  1.00 36.71  ? 8   DT  C "O4'" 1 
ATOM   955  C "C3'" . DT  C 2 8  ? 41.090 17.721  47.080  1.00 37.24  ? 8   DT  C "C3'" 1 
ATOM   956  O "O3'" . DT  C 2 8  ? 41.356 17.520  45.700  1.00 46.18  ? 8   DT  C "O3'" 1 
ATOM   957  C "C2'" . DT  C 2 8  ? 41.818 16.698  47.942  1.00 34.05  ? 8   DT  C "C2'" 1 
ATOM   958  C "C1'" . DT  C 2 8  ? 43.097 17.411  48.304  1.00 35.57  ? 8   DT  C "C1'" 1 
ATOM   959  N N1    . DT  C 2 8  ? 43.716 17.003  49.564  1.00 31.89  ? 8   DT  C N1    1 
ATOM   960  C C2    . DT  C 2 8  ? 44.987 16.487  49.519  1.00 31.67  ? 8   DT  C C2    1 
ATOM   961  O O2    . DT  C 2 8  ? 45.606 16.333  48.483  1.00 33.68  ? 8   DT  C O2    1 
ATOM   962  N N3    . DT  C 2 8  ? 45.534 16.199  50.748  1.00 31.39  ? 8   DT  C N3    1 
ATOM   963  C C4    . DT  C 2 8  ? 44.937 16.345  51.981  1.00 30.65  ? 8   DT  C C4    1 
ATOM   964  O O4    . DT  C 2 8  ? 45.557 16.048  53.004  1.00 31.22  ? 8   DT  C O4    1 
ATOM   965  C C5    . DT  C 2 8  ? 43.600 16.893  51.956  1.00 30.35  ? 8   DT  C C5    1 
ATOM   966  C C7    . DT  C 2 8  ? 42.884 17.108  53.253  1.00 30.96  ? 8   DT  C C7    1 
ATOM   967  C C6    . DT  C 2 8  ? 43.061 17.191  50.763  1.00 35.90  ? 8   DT  C C6    1 
ATOM   968  P P     . DT  C 2 9  ? 40.785 16.241  44.953  1.00 47.18  ? 9   DT  C P     1 
ATOM   969  O OP1   . DT  C 2 9  ? 40.689 16.579  43.529  1.00 46.18  ? 9   DT  C OP1   1 
ATOM   970  O OP2   . DT  C 2 9  ? 39.581 15.765  45.678  1.00 41.39  ? 9   DT  C OP2   1 
ATOM   971  O "O5'" . DT  C 2 9  ? 41.997 15.215  45.046  1.00 45.61  ? 9   DT  C "O5'" 1 
ATOM   972  C "C5'" . DT  C 2 9  ? 43.293 15.627  44.579  1.00 40.41  ? 9   DT  C "C5'" 1 
ATOM   973  C "C4'" . DT  C 2 9  ? 44.276 14.484  44.620  1.00 44.60  ? 9   DT  C "C4'" 1 
ATOM   974  O "O4'" . DT  C 2 9  ? 44.819 14.320  45.952  1.00 37.39  ? 9   DT  C "O4'" 1 
ATOM   975  C "C3'" . DT  C 2 9  ? 43.722 13.118  44.215  1.00 42.68  ? 9   DT  C "C3'" 1 
ATOM   976  O "O3'" . DT  C 2 9  ? 44.677 12.598  43.294  1.00 55.32  ? 9   DT  C "O3'" 1 
ATOM   977  C "C2'" . DT  C 2 9  ? 43.669 12.328  45.514  1.00 40.84  ? 9   DT  C "C2'" 1 
ATOM   978  C "C1'" . DT  C 2 9  ? 44.798 12.952  46.308  1.00 36.50  ? 9   DT  C "C1'" 1 
ATOM   979  N N1    . DT  C 2 9  ? 44.676 12.901  47.769  1.00 31.89  ? 9   DT  C N1    1 
ATOM   980  C C2    . DT  C 2 9  ? 45.815 12.605  48.480  1.00 33.51  ? 9   DT  C C2    1 
ATOM   981  O O2    . DT  C 2 9  ? 46.863 12.277  47.950  1.00 38.27  ? 9   DT  C O2    1 
ATOM   982  N N3    . DT  C 2 9  ? 45.666 12.657  49.842  1.00 31.70  ? 9   DT  C N3    1 
ATOM   983  C C4    . DT  C 2 9  ? 44.532 13.028  50.544  1.00 31.54  ? 9   DT  C C4    1 
ATOM   984  O O4    . DT  C 2 9  ? 44.549 13.034  51.776  1.00 31.46  ? 9   DT  C O4    1 
ATOM   985  C C5    . DT  C 2 9  ? 43.384 13.361  49.732  1.00 34.96  ? 9   DT  C C5    1 
ATOM   986  C C7    . DT  C 2 9  ? 42.098 13.735  50.403  1.00 35.53  ? 9   DT  C C7    1 
ATOM   987  C C6    . DT  C 2 9  ? 43.518 13.298  48.400  1.00 32.43  ? 9   DT  C C6    1 
ATOM   988  P P     . DA  C 2 10 ? 44.262 11.456  42.278  1.00 58.63  ? 10  DA  C P     1 
ATOM   989  O OP1   . DA  C 2 10 ? 44.880 11.774  40.959  1.00 57.91  ? 10  DA  C OP1   1 
ATOM   990  O OP2   . DA  C 2 10 ? 42.800 11.236  42.399  1.00 58.50  ? 10  DA  C OP2   1 
ATOM   991  O "O5'" . DA  C 2 10 ? 44.991 10.180  42.890  1.00 49.45  ? 10  DA  C "O5'" 1 
ATOM   992  C "C5'" . DA  C 2 10 ? 46.399 10.221  43.183  1.00 46.69  ? 10  DA  C "C5'" 1 
ATOM   993  C "C4'" . DA  C 2 10 ? 46.767 9.025   44.025  1.00 45.81  ? 10  DA  C "C4'" 1 
ATOM   994  O "O4'" . DA  C 2 10 ? 46.514 9.315   45.426  1.00 45.71  ? 10  DA  C "O4'" 1 
ATOM   995  C "C3'" . DA  C 2 10 ? 45.958 7.769   43.707  1.00 45.34  ? 10  DA  C "C3'" 1 
ATOM   996  O "O3'" . DA  C 2 10 ? 46.760 6.608   43.882  1.00 51.13  ? 10  DA  C "O3'" 1 
ATOM   997  C "C2'" . DA  C 2 10 ? 44.884 7.775   44.771  1.00 44.61  ? 10  DA  C "C2'" 1 
ATOM   998  C "C1'" . DA  C 2 10 ? 45.700 8.279   45.946  1.00 43.35  ? 10  DA  C "C1'" 1 
ATOM   999  N N9    . DA  C 2 10 ? 44.936 8.797   47.074  1.00 37.45  ? 10  DA  C N9    1 
ATOM   1000 C C8    . DA  C 2 10 ? 43.627 9.205   47.132  1.00 36.27  ? 10  DA  C C8    1 
ATOM   1001 N N7    . DA  C 2 10 ? 43.234 9.548   48.336  1.00 35.59  ? 10  DA  C N7    1 
ATOM   1002 C C5    . DA  C 2 10 ? 44.341 9.286   49.133  1.00 32.82  ? 10  DA  C C5    1 
ATOM   1003 C C6    . DA  C 2 10 ? 44.577 9.473   50.502  1.00 31.48  ? 10  DA  C C6    1 
ATOM   1004 N N6    . DA  C 2 10 ? 43.645 9.902   51.351  1.00 28.46  ? 10  DA  C N6    1 
ATOM   1005 N N1    . DA  C 2 10 ? 45.791 9.119   50.989  1.00 33.16  ? 10  DA  C N1    1 
ATOM   1006 C C2    . DA  C 2 10 ? 46.715 8.669   50.132  1.00 34.41  ? 10  DA  C C2    1 
ATOM   1007 N N3    . DA  C 2 10 ? 46.623 8.489   48.809  1.00 34.78  ? 10  DA  C N3    1 
ATOM   1008 C C4    . DA  C 2 10 ? 45.397 8.827   48.371  1.00 35.34  ? 10  DA  C C4    1 
ATOM   1009 P P     . DG  C 2 11 ? 46.500 5.310   43.004  1.00 62.72  ? 11  DG  C P     1 
ATOM   1010 O OP1   . DG  C 2 11 ? 47.189 5.495   41.703  1.00 64.78  ? 11  DG  C OP1   1 
ATOM   1011 O OP2   . DG  C 2 11 ? 45.051 4.997   43.045  1.00 54.92  ? 11  DG  C OP2   1 
ATOM   1012 O "O5'" . DG  C 2 11 ? 47.323 4.203   43.792  1.00 66.61  ? 11  DG  C "O5'" 1 
ATOM   1013 C "C5'" . DG  C 2 11 ? 46.715 3.431   44.828  1.00 67.10  ? 11  DG  C "C5'" 1 
ATOM   1014 C "C4'" . DG  C 2 11 ? 47.443 3.670   46.126  1.00 61.58  ? 11  DG  C "C4'" 1 
ATOM   1015 O "O4'" . DG  C 2 11 ? 46.949 4.879   46.733  1.00 59.84  ? 11  DG  C "O4'" 1 
ATOM   1016 C "C3'" . DG  C 2 11 ? 47.200 2.595   47.169  1.00 60.06  ? 11  DG  C "C3'" 1 
ATOM   1017 O "O3'" . DG  C 2 11 ? 48.129 1.526   47.062  1.00 61.84  ? 11  DG  C "O3'" 1 
ATOM   1018 C "C2'" . DG  C 2 11 ? 47.419 3.331   48.475  1.00 53.84  ? 11  DG  C "C2'" 1 
ATOM   1019 C "C1'" . DG  C 2 11 ? 47.033 4.763   48.153  1.00 51.47  ? 11  DG  C "C1'" 1 
ATOM   1020 N N9    . DG  C 2 11 ? 45.771 5.225   48.721  1.00 43.20  ? 11  DG  C N9    1 
ATOM   1021 C C8    . DG  C 2 11 ? 44.636 5.597   48.041  1.00 42.35  ? 11  DG  C C8    1 
ATOM   1022 N N7    . DG  C 2 11 ? 43.685 6.020   48.826  1.00 38.24  ? 11  DG  C N7    1 
ATOM   1023 C C5    . DG  C 2 11 ? 44.221 5.916   50.102  1.00 36.10  ? 11  DG  C C5    1 
ATOM   1024 C C6    . DG  C 2 11 ? 43.666 6.258   51.359  1.00 33.06  ? 11  DG  C C6    1 
ATOM   1025 O O6    . DG  C 2 11 ? 42.546 6.714   51.604  1.00 30.84  ? 11  DG  C O6    1 
ATOM   1026 N N1    . DG  C 2 11 ? 44.553 5.999   52.400  1.00 32.05  ? 11  DG  C N1    1 
ATOM   1027 C C2    . DG  C 2 11 ? 45.823 5.496   52.245  1.00 37.53  ? 11  DG  C C2    1 
ATOM   1028 N N2    . DG  C 2 11 ? 46.525 5.292   53.369  1.00 35.41  ? 11  DG  C N2    1 
ATOM   1029 N N3    . DG  C 2 11 ? 46.357 5.188   51.073  1.00 38.24  ? 11  DG  C N3    1 
ATOM   1030 C C4    . DG  C 2 11 ? 45.511 5.437   50.053  1.00 38.97  ? 11  DG  C C4    1 
ATOM   1031 P P     . DT  C 2 12 ? 47.729 0.130   47.680  1.00 70.44  ? 12  DT  C P     1 
ATOM   1032 O OP1   . DT  C 2 12 ? 48.769 -0.857  47.308  1.00 65.53  ? 12  DT  C OP1   1 
ATOM   1033 O OP2   . DT  C 2 12 ? 46.298 -0.108  47.332  1.00 56.95  ? 12  DT  C OP2   1 
ATOM   1034 O "O5'" . DT  C 2 12 ? 47.818 0.394   49.252  1.00 56.83  ? 12  DT  C "O5'" 1 
ATOM   1035 C "C5'" . DT  C 2 12 ? 49.042 0.784   49.915  1.00 53.44  ? 12  DT  C "C5'" 1 
ATOM   1036 C "C4'" . DT  C 2 12 ? 48.819 0.768   51.411  1.00 51.41  ? 12  DT  C "C4'" 1 
ATOM   1037 O "O4'" . DT  C 2 12 ? 47.758 1.695   51.755  1.00 44.70  ? 12  DT  C "O4'" 1 
ATOM   1038 C "C3'" . DT  C 2 12 ? 48.373 -0.595  51.940  1.00 54.01  ? 12  DT  C "C3'" 1 
ATOM   1039 O "O3'" . DT  C 2 12 ? 49.045 -0.944  53.159  1.00 60.14  ? 12  DT  C "O3'" 1 
ATOM   1040 C "C2'" . DT  C 2 12 ? 46.872 -0.434  52.109  1.00 51.62  ? 12  DT  C "C2'" 1 
ATOM   1041 C "C1'" . DT  C 2 12 ? 46.764 1.019   52.516  1.00 45.23  ? 12  DT  C "C1'" 1 
ATOM   1042 N N1    . DT  C 2 12 ? 45.463 1.656   52.237  1.00 42.99  ? 12  DT  C N1    1 
ATOM   1043 C C2    . DT  C 2 12 ? 44.728 2.176   53.287  1.00 40.86  ? 12  DT  C C2    1 
ATOM   1044 O O2    . DT  C 2 12 ? 45.089 2.122   54.453  1.00 38.99  ? 12  DT  C O2    1 
ATOM   1045 N N3    . DT  C 2 12 ? 43.545 2.762   52.918  1.00 36.52  ? 12  DT  C N3    1 
ATOM   1046 C C4    . DT  C 2 12 ? 43.021 2.861   51.641  1.00 39.04  ? 12  DT  C C4    1 
ATOM   1047 O O4    . DT  C 2 12 ? 41.942 3.420   51.466  1.00 36.59  ? 12  DT  C O4    1 
ATOM   1048 C C5    . DT  C 2 12 ? 43.840 2.291   50.592  1.00 41.25  ? 12  DT  C C5    1 
ATOM   1049 C C7    . DT  C 2 12 ? 43.359 2.365   49.176  1.00 41.93  ? 12  DT  C C7    1 
ATOM   1050 C C6    . DT  C 2 12 ? 45.000 1.719   50.939  1.00 41.53  ? 12  DT  C C6    1 
ATOM   1051 P P     . DC  C 2 13 ? 48.776 -2.363  53.829  1.00 62.53  ? 13  DC  C P     1 
ATOM   1052 O OP1   . DC  C 2 13 ? 49.960 -2.726  54.655  1.00 65.44  ? 13  DC  C OP1   1 
ATOM   1053 O OP2   . DC  C 2 13 ? 48.266 -3.288  52.784  1.00 63.39  ? 13  DC  C OP2   1 
ATOM   1054 O "O5'" . DC  C 2 13 ? 47.557 -2.085  54.821  1.00 65.09  ? 13  DC  C "O5'" 1 
ATOM   1055 C "C5'" . DC  C 2 13 ? 47.751 -1.358  56.044  1.00 58.00  ? 13  DC  C "C5'" 1 
ATOM   1056 C "C4'" . DC  C 2 13 ? 46.475 -1.336  56.854  1.00 55.55  ? 13  DC  C "C4'" 1 
ATOM   1057 O "O4'" . DC  C 2 13 ? 45.455 -0.595  56.142  1.00 48.95  ? 13  DC  C "O4'" 1 
ATOM   1058 C "C3'" . DC  C 2 13 ? 45.857 -2.697  57.170  1.00 57.31  ? 13  DC  C "C3'" 1 
ATOM   1059 O "O3'" . DC  C 2 13 ? 45.316 -2.636  58.494  1.00 65.24  ? 13  DC  C "O3'" 1 
ATOM   1060 C "C2'" . DC  C 2 13 ? 44.705 -2.787  56.187  1.00 54.83  ? 13  DC  C "C2'" 1 
ATOM   1061 C "C1'" . DC  C 2 13 ? 44.258 -1.342  56.152  1.00 48.44  ? 13  DC  C "C1'" 1 
ATOM   1062 N N1    . DC  C 2 13 ? 43.435 -0.922  54.995  1.00 46.48  ? 13  DC  C N1    1 
ATOM   1063 C C2    . DC  C 2 13 ? 42.305 -0.125  55.228  1.00 43.85  ? 13  DC  C C2    1 
ATOM   1064 O O2    . DC  C 2 13 ? 42.045 0.226   56.389  1.00 44.47  ? 13  DC  C O2    1 
ATOM   1065 N N3    . DC  C 2 13 ? 41.522 0.234   54.184  1.00 44.93  ? 13  DC  C N3    1 
ATOM   1066 C C4    . DC  C 2 13 ? 41.838 -0.158  52.947  1.00 44.28  ? 13  DC  C C4    1 
ATOM   1067 N N4    . DC  C 2 13 ? 41.043 0.230   51.946  1.00 44.38  ? 13  DC  C N4    1 
ATOM   1068 C C5    . DC  C 2 13 ? 42.979 -0.971  52.682  1.00 43.76  ? 13  DC  C C5    1 
ATOM   1069 C C6    . DC  C 2 13 ? 43.738 -1.333  53.726  1.00 46.30  ? 13  DC  C C6    1 
ATOM   1070 P P     . DG  C 2 14 ? 45.234 -3.934  59.408  1.00 74.94  ? 14  DG  C P     1 
ATOM   1071 O OP1   . DG  C 2 14 ? 44.840 -3.496  60.769  1.00 80.87  ? 14  DG  C OP1   1 
ATOM   1072 O OP2   . DG  C 2 14 ? 46.500 -4.695  59.222  1.00 79.96  ? 14  DG  C OP2   1 
ATOM   1073 O "O5'" . DG  C 2 14 ? 44.005 -4.751  58.794  1.00 85.87  ? 14  DG  C "O5'" 1 
ATOM   1074 C "C5'" . DG  C 2 14 ? 42.627 -4.392  59.070  1.00 88.90  ? 14  DG  C "C5'" 1 
ATOM   1075 C "C4'" . DG  C 2 14 ? 41.657 -5.400  58.487  1.00 96.63  ? 14  DG  C "C4'" 1 
ATOM   1076 O "O4'" . DG  C 2 14 ? 42.220 -6.043  57.321  1.00 98.95  ? 14  DG  C "O4'" 1 
ATOM   1077 C "C3'" . DG  C 2 14 ? 41.244 -6.542  59.417  1.00 104.42 ? 14  DG  C "C3'" 1 
ATOM   1078 O "O3'" . DG  C 2 14 ? 39.902 -6.973  59.160  1.00 100.59 ? 14  DG  C "O3'" 1 
ATOM   1079 C "C2'" . DG  C 2 14 ? 42.234 -7.644  59.085  1.00 106.77 ? 14  DG  C "C2'" 1 
ATOM   1080 C "C1'" . DG  C 2 14 ? 42.667 -7.358  57.643  1.00 106.09 ? 14  DG  C "C1'" 1 
ATOM   1081 N N9    . DG  C 2 14 ? 44.112 -7.405  57.426  1.00 110.29 ? 14  DG  C N9    1 
ATOM   1082 C C8    . DG  C 2 14 ? 45.053 -8.013  58.225  1.00 114.52 ? 14  DG  C C8    1 
ATOM   1083 N N7    . DG  C 2 14 ? 46.272 -7.873  57.779  1.00 111.22 ? 14  DG  C N7    1 
ATOM   1084 C C5    . DG  C 2 14 ? 46.130 -7.122  56.619  1.00 107.87 ? 14  DG  C C5    1 
ATOM   1085 C C6    . DG  C 2 14 ? 47.108 -6.656  55.699  1.00 103.82 ? 14  DG  C C6    1 
ATOM   1086 O O6    . DG  C 2 14 ? 48.334 -6.818  55.730  1.00 110.78 ? 14  DG  C O6    1 
ATOM   1087 N N1    . DG  C 2 14 ? 46.528 -5.939  54.656  1.00 89.95  ? 14  DG  C N1    1 
ATOM   1088 C C2    . DG  C 2 14 ? 45.183 -5.697  54.516  1.00 88.01  ? 14  DG  C C2    1 
ATOM   1089 N N2    . DG  C 2 14 ? 44.818 -4.979  53.441  1.00 78.90  ? 14  DG  C N2    1 
ATOM   1090 N N3    . DG  C 2 14 ? 44.262 -6.127  55.365  1.00 95.72  ? 14  DG  C N3    1 
ATOM   1091 C C4    . DG  C 2 14 ? 44.803 -6.827  56.386  1.00 99.59  ? 14  DG  C C4    1 
ATOM   1092 N N     . VAL D 1 4  ? 51.025 0.323   99.904  1.00 82.13  ? 137 VAL D N     1 
ATOM   1093 C CA    . VAL D 1 4  ? 51.696 0.786   98.649  1.00 71.35  ? 137 VAL D CA    1 
ATOM   1094 C C     . VAL D 1 4  ? 50.777 0.636   97.437  1.00 63.49  ? 137 VAL D C     1 
ATOM   1095 O O     . VAL D 1 4  ? 50.624 -0.458  96.889  1.00 63.12  ? 137 VAL D O     1 
ATOM   1096 C CB    . VAL D 1 4  ? 53.001 -0.003  98.372  1.00 65.75  ? 137 VAL D CB    1 
ATOM   1097 N N     . ARG D 1 5  ? 50.137 1.721   97.021  1.00 60.05  ? 138 ARG D N     1 
ATOM   1098 C CA    . ARG D 1 5  ? 49.525 1.719   95.680  1.00 56.92  ? 138 ARG D CA    1 
ATOM   1099 C C     . ARG D 1 5  ? 50.657 1.831   94.673  1.00 55.03  ? 138 ARG D C     1 
ATOM   1100 O O     . ARG D 1 5  ? 51.715 2.409   94.957  1.00 58.91  ? 138 ARG D O     1 
ATOM   1101 C CB    . ARG D 1 5  ? 48.456 2.814   95.494  1.00 56.45  ? 138 ARG D CB    1 
ATOM   1102 C CG    . ARG D 1 5  ? 48.952 4.249   95.531  1.00 62.86  ? 138 ARG D CG    1 
ATOM   1103 C CD    . ARG D 1 5  ? 47.809 5.247   95.378  1.00 64.24  ? 138 ARG D CD    1 
ATOM   1104 N NE    . ARG D 1 5  ? 47.216 5.254   94.028  1.00 59.74  ? 138 ARG D NE    1 
ATOM   1105 C CZ    . ARG D 1 5  ? 45.961 4.912   93.734  1.00 56.37  ? 138 ARG D CZ    1 
ATOM   1106 N NH1   . ARG D 1 5  ? 45.103 4.530   94.674  1.00 54.96  ? 138 ARG D NH1   1 
ATOM   1107 N NH2   . ARG D 1 5  ? 45.539 4.967   92.482  1.00 53.65  ? 138 ARG D NH2   1 
ATOM   1108 N N     . LYS D 1 6  ? 50.459 1.224   93.513  1.00 55.12  ? 139 LYS D N     1 
ATOM   1109 C CA    . LYS D 1 6  ? 51.447 1.294   92.466  1.00 60.81  ? 139 LYS D CA    1 
ATOM   1110 C C     . LYS D 1 6  ? 51.707 2.773   92.147  1.00 55.58  ? 139 LYS D C     1 
ATOM   1111 O O     . LYS D 1 6  ? 50.777 3.579   92.142  1.00 54.14  ? 139 LYS D O     1 
ATOM   1112 C CB    . LYS D 1 6  ? 50.914 0.564   91.229  1.00 68.22  ? 139 LYS D CB    1 
ATOM   1113 C CG    . LYS D 1 6  ? 51.853 0.524   90.043  1.00 72.43  ? 139 LYS D CG    1 
ATOM   1114 C CD    . LYS D 1 6  ? 51.050 0.319   88.775  1.00 77.86  ? 139 LYS D CD    1 
ATOM   1115 C CE    . LYS D 1 6  ? 51.934 0.188   87.553  1.00 67.11  ? 139 LYS D CE    1 
ATOM   1116 N NZ    . LYS D 1 6  ? 51.335 -0.788  86.605  1.00 69.68  ? 139 LYS D NZ    1 
ATOM   1117 N N     . PRO D 1 7  ? 52.972 3.135   91.879  1.00 54.20  ? 140 PRO D N     1 
ATOM   1118 C CA    . PRO D 1 7  ? 53.247 4.490   91.432  1.00 52.78  ? 140 PRO D CA    1 
ATOM   1119 C C     . PRO D 1 7  ? 52.531 4.738   90.112  1.00 50.45  ? 140 PRO D C     1 
ATOM   1120 O O     . PRO D 1 7  ? 52.384 3.817   89.309  1.00 52.19  ? 140 PRO D O     1 
ATOM   1121 C CB    . PRO D 1 7  ? 54.767 4.497   91.219  1.00 54.48  ? 140 PRO D CB    1 
ATOM   1122 C CG    . PRO D 1 7  ? 55.273 3.366   92.047  1.00 61.98  ? 140 PRO D CG    1 
ATOM   1123 C CD    . PRO D 1 7  ? 54.201 2.327   91.948  1.00 59.42  ? 140 PRO D CD    1 
ATOM   1124 N N     . ARG D 1 8  ? 52.061 5.961   89.914  1.00 47.16  ? 141 ARG D N     1 
ATOM   1125 C CA    . ARG D 1 8  ? 51.275 6.277   88.732  1.00 43.18  ? 141 ARG D CA    1 
ATOM   1126 C C     . ARG D 1 8  ? 52.181 6.358   87.500  1.00 43.65  ? 141 ARG D C     1 
ATOM   1127 O O     . ARG D 1 8  ? 53.160 7.115   87.440  1.00 36.66  ? 141 ARG D O     1 
ATOM   1128 C CB    . ARG D 1 8  ? 50.521 7.572   88.942  1.00 42.43  ? 141 ARG D CB    1 
ATOM   1129 C CG    . ARG D 1 8  ? 49.646 7.955   87.767  1.00 38.47  ? 141 ARG D CG    1 
ATOM   1130 C CD    . ARG D 1 8  ? 48.796 9.147   88.093  1.00 41.33  ? 141 ARG D CD    1 
ATOM   1131 N NE    . ARG D 1 8  ? 48.118 9.652   86.907  1.00 41.05  ? 141 ARG D NE    1 
ATOM   1132 C CZ    . ARG D 1 8  ? 46.807 9.806   86.788  1.00 38.43  ? 141 ARG D CZ    1 
ATOM   1133 N NH1   . ARG D 1 8  ? 45.970 9.495   87.787  1.00 37.39  ? 141 ARG D NH1   1 
ATOM   1134 N NH2   . ARG D 1 8  ? 46.321 10.269  85.646  1.00 36.49  ? 141 ARG D NH2   1 
ATOM   1135 N N     . THR D 1 9  ? 51.840 5.559   86.508  1.00 44.53  ? 142 THR D N     1 
ATOM   1136 C CA    . THR D 1 9  ? 52.531 5.592   85.244  1.00 42.22  ? 142 THR D CA    1 
ATOM   1137 C C     . THR D 1 9  ? 52.339 6.939   84.551  1.00 41.60  ? 142 THR D C     1 
ATOM   1138 O O     . THR D 1 9  ? 51.212 7.436   84.458  1.00 36.52  ? 142 THR D O     1 
ATOM   1139 C CB    . THR D 1 9  ? 51.977 4.476   84.352  1.00 43.86  ? 142 THR D CB    1 
ATOM   1140 O OG1   . THR D 1 9  ? 52.049 3.250   85.097  1.00 46.33  ? 142 THR D OG1   1 
ATOM   1141 C CG2   . THR D 1 9  ? 52.782 4.364   83.083  1.00 43.64  ? 142 THR D CG2   1 
ATOM   1142 N N     . ILE D 1 10 ? 53.445 7.533   84.103  1.00 37.24  ? 143 ILE D N     1 
ATOM   1143 C CA    . ILE D 1 10 ? 53.415 8.716   83.253  1.00 44.33  ? 143 ILE D CA    1 
ATOM   1144 C C     . ILE D 1 10 ? 53.675 8.213   81.823  1.00 46.16  ? 143 ILE D C     1 
ATOM   1145 O O     . ILE D 1 10 ? 54.793 7.822   81.492  1.00 43.22  ? 143 ILE D O     1 
ATOM   1146 C CB    . ILE D 1 10 ? 54.511 9.738   83.662  1.00 42.50  ? 143 ILE D CB    1 
ATOM   1147 C CG1   . ILE D 1 10 ? 54.478 10.027  85.168  1.00 52.05  ? 143 ILE D CG1   1 
ATOM   1148 C CG2   . ILE D 1 10 ? 54.417 11.041  82.884  1.00 41.00  ? 143 ILE D CG2   1 
ATOM   1149 C CD1   . ILE D 1 10 ? 53.134 10.475  85.673  1.00 48.49  ? 143 ILE D CD1   1 
ATOM   1150 N N     . TYR D 1 11 ? 52.654 8.173   80.986  1.00 42.92  ? 144 TYR D N     1 
ATOM   1151 C CA    . TYR D 1 11 ? 52.842 7.664   79.623  1.00 39.53  ? 144 TYR D CA    1 
ATOM   1152 C C     . TYR D 1 11 ? 53.595 8.666   78.759  1.00 36.75  ? 144 TYR D C     1 
ATOM   1153 O O     . TYR D 1 11 ? 53.393 9.857   78.872  1.00 42.21  ? 144 TYR D O     1 
ATOM   1154 C CB    . TYR D 1 11 ? 51.501 7.280   78.975  1.00 39.05  ? 144 TYR D CB    1 
ATOM   1155 C CG    . TYR D 1 11 ? 50.890 6.026   79.576  1.00 37.12  ? 144 TYR D CG    1 
ATOM   1156 C CD1   . TYR D 1 11 ? 51.421 4.770   79.314  1.00 41.08  ? 144 TYR D CD1   1 
ATOM   1157 C CD2   . TYR D 1 11 ? 49.762 6.091   80.380  1.00 33.72  ? 144 TYR D CD2   1 
ATOM   1158 C CE1   . TYR D 1 11 ? 50.854 3.621   79.835  1.00 38.22  ? 144 TYR D CE1   1 
ATOM   1159 C CE2   . TYR D 1 11 ? 49.190 4.944   80.903  1.00 35.14  ? 144 TYR D CE2   1 
ATOM   1160 C CZ    . TYR D 1 11 ? 49.745 3.709   80.649  1.00 35.99  ? 144 TYR D CZ    1 
ATOM   1161 O OH    . TYR D 1 11 ? 49.189 2.568   81.241  1.00 41.61  ? 144 TYR D OH    1 
ATOM   1162 N N     . SER D 1 12 ? 54.456 8.178   77.879  1.00 37.68  ? 145 SER D N     1 
ATOM   1163 C CA    . SER D 1 12 ? 55.071 9.011   76.865  1.00 34.43  ? 145 SER D CA    1 
ATOM   1164 C C     . SER D 1 12 ? 54.039 9.276   75.755  1.00 35.18  ? 145 SER D C     1 
ATOM   1165 O O     . SER D 1 12 ? 53.104 8.508   75.594  1.00 30.58  ? 145 SER D O     1 
ATOM   1166 C CB    . SER D 1 12 ? 56.299 8.300   76.258  1.00 37.38  ? 145 SER D CB    1 
ATOM   1167 O OG    . SER D 1 12 ? 55.942 7.118   75.519  1.00 36.47  ? 145 SER D OG    1 
ATOM   1168 N N     . SER D 1 13 ? 54.270 10.329  74.991  1.00 38.73  ? 146 SER D N     1 
ATOM   1169 C CA    A SER D 1 13 ? 53.451 10.618  73.801  0.50 43.51  ? 146 SER D CA    1 
ATOM   1170 C CA    B SER D 1 13 ? 53.490 10.636  73.781  0.50 42.30  ? 146 SER D CA    1 
ATOM   1171 C C     . SER D 1 13 ? 53.487 9.469   72.781  1.00 41.95  ? 146 SER D C     1 
ATOM   1172 O O     . SER D 1 13 ? 52.494 9.193   72.126  1.00 33.12  ? 146 SER D O     1 
ATOM   1173 C CB    A SER D 1 13 ? 53.880 11.934  73.141  0.50 43.76  ? 146 SER D CB    1 
ATOM   1174 C CB    B SER D 1 13 ? 54.065 11.882  73.101  0.50 41.09  ? 146 SER D CB    1 
ATOM   1175 O OG    A SER D 1 13 ? 55.076 11.794  72.394  0.50 43.21  ? 146 SER D OG    1 
ATOM   1176 O OG    B SER D 1 13 ? 54.262 12.940  74.030  0.50 39.41  ? 146 SER D OG    1 
ATOM   1177 N N     . PHE D 1 14 ? 54.623 8.789   72.657  1.00 39.11  ? 147 PHE D N     1 
ATOM   1178 C CA    . PHE D 1 14 ? 54.739 7.629   71.780  1.00 43.84  ? 147 PHE D CA    1 
ATOM   1179 C C     . PHE D 1 14 ? 53.845 6.477   72.246  1.00 38.77  ? 147 PHE D C     1 
ATOM   1180 O O     . PHE D 1 14 ? 53.224 5.816   71.432  1.00 32.03  ? 147 PHE D O     1 
ATOM   1181 C CB    . PHE D 1 14 ? 56.205 7.176   71.647  1.00 50.83  ? 147 PHE D CB    1 
ATOM   1182 C CG    . PHE D 1 14 ? 56.373 5.797   71.064  1.00 67.20  ? 147 PHE D CG    1 
ATOM   1183 C CD1   . PHE D 1 14 ? 56.295 5.593   69.687  1.00 75.01  ? 147 PHE D CD1   1 
ATOM   1184 C CD2   . PHE D 1 14 ? 56.609 4.696   71.891  1.00 75.28  ? 147 PHE D CD2   1 
ATOM   1185 C CE1   . PHE D 1 14 ? 56.453 4.325   69.144  1.00 81.64  ? 147 PHE D CE1   1 
ATOM   1186 C CE2   . PHE D 1 14 ? 56.765 3.424   71.353  1.00 82.63  ? 147 PHE D CE2   1 
ATOM   1187 C CZ    . PHE D 1 14 ? 56.689 3.240   69.978  1.00 86.73  ? 147 PHE D CZ    1 
ATOM   1188 N N     . GLN D 1 15 ? 53.776 6.236   73.553  1.00 32.49  ? 148 GLN D N     1 
ATOM   1189 C CA    . GLN D 1 15 ? 52.924 5.188   74.098  1.00 28.65  ? 148 GLN D CA    1 
ATOM   1190 C C     . GLN D 1 15 ? 51.429 5.571   73.948  1.00 27.12  ? 148 GLN D C     1 
ATOM   1191 O O     . GLN D 1 15 ? 50.580 4.704   73.656  1.00 30.61  ? 148 GLN D O     1 
ATOM   1192 C CB    . GLN D 1 15 ? 53.224 4.941   75.591  1.00 29.12  ? 148 GLN D CB    1 
ATOM   1193 C CG    . GLN D 1 15 ? 54.601 4.289   75.821  1.00 33.15  ? 148 GLN D CG    1 
ATOM   1194 C CD    . GLN D 1 15 ? 55.091 4.339   77.255  1.00 34.82  ? 148 GLN D CD    1 
ATOM   1195 O OE1   . GLN D 1 15 ? 54.738 5.227   77.999  1.00 34.11  ? 148 GLN D OE1   1 
ATOM   1196 N NE2   . GLN D 1 15 ? 55.938 3.398   77.625  1.00 36.27  ? 148 GLN D NE2   1 
ATOM   1197 N N     . LEU D 1 16 ? 51.101 6.815   74.250  1.00 27.10  ? 149 LEU D N     1 
ATOM   1198 C CA    . LEU D 1 16 ? 49.667 7.208   74.236  1.00 29.73  ? 149 LEU D CA    1 
ATOM   1199 C C     . LEU D 1 16 ? 49.143 7.117   72.796  1.00 29.19  ? 149 LEU D C     1 
ATOM   1200 O O     . LEU D 1 16 ? 48.021 6.684   72.562  1.00 33.20  ? 149 LEU D O     1 
ATOM   1201 C CB    . LEU D 1 16 ? 49.478 8.598   74.734  1.00 28.75  ? 149 LEU D CB    1 
ATOM   1202 C CG    . LEU D 1 16 ? 49.744 8.812   76.245  1.00 33.85  ? 149 LEU D CG    1 
ATOM   1203 C CD1   . LEU D 1 16 ? 49.719 10.290  76.584  1.00 39.36  ? 149 LEU D CD1   1 
ATOM   1204 C CD2   . LEU D 1 16 ? 48.739 8.033   77.062  1.00 34.07  ? 149 LEU D CD2   1 
ATOM   1205 N N     . ALA D 1 17 ? 49.972 7.552   71.868  1.00 29.65  ? 150 ALA D N     1 
ATOM   1206 C CA    . ALA D 1 17 ? 49.611 7.560   70.432  1.00 33.13  ? 150 ALA D CA    1 
ATOM   1207 C C     . ALA D 1 17 ? 49.367 6.144   69.922  1.00 31.84  ? 150 ALA D C     1 
ATOM   1208 O O     . ALA D 1 17 ? 48.415 5.890   69.209  1.00 28.84  ? 150 ALA D O     1 
ATOM   1209 C CB    . ALA D 1 17 ? 50.699 8.229   69.632  1.00 33.43  ? 150 ALA D CB    1 
ATOM   1210 N N     . ALA D 1 18 ? 50.206 5.199   70.341  1.00 29.39  ? 151 ALA D N     1 
ATOM   1211 C CA    . ALA D 1 18 ? 50.080 3.804   69.948  1.00 28.77  ? 151 ALA D CA    1 
ATOM   1212 C C     . ALA D 1 18 ? 48.827 3.178   70.535  1.00 31.77  ? 151 ALA D C     1 
ATOM   1213 O O     . ALA D 1 18 ? 48.114 2.422   69.876  1.00 25.89  ? 151 ALA D O     1 
ATOM   1214 C CB    . ALA D 1 18 ? 51.325 3.017   70.348  1.00 33.09  ? 151 ALA D CB    1 
ATOM   1215 N N     . LEU D 1 19 ? 48.539 3.503   71.788  1.00 25.49  ? 152 LEU D N     1 
ATOM   1216 C CA    . LEU D 1 19 ? 47.389 2.944   72.456  1.00 25.67  ? 152 LEU D CA    1 
ATOM   1217 C C     . LEU D 1 19 ? 46.089 3.520   71.857  1.00 24.53  ? 152 LEU D C     1 
ATOM   1218 O O     . LEU D 1 19 ? 45.105 2.785   71.604  1.00 26.16  ? 152 LEU D O     1 
ATOM   1219 C CB    . LEU D 1 19 ? 47.490 3.304   73.920  1.00 24.92  ? 152 LEU D CB    1 
ATOM   1220 C CG    . LEU D 1 19 ? 48.533 2.473   74.724  1.00 27.69  ? 152 LEU D CG    1 
ATOM   1221 C CD1   . LEU D 1 19 ? 48.797 3.243   75.995  1.00 28.00  ? 152 LEU D CD1   1 
ATOM   1222 C CD2   . LEU D 1 19 ? 48.041 1.087   75.063  1.00 32.50  ? 152 LEU D CD2   1 
ATOM   1223 N N     . GLN D 1 20 ? 46.129 4.809   71.614  1.00 25.54  ? 153 GLN D N     1 
ATOM   1224 C CA    . GLN D 1 20 ? 44.970 5.530   71.031  1.00 25.98  ? 153 GLN D CA    1 
ATOM   1225 C C     . GLN D 1 20 ? 44.676 5.107   69.594  1.00 32.48  ? 153 GLN D C     1 
ATOM   1226 O O     . GLN D 1 20 ? 43.510 5.008   69.221  1.00 26.69  ? 153 GLN D O     1 
ATOM   1227 C CB    . GLN D 1 20 ? 45.243 7.007   71.071  1.00 28.07  ? 153 GLN D CB    1 
ATOM   1228 C CG    . GLN D 1 20 ? 45.215 7.532   72.523  1.00 31.05  ? 153 GLN D CG    1 
ATOM   1229 C CD    . GLN D 1 20 ? 45.829 8.880   72.651  1.00 27.04  ? 153 GLN D CD    1 
ATOM   1230 O OE1   . GLN D 1 20 ? 46.412 9.403   71.717  1.00 32.35  ? 153 GLN D OE1   1 
ATOM   1231 N NE2   . GLN D 1 20 ? 45.735 9.446   73.840  1.00 34.41  ? 153 GLN D NE2   1 
ATOM   1232 N N     . ARG D 1 21 ? 45.732 4.896   68.806  1.00 27.18  ? 154 ARG D N     1 
ATOM   1233 C CA    . ARG D 1 21 ? 45.578 4.429   67.412  1.00 26.60  ? 154 ARG D CA    1 
ATOM   1234 C C     . ARG D 1 21 ? 44.947 3.035   67.425  1.00 27.85  ? 154 ARG D C     1 
ATOM   1235 O O     . ARG D 1 21 ? 44.012 2.739   66.658  1.00 28.24  ? 154 ARG D O     1 
ATOM   1236 C CB    . ARG D 1 21 ? 46.931 4.401   66.704  1.00 29.13  ? 154 ARG D CB    1 
ATOM   1237 C CG    . ARG D 1 21 ? 46.863 3.821   65.283  1.00 34.20  ? 154 ARG D CG    1 
ATOM   1238 C CD    . ARG D 1 21 ? 45.895 4.621   64.399  1.00 33.82  ? 154 ARG D CD    1 
ATOM   1239 N NE    . ARG D 1 21 ? 45.834 4.078   63.028  1.00 37.94  ? 154 ARG D NE    1 
ATOM   1240 C CZ    . ARG D 1 21 ? 44.719 3.792   62.348  1.00 38.25  ? 154 ARG D CZ    1 
ATOM   1241 N NH1   . ARG D 1 21 ? 43.482 3.992   62.837  1.00 39.88  ? 154 ARG D NH1   1 
ATOM   1242 N NH2   . ARG D 1 21 ? 44.839 3.284   61.158  1.00 37.61  ? 154 ARG D NH2   1 
ATOM   1243 N N     . ARG D 1 22 ? 45.444 2.162   68.313  1.00 29.54  ? 155 ARG D N     1 
ATOM   1244 C CA    . ARG D 1 22 ? 44.884 0.828   68.411  1.00 31.50  ? 155 ARG D CA    1 
ATOM   1245 C C     . ARG D 1 22 ? 43.431 0.837   68.868  1.00 27.12  ? 155 ARG D C     1 
ATOM   1246 O O     . ARG D 1 22 ? 42.631 0.010   68.363  1.00 28.24  ? 155 ARG D O     1 
ATOM   1247 C CB    . ARG D 1 22 ? 45.687 -0.098  69.366  1.00 29.99  ? 155 ARG D CB    1 
ATOM   1248 C CG    . ARG D 1 22 ? 45.112 -1.529  69.446  1.00 34.84  ? 155 ARG D CG    1 
ATOM   1249 C CD    . ARG D 1 22 ? 45.193 -2.307  68.113  1.00 33.70  ? 155 ARG D CD    1 
ATOM   1250 N NE    . ARG D 1 22 ? 46.580 -2.283  67.639  1.00 38.45  ? 155 ARG D NE    1 
ATOM   1251 C CZ    . ARG D 1 22 ? 47.519 -3.199  67.910  1.00 43.96  ? 155 ARG D CZ    1 
ATOM   1252 N NH1   . ARG D 1 22 ? 47.230 -4.316  68.552  1.00 42.03  ? 155 ARG D NH1   1 
ATOM   1253 N NH2   . ARG D 1 22 ? 48.759 -2.999  67.502  1.00 48.45  ? 155 ARG D NH2   1 
ATOM   1254 N N     . PHE D 1 23 ? 43.105 1.728   69.806  1.00 25.74  ? 156 PHE D N     1 
ATOM   1255 C CA    . PHE D 1 23 ? 41.718 1.841   70.343  1.00 25.27  ? 156 PHE D CA    1 
ATOM   1256 C C     . PHE D 1 23 ? 40.742 2.240   69.214  1.00 29.93  ? 156 PHE D C     1 
ATOM   1257 O O     . PHE D 1 23 ? 39.574 1.926   69.280  1.00 30.04  ? 156 PHE D O     1 
ATOM   1258 C CB    . PHE D 1 23 ? 41.651 2.853   71.481  1.00 23.57  ? 156 PHE D CB    1 
ATOM   1259 C CG    . PHE D 1 23 ? 40.348 2.825   72.255  1.00 28.57  ? 156 PHE D CG    1 
ATOM   1260 C CD1   . PHE D 1 23 ? 40.134 1.868   73.220  1.00 30.97  ? 156 PHE D CD1   1 
ATOM   1261 C CD2   . PHE D 1 23 ? 39.342 3.716   71.975  1.00 28.41  ? 156 PHE D CD2   1 
ATOM   1262 C CE1   . PHE D 1 23 ? 38.934 1.810   73.910  1.00 38.03  ? 156 PHE D CE1   1 
ATOM   1263 C CE2   . PHE D 1 23 ? 38.122 3.674   72.651  1.00 30.05  ? 156 PHE D CE2   1 
ATOM   1264 C CZ    . PHE D 1 23 ? 37.914 2.710   73.608  1.00 34.69  ? 156 PHE D CZ    1 
ATOM   1265 N N     . GLN D 1 24 ? 41.221 2.953   68.219  1.00 32.60  ? 157 GLN D N     1 
ATOM   1266 C CA    . GLN D 1 24 ? 40.371 3.248   67.039  1.00 31.18  ? 157 GLN D CA    1 
ATOM   1267 C C     . GLN D 1 24 ? 39.958 1.962   66.328  1.00 37.97  ? 157 GLN D C     1 
ATOM   1268 O O     . GLN D 1 24 ? 38.864 1.864   65.797  1.00 39.65  ? 157 GLN D O     1 
ATOM   1269 C CB    . GLN D 1 24 ? 41.097 4.137   66.066  1.00 30.12  ? 157 GLN D CB    1 
ATOM   1270 C CG    . GLN D 1 24 ? 41.234 5.566   66.509  1.00 33.93  ? 157 GLN D CG    1 
ATOM   1271 C CD    . GLN D 1 24 ? 41.929 6.415   65.470  1.00 32.71  ? 157 GLN D CD    1 
ATOM   1272 O OE1   . GLN D 1 24 ? 42.822 5.946   64.742  1.00 36.50  ? 157 GLN D OE1   1 
ATOM   1273 N NE2   . GLN D 1 24 ? 41.565 7.679   65.413  1.00 30.31  ? 157 GLN D NE2   1 
ATOM   1274 N N     . LYS D 1 25 ? 40.841 0.979   66.276  1.00 36.15  ? 158 LYS D N     1 
ATOM   1275 C CA    . LYS D 1 25 ? 40.569 -0.243  65.532  1.00 38.00  ? 158 LYS D CA    1 
ATOM   1276 C C     . LYS D 1 25 ? 39.796 -1.215  66.377  1.00 43.06  ? 158 LYS D C     1 
ATOM   1277 O O     . LYS D 1 25 ? 38.891 -1.846  65.903  1.00 36.19  ? 158 LYS D O     1 
ATOM   1278 C CB    . LYS D 1 25 ? 41.869 -0.907  65.085  1.00 40.16  ? 158 LYS D CB    1 
ATOM   1279 C CG    . LYS D 1 25 ? 42.767 0.003   64.281  1.00 42.44  ? 158 LYS D CG    1 
ATOM   1280 C CD    . LYS D 1 25 ? 44.083 -0.696  63.984  1.00 49.66  ? 158 LYS D CD    1 
ATOM   1281 C CE    . LYS D 1 25 ? 45.120 0.322   63.553  1.00 46.00  ? 158 LYS D CE    1 
ATOM   1282 N NZ    . LYS D 1 25 ? 46.252 -0.356  62.899  1.00 52.24  ? 158 LYS D NZ    1 
ATOM   1283 N N     . THR D 1 26 ? 40.176 -1.352  67.646  1.00 34.11  ? 159 THR D N     1 
ATOM   1284 C CA    . THR D 1 26 ? 39.551 -2.335  68.510  1.00 38.56  ? 159 THR D CA    1 
ATOM   1285 C C     . THR D 1 26 ? 39.531 -1.795  69.934  1.00 39.51  ? 159 THR D C     1 
ATOM   1286 O O     . THR D 1 26 ? 40.555 -1.338  70.443  1.00 37.01  ? 159 THR D O     1 
ATOM   1287 C CB    . THR D 1 26 ? 40.298 -3.683  68.478  1.00 44.27  ? 159 THR D CB    1 
ATOM   1288 O OG1   . THR D 1 26 ? 39.593 -4.633  69.286  1.00 53.33  ? 159 THR D OG1   1 
ATOM   1289 C CG2   . THR D 1 26 ? 41.752 -3.563  68.976  1.00 39.63  ? 159 THR D CG2   1 
ATOM   1290 N N     . GLN D 1 27 ? 38.367 -1.891  70.566  1.00 38.52  ? 160 GLN D N     1 
ATOM   1291 C CA    . GLN D 1 27 ? 38.168 -1.396  71.928  1.00 39.22  ? 160 GLN D CA    1 
ATOM   1292 C C     . GLN D 1 27 ? 38.417 -2.461  72.986  1.00 36.90  ? 160 GLN D C     1 
ATOM   1293 O O     . GLN D 1 27 ? 38.606 -2.119  74.144  1.00 39.54  ? 160 GLN D O     1 
ATOM   1294 C CB    . GLN D 1 27 ? 36.769 -0.807  72.077  1.00 39.60  ? 160 GLN D CB    1 
ATOM   1295 C CG    . GLN D 1 27 ? 36.534 0.370   71.143  1.00 43.77  ? 160 GLN D CG    1 
ATOM   1296 C CD    . GLN D 1 27 ? 36.395 -0.062  69.694  1.00 47.27  ? 160 GLN D CD    1 
ATOM   1297 O OE1   . GLN D 1 27 ? 35.561 -0.903  69.390  1.00 48.88  ? 160 GLN D OE1   1 
ATOM   1298 N NE2   . GLN D 1 27 ? 37.255 0.467   68.803  1.00 43.20  ? 160 GLN D NE2   1 
ATOM   1299 N N     . TYR D 1 28 ? 38.412 -3.734  72.587  1.00 43.48  ? 161 TYR D N     1 
ATOM   1300 C CA    . TYR D 1 28 ? 38.856 -4.856  73.455  1.00 43.35  ? 161 TYR D CA    1 
ATOM   1301 C C     . TYR D 1 28 ? 40.040 -5.594  72.829  1.00 45.43  ? 161 TYR D C     1 
ATOM   1302 O O     . TYR D 1 28 ? 40.076 -5.824  71.632  1.00 43.86  ? 161 TYR D O     1 
ATOM   1303 C CB    . TYR D 1 28 ? 37.705 -5.836  73.699  1.00 39.36  ? 161 TYR D CB    1 
ATOM   1304 C CG    . TYR D 1 28 ? 36.510 -5.208  74.360  1.00 38.63  ? 161 TYR D CG    1 
ATOM   1305 C CD1   . TYR D 1 28 ? 36.336 -5.297  75.726  1.00 39.10  ? 161 TYR D CD1   1 
ATOM   1306 C CD2   . TYR D 1 28 ? 35.547 -4.504  73.614  1.00 42.70  ? 161 TYR D CD2   1 
ATOM   1307 C CE1   . TYR D 1 28 ? 35.252 -4.739  76.351  1.00 42.02  ? 161 TYR D CE1   1 
ATOM   1308 C CE2   . TYR D 1 28 ? 34.448 -3.928  74.249  1.00 39.06  ? 161 TYR D CE2   1 
ATOM   1309 C CZ    . TYR D 1 28 ? 34.316 -4.052  75.615  1.00 44.58  ? 161 TYR D CZ    1 
ATOM   1310 O OH    . TYR D 1 28 ? 33.276 -3.489  76.302  1.00 41.78  ? 161 TYR D OH    1 
ATOM   1311 N N     . LEU D 1 29 ? 41.024 -5.961  73.637  1.00 42.95  ? 162 LEU D N     1 
ATOM   1312 C CA    . LEU D 1 29 ? 42.184 -6.679  73.126  1.00 48.05  ? 162 LEU D CA    1 
ATOM   1313 C C     . LEU D 1 29 ? 42.053 -8.180  73.362  1.00 52.41  ? 162 LEU D C     1 
ATOM   1314 O O     . LEU D 1 29 ? 41.554 -8.607  74.394  1.00 52.40  ? 162 LEU D O     1 
ATOM   1315 C CB    . LEU D 1 29 ? 43.466 -6.172  73.788  1.00 46.64  ? 162 LEU D CB    1 
ATOM   1316 C CG    . LEU D 1 29 ? 43.840 -4.721  73.467  1.00 46.91  ? 162 LEU D CG    1 
ATOM   1317 C CD1   . LEU D 1 29 ? 45.157 -4.401  74.135  1.00 46.22  ? 162 LEU D CD1   1 
ATOM   1318 C CD2   . LEU D 1 29 ? 43.918 -4.432  71.977  1.00 46.53  ? 162 LEU D CD2   1 
ATOM   1319 N N     . ALA D 1 30 ? 42.503 -8.973  72.393  1.00 52.92  ? 163 ALA D N     1 
ATOM   1320 C CA    . ALA D 1 30 ? 42.742 -10.393 72.632  1.00 58.31  ? 163 ALA D CA    1 
ATOM   1321 C C     . ALA D 1 30 ? 44.036 -10.512 73.443  1.00 51.20  ? 163 ALA D C     1 
ATOM   1322 O O     . ALA D 1 30 ? 44.901 -9.634  73.389  1.00 43.50  ? 163 ALA D O     1 
ATOM   1323 C CB    . ALA D 1 30 ? 42.848 -11.167 71.313  1.00 52.53  ? 163 ALA D CB    1 
ATOM   1324 N N     . LEU D 1 31 ? 44.169 -11.609 74.178  1.00 55.85  ? 164 LEU D N     1 
ATOM   1325 C CA    . LEU D 1 31 ? 45.335 -11.820 75.035  1.00 54.19  ? 164 LEU D CA    1 
ATOM   1326 C C     . LEU D 1 31 ? 46.659 -11.812 74.257  1.00 50.74  ? 164 LEU D C     1 
ATOM   1327 O O     . LEU D 1 31 ? 47.599 -11.134 74.677  1.00 49.40  ? 164 LEU D O     1 
ATOM   1328 C CB    . LEU D 1 31 ? 45.184 -13.113 75.840  1.00 60.94  ? 164 LEU D CB    1 
ATOM   1329 C CG    . LEU D 1 31 ? 43.968 -13.124 76.775  1.00 64.93  ? 164 LEU D CG    1 
ATOM   1330 C CD1   . LEU D 1 31 ? 43.648 -14.538 77.250  1.00 64.80  ? 164 LEU D CD1   1 
ATOM   1331 C CD2   . LEU D 1 31 ? 44.196 -12.182 77.951  1.00 62.16  ? 164 LEU D CD2   1 
ATOM   1332 N N     . PRO D 1 32 ? 46.735 -12.531 73.112  1.00 47.35  ? 165 PRO D N     1 
ATOM   1333 C CA    . PRO D 1 32 ? 47.990 -12.424 72.308  1.00 48.36  ? 165 PRO D CA    1 
ATOM   1334 C C     . PRO D 1 32 ? 48.275 -10.992 71.838  1.00 43.52  ? 165 PRO D C     1 
ATOM   1335 O O     . PRO D 1 32 ? 49.401 -10.513 71.923  1.00 41.08  ? 165 PRO D O     1 
ATOM   1336 C CB    . PRO D 1 32 ? 47.741 -13.347 71.102  1.00 51.11  ? 165 PRO D CB    1 
ATOM   1337 C CG    . PRO D 1 32 ? 46.514 -14.137 71.431  1.00 52.87  ? 165 PRO D CG    1 
ATOM   1338 C CD    . PRO D 1 32 ? 45.729 -13.389 72.462  1.00 48.98  ? 165 PRO D CD    1 
ATOM   1339 N N     . GLU D 1 33 ? 47.231 -10.297 71.384  1.00 41.69  ? 166 GLU D N     1 
ATOM   1340 C CA    . GLU D 1 33 ? 47.336 -8.906  70.980  1.00 39.18  ? 166 GLU D CA    1 
ATOM   1341 C C     . GLU D 1 33 ? 47.828 -7.987  72.128  1.00 40.13  ? 166 GLU D C     1 
ATOM   1342 O O     . GLU D 1 33 ? 48.684 -7.118  71.925  1.00 40.43  ? 166 GLU D O     1 
ATOM   1343 C CB    . GLU D 1 33 ? 45.957 -8.441  70.494  1.00 42.31  ? 166 GLU D CB    1 
ATOM   1344 C CG    . GLU D 1 33 ? 45.944 -7.089  69.849  1.00 45.20  ? 166 GLU D CG    1 
ATOM   1345 C CD    . GLU D 1 33 ? 44.623 -6.794  69.137  1.00 49.73  ? 166 GLU D CD    1 
ATOM   1346 O OE1   . GLU D 1 33 ? 43.720 -7.680  69.109  1.00 50.54  ? 166 GLU D OE1   1 
ATOM   1347 O OE2   . GLU D 1 33 ? 44.500 -5.665  68.629  1.00 48.02  ? 166 GLU D OE2   1 
ATOM   1348 N N     . ARG D 1 34 ? 47.282 -8.200  73.321  1.00 36.43  ? 167 ARG D N     1 
ATOM   1349 C CA    A ARG D 1 34 ? 47.661 -7.432  74.507  0.50 37.04  ? 167 ARG D CA    1 
ATOM   1350 C CA    B ARG D 1 34 ? 47.669 -7.407  74.491  0.50 37.43  ? 167 ARG D CA    1 
ATOM   1351 C C     . ARG D 1 34 ? 49.140 -7.601  74.853  1.00 35.42  ? 167 ARG D C     1 
ATOM   1352 O O     . ARG D 1 34 ? 49.828 -6.625  75.145  1.00 39.26  ? 167 ARG D O     1 
ATOM   1353 C CB    A ARG D 1 34 ? 46.805 -7.873  75.688  0.50 39.66  ? 167 ARG D CB    1 
ATOM   1354 C CB    B ARG D 1 34 ? 46.797 -7.740  75.699  0.50 40.63  ? 167 ARG D CB    1 
ATOM   1355 C CG    A ARG D 1 34 ? 46.938 -7.015  76.928  0.50 41.06  ? 167 ARG D CG    1 
ATOM   1356 C CG    B ARG D 1 34 ? 46.946 -6.757  76.850  0.50 43.33  ? 167 ARG D CG    1 
ATOM   1357 C CD    A ARG D 1 34 ? 45.929 -7.458  77.976  0.50 43.21  ? 167 ARG D CD    1 
ATOM   1358 C CD    B ARG D 1 34 ? 46.583 -7.395  78.182  0.50 47.53  ? 167 ARG D CD    1 
ATOM   1359 N NE    A ARG D 1 34 ? 46.487 -8.480  78.857  0.50 42.91  ? 167 ARG D NE    1 
ATOM   1360 N NE    B ARG D 1 34 ? 45.153 -7.673  78.315  0.50 45.81  ? 167 ARG D NE    1 
ATOM   1361 C CZ    A ARG D 1 34 ? 45.803 -9.080  79.826  0.50 45.54  ? 167 ARG D CZ    1 
ATOM   1362 C CZ    B ARG D 1 34 ? 44.667 -8.736  78.946  0.50 50.29  ? 167 ARG D CZ    1 
ATOM   1363 N NH1   A ARG D 1 34 ? 44.522 -8.773  80.014  0.50 41.01  ? 167 ARG D NH1   1 
ATOM   1364 N NH1   B ARG D 1 34 ? 45.492 -9.627  79.478  0.50 54.39  ? 167 ARG D NH1   1 
ATOM   1365 N NH2   A ARG D 1 34 ? 46.400 -9.982  80.606  0.50 43.83  ? 167 ARG D NH2   1 
ATOM   1366 N NH2   B ARG D 1 34 ? 43.359 -8.925  79.030  0.50 55.69  ? 167 ARG D NH2   1 
ATOM   1367 N N     . ALA D 1 35 ? 49.624 -8.832  74.817  1.00 39.84  ? 168 ALA D N     1 
ATOM   1368 C CA    . ALA D 1 35 ? 51.052 -9.072  75.172  1.00 41.23  ? 168 ALA D CA    1 
ATOM   1369 C C     . ALA D 1 35 ? 51.947 -8.381  74.158  1.00 42.02  ? 168 ALA D C     1 
ATOM   1370 O O     . ALA D 1 35 ? 52.920 -7.748  74.529  1.00 38.99  ? 168 ALA D O     1 
ATOM   1371 C CB    . ALA D 1 35 ? 51.363 -10.549 75.254  1.00 43.68  ? 168 ALA D CB    1 
ATOM   1372 N N     . GLU D 1 36 ? 51.575 -8.449  72.871  1.00 40.70  ? 169 GLU D N     1 
ATOM   1373 C CA    . GLU D 1 36 ? 52.393 -7.861  71.803  1.00 42.34  ? 169 GLU D CA    1 
ATOM   1374 C C     . GLU D 1 36 ? 52.428 -6.318  71.853  1.00 39.46  ? 169 GLU D C     1 
ATOM   1375 O O     . GLU D 1 36 ? 53.461 -5.684  71.591  1.00 37.49  ? 169 GLU D O     1 
ATOM   1376 C CB    . GLU D 1 36 ? 51.882 -8.378  70.445  1.00 43.60  ? 169 GLU D CB    1 
ATOM   1377 C CG    . GLU D 1 36 ? 52.319 -7.583  69.230  1.00 59.22  ? 169 GLU D CG    1 
ATOM   1378 C CD    . GLU D 1 36 ? 53.757 -7.839  68.825  1.00 64.46  ? 169 GLU D CD    1 
ATOM   1379 O OE1   . GLU D 1 36 ? 54.657 -7.154  69.359  1.00 75.00  ? 169 GLU D OE1   1 
ATOM   1380 O OE2   . GLU D 1 36 ? 53.981 -8.705  67.947  1.00 76.38  ? 169 GLU D OE2   1 
ATOM   1381 N N     . LEU D 1 37 ? 51.282 -5.711  72.136  1.00 37.72  ? 170 LEU D N     1 
ATOM   1382 C CA    . LEU D 1 37 ? 51.183 -4.273  72.230  1.00 37.09  ? 170 LEU D CA    1 
ATOM   1383 C C     . LEU D 1 37 ? 51.976 -3.797  73.474  1.00 35.14  ? 170 LEU D C     1 
ATOM   1384 O O     . LEU D 1 37 ? 52.798 -2.875  73.400  1.00 34.90  ? 170 LEU D O     1 
ATOM   1385 C CB    . LEU D 1 37 ? 49.676 -3.863  72.310  1.00 35.05  ? 170 LEU D CB    1 
ATOM   1386 C CG    . LEU D 1 37 ? 49.393 -2.356  72.258  1.00 42.73  ? 170 LEU D CG    1 
ATOM   1387 C CD1   . LEU D 1 37 ? 50.203 -1.639  71.195  1.00 46.32  ? 170 LEU D CD1   1 
ATOM   1388 C CD2   . LEU D 1 37 ? 47.911 -2.070  72.051  1.00 48.50  ? 170 LEU D CD2   1 
ATOM   1389 N N     . ALA D 1 38 ? 51.736 -4.446  74.602  1.00 37.68  ? 171 ALA D N     1 
ATOM   1390 C CA    . ALA D 1 38 ? 52.445 -4.121  75.842  1.00 32.49  ? 171 ALA D CA    1 
ATOM   1391 C C     . ALA D 1 38 ? 53.964 -4.149  75.632  1.00 36.00  ? 171 ALA D C     1 
ATOM   1392 O O     . ALA D 1 38 ? 54.646 -3.145  75.847  1.00 38.97  ? 171 ALA D O     1 
ATOM   1393 C CB    . ALA D 1 38 ? 52.052 -5.101  76.938  1.00 38.12  ? 171 ALA D CB    1 
ATOM   1394 N N     . ALA D 1 39 ? 54.464 -5.291  75.178  1.00 39.45  ? 172 ALA D N     1 
ATOM   1395 C CA    . ALA D 1 39 ? 55.908 -5.477  74.905  1.00 40.75  ? 172 ALA D CA    1 
ATOM   1396 C C     . ALA D 1 39 ? 56.430 -4.423  73.940  1.00 43.63  ? 172 ALA D C     1 
ATOM   1397 O O     . ALA D 1 39 ? 57.406 -3.772  74.231  1.00 39.03  ? 172 ALA D O     1 
ATOM   1398 C CB    . ALA D 1 39 ? 56.152 -6.851  74.345  1.00 44.49  ? 172 ALA D CB    1 
ATOM   1399 N N     . SER D 1 40 ? 55.733 -4.205  72.819  1.00 38.82  ? 173 SER D N     1 
ATOM   1400 C CA    . SER D 1 40 ? 56.173 -3.213  71.822  1.00 40.50  ? 173 SER D CA    1 
ATOM   1401 C C     . SER D 1 40 ? 56.274 -1.778  72.360  1.00 41.07  ? 173 SER D C     1 
ATOM   1402 O O     . SER D 1 40 ? 57.016 -0.958  71.811  1.00 43.04  ? 173 SER D O     1 
ATOM   1403 C CB    . SER D 1 40 ? 55.250 -3.225  70.588  1.00 45.96  ? 173 SER D CB    1 
ATOM   1404 O OG    . SER D 1 40 ? 54.124 -2.391  70.799  1.00 43.63  ? 173 SER D OG    1 
ATOM   1405 N N     . LEU D 1 41 ? 55.530 -1.470  73.420  1.00 39.64  ? 174 LEU D N     1 
ATOM   1406 C CA    . LEU D 1 41 ? 55.549 -0.150  74.036  1.00 37.99  ? 174 LEU D CA    1 
ATOM   1407 C C     . LEU D 1 41 ? 56.304 -0.078  75.353  1.00 39.23  ? 174 LEU D C     1 
ATOM   1408 O O     . LEU D 1 41 ? 56.351 0.993   75.945  1.00 41.49  ? 174 LEU D O     1 
ATOM   1409 C CB    . LEU D 1 41 ? 54.131 0.329   74.313  1.00 35.22  ? 174 LEU D CB    1 
ATOM   1410 C CG    . LEU D 1 41 ? 53.253 0.421   73.074  1.00 34.53  ? 174 LEU D CG    1 
ATOM   1411 C CD1   . LEU D 1 41 ? 51.896 0.922   73.546  1.00 35.26  ? 174 LEU D CD1   1 
ATOM   1412 C CD2   . LEU D 1 41 ? 53.879 1.340   72.058  1.00 38.11  ? 174 LEU D CD2   1 
ATOM   1413 N N     . GLY D 1 42 ? 56.906 -1.180  75.800  1.00 43.62  ? 175 GLY D N     1 
ATOM   1414 C CA    . GLY D 1 42 ? 57.671 -1.172  77.056  1.00 41.68  ? 175 GLY D CA    1 
ATOM   1415 C C     . GLY D 1 42 ? 56.798 -1.049  78.287  1.00 43.13  ? 175 GLY D C     1 
ATOM   1416 O O     . GLY D 1 42 ? 57.197 -0.480  79.310  1.00 41.03  ? 175 GLY D O     1 
ATOM   1417 N N     . LEU D 1 43 ? 55.597 -1.604  78.201  1.00 35.60  ? 176 LEU D N     1 
ATOM   1418 C CA    . LEU D 1 43 ? 54.650 -1.563  79.284  1.00 36.10  ? 176 LEU D CA    1 
ATOM   1419 C C     . LEU D 1 43 ? 54.365 -2.968  79.730  1.00 35.56  ? 176 LEU D C     1 
ATOM   1420 O O     . LEU D 1 43 ? 54.652 -3.911  79.008  1.00 38.98  ? 176 LEU D O     1 
ATOM   1421 C CB    . LEU D 1 43 ? 53.322 -0.927  78.812  1.00 34.70  ? 176 LEU D CB    1 
ATOM   1422 C CG    . LEU D 1 43 ? 53.431 0.506   78.289  1.00 38.08  ? 176 LEU D CG    1 
ATOM   1423 C CD1   . LEU D 1 43 ? 52.146 0.921   77.593  1.00 35.17  ? 176 LEU D CD1   1 
ATOM   1424 C CD2   . LEU D 1 43 ? 53.781 1.463   79.430  1.00 37.02  ? 176 LEU D CD2   1 
ATOM   1425 N N     . THR D 1 44 ? 53.729 -3.078  80.897  1.00 38.21  ? 177 THR D N     1 
ATOM   1426 C CA    . THR D 1 44 ? 53.178 -4.338  81.373  1.00 40.66  ? 177 THR D CA    1 
ATOM   1427 C C     . THR D 1 44 ? 51.813 -4.590  80.768  1.00 43.13  ? 177 THR D C     1 
ATOM   1428 O O     . THR D 1 44 ? 51.121 -3.655  80.345  1.00 36.49  ? 177 THR D O     1 
ATOM   1429 C CB    . THR D 1 44 ? 53.040 -4.380  82.902  1.00 46.13  ? 177 THR D CB    1 
ATOM   1430 O OG1   . THR D 1 44 ? 51.954 -3.542  83.323  1.00 37.58  ? 177 THR D OG1   1 
ATOM   1431 C CG2   . THR D 1 44 ? 54.363 -3.963  83.570  1.00 46.71  ? 177 THR D CG2   1 
ATOM   1432 N N     . GLN D 1 45 ? 51.409 -5.847  80.761  1.00 42.88  ? 178 GLN D N     1 
ATOM   1433 C CA    . GLN D 1 45 ? 50.074 -6.185  80.266  1.00 44.91  ? 178 GLN D CA    1 
ATOM   1434 C C     . GLN D 1 45 ? 49.001 -5.605  81.161  1.00 43.86  ? 178 GLN D C     1 
ATOM   1435 O O     . GLN D 1 45 ? 47.974 -5.143  80.663  1.00 39.11  ? 178 GLN D O     1 
ATOM   1436 C CB    . GLN D 1 45 ? 49.887 -7.685  80.145  1.00 53.44  ? 178 GLN D CB    1 
ATOM   1437 C CG    . GLN D 1 45 ? 50.730 -8.286  79.040  1.00 53.08  ? 178 GLN D CG    1 
ATOM   1438 C CD    . GLN D 1 45 ? 50.339 -9.715  78.744  1.00 61.47  ? 178 GLN D CD    1 
ATOM   1439 O OE1   . GLN D 1 45 ? 49.159 -10.043 78.669  1.00 60.89  ? 178 GLN D OE1   1 
ATOM   1440 N NE2   . GLN D 1 45 ? 51.335 -10.572 78.566  1.00 62.80  ? 178 GLN D NE2   1 
ATOM   1441 N N     . THR D 1 46 ? 49.244 -5.577  82.479  1.00 41.76  ? 179 THR D N     1 
ATOM   1442 C CA    . THR D 1 46 ? 48.309 -4.895  83.342  1.00 41.53  ? 179 THR D CA    1 
ATOM   1443 C C     . THR D 1 46 ? 48.180 -3.400  83.005  1.00 35.94  ? 179 THR D C     1 
ATOM   1444 O O     . THR D 1 46 ? 47.075 -2.882  83.030  1.00 35.28  ? 179 THR D O     1 
ATOM   1445 C CB    . THR D 1 46 ? 48.650 -5.050  84.835  1.00 50.03  ? 179 THR D CB    1 
ATOM   1446 O OG1   . THR D 1 46 ? 48.807 -6.440  85.157  1.00 50.11  ? 179 THR D OG1   1 
ATOM   1447 C CG2   . THR D 1 46 ? 47.528 -4.467  85.685  1.00 56.90  ? 179 THR D CG2   1 
ATOM   1448 N N     . GLN D 1 47 ? 49.290 -2.691  82.743  1.00 33.36  ? 180 GLN D N     1 
ATOM   1449 C CA    . GLN D 1 47 ? 49.193 -1.273  82.406  1.00 34.23  ? 180 GLN D CA    1 
ATOM   1450 C C     . GLN D 1 47 ? 48.296 -1.113  81.163  1.00 36.35  ? 180 GLN D C     1 
ATOM   1451 O O     . GLN D 1 47 ? 47.383 -0.307  81.150  1.00 35.80  ? 180 GLN D O     1 
ATOM   1452 C CB    . GLN D 1 47 ? 50.553 -0.664  82.099  1.00 34.75  ? 180 GLN D CB    1 
ATOM   1453 C CG    . GLN D 1 47 ? 51.361 -0.267  83.327  1.00 40.15  ? 180 GLN D CG    1 
ATOM   1454 C CD    . GLN D 1 47 ? 52.784 0.074   82.944  1.00 42.93  ? 180 GLN D CD    1 
ATOM   1455 O OE1   . GLN D 1 47 ? 53.424 -0.664  82.208  1.00 36.50  ? 180 GLN D OE1   1 
ATOM   1456 N NE2   . GLN D 1 47 ? 53.271 1.215   83.399  1.00 55.44  ? 180 GLN D NE2   1 
ATOM   1457 N N     . VAL D 1 48 ? 48.573 -1.893  80.133  1.00 35.42  ? 181 VAL D N     1 
ATOM   1458 C CA    . VAL D 1 48 ? 47.737 -1.868  78.925  1.00 33.11  ? 181 VAL D CA    1 
ATOM   1459 C C     . VAL D 1 48 ? 46.283 -2.231  79.206  1.00 35.57  ? 181 VAL D C     1 
ATOM   1460 O O     . VAL D 1 48 ? 45.393 -1.533  78.762  1.00 27.98  ? 181 VAL D O     1 
ATOM   1461 C CB    . VAL D 1 48 ? 48.326 -2.721  77.806  1.00 31.24  ? 181 VAL D CB    1 
ATOM   1462 C CG1   . VAL D 1 48 ? 47.360 -2.775  76.611  1.00 31.32  ? 181 VAL D CG1   1 
ATOM   1463 C CG2   . VAL D 1 48 ? 49.671 -2.164  77.391  1.00 33.33  ? 181 VAL D CG2   1 
ATOM   1464 N N     . LYS D 1 49 ? 46.045 -3.284  79.971  1.00 38.79  ? 182 LYS D N     1 
ATOM   1465 C CA    . LYS D 1 49 ? 44.673 -3.727  80.308  1.00 39.89  ? 182 LYS D CA    1 
ATOM   1466 C C     . LYS D 1 49 ? 43.859 -2.624  80.974  1.00 36.78  ? 182 LYS D C     1 
ATOM   1467 O O     . LYS D 1 49 ? 42.719 -2.386  80.631  1.00 34.75  ? 182 LYS D O     1 
ATOM   1468 C CB    . LYS D 1 49 ? 44.750 -4.924  81.289  1.00 44.72  ? 182 LYS D CB    1 
ATOM   1469 C CG    . LYS D 1 49 ? 43.399 -5.461  81.752  1.00 46.40  ? 182 LYS D CG    1 
ATOM   1470 C CD    . LYS D 1 49 ? 43.513 -6.492  82.871  1.00 45.58  ? 182 LYS D CD    1 
ATOM   1471 C CE    . LYS D 1 49 ? 43.444 -5.823  84.235  1.00 55.63  ? 182 LYS D CE    1 
ATOM   1472 N NZ    . LYS D 1 49 ? 43.730 -6.766  85.362  1.00 63.09  ? 182 LYS D NZ    1 
ATOM   1473 N N     . ILE D 1 50 ? 44.467 -1.976  81.967  1.00 34.70  ? 183 ILE D N     1 
ATOM   1474 C CA    . ILE D 1 50 ? 43.864 -0.879  82.716  1.00 34.43  ? 183 ILE D CA    1 
ATOM   1475 C C     . ILE D 1 50 ? 43.581 0.365   81.859  1.00 30.04  ? 183 ILE D C     1 
ATOM   1476 O O     . ILE D 1 50 ? 42.471 0.967   81.944  1.00 28.64  ? 183 ILE D O     1 
ATOM   1477 C CB    . ILE D 1 50 ? 44.755 -0.564  83.989  1.00 33.44  ? 183 ILE D CB    1 
ATOM   1478 C CG1   . ILE D 1 50 ? 44.727 -1.750  84.949  1.00 42.22  ? 183 ILE D CG1   1 
ATOM   1479 C CG2   . ILE D 1 50 ? 44.289 0.696   84.691  1.00 32.58  ? 183 ILE D CG2   1 
ATOM   1480 C CD1   . ILE D 1 50 ? 43.349 -2.247  85.288  1.00 43.90  ? 183 ILE D CD1   1 
ATOM   1481 N N     . TRP D 1 51 ? 44.524 0.689   80.969  1.00 30.20  ? 184 TRP D N     1 
ATOM   1482 C CA    . TRP D 1 51 ? 44.364 1.787   80.039  1.00 31.24  ? 184 TRP D CA    1 
ATOM   1483 C C     . TRP D 1 51 ? 43.107 1.572   79.176  1.00 26.08  ? 184 TRP D C     1 
ATOM   1484 O O     . TRP D 1 51 ? 42.274 2.477   79.062  1.00 26.50  ? 184 TRP D O     1 
ATOM   1485 C CB    . TRP D 1 51 ? 45.596 1.951   79.140  1.00 28.95  ? 184 TRP D CB    1 
ATOM   1486 C CG    . TRP D 1 51 ? 45.583 3.200   78.309  1.00 27.81  ? 184 TRP D CG    1 
ATOM   1487 C CD1   . TRP D 1 51 ? 46.146 4.393   78.622  1.00 30.45  ? 184 TRP D CD1   1 
ATOM   1488 C CD2   . TRP D 1 51 ? 44.920 3.397   77.036  1.00 28.44  ? 184 TRP D CD2   1 
ATOM   1489 N NE1   . TRP D 1 51 ? 45.915 5.305   77.648  1.00 30.23  ? 184 TRP D NE1   1 
ATOM   1490 C CE2   . TRP D 1 51 ? 45.147 4.741   76.664  1.00 27.82  ? 184 TRP D CE2   1 
ATOM   1491 C CE3   . TRP D 1 51 ? 44.172 2.570   76.193  1.00 26.27  ? 184 TRP D CE3   1 
ATOM   1492 C CZ2   . TRP D 1 51 ? 44.653 5.294   75.466  1.00 27.65  ? 184 TRP D CZ2   1 
ATOM   1493 C CZ3   . TRP D 1 51 ? 43.686 3.113   74.978  1.00 28.75  ? 184 TRP D CZ3   1 
ATOM   1494 C CH2   . TRP D 1 51 ? 43.946 4.456   74.634  1.00 25.34  ? 184 TRP D CH2   1 
ATOM   1495 N N     . PHE D 1 52 ? 42.958 0.374   78.629  1.00 31.47  ? 185 PHE D N     1 
ATOM   1496 C CA    . PHE D 1 52 ? 41.756 0.044   77.870  1.00 32.26  ? 185 PHE D CA    1 
ATOM   1497 C C     . PHE D 1 52 ? 40.509 0.027   78.757  1.00 34.54  ? 185 PHE D C     1 
ATOM   1498 O O     . PHE D 1 52 ? 39.444 0.490   78.332  1.00 32.67  ? 185 PHE D O     1 
ATOM   1499 C CB    . PHE D 1 52 ? 41.902 -1.265  77.099  1.00 32.35  ? 185 PHE D CB    1 
ATOM   1500 C CG    . PHE D 1 52 ? 42.585 -1.114  75.778  1.00 35.34  ? 185 PHE D CG    1 
ATOM   1501 C CD1   . PHE D 1 52 ? 43.944 -0.932  75.704  1.00 33.03  ? 185 PHE D CD1   1 
ATOM   1502 C CD2   . PHE D 1 52 ? 41.864 -1.181  74.599  1.00 32.69  ? 185 PHE D CD2   1 
ATOM   1503 C CE1   . PHE D 1 52 ? 44.579 -0.774  74.483  1.00 33.76  ? 185 PHE D CE1   1 
ATOM   1504 C CE2   . PHE D 1 52 ? 42.478 -1.052  73.380  1.00 31.95  ? 185 PHE D CE2   1 
ATOM   1505 C CZ    . PHE D 1 52 ? 43.846 -0.858  73.306  1.00 35.34  ? 185 PHE D CZ    1 
ATOM   1506 N N     . GLN D 1 53 ? 40.606 -0.455  79.990  1.00 34.37  ? 186 GLN D N     1 
ATOM   1507 C CA    . GLN D 1 53 ? 39.448 -0.314  80.926  1.00 35.39  ? 186 GLN D CA    1 
ATOM   1508 C C     . GLN D 1 53 ? 38.993 1.128   81.040  1.00 31.04  ? 186 GLN D C     1 
ATOM   1509 O O     . GLN D 1 53 ? 37.825 1.420   80.957  1.00 34.13  ? 186 GLN D O     1 
ATOM   1510 C CB    . GLN D 1 53 ? 39.766 -0.803  82.356  1.00 41.51  ? 186 GLN D CB    1 
ATOM   1511 C CG    . GLN D 1 53 ? 40.033 -2.275  82.392  1.00 43.63  ? 186 GLN D CG    1 
ATOM   1512 C CD    . GLN D 1 53 ? 40.169 -2.867  83.769  1.00 48.58  ? 186 GLN D CD    1 
ATOM   1513 O OE1   . GLN D 1 53 ? 40.223 -2.175  84.816  1.00 45.18  ? 186 GLN D OE1   1 
ATOM   1514 N NE2   . GLN D 1 53 ? 40.219 -4.177  83.782  1.00 45.17  ? 186 GLN D NE2   1 
ATOM   1515 N N     . ASN D 1 54 ? 39.948 2.012   81.302  1.00 31.44  ? 187 ASN D N     1 
ATOM   1516 C CA    . ASN D 1 54 ? 39.667 3.384   81.604  1.00 30.25  ? 187 ASN D CA    1 
ATOM   1517 C C     . ASN D 1 54 ? 39.170 4.103   80.344  1.00 28.87  ? 187 ASN D C     1 
ATOM   1518 O O     . ASN D 1 54 ? 38.200 4.883   80.417  1.00 28.68  ? 187 ASN D O     1 
ATOM   1519 C CB    . ASN D 1 54 ? 40.891 4.079   82.235  1.00 27.40  ? 187 ASN D CB    1 
ATOM   1520 C CG    . ASN D 1 54 ? 41.131 3.638   83.707  1.00 29.14  ? 187 ASN D CG    1 
ATOM   1521 O OD1   . ASN D 1 54 ? 40.190 3.422   84.465  1.00 32.69  ? 187 ASN D OD1   1 
ATOM   1522 N ND2   . ASN D 1 54 ? 42.396 3.534   84.097  1.00 29.41  ? 187 ASN D ND2   1 
ATOM   1523 N N     . LYS D 1 55 ? 39.799 3.822   79.198  1.00 31.26  ? 188 LYS D N     1 
ATOM   1524 C CA    . LYS D 1 55 ? 39.373 4.443   77.923  1.00 32.73  ? 188 LYS D CA    1 
ATOM   1525 C C     . LYS D 1 55 ? 37.946 4.039   77.578  1.00 32.08  ? 188 LYS D C     1 
ATOM   1526 O O     . LYS D 1 55 ? 37.114 4.875   77.208  1.00 33.40  ? 188 LYS D O     1 
ATOM   1527 C CB    . LYS D 1 55 ? 40.284 3.994   76.773  1.00 33.47  ? 188 LYS D CB    1 
ATOM   1528 C CG    . LYS D 1 55 ? 40.078 4.736   75.478  1.00 31.83  ? 188 LYS D CG    1 
ATOM   1529 C CD    . LYS D 1 55 ? 40.563 6.157   75.589  1.00 32.10  ? 188 LYS D CD    1 
ATOM   1530 C CE    . LYS D 1 55 ? 40.528 6.857   74.247  1.00 37.59  ? 188 LYS D CE    1 
ATOM   1531 N NZ    . LYS D 1 55 ? 40.849 8.271   74.487  1.00 36.29  ? 188 LYS D NZ    1 
ATOM   1532 N N     . ARG D 1 56 ? 37.639 2.759   77.687  1.00 30.98  ? 189 ARG D N     1 
ATOM   1533 C CA    . ARG D 1 56 ? 36.246 2.343   77.500  1.00 34.67  ? 189 ARG D CA    1 
ATOM   1534 C C     . ARG D 1 56 ? 35.257 3.067   78.425  1.00 36.59  ? 189 ARG D C     1 
ATOM   1535 O O     . ARG D 1 56 ? 34.170 3.505   77.987  1.00 29.01  ? 189 ARG D O     1 
ATOM   1536 C CB    . ARG D 1 56 ? 36.097 0.820   77.623  1.00 38.19  ? 189 ARG D CB    1 
ATOM   1537 C CG    . ARG D 1 56 ? 36.738 0.016   76.500  1.00 38.93  ? 189 ARG D CG    1 
ATOM   1538 C CD    . ARG D 1 56 ? 36.312 -1.451  76.518  1.00 37.19  ? 189 ARG D CD    1 
ATOM   1539 N NE    . ARG D 1 56 ? 36.733 -2.171  77.732  1.00 32.86  ? 189 ARG D NE    1 
ATOM   1540 C CZ    . ARG D 1 56 ? 37.858 -2.873  77.868  1.00 33.48  ? 189 ARG D CZ    1 
ATOM   1541 N NH1   . ARG D 1 56 ? 38.743 -2.939  76.889  1.00 36.93  ? 189 ARG D NH1   1 
ATOM   1542 N NH2   . ARG D 1 56 ? 38.120 -3.484  79.022  1.00 38.84  ? 189 ARG D NH2   1 
ATOM   1543 N N     . SER D 1 57 ? 35.609 3.231   79.712  1.00 34.30  ? 190 SER D N     1 
ATOM   1544 C CA    . SER D 1 57 ? 34.748 3.952   80.599  1.00 33.85  ? 190 SER D CA    1 
ATOM   1545 C C     . SER D 1 57 ? 34.534 5.411   80.176  1.00 34.18  ? 190 SER D C     1 
ATOM   1546 O O     . SER D 1 57 ? 33.389 5.937   80.219  1.00 31.74  ? 190 SER D O     1 
ATOM   1547 C CB    . SER D 1 57 ? 35.278 3.876   82.049  1.00 39.66  ? 190 SER D CB    1 
ATOM   1548 O OG    . SER D 1 57 ? 34.496 4.717   82.835  1.00 47.63  ? 190 SER D OG    1 
ATOM   1549 N N     . LYS D 1 58 ? 35.604 6.077   79.763  1.00 30.10  ? 191 LYS D N     1 
ATOM   1550 C CA    . LYS D 1 58 ? 35.523 7.447   79.266  1.00 31.72  ? 191 LYS D CA    1 
ATOM   1551 C C     . LYS D 1 58 ? 34.570 7.570   78.064  1.00 33.42  ? 191 LYS D C     1 
ATOM   1552 O O     . LYS D 1 58 ? 33.749 8.469   78.014  1.00 31.79  ? 191 LYS D O     1 
ATOM   1553 C CB    . LYS D 1 58 ? 36.910 7.957   78.841  1.00 36.06  ? 191 LYS D CB    1 
ATOM   1554 C CG    . LYS D 1 58 ? 36.921 9.408   78.370  1.00 41.91  ? 191 LYS D CG    1 
ATOM   1555 C CD    . LYS D 1 58 ? 38.301 9.881   77.958  1.00 48.11  ? 191 LYS D CD    1 
ATOM   1556 C CE    . LYS D 1 58 ? 38.261 11.286  77.367  1.00 54.54  ? 191 LYS D CE    1 
ATOM   1557 N NZ    . LYS D 1 58 ? 39.480 11.578  76.557  1.00 53.40  ? 191 LYS D NZ    1 
ATOM   1558 N N     . ILE D 1 59 ? 34.738 6.690   77.092  1.00 34.15  ? 192 ILE D N     1 
ATOM   1559 C CA    . ILE D 1 59 ? 33.930 6.755   75.875  1.00 39.06  ? 192 ILE D CA    1 
ATOM   1560 C C     . ILE D 1 59 ? 32.477 6.583   76.257  1.00 37.23  ? 192 ILE D C     1 
ATOM   1561 O O     . ILE D 1 59 ? 31.632 7.357   75.824  1.00 47.17  ? 192 ILE D O     1 
ATOM   1562 C CB    . ILE D 1 59 ? 34.340 5.674   74.874  1.00 38.83  ? 192 ILE D CB    1 
ATOM   1563 C CG1   . ILE D 1 59 ? 35.771 5.901   74.386  1.00 42.64  ? 192 ILE D CG1   1 
ATOM   1564 C CG2   . ILE D 1 59 ? 33.347 5.608   73.720  1.00 41.20  ? 192 ILE D CG2   1 
ATOM   1565 C CD1   . ILE D 1 59 ? 36.093 7.300   73.902  1.00 47.76  ? 192 ILE D CD1   1 
ATOM   1566 N N     . LYS D 1 60 ? 32.187 5.582   77.097  1.00 41.20  ? 193 LYS D N     1 
ATOM   1567 C CA    . LYS D 1 60 ? 30.809 5.359   77.561  1.00 47.57  ? 193 LYS D CA    1 
ATOM   1568 C C     . LYS D 1 60 ? 30.226 6.590   78.224  1.00 46.60  ? 193 LYS D C     1 
ATOM   1569 O O     . LYS D 1 60 ? 29.041 6.869   78.077  1.00 44.04  ? 193 LYS D O     1 
ATOM   1570 C CB    . LYS D 1 60 ? 30.708 4.143   78.493  1.00 45.78  ? 193 LYS D CB    1 
ATOM   1571 C CG    . LYS D 1 60 ? 29.296 3.602   78.628  1.00 50.61  ? 193 LYS D CG    1 
ATOM   1572 N N     . LYS D 1 61 ? 31.053 7.341   78.951  1.00 37.63  ? 194 LYS D N     1 
ATOM   1573 C CA    . LYS D 1 61 ? 30.579 8.559   79.598  1.00 40.54  ? 194 LYS D CA    1 
ATOM   1574 C C     . LYS D 1 61 ? 30.243 9.640   78.586  1.00 41.19  ? 194 LYS D C     1 
ATOM   1575 O O     . LYS D 1 61 ? 29.229 10.341  78.709  1.00 41.44  ? 194 LYS D O     1 
ATOM   1576 C CB    . LYS D 1 61 ? 31.590 9.113   80.591  1.00 41.59  ? 194 LYS D CB    1 
ATOM   1577 C CG    . LYS D 1 61 ? 31.639 8.353   81.899  1.00 52.39  ? 194 LYS D CG    1 
ATOM   1578 C CD    . LYS D 1 61 ? 32.584 9.042   82.880  1.00 57.13  ? 194 LYS D CD    1 
ATOM   1579 C CE    . LYS D 1 61 ? 33.201 8.037   83.841  1.00 66.48  ? 194 LYS D CE    1 
ATOM   1580 N NZ    . LYS D 1 61 ? 32.182 7.442   84.744  1.00 66.96  ? 194 LYS D NZ    1 
ATOM   1581 N N     . ILE D 1 62 ? 31.076 9.763   77.568  1.00 37.83  ? 195 ILE D N     1 
ATOM   1582 C CA    . ILE D 1 62 ? 30.810 10.723  76.501  1.00 39.93  ? 195 ILE D CA    1 
ATOM   1583 C C     . ILE D 1 62 ? 29.494 10.354  75.809  1.00 42.53  ? 195 ILE D C     1 
ATOM   1584 O O     . ILE D 1 62 ? 28.727 11.234  75.488  1.00 44.41  ? 195 ILE D O     1 
ATOM   1585 C CB    . ILE D 1 62 ? 31.952 10.761  75.449  1.00 42.08  ? 195 ILE D CB    1 
ATOM   1586 C CG1   . ILE D 1 62 ? 33.258 11.234  76.087  1.00 42.88  ? 195 ILE D CG1   1 
ATOM   1587 C CG2   . ILE D 1 62 ? 31.589 11.707  74.293  1.00 48.19  ? 195 ILE D CG2   1 
ATOM   1588 C CD1   . ILE D 1 62 ? 34.494 11.049  75.235  1.00 46.33  ? 195 ILE D CD1   1 
ATOM   1589 N N     . MET D 1 63 ? 29.248 9.050   75.647  1.00 49.23  ? 196 MET D N     1 
ATOM   1590 C CA    A MET D 1 63 ? 28.110 8.525   74.875  0.50 50.22  ? 196 MET D CA    1 
ATOM   1591 C CA    B MET D 1 63 ? 28.108 8.548   74.875  0.50 53.03  ? 196 MET D CA    1 
ATOM   1592 C C     . MET D 1 63 ? 26.800 8.597   75.674  1.00 57.19  ? 196 MET D C     1 
ATOM   1593 O O     . MET D 1 63 ? 25.713 8.464   75.105  1.00 76.66  ? 196 MET D O     1 
ATOM   1594 C CB    A MET D 1 63 ? 28.396 7.079   74.395  0.50 47.44  ? 196 MET D CB    1 
ATOM   1595 C CB    B MET D 1 63 ? 28.393 7.124   74.380  0.50 54.25  ? 196 MET D CB    1 
ATOM   1596 C CG    A MET D 1 63 ? 29.271 6.980   73.137  0.50 45.30  ? 196 MET D CG    1 
ATOM   1597 C CG    B MET D 1 63 ? 27.721 6.786   73.063  0.50 60.54  ? 196 MET D CG    1 
ATOM   1598 S SD    A MET D 1 63 ? 30.151 5.408   72.873  0.50 46.19  ? 196 MET D SD    1 
ATOM   1599 S SD    B MET D 1 63 ? 28.097 7.945   71.729  0.50 62.69  ? 196 MET D SD    1 
ATOM   1600 C CE    A MET D 1 63 ? 29.947 5.194   71.100  0.50 54.25  ? 196 MET D CE    1 
ATOM   1601 C CE    B MET D 1 63 ? 26.486 8.052   70.953  0.50 57.68  ? 196 MET D CE    1 
ATOM   1602 N N     . LYS D 1 64 ? 26.903 8.794   76.992  1.00 61.95  ? 197 LYS D N     1 
ATOM   1603 C CA    . LYS D 1 64 ? 25.743 9.067   77.840  1.00 65.24  ? 197 LYS D CA    1 
ATOM   1604 C C     . LYS D 1 64 ? 25.412 10.560  77.733  1.00 71.37  ? 197 LYS D C     1 
ATOM   1605 O O     . LYS D 1 64 ? 24.274 10.965  77.974  1.00 65.47  ? 197 LYS D O     1 
ATOM   1606 C CB    . LYS D 1 64 ? 26.016 8.680   79.302  1.00 67.13  ? 197 LYS D CB    1 
ATOM   1607 N N     . ASN D 1 65 ? 26.418 11.365  77.368  1.00 73.11  ? 198 ASN D N     1 
ATOM   1608 C CA    . ASN D 1 65 ? 26.268 12.812  77.092  1.00 75.19  ? 198 ASN D CA    1 
ATOM   1609 C C     . ASN D 1 65 ? 25.970 13.660  78.335  1.00 82.08  ? 198 ASN D C     1 
ATOM   1610 O O     . ASN D 1 65 ? 26.657 13.536  79.350  1.00 93.21  ? 198 ASN D O     1 
ATOM   1611 C CB    . ASN D 1 65 ? 25.217 13.065  75.996  1.00 75.18  ? 198 ASN D CB    1 
ATOM   1612 O OXT   . ASN D 1 65 ? 25.065 14.502  78.362  1.00 82.92  ? 198 ASN D OXT   1 
ATOM   1613 O "O5'" . DC  E 2 1  ? 41.547 -19.703 91.221  1.00 140.93 ? 1   DC  E "O5'" 1 
ATOM   1614 C "C5'" . DC  E 2 1  ? 40.338 -18.924 91.132  1.00 144.54 ? 1   DC  E "C5'" 1 
ATOM   1615 C "C4'" . DC  E 2 1  ? 39.840 -18.886 89.704  1.00 151.73 ? 1   DC  E "C4'" 1 
ATOM   1616 O "O4'" . DC  E 2 1  ? 38.584 -19.602 89.599  1.00 158.20 ? 1   DC  E "O4'" 1 
ATOM   1617 C "C3'" . DC  E 2 1  ? 39.550 -17.488 89.151  1.00 142.03 ? 1   DC  E "C3'" 1 
ATOM   1618 O "O3'" . DC  E 2 1  ? 40.688 -16.771 88.634  1.00 135.38 ? 1   DC  E "O3'" 1 
ATOM   1619 C "C2'" . DC  E 2 1  ? 38.450 -17.754 88.139  1.00 138.31 ? 1   DC  E "C2'" 1 
ATOM   1620 C "C1'" . DC  E 2 1  ? 37.646 -18.845 88.834  1.00 143.85 ? 1   DC  E "C1'" 1 
ATOM   1621 N N1    . DC  E 2 1  ? 36.604 -18.344 89.752  1.00 131.59 ? 1   DC  E N1    1 
ATOM   1622 C C2    . DC  E 2 1  ? 35.463 -17.734 89.216  1.00 112.70 ? 1   DC  E C2    1 
ATOM   1623 O O2    . DC  E 2 1  ? 35.357 -17.636 87.985  1.00 94.04  ? 1   DC  E O2    1 
ATOM   1624 N N3    . DC  E 2 1  ? 34.505 -17.272 90.054  1.00 116.83 ? 1   DC  E N3    1 
ATOM   1625 C C4    . DC  E 2 1  ? 34.657 -17.397 91.376  1.00 119.57 ? 1   DC  E C4    1 
ATOM   1626 N N4    . DC  E 2 1  ? 33.689 -16.927 92.165  1.00 115.25 ? 1   DC  E N4    1 
ATOM   1627 C C5    . DC  E 2 1  ? 35.809 -18.011 91.947  1.00 126.64 ? 1   DC  E C5    1 
ATOM   1628 C C6    . DC  E 2 1  ? 36.748 -18.467 91.108  1.00 134.17 ? 1   DC  E C6    1 
ATOM   1629 P P     . DG  E 2 2  ? 41.717 -17.429 87.577  1.00 142.74 ? 2   DG  E P     1 
ATOM   1630 O OP1   . DG  E 2 2  ? 41.206 -18.760 87.163  1.00 132.45 ? 2   DG  E OP1   1 
ATOM   1631 O OP2   . DG  E 2 2  ? 43.087 -17.313 88.139  1.00 150.04 ? 2   DG  E OP2   1 
ATOM   1632 O "O5'" . DG  E 2 2  ? 41.643 -16.429 86.339  1.00 136.52 ? 2   DG  E "O5'" 1 
ATOM   1633 C "C5'" . DG  E 2 2  ? 41.117 -16.847 85.064  1.00 126.14 ? 2   DG  E "C5'" 1 
ATOM   1634 C "C4'" . DG  E 2 2  ? 40.237 -15.766 84.483  1.00 111.32 ? 2   DG  E "C4'" 1 
ATOM   1635 O "O4'" . DG  E 2 2  ? 38.973 -15.712 85.192  1.00 108.85 ? 2   DG  E "O4'" 1 
ATOM   1636 C "C3'" . DG  E 2 2  ? 40.819 -14.353 84.557  1.00 100.29 ? 2   DG  E "C3'" 1 
ATOM   1637 O "O3'" . DG  E 2 2  ? 40.522 -13.701 83.323  1.00 111.79 ? 2   DG  E "O3'" 1 
ATOM   1638 C "C2'" . DG  E 2 2  ? 40.050 -13.723 85.704  1.00 91.46  ? 2   DG  E "C2'" 1 
ATOM   1639 C "C1'" . DG  E 2 2  ? 38.692 -14.356 85.493  1.00 93.14  ? 2   DG  E "C1'" 1 
ATOM   1640 N N9    . DG  E 2 2  ? 37.766 -14.313 86.623  1.00 92.36  ? 2   DG  E N9    1 
ATOM   1641 C C8    . DG  E 2 2  ? 38.068 -14.407 87.961  1.00 94.89  ? 2   DG  E C8    1 
ATOM   1642 N N7    . DG  E 2 2  ? 37.017 -14.317 88.731  1.00 90.35  ? 2   DG  E N7    1 
ATOM   1643 C C5    . DG  E 2 2  ? 35.959 -14.135 87.850  1.00 82.96  ? 2   DG  E C5    1 
ATOM   1644 C C6    . DG  E 2 2  ? 34.570 -13.966 88.100  1.00 77.96  ? 2   DG  E C6    1 
ATOM   1645 O O6    . DG  E 2 2  ? 33.979 -13.942 89.186  1.00 70.95  ? 2   DG  E O6    1 
ATOM   1646 N N1    . DG  E 2 2  ? 33.853 -13.811 86.917  1.00 77.23  ? 2   DG  E N1    1 
ATOM   1647 C C2    . DG  E 2 2  ? 34.399 -13.821 85.656  1.00 76.74  ? 2   DG  E C2    1 
ATOM   1648 N N2    . DG  E 2 2  ? 33.542 -13.660 84.637  1.00 75.32  ? 2   DG  E N2    1 
ATOM   1649 N N3    . DG  E 2 2  ? 35.690 -13.980 85.410  1.00 75.74  ? 2   DG  E N3    1 
ATOM   1650 C C4    . DG  E 2 2  ? 36.406 -14.128 86.545  1.00 84.95  ? 2   DG  E C4    1 
ATOM   1651 P P     . DA  E 2 3  ? 41.400 -12.467 82.813  1.00 136.63 ? 3   DA  E P     1 
ATOM   1652 O OP1   . DA  E 2 3  ? 42.560 -13.010 82.062  1.00 145.13 ? 3   DA  E OP1   1 
ATOM   1653 O OP2   . DA  E 2 3  ? 41.626 -11.545 83.957  1.00 113.73 ? 3   DA  E OP2   1 
ATOM   1654 O "O5'" . DA  E 2 3  ? 40.422 -11.753 81.775  1.00 128.25 ? 3   DA  E "O5'" 1 
ATOM   1655 C "C5'" . DA  E 2 3  ? 39.556 -12.524 80.913  1.00 109.11 ? 3   DA  E "C5'" 1 
ATOM   1656 C "C4'" . DA  E 2 3  ? 38.202 -11.863 80.790  1.00 96.71  ? 3   DA  E "C4'" 1 
ATOM   1657 O "O4'" . DA  E 2 3  ? 37.451 -12.011 82.021  1.00 85.82  ? 3   DA  E "O4'" 1 
ATOM   1658 C "C3'" . DA  E 2 3  ? 38.251 -10.362 80.507  1.00 87.52  ? 3   DA  E "C3'" 1 
ATOM   1659 O "O3'" . DA  E 2 3  ? 37.238 -10.014 79.557  1.00 90.23  ? 3   DA  E "O3'" 1 
ATOM   1660 C "C2'" . DA  E 2 3  ? 37.979 -9.742  81.864  1.00 80.65  ? 3   DA  E "C2'" 1 
ATOM   1661 C "C1'" . DA  E 2 3  ? 37.013 -10.738 82.475  1.00 80.35  ? 3   DA  E "C1'" 1 
ATOM   1662 N N9    . DA  E 2 3  ? 36.994 -10.760 83.940  1.00 77.94  ? 3   DA  E N9    1 
ATOM   1663 C C8    . DA  E 2 3  ? 38.067 -10.876 84.791  1.00 75.73  ? 3   DA  E C8    1 
ATOM   1664 N N7    . DA  E 2 3  ? 37.738 -10.870 86.060  1.00 72.18  ? 3   DA  E N7    1 
ATOM   1665 C C5    . DA  E 2 3  ? 36.357 -10.739 86.046  1.00 67.93  ? 3   DA  E C5    1 
ATOM   1666 C C6    . DA  E 2 3  ? 35.402 -10.666 87.077  1.00 66.27  ? 3   DA  E C6    1 
ATOM   1667 N N6    . DA  E 2 3  ? 35.710 -10.719 88.376  1.00 66.39  ? 3   DA  E N6    1 
ATOM   1668 N N1    . DA  E 2 3  ? 34.105 -10.529 86.724  1.00 62.93  ? 3   DA  E N1    1 
ATOM   1669 C C2    . DA  E 2 3  ? 33.798 -10.471 85.420  1.00 62.77  ? 3   DA  E C2    1 
ATOM   1670 N N3    . DA  E 2 3  ? 34.605 -10.526 84.362  1.00 62.51  ? 3   DA  E N3    1 
ATOM   1671 C C4    . DA  E 2 3  ? 35.885 -10.665 84.747  1.00 66.78  ? 3   DA  E C4    1 
ATOM   1672 P P     . DC  E 2 4  ? 37.539 -8.918  78.432  1.00 92.46  ? 4   DC  E P     1 
ATOM   1673 O OP1   . DC  E 2 4  ? 37.226 -9.514  77.109  1.00 95.48  ? 4   DC  E OP1   1 
ATOM   1674 O OP2   . DC  E 2 4  ? 38.879 -8.322  78.699  1.00 88.22  ? 4   DC  E OP2   1 
ATOM   1675 O "O5'" . DC  E 2 4  ? 36.469 -7.778  78.722  1.00 80.19  ? 4   DC  E "O5'" 1 
ATOM   1676 C "C5'" . DC  E 2 4  ? 36.587 -6.936  79.875  1.00 68.14  ? 4   DC  E "C5'" 1 
ATOM   1677 C "C4'" . DC  E 2 4  ? 35.274 -6.927  80.619  1.00 65.40  ? 4   DC  E "C4'" 1 
ATOM   1678 O "O4'" . DC  E 2 4  ? 35.327 -7.777  81.785  1.00 64.50  ? 4   DC  E "O4'" 1 
ATOM   1679 C "C3'" . DC  E 2 4  ? 34.886 -5.561  81.154  1.00 59.34  ? 4   DC  E "C3'" 1 
ATOM   1680 O "O3'" . DC  E 2 4  ? 34.260 -4.835  80.100  1.00 55.56  ? 4   DC  E "O3'" 1 
ATOM   1681 C "C2'" . DC  E 2 4  ? 33.954 -5.905  82.302  1.00 61.94  ? 4   DC  E "C2'" 1 
ATOM   1682 C "C1'" . DC  E 2 4  ? 34.466 -7.250  82.797  1.00 59.36  ? 4   DC  E "C1'" 1 
ATOM   1683 N N1    . DC  E 2 4  ? 35.209 -7.229  84.073  1.00 54.28  ? 4   DC  E N1    1 
ATOM   1684 C C2    . DC  E 2 4  ? 34.482 -7.194  85.268  1.00 54.75  ? 4   DC  E C2    1 
ATOM   1685 O O2    . DC  E 2 4  ? 33.246 -7.130  85.216  1.00 54.81  ? 4   DC  E O2    1 
ATOM   1686 N N3    . DC  E 2 4  ? 35.144 -7.233  86.449  1.00 50.75  ? 4   DC  E N3    1 
ATOM   1687 C C4    . DC  E 2 4  ? 36.476 -7.302  86.463  1.00 56.80  ? 4   DC  E C4    1 
ATOM   1688 N N4    . DC  E 2 4  ? 37.087 -7.320  87.649  1.00 62.79  ? 4   DC  E N4    1 
ATOM   1689 C C5    . DC  E 2 4  ? 37.243 -7.338  85.260  1.00 58.35  ? 4   DC  E C5    1 
ATOM   1690 C C6    . DC  E 2 4  ? 36.573 -7.312  84.098  1.00 54.69  ? 4   DC  E C6    1 
ATOM   1691 P P     . DT  E 2 5  ? 34.261 -3.239  80.124  1.00 55.07  ? 5   DT  E P     1 
ATOM   1692 O OP1   . DT  E 2 5  ? 33.697 -2.779  78.822  1.00 53.62  ? 5   DT  E OP1   1 
ATOM   1693 O OP2   . DT  E 2 5  ? 35.613 -2.771  80.531  1.00 49.33  ? 5   DT  E OP2   1 
ATOM   1694 O "O5'" . DT  E 2 5  ? 33.213 -2.917  81.280  1.00 52.57  ? 5   DT  E "O5'" 1 
ATOM   1695 C "C5'" . DT  E 2 5  ? 31.879 -3.470  81.271  1.00 53.09  ? 5   DT  E "C5'" 1 
ATOM   1696 C "C4'" . DT  E 2 5  ? 31.165 -3.054  82.534  1.00 55.90  ? 5   DT  E "C4'" 1 
ATOM   1697 O "O4'" . DT  E 2 5  ? 31.810 -3.664  83.674  1.00 50.66  ? 5   DT  E "O4'" 1 
ATOM   1698 C "C3'" . DT  E 2 5  ? 31.203 -1.547  82.767  1.00 55.53  ? 5   DT  E "C3'" 1 
ATOM   1699 O "O3'" . DT  E 2 5  ? 29.903 -0.985  82.908  1.00 68.44  ? 5   DT  E "O3'" 1 
ATOM   1700 C "C2'" . DT  E 2 5  ? 32.051 -1.362  84.012  1.00 51.78  ? 5   DT  E "C2'" 1 
ATOM   1701 C "C1'" . DT  E 2 5  ? 32.033 -2.709  84.698  1.00 48.99  ? 5   DT  E "C1'" 1 
ATOM   1702 N N1    . DT  E 2 5  ? 33.305 -3.064  85.367  1.00 48.79  ? 5   DT  E N1    1 
ATOM   1703 C C2    . DT  E 2 5  ? 33.325 -3.226  86.734  1.00 46.13  ? 5   DT  E C2    1 
ATOM   1704 O O2    . DT  E 2 5  ? 32.345 -3.065  87.440  1.00 52.16  ? 5   DT  E O2    1 
ATOM   1705 N N3    . DT  E 2 5  ? 34.544 -3.584  87.248  1.00 47.24  ? 5   DT  E N3    1 
ATOM   1706 C C4    . DT  E 2 5  ? 35.718 -3.792  86.550  1.00 48.54  ? 5   DT  E C4    1 
ATOM   1707 O O4    . DT  E 2 5  ? 36.737 -4.119  87.153  1.00 49.61  ? 5   DT  E O4    1 
ATOM   1708 C C5    . DT  E 2 5  ? 35.627 -3.596  85.122  1.00 50.61  ? 5   DT  E C5    1 
ATOM   1709 C C7    . DT  E 2 5  ? 36.852 -3.783  84.283  1.00 49.19  ? 5   DT  E C7    1 
ATOM   1710 C C6    . DT  E 2 5  ? 34.442 -3.243  84.610  1.00 49.83  ? 5   DT  E C6    1 
ATOM   1711 P P     . DA  E 2 6  ? 29.739 0.608   82.853  1.00 82.78  ? 6   DA  E P     1 
ATOM   1712 O OP1   . DA  E 2 6  ? 28.731 0.937   81.808  1.00 85.09  ? 6   DA  E OP1   1 
ATOM   1713 O OP2   . DA  E 2 6  ? 31.107 1.222   82.800  1.00 63.46  ? 6   DA  E OP2   1 
ATOM   1714 O "O5'" . DA  E 2 6  ? 29.097 0.964   84.267  1.00 76.51  ? 6   DA  E "O5'" 1 
ATOM   1715 C "C5'" . DA  E 2 6  ? 28.785 -0.028  85.261  1.00 73.83  ? 6   DA  E "C5'" 1 
ATOM   1716 C "C4'" . DA  E 2 6  ? 28.913 0.599   86.628  1.00 74.26  ? 6   DA  E "C4'" 1 
ATOM   1717 O "O4'" . DA  E 2 6  ? 30.148 0.165   87.246  1.00 71.81  ? 6   DA  E "O4'" 1 
ATOM   1718 C "C3'" . DA  E 2 6  ? 28.967 2.127   86.619  1.00 76.67  ? 6   DA  E "C3'" 1 
ATOM   1719 O "O3'" . DA  E 2 6  ? 28.211 2.616   87.729  1.00 89.34  ? 6   DA  E "O3'" 1 
ATOM   1720 C "C2'" . DA  E 2 6  ? 30.457 2.426   86.681  1.00 65.51  ? 6   DA  E "C2'" 1 
ATOM   1721 C "C1'" . DA  E 2 6  ? 30.984 1.278   87.524  1.00 61.25  ? 6   DA  E "C1'" 1 
ATOM   1722 N N9    . DA  E 2 6  ? 32.363 0.869   87.263  1.00 53.04  ? 6   DA  E N9    1 
ATOM   1723 C C8    . DA  E 2 6  ? 33.055 0.875   86.078  1.00 52.39  ? 6   DA  E C8    1 
ATOM   1724 N N7    . DA  E 2 6  ? 34.273 0.399   86.176  1.00 53.74  ? 6   DA  E N7    1 
ATOM   1725 C C5    . DA  E 2 6  ? 34.392 0.061   87.516  1.00 50.28  ? 6   DA  E C5    1 
ATOM   1726 C C6    . DA  E 2 6  ? 35.453 -0.483  88.267  1.00 50.06  ? 6   DA  E C6    1 
ATOM   1727 N N6    . DA  E 2 6  ? 36.645 -0.793  87.750  1.00 45.88  ? 6   DA  E N6    1 
ATOM   1728 N N1    . DA  E 2 6  ? 35.250 -0.684  89.589  1.00 52.13  ? 6   DA  E N1    1 
ATOM   1729 C C2    . DA  E 2 6  ? 34.056 -0.371  90.107  1.00 53.19  ? 6   DA  E C2    1 
ATOM   1730 N N3    . DA  E 2 6  ? 32.980 0.135   89.503  1.00 56.62  ? 6   DA  E N3    1 
ATOM   1731 C C4    . DA  E 2 6  ? 33.220 0.335   88.195  1.00 53.66  ? 6   DA  E C4    1 
ATOM   1732 P P     . DA  E 2 7  ? 28.029 4.182   87.961  1.00 92.62  ? 7   DA  E P     1 
ATOM   1733 O OP1   . DA  E 2 7  ? 26.601 4.427   88.283  1.00 93.14  ? 7   DA  E OP1   1 
ATOM   1734 O OP2   . DA  E 2 7  ? 28.659 4.906   86.820  1.00 82.36  ? 7   DA  E OP2   1 
ATOM   1735 O "O5'" . DA  E 2 7  ? 28.887 4.422   89.281  1.00 74.93  ? 7   DA  E "O5'" 1 
ATOM   1736 C "C5'" . DA  E 2 7  ? 28.815 3.483   90.364  1.00 71.39  ? 7   DA  E "C5'" 1 
ATOM   1737 C "C4'" . DA  E 2 7  ? 30.027 3.615   91.255  1.00 70.35  ? 7   DA  E "C4'" 1 
ATOM   1738 O "O4'" . DA  E 2 7  ? 31.191 3.052   90.609  1.00 62.14  ? 7   DA  E "O4'" 1 
ATOM   1739 C "C3'" . DA  E 2 7  ? 30.403 5.049   91.642  1.00 76.88  ? 7   DA  E "C3'" 1 
ATOM   1740 O "O3'" . DA  E 2 7  ? 30.345 5.129   93.072  1.00 81.37  ? 7   DA  E "O3'" 1 
ATOM   1741 C "C2'" . DA  E 2 7  ? 31.801 5.238   91.065  1.00 63.66  ? 7   DA  E "C2'" 1 
ATOM   1742 C "C1'" . DA  E 2 7  ? 32.318 3.815   90.986  1.00 59.96  ? 7   DA  E "C1'" 1 
ATOM   1743 N N9    . DA  E 2 7  ? 33.381 3.572   90.006  1.00 56.76  ? 7   DA  E N9    1 
ATOM   1744 C C8    . DA  E 2 7  ? 33.354 3.798   88.650  1.00 53.63  ? 7   DA  E C8    1 
ATOM   1745 N N7    . DA  E 2 7  ? 34.469 3.472   88.039  1.00 56.10  ? 7   DA  E N7    1 
ATOM   1746 C C5    . DA  E 2 7  ? 35.281 2.992   89.058  1.00 48.09  ? 7   DA  E C5    1 
ATOM   1747 C C6    . DA  E 2 7  ? 36.593 2.476   89.065  1.00 48.11  ? 7   DA  E C6    1 
ATOM   1748 N N6    . DA  E 2 7  ? 37.352 2.360   87.972  1.00 50.66  ? 7   DA  E N6    1 
ATOM   1749 N N1    . DA  E 2 7  ? 37.100 2.063   90.248  1.00 44.71  ? 7   DA  E N1    1 
ATOM   1750 C C2    . DA  E 2 7  ? 36.343 2.185   91.346  1.00 49.14  ? 7   DA  E C2    1 
ATOM   1751 N N3    . DA  E 2 7  ? 35.100 2.651   91.466  1.00 51.70  ? 7   DA  E N3    1 
ATOM   1752 C C4    . DA  E 2 7  ? 34.620 3.039   90.273  1.00 49.94  ? 7   DA  E C4    1 
ATOM   1753 P P     . DT  E 2 8  ? 30.675 6.503   93.845  1.00 88.18  ? 8   DT  E P     1 
ATOM   1754 O OP1   . DT  E 2 8  ? 29.856 6.522   95.086  1.00 104.23 ? 8   DT  E OP1   1 
ATOM   1755 O OP2   . DT  E 2 8  ? 30.565 7.629   92.878  1.00 79.45  ? 8   DT  E OP2   1 
ATOM   1756 O "O5'" . DT  E 2 8  ? 32.211 6.332   94.236  1.00 69.51  ? 8   DT  E "O5'" 1 
ATOM   1757 C "C5'" . DT  E 2 8  ? 32.674 5.126   94.876  1.00 67.16  ? 8   DT  E "C5'" 1 
ATOM   1758 C "C4'" . DT  E 2 8  ? 34.182 5.119   94.967  1.00 66.28  ? 8   DT  E "C4'" 1 
ATOM   1759 O "O4'" . DT  E 2 8  ? 34.769 4.907   93.665  1.00 59.34  ? 8   DT  E "O4'" 1 
ATOM   1760 C "C3'" . DT  E 2 8  ? 34.804 6.410   95.504  1.00 69.35  ? 8   DT  E "C3'" 1 
ATOM   1761 O "O3'" . DT  E 2 8  ? 35.520 6.086   96.695  1.00 74.17  ? 8   DT  E "O3'" 1 
ATOM   1762 C "C2'" . DT  E 2 8  ? 35.711 6.896   94.381  1.00 61.55  ? 8   DT  E "C2'" 1 
ATOM   1763 C "C1'" . DT  E 2 8  ? 35.992 5.623   93.614  1.00 64.30  ? 8   DT  E "C1'" 1 
ATOM   1764 N N1    . DT  E 2 8  ? 36.386 5.765   92.180  1.00 50.91  ? 8   DT  E N1    1 
ATOM   1765 C C2    . DT  E 2 8  ? 37.608 5.267   91.785  1.00 47.24  ? 8   DT  E C2    1 
ATOM   1766 O O2    . DT  E 2 8  ? 38.401 4.752   92.556  1.00 47.26  ? 8   DT  E O2    1 
ATOM   1767 N N3    . DT  E 2 8  ? 37.870 5.391   90.442  1.00 44.18  ? 8   DT  E N3    1 
ATOM   1768 C C4    . DT  E 2 8  ? 37.058 5.962   89.481  1.00 48.43  ? 8   DT  E C4    1 
ATOM   1769 O O4    . DT  E 2 8  ? 37.432 6.004   88.313  1.00 41.13  ? 8   DT  E O4    1 
ATOM   1770 C C5    . DT  E 2 8  ? 35.784 6.450   89.963  1.00 52.53  ? 8   DT  E C5    1 
ATOM   1771 C C7    . DT  E 2 8  ? 34.837 7.085   88.995  1.00 52.29  ? 8   DT  E C7    1 
ATOM   1772 C C6    . DT  E 2 8  ? 35.516 6.329   91.270  1.00 50.04  ? 8   DT  E C6    1 
ATOM   1773 P P     . DT  E 2 9  ? 35.968 7.239   97.683  1.00 83.84  ? 9   DT  E P     1 
ATOM   1774 O OP1   . DT  E 2 9  ? 35.607 6.827   99.071  1.00 74.84  ? 9   DT  E OP1   1 
ATOM   1775 O OP2   . DT  E 2 9  ? 35.459 8.525   97.139  1.00 79.91  ? 9   DT  E OP2   1 
ATOM   1776 O "O5'" . DT  E 2 9  ? 37.552 7.234   97.518  1.00 67.02  ? 9   DT  E "O5'" 1 
ATOM   1777 C "C5'" . DT  E 2 9  ? 38.282 6.000   97.560  1.00 63.96  ? 9   DT  E "C5'" 1 
ATOM   1778 C "C4'" . DT  E 2 9  ? 39.646 6.190   96.945  1.00 61.41  ? 9   DT  E "C4'" 1 
ATOM   1779 O "O4'" . DT  E 2 9  ? 39.552 6.285   95.500  1.00 61.32  ? 9   DT  E "O4'" 1 
ATOM   1780 C "C3'" . DT  E 2 9  ? 40.384 7.452   97.393  1.00 60.96  ? 9   DT  E "C3'" 1 
ATOM   1781 O "O3'" . DT  E 2 9  ? 41.698 7.035   97.739  1.00 63.36  ? 9   DT  E "O3'" 1 
ATOM   1782 C "C2'" . DT  E 2 9  ? 40.402 8.329   96.150  1.00 61.54  ? 9   DT  E "C2'" 1 
ATOM   1783 C "C1'" . DT  E 2 9  ? 40.460 7.280   95.067  1.00 55.89  ? 9   DT  E "C1'" 1 
ATOM   1784 N N1    . DT  E 2 9  ? 40.053 7.692   93.714  1.00 52.36  ? 9   DT  E N1    1 
ATOM   1785 C C2    . DT  E 2 9  ? 40.849 7.321   92.653  1.00 53.83  ? 9   DT  E C2    1 
ATOM   1786 O O2    . DT  E 2 9  ? 41.911 6.725   92.787  1.00 46.45  ? 9   DT  E O2    1 
ATOM   1787 N N3    . DT  E 2 9  ? 40.372 7.700   91.421  1.00 44.31  ? 9   DT  E N3    1 
ATOM   1788 C C4    . DT  E 2 9  ? 39.196 8.376   91.153  1.00 45.57  ? 9   DT  E C4    1 
ATOM   1789 O O4    . DT  E 2 9  ? 38.893 8.641   89.992  1.00 42.32  ? 9   DT  E O4    1 
ATOM   1790 C C5    . DT  E 2 9  ? 38.405 8.725   92.317  1.00 46.85  ? 9   DT  E C5    1 
ATOM   1791 C C7    . DT  E 2 9  ? 37.120 9.467   92.129  1.00 52.70  ? 9   DT  E C7    1 
ATOM   1792 C C6    . DT  E 2 9  ? 38.862 8.358   93.520  1.00 51.37  ? 9   DT  E C6    1 
ATOM   1793 P P     . DA  E 2 10 ? 42.663 8.017   98.509  1.00 76.78  ? 10  DA  E P     1 
ATOM   1794 O OP1   . DA  E 2 10 ? 43.480 7.203   99.439  1.00 66.92  ? 10  DA  E OP1   1 
ATOM   1795 O OP2   . DA  E 2 10 ? 41.859 9.159   99.006  1.00 68.46  ? 10  DA  E OP2   1 
ATOM   1796 O "O5'" . DA  E 2 10 ? 43.596 8.563   97.344  1.00 71.80  ? 10  DA  E "O5'" 1 
ATOM   1797 C "C5'" . DA  E 2 10 ? 44.570 7.703   96.746  1.00 63.75  ? 10  DA  E "C5'" 1 
ATOM   1798 C "C4'" . DA  E 2 10 ? 45.171 8.397   95.551  1.00 57.90  ? 10  DA  E "C4'" 1 
ATOM   1799 O "O4'" . DA  E 2 10 ? 44.137 8.653   94.561  1.00 52.02  ? 10  DA  E "O4'" 1 
ATOM   1800 C "C3'" . DA  E 2 10 ? 45.818 9.753   95.856  1.00 54.56  ? 10  DA  E "C3'" 1 
ATOM   1801 O "O3'" . DA  E 2 10 ? 47.029 9.863   95.103  1.00 55.24  ? 10  DA  E "O3'" 1 
ATOM   1802 C "C2'" . DA  E 2 10 ? 44.817 10.745  95.293  1.00 51.13  ? 10  DA  E "C2'" 1 
ATOM   1803 C "C1'" . DA  E 2 10 ? 44.324 9.967   94.081  1.00 47.19  ? 10  DA  E "C1'" 1 
ATOM   1804 N N9    . DA  E 2 10 ? 43.071 10.432  93.483  1.00 46.52  ? 10  DA  E N9    1 
ATOM   1805 C C8    . DA  E 2 10 ? 41.947 10.922  94.102  1.00 47.33  ? 10  DA  E C8    1 
ATOM   1806 N N7    . DA  E 2 10 ? 41.005 11.294  93.266  1.00 49.00  ? 10  DA  E N7    1 
ATOM   1807 C C5    . DA  E 2 10 ? 41.549 11.041  92.014  1.00 44.35  ? 10  DA  E C5    1 
ATOM   1808 C C6    . DA  E 2 10 ? 41.049 11.214  90.710  1.00 42.77  ? 10  DA  E C6    1 
ATOM   1809 N N6    . DA  E 2 10 ? 39.841 11.710  90.438  1.00 44.64  ? 10  DA  E N6    1 
ATOM   1810 N N1    . DA  E 2 10 ? 41.855 10.879  89.678  1.00 37.92  ? 10  DA  E N1    1 
ATOM   1811 C C2    . DA  E 2 10 ? 43.065 10.375  89.948  1.00 40.33  ? 10  DA  E C2    1 
ATOM   1812 N N3    . DA  E 2 10 ? 43.639 10.148  91.130  1.00 43.18  ? 10  DA  E N3    1 
ATOM   1813 C C4    . DA  E 2 10 ? 42.820 10.508  92.133  1.00 43.34  ? 10  DA  E C4    1 
ATOM   1814 P P     . DG  E 2 11 ? 48.350 10.498  95.721  1.00 67.95  ? 11  DG  E P     1 
ATOM   1815 O OP1   . DG  E 2 11 ? 48.993 9.478   96.600  1.00 64.66  ? 11  DG  E OP1   1 
ATOM   1816 O OP2   . DG  E 2 11 ? 48.024 11.848  96.256  1.00 59.11  ? 11  DG  E OP2   1 
ATOM   1817 O "O5'" . DG  E 2 11 ? 49.253 10.714  94.427  1.00 61.68  ? 11  DG  E "O5'" 1 
ATOM   1818 C "C5'" . DG  E 2 11 ? 49.672 9.597   93.625  1.00 55.34  ? 11  DG  E "C5'" 1 
ATOM   1819 C "C4'" . DG  E 2 11 ? 49.871 10.035  92.193  1.00 51.71  ? 11  DG  E "C4'" 1 
ATOM   1820 O "O4'" . DG  E 2 11 ? 48.595 10.376  91.608  1.00 45.84  ? 11  DG  E "O4'" 1 
ATOM   1821 C "C3'" . DG  E 2 11 ? 50.749 11.273  92.022  1.00 46.62  ? 11  DG  E "C3'" 1 
ATOM   1822 O "O3'" . DG  E 2 11 ? 51.549 11.038  90.866  1.00 51.67  ? 11  DG  E "O3'" 1 
ATOM   1823 C "C2'" . DG  E 2 11 ? 49.741 12.399  91.882  1.00 45.25  ? 11  DG  E "C2'" 1 
ATOM   1824 C "C1'" . DG  E 2 11 ? 48.625 11.701  91.122  1.00 44.03  ? 11  DG  E "C1'" 1 
ATOM   1825 N N9    . DG  E 2 11 ? 47.284 12.248  91.273  1.00 42.70  ? 11  DG  E N9    1 
ATOM   1826 C C8    . DG  E 2 11 ? 46.557 12.380  92.431  1.00 42.58  ? 11  DG  E C8    1 
ATOM   1827 N N7    . DG  E 2 11 ? 45.362 12.868  92.232  1.00 40.55  ? 11  DG  E N7    1 
ATOM   1828 C C5    . DG  E 2 11 ? 45.272 13.003  90.851  1.00 42.50  ? 11  DG  E C5    1 
ATOM   1829 C C6    . DG  E 2 11 ? 44.211 13.489  90.040  1.00 41.21  ? 11  DG  E C6    1 
ATOM   1830 O O6    . DG  E 2 11 ? 43.087 13.876  90.389  1.00 43.00  ? 11  DG  E O6    1 
ATOM   1831 N N1    . DG  E 2 11 ? 44.539 13.447  88.688  1.00 38.25  ? 11  DG  E N1    1 
ATOM   1832 C C2    . DG  E 2 11 ? 45.753 13.047  88.183  1.00 37.96  ? 11  DG  E C2    1 
ATOM   1833 N N2    . DG  E 2 11 ? 45.895 13.122  86.854  1.00 40.67  ? 11  DG  E N2    1 
ATOM   1834 N N3    . DG  E 2 11 ? 46.760 12.619  88.930  1.00 40.15  ? 11  DG  E N3    1 
ATOM   1835 C C4    . DG  E 2 11 ? 46.453 12.632  90.246  1.00 42.65  ? 11  DG  E C4    1 
ATOM   1836 P P     . DT  E 2 12 ? 52.593 12.129  90.361  1.00 69.06  ? 12  DT  E P     1 
ATOM   1837 O OP1   . DT  E 2 12 ? 53.713 11.411  89.706  1.00 77.37  ? 12  DT  E OP1   1 
ATOM   1838 O OP2   . DT  E 2 12 ? 52.852 13.072  91.479  1.00 70.06  ? 12  DT  E OP2   1 
ATOM   1839 O "O5'" . DT  E 2 12 ? 51.839 12.859  89.165  1.00 58.92  ? 12  DT  E "O5'" 1 
ATOM   1840 C "C5'" . DT  E 2 12 ? 51.198 12.074  88.144  1.00 60.70  ? 12  DT  E "C5'" 1 
ATOM   1841 C "C4'" . DT  E 2 12 ? 51.033 12.869  86.870  1.00 57.23  ? 12  DT  E "C4'" 1 
ATOM   1842 O "O4'" . DT  E 2 12 ? 49.732 13.494  86.872  1.00 58.52  ? 12  DT  E "O4'" 1 
ATOM   1843 C "C3'" . DT  E 2 12 ? 52.031 14.004  86.639  1.00 55.64  ? 12  DT  E "C3'" 1 
ATOM   1844 O "O3'" . DT  E 2 12 ? 52.248 14.065  85.217  1.00 59.03  ? 12  DT  E "O3'" 1 
ATOM   1845 C "C2'" . DT  E 2 12 ? 51.324 15.197  87.266  1.00 54.12  ? 12  DT  E "C2'" 1 
ATOM   1846 C "C1'" . DT  E 2 12 ? 49.855 14.909  86.953  1.00 52.54  ? 12  DT  E "C1'" 1 
ATOM   1847 N N1    . DT  E 2 12 ? 48.823 15.378  87.902  1.00 48.74  ? 12  DT  E N1    1 
ATOM   1848 C C2    . DT  E 2 12 ? 47.638 15.823  87.358  1.00 45.88  ? 12  DT  E C2    1 
ATOM   1849 O O2    . DT  E 2 12 ? 47.448 15.912  86.156  1.00 49.09  ? 12  DT  E O2    1 
ATOM   1850 N N3    . DT  E 2 12 ? 46.688 16.188  88.277  1.00 48.43  ? 12  DT  E N3    1 
ATOM   1851 C C4    . DT  E 2 12 ? 46.793 16.131  89.654  1.00 45.70  ? 12  DT  E C4    1 
ATOM   1852 O O4    . DT  E 2 12 ? 45.845 16.473  90.353  1.00 47.59  ? 12  DT  E O4    1 
ATOM   1853 C C5    . DT  E 2 12 ? 48.056 15.639  90.158  1.00 46.43  ? 12  DT  E C5    1 
ATOM   1854 C C7    . DT  E 2 12 ? 48.260 15.555  91.638  1.00 46.78  ? 12  DT  E C7    1 
ATOM   1855 C C6    . DT  E 2 12 ? 48.990 15.274  89.269  1.00 49.28  ? 12  DT  E C6    1 
ATOM   1856 P P     . DC  E 2 13 ? 53.324 15.079  84.572  1.00 64.89  ? 13  DC  E P     1 
ATOM   1857 O OP1   . DC  E 2 13 ? 53.746 14.536  83.256  1.00 60.57  ? 13  DC  E OP1   1 
ATOM   1858 O OP2   . DC  E 2 13 ? 54.347 15.381  85.604  1.00 56.76  ? 13  DC  E OP2   1 
ATOM   1859 O "O5'" . DC  E 2 13 ? 52.457 16.393  84.316  1.00 54.43  ? 13  DC  E "O5'" 1 
ATOM   1860 C "C5'" . DC  E 2 13 ? 51.370 16.388  83.362  1.00 57.37  ? 13  DC  E "C5'" 1 
ATOM   1861 C "C4'" . DC  E 2 13 ? 50.634 17.708  83.376  1.00 56.61  ? 13  DC  E "C4'" 1 
ATOM   1862 O "O4'" . DC  E 2 13 ? 49.818 17.805  84.572  1.00 54.22  ? 13  DC  E "O4'" 1 
ATOM   1863 C "C3'" . DC  E 2 13 ? 51.530 18.950  83.373  1.00 59.61  ? 13  DC  E "C3'" 1 
ATOM   1864 O "O3'" . DC  E 2 13 ? 51.026 19.917  82.445  1.00 62.38  ? 13  DC  E "O3'" 1 
ATOM   1865 C "C2'" . DC  E 2 13 ? 51.406 19.477  84.792  1.00 54.37  ? 13  DC  E "C2'" 1 
ATOM   1866 C "C1'" . DC  E 2 13 ? 49.970 19.104  85.108  1.00 52.55  ? 13  DC  E "C1'" 1 
ATOM   1867 N N1    . DC  E 2 13 ? 49.593 19.064  86.535  1.00 53.88  ? 13  DC  E N1    1 
ATOM   1868 C C2    . DC  E 2 13 ? 48.273 19.358  86.888  1.00 49.34  ? 13  DC  E C2    1 
ATOM   1869 O O2    . DC  E 2 13 ? 47.465 19.640  85.996  1.00 48.74  ? 13  DC  E O2    1 
ATOM   1870 N N3    . DC  E 2 13 ? 47.915 19.336  88.194  1.00 54.49  ? 13  DC  E N3    1 
ATOM   1871 C C4    . DC  E 2 13 ? 48.819 19.023  89.127  1.00 56.38  ? 13  DC  E C4    1 
ATOM   1872 N N4    . DC  E 2 13 ? 48.422 19.003  90.402  1.00 54.52  ? 13  DC  E N4    1 
ATOM   1873 C C5    . DC  E 2 13 ? 50.169 18.713  88.794  1.00 55.79  ? 13  DC  E C5    1 
ATOM   1874 C C6    . DC  E 2 13 ? 50.509 18.742  87.498  1.00 52.79  ? 13  DC  E C6    1 
ATOM   1875 P P     . DG  E 2 14 ? 51.999 20.617  81.382  1.00 81.92  ? 14  DG  E P     1 
ATOM   1876 O OP1   . DG  E 2 14 ? 52.441 19.582  80.412  1.00 80.97  ? 14  DG  E OP1   1 
ATOM   1877 O OP2   . DG  E 2 14 ? 53.008 21.425  82.123  1.00 62.73  ? 14  DG  E OP2   1 
ATOM   1878 O "O5'" . DG  E 2 14 ? 51.018 21.606  80.608  1.00 67.07  ? 14  DG  E "O5'" 1 
ATOM   1879 C "C5'" . DG  E 2 14 ? 49.809 21.107  79.999  1.00 72.24  ? 14  DG  E "C5'" 1 
ATOM   1880 C "C4'" . DG  E 2 14 ? 48.632 21.984  80.361  1.00 67.71  ? 14  DG  E "C4'" 1 
ATOM   1881 O "O4'" . DG  E 2 14 ? 48.309 21.817  81.765  1.00 65.52  ? 14  DG  E "O4'" 1 
ATOM   1882 C "C3'" . DG  E 2 14 ? 48.858 23.485  80.151  1.00 70.72  ? 14  DG  E "C3'" 1 
ATOM   1883 O "O3'" . DG  E 2 14 ? 47.727 24.068  79.495  1.00 69.44  ? 14  DG  E "O3'" 1 
ATOM   1884 C "C2'" . DG  E 2 14 ? 49.030 24.024  81.562  1.00 68.25  ? 14  DG  E "C2'" 1 
ATOM   1885 C "C1'" . DG  E 2 14 ? 48.141 23.092  82.366  1.00 64.04  ? 14  DG  E "C1'" 1 
ATOM   1886 N N9    . DG  E 2 14 ? 48.483 22.969  83.781  1.00 67.53  ? 14  DG  E N9    1 
ATOM   1887 C C8    . DG  E 2 14 ? 49.720 22.675  84.305  1.00 60.14  ? 14  DG  E C8    1 
ATOM   1888 N N7    . DG  E 2 14 ? 49.720 22.597  85.608  1.00 51.89  ? 14  DG  E N7    1 
ATOM   1889 C C5    . DG  E 2 14 ? 48.405 22.857  85.968  1.00 53.16  ? 14  DG  E C5    1 
ATOM   1890 C C6    . DG  E 2 14 ? 47.803 22.933  87.250  1.00 53.08  ? 14  DG  E C6    1 
ATOM   1891 O O6    . DG  E 2 14 ? 48.329 22.773  88.358  1.00 57.41  ? 14  DG  E O6    1 
ATOM   1892 N N1    . DG  E 2 14 ? 46.447 23.228  87.162  1.00 52.83  ? 14  DG  E N1    1 
ATOM   1893 C C2    . DG  E 2 14 ? 45.757 23.433  85.992  1.00 55.07  ? 14  DG  E C2    1 
ATOM   1894 N N2    . DG  E 2 14 ? 44.450 23.705  86.117  1.00 56.49  ? 14  DG  E N2    1 
ATOM   1895 N N3    . DG  E 2 14 ? 46.308 23.376  84.790  1.00 60.47  ? 14  DG  E N3    1 
ATOM   1896 C C4    . DG  E 2 14 ? 47.627 23.087  84.853  1.00 57.17  ? 14  DG  E C4    1 
ATOM   1897 O "O5'" . DC  F 2 1  ? 42.317 25.820  95.470  1.00 88.82  ? 1   DC  F "O5'" 1 
ATOM   1898 C "C5'" . DC  F 2 1  ? 41.491 24.828  94.833  1.00 88.82  ? 1   DC  F "C5'" 1 
ATOM   1899 C "C4'" . DC  F 2 1  ? 40.985 25.338  93.503  1.00 86.95  ? 1   DC  F "C4'" 1 
ATOM   1900 O "O4'" . DC  F 2 1  ? 42.086 25.534  92.583  1.00 81.15  ? 1   DC  F "O4'" 1 
ATOM   1901 C "C3'" . DC  F 2 1  ? 40.020 24.397  92.791  1.00 80.78  ? 1   DC  F "C3'" 1 
ATOM   1902 O "O3'" . DC  F 2 1  ? 39.045 25.163  92.075  1.00 83.34  ? 1   DC  F "O3'" 1 
ATOM   1903 C "C2'" . DC  F 2 1  ? 40.937 23.604  91.880  1.00 76.29  ? 1   DC  F "C2'" 1 
ATOM   1904 C "C1'" . DC  F 2 1  ? 41.997 24.625  91.491  1.00 77.52  ? 1   DC  F "C1'" 1 
ATOM   1905 N N1    . DC  F 2 1  ? 43.339 24.056  91.271  1.00 72.19  ? 1   DC  F N1    1 
ATOM   1906 C C2    . DC  F 2 1  ? 43.850 23.966  89.967  1.00 64.23  ? 1   DC  F C2    1 
ATOM   1907 O O2    . DC  F 2 1  ? 43.154 24.361  89.018  1.00 64.27  ? 1   DC  F O2    1 
ATOM   1908 N N3    . DC  F 2 1  ? 45.088 23.449  89.778  1.00 60.56  ? 1   DC  F N3    1 
ATOM   1909 C C4    . DC  F 2 1  ? 45.806 23.035  90.828  1.00 63.42  ? 1   DC  F C4    1 
ATOM   1910 N N4    . DC  F 2 1  ? 47.018 22.526  90.599  1.00 58.33  ? 1   DC  F N4    1 
ATOM   1911 C C5    . DC  F 2 1  ? 45.309 23.116  92.161  1.00 66.49  ? 1   DC  F C5    1 
ATOM   1912 C C6    . DC  F 2 1  ? 44.085 23.630  92.336  1.00 70.16  ? 1   DC  F C6    1 
ATOM   1913 P P     . DG  F 2 2  ? 37.648 24.504  91.662  1.00 87.26  ? 2   DG  F P     1 
ATOM   1914 O OP1   . DG  F 2 2  ? 36.771 25.574  91.124  1.00 86.90  ? 2   DG  F OP1   1 
ATOM   1915 O OP2   . DG  F 2 2  ? 37.179 23.657  92.792  1.00 82.33  ? 2   DG  F OP2   1 
ATOM   1916 O "O5'" . DG  F 2 2  ? 38.052 23.577  90.431  1.00 81.87  ? 2   DG  F "O5'" 1 
ATOM   1917 C "C5'" . DG  F 2 2  ? 38.523 24.166  89.202  1.00 77.63  ? 2   DG  F "C5'" 1 
ATOM   1918 C "C4'" . DG  F 2 2  ? 38.873 23.090  88.201  1.00 69.76  ? 2   DG  F "C4'" 1 
ATOM   1919 O "O4'" . DG  F 2 2  ? 40.236 22.644  88.408  1.00 64.22  ? 2   DG  F "O4'" 1 
ATOM   1920 C "C3'" . DG  F 2 2  ? 38.016 21.829  88.287  1.00 67.64  ? 2   DG  F "C3'" 1 
ATOM   1921 O "O3'" . DG  F 2 2  ? 37.969 21.256  86.992  1.00 69.26  ? 2   DG  F "O3'" 1 
ATOM   1922 C "C2'" . DG  F 2 2  ? 38.860 20.900  89.132  1.00 63.18  ? 2   DG  F "C2'" 1 
ATOM   1923 C "C1'" . DG  F 2 2  ? 40.237 21.241  88.601  1.00 58.07  ? 2   DG  F "C1'" 1 
ATOM   1924 N N9    . DG  F 2 2  ? 41.355 20.899  89.471  1.00 61.85  ? 2   DG  F N9    1 
ATOM   1925 C C8    . DG  F 2 2  ? 41.349 20.745  90.837  1.00 63.30  ? 2   DG  F C8    1 
ATOM   1926 N N7    . DG  F 2 2  ? 42.514 20.404  91.318  1.00 60.37  ? 2   DG  F N7    1 
ATOM   1927 C C5    . DG  F 2 2  ? 43.332 20.307  90.201  1.00 55.03  ? 2   DG  F C5    1 
ATOM   1928 C C6    . DG  F 2 2  ? 44.704 19.970  90.093  1.00 54.40  ? 2   DG  F C6    1 
ATOM   1929 O O6    . DG  F 2 2  ? 45.499 19.675  90.994  1.00 54.84  ? 2   DG  F O6    1 
ATOM   1930 N N1    . DG  F 2 2  ? 45.134 20.000  88.771  1.00 46.23  ? 2   DG  F N1    1 
ATOM   1931 C C2    . DG  F 2 2  ? 44.346 20.304  87.690  1.00 49.70  ? 2   DG  F C2    1 
ATOM   1932 N N2    . DG  F 2 2  ? 44.945 20.281  86.495  1.00 50.52  ? 2   DG  F N2    1 
ATOM   1933 N N3    . DG  F 2 2  ? 43.071 20.639  87.779  1.00 48.94  ? 2   DG  F N3    1 
ATOM   1934 C C4    . DG  F 2 2  ? 42.631 20.610  89.054  1.00 51.83  ? 2   DG  F C4    1 
ATOM   1935 P P     . DA  F 2 3  ? 36.637 20.614  86.445  1.00 74.05  ? 3   DA  F P     1 
ATOM   1936 O OP1   . DA  F 2 3  ? 35.718 21.718  86.104  1.00 65.25  ? 3   DA  F OP1   1 
ATOM   1937 O OP2   . DA  F 2 3  ? 36.211 19.556  87.391  1.00 69.98  ? 3   DA  F OP2   1 
ATOM   1938 O "O5'" . DA  F 2 3  ? 37.136 19.967  85.077  1.00 65.49  ? 3   DA  F "O5'" 1 
ATOM   1939 C "C5'" . DA  F 2 3  ? 37.793 20.793  84.092  1.00 59.67  ? 3   DA  F "C5'" 1 
ATOM   1940 C "C4'" . DA  F 2 3  ? 38.719 19.968  83.231  1.00 52.78  ? 3   DA  F "C4'" 1 
ATOM   1941 O "O4'" . DA  F 2 3  ? 39.925 19.649  83.958  1.00 52.35  ? 3   DA  F "O4'" 1 
ATOM   1942 C "C3'" . DA  F 2 3  ? 38.142 18.634  82.771  1.00 49.45  ? 3   DA  F "C3'" 1 
ATOM   1943 O "O3'" . DA  F 2 3  ? 38.599 18.424  81.430  1.00 50.45  ? 3   DA  F "O3'" 1 
ATOM   1944 C "C2'" . DA  F 2 3  ? 38.680 17.658  83.798  1.00 45.18  ? 3   DA  F "C2'" 1 
ATOM   1945 C "C1'" . DA  F 2 3  ? 40.039 18.249  84.137  1.00 46.88  ? 3   DA  F "C1'" 1 
ATOM   1946 N N9    . DA  F 2 3  ? 40.496 18.011  85.502  1.00 46.47  ? 3   DA  F N9    1 
ATOM   1947 C C8    . DA  F 2 3  ? 39.768 18.079  86.664  1.00 46.93  ? 3   DA  F C8    1 
ATOM   1948 N N7    . DA  F 2 3  ? 40.463 17.799  87.741  1.00 46.04  ? 3   DA  F N7    1 
ATOM   1949 C C5    . DA  F 2 3  ? 41.739 17.548  87.257  1.00 41.46  ? 3   DA  F C5    1 
ATOM   1950 C C6    . DA  F 2 3  ? 42.940 17.201  87.897  1.00 42.11  ? 3   DA  F C6    1 
ATOM   1951 N N6    . DA  F 2 3  ? 43.054 17.043  89.216  1.00 42.41  ? 3   DA  F N6    1 
ATOM   1952 N N1    . DA  F 2 3  ? 44.031 17.010  87.124  1.00 40.60  ? 3   DA  F N1    1 
ATOM   1953 C C2    . DA  F 2 3  ? 43.911 17.156  85.798  1.00 43.25  ? 3   DA  F C2    1 
ATOM   1954 N N3    . DA  F 2 3  ? 42.839 17.486  85.081  1.00 40.31  ? 3   DA  F N3    1 
ATOM   1955 C C4    . DA  F 2 3  ? 41.771 17.662  85.879  1.00 45.78  ? 3   DA  F C4    1 
ATOM   1956 P P     . DC  F 2 4  ? 38.172 17.120  80.618  1.00 50.87  ? 4   DC  F P     1 
ATOM   1957 O OP1   . DC  F 2 4  ? 38.156 17.480  79.179  1.00 50.52  ? 4   DC  F OP1   1 
ATOM   1958 O OP2   . DC  F 2 4  ? 36.952 16.542  81.241  1.00 45.82  ? 4   DC  F OP2   1 
ATOM   1959 O "O5'" . DC  F 2 4  ? 39.370 16.107  80.936  1.00 44.75  ? 4   DC  F "O5'" 1 
ATOM   1960 C "C5'" . DC  F 2 4  ? 40.727 16.445  80.624  1.00 44.27  ? 4   DC  F "C5'" 1 
ATOM   1961 C "C4'" . DC  F 2 4  ? 41.672 15.428  81.220  1.00 43.61  ? 4   DC  F "C4'" 1 
ATOM   1962 O "O4'" . DC  F 2 4  ? 41.681 15.543  82.656  1.00 37.83  ? 4   DC  F "O4'" 1 
ATOM   1963 C "C3'" . DC  F 2 4  ? 41.354 13.956  80.912  1.00 37.95  ? 4   DC  F "C3'" 1 
ATOM   1964 O "O3'" . DC  F 2 4  ? 42.425 13.484  80.071  1.00 36.49  ? 4   DC  F "O3'" 1 
ATOM   1965 C "C2'" . DC  F 2 4  ? 41.204 13.315  82.286  1.00 37.93  ? 4   DC  F "C2'" 1 
ATOM   1966 C "C1'" . DC  F 2 4  ? 41.976 14.271  83.171  1.00 37.57  ? 4   DC  F "C1'" 1 
ATOM   1967 N N1    . DC  F 2 4  ? 41.641 14.270  84.601  1.00 40.35  ? 4   DC  F N1    1 
ATOM   1968 C C2    . DC  F 2 4  ? 42.668 14.054  85.531  1.00 35.81  ? 4   DC  F C2    1 
ATOM   1969 O O2    . DC  F 2 4  ? 43.822 13.857  85.120  1.00 37.51  ? 4   DC  F O2    1 
ATOM   1970 N N3    . DC  F 2 4  ? 42.379 14.075  86.850  1.00 31.83  ? 4   DC  F N3    1 
ATOM   1971 C C4    . DC  F 2 4  ? 41.125 14.279  87.256  1.00 40.10  ? 4   DC  F C4    1 
ATOM   1972 N N4    . DC  F 2 4  ? 40.885 14.265  88.571  1.00 39.69  ? 4   DC  F N4    1 
ATOM   1973 C C5    . DC  F 2 4  ? 40.061 14.506  86.335  1.00 38.21  ? 4   DC  F C5    1 
ATOM   1974 C C6    . DC  F 2 4  ? 40.360 14.490  85.028  1.00 40.18  ? 4   DC  F C6    1 
ATOM   1975 P P     . DT  F 2 5  ? 42.414 12.041  79.372  1.00 36.64  ? 5   DT  F P     1 
ATOM   1976 O OP1   . DT  F 2 5  ? 43.452 12.058  78.300  1.00 34.18  ? 5   DT  F OP1   1 
ATOM   1977 O OP2   . DT  F 2 5  ? 41.013 11.651  79.070  1.00 35.36  ? 5   DT  F OP2   1 
ATOM   1978 O "O5'" . DT  F 2 5  ? 42.893 11.070  80.526  1.00 34.61  ? 5   DT  F "O5'" 1 
ATOM   1979 C "C5'" . DT  F 2 5  ? 44.194 11.297  81.098  1.00 35.68  ? 5   DT  F "C5'" 1 
ATOM   1980 C "C4'" . DT  F 2 5  ? 44.405 10.373  82.268  1.00 30.70  ? 5   DT  F "C4'" 1 
ATOM   1981 O "O4'" . DT  F 2 5  ? 43.707 10.847  83.457  1.00 29.70  ? 5   DT  F "O4'" 1 
ATOM   1982 C "C3'" . DT  F 2 5  ? 43.930 8.934   82.023  1.00 32.28  ? 5   DT  F "C3'" 1 
ATOM   1983 O "O3'" . DT  F 2 5  ? 44.863 7.981   82.578  1.00 32.38  ? 5   DT  F "O3'" 1 
ATOM   1984 C "C2'" . DT  F 2 5  ? 42.670 8.835   82.852  1.00 30.24  ? 5   DT  F "C2'" 1 
ATOM   1985 C "C1'" . DT  F 2 5  ? 43.056 9.721   84.031  1.00 29.15  ? 5   DT  F "C1'" 1 
ATOM   1986 N N1    . DT  F 2 5  ? 41.998 10.201  84.914  1.00 33.51  ? 5   DT  F N1    1 
ATOM   1987 C C2    . DT  F 2 5  ? 42.353 10.427  86.228  1.00 36.19  ? 5   DT  F C2    1 
ATOM   1988 O O2    . DT  F 2 5  ? 43.480 10.246  86.651  1.00 34.48  ? 5   DT  F O2    1 
ATOM   1989 N N3    . DT  F 2 5  ? 41.334 10.864  87.028  1.00 34.70  ? 5   DT  F N3    1 
ATOM   1990 C C4    . DT  F 2 5  ? 40.033 11.126  86.650  1.00 41.78  ? 5   DT  F C4    1 
ATOM   1991 O O4    . DT  F 2 5  ? 39.232 11.530  87.479  1.00 39.14  ? 5   DT  F O4    1 
ATOM   1992 C C5    . DT  F 2 5  ? 39.730 10.877  85.254  1.00 36.72  ? 5   DT  F C5    1 
ATOM   1993 C C7    . DT  F 2 5  ? 38.340 11.113  84.755  1.00 40.32  ? 5   DT  F C7    1 
ATOM   1994 C C6    . DT  F 2 5  ? 40.719 10.441  84.465  1.00 37.86  ? 5   DT  F C6    1 
ATOM   1995 P P     . DA  F 2 6  ? 45.800 7.095   81.677  1.00 31.18  ? 6   DA  F P     1 
ATOM   1996 O OP1   . DA  F 2 6  ? 46.648 7.969   80.814  1.00 31.54  ? 6   DA  F OP1   1 
ATOM   1997 O OP2   . DA  F 2 6  ? 45.004 5.977   81.064  1.00 31.30  ? 6   DA  F OP2   1 
ATOM   1998 O "O5'" . DA  F 2 6  ? 46.681 6.364   82.812  1.00 29.41  ? 6   DA  F "O5'" 1 
ATOM   1999 C "C5'" . DA  F 2 6  ? 47.631 7.124   83.592  1.00 37.22  ? 6   DA  F "C5'" 1 
ATOM   2000 C "C4'" . DA  F 2 6  ? 47.838 6.476   84.941  1.00 31.64  ? 6   DA  F "C4'" 1 
ATOM   2001 O "O4'" . DA  F 2 6  ? 46.752 6.883   85.812  1.00 32.07  ? 6   DA  F "O4'" 1 
ATOM   2002 C "C3'" . DA  F 2 6  ? 47.806 4.947   84.930  1.00 35.02  ? 6   DA  F "C3'" 1 
ATOM   2003 O "O3'" . DA  F 2 6  ? 48.735 4.447   85.897  1.00 37.07  ? 6   DA  F "O3'" 1 
ATOM   2004 C "C2'" . DA  F 2 6  ? 46.365 4.630   85.286  1.00 34.30  ? 6   DA  F "C2'" 1 
ATOM   2005 C "C1'" . DA  F 2 6  ? 46.030 5.749   86.252  1.00 29.65  ? 6   DA  F "C1'" 1 
ATOM   2006 N N9    . DA  F 2 6  ? 44.629 6.129   86.291  1.00 32.06  ? 6   DA  F N9    1 
ATOM   2007 C C8    . DA  F 2 6  ? 43.814 6.374   85.212  1.00 31.09  ? 6   DA  F C8    1 
ATOM   2008 N N7    . DA  F 2 6  ? 42.609 6.770   85.542  1.00 34.78  ? 6   DA  F N7    1 
ATOM   2009 C C5    . DA  F 2 6  ? 42.659 6.862   86.926  1.00 31.26  ? 6   DA  F C5    1 
ATOM   2010 C C6    . DA  F 2 6  ? 41.701 7.229   87.878  1.00 31.75  ? 6   DA  F C6    1 
ATOM   2011 N N6    . DA  F 2 6  ? 40.462 7.615   87.568  1.00 31.54  ? 6   DA  F N6    1 
ATOM   2012 N N1    . DA  F 2 6  ? 42.056 7.171   89.181  1.00 36.31  ? 6   DA  F N1    1 
ATOM   2013 C C2    . DA  F 2 6  ? 43.305 6.788   89.493  1.00 36.57  ? 6   DA  F C2    1 
ATOM   2014 N N3    . DA  F 2 6  ? 44.297 6.427   88.687  1.00 33.55  ? 6   DA  F N3    1 
ATOM   2015 C C4    . DA  F 2 6  ? 43.906 6.492   87.398  1.00 32.11  ? 6   DA  F C4    1 
ATOM   2016 P P     . DA  F 2 7  ? 48.877 2.889   86.215  1.00 41.30  ? 7   DA  F P     1 
ATOM   2017 O OP1   . DA  F 2 7  ? 50.308 2.631   86.448  1.00 39.78  ? 7   DA  F OP1   1 
ATOM   2018 O OP2   . DA  F 2 7  ? 48.141 2.035   85.202  1.00 34.60  ? 7   DA  F OP2   1 
ATOM   2019 O "O5'" . DA  F 2 7  ? 48.040 2.722   87.543  1.00 39.44  ? 7   DA  F "O5'" 1 
ATOM   2020 C "C5'" . DA  F 2 7  ? 48.485 3.382   88.747  1.00 42.52  ? 7   DA  F "C5'" 1 
ATOM   2021 C "C4'" . DA  F 2 7  ? 47.518 3.056   89.853  1.00 41.99  ? 7   DA  F "C4'" 1 
ATOM   2022 O "O4'" . DA  F 2 7  ? 46.238 3.637   89.531  1.00 37.06  ? 7   DA  F "O4'" 1 
ATOM   2023 C "C3'" . DA  F 2 7  ? 47.276 1.560   90.079  1.00 48.63  ? 7   DA  F "C3'" 1 
ATOM   2024 O "O3'" . DA  F 2 7  ? 47.536 1.281   91.464  1.00 51.03  ? 7   DA  F "O3'" 1 
ATOM   2025 C "C2'" . DA  F 2 7  ? 45.830 1.347   89.664  1.00 45.33  ? 7   DA  F "C2'" 1 
ATOM   2026 C "C1'" . DA  F 2 7  ? 45.219 2.724   89.851  1.00 43.00  ? 7   DA  F "C1'" 1 
ATOM   2027 N N9    . DA  F 2 7  ? 44.084 3.012   88.992  1.00 39.98  ? 7   DA  F N9    1 
ATOM   2028 C C8    . DA  F 2 7  ? 44.022 2.908   87.620  1.00 33.74  ? 7   DA  F C8    1 
ATOM   2029 N N7    . DA  F 2 7  ? 42.856 3.232   87.121  1.00 34.41  ? 7   DA  F N7    1 
ATOM   2030 C C5    . DA  F 2 7  ? 42.104 3.594   88.230  1.00 35.42  ? 7   DA  F C5    1 
ATOM   2031 C C6    . DA  F 2 7  ? 40.774 4.034   88.370  1.00 36.90  ? 7   DA  F C6    1 
ATOM   2032 N N6    . DA  F 2 7  ? 39.945 4.214   87.345  1.00 35.51  ? 7   DA  F N6    1 
ATOM   2033 N N1    . DA  F 2 7  ? 40.326 4.299   89.620  1.00 38.25  ? 7   DA  F N1    1 
ATOM   2034 C C2    . DA  F 2 7  ? 41.166 4.121   90.650  1.00 36.92  ? 7   DA  F C2    1 
ATOM   2035 N N3    . DA  F 2 7  ? 42.435 3.714   90.644  1.00 39.06  ? 7   DA  F N3    1 
ATOM   2036 C C4    . DA  F 2 7  ? 42.843 3.448   89.391  1.00 41.15  ? 7   DA  F C4    1 
ATOM   2037 P P     . DT  F 2 8  ? 47.207 -0.148  92.098  1.00 51.50  ? 8   DT  F P     1 
ATOM   2038 O OP1   . DT  F 2 8  ? 48.094 -0.306  93.299  1.00 56.02  ? 8   DT  F OP1   1 
ATOM   2039 O OP2   . DT  F 2 8  ? 47.224 -1.166  91.035  1.00 52.06  ? 8   DT  F OP2   1 
ATOM   2040 O "O5'" . DT  F 2 8  ? 45.733 0.040   92.667  1.00 52.77  ? 8   DT  F "O5'" 1 
ATOM   2041 C "C5'" . DT  F 2 8  ? 45.559 0.914   93.792  1.00 52.71  ? 8   DT  F "C5'" 1 
ATOM   2042 C "C4'" . DT  F 2 8  ? 44.136 0.883   94.288  1.00 56.99  ? 8   DT  F "C4'" 1 
ATOM   2043 O "O4'" . DT  F 2 8  ? 43.252 1.306   93.233  1.00 53.30  ? 8   DT  F "O4'" 1 
ATOM   2044 C "C3'" . DT  F 2 8  ? 43.638 -0.489  94.739  1.00 59.83  ? 8   DT  F "C3'" 1 
ATOM   2045 O "O3'" . DT  F 2 8  ? 43.069 -0.351  96.040  1.00 61.27  ? 8   DT  F "O3'" 1 
ATOM   2046 C "C2'" . DT  F 2 8  ? 42.601 -0.872  93.697  1.00 52.84  ? 8   DT  F "C2'" 1 
ATOM   2047 C "C1'" . DT  F 2 8  ? 42.113 0.477   93.231  1.00 49.63  ? 8   DT  F "C1'" 1 
ATOM   2048 N N1    . DT  F 2 8  ? 41.557 0.506   91.874  1.00 47.68  ? 8   DT  F N1    1 
ATOM   2049 C C2    . DT  F 2 8  ? 40.288 1.004   91.725  1.00 46.18  ? 8   DT  F C2    1 
ATOM   2050 O O2    . DT  F 2 8  ? 39.611 1.388   92.662  1.00 45.67  ? 8   DT  F O2    1 
ATOM   2051 N N3    . DT  F 2 8  ? 39.835 1.037   90.432  1.00 42.43  ? 8   DT  F N3    1 
ATOM   2052 C C4    . DT  F 2 8  ? 40.513 0.630   89.300  1.00 44.61  ? 8   DT  F C4    1 
ATOM   2053 O O4    . DT  F 2 8  ? 39.978 0.726   88.203  1.00 42.78  ? 8   DT  F O4    1 
ATOM   2054 C C5    . DT  F 2 8  ? 41.845 0.126   89.527  1.00 43.99  ? 8   DT  F C5    1 
ATOM   2055 C C7    . DT  F 2 8  ? 42.654 -0.340  88.359  1.00 41.38  ? 8   DT  F C7    1 
ATOM   2056 C C6    . DT  F 2 8  ? 42.300 0.099   90.788  1.00 41.63  ? 8   DT  F C6    1 
ATOM   2057 P P     . DT  F 2 9  ? 42.507 -1.626  96.793  1.00 63.43  ? 9   DT  F P     1 
ATOM   2058 O OP1   . DT  F 2 9  ? 42.756 -1.443  98.244  1.00 65.67  ? 9   DT  F OP1   1 
ATOM   2059 O OP2   . DT  F 2 9  ? 43.005 -2.844  96.085  1.00 56.91  ? 9   DT  F OP2   1 
ATOM   2060 O "O5'" . DT  F 2 9  ? 40.941 -1.472  96.601  1.00 55.35  ? 9   DT  F "O5'" 1 
ATOM   2061 C "C5'" . DT  F 2 9  ? 40.291 -0.267  97.012  1.00 55.61  ? 9   DT  F "C5'" 1 
ATOM   2062 C "C4'" . DT  F 2 9  ? 38.826 -0.422  96.706  1.00 61.43  ? 9   DT  F "C4'" 1 
ATOM   2063 O "O4'" . DT  F 2 9  ? 38.637 -0.376  95.271  1.00 56.64  ? 9   DT  F "O4'" 1 
ATOM   2064 C "C3'" . DT  F 2 9  ? 38.267 -1.768  97.163  1.00 62.94  ? 9   DT  F "C3'" 1 
ATOM   2065 O "O3'" . DT  F 2 9  ? 37.052 -1.527  97.861  1.00 74.98  ? 9   DT  F "O3'" 1 
ATOM   2066 C "C2'" . DT  F 2 9  ? 38.062 -2.545  95.873  1.00 63.73  ? 9   DT  F "C2'" 1 
ATOM   2067 C "C1'" . DT  F 2 9  ? 37.775 -1.431  94.889  1.00 57.58  ? 9   DT  F "C1'" 1 
ATOM   2068 N N1    . DT  F 2 9  ? 38.019 -1.707  93.460  1.00 51.77  ? 9   DT  F N1    1 
ATOM   2069 C C2    . DT  F 2 9  ? 37.072 -1.270  92.562  1.00 50.75  ? 9   DT  F C2    1 
ATOM   2070 O O2    . DT  F 2 9  ? 36.025 -0.741  92.901  1.00 53.77  ? 9   DT  F O2    1 
ATOM   2071 N N3    . DT  F 2 9  ? 37.385 -1.497  91.244  1.00 50.45  ? 9   DT  F N3    1 
ATOM   2072 C C4    . DT  F 2 9  ? 38.534 -2.081  90.748  1.00 46.49  ? 9   DT  F C4    1 
ATOM   2073 O O4    . DT  F 2 9  ? 38.676 -2.215  89.536  1.00 48.89  ? 9   DT  F O4    1 
ATOM   2074 C C5    . DT  F 2 9  ? 39.489 -2.509  91.744  1.00 48.40  ? 9   DT  F C5    1 
ATOM   2075 C C7    . DT  F 2 9  ? 40.761 -3.157  91.297  1.00 45.00  ? 9   DT  F C7    1 
ATOM   2076 C C6    . DT  F 2 9  ? 39.201 -2.277  93.032  1.00 51.58  ? 9   DT  F C6    1 
ATOM   2077 P P     . DA  F 2 10 ? 36.390 -2.687  98.711  1.00 82.70  ? 10  DA  F P     1 
ATOM   2078 O OP1   . DA  F 2 10 ? 36.199 -2.185  100.093 1.00 79.66  ? 10  DA  F OP1   1 
ATOM   2079 O OP2   . DA  F 2 10 ? 37.153 -3.940  98.470  1.00 76.08  ? 10  DA  F OP2   1 
ATOM   2080 O "O5'" . DA  F 2 10 ? 34.973 -2.835  98.010  1.00 81.41  ? 10  DA  F "O5'" 1 
ATOM   2081 C "C5'" . DA  F 2 10 ? 34.271 -1.683  97.524  1.00 79.47  ? 10  DA  F "C5'" 1 
ATOM   2082 C "C4'" . DA  F 2 10 ? 33.106 -2.160  96.697  1.00 76.87  ? 10  DA  F "C4'" 1 
ATOM   2083 O "O4'" . DA  F 2 10 ? 33.541 -2.312  95.326  1.00 77.70  ? 10  DA  F "O4'" 1 
ATOM   2084 C "C3'" . DA  F 2 10 ? 32.574 -3.526  97.132  1.00 82.58  ? 10  DA  F "C3'" 1 
ATOM   2085 O "O3'" . DA  F 2 10 ? 31.153 -3.413  97.251  1.00 88.05  ? 10  DA  F "O3'" 1 
ATOM   2086 C "C2'" . DA  F 2 10 ? 33.153 -4.482  96.097  1.00 78.92  ? 10  DA  F "C2'" 1 
ATOM   2087 C "C1'" . DA  F 2 10 ? 33.233 -3.613  94.859  1.00 70.13  ? 10  DA  F "C1'" 1 
ATOM   2088 N N9    . DA  F 2 10 ? 34.244 -3.978  93.866  1.00 61.78  ? 10  DA  F N9    1 
ATOM   2089 C C8    . DA  F 2 10 ? 35.523 -4.436  94.066  1.00 59.84  ? 10  DA  F C8    1 
ATOM   2090 N N7    . DA  F 2 10 ? 36.193 -4.636  92.955  1.00 58.88  ? 10  DA  F N7    1 
ATOM   2091 C C5    . DA  F 2 10 ? 35.297 -4.278  91.957  1.00 54.20  ? 10  DA  F C5    1 
ATOM   2092 C C6    . DA  F 2 10 ? 35.395 -4.269  90.552  1.00 53.10  ? 10  DA  F C6    1 
ATOM   2093 N N6    . DA  F 2 10 ? 36.489 -4.640  89.882  1.00 50.72  ? 10  DA  F N6    1 
ATOM   2094 N N1    . DA  F 2 10 ? 34.317 -3.854  89.850  1.00 51.83  ? 10  DA  F N1    1 
ATOM   2095 C C2    . DA  F 2 10 ? 33.219 -3.481  90.521  1.00 51.85  ? 10  DA  F C2    1 
ATOM   2096 N N3    . DA  F 2 10 ? 33.003 -3.456  91.834  1.00 56.59  ? 10  DA  F N3    1 
ATOM   2097 C C4    . DA  F 2 10 ? 34.096 -3.863  92.503  1.00 56.21  ? 10  DA  F C4    1 
ATOM   2098 P P     . DG  F 2 11 ? 30.234 -4.707  97.245  1.00 102.05 ? 11  DG  F P     1 
ATOM   2099 O OP1   . DG  F 2 11 ? 28.949 -4.361  97.902  1.00 108.55 ? 11  DG  F OP1   1 
ATOM   2100 O OP2   . DG  F 2 11 ? 31.035 -5.855  97.747  1.00 104.98 ? 11  DG  F OP2   1 
ATOM   2101 O "O5'" . DG  F 2 11 ? 29.943 -4.889  95.694  1.00 102.38 ? 11  DG  F "O5'" 1 
ATOM   2102 C "C5'" . DG  F 2 11 ? 29.449 -3.779  94.922  1.00 94.43  ? 11  DG  F "C5'" 1 
ATOM   2103 C "C4'" . DG  F 2 11 ? 28.926 -4.296  93.606  1.00 92.80  ? 11  DG  F "C4'" 1 
ATOM   2104 O "O4'" . DG  F 2 11 ? 30.046 -4.520  92.714  1.00 87.27  ? 11  DG  F "O4'" 1 
ATOM   2105 C "C3'" . DG  F 2 11 ? 28.200 -5.636  93.741  1.00 96.78  ? 11  DG  F "C3'" 1 
ATOM   2106 O "O3'" . DG  F 2 11 ? 26.949 -5.623  93.054  1.00 101.09 ? 11  DG  F "O3'" 1 
ATOM   2107 C "C2'" . DG  F 2 11 ? 29.202 -6.646  93.209  1.00 93.50  ? 11  DG  F "C2'" 1 
ATOM   2108 C "C1'" . DG  F 2 11 ? 29.999 -5.842  92.205  1.00 83.79  ? 11  DG  F "C1'" 1 
ATOM   2109 N N9    . DG  F 2 11 ? 31.368 -6.320  92.032  1.00 70.72  ? 11  DG  F N9    1 
ATOM   2110 C C8    . DG  F 2 11 ? 32.229 -6.747  93.014  1.00 68.17  ? 11  DG  F C8    1 
ATOM   2111 N N7    . DG  F 2 11 ? 33.375 -7.159  92.546  1.00 62.69  ? 11  DG  F N7    1 
ATOM   2112 C C5    . DG  F 2 11 ? 33.256 -7.017  91.170  1.00 57.05  ? 11  DG  F C5    1 
ATOM   2113 C C6    . DG  F 2 11 ? 34.182 -7.309  90.131  1.00 55.76  ? 11  DG  F C6    1 
ATOM   2114 O O6    . DG  F 2 11 ? 35.330 -7.760  90.226  1.00 58.47  ? 11  DG  F O6    1 
ATOM   2115 N N1    . DG  F 2 11 ? 33.657 -7.005  88.878  1.00 52.50  ? 11  DG  F N1    1 
ATOM   2116 C C2    . DG  F 2 11 ? 32.394 -6.510  88.650  1.00 54.94  ? 11  DG  F C2    1 
ATOM   2117 N N2    . DG  F 2 11 ? 32.062 -6.294  87.370  1.00 54.76  ? 11  DG  F N2    1 
ATOM   2118 N N3    . DG  F 2 11 ? 31.524 -6.233  89.610  1.00 58.82  ? 11  DG  F N3    1 
ATOM   2119 C C4    . DG  F 2 11 ? 32.019 -6.511  90.836  1.00 62.69  ? 11  DG  F C4    1 
ATOM   2120 P P     . DT  F 2 12 ? 26.191 -6.999  92.759  1.00 124.80 ? 12  DT  F P     1 
ATOM   2121 O OP1   . DT  F 2 12 ? 24.731 -6.734  92.797  1.00 139.58 ? 12  DT  F OP1   1 
ATOM   2122 O OP2   . DT  F 2 12 ? 26.763 -8.051  93.643  1.00 109.34 ? 12  DT  F OP2   1 
ATOM   2123 O "O5'" . DT  F 2 12 ? 26.608 -7.298  91.251  1.00 114.74 ? 12  DT  F "O5'" 1 
ATOM   2124 C "C5'" . DT  F 2 12 ? 26.584 -6.240  90.272  1.00 99.59  ? 12  DT  F "C5'" 1 
ATOM   2125 C "C4'" . DT  F 2 12 ? 26.857 -6.788  88.890  1.00 90.18  ? 12  DT  F "C4'" 1 
ATOM   2126 O "O4'" . DT  F 2 12 ? 28.250 -7.160  88.775  1.00 75.90  ? 12  DT  F "O4'" 1 
ATOM   2127 C "C3'" . DT  F 2 12 ? 26.057 -8.038  88.523  1.00 91.56  ? 12  DT  F "C3'" 1 
ATOM   2128 O "O3'" . DT  F 2 12 ? 25.617 -7.921  87.168  1.00 99.11  ? 12  DT  F "O3'" 1 
ATOM   2129 C "C2'" . DT  F 2 12 ? 27.063 -9.162  88.694  1.00 84.62  ? 12  DT  F "C2'" 1 
ATOM   2130 C "C1'" . DT  F 2 12 ? 28.339 -8.475  88.256  1.00 74.01  ? 12  DT  F "C1'" 1 
ATOM   2131 N N1    . DT  F 2 12 ? 29.600 -9.068  88.741  1.00 69.92  ? 12  DT  F N1    1 
ATOM   2132 C C2    . DT  F 2 12 ? 30.584 -9.345  87.818  1.00 64.82  ? 12  DT  F C2    1 
ATOM   2133 O O2    . DT  F 2 12 ? 30.449 -9.152  86.620  1.00 67.88  ? 12  DT  F O2    1 
ATOM   2134 N N3    . DT  F 2 12 ? 31.738 -9.864  88.350  1.00 60.07  ? 12  DT  F N3    1 
ATOM   2135 C C4    . DT  F 2 12 ? 31.996 -10.135 89.681  1.00 62.49  ? 12  DT  F C4    1 
ATOM   2136 O O4    . DT  F 2 12 ? 33.079 -10.612 90.008  1.00 62.38  ? 12  DT  F O4    1 
ATOM   2137 C C5    . DT  F 2 12 ? 30.925 -9.810  90.595  1.00 64.26  ? 12  DT  F C5    1 
ATOM   2138 C C7    . DT  F 2 12 ? 31.119 -10.059 92.058  1.00 67.42  ? 12  DT  F C7    1 
ATOM   2139 C C6    . DT  F 2 12 ? 29.798 -9.293  90.088  1.00 69.76  ? 12  DT  F C6    1 
ATOM   2140 P P     . DC  F 2 13 ? 24.555 -8.948  86.584  1.00 106.48 ? 13  DC  F P     1 
ATOM   2141 O OP1   . DC  F 2 13 ? 23.623 -8.189  85.714  1.00 107.13 ? 13  DC  F OP1   1 
ATOM   2142 O OP2   . DC  F 2 13 ? 24.013 -9.741  87.716  1.00 112.94 ? 13  DC  F OP2   1 
ATOM   2143 O "O5'" . DC  F 2 13 ? 25.458 -9.920  85.698  1.00 113.09 ? 13  DC  F "O5'" 1 
ATOM   2144 C "C5'" . DC  F 2 13 ? 25.695 -9.663  84.296  1.00 107.35 ? 13  DC  F "C5'" 1 
ATOM   2145 C "C4'" . DC  F 2 13 ? 26.671 -10.668 83.725  1.00 98.07  ? 13  DC  F "C4'" 1 
ATOM   2146 O "O4'" . DC  F 2 13 ? 27.774 -10.831 84.643  1.00 87.77  ? 13  DC  F "O4'" 1 
ATOM   2147 C "C3'" . DC  F 2 13 ? 26.094 -12.068 83.478  1.00 101.51 ? 13  DC  F "C3'" 1 
ATOM   2148 O "O3'" . DC  F 2 13 ? 26.099 -12.415 82.086  1.00 102.68 ? 13  DC  F "O3'" 1 
ATOM   2149 C "C2'" . DC  F 2 13 ? 26.983 -13.004 84.283  1.00 96.27  ? 13  DC  F "C2'" 1 
ATOM   2150 C "C1'" . DC  F 2 13 ? 28.211 -12.174 84.621  1.00 85.60  ? 13  DC  F "C1'" 1 
ATOM   2151 N N1    . DC  F 2 13 ? 28.825 -12.471 85.931  1.00 75.00  ? 13  DC  F N1    1 
ATOM   2152 C C2    . DC  F 2 13 ? 30.187 -12.796 85.982  1.00 70.59  ? 13  DC  F C2    1 
ATOM   2153 O O2    . DC  F 2 13 ? 30.836 -12.828 84.927  1.00 72.92  ? 13  DC  F O2    1 
ATOM   2154 N N3    . DC  F 2 13 ? 30.759 -13.064 87.179  1.00 66.79  ? 13  DC  F N3    1 
ATOM   2155 C C4    . DC  F 2 13 ? 30.029 -13.006 88.295  1.00 65.97  ? 13  DC  F C4    1 
ATOM   2156 N N4    . DC  F 2 13 ? 30.635 -13.277 89.452  1.00 65.03  ? 13  DC  F N4    1 
ATOM   2157 C C5    . DC  F 2 13 ? 28.641 -12.676 88.273  1.00 71.39  ? 13  DC  F C5    1 
ATOM   2158 C C6    . DC  F 2 13 ? 28.085 -12.417 87.080  1.00 73.09  ? 13  DC  F C6    1 
HETATM 2159 O O     . HOH G 3 .  ? 45.888 11.113  77.408  1.00 35.62  ? 201 HOH A O     1 
HETATM 2160 O O     . HOH G 3 .  ? 38.317 20.282  56.410  1.00 33.14  ? 202 HOH A O     1 
HETATM 2161 O O     . HOH G 3 .  ? 51.150 20.157  58.740  1.00 34.27  ? 203 HOH A O     1 
HETATM 2162 O O     . HOH G 3 .  ? 33.672 21.070  57.107  1.00 35.53  ? 204 HOH A O     1 
HETATM 2163 O O     . HOH G 3 .  ? 41.195 10.414  58.538  1.00 36.21  ? 205 HOH A O     1 
HETATM 2164 O O     . HOH G 3 .  ? 57.114 19.697  60.430  1.00 40.40  ? 206 HOH A O     1 
HETATM 2165 O O     . HOH G 3 .  ? 61.083 15.891  57.112  1.00 42.14  ? 207 HOH A O     1 
HETATM 2166 O O     . HOH G 3 .  ? 30.230 19.637  64.522  1.00 30.50  ? 208 HOH A O     1 
HETATM 2167 O O     . HOH G 3 .  ? 41.332 21.041  74.628  1.00 35.51  ? 209 HOH A O     1 
HETATM 2168 O O     . HOH G 3 .  ? 43.950 29.470  60.797  1.00 48.87  ? 210 HOH A O     1 
HETATM 2169 O O     . HOH G 3 .  ? 42.220 11.218  54.976  1.00 36.50  ? 211 HOH A O     1 
HETATM 2170 O O     . HOH G 3 .  ? 47.582 12.002  79.300  1.00 32.62  ? 212 HOH A O     1 
HETATM 2171 O O     . HOH G 3 .  ? 30.694 19.102  72.786  1.00 40.18  ? 213 HOH A O     1 
HETATM 2172 O O     . HOH G 3 .  ? 63.631 15.915  56.008  1.00 65.01  ? 214 HOH A O     1 
HETATM 2173 O O     . HOH G 3 .  ? 47.434 19.339  77.379  1.00 47.58  ? 215 HOH A O     1 
HETATM 2174 O O     . HOH G 3 .  ? 48.812 22.614  63.417  1.00 41.80  ? 216 HOH A O     1 
HETATM 2175 O O     . HOH G 3 .  ? 41.168 27.288  73.924  1.00 43.14  ? 217 HOH A O     1 
HETATM 2176 O O     . HOH G 3 .  ? 35.163 27.169  61.017  1.00 45.22  ? 218 HOH A O     1 
HETATM 2177 O O     . HOH G 3 .  ? 38.378 9.309   64.860  1.00 37.13  ? 219 HOH A O     1 
HETATM 2178 O O     . HOH G 3 .  ? 47.468 28.955  58.517  1.00 45.13  ? 220 HOH A O     1 
HETATM 2179 O O     . HOH G 3 .  ? 44.162 29.259  57.724  1.00 44.52  ? 221 HOH A O     1 
HETATM 2180 O O     . HOH G 3 .  ? 30.305 17.148  66.125  1.00 37.30  ? 222 HOH A O     1 
HETATM 2181 O O     . HOH G 3 .  ? 28.367 16.389  67.524  1.00 43.23  ? 223 HOH A O     1 
HETATM 2182 O O     . HOH G 3 .  ? 36.674 5.355   67.146  1.00 44.03  ? 224 HOH A O     1 
HETATM 2183 O O     . HOH G 3 .  ? 65.655 18.396  56.854  1.00 41.44  ? 225 HOH A O     1 
HETATM 2184 O O     . HOH G 3 .  ? 61.857 20.330  60.406  1.00 44.59  ? 226 HOH A O     1 
HETATM 2185 O O     . HOH G 3 .  ? 53.185 18.855  57.880  1.00 44.72  ? 227 HOH A O     1 
HETATM 2186 O O     . HOH G 3 .  ? 55.388 14.813  52.170  1.00 45.74  ? 228 HOH A O     1 
HETATM 2187 O O     . HOH G 3 .  ? 49.864 20.337  70.726  1.00 43.33  ? 229 HOH A O     1 
HETATM 2188 O O     . HOH G 3 .  ? 30.520 9.484   67.481  1.00 51.97  ? 230 HOH A O     1 
HETATM 2189 O O     . HOH G 3 .  ? 57.322 22.393  61.649  1.00 49.69  ? 231 HOH A O     1 
HETATM 2190 O O     . HOH G 3 .  ? 38.199 6.320   64.362  1.00 45.54  ? 232 HOH A O     1 
HETATM 2191 O O     . HOH G 3 .  ? 50.983 22.914  64.969  1.00 42.62  ? 233 HOH A O     1 
HETATM 2192 O O     . HOH G 3 .  ? 51.809 15.723  54.959  1.00 49.12  ? 234 HOH A O     1 
HETATM 2193 O O     . HOH G 3 .  ? 48.851 27.243  66.961  1.00 48.82  ? 235 HOH A O     1 
HETATM 2194 O O     . HOH G 3 .  ? 49.989 21.221  61.368  1.00 42.36  ? 236 HOH A O     1 
HETATM 2195 O O     . HOH G 3 .  ? 49.871 13.128  78.390  1.00 52.07  ? 237 HOH A O     1 
HETATM 2196 O O     . HOH G 3 .  ? 58.482 15.050  66.177  1.00 48.81  ? 238 HOH A O     1 
HETATM 2197 O O     . HOH G 3 .  ? 57.959 17.525  67.488  1.00 52.32  ? 239 HOH A O     1 
HETATM 2198 O O     . HOH G 3 .  ? 60.508 18.646  68.155  1.00 43.48  ? 240 HOH A O     1 
HETATM 2199 O O     . HOH G 3 .  ? 60.632 19.178  70.994  1.00 47.40  ? 241 HOH A O     1 
HETATM 2200 O O     . HOH G 3 .  ? 41.783 18.886  76.035  1.00 51.45  ? 242 HOH A O     1 
HETATM 2201 O O     . HOH G 3 .  ? 41.575 30.111  74.890  1.00 58.02  ? 243 HOH A O     1 
HETATM 2202 O O     . HOH G 3 .  ? 27.048 14.495  66.878  1.00 47.12  ? 244 HOH A O     1 
HETATM 2203 O O     . HOH G 3 .  ? 31.258 10.784  65.112  1.00 49.25  ? 245 HOH A O     1 
HETATM 2204 O O     . HOH G 3 .  ? 41.713 25.738  49.880  1.00 50.92  ? 246 HOH A O     1 
HETATM 2205 O O     . HOH G 3 .  ? 34.957 19.581  53.544  1.00 56.34  ? 247 HOH A O     1 
HETATM 2206 O O     . HOH G 3 .  ? 53.587 10.469  67.560  1.00 56.41  ? 248 HOH A O     1 
HETATM 2207 O O     . HOH G 3 .  ? 52.816 11.593  63.720  1.00 40.49  ? 249 HOH A O     1 
HETATM 2208 O O     . HOH G 3 .  ? 60.886 18.687  57.269  1.00 56.01  ? 250 HOH A O     1 
HETATM 2209 O O     . HOH G 3 .  ? 56.700 20.544  55.751  1.00 50.18  ? 251 HOH A O     1 
HETATM 2210 O O     . HOH G 3 .  ? 59.299 19.661  55.379  1.00 50.66  ? 252 HOH A O     1 
HETATM 2211 O O     . HOH G 3 .  ? 59.617 14.516  55.460  1.00 62.64  ? 253 HOH A O     1 
HETATM 2212 O O     . HOH G 3 .  ? 28.726 17.154  72.093  1.00 49.03  ? 254 HOH A O     1 
HETATM 2213 O O     . HOH G 3 .  ? 62.910 22.879  59.215  1.00 53.29  ? 255 HOH A O     1 
HETATM 2214 O O     . HOH G 3 .  ? 36.532 15.168  73.067  1.00 42.61  ? 256 HOH A O     1 
HETATM 2215 O O     . HOH G 3 .  ? 57.253 23.628  55.320  1.00 58.44  ? 257 HOH A O     1 
HETATM 2216 O O     . HOH G 3 .  ? 36.916 28.647  62.710  1.00 52.52  ? 258 HOH A O     1 
HETATM 2217 O O     . HOH G 3 .  ? 39.658 33.399  70.002  1.00 45.02  ? 259 HOH A O     1 
HETATM 2218 O O     . HOH G 3 .  ? 42.672 34.604  66.256  1.00 58.84  ? 260 HOH A O     1 
HETATM 2219 O O     . HOH G 3 .  ? 54.151 20.706  67.153  1.00 52.01  ? 261 HOH A O     1 
HETATM 2220 O O     . HOH G 3 .  ? 29.241 15.731  70.028  1.00 57.26  ? 262 HOH A O     1 
HETATM 2221 O O     . HOH G 3 .  ? 59.013 17.343  53.726  1.00 59.66  ? 263 HOH A O     1 
HETATM 2222 O O     . HOH G 3 .  ? 44.679 31.765  62.604  1.00 56.07  ? 264 HOH A O     1 
HETATM 2223 O O     . HOH G 3 .  ? 42.419 31.886  72.851  1.00 60.75  ? 265 HOH A O     1 
HETATM 2224 O O     . HOH G 3 .  ? 29.091 23.727  67.777  1.00 47.87  ? 266 HOH A O     1 
HETATM 2225 O O     . HOH G 3 .  ? 56.306 25.790  63.788  1.00 53.98  ? 267 HOH A O     1 
HETATM 2226 O O     . HOH G 3 .  ? 55.008 19.490  53.881  1.00 53.52  ? 268 HOH A O     1 
HETATM 2227 O O     . HOH G 3 .  ? 57.329 12.943  68.376  1.00 64.13  ? 269 HOH A O     1 
HETATM 2228 O O     . HOH G 3 .  ? 39.132 30.027  77.150  1.00 64.22  ? 270 HOH A O     1 
HETATM 2229 O O     . HOH G 3 .  ? 55.465 20.500  58.397  1.00 44.88  ? 271 HOH A O     1 
HETATM 2230 O O     . HOH G 3 .  ? 28.929 26.950  67.819  1.00 52.53  ? 272 HOH A O     1 
HETATM 2231 O O     . HOH G 3 .  ? 31.317 10.360  59.210  1.00 53.45  ? 273 HOH A O     1 
HETATM 2232 O O     . HOH G 3 .  ? 40.678 29.821  50.661  1.00 49.39  ? 274 HOH A O     1 
HETATM 2233 O O     . HOH G 3 .  ? 36.023 26.654  56.255  1.00 48.88  ? 275 HOH A O     1 
HETATM 2234 O O     . HOH G 3 .  ? 43.763 16.906  77.017  1.00 51.64  ? 276 HOH A O     1 
HETATM 2235 O O     . HOH G 3 .  ? 50.648 14.539  72.266  1.00 44.98  ? 277 HOH A O     1 
HETATM 2236 O O     . HOH G 3 .  ? 35.626 18.630  74.631  1.00 61.58  ? 278 HOH A O     1 
HETATM 2237 O O     . HOH G 3 .  ? 29.462 21.791  72.387  1.00 50.88  ? 279 HOH A O     1 
HETATM 2238 O O     . HOH G 3 .  ? 31.474 12.592  60.904  1.00 42.41  ? 280 HOH A O     1 
HETATM 2239 O O     . HOH G 3 .  ? 68.621 13.834  59.558  1.00 44.23  ? 281 HOH A O     1 
HETATM 2240 O O     . HOH G 3 .  ? 63.163 19.958  57.169  1.00 47.82  ? 282 HOH A O     1 
HETATM 2241 O O     . HOH G 3 .  ? 54.693 27.500  65.293  1.00 58.51  ? 283 HOH A O     1 
HETATM 2242 O O     . HOH G 3 .  ? 61.336 21.887  71.338  1.00 49.48  ? 284 HOH A O     1 
HETATM 2243 O O     . HOH G 3 .  ? 62.566 21.356  66.007  1.00 45.49  ? 285 HOH A O     1 
HETATM 2244 O O     . HOH G 3 .  ? 60.446 21.087  66.948  1.00 45.47  ? 286 HOH A O     1 
HETATM 2245 O O     . HOH G 3 .  ? 37.160 30.249  58.378  1.00 48.78  ? 287 HOH A O     1 
HETATM 2246 O O     . HOH G 3 .  ? 53.985 18.807  69.475  1.00 58.96  ? 288 HOH A O     1 
HETATM 2247 O O     . HOH G 3 .  ? 51.850 18.494  71.648  1.00 54.74  ? 289 HOH A O     1 
HETATM 2248 O O     . HOH G 3 .  ? 27.884 12.025  67.514  1.00 53.14  ? 290 HOH A O     1 
HETATM 2249 O O     . HOH G 3 .  ? 46.937 25.544  74.007  1.00 53.61  ? 291 HOH A O     1 
HETATM 2250 O O     . HOH G 3 .  ? 30.320 12.623  71.339  1.00 45.60  ? 292 HOH A O     1 
HETATM 2251 O O     . HOH G 3 .  ? 59.549 19.978  59.278  1.00 50.57  ? 293 HOH A O     1 
HETATM 2252 O O     . HOH G 3 .  ? 56.168 16.627  50.032  1.00 60.94  ? 294 HOH A O     1 
HETATM 2253 O O     . HOH G 3 .  ? 56.358 19.850  66.440  1.00 57.90  ? 295 HOH A O     1 
HETATM 2254 O O     . HOH G 3 .  ? 32.637 25.180  61.020  1.00 49.88  ? 296 HOH A O     1 
HETATM 2255 O O     . HOH G 3 .  ? 38.186 27.873  47.083  1.00 60.63  ? 297 HOH A O     1 
HETATM 2256 O O     . HOH G 3 .  ? 49.997 12.162  74.082  1.00 54.55  ? 298 HOH A O     1 
HETATM 2257 O O     . HOH G 3 .  ? 38.999 10.816  62.788  1.00 27.57  ? 299 HOH A O     1 
HETATM 2258 O O     . HOH G 3 .  ? 48.578 12.375  58.958  1.00 28.79  ? 300 HOH A O     1 
HETATM 2259 O O     . HOH G 3 .  ? 47.189 20.939  61.863  1.00 26.80  ? 301 HOH A O     1 
HETATM 2260 O O     . HOH H 3 .  ? 42.440 11.415  65.222  1.00 24.22  ? 101 HOH B O     1 
HETATM 2261 O O     . HOH H 3 .  ? 51.537 10.132  61.552  1.00 29.29  ? 102 HOH B O     1 
HETATM 2262 O O     . HOH H 3 .  ? 42.468 12.619  62.006  1.00 25.81  ? 103 HOH B O     1 
HETATM 2263 O O     . HOH H 3 .  ? 39.135 10.116  56.780  1.00 35.84  ? 104 HOH B O     1 
HETATM 2264 O O     . HOH H 3 .  ? 45.935 26.659  51.305  1.00 37.71  ? 105 HOH B O     1 
HETATM 2265 O O     . HOH H 3 .  ? 48.274 13.063  56.262  1.00 31.54  ? 106 HOH B O     1 
HETATM 2266 O O     . HOH H 3 .  ? 40.639 12.977  64.011  1.00 30.08  ? 107 HOH B O     1 
HETATM 2267 O O     . HOH H 3 .  ? 51.282 11.604  59.543  1.00 33.04  ? 108 HOH B O     1 
HETATM 2268 O O     . HOH H 3 .  ? 37.840 7.289   54.058  1.00 47.66  ? 109 HOH B O     1 
HETATM 2269 O O     . HOH H 3 .  ? 39.711 9.545   54.154  1.00 45.31  ? 110 HOH B O     1 
HETATM 2270 O O     . HOH H 3 .  ? 34.709 1.497   57.607  1.00 53.35  ? 111 HOH B O     1 
HETATM 2271 O O     . HOH H 3 .  ? 50.850 7.080   52.160  1.00 51.47  ? 112 HOH B O     1 
HETATM 2272 O O     . HOH H 3 .  ? 53.948 13.325  56.836  1.00 53.33  ? 113 HOH B O     1 
HETATM 2273 O O     . HOH H 3 .  ? 42.778 3.161   59.609  1.00 41.52  ? 114 HOH B O     1 
HETATM 2274 O O     . HOH H 3 .  ? 57.054 10.116  56.915  1.00 46.69  ? 115 HOH B O     1 
HETATM 2275 O O     . HOH H 3 .  ? 49.134 15.961  55.809  1.00 43.34  ? 116 HOH B O     1 
HETATM 2276 O O     . HOH H 3 .  ? 34.225 7.698   53.748  1.00 66.70  ? 117 HOH B O     1 
HETATM 2277 O O     . HOH H 3 .  ? 32.822 11.490  56.201  1.00 58.87  ? 118 HOH B O     1 
HETATM 2278 O O     . HOH H 3 .  ? 35.359 10.136  55.534  1.00 54.85  ? 119 HOH B O     1 
HETATM 2279 O O     . HOH H 3 .  ? 57.092 12.689  57.044  1.00 59.04  ? 120 HOH B O     1 
HETATM 2280 O O     . HOH H 3 .  ? 54.331 6.698   58.640  1.00 65.03  ? 121 HOH B O     1 
HETATM 2281 O O     . HOH H 3 .  ? 34.515 6.613   61.193  1.00 58.71  ? 122 HOH B O     1 
HETATM 2282 O O     . HOH H 3 .  ? 37.566 2.523   59.488  1.00 51.78  ? 123 HOH B O     1 
HETATM 2283 O O     . HOH H 3 .  ? 36.117 4.420   61.139  1.00 55.93  ? 124 HOH B O     1 
HETATM 2284 O O     . HOH H 3 .  ? 38.324 1.613   50.056  1.00 44.32  ? 125 HOH B O     1 
HETATM 2285 O O     . HOH H 3 .  ? 35.196 3.790   51.274  1.00 54.45  ? 126 HOH B O     1 
HETATM 2286 O O     . HOH H 3 .  ? 50.160 13.005  46.748  1.00 55.61  ? 127 HOH B O     1 
HETATM 2287 O O     . HOH H 3 .  ? 53.518 8.442   61.430  1.00 54.92  ? 128 HOH B O     1 
HETATM 2288 O O     A HOH H 3 .  ? 52.167 19.105  54.780  0.50 31.55  ? 129 HOH B O     1 
HETATM 2289 O O     . HOH H 3 .  ? 48.911 14.622  45.622  1.00 59.20  ? 130 HOH B O     1 
HETATM 2290 O O     . HOH H 3 .  ? 50.003 22.501  40.490  1.00 59.20  ? 131 HOH B O     1 
HETATM 2291 O O     . HOH H 3 .  ? 54.260 24.338  48.463  1.00 57.62  ? 132 HOH B O     1 
HETATM 2292 O O     . HOH H 3 .  ? 50.914 28.669  47.436  1.00 50.47  ? 133 HOH B O     1 
HETATM 2293 O O     . HOH H 3 .  ? 51.328 9.469   49.031  1.00 49.11  ? 134 HOH B O     1 
HETATM 2294 O O     . HOH H 3 .  ? 38.635 2.516   62.268  1.00 53.93  ? 135 HOH B O     1 
HETATM 2295 O O     . HOH I 3 .  ? 41.568 21.599  59.285  1.00 23.73  ? 101 HOH C O     1 
HETATM 2296 O O     . HOH I 3 .  ? 44.297 21.204  59.163  1.00 28.91  ? 102 HOH C O     1 
HETATM 2297 O O     . HOH I 3 .  ? 47.320 24.900  63.250  1.00 34.47  ? 103 HOH C O     1 
HETATM 2298 O O     . HOH I 3 .  ? 49.865 20.678  56.576  1.00 33.58  ? 104 HOH C O     1 
HETATM 2299 O O     . HOH I 3 .  ? 42.707 13.552  53.790  1.00 36.61  ? 105 HOH C O     1 
HETATM 2300 O O     . HOH I 3 .  ? 45.568 16.259  55.778  1.00 34.55  ? 106 HOH C O     1 
HETATM 2301 O O     . HOH I 3 .  ? 39.679 16.674  51.071  1.00 35.35  ? 107 HOH C O     1 
HETATM 2302 O O     . HOH I 3 .  ? 39.848 3.839   49.623  1.00 58.72  ? 108 HOH C O     1 
HETATM 2303 O O     . HOH I 3 .  ? 38.836 18.924  53.903  1.00 45.66  ? 109 HOH C O     1 
HETATM 2304 O O     . HOH I 3 .  ? 40.521 10.455  51.058  1.00 45.10  ? 110 HOH C O     1 
HETATM 2305 O O     . HOH I 3 .  ? 43.946 24.992  51.506  1.00 37.33  ? 111 HOH C O     1 
HETATM 2306 O O     . HOH I 3 .  ? 46.198 27.924  60.960  1.00 36.46  ? 112 HOH C O     1 
HETATM 2307 O O     . HOH I 3 .  ? 55.209 22.319  59.594  1.00 49.72  ? 113 HOH C O     1 
HETATM 2308 O O     . HOH I 3 .  ? 43.028 0.360   59.110  1.00 46.55  ? 114 HOH C O     1 
HETATM 2309 O O     . HOH I 3 .  ? 47.752 29.050  62.816  1.00 46.12  ? 115 HOH C O     1 
HETATM 2310 O O     . HOH I 3 .  ? 48.844 26.865  64.223  1.00 44.27  ? 116 HOH C O     1 
HETATM 2311 O O     . HOH I 3 .  ? 52.793 22.576  59.730  1.00 42.49  ? 117 HOH C O     1 
HETATM 2312 O O     . HOH I 3 .  ? 50.315 29.304  58.445  1.00 44.42  ? 118 HOH C O     1 
HETATM 2313 O O     . HOH I 3 .  ? 41.056 -0.674  49.485  1.00 55.78  ? 119 HOH C O     1 
HETATM 2314 O O     . HOH I 3 .  ? 62.698 35.726  50.490  1.00 49.75  ? 120 HOH C O     1 
HETATM 2315 O O     . HOH I 3 .  ? 38.483 16.325  53.736  1.00 44.76  ? 121 HOH C O     1 
HETATM 2316 O O     . HOH I 3 .  ? 61.030 25.428  51.184  1.00 64.37  ? 122 HOH C O     1 
HETATM 2317 O O     . HOH I 3 .  ? 38.470 15.380  49.095  1.00 54.38  ? 123 HOH C O     1 
HETATM 2318 O O     . HOH I 3 .  ? 49.250 4.626   51.106  1.00 59.16  ? 124 HOH C O     1 
HETATM 2319 O O     . HOH I 3 .  ? 56.079 25.099  51.572  1.00 50.71  ? 125 HOH C O     1 
HETATM 2320 O O     . HOH I 3 .  ? 49.102 8.183   47.480  1.00 47.23  ? 126 HOH C O     1 
HETATM 2321 O O     . HOH I 3 .  ? 41.200 6.611   48.020  1.00 59.46  ? 127 HOH C O     1 
HETATM 2322 O O     . HOH I 3 .  ? 49.153 5.988   45.594  1.00 65.79  ? 128 HOH C O     1 
HETATM 2323 O O     . HOH J 3 .  ? 47.193 2.215   82.797  1.00 31.98  ? 201 HOH D O     1 
HETATM 2324 O O     . HOH J 3 .  ? 43.194 7.417   77.924  1.00 31.57  ? 202 HOH D O     1 
HETATM 2325 O O     . HOH J 3 .  ? 51.254 -7.343  83.884  1.00 45.62  ? 203 HOH D O     1 
HETATM 2326 O O     . HOH J 3 .  ? 41.098 6.250   70.274  1.00 42.11  ? 204 HOH D O     1 
HETATM 2327 O O     . HOH J 3 .  ? 39.137 7.932   82.060  1.00 34.79  ? 205 HOH D O     1 
HETATM 2328 O O     . HOH J 3 .  ? 47.244 -0.008  65.827  1.00 32.16  ? 206 HOH D O     1 
HETATM 2329 O O     . HOH J 3 .  ? 49.303 -6.160  69.263  1.00 41.73  ? 207 HOH D O     1 
HETATM 2330 O O     . HOH J 3 .  ? 40.323 0.771   85.345  1.00 41.41  ? 208 HOH D O     1 
HETATM 2331 O O     . HOH J 3 .  ? 40.750 7.018   80.048  1.00 37.25  ? 209 HOH D O     1 
HETATM 2332 O O     . HOH J 3 .  ? 48.241 3.947   61.895  1.00 44.61  ? 210 HOH D O     1 
HETATM 2333 O O     . HOH J 3 .  ? 58.276 6.049   74.590  1.00 49.83  ? 211 HOH D O     1 
HETATM 2334 O O     . HOH J 3 .  ? 49.066 1.304   67.645  1.00 38.36  ? 212 HOH D O     1 
HETATM 2335 O O     A HOH J 3 .  ? 55.758 2.342   82.083  0.50 38.94  ? 213 HOH D O     1 
HETATM 2336 O O     B HOH J 3 .  ? 55.942 0.639   82.632  0.50 42.92  ? 213 HOH D O     1 
HETATM 2337 O O     . HOH J 3 .  ? 50.038 9.731   84.651  1.00 53.35  ? 214 HOH D O     1 
HETATM 2338 O O     . HOH J 3 .  ? 47.692 11.561  83.465  1.00 40.03  ? 215 HOH D O     1 
HETATM 2339 O O     . HOH J 3 .  ? 54.365 2.743   86.671  1.00 53.80  ? 216 HOH D O     1 
HETATM 2340 O O     . HOH J 3 .  ? 40.914 -5.049  76.334  1.00 40.30  ? 217 HOH D O     1 
HETATM 2341 O O     . HOH J 3 .  ? 41.603 8.379   71.895  1.00 56.67  ? 218 HOH D O     1 
HETATM 2342 O O     . HOH J 3 .  ? 43.458 8.514   75.373  1.00 32.81  ? 219 HOH D O     1 
HETATM 2343 O O     . HOH J 3 .  ? 36.139 7.959   82.382  1.00 53.89  ? 220 HOH D O     1 
HETATM 2344 O O     . HOH J 3 .  ? 41.042 -4.062  79.283  1.00 44.62  ? 221 HOH D O     1 
HETATM 2345 O O     . HOH J 3 .  ? 35.751 -0.205  81.768  1.00 37.62  ? 222 HOH D O     1 
HETATM 2346 O O     . HOH J 3 .  ? 59.392 -4.177  76.471  1.00 52.56  ? 223 HOH D O     1 
HETATM 2347 O O     . HOH J 3 .  ? 50.527 9.687   81.770  1.00 40.27  ? 224 HOH D O     1 
HETATM 2348 O O     . HOH J 3 .  ? 42.917 -6.228  77.963  1.00 39.99  ? 225 HOH D O     1 
HETATM 2349 O O     . HOH J 3 .  ? 37.495 2.844   84.821  1.00 40.83  ? 226 HOH D O     1 
HETATM 2350 O O     . HOH J 3 .  ? 53.496 5.844   68.566  1.00 43.80  ? 227 HOH D O     1 
HETATM 2351 O O     . HOH J 3 .  ? 34.113 11.211  79.565  1.00 40.97  ? 228 HOH D O     1 
HETATM 2352 O O     . HOH J 3 .  ? 36.820 -4.401  69.773  1.00 52.24  ? 229 HOH D O     1 
HETATM 2353 O O     . HOH J 3 .  ? 46.900 6.272   90.473  1.00 46.43  ? 230 HOH D O     1 
HETATM 2354 O O     . HOH J 3 .  ? 55.089 -6.644  78.581  1.00 55.98  ? 231 HOH D O     1 
HETATM 2355 O O     A HOH J 3 .  ? 51.297 6.007   66.881  0.67 34.73  ? 232 HOH D O     1 
HETATM 2356 O O     B HOH J 3 .  ? 51.001 6.077   64.600  0.33 24.51  ? 232 HOH D O     1 
HETATM 2357 O O     . HOH J 3 .  ? 56.427 12.014  75.710  1.00 53.66  ? 233 HOH D O     1 
HETATM 2358 O O     . HOH J 3 .  ? 53.873 -8.424  76.886  1.00 46.99  ? 234 HOH D O     1 
HETATM 2359 O O     . HOH J 3 .  ? 50.451 2.646   66.323  1.00 62.43  ? 235 HOH D O     1 
HETATM 2360 O O     . HOH J 3 .  ? 57.275 9.771   73.135  1.00 51.69  ? 236 HOH D O     1 
HETATM 2361 O O     . HOH J 3 .  ? 49.066 5.880   92.175  1.00 60.62  ? 237 HOH D O     1 
HETATM 2362 O O     . HOH J 3 .  ? 45.466 3.323   97.355  1.00 58.18  ? 238 HOH D O     1 
HETATM 2363 O O     . HOH J 3 .  ? 52.161 -10.909 68.324  1.00 57.08  ? 239 HOH D O     1 
HETATM 2364 O O     . HOH J 3 .  ? 52.467 7.776   92.098  1.00 54.93  ? 240 HOH D O     1 
HETATM 2365 O O     . HOH J 3 .  ? 55.907 6.412   84.808  1.00 51.69  ? 241 HOH D O     1 
HETATM 2366 O O     . HOH J 3 .  ? 53.575 -7.930  81.320  1.00 48.22  ? 242 HOH D O     1 
HETATM 2367 O O     . HOH J 3 .  ? 52.816 4.804   95.465  1.00 64.23  ? 243 HOH D O     1 
HETATM 2368 O O     . HOH J 3 .  ? 35.665 10.864  81.826  1.00 49.87  ? 244 HOH D O     1 
HETATM 2369 O O     . HOH K 3 .  ? 46.174 9.023   90.793  1.00 40.81  ? 101 HOH E O     1 
HETATM 2370 O O     . HOH K 3 .  ? 36.294 0.237   84.314  1.00 46.07  ? 102 HOH E O     1 
HETATM 2371 O O     . HOH K 3 .  ? 42.781 4.393   93.266  1.00 47.06  ? 103 HOH E O     1 
HETATM 2372 O O     . HOH K 3 .  ? 33.469 0.894   80.711  1.00 44.41  ? 104 HOH E O     1 
HETATM 2373 O O     . HOH K 3 .  ? 31.116 -6.997  84.089  1.00 56.60  ? 105 HOH E O     1 
HETATM 2374 O O     . HOH K 3 .  ? 51.764 13.418  81.450  1.00 49.91  ? 106 HOH E O     1 
HETATM 2375 O O     . HOH K 3 .  ? 32.446 -0.377  78.624  1.00 52.68  ? 107 HOH E O     1 
HETATM 2376 O O     . HOH K 3 .  ? 25.775 5.891   86.226  1.00 58.11  ? 108 HOH E O     1 
HETATM 2377 O O     . HOH K 3 .  ? 39.377 -7.548  76.191  1.00 54.19  ? 109 HOH E O     1 
HETATM 2378 O O     . HOH L 3 .  ? 44.869 3.831   82.558  1.00 29.28  ? 101 HOH F O     1 
HETATM 2379 O O     . HOH L 3 .  ? 39.974 7.087   84.664  1.00 36.96  ? 102 HOH F O     1 
HETATM 2380 O O     . HOH L 3 .  ? 42.927 5.234   79.501  1.00 31.09  ? 103 HOH F O     1 
HETATM 2381 O O     . HOH L 3 .  ? 45.660 8.277   78.415  1.00 29.90  ? 104 HOH F O     1 
HETATM 2382 O O     . HOH L 3 .  ? 48.079 10.051  81.185  1.00 41.25  ? 105 HOH F O     1 
HETATM 2383 O O     . HOH L 3 .  ? 48.137 -0.771  85.937  1.00 43.75  ? 106 HOH F O     1 
HETATM 2384 O O     . HOH L 3 .  ? 39.545 10.563  81.297  1.00 37.13  ? 107 HOH F O     1 
HETATM 2385 O O     . HOH L 3 .  ? 37.646 14.586  82.883  1.00 45.31  ? 108 HOH F O     1 
HETATM 2386 O O     . HOH L 3 .  ? 41.083 8.857   78.039  1.00 44.65  ? 109 HOH F O     1 
HETATM 2387 O O     . HOH L 3 .  ? 42.597 11.066  75.879  1.00 40.61  ? 110 HOH F O     1 
HETATM 2388 O O     . HOH L 3 .  ? 37.507 12.381  81.122  1.00 45.48  ? 111 HOH F O     1 
HETATM 2389 O O     . HOH L 3 .  ? 45.664 13.634  83.045  1.00 49.20  ? 112 HOH F O     1 
HETATM 2390 O O     . HOH L 3 .  ? 45.443 -3.884  88.283  1.00 49.97  ? 113 HOH F O     1 
HETATM 2391 O O     . HOH L 3 .  ? 46.732 -1.714  88.201  1.00 50.56  ? 114 HOH F O     1 
HETATM 2392 O O     . HOH L 3 .  ? 38.137 14.734  89.305  1.00 50.76  ? 115 HOH F O     1 
HETATM 2393 O O     . HOH L 3 .  ? 47.709 -5.494  89.134  1.00 65.69  ? 116 HOH F O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ARG A 5  ? 0.5378 0.8291 0.4250 0.0573  -0.1018 0.0993  138 ARG A N     
2    C CA    . ARG A 5  ? 0.4676 0.7437 0.3750 0.0523  -0.0957 0.0868  138 ARG A CA    
3    C C     . ARG A 5  ? 0.4430 0.7055 0.3721 0.0569  -0.0967 0.0921  138 ARG A C     
4    O O     . ARG A 5  ? 0.5173 0.7743 0.4480 0.0633  -0.0980 0.1082  138 ARG A O     
5    C CB    . ARG A 5  ? 0.5487 0.8136 0.4522 0.0459  -0.0836 0.0851  138 ARG A CB    
6    C CG    . ARG A 5  ? 0.5985 0.8517 0.4982 0.0463  -0.0761 0.1030  138 ARG A CG    
7    C CD    . ARG A 5  ? 0.6212 0.8715 0.5163 0.0392  -0.0649 0.0996  138 ARG A CD    
8    N NE    . ARG A 5  ? 0.5830 0.8208 0.4966 0.0340  -0.0603 0.0887  138 ARG A NE    
9    C CZ    . ARG A 5  ? 0.5965 0.8376 0.5116 0.0291  -0.0556 0.0754  138 ARG A CZ    
10   N NH1   . ARG A 5  ? 0.6472 0.9022 0.5472 0.0282  -0.0533 0.0691  138 ARG A NH1   
11   N NH2   . ARG A 5  ? 0.5117 0.7419 0.4435 0.0256  -0.0529 0.0681  138 ARG A NH2   
12   N N     . LYS A 6  ? 0.4081 0.6650 0.3531 0.0540  -0.0953 0.0787  139 LYS A N     
13   C CA    . LYS A 6  ? 0.4350 0.6787 0.3996 0.0577  -0.0943 0.0796  139 LYS A CA    
14   C C     . LYS A 6  ? 0.4865 0.7082 0.4530 0.0571  -0.0862 0.0892  139 LYS A C     
15   O O     . LYS A 6  ? 0.4328 0.6480 0.3935 0.0502  -0.0793 0.0866  139 LYS A O     
16   C CB    . LYS A 6  ? 0.4992 0.7422 0.4757 0.0532  -0.0926 0.0626  139 LYS A CB    
17   C CG    . LYS A 6  ? 0.5777 0.8056 0.5711 0.0554  -0.0886 0.0600  139 LYS A CG    
18   C CD    . LYS A 6  ? 0.5732 0.7962 0.5706 0.0489  -0.0836 0.0459  139 LYS A CD    
19   C CE    . LYS A 6  ? 0.4706 0.6871 0.4829 0.0513  -0.0813 0.0400  139 LYS A CE    
20   N NZ    . LYS A 6  ? 0.3492 0.5719 0.3663 0.0468  -0.0801 0.0276  139 LYS A NZ    
21   N N     . PRO A 7  ? 0.4782 0.6884 0.4548 0.0639  -0.0866 0.0995  140 PRO A N     
22   C CA    . PRO A 7  ? 0.5032 0.6905 0.4833 0.0622  -0.0791 0.1069  140 PRO A CA    
23   C C     . PRO A 7  ? 0.3724 0.5481 0.3601 0.0552  -0.0735 0.0928  140 PRO A C     
24   O O     . PRO A 7  ? 0.3522 0.5331 0.3457 0.0548  -0.0750 0.0801  140 PRO A O     
25   C CB    . PRO A 7  ? 0.5217 0.6984 0.5141 0.0720  -0.0810 0.1168  140 PRO A CB    
26   C CG    . PRO A 7  ? 0.5848 0.7835 0.5769 0.0796  -0.0905 0.1197  140 PRO A CG    
27   C CD    . PRO A 7  ? 0.5176 0.7341 0.5057 0.0734  -0.0933 0.1036  140 PRO A CD    
28   N N     . ARG A 8  ? 0.4282 0.5895 0.4157 0.0493  -0.0672 0.0958  141 ARG A N     
29   C CA    . ARG A 8  ? 0.3988 0.5517 0.3920 0.0423  -0.0632 0.0831  141 ARG A CA    
30   C C     . ARG A 8  ? 0.3920 0.5295 0.3973 0.0459  -0.0630 0.0770  141 ARG A C     
31   O O     . ARG A 8  ? 0.4299 0.5509 0.4412 0.0494  -0.0615 0.0847  141 ARG A O     
32   C CB    . ARG A 8  ? 0.4644 0.6080 0.4565 0.0349  -0.0572 0.0894  141 ARG A CB    
33   C CG    . ARG A 8  ? 0.4754 0.6157 0.4724 0.0268  -0.0541 0.0781  141 ARG A CG    
34   C CD    . ARG A 8  ? 0.4729 0.6060 0.4724 0.0194  -0.0485 0.0861  141 ARG A CD    
35   N NE    . ARG A 8  ? 0.4490 0.5766 0.4573 0.0123  -0.0473 0.0750  141 ARG A NE    
36   C CZ    . ARG A 8  ? 0.3686 0.5078 0.3775 0.0063  -0.0451 0.0696  141 ARG A CZ    
37   N NH1   . ARG A 8  ? 0.3533 0.5092 0.3536 0.0061  -0.0424 0.0734  141 ARG A NH1   
38   N NH2   . ARG A 8  ? 0.3888 0.5231 0.4066 0.0008  -0.0458 0.0600  141 ARG A NH2   
39   N N     . THR A 9  ? 0.3809 0.5226 0.3892 0.0454  -0.0637 0.0637  142 THR A N     
40   C CA    . THR A 9  ? 0.3874 0.5156 0.4042 0.0482  -0.0621 0.0558  142 THR A CA    
41   C C     . THR A 9  ? 0.4849 0.5931 0.5042 0.0426  -0.0584 0.0539  142 THR A C     
42   O O     . THR A 9  ? 0.4336 0.5430 0.4500 0.0342  -0.0571 0.0527  142 THR A O     
43   C CB    . THR A 9  ? 0.3722 0.5096 0.3893 0.0470  -0.0623 0.0428  142 THR A CB    
44   O OG1   . THR A 9  ? 0.3402 0.4956 0.3584 0.0511  -0.0659 0.0429  142 THR A OG1   
45   C CG2   . THR A 9  ? 0.4090 0.5331 0.4315 0.0501  -0.0596 0.0347  142 THR A CG2   
46   N N     . ILE A 10 ? 0.4932 0.5835 0.5191 0.0471  -0.0567 0.0528  143 ILE A N     
47   C CA    . ILE A 10 ? 0.5631 0.6328 0.5921 0.0414  -0.0540 0.0478  143 ILE A CA    
48   C C     . ILE A 10 ? 0.4966 0.5622 0.5254 0.0437  -0.0533 0.0333  143 ILE A C     
49   O O     . ILE A 10 ? 0.5469 0.6084 0.5793 0.0526  -0.0520 0.0317  143 ILE A O     
50   C CB    . ILE A 10 ? 0.6585 0.7068 0.6946 0.0446  -0.0516 0.0577  143 ILE A CB    
51   C CG1   . ILE A 10 ? 0.6994 0.7532 0.7337 0.0434  -0.0516 0.0749  143 ILE A CG1   
52   C CG2   . ILE A 10 ? 0.6578 0.6834 0.6984 0.0371  -0.0493 0.0498  143 ILE A CG2   
53   C CD1   . ILE A 10 ? 0.7032 0.7578 0.7359 0.0313  -0.0495 0.0771  143 ILE A CD1   
54   N N     . TYR A 11 ? 0.4719 0.5414 0.4961 0.0364  -0.0541 0.0236  144 TYR A N     
55   C CA    . TYR A 11 ? 0.4748 0.5416 0.4955 0.0383  -0.0534 0.0107  144 TYR A CA    
56   C C     . TYR A 11 ? 0.5097 0.5528 0.5320 0.0370  -0.0519 0.0038  144 TYR A C     
57   O O     . TYR A 11 ? 0.5408 0.5733 0.5669 0.0293  -0.0527 0.0057  144 TYR A O     
58   C CB    . TYR A 11 ? 0.4403 0.5207 0.4548 0.0318  -0.0556 0.0043  144 TYR A CB    
59   C CG    . TYR A 11 ? 0.4142 0.5149 0.4273 0.0339  -0.0562 0.0082  144 TYR A CG    
60   C CD1   . TYR A 11 ? 0.4245 0.5323 0.4377 0.0406  -0.0548 0.0059  144 TYR A CD1   
61   C CD2   . TYR A 11 ? 0.3819 0.4945 0.3945 0.0288  -0.0576 0.0135  144 TYR A CD2   
62   C CE1   . TYR A 11 ? 0.3864 0.5114 0.4001 0.0414  -0.0557 0.0082  144 TYR A CE1   
63   C CE2   . TYR A 11 ? 0.3097 0.4389 0.3206 0.0305  -0.0582 0.0149  144 TYR A CE2   
64   C CZ    . TYR A 11 ? 0.3531 0.4878 0.3651 0.0363  -0.0578 0.0119  144 TYR A CZ    
65   O OH    . TYR A 11 ? 0.3616 0.5116 0.3737 0.0368  -0.0587 0.0122  144 TYR A OH    
66   N N     . SER A 12 ? 0.4738 0.5090 0.4942 0.0440  -0.0491 -0.0045 145 SER A N     
67   C CA    . SER A 12 ? 0.5022 0.5148 0.5213 0.0430  -0.0475 -0.0151 145 SER A CA    
68   C C     . SER A 12 ? 0.5982 0.6141 0.6081 0.0342  -0.0511 -0.0267 145 SER A C     
69   O O     . SER A 12 ? 0.5508 0.5855 0.5546 0.0328  -0.0531 -0.0271 145 SER A O     
70   C CB    . SER A 12 ? 0.5018 0.5076 0.5199 0.0544  -0.0422 -0.0214 145 SER A CB    
71   O OG    . SER A 12 ? 0.5173 0.5404 0.5276 0.0573  -0.0412 -0.0263 145 SER A OG    
72   N N     . SER A 13 ? 0.6169 0.6143 0.6261 0.0284  -0.0524 -0.0363 146 SER A N     
73   C CA    . SER A 13 ? 0.6068 0.6081 0.6066 0.0207  -0.0573 -0.0485 146 SER A CA    
74   C C     . SER A 13 ? 0.5289 0.5418 0.5144 0.0273  -0.0560 -0.0558 146 SER A C     
75   O O     . SER A 13 ? 0.5541 0.5815 0.5325 0.0230  -0.0603 -0.0581 146 SER A O     
76   C CB    . SER A 13 ? 0.6793 0.6574 0.6799 0.0141  -0.0593 -0.0606 146 SER A CB    
77   O OG    . SER A 13 ? 0.7968 0.7551 0.7947 0.0230  -0.0535 -0.0678 146 SER A OG    
78   N N     . PHE A 14 ? 0.4872 0.4947 0.4698 0.0382  -0.0495 -0.0578 147 PHE A N     
79   C CA    . PHE A 14 ? 0.4874 0.5066 0.4579 0.0450  -0.0459 -0.0623 147 PHE A CA    
80   C C     . PHE A 14 ? 0.5267 0.5699 0.4985 0.0452  -0.0467 -0.0524 147 PHE A C     
81   O O     . PHE A 14 ? 0.4698 0.5242 0.4306 0.0444  -0.0477 -0.0554 147 PHE A O     
82   C CB    . PHE A 14 ? 0.5262 0.5363 0.4984 0.0570  -0.0372 -0.0646 147 PHE A CB    
83   C CG    . PHE A 14 ? 0.5496 0.5744 0.5140 0.0645  -0.0314 -0.0655 147 PHE A CG    
84   C CD1   . PHE A 14 ? 0.7057 0.7295 0.6516 0.0653  -0.0295 -0.0771 147 PHE A CD1   
85   C CD2   . PHE A 14 ? 0.6439 0.6840 0.6196 0.0705  -0.0276 -0.0546 147 PHE A CD2   
86   C CE1   . PHE A 14 ? 0.6932 0.7303 0.6321 0.0720  -0.0226 -0.0761 147 PHE A CE1   
87   C CE2   . PHE A 14 ? 0.6155 0.6689 0.5869 0.0763  -0.0213 -0.0548 147 PHE A CE2   
88   C CZ    . PHE A 14 ? 0.6800 0.7316 0.6331 0.0770  -0.0181 -0.0648 147 PHE A CZ    
89   N N     . GLN A 15 ? 0.4524 0.5030 0.4369 0.0468  -0.0462 -0.0404 148 GLN A N     
90   C CA    . GLN A 15 ? 0.4175 0.4886 0.4044 0.0462  -0.0471 -0.0323 148 GLN A CA    
91   C C     . GLN A 15 ? 0.3700 0.4491 0.3540 0.0369  -0.0532 -0.0319 148 GLN A C     
92   O O     . GLN A 15 ? 0.3521 0.4437 0.3310 0.0364  -0.0538 -0.0318 148 GLN A O     
93   C CB    . GLN A 15 ? 0.3773 0.4540 0.3768 0.0493  -0.0466 -0.0211 148 GLN A CB    
94   C CG    . GLN A 15 ? 0.4007 0.4752 0.4067 0.0596  -0.0413 -0.0197 148 GLN A CG    
95   C CD    . GLN A 15 ? 0.4352 0.5139 0.4534 0.0629  -0.0428 -0.0081 148 GLN A CD    
96   O OE1   . GLN A 15 ? 0.4282 0.5020 0.4484 0.0583  -0.0463 -0.0020 148 GLN A OE1   
97   N NE2   . GLN A 15 ? 0.4272 0.5158 0.4535 0.0708  -0.0402 -0.0046 148 GLN A NE2   
98   N N     . LEU A 16 ? 0.3613 0.4327 0.3498 0.0299  -0.0571 -0.0314 149 LEU A N     
99   C CA    . LEU A 16 ? 0.3639 0.4448 0.3528 0.0215  -0.0623 -0.0310 149 LEU A CA    
100  C C     . LEU A 16 ? 0.3985 0.4820 0.3760 0.0198  -0.0658 -0.0406 149 LEU A C     
101  O O     . LEU A 16 ? 0.4125 0.5102 0.3883 0.0179  -0.0686 -0.0387 149 LEU A O     
102  C CB    . LEU A 16 ? 0.4113 0.4840 0.4095 0.0136  -0.0648 -0.0285 149 LEU A CB    
103  C CG    . LEU A 16 ? 0.4355 0.5084 0.4430 0.0144  -0.0621 -0.0165 149 LEU A CG    
104  C CD1   . LEU A 16 ? 0.5021 0.5633 0.5185 0.0066  -0.0629 -0.0137 149 LEU A CD1   
105  C CD2   . LEU A 16 ? 0.4564 0.5491 0.4650 0.0142  -0.0621 -0.0091 149 LEU A CD2   
106  N N     . ALA A 17 ? 0.4535 0.5230 0.4226 0.0210  -0.0657 -0.0509 150 ALA A N     
107  C CA    . ALA A 17 ? 0.4413 0.5135 0.3959 0.0199  -0.0697 -0.0605 150 ALA A CA    
108  C C     . ALA A 17 ? 0.4306 0.5160 0.3763 0.0268  -0.0660 -0.0568 150 ALA A C     
109  O O     . ALA A 17 ? 0.4184 0.5156 0.3577 0.0255  -0.0700 -0.0561 150 ALA A O     
110  C CB    . ALA A 17 ? 0.4571 0.5109 0.4022 0.0213  -0.0687 -0.0734 150 ALA A CB    
111  N N     . ALA A 18 ? 0.3849 0.4687 0.3323 0.0344  -0.0582 -0.0533 151 ALA A N     
112  C CA    . ALA A 18 ? 0.4010 0.4966 0.3435 0.0401  -0.0533 -0.0486 151 ALA A CA    
113  C C     . ALA A 18 ? 0.3314 0.4420 0.2815 0.0376  -0.0552 -0.0394 151 ALA A C     
114  O O     . ALA A 18 ? 0.3436 0.4626 0.2869 0.0394  -0.0544 -0.0372 151 ALA A O     
115  C CB    . ALA A 18 ? 0.3891 0.4818 0.3359 0.0480  -0.0445 -0.0469 151 ALA A CB    
116  N N     . LEU A 19 ? 0.3264 0.4395 0.2901 0.0342  -0.0569 -0.0336 152 LEU A N     
117  C CA    . LEU A 19 ? 0.3022 0.4280 0.2730 0.0320  -0.0582 -0.0267 152 LEU A CA    
118  C C     . LEU A 19 ? 0.3153 0.4469 0.2830 0.0274  -0.0642 -0.0280 152 LEU A C     
119  O O     . LEU A 19 ? 0.2860 0.4267 0.2521 0.0289  -0.0642 -0.0247 152 LEU A O     
120  C CB    . LEU A 19 ? 0.3058 0.4324 0.2882 0.0295  -0.0586 -0.0215 152 LEU A CB    
121  C CG    . LEU A 19 ? 0.3067 0.4331 0.2939 0.0349  -0.0539 -0.0184 152 LEU A CG    
122  C CD1   . LEU A 19 ? 0.3253 0.4488 0.3202 0.0332  -0.0553 -0.0135 152 LEU A CD1   
123  C CD2   . LEU A 19 ? 0.3445 0.4829 0.3352 0.0369  -0.0513 -0.0148 152 LEU A CD2   
124  N N     . GLN A 20 ? 0.3666 0.4925 0.3343 0.0223  -0.0693 -0.0328 153 GLN A N     
125  C CA    . GLN A 20 ? 0.3656 0.4994 0.3332 0.0174  -0.0765 -0.0346 153 GLN A CA    
126  C C     . GLN A 20 ? 0.4042 0.5416 0.3568 0.0213  -0.0785 -0.0378 153 GLN A C     
127  O O     . GLN A 20 ? 0.4088 0.5579 0.3619 0.0218  -0.0816 -0.0338 153 GLN A O     
128  C CB    . GLN A 20 ? 0.4143 0.5405 0.3866 0.0098  -0.0817 -0.0404 153 GLN A CB    
129  C CG    . GLN A 20 ? 0.4264 0.5487 0.4128 0.0056  -0.0793 -0.0352 153 GLN A CG    
130  C CD    . GLN A 20 ? 0.4516 0.5886 0.4502 0.0012  -0.0808 -0.0286 153 GLN A CD    
131  O OE1   . GLN A 20 ? 0.5092 0.6592 0.5074 0.0037  -0.0819 -0.0262 153 GLN A OE1   
132  N NE2   . GLN A 20 ? 0.4799 0.6146 0.4900 -0.0047 -0.0801 -0.0252 153 GLN A NE2   
133  N N     . ARG A 21 ? 0.3927 0.5202 0.3313 0.0249  -0.0760 -0.0444 154 ARG A N     
134  C CA    . ARG A 21 ? 0.4867 0.6181 0.4077 0.0293  -0.0767 -0.0463 154 ARG A CA    
135  C C     . ARG A 21 ? 0.4216 0.5620 0.3433 0.0348  -0.0712 -0.0363 154 ARG A C     
136  O O     . ARG A 21 ? 0.3878 0.5370 0.3032 0.0364  -0.0747 -0.0325 154 ARG A O     
137  C CB    . ARG A 21 ? 0.5068 0.6264 0.4112 0.0334  -0.0726 -0.0553 154 ARG A CB    
138  C CG    . ARG A 21 ? 0.5686 0.6941 0.4520 0.0380  -0.0732 -0.0562 154 ARG A CG    
139  N N     . ARG A 22 ? 0.4466 0.5851 0.3775 0.0373  -0.0633 -0.0316 155 ARG A N     
140  C CA    A ARG A 22 ? 0.3789 0.5242 0.3134 0.0409  -0.0578 -0.0231 155 ARG A CA    
141  C CA    B ARG A 22 ? 0.3888 0.5342 0.3233 0.0409  -0.0578 -0.0230 155 ARG A CA    
142  C C     . ARG A 22 ? 0.3276 0.4821 0.2722 0.0384  -0.0624 -0.0175 155 ARG A C     
143  O O     . ARG A 22 ? 0.3245 0.4843 0.2670 0.0414  -0.0614 -0.0115 155 ARG A O     
144  C CB    A ARG A 22 ? 0.3424 0.4856 0.2878 0.0425  -0.0504 -0.0207 155 ARG A CB    
145  C CB    B ARG A 22 ? 0.3630 0.5067 0.3088 0.0425  -0.0503 -0.0203 155 ARG A CB    
146  C CG    A ARG A 22 ? 0.3045 0.4534 0.2545 0.0452  -0.0440 -0.0134 155 ARG A CG    
147  C CG    B ARG A 22 ? 0.3297 0.4798 0.2824 0.0443  -0.0451 -0.0127 155 ARG A CG    
148  C CD    A ARG A 22 ? 0.3316 0.4804 0.2665 0.0498  -0.0397 -0.0115 155 ARG A CD    
149  C CD    B ARG A 22 ? 0.3922 0.5425 0.3326 0.0489  -0.0397 -0.0096 155 ARG A CD    
150  N NE    A ARG A 22 ? 0.3102 0.4627 0.2519 0.0515  -0.0325 -0.0035 155 ARG A NE    
151  N NE    B ARG A 22 ? 0.4317 0.5774 0.3659 0.0522  -0.0337 -0.0138 155 ARG A NE    
152  C CZ    A ARG A 22 ? 0.3490 0.5018 0.2960 0.0535  -0.0237 -0.0019 155 ARG A CZ    
153  C CZ    B ARG A 22 ? 0.4280 0.5752 0.3718 0.0542  -0.0256 -0.0115 155 ARG A CZ    
154  N NH1   A ARG A 22 ? 0.3767 0.5267 0.3224 0.0554  -0.0209 -0.0075 155 ARG A NH1   
155  N NH1   B ARG A 22 ? 0.3956 0.5483 0.3545 0.0522  -0.0234 -0.0057 155 ARG A NH1   
156  N NH2   A ARG A 22 ? 0.3544 0.5103 0.3101 0.0534  -0.0175 0.0051  155 ARG A NH2   
157  N NH2   B ARG A 22 ? 0.4239 0.5677 0.3633 0.0583  -0.0198 -0.0157 155 ARG A NH2   
158  N N     . PHE A 23 ? 0.3289 0.4849 0.2851 0.0334  -0.0664 -0.0187 156 PHE A N     
159  C CA    . PHE A 23 ? 0.3108 0.4762 0.2781 0.0319  -0.0688 -0.0138 156 PHE A CA    
160  C C     . PHE A 23 ? 0.3557 0.5290 0.3185 0.0327  -0.0756 -0.0125 156 PHE A C     
161  O O     . PHE A 23 ? 0.3636 0.5443 0.3331 0.0351  -0.0755 -0.0067 156 PHE A O     
162  C CB    . PHE A 23 ? 0.2746 0.4413 0.2540 0.0265  -0.0706 -0.0149 156 PHE A CB    
163  C CG    . PHE A 23 ? 0.3069 0.4834 0.2983 0.0258  -0.0705 -0.0105 156 PHE A CG    
164  C CD1   . PHE A 23 ? 0.3257 0.5031 0.3233 0.0275  -0.0648 -0.0076 156 PHE A CD1   
165  C CD2   . PHE A 23 ? 0.3012 0.4869 0.2993 0.0231  -0.0762 -0.0102 156 PHE A CD2   
166  C CE1   . PHE A 23 ? 0.2808 0.4659 0.2883 0.0275  -0.0636 -0.0053 156 PHE A CE1   
167  C CE2   . PHE A 23 ? 0.3399 0.5351 0.3501 0.0236  -0.0746 -0.0065 156 PHE A CE2   
168  C CZ    . PHE A 23 ? 0.3287 0.5227 0.3426 0.0261  -0.0679 -0.0044 156 PHE A CZ    
169  N N     . GLN A 24 ? 0.3655 0.5373 0.3174 0.0310  -0.0816 -0.0184 157 GLN A N     
170  C CA    . GLN A 24 ? 0.4016 0.5829 0.3462 0.0324  -0.0897 -0.0175 157 GLN A CA    
171  C C     . GLN A 24 ? 0.4214 0.6055 0.3573 0.0402  -0.0860 -0.0090 157 GLN A C     
172  O O     . GLN A 24 ? 0.4652 0.6595 0.4034 0.0430  -0.0909 -0.0031 157 GLN A O     
173  C CB    . GLN A 24 ? 0.4674 0.6450 0.3976 0.0296  -0.0963 -0.0272 157 GLN A CB    
174  C CG    . GLN A 24 ? 0.6066 0.7817 0.5470 0.0208  -0.1019 -0.0352 157 GLN A CG    
175  C CD    . GLN A 24 ? 0.8451 1.0171 0.7711 0.0173  -0.1103 -0.0465 157 GLN A CD    
176  O OE1   . GLN A 24 ? 0.8105 0.9724 0.7175 0.0208  -0.1072 -0.0524 157 GLN A OE1   
177  N NE2   . GLN A 24 ? 1.0171 1.1985 0.9526 0.0102  -0.1207 -0.0503 157 GLN A NE2   
178  N N     . LYS A 25 ? 0.3686 0.5442 0.2970 0.0438  -0.0769 -0.0073 158 LYS A N     
179  C CA    . LYS A 25 ? 0.4074 0.5838 0.3288 0.0503  -0.0716 0.0018  158 LYS A CA    
180  C C     . LYS A 25 ? 0.3797 0.5540 0.3165 0.0516  -0.0632 0.0088  158 LYS A C     
181  O O     . LYS A 25 ? 0.3308 0.5068 0.2688 0.0560  -0.0608 0.0180  158 LYS A O     
182  C CB    . LYS A 25 ? 0.5076 0.6777 0.4089 0.0535  -0.0661 -0.0002 158 LYS A CB    
183  C CG    . LYS A 25 ? 0.6257 0.7984 0.5065 0.0537  -0.0746 -0.0069 158 LYS A CG    
184  C CD    . LYS A 25 ? 0.6919 0.8615 0.5491 0.0596  -0.0682 -0.0052 158 LYS A CD    
185  C CE    . LYS A 25 ? 0.8517 1.0239 0.6858 0.0596  -0.0773 -0.0141 158 LYS A CE    
186  N NZ    . LYS A 25 ? 1.0493 1.2161 0.8590 0.0648  -0.0688 -0.0164 158 LYS A NZ    
187  N N     . THR A 26 ? 0.3520 0.5223 0.3008 0.0476  -0.0595 0.0046  159 THR A N     
188  C CA    . THR A 26 ? 0.3317 0.4996 0.2939 0.0477  -0.0521 0.0083  159 THR A CA    
189  C C     . THR A 26 ? 0.2835 0.4539 0.2602 0.0432  -0.0544 0.0043  159 THR A C     
190  O O     . THR A 26 ? 0.3166 0.4851 0.2937 0.0397  -0.0554 -0.0011 159 THR A O     
191  C CB    . THR A 26 ? 0.4018 0.5639 0.3617 0.0478  -0.0442 0.0069  159 THR A CB    
192  O OG1   . THR A 26 ? 0.3834 0.5437 0.3267 0.0518  -0.0414 0.0087  159 THR A OG1   
193  C CG2   . THR A 26 ? 0.4018 0.5627 0.3748 0.0476  -0.0372 0.0112  159 THR A CG2   
194  N N     . GLN A 27 ? 0.2578 0.4326 0.2449 0.0438  -0.0552 0.0073  160 GLN A N     
195  C CA    A GLN A 27 ? 0.3267 0.5053 0.3256 0.0403  -0.0560 0.0040  160 GLN A CA    
196  C CA    B GLN A 27 ? 0.2928 0.4711 0.2914 0.0401  -0.0560 0.0037  160 GLN A CA    
197  C C     . GLN A 27 ? 0.2543 0.4291 0.2607 0.0392  -0.0497 0.0026  160 GLN A C     
198  O O     . GLN A 27 ? 0.2461 0.4232 0.2578 0.0358  -0.0498 -0.0011 160 GLN A O     
199  C CB    A GLN A 27 ? 0.3726 0.5591 0.3803 0.0423  -0.0590 0.0068  160 GLN A CB    
200  C CB    B GLN A 27 ? 0.3125 0.4992 0.3193 0.0413  -0.0597 0.0058  160 GLN A CB    
201  C CG    A GLN A 27 ? 0.4334 0.6277 0.4372 0.0419  -0.0673 0.0070  160 GLN A CG    
202  C CG    B GLN A 27 ? 0.3141 0.5072 0.3153 0.0410  -0.0678 0.0059  160 GLN A CG    
203  C CD    A GLN A 27 ? 0.4025 0.6087 0.4203 0.0416  -0.0708 0.0079  160 GLN A CD    
204  C CD    B GLN A 27 ? 0.3524 0.5475 0.3471 0.0470  -0.0700 0.0123  160 GLN A CD    
205  O OE1   A GLN A 27 ? 0.4012 0.6094 0.4304 0.0430  -0.0661 0.0086  160 GLN A OE1   
206  O OE1   B GLN A 27 ? 0.3602 0.5488 0.3425 0.0496  -0.0673 0.0145  160 GLN A OE1   
207  N NE2   A GLN A 27 ? 0.3922 0.6070 0.4097 0.0394  -0.0790 0.0069  160 GLN A NE2   
208  N NE2   B GLN A 27 ? 0.3133 0.5184 0.3168 0.0500  -0.0743 0.0163  160 GLN A NE2   
209  N N     . TYR A 28 ? 0.2504 0.4202 0.2577 0.0417  -0.0445 0.0062  161 TYR A N     
210  C CA    . TYR A 28 ? 0.2653 0.4317 0.2810 0.0395  -0.0390 0.0039  161 TYR A CA    
211  C C     . TYR A 28 ? 0.3348 0.4975 0.3465 0.0399  -0.0348 0.0062  161 TYR A C     
212  O O     . TYR A 28 ? 0.3011 0.4611 0.3066 0.0432  -0.0324 0.0120  161 TYR A O     
213  C CB    . TYR A 28 ? 0.2266 0.3898 0.2521 0.0411  -0.0353 0.0055  161 TYR A CB    
214  C CG    . TYR A 28 ? 0.1996 0.3675 0.2309 0.0415  -0.0375 0.0024  161 TYR A CG    
215  C CD1   . TYR A 28 ? 0.2460 0.4161 0.2819 0.0380  -0.0366 -0.0046 161 TYR A CD1   
216  C CD2   . TYR A 28 ? 0.2363 0.4082 0.2685 0.0456  -0.0402 0.0065  161 TYR A CD2   
217  C CE1   . TYR A 28 ? 0.2296 0.4050 0.2695 0.0387  -0.0370 -0.0073 161 TYR A CE1   
218  C CE2   . TYR A 28 ? 0.2590 0.4373 0.2987 0.0463  -0.0409 0.0040  161 TYR A CE2   
219  C CZ    . TYR A 28 ? 0.2565 0.4359 0.2998 0.0430  -0.0383 -0.0029 161 TYR A CZ    
220  O OH    . TYR A 28 ? 0.2604 0.4468 0.3100 0.0441  -0.0375 -0.0054 161 TYR A OH    
221  N N     . LEU A 29 ? 0.2538 0.4177 0.2690 0.0369  -0.0338 0.0021  162 LEU A N     
222  C CA    . LEU A 29 ? 0.2695 0.4326 0.2846 0.0372  -0.0290 0.0036  162 LEU A CA    
223  C C     . LEU A 29 ? 0.3360 0.4981 0.3643 0.0346  -0.0232 0.0045  162 LEU A C     
224  O O     . LEU A 29 ? 0.2594 0.4231 0.2977 0.0309  -0.0247 -0.0002 162 LEU A O     
225  C CB    . LEU A 29 ? 0.2568 0.4234 0.2713 0.0361  -0.0316 -0.0007 162 LEU A CB    
226  C CG    . LEU A 29 ? 0.3101 0.4753 0.3136 0.0376  -0.0363 -0.0026 162 LEU A CG    
227  C CD1   . LEU A 29 ? 0.3522 0.5193 0.3592 0.0369  -0.0377 -0.0056 162 LEU A CD1   
228  C CD2   . LEU A 29 ? 0.3748 0.5363 0.3657 0.0412  -0.0344 -0.0008 162 LEU A CD2   
229  N N     . ALA A 30 ? 0.3217 0.4814 0.3502 0.0360  -0.0165 0.0102  163 ALA A N     
230  C CA    . ALA A 30 ? 0.3221 0.4817 0.3661 0.0321  -0.0101 0.0112  163 ALA A CA    
231  C C     . ALA A 30 ? 0.2831 0.4516 0.3349 0.0295  -0.0115 0.0060  163 ALA A C     
232  O O     . ALA A 30 ? 0.2555 0.4273 0.2989 0.0323  -0.0146 0.0042  163 ALA A O     
233  C CB    . ALA A 30 ? 0.3237 0.4793 0.3658 0.0344  -0.0014 0.0204  163 ALA A CB    
234  N N     . LEU A 31 ? 0.2824 0.4549 0.3512 0.0241  -0.0101 0.0029  164 LEU A N     
235  C CA    . LEU A 31 ? 0.3186 0.5026 0.3967 0.0223  -0.0126 -0.0010 164 LEU A CA    
236  C C     . LEU A 31 ? 0.2829 0.4714 0.3584 0.0269  -0.0075 0.0030  164 LEU A C     
237  O O     . LEU A 31 ? 0.3117 0.5053 0.3841 0.0300  -0.0114 0.0005  164 LEU A O     
238  C CB    . LEU A 31 ? 0.3330 0.5223 0.4319 0.0149  -0.0119 -0.0049 164 LEU A CB    
239  C CG    . LEU A 31 ? 0.4030 0.5903 0.5030 0.0108  -0.0187 -0.0130 164 LEU A CG    
240  C CD1   . LEU A 31 ? 0.4912 0.6840 0.6113 0.0025  -0.0192 -0.0191 164 LEU A CD1   
241  C CD2   . LEU A 31 ? 0.4152 0.6087 0.5043 0.0132  -0.0276 -0.0172 164 LEU A CD2   
242  N N     . PRO A 32 ? 0.3229 0.5087 0.3989 0.0282  0.0020  0.0096  165 PRO A N     
243  C CA    . PRO A 32 ? 0.3760 0.5666 0.4485 0.0333  0.0084  0.0125  165 PRO A CA    
244  C C     . PRO A 32 ? 0.3662 0.5513 0.4167 0.0398  0.0049  0.0107  165 PRO A C     
245  O O     . PRO A 32 ? 0.3023 0.4912 0.3512 0.0441  0.0063  0.0087  165 PRO A O     
246  C CB    . PRO A 32 ? 0.4015 0.5886 0.4742 0.0333  0.0198  0.0210  165 PRO A CB    
247  C CG    . PRO A 32 ? 0.4173 0.6002 0.5039 0.0264  0.0197  0.0221  165 PRO A CG    
248  C CD    . PRO A 32 ? 0.3398 0.5181 0.4205 0.0254  0.0086  0.0154  165 PRO A CD    
249  N N     . GLU A 33 ? 0.3058 0.4823 0.3417 0.0404  0.0001  0.0109  166 GLU A N     
250  C CA    . GLU A 33 ? 0.3104 0.4821 0.3279 0.0446  -0.0048 0.0080  166 GLU A CA    
251  C C     . GLU A 33 ? 0.2642 0.4379 0.2847 0.0440  -0.0123 0.0020  166 GLU A C     
252  O O     . GLU A 33 ? 0.3132 0.4838 0.3241 0.0477  -0.0137 -0.0008 166 GLU A O     
253  C CB    . GLU A 33 ? 0.3285 0.4938 0.3339 0.0446  -0.0092 0.0099  166 GLU A CB    
254  C CG    . GLU A 33 ? 0.3733 0.5354 0.3708 0.0471  -0.0023 0.0179  166 GLU A CG    
255  C CD    . GLU A 33 ? 0.4558 0.6134 0.4439 0.0483  -0.0075 0.0213  166 GLU A CD    
256  O OE1   . GLU A 33 ? 0.3559 0.5129 0.3520 0.0457  -0.0130 0.0191  166 GLU A OE1   
257  O OE2   . GLU A 33 ? 0.4307 0.5863 0.4037 0.0524  -0.0055 0.0268  166 GLU A OE2   
258  N N     . ARG A 34 ? 0.2631 0.4407 0.2951 0.0395  -0.0175 0.0001  167 ARG A N     
259  C CA    . ARG A 34 ? 0.2252 0.4051 0.2586 0.0390  -0.0245 -0.0035 167 ARG A CA    
260  C C     . ARG A 34 ? 0.2157 0.4023 0.2583 0.0421  -0.0222 -0.0037 167 ARG A C     
261  O O     . ARG A 34 ? 0.2262 0.4107 0.2651 0.0456  -0.0249 -0.0051 167 ARG A O     
262  C CB    . ARG A 34 ? 0.2033 0.3876 0.2455 0.0338  -0.0292 -0.0056 167 ARG A CB    
263  C CG    . ARG A 34 ? 0.2394 0.4274 0.2812 0.0335  -0.0362 -0.0080 167 ARG A CG    
264  C CD    . ARG A 34 ? 0.2124 0.4052 0.2600 0.0286  -0.0397 -0.0111 167 ARG A CD    
265  N NE    . ARG A 34 ? 0.2296 0.4326 0.2921 0.0259  -0.0399 -0.0130 167 ARG A NE    
266  C CZ    . ARG A 34 ? 0.2887 0.4970 0.3571 0.0211  -0.0434 -0.0178 167 ARG A CZ    
267  N NH1   . ARG A 34 ? 0.2781 0.4812 0.3384 0.0194  -0.0450 -0.0208 167 ARG A NH1   
268  N NH2   . ARG A 34 ? 0.2243 0.4439 0.3075 0.0179  -0.0452 -0.0203 167 ARG A NH2   
269  N N     . ALA A 35 ? 0.2678 0.4625 0.3247 0.0407  -0.0172 -0.0021 168 ALA A N     
270  C CA    . ALA A 35 ? 0.2682 0.4724 0.3377 0.0444  -0.0143 -0.0017 168 ALA A CA    
271  C C     . ALA A 35 ? 0.3076 0.5055 0.3663 0.0518  -0.0085 -0.0017 168 ALA A C     
272  O O     . ALA A 35 ? 0.3167 0.5145 0.3765 0.0564  -0.0107 -0.0031 168 ALA A O     
273  C CB    . ALA A 35 ? 0.3231 0.5380 0.4117 0.0408  -0.0084 0.0003  168 ALA A CB    
274  N N     . GLU A 36 ? 0.3104 0.5019 0.3570 0.0531  -0.0014 -0.0001 169 GLU A N     
275  C CA    . GLU A 36 ? 0.3498 0.5347 0.3823 0.0599  0.0044  -0.0019 169 GLU A CA    
276  C C     . GLU A 36 ? 0.3191 0.4929 0.3375 0.0620  -0.0028 -0.0070 169 GLU A C     
277  O O     . GLU A 36 ? 0.3132 0.4828 0.3289 0.0677  -0.0004 -0.0105 169 GLU A O     
278  C CB    . GLU A 36 ? 0.3976 0.5780 0.4150 0.0603  0.0113  0.0011  169 GLU A CB    
279  C CG    . GLU A 36 ? 0.5197 0.6953 0.5208 0.0673  0.0189  -0.0013 169 GLU A CG    
280  C CD    . GLU A 36 ? 0.5779 0.7499 0.5604 0.0678  0.0241  0.0028  169 GLU A CD    
281  O OE1   . GLU A 36 ? 0.5495 0.7170 0.5239 0.0641  0.0171  0.0048  169 GLU A OE1   
282  O OE2   . GLU A 36 ? 0.6849 0.8594 0.6608 0.0724  0.0354  0.0048  169 GLU A OE2   
283  N N     . LEU A 37 ? 0.3153 0.4838 0.3260 0.0573  -0.0109 -0.0076 170 LEU A N     
284  C CA    . LEU A 37 ? 0.2985 0.4571 0.2986 0.0574  -0.0177 -0.0118 170 LEU A CA    
285  C C     . LEU A 37 ? 0.2876 0.4463 0.2981 0.0588  -0.0219 -0.0124 170 LEU A C     
286  O O     . LEU A 37 ? 0.2958 0.4450 0.3013 0.0622  -0.0225 -0.0158 170 LEU A O     
287  C CB    . LEU A 37 ? 0.2981 0.4550 0.2924 0.0518  -0.0247 -0.0110 170 LEU A CB    
288  C CG    . LEU A 37 ? 0.3257 0.4746 0.3123 0.0497  -0.0321 -0.0145 170 LEU A CG    
289  C CD1   . LEU A 37 ? 0.4271 0.5666 0.3985 0.0528  -0.0306 -0.0200 170 LEU A CD1   
290  C CD2   . LEU A 37 ? 0.3073 0.4587 0.2927 0.0447  -0.0375 -0.0128 170 LEU A CD2   
291  N N     . ALA A 38 ? 0.2770 0.4460 0.3015 0.0560  -0.0251 -0.0089 171 ALA A N     
292  C CA    . ALA A 38 ? 0.2731 0.4451 0.3073 0.0578  -0.0295 -0.0073 171 ALA A CA    
293  C C     . ALA A 38 ? 0.2658 0.4385 0.3080 0.0659  -0.0240 -0.0074 171 ALA A C     
294  O O     . ALA A 38 ? 0.2809 0.4450 0.3220 0.0703  -0.0254 -0.0079 171 ALA A O     
295  C CB    . ALA A 38 ? 0.2564 0.4423 0.3030 0.0535  -0.0338 -0.0046 171 ALA A CB    
296  N N     . ALA A 39 ? 0.2860 0.4684 0.3373 0.0680  -0.0169 -0.0067 172 ALA A N     
297  C CA    . ALA A 39 ? 0.3446 0.5300 0.4055 0.0766  -0.0097 -0.0069 172 ALA A CA    
298  C C     . ALA A 39 ? 0.3630 0.5312 0.4081 0.0823  -0.0050 -0.0125 172 ALA A C     
299  O O     . ALA A 39 ? 0.3846 0.5473 0.4346 0.0892  -0.0040 -0.0135 172 ALA A O     
300  C CB    . ALA A 39 ? 0.3531 0.5530 0.4269 0.0768  -0.0012 -0.0049 172 ALA A CB    
301  N N     . SER A 40 ? 0.3686 0.5271 0.3942 0.0789  -0.0041 -0.0163 173 SER A N     
302  C CA    . SER A 40 ? 0.3696 0.5122 0.3778 0.0828  -0.0010 -0.0237 173 SER A CA    
303  C C     . SER A 40 ? 0.3792 0.5072 0.3848 0.0826  -0.0081 -0.0267 173 SER A C     
304  O O     . SER A 40 ? 0.3922 0.5057 0.3890 0.0869  -0.0053 -0.0338 173 SER A O     
305  C CB    . SER A 40 ? 0.4350 0.5734 0.4225 0.0786  -0.0007 -0.0265 173 SER A CB    
306  O OG    . SER A 40 ? 0.4828 0.6162 0.4640 0.0715  -0.0109 -0.0265 173 SER A OG    
307  N N     . LEU A 41 ? 0.3674 0.4985 0.3803 0.0774  -0.0166 -0.0215 174 LEU A N     
308  C CA    . LEU A 41 ? 0.3882 0.5061 0.3990 0.0754  -0.0230 -0.0220 174 LEU A CA    
309  C C     . LEU A 41 ? 0.3750 0.4964 0.4023 0.0797  -0.0254 -0.0149 174 LEU A C     
310  O O     . LEU A 41 ? 0.4558 0.5665 0.4834 0.0788  -0.0298 -0.0127 174 LEU A O     
311  C CB    . LEU A 41 ? 0.4140 0.5330 0.4179 0.0660  -0.0305 -0.0206 174 LEU A CB    
312  C CG    . LEU A 41 ? 0.4180 0.5337 0.4059 0.0617  -0.0308 -0.0263 174 LEU A CG    
313  C CD1   . LEU A 41 ? 0.4536 0.5724 0.4397 0.0536  -0.0382 -0.0237 174 LEU A CD1   
314  C CD2   . LEU A 41 ? 0.4603 0.5600 0.4360 0.0637  -0.0293 -0.0355 174 LEU A CD2   
315  N N     . GLY A 42 ? 0.4174 0.5543 0.4589 0.0845  -0.0226 -0.0106 175 GLY A N     
316  C CA    . GLY A 42 ? 0.4011 0.5442 0.4580 0.0894  -0.0261 -0.0032 175 GLY A CA    
317  C C     . GLY A 42 ? 0.3163 0.4669 0.3734 0.0826  -0.0353 0.0029  175 GLY A C     
318  O O     . GLY A 42 ? 0.3754 0.5238 0.4370 0.0850  -0.0401 0.0095  175 GLY A O     
319  N N     . LEU A 43 ? 0.2797 0.4387 0.3313 0.0747  -0.0372 0.0012  176 LEU A N     
320  C CA    . LEU A 43 ? 0.2699 0.4364 0.3198 0.0682  -0.0446 0.0052  176 LEU A CA    
321  C C     . LEU A 43 ? 0.2358 0.4214 0.2948 0.0655  -0.0462 0.0058  176 LEU A C     
322  O O     . LEU A 43 ? 0.2938 0.4854 0.3585 0.0659  -0.0409 0.0028  176 LEU A O     
323  C CB    . LEU A 43 ? 0.2701 0.4279 0.3058 0.0604  -0.0459 0.0018  176 LEU A CB    
324  C CG    . LEU A 43 ? 0.3559 0.4951 0.3833 0.0600  -0.0461 0.0005  176 LEU A CG    
325  C CD1   . LEU A 43 ? 0.3471 0.4827 0.3637 0.0524  -0.0475 -0.0034 176 LEU A CD1   
326  C CD2   . LEU A 43 ? 0.4013 0.5360 0.4320 0.0612  -0.0499 0.0079  176 LEU A CD2   
327  N N     . THR A 44 ? 0.2386 0.4336 0.2981 0.0618  -0.0533 0.0092  177 THR A N     
328  C CA    . THR A 44 ? 0.2377 0.4481 0.3032 0.0566  -0.0555 0.0068  177 THR A CA    
329  C C     . THR A 44 ? 0.2530 0.4581 0.3091 0.0496  -0.0532 0.0019  177 THR A C     
330  O O     . THR A 44 ? 0.2489 0.4423 0.2929 0.0477  -0.0530 0.0013  177 THR A O     
331  C CB    . THR A 44 ? 0.2197 0.4432 0.2870 0.0551  -0.0642 0.0102  177 THR A CB    
332  O OG1   . THR A 44 ? 0.2116 0.4282 0.2640 0.0508  -0.0668 0.0109  177 THR A OG1   
333  C CG2   . THR A 44 ? 0.2613 0.4897 0.3368 0.0632  -0.0676 0.0175  177 THR A CG2   
334  N N     . GLN A 45 ? 0.2472 0.4614 0.3109 0.0457  -0.0518 -0.0012 178 GLN A N     
335  C CA    . GLN A 45 ? 0.2228 0.4330 0.2801 0.0397  -0.0504 -0.0050 178 GLN A CA    
336  C C     . GLN A 45 ? 0.2558 0.4656 0.3040 0.0361  -0.0557 -0.0057 178 GLN A C     
337  O O     . GLN A 45 ? 0.1959 0.3982 0.2358 0.0334  -0.0540 -0.0074 178 GLN A O     
338  C CB    . GLN A 45 ? 0.2493 0.4684 0.3192 0.0358  -0.0479 -0.0077 178 GLN A CB    
339  C CG    . GLN A 45 ? 0.2647 0.4826 0.3413 0.0389  -0.0396 -0.0062 178 GLN A CG    
340  C CD    . GLN A 45 ? 0.3006 0.5262 0.3913 0.0340  -0.0360 -0.0076 178 GLN A CD    
341  O OE1   . GLN A 45 ? 0.2797 0.4990 0.3673 0.0295  -0.0336 -0.0091 178 GLN A OE1   
342  N NE2   . GLN A 45 ? 0.2679 0.5078 0.3769 0.0344  -0.0358 -0.0069 178 GLN A NE2   
343  N N     . THR A 46 ? 0.1863 0.4054 0.2355 0.0364  -0.0620 -0.0039 179 THR A N     
344  C CA    . THR A 46 ? 0.2278 0.4466 0.2657 0.0338  -0.0656 -0.0036 179 THR A CA    
345  C C     . THR A 46 ? 0.2632 0.4698 0.2909 0.0352  -0.0640 0.0005  179 THR A C     
346  O O     . THR A 46 ? 0.2381 0.4414 0.2580 0.0317  -0.0631 -0.0009 179 THR A O     
347  C CB    . THR A 46 ? 0.3052 0.5376 0.3436 0.0345  -0.0729 -0.0016 179 THR A CB    
348  O OG1   . THR A 46 ? 0.2691 0.5134 0.3185 0.0313  -0.0750 -0.0074 179 THR A OG1   
349  C CG2   . THR A 46 ? 0.3358 0.5691 0.3605 0.0317  -0.0751 -0.0017 179 THR A CG2   
350  N N     . GLN A 47 ? 0.2317 0.4320 0.2612 0.0399  -0.0634 0.0050  180 GLN A N     
351  C CA    . GLN A 47 ? 0.3092 0.4963 0.3314 0.0400  -0.0620 0.0080  180 GLN A CA    
352  C C     . GLN A 47 ? 0.2852 0.4650 0.3040 0.0370  -0.0582 0.0028  180 GLN A C     
353  O O     . GLN A 47 ? 0.2540 0.4296 0.2671 0.0335  -0.0582 0.0028  180 GLN A O     
354  C CB    . GLN A 47 ? 0.3320 0.5105 0.3580 0.0458  -0.0610 0.0118  180 GLN A CB    
355  C CG    . GLN A 47 ? 0.3433 0.5271 0.3721 0.0500  -0.0652 0.0199  180 GLN A CG    
356  C CD    . GLN A 47 ? 0.3279 0.5024 0.3634 0.0572  -0.0633 0.0231  180 GLN A CD    
357  O OE1   . GLN A 47 ? 0.2786 0.4563 0.3227 0.0615  -0.0608 0.0199  180 GLN A OE1   
358  N NE2   . GLN A 47 ? 0.3913 0.5538 0.4240 0.0589  -0.0637 0.0298  180 GLN A NE2   
359  N N     . VAL A 48 ? 0.2628 0.4423 0.2854 0.0385  -0.0549 -0.0007 181 VAL A N     
360  C CA    . VAL A 48 ? 0.2563 0.4298 0.2738 0.0364  -0.0519 -0.0042 181 VAL A CA    
361  C C     . VAL A 48 ? 0.2944 0.4727 0.3106 0.0321  -0.0526 -0.0058 181 VAL A C     
362  O O     . VAL A 48 ? 0.2625 0.4370 0.2740 0.0302  -0.0527 -0.0064 181 VAL A O     
363  C CB    . VAL A 48 ? 0.2783 0.4508 0.2981 0.0395  -0.0471 -0.0061 181 VAL A CB    
364  C CG1   . VAL A 48 ? 0.2614 0.4301 0.2749 0.0380  -0.0447 -0.0079 181 VAL A CG1   
365  C CG2   . VAL A 48 ? 0.2929 0.4586 0.3123 0.0446  -0.0450 -0.0060 181 VAL A CG2   
366  N N     . LYS A 49 ? 0.2315 0.4184 0.2528 0.0307  -0.0532 -0.0072 182 LYS A N     
367  C CA    . LYS A 49 ? 0.2933 0.4833 0.3143 0.0274  -0.0529 -0.0102 182 LYS A CA    
368  C C     . LYS A 49 ? 0.2293 0.4198 0.2441 0.0258  -0.0545 -0.0090 182 LYS A C     
369  O O     . LYS A 49 ? 0.2312 0.4208 0.2449 0.0246  -0.0528 -0.0104 182 LYS A O     
370  C CB    . LYS A 49 ? 0.3138 0.5128 0.3413 0.0255  -0.0543 -0.0137 182 LYS A CB    
371  C CG    . LYS A 49 ? 0.3190 0.5194 0.3466 0.0223  -0.0533 -0.0190 182 LYS A CG    
372  C CD    . LYS A 49 ? 0.3355 0.5450 0.3690 0.0195  -0.0563 -0.0242 182 LYS A CD    
373  C CE    . LYS A 49 ? 0.4360 0.6542 0.4618 0.0196  -0.0617 -0.0237 182 LYS A CE    
374  N NZ    . LYS A 49 ? 0.4923 0.7208 0.5229 0.0163  -0.0661 -0.0303 182 LYS A NZ    
375  N N     . ILE A 50 ? 0.2393 0.4319 0.2511 0.0263  -0.0572 -0.0053 183 ILE A N     
376  C CA    . ILE A 50 ? 0.2394 0.4333 0.2455 0.0244  -0.0575 -0.0024 183 ILE A CA    
377  C C     . ILE A 50 ? 0.2484 0.4344 0.2542 0.0232  -0.0563 -0.0003 183 ILE A C     
378  O O     . ILE A 50 ? 0.2331 0.4217 0.2384 0.0207  -0.0548 0.0000  183 ILE A O     
379  C CB    . ILE A 50 ? 0.2419 0.4401 0.2440 0.0255  -0.0604 0.0030  183 ILE A CB    
380  C CG1   . ILE A 50 ? 0.2968 0.5061 0.2981 0.0255  -0.0630 -0.0007 183 ILE A CG1   
381  C CG2   . ILE A 50 ? 0.2355 0.4339 0.2318 0.0233  -0.0590 0.0081  183 ILE A CG2   
382  C CD1   . ILE A 50 ? 0.3618 0.5753 0.3606 0.0226  -0.0608 -0.0077 183 ILE A CD1   
383  N N     . TRP A 51 ? 0.2357 0.4136 0.2427 0.0250  -0.0568 0.0000  184 TRP A N     
384  C CA    . TRP A 51 ? 0.2499 0.4202 0.2563 0.0231  -0.0570 -0.0002 184 TRP A CA    
385  C C     . TRP A 51 ? 0.2329 0.4065 0.2401 0.0220  -0.0564 -0.0034 184 TRP A C     
386  O O     . TRP A 51 ? 0.2321 0.4079 0.2413 0.0189  -0.0571 -0.0028 184 TRP A O     
387  C CB    . TRP A 51 ? 0.2546 0.4148 0.2599 0.0256  -0.0574 -0.0013 184 TRP A CB    
388  C CG    . TRP A 51 ? 0.2203 0.3722 0.2242 0.0227  -0.0588 -0.0030 184 TRP A CG    
389  C CD1   . TRP A 51 ? 0.2765 0.4205 0.2820 0.0201  -0.0597 -0.0006 184 TRP A CD1   
390  C CD2   . TRP A 51 ? 0.2272 0.3789 0.2286 0.0213  -0.0602 -0.0074 184 TRP A CD2   
391  N NE1   . TRP A 51 ? 0.3024 0.4409 0.3076 0.0162  -0.0619 -0.0049 184 TRP A NE1   
392  C CE2   . TRP A 51 ? 0.2683 0.4128 0.2702 0.0171  -0.0629 -0.0090 184 TRP A CE2   
393  C CE3   . TRP A 51 ? 0.2328 0.3896 0.2318 0.0232  -0.0597 -0.0094 184 TRP A CE3   
394  C CZ2   . TRP A 51 ? 0.2468 0.3911 0.2462 0.0146  -0.0665 -0.0139 184 TRP A CZ2   
395  C CZ3   . TRP A 51 ? 0.2408 0.3972 0.2361 0.0218  -0.0630 -0.0125 184 TRP A CZ3   
396  C CH2   . TRP A 51 ? 0.2306 0.3818 0.2258 0.0176  -0.0668 -0.0152 184 TRP A CH2   
397  N N     . PHE A 52 ? 0.2078 0.3828 0.2154 0.0245  -0.0549 -0.0059 185 PHE A N     
398  C CA    . PHE A 52 ? 0.2357 0.4134 0.2449 0.0248  -0.0539 -0.0072 185 PHE A CA    
399  C C     . PHE A 52 ? 0.2549 0.4398 0.2679 0.0234  -0.0527 -0.0075 185 PHE A C     
400  O O     . PHE A 52 ? 0.1909 0.3788 0.2068 0.0232  -0.0530 -0.0070 185 PHE A O     
401  C CB    . PHE A 52 ? 0.2243 0.4001 0.2339 0.0276  -0.0514 -0.0082 185 PHE A CB    
402  C CG    . PHE A 52 ? 0.2734 0.4434 0.2772 0.0298  -0.0515 -0.0079 185 PHE A CG    
403  C CD1   . PHE A 52 ? 0.2627 0.4278 0.2634 0.0312  -0.0512 -0.0087 185 PHE A CD1   
404  C CD2   . PHE A 52 ? 0.2715 0.4413 0.2723 0.0313  -0.0518 -0.0069 185 PHE A CD2   
405  C CE1   . PHE A 52 ? 0.2887 0.4482 0.2818 0.0336  -0.0504 -0.0101 185 PHE A CE1   
406  C CE2   . PHE A 52 ? 0.2617 0.4271 0.2537 0.0336  -0.0520 -0.0071 185 PHE A CE2   
407  C CZ    . PHE A 52 ? 0.2647 0.4248 0.2520 0.0345  -0.0511 -0.0094 185 PHE A CZ    
408  N N     . GLN A 53 ? 0.2260 0.4151 0.2389 0.0227  -0.0513 -0.0085 186 GLN A N     
409  C CA    . GLN A 53 ? 0.2372 0.4332 0.2512 0.0217  -0.0491 -0.0096 186 GLN A CA    
410  C C     . GLN A 53 ? 0.2318 0.4309 0.2469 0.0192  -0.0492 -0.0058 186 GLN A C     
411  O O     . GLN A 53 ? 0.2924 0.4974 0.3128 0.0192  -0.0470 -0.0060 186 GLN A O     
412  C CB    . GLN A 53 ? 0.2804 0.4810 0.2899 0.0210  -0.0487 -0.0115 186 GLN A CB    
413  C CG    . GLN A 53 ? 0.2990 0.4989 0.3102 0.0217  -0.0489 -0.0166 186 GLN A CG    
414  C CD    . GLN A 53 ? 0.2889 0.4956 0.2952 0.0205  -0.0502 -0.0202 186 GLN A CD    
415  O OE1   . GLN A 53 ? 0.3082 0.5207 0.3069 0.0199  -0.0505 -0.0179 186 GLN A OE1   
416  N NE2   . GLN A 53 ? 0.2940 0.5008 0.3044 0.0197  -0.0510 -0.0257 186 GLN A NE2   
417  N N     . ASN A 54 ? 0.2232 0.4189 0.2355 0.0172  -0.0512 -0.0019 187 ASN A N     
418  C CA    . ASN A 54 ? 0.2674 0.4654 0.2825 0.0136  -0.0505 0.0021  187 ASN A CA    
419  C C     . ASN A 54 ? 0.2149 0.4123 0.2369 0.0118  -0.0529 0.0013  187 ASN A C     
420  O O     . ASN A 54 ? 0.3060 0.5108 0.3353 0.0091  -0.0518 0.0028  187 ASN A O     
421  C CB    . ASN A 54 ? 0.2518 0.4440 0.2632 0.0120  -0.0515 0.0073  187 ASN A CB    
422  C CG    . ASN A 54 ? 0.2621 0.4601 0.2662 0.0133  -0.0496 0.0102  187 ASN A CG    
423  O OD1   . ASN A 54 ? 0.2696 0.4765 0.2719 0.0131  -0.0462 0.0090  187 ASN A OD1   
424  N ND2   . ASN A 54 ? 0.3466 0.5401 0.3464 0.0151  -0.0520 0.0136  187 ASN A ND2   
425  N N     . LYS A 55 ? 0.2146 0.4049 0.2341 0.0136  -0.0563 -0.0013 188 LYS A N     
426  C CA    . LYS A 55 ? 0.2728 0.4636 0.2959 0.0123  -0.0601 -0.0028 188 LYS A CA    
427  C C     . LYS A 55 ? 0.2382 0.4392 0.2677 0.0148  -0.0594 -0.0030 188 LYS A C     
428  O O     . LYS A 55 ? 0.2892 0.4976 0.3266 0.0126  -0.0617 -0.0023 188 LYS A O     
429  C CB    . LYS A 55 ? 0.2497 0.4308 0.2651 0.0146  -0.0630 -0.0057 188 LYS A CB    
430  C CG    . LYS A 55 ? 0.2583 0.4403 0.2734 0.0135  -0.0683 -0.0082 188 LYS A CG    
431  C CD    . LYS A 55 ? 0.2931 0.4738 0.3135 0.0066  -0.0720 -0.0093 188 LYS A CD    
432  C CE    . LYS A 55 ? 0.3149 0.4992 0.3351 0.0046  -0.0792 -0.0133 188 LYS A CE    
433  N NZ    . LYS A 55 ? 0.2878 0.4678 0.3134 -0.0032 -0.0833 -0.0164 188 LYS A NZ    
434  N N     . ARG A 56 ? 0.2483 0.4498 0.2764 0.0193  -0.0558 -0.0040 189 ARG A N     
435  C CA    . ARG A 56 ? 0.2669 0.4753 0.3020 0.0229  -0.0539 -0.0040 189 ARG A CA    
436  C C     . ARG A 56 ? 0.2938 0.5130 0.3375 0.0212  -0.0503 -0.0031 189 ARG A C     
437  O O     . ARG A 56 ? 0.2249 0.4538 0.2793 0.0228  -0.0504 -0.0018 189 ARG A O     
438  C CB    . ARG A 56 ? 0.2289 0.4320 0.2614 0.0271  -0.0503 -0.0060 189 ARG A CB    
439  C CG    . ARG A 56 ? 0.2022 0.3976 0.2292 0.0294  -0.0524 -0.0051 189 ARG A CG    
440  C CD    . ARG A 56 ? 0.2064 0.3973 0.2355 0.0332  -0.0482 -0.0055 189 ARG A CD    
441  N NE    . ARG A 56 ? 0.1876 0.3762 0.2157 0.0310  -0.0450 -0.0097 189 ARG A NE    
442  C CZ    . ARG A 56 ? 0.2624 0.4465 0.2869 0.0297  -0.0450 -0.0108 189 ARG A CZ    
443  N NH1   . ARG A 56 ? 0.2112 0.3907 0.2319 0.0308  -0.0458 -0.0081 189 ARG A NH1   
444  N NH2   . ARG A 56 ? 0.2267 0.4123 0.2517 0.0276  -0.0438 -0.0149 189 ARG A NH2   
445  N N     . SER A 57 ? 0.2566 0.4757 0.2962 0.0184  -0.0471 -0.0029 190 SER A N     
446  C CA    . SER A 57 ? 0.2734 0.5030 0.3188 0.0166  -0.0422 -0.0013 190 SER A CA    
447  C C     . SER A 57 ? 0.2341 0.4704 0.2896 0.0116  -0.0446 0.0026  190 SER A C     
448  O O     . SER A 57 ? 0.3014 0.5506 0.3689 0.0112  -0.0410 0.0042  190 SER A O     
449  C CB    . SER A 57 ? 0.3134 0.5410 0.3484 0.0149  -0.0389 -0.0006 190 SER A CB    
450  O OG    . SER A 57 ? 0.5256 0.7640 0.5639 0.0139  -0.0325 0.0011  190 SER A OG    
451  N N     . LYS A 58 ? 0.2336 0.4618 0.2863 0.0074  -0.0501 0.0036  191 LYS A N     
452  C CA    . LYS A 58 ? 0.3081 0.5410 0.3717 0.0009  -0.0537 0.0057  191 LYS A CA    
453  C C     . LYS A 58 ? 0.2903 0.5350 0.3658 0.0028  -0.0576 0.0044  191 LYS A C     
454  O O     . LYS A 58 ? 0.2508 0.5097 0.3419 -0.0004 -0.0566 0.0067  191 LYS A O     
455  C CB    . LYS A 58 ? 0.2989 0.5182 0.3563 -0.0026 -0.0597 0.0041  191 LYS A CB    
456  C CG    . LYS A 58 ? 0.3194 0.5404 0.3878 -0.0111 -0.0633 0.0049  191 LYS A CG    
457  C CD    . LYS A 58 ? 0.3442 0.5522 0.4059 -0.0129 -0.0707 -0.0003 191 LYS A CD    
458  C CE    . LYS A 58 ? 0.4346 0.6437 0.5082 -0.0223 -0.0758 -0.0021 191 LYS A CE    
459  N NZ    . LYS A 58 ? 0.3806 0.5806 0.4593 -0.0293 -0.0719 0.0019  191 LYS A NZ    
460  N N     . ILE A 59 ? 0.2927 0.5327 0.3616 0.0083  -0.0616 0.0018  192 ILE A N     
461  C CA    . ILE A 59 ? 0.3134 0.5643 0.3915 0.0121  -0.0663 0.0022  192 ILE A CA    
462  C C     . ILE A 59 ? 0.3445 0.6089 0.4359 0.0168  -0.0600 0.0043  192 ILE A C     
463  O O     . ILE A 59 ? 0.2575 0.5376 0.3650 0.0171  -0.0628 0.0063  192 ILE A O     
464  C CB    . ILE A 59 ? 0.3574 0.5994 0.4236 0.0186  -0.0696 0.0011  192 ILE A CB    
465  C CG1   . ILE A 59 ? 0.3295 0.5591 0.3818 0.0156  -0.0748 -0.0017 192 ILE A CG1   
466  C CG2   . ILE A 59 ? 0.3623 0.6161 0.4373 0.0236  -0.0744 0.0037  192 ILE A CG2   
467  C CD1   . ILE A 59 ? 0.3220 0.5515 0.3772 0.0074  -0.0800 -0.0041 192 ILE A CD1   
468  N N     . LYS A 60 ? 0.2366 0.4960 0.3223 0.0209  -0.0519 0.0031  193 LYS A N     
469  C CA    . LYS A 60 ? 0.2677 0.5372 0.3642 0.0264  -0.0448 0.0032  193 LYS A CA    
470  C C     . LYS A 60 ? 0.2823 0.5673 0.3924 0.0220  -0.0405 0.0056  193 LYS A C     
471  O O     . LYS A 60 ? 0.3049 0.6046 0.4315 0.0259  -0.0377 0.0070  193 LYS A O     
472  C CB    . LYS A 60 ? 0.2767 0.5365 0.3624 0.0302  -0.0372 -0.0008 193 LYS A CB    
473  C CG    . LYS A 60 ? 0.3077 0.5734 0.4030 0.0377  -0.0298 -0.0030 193 LYS A CG    
474  C CD    . LYS A 60 ? 0.4312 0.6917 0.5311 0.0452  -0.0327 -0.0020 193 LYS A CD    
475  N N     . LYS A 61 ? 0.2852 0.5669 0.3892 0.0144  -0.0388 0.0068  194 LYS A N     
476  C CA    A LYS A 61 ? 0.3070 0.6027 0.4239 0.0092  -0.0332 0.0107  194 LYS A CA    
477  C CA    B LYS A 61 ? 0.3048 0.6001 0.4214 0.0089  -0.0334 0.0108  194 LYS A CA    
478  C C     . LYS A 61 ? 0.2858 0.5949 0.4226 0.0045  -0.0401 0.0132  194 LYS A C     
479  O O     . LYS A 61 ? 0.2733 0.6010 0.4293 0.0038  -0.0353 0.0160  194 LYS A O     
480  C CB    A LYS A 61 ? 0.3428 0.6303 0.4483 0.0027  -0.0297 0.0135  194 LYS A CB    
481  C CB    B LYS A 61 ? 0.3360 0.6220 0.4413 0.0018  -0.0312 0.0136  194 LYS A CB    
482  C CG    A LYS A 61 ? 0.4026 0.6849 0.4916 0.0072  -0.0219 0.0115  194 LYS A CG    
483  C CG    B LYS A 61 ? 0.4139 0.6929 0.5015 0.0055  -0.0241 0.0122  194 LYS A CG    
484  C CD    A LYS A 61 ? 0.4657 0.7414 0.5429 0.0017  -0.0194 0.0163  194 LYS A CD    
485  C CD    B LYS A 61 ? 0.4252 0.6910 0.4985 0.0007  -0.0260 0.0153  194 LYS A CD    
486  C CE    A LYS A 61 ? 0.5263 0.7940 0.5831 0.0061  -0.0169 0.0132  194 LYS A CE    
487  C CE    B LYS A 61 ? 0.5008 0.7635 0.5567 0.0043  -0.0203 0.0144  194 LYS A CE    
488  N NZ    A LYS A 61 ? 0.4657 0.7442 0.5190 0.0098  -0.0068 0.0112  194 LYS A NZ    
489  N NZ    B LYS A 61 ? 0.4427 0.6934 0.4849 0.0018  -0.0234 0.0181  194 LYS A NZ    
490  N N     . ILE A 62 ? 0.2290 0.5305 0.3621 0.0014  -0.0510 0.0115  195 ILE A N     
491  C CA    . ILE A 62 ? 0.2794 0.5958 0.4312 -0.0028 -0.0598 0.0122  195 ILE A CA    
492  C C     . ILE A 62 ? 0.2398 0.5728 0.4058 0.0062  -0.0600 0.0134  195 ILE A C     
493  O O     . ILE A 62 ? 0.2477 0.6024 0.4374 0.0047  -0.0595 0.0162  195 ILE A O     
494  C CB    . ILE A 62 ? 0.3002 0.6051 0.4415 -0.0063 -0.0720 0.0083  195 ILE A CB    
495  C CG1   . ILE A 62 ? 0.3649 0.6545 0.4977 -0.0154 -0.0715 0.0073  195 ILE A CG1   
496  C CG2   . ILE A 62 ? 0.3089 0.6309 0.4671 -0.0096 -0.0831 0.0076  195 ILE A CG2   
497  C CD1   . ILE A 62 ? 0.3811 0.6520 0.4942 -0.0142 -0.0783 0.0024  195 ILE A CD1   
498  N N     . MET A 63 ? 0.2603 0.5840 0.4144 0.0161  -0.0598 0.0121  196 MET A N     
499  C CA    . MET A 63 ? 0.3311 0.6669 0.4981 0.0264  -0.0595 0.0143  196 MET A CA    
500  C C     . MET A 63 ? 0.3180 0.6710 0.5047 0.0294  -0.0486 0.0161  196 MET A C     
501  O O     . MET A 63 ? 0.2515 0.6238 0.4597 0.0342  -0.0506 0.0193  196 MET A O     
502  C CB    . MET A 63 ? 0.3879 0.7073 0.5395 0.0359  -0.0575 0.0132  196 MET A CB    
503  C CG    . MET A 63 ? 0.5121 0.8200 0.6485 0.0364  -0.0678 0.0133  196 MET A CG    
504  S SD    . MET A 63 ? 0.6853 0.9724 0.8049 0.0455  -0.0635 0.0132  196 MET A SD    
505  C CE    . MET A 63 ? 0.6459 0.9398 0.7826 0.0556  -0.0530 0.0142  196 MET A CE    
506  N N     . LYS A 64 ? 0.3068 0.6540 0.4857 0.0271  -0.0373 0.0144  197 LYS A N     
507  C CA    . LYS A 64 ? 0.2996 0.6618 0.4926 0.0302  -0.0244 0.0152  197 LYS A CA    
508  C C     . LYS A 64 ? 0.2818 0.6590 0.4882 0.0200  -0.0206 0.0191  197 LYS A C     
509  O O     . LYS A 64 ? 0.2761 0.6640 0.4893 0.0211  -0.0076 0.0202  197 LYS A O     
510  C CB    . LYS A 64 ? 0.3522 0.7000 0.5260 0.0349  -0.0133 0.0102  197 LYS A CB    
511  C CG    . LYS A 64 ? 0.4473 0.7767 0.6070 0.0428  -0.0159 0.0058  197 LYS A CG    
512  C CD    . LYS A 64 ? 0.5682 0.9040 0.7441 0.0529  -0.0189 0.0077  197 LYS A CD    
513  C CE    . LYS A 64 ? 0.6334 0.9492 0.7968 0.0606  -0.0183 0.0041  197 LYS A CE    
514  N NZ    . LYS A 64 ? 0.6836 1.0031 0.8615 0.0708  -0.0220 0.0084  197 LYS A NZ    
515  N N     . ASN A 65 ? 0.2532 0.6316 0.4644 0.0099  -0.0307 0.0211  198 ASN A N     
516  C CA    . ASN A 65 ? 0.2309 0.6211 0.4564 -0.0011 -0.0265 0.0254  198 ASN A CA    
517  C C     . ASN A 65 ? 0.2644 0.6848 0.5239 -0.0011 -0.0242 0.0291  198 ASN A C     
518  O O     . ASN A 65 ? 0.2410 0.6735 0.5125 0.0095  -0.0253 0.0285  198 ASN A O     
519  C CB    . ASN A 65 ? 0.2256 0.6024 0.4436 -0.0131 -0.0362 0.0252  198 ASN A CB    
520  C CG    . ASN A 65 ? 0.2280 0.6114 0.4578 -0.0169 -0.0519 0.0229  198 ASN A CG    
521  O OD1   . ASN A 65 ? 0.1839 0.5864 0.4316 -0.0114 -0.0570 0.0232  198 ASN A OD1   
522  N ND2   . ASN A 65 ? 0.2119 0.5796 0.4316 -0.0261 -0.0600 0.0203  198 ASN A ND2   
523  O OXT   . ASN A 65 ? 0.2228 0.6559 0.4992 -0.0115 -0.0205 0.0335  198 ASN A OXT   
524  O "O5'" . DC  B 1  ? 1.4258 1.7616 1.8234 -0.2567 -0.2302 0.0125  1   DC  B "O5'" 
525  C "C5'" . DC  B 1  ? 1.3793 1.6489 1.6909 -0.2665 -0.2146 -0.0012 1   DC  B "C5'" 
526  C "C4'" . DC  B 1  ? 1.2879 1.5475 1.5934 -0.2478 -0.1614 -0.0023 1   DC  B "C4'" 
527  O "O4'" . DC  B 1  ? 1.3796 1.5749 1.6105 -0.2589 -0.1468 -0.0135 1   DC  B "O4'" 
528  C "C3'" . DC  B 1  ? 1.1001 1.3640 1.3806 -0.2096 -0.1378 -0.0007 1   DC  B "C3'" 
529  O "O3'" . DC  B 1  ? 0.8036 1.1172 1.1591 -0.1952 -0.1162 0.0098  1   DC  B "O3'" 
530  C "C2'" . DC  B 1  ? 1.0592 1.2698 1.2676 -0.1996 -0.1052 -0.0088 1   DC  B "C2'" 
531  C "C1'" . DC  B 1  ? 1.1450 1.3095 1.3160 -0.2294 -0.1150 -0.0172 1   DC  B "C1'" 
532  N N1    . DC  B 1  ? 1.0071 1.1164 1.0914 -0.2301 -0.1278 -0.0275 1   DC  B N1    
533  C C2    . DC  B 1  ? 0.8861 0.9526 0.9084 -0.2092 -0.0979 -0.0320 1   DC  B C2    
534  O O2    . DC  B 1  ? 0.7831 0.8587 0.8200 -0.1913 -0.0672 -0.0271 1   DC  B O2    
535  N N3    . DC  B 1  ? 0.9900 1.0044 0.9378 -0.2083 -0.1029 -0.0406 1   DC  B N3    
536  C C4    . DC  B 1  ? 1.1335 1.1301 1.0553 -0.2289 -0.1363 -0.0460 1   DC  B C4    
537  N N4    . DC  B 1  ? 1.1891 1.1261 1.0303 -0.2267 -0.1345 -0.0547 1   DC  B N4    
538  C C5    . DC  B 1  ? 1.1241 1.1611 1.1016 -0.2520 -0.1730 -0.0415 1   DC  B C5    
539  C C6    . DC  B 1  ? 1.1133 1.2094 1.1769 -0.2512 -0.1673 -0.0317 1   DC  B C6    
540  P P     . DG  B 2  ? 0.7704 1.1247 1.1585 -0.1696 -0.1233 0.0176  2   DG  B P     
541  O OP1   . DG  B 2  ? 0.6343 1.0419 1.1209 -0.1693 -0.1117 0.0298  2   DG  B OP1   
542  O OP2   . DG  B 2  ? 0.7099 1.0545 1.0609 -0.1719 -0.1638 0.0151  2   DG  B OP2   
543  O "O5'" . DG  B 2  ? 0.5547 0.8849 0.8899 -0.1399 -0.0877 0.0138  2   DG  B "O5'" 
544  C "C5'" . DG  B 2  ? 0.4910 0.8026 0.8163 -0.1353 -0.0483 0.0132  2   DG  B "C5'" 
545  C "C4'" . DG  B 2  ? 0.4825 0.7552 0.7306 -0.1152 -0.0348 0.0069  2   DG  B "C4'" 
546  O "O4'" . DG  B 2  ? 0.4614 0.6940 0.6535 -0.1273 -0.0483 -0.0011 2   DG  B "O4'" 
547  C "C3'" . DG  B 2  ? 0.4432 0.7292 0.6791 -0.0943 -0.0468 0.0072  2   DG  B "C3'" 
548  O "O3'" . DG  B 2  ? 0.4033 0.6735 0.6048 -0.0723 -0.0233 0.0064  2   DG  B "O3'" 
549  C "C2'" . DG  B 2  ? 0.4277 0.6890 0.6146 -0.1011 -0.0731 0.0004  2   DG  B "C2'" 
550  C "C1'" . DG  B 2  ? 0.4743 0.6944 0.6208 -0.1111 -0.0587 -0.0049 2   DG  B "C1'" 
551  N N9    . DG  B 2  ? 0.5103 0.6947 0.6095 -0.1250 -0.0767 -0.0123 2   DG  B N9    
552  C C8    . DG  B 2  ? 0.5492 0.7340 0.6460 -0.1414 -0.1093 -0.0144 2   DG  B C8    
553  N N7    . DG  B 2  ? 0.5704 0.7068 0.6047 -0.1498 -0.1146 -0.0225 2   DG  B N7    
554  C C5    . DG  B 2  ? 0.5496 0.6576 0.5515 -0.1358 -0.0836 -0.0247 2   DG  B C5    
555  C C6    . DG  B 2  ? 0.5751 0.6284 0.5129 -0.1334 -0.0707 -0.0314 2   DG  B C6    
556  O O6    . DG  B 2  ? 0.6090 0.6213 0.4981 -0.1450 -0.0811 -0.0387 2   DG  B O6    
557  N N1    . DG  B 2  ? 0.5443 0.5876 0.4742 -0.1149 -0.0417 -0.0284 2   DG  B N1    
558  C C2    . DG  B 2  ? 0.5187 0.5938 0.4860 -0.1023 -0.0278 -0.0211 2   DG  B C2    
559  N N2    . DG  B 2  ? 0.5158 0.5695 0.4606 -0.0858 -0.0046 -0.0181 2   DG  B N2    
560  N N3    . DG  B 2  ? 0.4897 0.6098 0.5100 -0.1052 -0.0354 -0.0165 2   DG  B N3    
561  C C4    . DG  B 2  ? 0.5290 0.6664 0.5684 -0.1208 -0.0630 -0.0181 2   DG  B C4    
562  P P     . DA  B 3  ? 0.3550 0.6400 0.5536 -0.0511 -0.0265 0.0075  3   DA  B P     
563  O OP1   . DA  B 3  ? 0.2908 0.5994 0.5361 -0.0440 -0.0078 0.0138  3   DA  B OP1   
564  O OP2   . DA  B 3  ? 0.3170 0.6071 0.5046 -0.0522 -0.0562 0.0054  3   DA  B OP2   
565  O "O5'" . DA  B 3  ? 0.3361 0.5875 0.4743 -0.0362 -0.0120 0.0036  3   DA  B "O5'" 
566  C "C5'" . DA  B 3  ? 0.3404 0.5693 0.4615 -0.0338 0.0139  0.0053  3   DA  B "C5'" 
567  C "C4'" . DA  B 3  ? 0.3503 0.5438 0.4176 -0.0296 0.0148  0.0026  3   DA  B "C4'" 
568  O "O4'" . DA  B 3  ? 0.3558 0.5366 0.4180 -0.0456 0.0058  -0.0004 3   DA  B "O4'" 
569  C "C3'" . DA  B 3  ? 0.3349 0.5252 0.3733 -0.0152 0.0017  0.0003  3   DA  B "C3'" 
570  O "O3'" . DA  B 3  ? 0.2826 0.4637 0.2995 -0.0003 0.0110  0.0026  3   DA  B "O3'" 
571  C "C2'" . DA  B 3  ? 0.3427 0.5040 0.3476 -0.0168 0.0007  -0.0014 3   DA  B "C2'" 
572  C "C1'" . DA  B 3  ? 0.3892 0.5469 0.4093 -0.0376 -0.0012 -0.0036 3   DA  B "C1'" 
573  N N9    . DA  B 3  ? 0.3797 0.5421 0.4012 -0.0477 -0.0219 -0.0082 3   DA  B N9    
574  C C8    . DA  B 3  ? 0.3987 0.5888 0.4536 -0.0579 -0.0401 -0.0082 3   DA  B C8    
575  N N7    . DA  B 3  ? 0.3613 0.5388 0.3959 -0.0667 -0.0582 -0.0125 3   DA  B N7    
576  C C5    . DA  B 3  ? 0.3845 0.5237 0.3724 -0.0616 -0.0469 -0.0162 3   DA  B C5    
577  C C6    . DA  B 3  ? 0.4619 0.5654 0.4059 -0.0655 -0.0509 -0.0217 3   DA  B C6    
578  N N6    . DA  B 3  ? 0.4476 0.5438 0.3783 -0.0784 -0.0712 -0.0253 3   DA  B N6    
579  N N1    . DA  B 3  ? 0.4491 0.5201 0.3601 -0.0547 -0.0321 -0.0226 3   DA  B N1    
580  C C2    . DA  B 3  ? 0.4624 0.5373 0.3820 -0.0417 -0.0161 -0.0173 3   DA  B C2    
581  N N3    . DA  B 3  ? 0.3943 0.4958 0.3438 -0.0386 -0.0126 -0.0125 3   DA  B N3    
582  C C4    . DA  B 3  ? 0.3999 0.5329 0.3838 -0.0488 -0.0262 -0.0127 3   DA  B C4    
583  P P     . DC  B 4  ? 0.2683 0.4607 0.2782 0.0121  -0.0015 0.0012  4   DC  B P     
584  O OP1   . DC  B 4  ? 0.2927 0.4649 0.2714 0.0228  0.0071  0.0037  4   DC  B OP1   
585  O OP2   . DC  B 4  ? 0.2669 0.4867 0.3095 0.0097  -0.0097 -0.0001 4   DC  B OP2   
586  O "O5'" . DC  B 4  ? 0.2794 0.4631 0.2708 0.0154  -0.0131 0.0000  4   DC  B "O5'" 
587  C "C5'" . DC  B 4  ? 0.3165 0.4744 0.2795 0.0222  -0.0070 0.0036  4   DC  B "C5'" 
588  C "C4'" . DC  B 4  ? 0.3453 0.4942 0.3004 0.0245  -0.0115 0.0030  4   DC  B "C4'" 
589  O "O4'" . DC  B 4  ? 0.3732 0.5158 0.3319 0.0101  -0.0106 -0.0014 4   DC  B "O4'" 
590  C "C3'" . DC  B 4  ? 0.3325 0.4982 0.2965 0.0315  -0.0226 0.0018  4   DC  B "C3'" 
591  O "O3'" . DC  B 4  ? 0.3374 0.5034 0.2967 0.0452  -0.0268 0.0072  4   DC  B "O3'" 
592  C "C2'" . DC  B 4  ? 0.3715 0.5217 0.3272 0.0281  -0.0192 -0.0005 4   DC  B "C2'" 
593  C "C1'" . DC  B 4  ? 0.3694 0.5061 0.3198 0.0120  -0.0154 -0.0041 4   DC  B "C1'" 
594  N N1    . DC  B 4  ? 0.3589 0.5059 0.3186 -0.0015 -0.0265 -0.0091 4   DC  B N1    
595  C C2    . DC  B 4  ? 0.3835 0.5092 0.3212 -0.0063 -0.0282 -0.0132 4   DC  B C2    
596  O O2    . DC  B 4  ? 0.3941 0.4956 0.3115 0.0022  -0.0162 -0.0125 4   DC  B O2    
597  N N3    . DC  B 4  ? 0.3705 0.4987 0.3074 -0.0195 -0.0424 -0.0168 4   DC  B N3    
598  C C4    . DC  B 4  ? 0.3627 0.5199 0.3301 -0.0263 -0.0551 -0.0152 4   DC  B C4    
599  N N4    . DC  B 4  ? 0.3434 0.5025 0.3105 -0.0382 -0.0733 -0.0167 4   DC  B N4    
600  C C5    . DC  B 4  ? 0.3481 0.5299 0.3451 -0.0198 -0.0488 -0.0112 4   DC  B C5    
601  C C6    . DC  B 4  ? 0.3269 0.4991 0.3135 -0.0085 -0.0343 -0.0089 4   DC  B C6    
602  P P     . DT  B 5  ? 0.2847 0.4733 0.2610 0.0504  -0.0385 0.0069  5   DT  B P     
603  O OP1   . DT  B 5  ? 0.2887 0.4775 0.2617 0.0611  -0.0478 0.0137  5   DT  B OP1   
604  O OP2   . DT  B 5  ? 0.2425 0.4466 0.2291 0.0431  -0.0427 0.0019  5   DT  B OP2   
605  O "O5'" . DT  B 5  ? 0.2891 0.4752 0.2728 0.0527  -0.0334 0.0068  5   DT  B "O5'" 
606  C "C5'" . DT  B 5  ? 0.3586 0.5300 0.3400 0.0632  -0.0255 0.0127  5   DT  B "C5'" 
607  C "C4'" . DT  B 5  ? 0.3971 0.5596 0.3802 0.0632  -0.0140 0.0102  5   DT  B "C4'" 
608  O "O4'" . DT  B 5  ? 0.3921 0.5355 0.3521 0.0492  -0.0096 0.0025  5   DT  B "O4'" 
609  C "C3'" . DT  B 5  ? 0.3629 0.5470 0.3672 0.0636  -0.0177 0.0094  5   DT  B "C3'" 
610  O "O3'" . DT  B 5  ? 0.4054 0.5997 0.4365 0.0775  -0.0143 0.0178  5   DT  B "O3'" 
611  C "C2'" . DT  B 5  ? 0.3820 0.5444 0.3657 0.0556  -0.0064 0.0032  5   DT  B "C2'" 
612  C "C1'" . DT  B 5  ? 0.3941 0.5343 0.3499 0.0445  -0.0071 -0.0016 5   DT  B "C1'" 
613  N N1    . DT  B 5  ? 0.3463 0.4945 0.2972 0.0301  -0.0204 -0.0071 5   DT  B N1    
614  C C2    . DT  B 5  ? 0.4040 0.5298 0.3297 0.0196  -0.0203 -0.0121 5   DT  B C2    
615  O O2    . DT  B 5  ? 0.4081 0.5047 0.3108 0.0216  -0.0062 -0.0134 5   DT  B O2    
616  N N3    . DT  B 5  ? 0.3720 0.5086 0.2997 0.0074  -0.0369 -0.0145 5   DT  B N3    
617  C C4    . DT  B 5  ? 0.3474 0.5143 0.3032 0.0064  -0.0478 -0.0126 5   DT  B C4    
618  O O4    . DT  B 5  ? 0.3331 0.5095 0.2960 -0.0027 -0.0614 -0.0132 5   DT  B O4    
619  C C5    . DT  B 5  ? 0.3084 0.4907 0.2816 0.0174  -0.0422 -0.0091 5   DT  B C5    
620  C C7    . DT  B 5  ? 0.2573 0.4620 0.2514 0.0174  -0.0476 -0.0077 5   DT  B C7    
621  C C6    . DT  B 5  ? 0.3374 0.5095 0.3055 0.0277  -0.0317 -0.0064 5   DT  B C6    
622  P P     . DA  B 6  ? 0.4307 0.6510 0.4965 0.0795  -0.0164 0.0202  6   DA  B P     
623  O OP1   . DA  B 6  ? 0.3965 0.6324 0.5000 0.0941  -0.0173 0.0316  6   DA  B OP1   
624  O OP2   . DA  B 6  ? 0.3099 0.5463 0.3745 0.0690  -0.0322 0.0149  6   DA  B OP2   
625  O "O5'" . DA  B 6  ? 0.3767 0.5754 0.4289 0.0763  0.0056  0.0157  6   DA  B "O5'" 
626  C "C5'" . DA  B 6  ? 0.4184 0.5881 0.4597 0.0844  0.0294  0.0177  6   DA  B "C5'" 
627  C "C4'" . DA  B 6  ? 0.4771 0.6246 0.5001 0.0793  0.0489  0.0130  6   DA  B "C4'" 
628  O "O4'" . DA  B 6  ? 0.4842 0.6138 0.4642 0.0630  0.0381  0.0036  6   DA  B "O4'" 
629  C "C3'" . DA  B 6  ? 0.5045 0.6786 0.5647 0.0804  0.0515  0.0167  6   DA  B "C3'" 
630  O "O3'" . DA  B 6  ? 0.5716 0.7170 0.6215 0.0838  0.0832  0.0170  6   DA  B "O3'" 
631  C "C2'" . DA  B 6  ? 0.4744 0.6565 0.5164 0.0659  0.0310  0.0099  6   DA  B "C2'" 
632  C "C1'" . DA  B 6  ? 0.4887 0.6355 0.4769 0.0564  0.0292  0.0022  6   DA  B "C1'" 
633  N N9    . DA  B 6  ? 0.4641 0.6241 0.4439 0.0463  0.0046  -0.0018 6   DA  B N9    
634  C C8    . DA  B 6  ? 0.4067 0.5969 0.4107 0.0475  -0.0126 -0.0001 6   DA  B C8    
635  N N7    . DA  B 6  ? 0.3689 0.5620 0.3613 0.0387  -0.0266 -0.0039 6   DA  B N7    
636  C C5    . DA  B 6  ? 0.4060 0.5728 0.3671 0.0301  -0.0239 -0.0077 6   DA  B C5    
637  C C6    . DA  B 6  ? 0.3835 0.5440 0.3273 0.0188  -0.0380 -0.0108 6   DA  B C6    
638  N N6    . DA  B 6  ? 0.3648 0.5483 0.3276 0.0160  -0.0524 -0.0103 6   DA  B N6    
639  N N1    . DA  B 6  ? 0.4055 0.5328 0.3114 0.0106  -0.0368 -0.0135 6   DA  B N1    
640  C C2    . DA  B 6  ? 0.4964 0.5941 0.3794 0.0145  -0.0163 -0.0142 6   DA  B C2    
641  N N3    . DA  B 6  ? 0.4688 0.5717 0.3723 0.0269  0.0035  -0.0110 6   DA  B N3    
642  C C4    . DA  B 6  ? 0.4328 0.5745 0.3787 0.0340  -0.0045 -0.0073 6   DA  B C4    
643  P P     . DA  B 7  ? 0.6368 0.7994 0.7218 0.0839  0.0966  0.0211  7   DA  B P     
644  O OP1   . DA  B 7  ? 0.5773 0.7204 0.6785 0.0968  0.1357  0.0272  7   DA  B OP1   
645  O OP2   . DA  B 7  ? 0.6306 0.8443 0.7662 0.0817  0.0696  0.0253  7   DA  B OP2   
646  O "O5'" . DA  B 7  ? 0.6046 0.7338 0.6311 0.0688  0.0968  0.0122  7   DA  B "O5'" 
647  C "C5'" . DA  B 7  ? 0.6259 0.6983 0.5839 0.0639  0.1107  0.0054  7   DA  B "C5'" 
648  C "C4'" . DA  B 7  ? 0.6336 0.6864 0.5442 0.0488  0.0953  -0.0005 7   DA  B "C4'" 
649  O "O4'" . DA  B 7  ? 0.5643 0.6450 0.4803 0.0416  0.0594  -0.0032 7   DA  B "O4'" 
650  C "C3'" . DA  B 7  ? 0.6330 0.6972 0.5620 0.0469  0.1028  0.0031  7   DA  B "C3'" 
651  O "O3'" . DA  B 7  ? 0.7206 0.7269 0.5871 0.0415  0.1246  0.0005  7   DA  B "O3'" 
652  C "C2'" . DA  B 7  ? 0.5781 0.6765 0.5212 0.0394  0.0674  0.0018  7   DA  B "C2'" 
653  C "C1'" . DA  B 7  ? 0.5228 0.6126 0.4354 0.0342  0.0451  -0.0033 7   DA  B "C1'" 
654  N N9    . DA  B 7  ? 0.4629 0.5918 0.4034 0.0322  0.0165  -0.0036 7   DA  B N9    
655  C C8    . DA  B 7  ? 0.4166 0.5853 0.4050 0.0384  0.0085  -0.0007 7   DA  B C8    
656  N N7    . DA  B 7  ? 0.4073 0.5948 0.4013 0.0348  -0.0133 -0.0025 7   DA  B N7    
657  C C5    . DA  B 7  ? 0.3493 0.5155 0.3077 0.0266  -0.0217 -0.0055 7   DA  B C5    
658  C C6    . DA  B 7  ? 0.3694 0.5445 0.3250 0.0212  -0.0419 -0.0066 7   DA  B C6    
659  N N6    . DA  B 7  ? 0.3298 0.5324 0.3128 0.0236  -0.0521 -0.0063 7   DA  B N6    
660  N N1    . DA  B 7  ? 0.3532 0.5051 0.2761 0.0131  -0.0511 -0.0074 7   DA  B N1    
661  C C2    . DA  B 7  ? 0.4510 0.5648 0.3337 0.0098  -0.0395 -0.0084 7   DA  B C2    
662  N N3    . DA  B 7  ? 0.4290 0.5253 0.3045 0.0149  -0.0145 -0.0085 7   DA  B N3    
663  C C4    . DA  B 7  ? 0.4533 0.5818 0.3746 0.0239  -0.0067 -0.0064 7   DA  B C4    
664  P P     . DT  B 8  ? 0.8138 0.8097 0.6761 0.0376  0.1396  0.0041  8   DT  B P     
665  O OP1   . DT  B 8  ? 0.9328 0.8611 0.7335 0.0375  0.1770  0.0031  8   DT  B OP1   
666  O OP2   . DT  B 8  ? 0.7287 0.7816 0.6740 0.0430  0.1414  0.0107  8   DT  B OP2   
667  O "O5'" . DT  B 8  ? 0.7701 0.7630 0.5959 0.0259  0.1026  0.0011  8   DT  B "O5'" 
668  C "C5'" . DT  B 8  ? 0.7270 0.6834 0.4888 0.0175  0.0824  -0.0041 8   DT  B "C5'" 
669  C "C4'" . DT  B 8  ? 0.7224 0.6977 0.4825 0.0105  0.0456  -0.0031 8   DT  B "C4'" 
670  O "O4'" . DT  B 8  ? 0.6048 0.6393 0.4275 0.0145  0.0256  -0.0030 8   DT  B "O4'" 
671  C "C3'" . DT  B 8  ? 0.7039 0.6739 0.4611 0.0094  0.0501  0.0020  8   DT  B "C3'" 
672  O "O3'" . DT  B 8  ? 0.8206 0.7368 0.5023 0.0013  0.0392  0.0026  8   DT  B "O3'" 
673  C "C2'" . DT  B 8  ? 0.6351 0.6622 0.4518 0.0117  0.0264  0.0037  8   DT  B "C2'" 
674  C "C1'" . DT  B 8  ? 0.5832 0.6371 0.4188 0.0124  0.0056  -0.0001 8   DT  B "C1'" 
675  N N1    . DT  B 8  ? 0.5232 0.6299 0.4193 0.0172  -0.0056 -0.0001 8   DT  B N1    
676  C C2    . DT  B 8  ? 0.4735 0.6000 0.3787 0.0156  -0.0316 -0.0004 8   DT  B C2    
677  O O2    . DT  B 8  ? 0.4805 0.5906 0.3571 0.0108  -0.0481 0.0006  8   DT  B O2    
678  N N3    . DT  B 8  ? 0.4151 0.5797 0.3646 0.0199  -0.0376 -0.0012 8   DT  B N3    
679  C C4    . DT  B 8  ? 0.3949 0.5803 0.3785 0.0242  -0.0271 -0.0011 8   DT  B C4    
680  O O4    . DT  B 8  ? 0.3438 0.5550 0.3543 0.0262  -0.0373 -0.0020 8   DT  B O4    
681  C C5    . DT  B 8  ? 0.4234 0.5950 0.4071 0.0259  -0.0037 0.0007  8   DT  B C5    
682  C C7    . DT  B 8  ? 0.4291 0.6279 0.4605 0.0309  0.0050  0.0034  8   DT  B C7    
683  C C6    . DT  B 8  ? 0.4693 0.6018 0.4098 0.0231  0.0089  0.0008  8   DT  B C6    
684  P P     . DT  B 9  ? 0.8586 0.7464 0.5093 -0.0007 0.0431  0.0091  9   DT  B P     
685  O OP1   . DT  B 9  ? 0.9266 0.7399 0.4819 -0.0085 0.0426  0.0092  9   DT  B OP1   
686  O OP2   . DT  B 9  ? 0.8601 0.7673 0.5582 0.0043  0.0758  0.0119  9   DT  B OP2   
687  O "O5'" . DT  B 9  ? 0.7927 0.7197 0.4733 -0.0006 0.0032  0.0126  9   DT  B "O5'" 
688  C "C5'" . DT  B 9  ? 0.7079 0.6425 0.3785 -0.0046 -0.0332 0.0117  9   DT  B "C5'" 
689  C "C4'" . DT  B 9  ? 0.6867 0.6587 0.3963 -0.0007 -0.0602 0.0173  9   DT  B "C4'" 
690  O "O4'" . DT  B 9  ? 0.6284 0.6573 0.4091 0.0051  -0.0578 0.0139  9   DT  B "O4'" 
691  C "C3'" . DT  B 9  ? 0.7047 0.6585 0.4014 0.0023  -0.0539 0.0246  9   DT  B "C3'" 
692  O "O3'" . DT  B 9  ? 0.7046 0.6584 0.3928 0.0036  -0.0881 0.0322  9   DT  B "O3'" 
693  C "C2'" . DT  B 9  ? 0.6252 0.6240 0.3880 0.0079  -0.0384 0.0223  9   DT  B "C2'" 
694  C "C1'" . DT  B 9  ? 0.5592 0.6049 0.3685 0.0102  -0.0552 0.0176  9   DT  B "C1'" 
695  N N1    . DT  B 9  ? 0.4826 0.5685 0.3468 0.0134  -0.0425 0.0126  9   DT  B N1    
696  C C2    . DT  B 9  ? 0.4542 0.5769 0.3569 0.0171  -0.0585 0.0111  9   DT  B C2    
697  O O2    . DT  B 9  ? 0.4451 0.5728 0.3478 0.0188  -0.0788 0.0143  9   DT  B O2    
698  N N3    . DT  B 9  ? 0.3769 0.5287 0.3189 0.0188  -0.0497 0.0067  9   DT  B N3    
699  C C4    . DT  B 9  ? 0.3808 0.5359 0.3373 0.0176  -0.0303 0.0051  9   DT  B C4    
700  O O4    . DT  B 9  ? 0.3718 0.5547 0.3643 0.0189  -0.0304 0.0026  9   DT  B O4    
701  C C5    . DT  B 9  ? 0.4412 0.5628 0.3674 0.0150  -0.0107 0.0076  9   DT  B C5    
702  C C7    . DT  B 9  ? 0.4539 0.5809 0.4058 0.0150  0.0148  0.0080  9   DT  B C7    
703  C C6    . DT  B 9  ? 0.4828 0.5680 0.3591 0.0128  -0.0163 0.0105  9   DT  B C6    
704  P P     . DA  B 10 ? 0.8099 0.7341 0.4705 0.0076  -0.0920 0.0428  10  DA  B P     
705  O OP1   . DA  B 10 ? 0.7738 0.6787 0.4004 0.0064  -0.1305 0.0517  10  DA  B OP1   
706  O OP2   . DA  B 10 ? 0.8631 0.7454 0.4865 0.0047  -0.0556 0.0422  10  DA  B OP2   
707  O "O5'" . DA  B 10 ? 0.7025 0.6772 0.4344 0.0166  -0.0922 0.0433  10  DA  B "O5'" 
708  C "C5'" . DA  B 10 ? 0.6232 0.6372 0.3984 0.0226  -0.1193 0.0460  10  DA  B "C5'" 
709  C "C4'" . DA  B 10 ? 0.5848 0.6336 0.4148 0.0300  -0.1085 0.0436  10  DA  B "C4'" 
710  O "O4'" . DA  B 10 ? 0.5316 0.6018 0.3871 0.0258  -0.0866 0.0328  10  DA  B "O4'" 
711  C "C3'" . DA  B 10 ? 0.6177 0.6410 0.4349 0.0341  -0.0969 0.0494  10  DA  B "C3'" 
712  O "O3'" . DA  B 10 ? 0.6092 0.6560 0.4668 0.0441  -0.1042 0.0522  10  DA  B "O3'" 
713  C "C2'" . DA  B 10 ? 0.5561 0.5803 0.3822 0.0269  -0.0666 0.0407  10  DA  B "C2'" 
714  C "C1'" . DA  B 10 ? 0.5253 0.5946 0.3958 0.0266  -0.0693 0.0317  10  DA  B "C1'" 
715  N N9    . DA  B 10 ? 0.4831 0.5650 0.3713 0.0203  -0.0486 0.0237  10  DA  B N9    
716  C C8    . DA  B 10 ? 0.5100 0.5718 0.3801 0.0144  -0.0270 0.0229  10  DA  B C8    
717  N N7    . DA  B 10 ? 0.4910 0.5789 0.3982 0.0115  -0.0138 0.0173  10  DA  B N7    
718  C C5    . DA  B 10 ? 0.4013 0.5231 0.3435 0.0146  -0.0292 0.0134  10  DA  B C5    
719  C C6    . DA  B 10 ? 0.3875 0.5421 0.3696 0.0133  -0.0296 0.0078  10  DA  B C6    
720  N N6    . DA  B 10 ? 0.4188 0.5858 0.4249 0.0094  -0.0162 0.0064  10  DA  B N6    
721  N N1    . DA  B 10 ? 0.3459 0.5181 0.3426 0.0169  -0.0441 0.0047  10  DA  B N1    
722  C C2    . DA  B 10 ? 0.4082 0.5716 0.3915 0.0227  -0.0549 0.0080  10  DA  B C2    
723  N N3    . DA  B 10 ? 0.4065 0.5466 0.3623 0.0254  -0.0593 0.0148  10  DA  B N3    
724  C C4    . DA  B 10 ? 0.4201 0.5376 0.3511 0.0203  -0.0472 0.0168  10  DA  B C4    
725  P P     . DG  B 11 ? 0.7358 0.7545 0.5793 0.0540  -0.1093 0.0644  11  DG  B P     
726  O OP1   . DG  B 11 ? 0.7489 0.7639 0.5830 0.0610  -0.1403 0.0770  11  DG  B OP1   
727  O OP2   . DG  B 11 ? 0.6744 0.6527 0.4805 0.0473  -0.0866 0.0644  11  DG  B OP2   
728  O "O5'" . DG  B 11 ? 0.6707 0.7175 0.5649 0.0626  -0.1023 0.0605  11  DG  B "O5'" 
729  C "C5'" . DG  B 11 ? 0.6129 0.6996 0.5518 0.0692  -0.1127 0.0588  11  DG  B "C5'" 
730  C "C4'" . DG  B 11 ? 0.5835 0.6849 0.5502 0.0696  -0.0937 0.0480  11  DG  B "C4'" 
731  O "O4'" . DG  B 11 ? 0.6131 0.7219 0.5746 0.0559  -0.0819 0.0359  11  DG  B "O4'" 
732  C "C3'" . DG  B 11 ? 0.5987 0.6713 0.5572 0.0741  -0.0795 0.0491  11  DG  B "C3'" 
733  O "O3'" . DG  B 11 ? 0.6207 0.7064 0.6090 0.0824  -0.0717 0.0447  11  DG  B "O3'" 
734  C "C2'" . DG  B 11 ? 0.5976 0.6560 0.5361 0.0581  -0.0639 0.0398  11  DG  B "C2'" 
735  C "C1'" . DG  B 11 ? 0.5265 0.6188 0.4832 0.0502  -0.0653 0.0300  11  DG  B "C1'" 
736  N N9    . DG  B 11 ? 0.5011 0.5929 0.4488 0.0367  -0.0558 0.0244  11  DG  B N9    
737  C C8    . DG  B 11 ? 0.4962 0.5696 0.4169 0.0316  -0.0518 0.0288  11  DG  B C8    
738  N N7    . DG  B 11 ? 0.4794 0.5603 0.4077 0.0214  -0.0385 0.0229  11  DG  B N7    
739  C C5    . DG  B 11 ? 0.4176 0.5247 0.3787 0.0187  -0.0392 0.0145  11  DG  B C5    
740  C C6    . DG  B 11 ? 0.4016 0.5293 0.3885 0.0091  -0.0327 0.0075  11  DG  B C6    
741  O O6    . DG  B 11 ? 0.4370 0.5684 0.4320 0.0025  -0.0211 0.0079  11  DG  B O6    
742  N N1    . DG  B 11 ? 0.4097 0.5529 0.4145 0.0085  -0.0407 0.0007  11  DG  B N1    
743  C C2    . DG  B 11 ? 0.3769 0.5135 0.3751 0.0167  -0.0472 0.0000  11  DG  B C2    
744  N N2    . DG  B 11 ? 0.3603 0.5033 0.3664 0.0140  -0.0508 -0.0076 11  DG  B N2    
745  N N3    . DG  B 11 ? 0.4441 0.5665 0.4287 0.0275  -0.0497 0.0071  11  DG  B N3    
746  C C4    . DG  B 11 ? 0.4205 0.5303 0.3876 0.0274  -0.0485 0.0145  11  DG  B C4    
747  P P     . DT  B 12 ? 0.7494 0.8025 0.7310 0.0888  -0.0551 0.0439  12  DT  B P     
748  O OP1   . DT  B 12 ? 0.8282 0.8920 0.8411 0.1060  -0.0511 0.0475  12  DT  B OP1   
749  O OP2   . DT  B 12 ? 0.9086 0.9253 0.8599 0.0892  -0.0553 0.0533  12  DT  B OP2   
750  O "O5'" . DT  B 12 ? 0.7018 0.7514 0.6746 0.0717  -0.0416 0.0270  12  DT  B "O5'" 
751  C "C5'" . DT  B 12 ? 0.6738 0.7511 0.6623 0.0672  -0.0421 0.0171  12  DT  B "C5'" 
752  C "C4'" . DT  B 12 ? 0.6959 0.7572 0.6713 0.0544  -0.0323 0.0037  12  DT  B "C4'" 
753  O "O4'" . DT  B 12 ? 0.6307 0.7025 0.6038 0.0370  -0.0368 -0.0012 12  DT  B "O4'" 
754  C "C3'" . DT  B 12 ? 0.7520 0.7697 0.7070 0.0542  -0.0199 0.0019  12  DT  B "C3'" 
755  O "O3'" . DT  B 12 ? 0.8131 0.8172 0.7572 0.0494  -0.0128 -0.0102 12  DT  B "O3'" 
756  C "C2'" . DT  B 12 ? 0.6959 0.7028 0.6398 0.0374  -0.0203 0.0012  12  DT  B "C2'" 
757  C "C1'" . DT  B 12 ? 0.6363 0.6794 0.5953 0.0249  -0.0294 -0.0045 12  DT  B "C1'" 
758  N N1    . DT  B 12 ? 0.5746 0.6263 0.5374 0.0149  -0.0295 -0.0007 12  DT  B N1    
759  C C2    . DT  B 12 ? 0.5309 0.6034 0.5103 -0.0003 -0.0319 -0.0074 12  DT  B C2    
760  O O2    . DT  B 12 ? 0.5508 0.6312 0.5363 -0.0073 -0.0383 -0.0162 12  DT  B O2    
761  N N3    . DT  B 12 ? 0.5418 0.6215 0.5285 -0.0067 -0.0260 -0.0026 12  DT  B N3    
762  C C4    . DT  B 12 ? 0.5310 0.5932 0.4991 -0.0008 -0.0186 0.0069  12  DT  B C4    
763  O O4    . DT  B 12 ? 0.5405 0.6047 0.5114 -0.0075 -0.0089 0.0099  12  DT  B O4    
764  C C5    . DT  B 12 ? 0.5745 0.6149 0.5204 0.0141  -0.0228 0.0140  12  DT  B C5    
765  C C7    . DT  B 12 ? 0.5924 0.6077 0.5095 0.0207  -0.0209 0.0260  12  DT  B C7    
766  C C6    . DT  B 12 ? 0.5706 0.6106 0.5210 0.0220  -0.0276 0.0104  12  DT  B C6    
767  P P     . DC  B 13 ? 0.8531 0.8038 0.7678 0.0474  0.0023  -0.0168 13  DC  B P     
768  O OP1   . DC  B 13 ? 0.9371 0.8733 0.8391 0.0535  0.0127  -0.0249 13  DC  B OP1   
769  O OP2   . DC  B 13 ? 0.7385 0.6652 0.6514 0.0602  0.0099  -0.0049 13  DC  B OP2   
770  O "O5'" . DC  B 13 ? 0.8231 0.7644 0.7238 0.0199  -0.0049 -0.0272 13  DC  B "O5'" 
771  C "C5'" . DC  B 13 ? 0.7553 0.7181 0.6582 0.0046  -0.0179 -0.0369 13  DC  B "C5'" 
772  C "C4'" . DC  B 13 ? 0.7591 0.7150 0.6612 -0.0207 -0.0260 -0.0431 13  DC  B "C4'" 
773  O "O4'" . DC  B 13 ? 0.7021 0.6880 0.6333 -0.0239 -0.0281 -0.0341 13  DC  B "O4'" 
774  C "C3'" . DC  B 13 ? 0.7969 0.6994 0.6717 -0.0299 -0.0150 -0.0476 13  DC  B "C3'" 
775  O "O3'" . DC  B 13 ? 0.8478 0.7421 0.7179 -0.0577 -0.0278 -0.0583 13  DC  B "O3'" 
776  C "C2'" . DC  B 13 ? 0.7619 0.6669 0.6518 -0.0270 -0.0070 -0.0360 13  DC  B "C2'" 
777  C "C1'" . DC  B 13 ? 0.7134 0.6694 0.6378 -0.0354 -0.0190 -0.0330 13  DC  B "C1'" 
778  N N1    . DC  B 13 ? 0.6357 0.6051 0.5738 -0.0295 -0.0122 -0.0208 13  DC  B N1    
779  C C2    . DC  B 13 ? 0.5889 0.5919 0.5559 -0.0411 -0.0155 -0.0191 13  DC  B C2    
780  O O2    . DC  B 13 ? 0.6388 0.6653 0.6263 -0.0546 -0.0272 -0.0263 13  DC  B O2    
781  N N3    . DC  B 13 ? 0.5847 0.5906 0.5542 -0.0363 -0.0056 -0.0088 13  DC  B N3    
782  C C4    . DC  B 13 ? 0.6151 0.5920 0.5574 -0.0219 0.0019  0.0002  13  DC  B C4    
783  N N4    . DC  B 13 ? 0.6623 0.6342 0.5961 -0.0189 0.0102  0.0101  13  DC  B N4    
784  C C5    . DC  B 13 ? 0.6601 0.6085 0.5809 -0.0088 0.0017  0.0004  13  DC  B C5    
785  C C6    . DC  B 13 ? 0.6502 0.5954 0.5708 -0.0127 -0.0025 -0.0105 13  DC  B C6    
786  P P     . DG  B 14 ? 1.0052 0.8400 0.8269 -0.0710 -0.0267 -0.0726 14  DG  B P     
787  O OP1   . DG  B 14 ? 0.9842 0.8075 0.7778 -0.0552 -0.0229 -0.0771 14  DG  B OP1   
788  O OP2   . DG  B 14 ? 0.9093 0.6964 0.7131 -0.0727 -0.0086 -0.0713 14  DG  B OP2   
789  O "O5'" . DG  B 14 ? 0.9685 0.8183 0.8021 -0.1033 -0.0532 -0.0810 14  DG  B "O5'" 
790  C "C5'" . DG  B 14 ? 0.8742 0.7760 0.7368 -0.1059 -0.0747 -0.0792 14  DG  B "C5'" 
791  C "C4'" . DG  B 14 ? 0.8364 0.7752 0.7492 -0.1287 -0.0903 -0.0761 14  DG  B "C4'" 
792  O "O4'" . DG  B 14 ? 0.7441 0.7104 0.6947 -0.1180 -0.0722 -0.0638 14  DG  B "O4'" 
793  C "C3'" . DG  B 14 ? 0.8703 0.7739 0.7745 -0.1595 -0.0982 -0.0847 14  DG  B "C3'" 
794  O "O3'" . DG  B 14 ? 0.8757 0.8196 0.8267 -0.1833 -0.1256 -0.0842 14  DG  B "O3'" 
795  C "C2'" . DG  B 14 ? 0.8310 0.7243 0.7509 -0.1569 -0.0721 -0.0771 14  DG  B "C2'" 
796  C "C1'" . DG  B 14 ? 0.7497 0.6998 0.7148 -0.1383 -0.0652 -0.0636 14  DG  B "C1'" 
797  N N9    . DG  B 14 ? 0.6845 0.6249 0.6484 -0.1218 -0.0392 -0.0533 14  DG  B N9    
798  C C8    . DG  B 14 ? 0.6895 0.5859 0.6128 -0.1045 -0.0217 -0.0515 14  DG  B C8    
799  N N7    . DG  B 14 ? 0.6834 0.5808 0.6128 -0.0919 -0.0052 -0.0394 14  DG  B N7    
800  C C5    . DG  B 14 ? 0.6404 0.5816 0.6129 -0.1013 -0.0077 -0.0343 14  DG  B C5    
801  C C6    . DG  B 14 ? 0.6493 0.6022 0.6366 -0.0953 0.0081  -0.0223 14  DG  B C6    
802  O O6    . DG  B 14 ? 0.6685 0.5947 0.6298 -0.0810 0.0230  -0.0131 14  DG  B O6    
803  N N1    . DG  B 14 ? 0.6036 0.6007 0.6382 -0.1070 0.0053  -0.0207 14  DG  B N1    
804  C C2    . DG  B 14 ? 0.5955 0.6260 0.6649 -0.1222 -0.0149 -0.0278 14  DG  B C2    
805  N N2    . DG  B 14 ? 0.5685 0.6419 0.6902 -0.1291 -0.0133 -0.0225 14  DG  B N2    
806  N N3    . DG  B 14 ? 0.6152 0.6338 0.6666 -0.1294 -0.0349 -0.0386 14  DG  B N3    
807  C C4    . DG  B 14 ? 0.6545 0.6261 0.6546 -0.1185 -0.0280 -0.0421 14  DG  B C4    
808  O "O5'" . DC  C 1  ? 1.2997 1.1244 1.3024 -0.3426 0.3323  0.0782  1   DC  C "O5'" 
809  C "C5'" . DC  C 1  ? 1.2268 1.1416 1.3158 -0.3319 0.3384  0.0603  1   DC  C "C5'" 
810  C "C4'" . DC  C 1  ? 1.1278 1.1148 1.2951 -0.3100 0.2825  0.0445  1   DC  C "C4'" 
811  O "O4'" . DC  C 1  ? 1.0971 1.0542 1.2301 -0.2975 0.2340  0.0487  1   DC  C "O4'" 
812  C "C3'" . DC  C 1  ? 1.0654 1.1290 1.2868 -0.2807 0.2610  0.0320  1   DC  C "C3'" 
813  O "O3'" . DC  C 1  ? 1.0692 1.2114 1.4177 -0.2930 0.2621  0.0107  1   DC  C "O3'" 
814  C "C2'" . DC  C 1  ? 0.9869 1.0431 1.1669 -0.2495 0.2029  0.0359  1   DC  C "C2'" 
815  C "C1'" . DC  C 1  ? 0.9648 0.9798 1.1337 -0.2668 0.1876  0.0378  1   DC  C "C1'" 
816  N N1    . DC  C 1  ? 0.8925 0.8617 0.9875 -0.2434 0.1489  0.0474  1   DC  C N1    
817  C C2    . DC  C 1  ? 0.8166 0.8101 0.9422 -0.2319 0.1057  0.0353  1   DC  C C2    
818  O O2    . DC  C 1  ? 0.7749 0.8253 0.9830 -0.2411 0.0950  0.0183  1   DC  C O2    
819  N N3    . DC  C 1  ? 0.7729 0.7256 0.8373 -0.2106 0.0765  0.0415  1   DC  C N3    
820  C C4    . DC  C 1  ? 0.8569 0.7504 0.8403 -0.1994 0.0832  0.0593  1   DC  C C4    
821  N N4    . DC  C 1  ? 0.8548 0.7157 0.7936 -0.1763 0.0534  0.0627  1   DC  C N4    
822  C C5    . DC  C 1  ? 0.8754 0.7390 0.8189 -0.2104 0.1201  0.0733  1   DC  C C5    
823  C C6    . DC  C 1  ? 0.9046 0.8055 0.9020 -0.2330 0.1549  0.0666  1   DC  C C6    
824  P P     . DG  C 2  ? 0.9409 1.1644 1.3658 -0.2682 0.2507  -0.0039 2   DG  C P     
825  O OP1   . DG  C 2  ? 0.8862 1.1784 1.4442 -0.2887 0.2646  -0.0245 2   DG  C OP1   
826  O OP2   . DG  C 2  ? 0.8835 1.0828 1.2393 -0.2516 0.2774  0.0055  2   DG  C OP2   
827  O "O5'" . DG  C 2  ? 0.8596 1.1011 1.2775 -0.2389 0.1830  -0.0059 2   DG  C "O5'" 
828  C "C5'" . DG  C 2  ? 0.8551 1.1479 1.3603 -0.2417 0.1446  -0.0223 2   DG  C "C5'" 
829  C "C4'" . DG  C 2  ? 0.7590 1.0520 1.2259 -0.2116 0.0894  -0.0209 2   DG  C "C4'" 
830  O "O4'" . DG  C 2  ? 0.7426 0.9682 1.1071 -0.2061 0.0825  -0.0062 2   DG  C "O4'" 
831  C "C3'" . DG  C 2  ? 0.7425 1.0633 1.2023 -0.1801 0.0807  -0.0194 2   DG  C "C3'" 
832  O "O3'" . DG  C 2  ? 0.7645 1.1136 1.2461 -0.1614 0.0299  -0.0270 2   DG  C "O3'" 
833  C "C2'" . DG  C 2  ? 0.6701 0.9336 1.0206 -0.1663 0.0875  -0.0021 2   DG  C "C2'" 
834  C "C1'" . DG  C 2  ? 0.6639 0.8843 0.9728 -0.1749 0.0663  0.0014  2   DG  C "C1'" 
835  N N9    . DG  C 2  ? 0.6661 0.8216 0.8812 -0.1708 0.0757  0.0175  2   DG  C N9    
836  C C8    . DG  C 2  ? 0.7002 0.8185 0.8621 -0.1746 0.1103  0.0303  2   DG  C C8    
837  N N7    . DG  C 2  ? 0.6847 0.7452 0.7663 -0.1664 0.1016  0.0434  2   DG  C N7    
838  C C5    . DG  C 2  ? 0.6569 0.7195 0.7439 -0.1567 0.0643  0.0377  2   DG  C C5    
839  C C6    . DG  C 2  ? 0.6774 0.6943 0.7072 -0.1432 0.0417  0.0442  2   DG  C C6    
840  O O6    . DG  C 2  ? 0.7131 0.6784 0.6775 -0.1358 0.0448  0.0578  2   DG  C O6    
841  N N1    . DG  C 2  ? 0.6253 0.6584 0.6799 -0.1377 0.0118  0.0320  2   DG  C N1    
842  C C2    . DG  C 2  ? 0.5825 0.6653 0.7008 -0.1440 -0.0012 0.0170  2   DG  C C2    
843  N N2    . DG  C 2  ? 0.5736 0.6549 0.6916 -0.1377 -0.0313 0.0065  2   DG  C N2    
844  N N3    . DG  C 2  ? 0.5909 0.7190 0.7685 -0.1548 0.0133  0.0118  2   DG  C N3    
845  C C4    . DG  C 2  ? 0.6267 0.7439 0.7885 -0.1605 0.0485  0.0220  2   DG  C C4    
846  P P     . DA  C 3  ? 0.8106 1.2099 1.3414 -0.1373 0.0159  -0.0332 3   DA  C P     
847  O OP1   . DA  C 3  ? 0.6938 1.1508 1.3423 -0.1502 0.0192  -0.0496 3   DA  C OP1   
848  O OP2   . DA  C 3  ? 0.8618 1.2421 1.3367 -0.1220 0.0441  -0.0225 3   DA  C OP2   
849  O "O5'" . DA  C 3  ? 0.6383 1.0309 1.1346 -0.1174 -0.0394 -0.0335 3   DA  C "O5'" 
850  C "C5'" . DA  C 3  ? 0.6287 1.0163 1.1354 -0.1283 -0.0758 -0.0420 3   DA  C "C5'" 
851  C "C4'" . DA  C 3  ? 0.6010 0.9449 1.0170 -0.1137 -0.1019 -0.0354 3   DA  C "C4'" 
852  O "O4'" . DA  C 3  ? 0.5794 0.8771 0.9266 -0.1175 -0.0738 -0.0239 3   DA  C "O4'" 
853  C "C3'" . DA  C 3  ? 0.5294 0.8772 0.9124 -0.0854 -0.1190 -0.0299 3   DA  C "C3'" 
854  O "O3'" . DA  C 3  ? 0.4919 0.8223 0.8411 -0.0786 -0.1611 -0.0347 3   DA  C "O3'" 
855  C "C2'" . DA  C 3  ? 0.5366 0.8542 0.8538 -0.0773 -0.0880 -0.0165 3   DA  C "C2'" 
856  C "C1'" . DA  C 3  ? 0.5239 0.8036 0.8074 -0.0944 -0.0756 -0.0143 3   DA  C "C1'" 
857  N N9    . DA  C 3  ? 0.4901 0.7426 0.7333 -0.0962 -0.0411 -0.0026 3   DA  C N9    
858  C C8    . DA  C 3  ? 0.4733 0.7356 0.7329 -0.1011 -0.0072 0.0017  3   DA  C C8    
859  N N7    . DA  C 3  ? 0.4728 0.6948 0.6738 -0.1024 0.0141  0.0130  3   DA  C N7    
860  C C5    . DA  C 3  ? 0.4463 0.6350 0.6010 -0.0969 -0.0071 0.0156  3   DA  C C5    
861  C C6    . DA  C 3  ? 0.4924 0.6330 0.5827 -0.0918 -0.0045 0.0257  3   DA  C C6    
862  N N6    . DA  C 3  ? 0.4785 0.5896 0.5290 -0.0935 0.0178  0.0371  3   DA  C N6    
863  N N1    . DA  C 3  ? 0.4811 0.6011 0.5474 -0.0841 -0.0272 0.0229  3   DA  C N1    
864  C C2    . DA  C 3  ? 0.4578 0.5984 0.5503 -0.0836 -0.0497 0.0111  3   DA  C C2    
865  N N3    . DA  C 3  ? 0.4583 0.6391 0.6017 -0.0881 -0.0596 0.0024  3   DA  C N3    
866  C C4    . DA  C 3  ? 0.4693 0.6759 0.6478 -0.0937 -0.0378 0.0052  3   DA  C C4    
867  P P     . DC  C 4  ? 0.5545 0.8730 0.8519 -0.0535 -0.1823 -0.0287 4   DC  C P     
868  O OP1   . DC  C 4  ? 0.5566 0.8598 0.8338 -0.0523 -0.2271 -0.0369 4   DC  C OP1   
869  O OP2   . DC  C 4  ? 0.4415 0.7895 0.7734 -0.0395 -0.1684 -0.0235 4   DC  C OP2   
870  O "O5'" . DC  C 4  ? 0.4084 0.6860 0.6250 -0.0483 -0.1596 -0.0193 4   DC  C "O5'" 
871  C "C5'" . DC  C 4  ? 0.3959 0.6366 0.5671 -0.0563 -0.1635 -0.0230 4   DC  C "C5'" 
872  C "C4'" . DC  C 4  ? 0.3933 0.6081 0.5094 -0.0463 -0.1403 -0.0141 4   DC  C "C4'" 
873  O "O4'" . DC  C 4  ? 0.3775 0.5993 0.5121 -0.0517 -0.1107 -0.0065 4   DC  C "O4'" 
874  C "C3'" . DC  C 4  ? 0.3523 0.5686 0.4381 -0.0278 -0.1407 -0.0079 4   DC  C "C3'" 
875  O "O3'" . DC  C 4  ? 0.3988 0.5823 0.4291 -0.0230 -0.1473 -0.0117 4   DC  C "O3'" 
876  C "C2'" . DC  C 4  ? 0.3640 0.5879 0.4527 -0.0236 -0.1120 0.0014  4   DC  C "C2'" 
877  C "C1'" . DC  C 4  ? 0.3821 0.5933 0.4779 -0.0374 -0.0971 0.0019  4   DC  C "C1'" 
878  N N1    . DC  C 4  ? 0.3379 0.5548 0.4450 -0.0409 -0.0711 0.0096  4   DC  C N1    
879  C C2    . DC  C 4  ? 0.4078 0.5948 0.4770 -0.0400 -0.0575 0.0168  4   DC  C C2    
880  O O2    . DC  C 4  ? 0.3915 0.5542 0.4310 -0.0351 -0.0666 0.0153  4   DC  C O2    
881  N N3    . DC  C 4  ? 0.3913 0.5728 0.4550 -0.0440 -0.0354 0.0244  4   DC  C N3    
882  C C4    . DC  C 4  ? 0.3988 0.6061 0.4975 -0.0490 -0.0209 0.0231  4   DC  C C4    
883  N N4    . DC  C 4  ? 0.4507 0.6445 0.5324 -0.0538 0.0044  0.0294  4   DC  C N4    
884  C C5    . DC  C 4  ? 0.3904 0.6350 0.5411 -0.0481 -0.0329 0.0146  4   DC  C C5    
885  C C6    . DC  C 4  ? 0.3872 0.6340 0.5381 -0.0438 -0.0609 0.0091  4   DC  C C6    
886  P P     . DT  C 5  ? 0.4279 0.5990 0.4133 -0.0090 -0.1479 -0.0084 5   DT  C P     
887  O OP1   . DT  C 5  ? 0.4148 0.5500 0.3495 -0.0099 -0.1546 -0.0173 5   DT  C OP1   
888  O OP2   . DT  C 5  ? 0.3769 0.5670 0.3810 -0.0026 -0.1612 -0.0036 5   DT  C OP2   
889  O "O5'" . DT  C 5  ? 0.3731 0.5479 0.3542 -0.0023 -0.1197 -0.0013 5   DT  C "O5'" 
890  C "C5'" . DT  C 5  ? 0.4274 0.5868 0.4000 -0.0039 -0.1071 -0.0032 5   DT  C "C5'" 
891  C "C4'" . DT  C 5  ? 0.3618 0.5283 0.3354 0.0040  -0.0898 0.0039  5   DT  C "C4'" 
892  O "O4'" . DT  C 5  ? 0.3563 0.5364 0.3551 -0.0010 -0.0829 0.0109  5   DT  C "O4'" 
893  C "C3'" . DT  C 5  ? 0.3704 0.5466 0.3342 0.0120  -0.0856 0.0066  5   DT  C "C3'" 
894  O "O3'" . DT  C 5  ? 0.3389 0.5139 0.2976 0.0189  -0.0732 0.0068  5   DT  C "O3'" 
895  C "C2'" . DT  C 5  ? 0.3384 0.5359 0.3279 0.0110  -0.0840 0.0135  5   DT  C "C2'" 
896  C "C1'" . DT  C 5  ? 0.3297 0.5245 0.3305 0.0057  -0.0755 0.0162  5   DT  C "C1'" 
897  N N1    . DT  C 5  ? 0.3370 0.5457 0.3622 0.0000  -0.0670 0.0205  5   DT  C N1    
898  C C2    . DT  C 5  ? 0.3389 0.5360 0.3545 -0.0029 -0.0540 0.0258  5   DT  C C2    
899  O O2    . DT  C 5  ? 0.3530 0.5305 0.3454 0.0008  -0.0550 0.0278  5   DT  C O2    
900  N N3    . DT  C 5  ? 0.3360 0.5420 0.3687 -0.0096 -0.0397 0.0281  5   DT  C N3    
901  C C4    . DT  C 5  ? 0.3088 0.5408 0.3796 -0.0112 -0.0378 0.0243  5   DT  C C4    
902  O O4    . DT  C 5  ? 0.3498 0.5887 0.4380 -0.0169 -0.0189 0.0246  5   DT  C O4    
903  C C5    . DT  C 5  ? 0.3207 0.5658 0.4052 -0.0052 -0.0588 0.0198  5   DT  C C5    
904  C C7    . DT  C 5  ? 0.3300 0.6021 0.4607 -0.0034 -0.0655 0.0156  5   DT  C C7    
905  C C6    . DT  C 5  ? 0.3287 0.5581 0.3836 -0.0012 -0.0717 0.0187  5   DT  C C6    
906  P P     . DA  C 6  ? 0.3355 0.5020 0.2742 0.0240  -0.0646 0.0002  6   DA  C P     
907  O OP1   . DA  C 6  ? 0.3617 0.5054 0.2794 0.0228  -0.0663 -0.0091 6   DA  C OP1   
908  O OP2   . DA  C 6  ? 0.3435 0.5155 0.2733 0.0236  -0.0621 0.0044  6   DA  C OP2   
909  O "O5'" . DA  C 6  ? 0.3036 0.4807 0.2618 0.0310  -0.0558 0.0002  6   DA  C "O5'" 
910  C "C5'" . DA  C 6  ? 0.3254 0.4938 0.2926 0.0359  -0.0588 -0.0017 6   DA  C "C5'" 
911  C "C4'" . DA  C 6  ? 0.3326 0.5115 0.3162 0.0414  -0.0618 0.0033  6   DA  C "C4'" 
912  O "O4'" . DA  C 6  ? 0.3829 0.5604 0.3602 0.0352  -0.0663 0.0133  6   DA  C "O4'" 
913  C "C3'" . DA  C 6  ? 0.3037 0.5028 0.3011 0.0432  -0.0556 0.0008  6   DA  C "C3'" 
914  O "O3'" . DA  C 6  ? 0.2930 0.4991 0.3137 0.0524  -0.0621 -0.0022 6   DA  C "O3'" 
915  C "C2'" . DA  C 6  ? 0.2671 0.4719 0.2565 0.0365  -0.0573 0.0091  6   DA  C "C2'" 
916  C "C1'" . DA  C 6  ? 0.3124 0.5047 0.2933 0.0346  -0.0643 0.0162  6   DA  C "C1'" 
917  N N9    . DA  C 6  ? 0.2727 0.4682 0.2497 0.0271  -0.0611 0.0212  6   DA  C N9    
918  C C8    . DA  C 6  ? 0.2874 0.4893 0.2670 0.0237  -0.0605 0.0200  6   DA  C C8    
919  N N7    . DA  C 6  ? 0.2582 0.4668 0.2465 0.0199  -0.0587 0.0237  6   DA  C N7    
920  C C5    . DA  C 6  ? 0.2449 0.4473 0.2278 0.0185  -0.0531 0.0275  6   DA  C C5    
921  C C6    . DA  C 6  ? 0.2666 0.4683 0.2505 0.0139  -0.0430 0.0307  6   DA  C C6    
922  N N6    . DA  C 6  ? 0.3144 0.5303 0.3209 0.0112  -0.0368 0.0294  6   DA  C N6    
923  N N1    . DA  C 6  ? 0.3244 0.5072 0.2844 0.0126  -0.0392 0.0345  6   DA  C N1    
924  C C2    . DA  C 6  ? 0.3044 0.4744 0.2493 0.0181  -0.0509 0.0353  6   DA  C C2    
925  N N3    . DA  C 6  ? 0.2753 0.4521 0.2314 0.0246  -0.0605 0.0310  6   DA  C N3    
926  C C4    . DA  C 6  ? 0.2520 0.4440 0.2239 0.0233  -0.0580 0.0270  6   DA  C C4    
927  P P     . DA  C 7  ? 0.2979 0.5275 0.3450 0.0528  -0.0604 -0.0068 7   DA  C P     
928  O OP1   . DA  C 7  ? 0.2793 0.5199 0.3647 0.0647  -0.0656 -0.0165 7   DA  C OP1   
929  O OP2   . DA  C 7  ? 0.2633 0.5002 0.3045 0.0432  -0.0434 -0.0088 7   DA  C OP2   
930  O "O5'" . DA  C 7  ? 0.2813 0.5063 0.3135 0.0499  -0.0746 0.0025  7   DA  C "O5'" 
931  C "C5'" . DA  C 7  ? 0.3505 0.5577 0.3709 0.0563  -0.0925 0.0084  7   DA  C "C5'" 
932  C "C4'" . DA  C 7  ? 0.3199 0.5192 0.3174 0.0513  -0.1006 0.0143  7   DA  C "C4'" 
933  O "O4'" . DA  C 7  ? 0.2716 0.4619 0.2434 0.0417  -0.0869 0.0209  7   DA  C "O4'" 
934  C "C3'" . DA  C 7  ? 0.3221 0.5421 0.3401 0.0481  -0.1029 0.0071  7   DA  C "C3'" 
935  O "O3'" . DA  C 7  ? 0.4245 0.6310 0.4284 0.0515  -0.1260 0.0084  7   DA  C "O3'" 
936  C "C2'" . DA  C 7  ? 0.2856 0.5057 0.2868 0.0378  -0.0860 0.0098  7   DA  C "C2'" 
937  C "C1'" . DA  C 7  ? 0.2872 0.4865 0.2574 0.0361  -0.0815 0.0189  7   DA  C "C1'" 
938  N N9    . DA  C 7  ? 0.2878 0.4921 0.2573 0.0307  -0.0660 0.0209  7   DA  C N9    
939  C C8    . DA  C 7  ? 0.3048 0.5195 0.2870 0.0301  -0.0589 0.0186  7   DA  C C8    
940  N N7    . DA  C 7  ? 0.2908 0.5053 0.2692 0.0271  -0.0529 0.0216  7   DA  C N7    
941  C C5    . DA  C 7  ? 0.2849 0.4924 0.2536 0.0251  -0.0501 0.0247  7   DA  C C5    
942  C C6    . DA  C 7  ? 0.3144 0.5224 0.2851 0.0229  -0.0409 0.0264  7   DA  C C6    
943  N N6    . DA  C 7  ? 0.2860 0.5039 0.2737 0.0242  -0.0399 0.0263  7   DA  C N6    
944  N N1    . DA  C 7  ? 0.3103 0.5057 0.2644 0.0202  -0.0332 0.0273  7   DA  C N1    
945  C C2    . DA  C 7  ? 0.3283 0.5068 0.2569 0.0200  -0.0405 0.0282  7   DA  C C2    
946  N N3    . DA  C 7  ? 0.3091 0.4878 0.2386 0.0238  -0.0560 0.0273  7   DA  C N3    
947  C C4    . DA  C 7  ? 0.2978 0.4946 0.2529 0.0263  -0.0574 0.0248  7   DA  C C4    
948  P P     . DT  C 8  ? 0.3643 0.5811 0.3771 0.0458  -0.1364 0.0009  8   DT  C P     
949  O OP1   . DT  C 8  ? 0.3877 0.5945 0.4009 0.0549  -0.1706 -0.0008 8   DT  C OP1   
950  O OP2   . DT  C 8  ? 0.3402 0.5878 0.3954 0.0392  -0.1199 -0.0083 8   DT  C OP2   
951  O "O5'" . DT  C 8  ? 0.3983 0.5892 0.3591 0.0369  -0.1264 0.0074  8   DT  C "O5'" 
952  C "C5'" . DT  C 8  ? 0.4846 0.6375 0.3917 0.0380  -0.1369 0.0152  8   DT  C "C5'" 
953  C "C4'" . DT  C 8  ? 0.5060 0.6404 0.3746 0.0287  -0.1197 0.0161  8   DT  C "C4'" 
954  O "O4'" . DT  C 8  ? 0.4526 0.6031 0.3390 0.0253  -0.0923 0.0179  8   DT  C "O4'" 
955  C "C3'" . DT  C 8  ? 0.4691 0.6065 0.3391 0.0232  -0.1271 0.0057  8   DT  C "C3'" 
956  O "O3'" . DT  C 8  ? 0.6165 0.7129 0.4250 0.0199  -0.1341 0.0062  8   DT  C "O3'" 
957  C "C2'" . DT  C 8  ? 0.4166 0.5706 0.3066 0.0180  -0.1003 0.0034  8   DT  C "C2'" 
958  C "C1'" . DT  C 8  ? 0.4394 0.5903 0.3219 0.0199  -0.0806 0.0125  8   DT  C "C1'" 
959  N N1    . DT  C 8  ? 0.3749 0.5478 0.2889 0.0199  -0.0639 0.0131  8   DT  C N1    
960  C C2    . DT  C 8  ? 0.3758 0.5437 0.2835 0.0190  -0.0455 0.0145  8   DT  C C2    
961  O O2    . DT  C 8  ? 0.4177 0.5651 0.2968 0.0169  -0.0363 0.0138  8   DT  C O2    
962  N N3    . DT  C 8  ? 0.3571 0.5425 0.2927 0.0212  -0.0382 0.0161  8   DT  C N3    
963  C C4    . DT  C 8  ? 0.3360 0.5361 0.2922 0.0221  -0.0435 0.0167  8   DT  C C4    
964  O O4    . DT  C 8  ? 0.3378 0.5434 0.3049 0.0240  -0.0389 0.0190  8   DT  C O4    
965  C C5    . DT  C 8  ? 0.3282 0.5340 0.2909 0.0217  -0.0550 0.0136  8   DT  C C5    
966  C C7    . DT  C 8  ? 0.3239 0.5439 0.3085 0.0218  -0.0535 0.0116  8   DT  C C7    
967  C C6    . DT  C 8  ? 0.4071 0.6023 0.3545 0.0217  -0.0667 0.0118  8   DT  C C6    
968  P P     . DT  C 9  ? 0.6391 0.7230 0.4302 0.0130  -0.1468 -0.0059 9   DT  C P     
969  O OP1   . DT  C 9  ? 0.6667 0.7014 0.3863 0.0128  -0.1670 -0.0043 9   DT  C OP1   
970  O OP2   . DT  C 9  ? 0.5319 0.6541 0.3864 0.0118  -0.1621 -0.0154 9   DT  C OP2   
971  O "O5'" . DT  C 9  ? 0.6267 0.7027 0.4033 0.0072  -0.1115 -0.0081 9   DT  C "O5'" 
972  C "C5'" . DT  C 9  ? 0.5823 0.6336 0.3193 0.0071  -0.0862 -0.0011 9   DT  C "C5'" 
973  C "C4'" . DT  C 9  ? 0.6365 0.6846 0.3733 0.0044  -0.0565 -0.0075 9   DT  C "C4'" 
974  O "O4'" . DT  C 9  ? 0.5135 0.5990 0.3079 0.0085  -0.0418 -0.0042 9   DT  C "O4'" 
975  C "C3'" . DT  C 9  ? 0.6208 0.6550 0.3458 -0.0002 -0.0637 -0.0208 9   DT  C "C3'" 
976  O "O3'" . DT  C 9  ? 0.8092 0.8069 0.4856 -0.0022 -0.0390 -0.0265 9   DT  C "O3'" 
977  C "C2'" . DT  C 9  ? 0.5659 0.6345 0.3510 0.0010  -0.0564 -0.0221 9   DT  C "C2'" 
978  C "C1'" . DT  C 9  ? 0.4955 0.5846 0.3068 0.0077  -0.0355 -0.0122 9   DT  C "C1'" 
979  N N1    . DT  C 9  ? 0.4091 0.5312 0.2712 0.0108  -0.0362 -0.0074 9   DT  C N1    
980  C C2    . DT  C 9  ? 0.4193 0.5509 0.3030 0.0166  -0.0186 -0.0040 9   DT  C C2    
981  O O2    . DT  C 9  ? 0.4863 0.6064 0.3612 0.0199  -0.0007 -0.0068 9   DT  C O2    
982  N N3    . DT  C 9  ? 0.3783 0.5314 0.2945 0.0189  -0.0228 0.0014  9   DT  C N3    
983  C C4    . DT  C 9  ? 0.3669 0.5339 0.2973 0.0151  -0.0353 0.0027  9   DT  C C4    
984  O O4    . DT  C 9  ? 0.3560 0.5343 0.3048 0.0166  -0.0335 0.0072  9   DT  C O4    
985  C C5    . DT  C 9  ? 0.4143 0.5787 0.3353 0.0101  -0.0504 -0.0024 9   DT  C C5    
986  C C7    . DT  C 9  ? 0.4049 0.5899 0.3549 0.0071  -0.0617 -0.0044 9   DT  C C7    
987  C C6    . DT  C 9  ? 0.4013 0.5430 0.2876 0.0087  -0.0537 -0.0064 9   DT  C C6    
988  P P     . DA  C 10 ? 0.8815 0.8381 0.5079 -0.0087 -0.0455 -0.0420 10  DA  C P     
989  O OP1   . DA  C 10 ? 0.9167 0.8212 0.4623 -0.0119 -0.0302 -0.0440 10  DA  C OP1   
990  O OP2   . DA  C 10 ? 0.8704 0.8378 0.5143 -0.0136 -0.0845 -0.0470 10  DA  C OP2   
991  O "O5'" . DA  C 10 ? 0.7503 0.7166 0.4120 -0.0055 -0.0185 -0.0495 10  DA  C "O5'" 
992  C "C5'" . DA  C 10 ? 0.7053 0.6812 0.3872 0.0023  0.0169  -0.0462 10  DA  C "C5'" 
993  C "C4'" . DA  C 10 ? 0.6745 0.6639 0.4019 0.0088  0.0276  -0.0509 10  DA  C "C4'" 
994  O "O4'" . DA  C 10 ? 0.6402 0.6713 0.4251 0.0123  0.0150  -0.0394 10  DA  C "O4'" 
995  C "C3'" . DA  C 10 ? 0.6847 0.6461 0.3919 0.0024  0.0157  -0.0640 10  DA  C "C3'" 
996  O "O3'" . DA  C 10 ? 0.7581 0.7057 0.4788 0.0105  0.0385  -0.0720 10  DA  C "O3'" 
997  C "C2'" . DA  C 10 ? 0.6507 0.6429 0.4012 -0.0022 -0.0094 -0.0573 10  DA  C "C2'" 
998  C "C1'" . DA  C 10 ? 0.6068 0.6346 0.4055 0.0083  0.0025  -0.0437 10  DA  C "C1'" 
999  N N9    . DA  C 10 ? 0.5088 0.5694 0.3446 0.0057  -0.0139 -0.0338 10  DA  C N9    
1000 C C8    . DA  C 10 ? 0.4877 0.5604 0.3298 -0.0034 -0.0362 -0.0344 10  DA  C C8    
1001 N N7    . DA  C 10 ? 0.4571 0.5581 0.3371 -0.0033 -0.0393 -0.0264 10  DA  C N7    
1002 C C5    . DA  C 10 ? 0.4172 0.5203 0.3094 0.0059  -0.0229 -0.0193 10  DA  C C5    
1003 C C6    . DA  C 10 ? 0.3860 0.5061 0.3040 0.0102  -0.0202 -0.0093 10  DA  C C6    
1004 N N6    . DA  C 10 ? 0.3364 0.4736 0.2713 0.0040  -0.0268 -0.0060 10  DA  C N6    
1005 N N1    . DA  C 10 ? 0.4063 0.5221 0.3313 0.0213  -0.0107 -0.0045 10  DA  C N1    
1006 C C2    . DA  C 10 ? 0.4297 0.5312 0.3463 0.0283  0.0004  -0.0105 10  DA  C C2    
1007 N N3    . DA  C 10 ? 0.4496 0.5329 0.3389 0.0244  0.0060  -0.0208 10  DA  C N3    
1008 C C4    . DA  C 10 ? 0.4623 0.5449 0.3353 0.0126  -0.0086 -0.0240 10  DA  C C4    
1009 P P     . DG  C 11 ? 0.9367 0.8334 0.6129 0.0053  0.0424  -0.0912 11  DG  C P     
1010 O OP1   . DG  C 11 ? 0.9946 0.8546 0.6119 0.0058  0.0661  -0.1020 11  DG  C OP1   
1011 O OP2   . DG  C 11 ? 0.8417 0.7336 0.5113 -0.0096 0.0094  -0.0948 11  DG  C OP2   
1012 O "O5'" . DG  C 11 ? 0.9717 0.8682 0.6909 0.0190  0.0616  -0.0929 11  DG  C "O5'" 
1013 C "C5'" . DG  C 11 ? 0.9657 0.8668 0.7169 0.0168  0.0464  -0.0879 11  DG  C "C5'" 
1014 C "C4'" . DG  C 11 ? 0.8659 0.8017 0.6720 0.0311  0.0501  -0.0719 11  DG  C "C4'" 
1015 O "O4'" . DG  C 11 ? 0.8244 0.8004 0.6485 0.0252  0.0340  -0.0579 11  DG  C "O4'" 
1016 C "C3'" . DG  C 11 ? 0.8444 0.7662 0.6713 0.0331  0.0435  -0.0669 11  DG  C "C3'" 
1017 O "O3'" . DG  C 11 ? 0.8757 0.7666 0.7071 0.0492  0.0601  -0.0745 11  DG  C "O3'" 
1018 C "C2'" . DG  C 11 ? 0.7403 0.7004 0.6050 0.0394  0.0345  -0.0479 11  DG  C "C2'" 
1019 C "C1'" . DG  C 11 ? 0.6998 0.6943 0.5615 0.0309  0.0274  -0.0444 11  DG  C "C1'" 
1020 N N9    . DG  C 11 ? 0.5880 0.5994 0.4538 0.0162  0.0096  -0.0379 11  DG  C N9    
1021 C C8    . DG  C 11 ? 0.5817 0.5956 0.4314 0.0011  -0.0036 -0.0447 11  DG  C C8    
1022 N N7    . DG  C 11 ? 0.5145 0.5518 0.3864 -0.0078 -0.0153 -0.0384 11  DG  C N7    
1023 C C5    . DG  C 11 ? 0.4785 0.5227 0.3703 0.0001  -0.0080 -0.0261 11  DG  C C5    
1024 C C6    . DG  C 11 ? 0.4279 0.4893 0.3387 -0.0046 -0.0106 -0.0160 11  DG  C C6    
1025 O O6    . DG  C 11 ? 0.3888 0.4689 0.3138 -0.0168 -0.0164 -0.0174 11  DG  C O6    
1026 N N1    . DG  C 11 ? 0.4174 0.4701 0.3301 0.0069  -0.0054 -0.0046 11  DG  C N1    
1027 C C2    . DG  C 11 ? 0.4924 0.5299 0.4035 0.0234  -0.0010 -0.0037 11  DG  C C2    
1028 N N2    . DG  C 11 ? 0.4666 0.4963 0.3823 0.0347  -0.0041 0.0078  11  DG  C N2    
1029 N N3    . DG  C 11 ? 0.5069 0.5345 0.4115 0.0288  0.0059  -0.0146 11  DG  C N3    
1030 C C4    . DG  C 11 ? 0.5209 0.5497 0.4100 0.0157  0.0032  -0.0250 11  DG  C C4    
1031 P P     . DT  C 12 ? 0.9996 0.8488 0.8278 0.0479  0.0548  -0.0743 12  DT  C P     
1032 O OP1   . DT  C 12 ? 0.9479 0.7625 0.7793 0.0682  0.0730  -0.0855 12  DT  C OP1   
1033 O OP2   . DT  C 12 ? 0.8436 0.6768 0.6434 0.0214  0.0421  -0.0811 12  DT  C OP2   
1034 O "O5'" . DT  C 12 ? 0.8092 0.6808 0.6693 0.0541  0.0417  -0.0518 12  DT  C "O5'" 
1035 C "C5'" . DT  C 12 ? 0.7461 0.6420 0.6424 0.0772  0.0419  -0.0417 12  DT  C "C5'" 
1036 C "C4'" . DT  C 12 ? 0.7183 0.6139 0.6211 0.0777  0.0246  -0.0218 12  DT  C "C4'" 
1037 O "O4'" . DT  C 12 ? 0.6271 0.5500 0.5211 0.0568  0.0170  -0.0151 12  DT  C "O4'" 
1038 C "C3'" . DT  C 12 ? 0.7781 0.6165 0.6574 0.0746  0.0221  -0.0179 12  DT  C "C3'" 
1039 O "O3'" . DT  C 12 ? 0.8594 0.6800 0.7455 0.0926  0.0091  -0.0011 12  DT  C "O3'" 
1040 C "C2'" . DT  C 12 ? 0.7552 0.5934 0.6124 0.0442  0.0201  -0.0163 12  DT  C "C2'" 
1041 C "C1'" . DT  C 12 ? 0.6507 0.5434 0.5243 0.0412  0.0132  -0.0080 12  DT  C "C1'" 
1042 N N1    . DT  C 12 ? 0.6156 0.5320 0.4858 0.0168  0.0122  -0.0128 12  DT  C N1    
1043 C C2    . DT  C 12 ? 0.5829 0.5141 0.4555 0.0051  0.0090  -0.0015 12  DT  C C2    
1044 O O2    . DT  C 12 ? 0.5658 0.4845 0.4309 0.0121  0.0067  0.0131  12  DT  C O2    
1045 N N3    . DT  C 12 ? 0.5157 0.4738 0.3980 -0.0144 0.0079  -0.0090 12  DT  C N3    
1046 C C4    . DT  C 12 ? 0.5437 0.5114 0.4280 -0.0233 0.0035  -0.0249 12  DT  C C4    
1047 O O4    . DT  C 12 ? 0.4989 0.4926 0.3986 -0.0385 -0.0029 -0.0304 12  DT  C O4    
1048 C C5    . DT  C 12 ? 0.5857 0.5290 0.4526 -0.0121 0.0064  -0.0352 12  DT  C C5    
1049 C C7    . DT  C 12 ? 0.6001 0.5413 0.4517 -0.0214 0.0002  -0.0526 12  DT  C C7    
1050 C C6    . DT  C 12 ? 0.5978 0.5186 0.4616 0.0069  0.0136  -0.0294 12  DT  C C6    
1051 P P     . DC  C 13 ? 0.9238 0.6730 0.7787 0.0930  0.0056  0.0073  13  DC  C P     
1052 O OP1   . DC  C 13 ? 0.9622 0.6929 0.8313 0.1240  -0.0110 0.0198  13  DC  C OP1   
1053 O OP2   . DC  C 13 ? 0.9521 0.6658 0.7905 0.0817  0.0208  -0.0105 13  DC  C OP2   
1054 O "O5'" . DC  C 13 ? 0.9689 0.7115 0.7927 0.0658  0.0028  0.0219  13  DC  C "O5'" 
1055 C "C5'" . DC  C 13 ? 0.8764 0.6331 0.6943 0.0702  -0.0106 0.0402  13  DC  C "C5'" 
1056 C "C4'" . DC  C 13 ? 0.8630 0.6012 0.6461 0.0414  -0.0025 0.0497  13  DC  C "C4'" 
1057 O "O4'" . DC  C 13 ? 0.7574 0.5425 0.5598 0.0182  0.0092  0.0361  13  DC  C "O4'" 
1058 C "C3'" . DC  C 13 ? 0.9222 0.5879 0.6671 0.0272  0.0072  0.0548  13  DC  C "C3'" 
1059 O "O3'" . DC  C 13 ? 1.0464 0.6822 0.7501 0.0132  0.0103  0.0732  13  DC  C "O3'" 
1060 C "C2'" . DC  C 13 ? 0.8798 0.5635 0.6400 -0.0010 0.0239  0.0360  13  DC  C "C2'" 
1061 C "C1'" . DC  C 13 ? 0.7668 0.5209 0.5528 -0.0094 0.0235  0.0327  13  DC  C "C1'" 
1062 N N1    . DC  C 13 ? 0.7186 0.5142 0.5330 -0.0264 0.0279  0.0129  13  DC  C N1    
1063 C C2    . DC  C 13 ? 0.6668 0.5008 0.4982 -0.0482 0.0335  0.0105  13  DC  C C2    
1064 O O2    . DC  C 13 ? 0.6792 0.5112 0.4989 -0.0535 0.0400  0.0237  13  DC  C O2    
1065 N N3    . DC  C 13 ? 0.6598 0.5288 0.5183 -0.0619 0.0306  -0.0070 13  DC  C N3    
1066 C C4    . DC  C 13 ? 0.6546 0.5159 0.5116 -0.0565 0.0239  -0.0215 13  DC  C C4    
1067 N N4    . DC  C 13 ? 0.6405 0.5304 0.5152 -0.0699 0.0156  -0.0379 13  DC  C N4    
1068 C C5    . DC  C 13 ? 0.6685 0.4893 0.5045 -0.0360 0.0246  -0.0208 13  DC  C C5    
1069 C C6    . DC  C 13 ? 0.7153 0.5072 0.5366 -0.0206 0.0260  -0.0036 13  DC  C C6    
1070 P P     . DG  C 14 ? 1.2205 0.7619 0.8649 0.0095  0.0127  0.0910  14  DG  C P     
1071 O OP1   . DG  C 14 ? 1.3184 0.8388 0.9152 -0.0024 0.0163  0.1096  14  DG  C OP1   
1072 O OP2   . DG  C 14 ? 1.2954 0.8011 0.9416 0.0444  -0.0082 0.0943  14  DG  C OP2   
1073 O "O5'" . DG  C 14 ? 1.3661 0.8849 1.0115 -0.0244 0.0385  0.0782  14  DG  C "O5'" 
1074 C "C5'" . DG  C 14 ? 1.3972 0.9351 1.0452 -0.0618 0.0624  0.0746  14  DG  C "C5'" 
1075 C "C4'" . DG  C 14 ? 1.5033 1.0105 1.1574 -0.0917 0.0812  0.0618  14  DG  C "C4'" 
1076 O "O4'" . DG  C 14 ? 1.5299 1.0282 1.2014 -0.0764 0.0694  0.0467  14  DG  C "O4'" 
1077 C "C3'" . DG  C 14 ? 1.6515 1.0672 1.2488 -0.1115 0.0992  0.0783  14  DG  C "C3'" 
1078 O "O3'" . DG  C 14 ? 1.5967 1.0106 1.2144 -0.1537 0.1256  0.0652  14  DG  C "O3'" 
1079 C "C2'" . DG  C 14 ? 1.7111 1.0615 1.2841 -0.0856 0.0827  0.0820  14  DG  C "C2'" 
1080 C "C1'" . DG  C 14 ? 1.6645 1.0734 1.2928 -0.0688 0.0691  0.0573  14  DG  C "C1'" 
1081 N N9    . DG  C 14 ? 1.7183 1.1226 1.3493 -0.0251 0.0464  0.0604  14  DG  C N9    
1082 C C8    . DG  C 14 ? 1.8053 1.1466 1.3993 0.0022  0.0313  0.0806  14  DG  C C8    
1083 N N7    . DG  C 14 ? 1.7465 1.1093 1.3699 0.0401  0.0122  0.0756  14  DG  C N7    
1084 C C5    . DG  C 14 ? 1.6621 1.1011 1.3353 0.0354  0.0188  0.0520  14  DG  C C5    
1085 C C6    . DG  C 14 ? 1.5791 1.0680 1.2974 0.0628  0.0116  0.0366  14  DG  C C6    
1086 O O6    . DG  C 14 ? 1.6627 1.1468 1.3996 0.0984  -0.0018 0.0388  14  DG  C O6    
1087 N N1    . DG  C 14 ? 1.3751 0.9229 1.1195 0.0449  0.0225  0.0165  14  DG  C N1    
1088 C C2    . DG  C 14 ? 1.3472 0.9105 1.0860 0.0081  0.0333  0.0107  14  DG  C C2    
1089 N N2    . DG  C 14 ? 1.2054 0.8229 0.9695 -0.0014 0.0357  -0.0082 14  DG  C N2    
1090 N N3    . DG  C 14 ? 1.4663 0.9928 1.1779 -0.0175 0.0414  0.0224  14  DG  C N3    
1091 C C4    . DG  C 14 ? 1.5485 1.0114 1.2238 -0.0033 0.0362  0.0432  14  DG  C C4    
1092 N N     . VAL D 4  ? 1.3100 1.1880 0.6226 -0.0034 -0.2385 0.0405  137 VAL D N     
1093 C CA    . VAL D 4  ? 1.1412 1.0452 0.5245 0.0032  -0.2441 0.0301  137 VAL D CA    
1094 C C     . VAL D 4  ? 1.0268 0.9343 0.4511 0.0037  -0.2164 0.0303  137 VAL D C     
1095 O O     . VAL D 4  ? 1.0201 0.9197 0.4582 0.0096  -0.2138 0.0464  137 VAL D O     
1096 C CB    . VAL D 4  ? 1.0585 0.9714 0.4681 0.0161  -0.2747 0.0430  137 VAL D CB    
1097 N N     . ARG D 5  ? 0.9738 0.8914 0.4163 -0.0022 -0.1963 0.0122  138 ARG D N     
1098 C CA    . ARG D 5  ? 0.9144 0.8422 0.4060 0.0000  -0.1766 0.0107  138 ARG D CA    
1099 C C     . ARG D 5  ? 0.8660 0.8143 0.4105 0.0082  -0.1931 0.0085  138 ARG D C     
1100 O O     . ARG D 5  ? 0.9092 0.8691 0.4598 0.0086  -0.2134 0.0007  138 ARG D O     
1101 C CB    . ARG D 5  ? 0.9051 0.8373 0.4023 -0.0065 -0.1508 -0.0059 138 ARG D CB    
1102 C CG    . ARG D 5  ? 0.9787 0.9213 0.4882 -0.0091 -0.1562 -0.0267 138 ARG D CG    
1103 C CD    . ARG D 5  ? 0.9950 0.9373 0.5085 -0.0130 -0.1300 -0.0418 138 ARG D CD    
1104 N NE    . ARG D 5  ? 0.9182 0.8719 0.4797 -0.0089 -0.1146 -0.0397 138 ARG D NE    
1105 C CZ    . ARG D 5  ? 0.8747 0.8279 0.4392 -0.0094 -0.0919 -0.0355 138 ARG D CZ    
1106 N NH1   . ARG D 5  ? 0.8738 0.8163 0.3982 -0.0144 -0.0782 -0.0326 138 ARG D NH1   
1107 N NH2   . ARG D 5  ? 0.8218 0.7869 0.4297 -0.0055 -0.0823 -0.0343 138 ARG D NH2   
1108 N N     . LYS D 6  ? 0.8530 0.8064 0.4347 0.0139  -0.1846 0.0154  139 LYS D N     
1109 C CA    . LYS D 6  ? 0.9014 0.8756 0.5332 0.0217  -0.1956 0.0130  139 LYS D CA    
1110 C C     . LYS D 6  ? 0.8215 0.8133 0.4770 0.0160  -0.1930 -0.0050 139 LYS D C     
1111 O O     . LYS D 6  ? 0.8070 0.7942 0.4557 0.0093  -0.1746 -0.0146 139 LYS D O     
1112 C CB    . LYS D 6  ? 0.9850 0.9598 0.6472 0.0267  -0.1811 0.0196  139 LYS D CB    
1113 C CG    . LYS D 6  ? 1.0145 1.0106 0.7265 0.0353  -0.1883 0.0175  139 LYS D CG    
1114 C CD    . LYS D 6  ? 1.0740 1.0724 0.8117 0.0361  -0.1686 0.0172  139 LYS D CD    
1115 C CE    . LYS D 6  ? 0.9163 0.9348 0.6988 0.0447  -0.1730 0.0154  139 LYS D CE    
1116 N NZ    . LYS D 6  ? 0.9479 0.9584 0.7410 0.0493  -0.1619 0.0210  139 LYS D NZ    
1117 N N     . PRO D 7  ? 0.7875 0.7990 0.4726 0.0186  -0.2112 -0.0096 140 PRO D N     
1118 C CA    . PRO D 7  ? 0.7557 0.7817 0.4678 0.0117  -0.2078 -0.0250 140 PRO D CA    
1119 C C     . PRO D 7  ? 0.7140 0.7446 0.4579 0.0127  -0.1857 -0.0260 140 PRO D C     
1120 O O     . PRO D 7  ? 0.7296 0.7628 0.4902 0.0203  -0.1804 -0.0160 140 PRO D O     
1121 C CB    . PRO D 7  ? 0.7581 0.8085 0.5034 0.0149  -0.2306 -0.0255 140 PRO D CB    
1122 C CG    . PRO D 7  ? 0.8628 0.9079 0.5841 0.0230  -0.2507 -0.0133 140 PRO D CG    
1123 C CD    . PRO D 7  ? 0.8455 0.8680 0.5442 0.0280  -0.2352 -0.0006 140 PRO D CD    
1124 N N     . ARG D 8  ? 0.6709 0.7002 0.4207 0.0056  -0.1736 -0.0381 141 ARG D N     
1125 C CA    . ARG D 8  ? 0.6112 0.6430 0.3863 0.0069  -0.1536 -0.0382 141 ARG D CA    
1126 C C     . ARG D 8  ? 0.5950 0.6480 0.4153 0.0096  -0.1573 -0.0360 141 ARG D C     
1127 O O     . ARG D 8  ? 0.4958 0.5612 0.3358 0.0045  -0.1673 -0.0424 141 ARG D O     
1128 C CB    . ARG D 8  ? 0.6077 0.6293 0.3750 0.0005  -0.1409 -0.0510 141 ARG D CB    
1129 C CG    . ARG D 8  ? 0.5487 0.5724 0.3405 0.0030  -0.1222 -0.0501 141 ARG D CG    
1130 C CD    . ARG D 8  ? 0.5925 0.6031 0.3746 -0.0002 -0.1097 -0.0622 141 ARG D CD    
1131 N NE    . ARG D 8  ? 0.5786 0.5926 0.3883 0.0032  -0.0957 -0.0606 141 ARG D NE    
1132 C CZ    . ARG D 8  ? 0.5483 0.5572 0.3544 0.0071  -0.0794 -0.0618 141 ARG D CZ    
1133 N NH1   . ARG D 8  ? 0.5476 0.5484 0.3243 0.0071  -0.0714 -0.0652 141 ARG D NH1   
1134 N NH2   . ARG D 8  ? 0.5134 0.5269 0.3460 0.0110  -0.0707 -0.0590 141 ARG D NH2   
1135 N N     . THR D 9  ? 0.5993 0.6569 0.4356 0.0166  -0.1485 -0.0273 142 THR D N     
1136 C CA    . THR D 9  ? 0.5506 0.6277 0.4257 0.0196  -0.1475 -0.0254 142 THR D CA    
1137 C C     . THR D 9  ? 0.5357 0.6159 0.4288 0.0127  -0.1369 -0.0320 142 THR D C     
1138 O O     . THR D 9  ? 0.4793 0.5464 0.3617 0.0112  -0.1236 -0.0342 142 THR D O     
1139 C CB    . THR D 9  ? 0.5698 0.6460 0.4505 0.0279  -0.1383 -0.0168 142 THR D CB    
1140 O OG1   . THR D 9  ? 0.6114 0.6774 0.4714 0.0336  -0.1477 -0.0098 142 THR D OG1   
1141 C CG2   . THR D 9  ? 0.5481 0.6452 0.4646 0.0323  -0.1372 -0.0154 142 THR D CG2   
1142 N N     . ILE D 10 ? 0.4653 0.5628 0.3867 0.0085  -0.1431 -0.0346 143 ILE D N     
1143 C CA    . ILE D 10 ? 0.5476 0.6473 0.4893 0.0017  -0.1331 -0.0375 143 ILE D CA    
1144 C C     . ILE D 10 ? 0.5563 0.6734 0.5241 0.0073  -0.1250 -0.0296 143 ILE D C     
1145 O O     . ILE D 10 ? 0.5040 0.6430 0.4948 0.0088  -0.1317 -0.0278 143 ILE D O     
1146 C CB    . ILE D 10 ? 0.5170 0.6243 0.4734 -0.0097 -0.1440 -0.0453 143 ILE D CB    
1147 C CG1   . ILE D 10 ? 0.6526 0.7452 0.5798 -0.0146 -0.1562 -0.0547 143 ILE D CG1   
1148 C CG2   . ILE D 10 ? 0.4940 0.5962 0.4673 -0.0185 -0.1334 -0.0473 143 ILE D CG2   
1149 C CD1   . ILE D 10 ? 0.6268 0.6922 0.5230 -0.0142 -0.1448 -0.0598 143 ILE D CD1   
1150 N N     . TYR D 11 ? 0.5188 0.6285 0.4832 0.0110  -0.1111 -0.0254 144 TYR D N     
1151 C CA    . TYR D 11 ? 0.4648 0.5894 0.4478 0.0162  -0.1034 -0.0191 144 TYR D CA    
1152 C C     . TYR D 11 ? 0.4171 0.5545 0.4247 0.0086  -0.0986 -0.0181 144 TYR D C     
1153 O O     . TYR D 11 ? 0.4900 0.6162 0.4972 0.0003  -0.0959 -0.0202 144 TYR D O     
1154 C CB    . TYR D 11 ? 0.4665 0.5804 0.4368 0.0217  -0.0922 -0.0152 144 TYR D CB    
1155 C CG    . TYR D 11 ? 0.4513 0.5563 0.4025 0.0281  -0.0951 -0.0142 144 TYR D CG    
1156 C CD1   . TYR D 11 ? 0.4976 0.6099 0.4533 0.0354  -0.0995 -0.0115 144 TYR D CD1   
1157 C CD2   . TYR D 11 ? 0.4213 0.5095 0.3504 0.0268  -0.0921 -0.0157 144 TYR D CD2   
1158 C CE1   . TYR D 11 ? 0.4718 0.5711 0.4092 0.0400  -0.1021 -0.0091 144 TYR D CE1   
1159 C CE2   . TYR D 11 ? 0.4481 0.5274 0.3594 0.0302  -0.0932 -0.0131 144 TYR D CE2   
1160 C CZ    . TYR D 11 ? 0.4567 0.5395 0.3713 0.0361  -0.0989 -0.0092 144 TYR D CZ    
1161 O OH    . TYR D 11 ? 0.5390 0.6076 0.4342 0.0382  -0.1004 -0.0053 144 TYR D OH    
1162 N N     . SER D 12 ? 0.4143 0.5742 0.4433 0.0114  -0.0963 -0.0149 145 SER D N     
1163 C CA    . SER D 12 ? 0.3613 0.5346 0.4120 0.0038  -0.0877 -0.0116 145 SER D CA    
1164 C C     . SER D 12 ? 0.3782 0.5404 0.4179 0.0059  -0.0743 -0.0051 145 SER D C     
1165 O O     . SER D 12 ? 0.3283 0.4821 0.3516 0.0147  -0.0722 -0.0042 145 SER D O     
1166 C CB    . SER D 12 ? 0.3797 0.5842 0.4565 0.0075  -0.0873 -0.0109 145 SER D CB    
1167 O OG    . SER D 12 ? 0.3692 0.5770 0.4394 0.0204  -0.0814 -0.0090 145 SER D OG    
1168 N N     . SER D 13 ? 0.4196 0.5826 0.4692 -0.0028 -0.0663 -0.0001 146 SER D N     
1169 C CA    A SER D 13 ? 0.4859 0.6412 0.5258 -0.0005 -0.0550 0.0080  146 SER D CA    
1170 C CA    B SER D 13 ? 0.4702 0.6261 0.5108 -0.0008 -0.0548 0.0081  146 SER D CA    
1171 C C     . SER D 13 ? 0.4612 0.6331 0.4996 0.0086  -0.0490 0.0101  146 SER D C     
1172 O O     . SER D 13 ? 0.3574 0.5212 0.3798 0.0146  -0.0449 0.0134  146 SER D O     
1173 C CB    A SER D 13 ? 0.4866 0.6390 0.5368 -0.0125 -0.0477 0.0153  146 SER D CB    
1174 C CB    B SER D 13 ? 0.4505 0.6068 0.5037 -0.0132 -0.0474 0.0152  146 SER D CB    
1175 O OG    A SER D 13 ? 0.4642 0.6430 0.5344 -0.0179 -0.0411 0.0184  146 SER D OG    
1176 O OG    B SER D 13 ? 0.4328 0.5736 0.4907 -0.0235 -0.0536 0.0111  146 SER D OG    
1177 N N     . PHE D 14 ? 0.4114 0.6072 0.4673 0.0103  -0.0491 0.0070  147 PHE D N     
1178 C CA    . PHE D 14 ? 0.4671 0.6769 0.5215 0.0204  -0.0433 0.0059  147 PHE D CA    
1179 C C     . PHE D 14 ? 0.4136 0.6094 0.4500 0.0313  -0.0502 0.0013  147 PHE D C     
1180 O O     . PHE D 14 ? 0.3334 0.5264 0.3569 0.0375  -0.0453 0.0014  147 PHE D O     
1181 C CB    . PHE D 14 ? 0.5366 0.7765 0.6183 0.0217  -0.0417 0.0021  147 PHE D CB    
1182 C CG    . PHE D 14 ? 0.7405 0.9913 0.8214 0.0355  -0.0383 -0.0029 147 PHE D CG    
1183 C CD1   . PHE D 14 ? 0.8392 1.0980 0.9128 0.0380  -0.0243 -0.0013 147 PHE D CD1   
1184 C CD2   . PHE D 14 ? 0.8416 1.0920 0.9264 0.0463  -0.0495 -0.0093 147 PHE D CD2   
1185 C CE1   . PHE D 14 ? 0.9214 1.1875 0.9928 0.0510  -0.0208 -0.0086 147 PHE D CE1   
1186 C CE2   . PHE D 14 ? 0.9332 1.1888 1.0175 0.0599  -0.0464 -0.0148 147 PHE D CE2   
1187 C CZ    . PHE D 14 ? 0.9846 1.2480 1.0627 0.0622  -0.0318 -0.0157 147 PHE D CZ    
1188 N N     . GLN D 15 ? 0.3380 0.5243 0.3720 0.0323  -0.0616 -0.0025 148 GLN D N     
1189 C CA    . GLN D 15 ? 0.3005 0.4713 0.3165 0.0401  -0.0673 -0.0051 148 GLN D CA    
1190 C C     . GLN D 15 ? 0.2938 0.4461 0.2904 0.0380  -0.0635 -0.0024 148 GLN D C     
1191 O O     . GLN D 15 ? 0.3446 0.4897 0.3287 0.0431  -0.0626 -0.0031 148 GLN D O     
1192 C CB    . GLN D 15 ? 0.3094 0.4736 0.3234 0.0403  -0.0801 -0.0081 148 GLN D CB    
1193 C CG    . GLN D 15 ? 0.3473 0.5307 0.3814 0.0460  -0.0874 -0.0107 148 GLN D CG    
1194 C CD    . GLN D 15 ? 0.3697 0.5504 0.4030 0.0444  -0.1025 -0.0125 148 GLN D CD    
1195 O OE1   . GLN D 15 ? 0.3676 0.5374 0.3909 0.0356  -0.1057 -0.0134 148 GLN D OE1   
1196 N NE2   . GLN D 15 ? 0.3811 0.5718 0.4249 0.0536  -0.1123 -0.0136 148 GLN D NE2   
1197 N N     . LEU D 16 ? 0.2964 0.4408 0.2922 0.0309  -0.0625 -0.0001 149 LEU D N     
1198 C CA    . LEU D 16 ? 0.3396 0.4687 0.3212 0.0312  -0.0598 0.0017  149 LEU D CA    
1199 C C     . LEU D 16 ? 0.3320 0.4664 0.3106 0.0340  -0.0531 0.0066  149 LEU D C     
1200 O O     . LEU D 16 ? 0.3878 0.5172 0.3564 0.0375  -0.0528 0.0066  149 LEU D O     
1201 C CB    . LEU D 16 ? 0.3304 0.4484 0.3134 0.0252  -0.0595 0.0023  149 LEU D CB    
1202 C CG    . LEU D 16 ? 0.3993 0.5083 0.3784 0.0217  -0.0667 -0.0044 149 LEU D CG    
1203 C CD1   . LEU D 16 ? 0.4725 0.5686 0.4542 0.0150  -0.0657 -0.0057 149 LEU D CD1   
1204 C CD2   . LEU D 16 ? 0.4108 0.5105 0.3731 0.0262  -0.0683 -0.0076 149 LEU D CD2   
1205 N N     . ALA D 17 ? 0.3313 0.4770 0.3184 0.0314  -0.0478 0.0107  150 ALA D N     
1206 C CA    . ALA D 17 ? 0.3760 0.5270 0.3557 0.0332  -0.0413 0.0162  150 ALA D CA    
1207 C C     . ALA D 17 ? 0.3605 0.5173 0.3318 0.0401  -0.0416 0.0108  150 ALA D C     
1208 O O     . ALA D 17 ? 0.3275 0.4817 0.2865 0.0426  -0.0415 0.0119  150 ALA D O     
1209 C CB    . ALA D 17 ? 0.3726 0.5357 0.3616 0.0276  -0.0336 0.0219  150 ALA D CB    
1210 N N     . ALA D 18 ? 0.3249 0.4882 0.3036 0.0436  -0.0435 0.0042  151 ALA D N     
1211 C CA    . ALA D 18 ? 0.3193 0.4830 0.2908 0.0507  -0.0442 -0.0024 151 ALA D CA    
1212 C C     . ALA D 18 ? 0.3666 0.5143 0.3263 0.0515  -0.0505 -0.0046 151 ALA D C     
1213 O O     . ALA D 18 ? 0.2968 0.4411 0.2458 0.0535  -0.0505 -0.0078 151 ALA D O     
1214 C CB    . ALA D 18 ? 0.3663 0.5390 0.3516 0.0561  -0.0456 -0.0081 151 ALA D CB    
1215 N N     . LEU D 19 ? 0.2897 0.4279 0.2507 0.0487  -0.0553 -0.0034 152 LEU D N     
1216 C CA    . LEU D 19 ? 0.2995 0.4248 0.2507 0.0478  -0.0590 -0.0048 152 LEU D CA    
1217 C C     . LEU D 19 ? 0.2864 0.4122 0.2331 0.0455  -0.0567 -0.0019 152 LEU D C     
1218 O O     . LEU D 19 ? 0.3099 0.4331 0.2506 0.0451  -0.0581 -0.0042 152 LEU D O     
1219 C CB    . LEU D 19 ? 0.2929 0.4098 0.2440 0.0452  -0.0629 -0.0044 152 LEU D CB    
1220 C CG    . LEU D 19 ? 0.3284 0.4426 0.2809 0.0485  -0.0692 -0.0066 152 LEU D CG    
1221 C CD1   . LEU D 19 ? 0.3342 0.4441 0.2855 0.0445  -0.0735 -0.0059 152 LEU D CD1   
1222 C CD2   . LEU D 19 ? 0.3976 0.4982 0.3390 0.0509  -0.0724 -0.0079 152 LEU D CD2   
1223 N N     . GLN D 20 ? 0.2966 0.4258 0.2480 0.0440  -0.0541 0.0031  153 GLN D N     
1224 C CA    . GLN D 20 ? 0.3024 0.4326 0.2521 0.0442  -0.0535 0.0076  153 GLN D CA    
1225 C C     . GLN D 20 ? 0.3844 0.5230 0.3266 0.0460  -0.0536 0.0087  153 GLN D C     
1226 O O     . GLN D 20 ? 0.3110 0.4522 0.2507 0.0467  -0.0568 0.0092  153 GLN D O     
1227 C CB    . GLN D 20 ? 0.3280 0.4549 0.2834 0.0429  -0.0512 0.0137  153 GLN D CB    
1228 C CG    . GLN D 20 ? 0.3679 0.4842 0.3273 0.0409  -0.0519 0.0104  153 GLN D CG    
1229 C CD    . GLN D 20 ? 0.3174 0.4269 0.2829 0.0379  -0.0501 0.0139  153 GLN D CD    
1230 O OE1   . GLN D 20 ? 0.3827 0.4956 0.3506 0.0361  -0.0476 0.0203  153 GLN D OE1   
1231 N NE2   . GLN D 20 ? 0.4142 0.5127 0.3805 0.0361  -0.0509 0.0093  153 GLN D NE2   
1232 N N     . ARG D 21 ? 0.3161 0.4610 0.2554 0.0467  -0.0501 0.0086  154 ARG D N     
1233 C CA    . ARG D 21 ? 0.3103 0.4628 0.2372 0.0485  -0.0492 0.0078  154 ARG D CA    
1234 C C     . ARG D 21 ? 0.3293 0.4785 0.2502 0.0492  -0.0539 -0.0017 154 ARG D C     
1235 O O     . ARG D 21 ? 0.3363 0.4885 0.2482 0.0486  -0.0581 -0.0032 154 ARG D O     
1236 C CB    . ARG D 21 ? 0.3400 0.5012 0.2656 0.0492  -0.0416 0.0076  154 ARG D CB    
1237 C CG    . ARG D 21 ? 0.4077 0.5760 0.3155 0.0512  -0.0391 0.0044  154 ARG D CG    
1238 C CD    . ARG D 21 ? 0.4070 0.5764 0.3014 0.0499  -0.0426 0.0137  154 ARG D CD    
1239 N NE    . ARG D 21 ? 0.4644 0.6406 0.3365 0.0512  -0.0414 0.0101  154 ARG D NE    
1240 C CZ    . ARG D 21 ? 0.4730 0.6499 0.3304 0.0514  -0.0502 0.0086  154 ARG D CZ    
1241 N NH1   . ARG D 21 ? 0.4916 0.6660 0.3574 0.0509  -0.0606 0.0111  154 ARG D NH1   
1242 N NH2   . ARG D 21 ? 0.4707 0.6529 0.3052 0.0521  -0.0488 0.0036  154 ARG D NH2   
1243 N N     . ARG D 22 ? 0.3515 0.4933 0.2774 0.0500  -0.0543 -0.0079 155 ARG D N     
1244 C CA    . ARG D 22 ? 0.3811 0.5142 0.3014 0.0495  -0.0584 -0.0160 155 ARG D CA    
1245 C C     . ARG D 22 ? 0.3259 0.4564 0.2478 0.0442  -0.0630 -0.0147 155 ARG D C     
1246 O O     . ARG D 22 ? 0.3423 0.4716 0.2588 0.0411  -0.0670 -0.0202 155 ARG D O     
1247 C CB    . ARG D 22 ? 0.3644 0.4861 0.2887 0.0522  -0.0591 -0.0203 155 ARG D CB    
1248 C CG    . ARG D 22 ? 0.4334 0.5399 0.3504 0.0507  -0.0632 -0.0277 155 ARG D CG    
1249 C CD    . ARG D 22 ? 0.4223 0.5291 0.3290 0.0533  -0.0625 -0.0372 155 ARG D CD    
1250 N NE    . ARG D 22 ? 0.4792 0.5933 0.3884 0.0619  -0.0567 -0.0400 155 ARG D NE    
1251 C CZ    . ARG D 22 ? 0.5505 0.6559 0.4638 0.0697  -0.0561 -0.0462 155 ARG D CZ    
1252 N NH1   . ARG D 22 ? 0.5341 0.6176 0.4449 0.0699  -0.0616 -0.0500 155 ARG D NH1   
1253 N NH2   . ARG D 22 ? 0.6001 0.7192 0.5213 0.0775  -0.0496 -0.0482 155 ARG D NH2   
1254 N N     . PHE D 23 ? 0.3056 0.4361 0.2360 0.0428  -0.0620 -0.0088 156 PHE D N     
1255 C CA    . PHE D 23 ? 0.2971 0.4294 0.2333 0.0387  -0.0638 -0.0078 156 PHE D CA    
1256 C C     . PHE D 23 ? 0.3512 0.4972 0.2886 0.0390  -0.0679 -0.0061 156 PHE D C     
1257 O O     . PHE D 23 ? 0.3485 0.5007 0.2922 0.0352  -0.0711 -0.0080 156 PHE D O     
1258 C CB    . PHE D 23 ? 0.2739 0.4040 0.2175 0.0391  -0.0604 -0.0035 156 PHE D CB    
1259 C CG    . PHE D 23 ? 0.3341 0.4667 0.2845 0.0354  -0.0591 -0.0043 156 PHE D CG    
1260 C CD1   . PHE D 23 ? 0.3688 0.4926 0.3153 0.0298  -0.0574 -0.0071 156 PHE D CD1   
1261 C CD2   . PHE D 23 ? 0.3244 0.4691 0.2857 0.0379  -0.0591 -0.0016 156 PHE D CD2   
1262 C CE1   . PHE D 23 ? 0.4541 0.5831 0.4075 0.0249  -0.0536 -0.0076 156 PHE D CE1   
1263 C CE2   . PHE D 23 ? 0.3391 0.4913 0.3111 0.0351  -0.0563 -0.0033 156 PHE D CE2   
1264 C CZ    . PHE D 23 ? 0.4014 0.5471 0.3695 0.0276  -0.0525 -0.0066 156 PHE D CZ    
1265 N N     . GLN D 24 ? 0.3850 0.5365 0.3168 0.0431  -0.0680 -0.0016 157 GLN D N     
1266 C CA    . GLN D 24 ? 0.3645 0.5280 0.2922 0.0443  -0.0742 0.0010  157 GLN D CA    
1267 C C     . GLN D 24 ? 0.4528 0.6186 0.3713 0.0401  -0.0798 -0.0083 157 GLN D C     
1268 O O     . GLN D 24 ? 0.4696 0.6464 0.3903 0.0379  -0.0877 -0.0093 157 GLN D O     
1269 C CB    . GLN D 24 ? 0.3538 0.5195 0.2711 0.0483  -0.0723 0.0089  157 GLN D CB    
1270 C CG    . GLN D 24 ? 0.4003 0.5623 0.3266 0.0515  -0.0692 0.0192  157 GLN D CG    
1271 C CD    . GLN D 24 ? 0.3888 0.5507 0.3031 0.0533  -0.0667 0.0290  157 GLN D CD    
1272 O OE1   . GLN D 24 ? 0.4406 0.6048 0.3415 0.0517  -0.0624 0.0269  157 GLN D OE1   
1273 N NE2   . GLN D 24 ? 0.3582 0.5163 0.2769 0.0566  -0.0681 0.0400  157 GLN D NE2   
1274 N N     . LYS D 25 ? 0.4363 0.5918 0.3453 0.0393  -0.0766 -0.0161 158 LYS D N     
1275 C CA    . LYS D 25 ? 0.4645 0.6172 0.3621 0.0357  -0.0814 -0.0270 158 LYS D CA    
1276 C C     . LYS D 25 ? 0.5282 0.6727 0.4352 0.0281  -0.0843 -0.0328 158 LYS D C     
1277 O O     . LYS D 25 ? 0.4402 0.5883 0.3462 0.0215  -0.0914 -0.0392 158 LYS D O     
1278 C CB    . LYS D 25 ? 0.4993 0.6427 0.3838 0.0400  -0.0757 -0.0341 158 LYS D CB    
1279 C CG    . LYS D 25 ? 0.5281 0.6807 0.4036 0.0457  -0.0697 -0.0280 158 LYS D CG    
1280 C CD    . LYS D 25 ? 0.6235 0.7709 0.4921 0.0508  -0.0617 -0.0363 158 LYS D CD    
1281 C CE    . LYS D 25 ? 0.5739 0.7324 0.4414 0.0545  -0.0525 -0.0279 158 LYS D CE    
1282 N NZ    . LYS D 25 ? 0.6550 0.8155 0.5144 0.0598  -0.0437 -0.0375 158 LYS D NZ    
1283 N N     . THR D 26 ? 0.4159 0.5490 0.3308 0.0278  -0.0789 -0.0304 159 THR D N     
1284 C CA    . THR D 26 ? 0.4744 0.5960 0.3945 0.0195  -0.0797 -0.0339 159 THR D CA    
1285 C C     . THR D 26 ? 0.4842 0.6032 0.4137 0.0192  -0.0741 -0.0262 159 THR D C     
1286 O O     . THR D 26 ? 0.4553 0.5685 0.3824 0.0255  -0.0702 -0.0224 159 THR D O     
1287 C CB    . THR D 26 ? 0.5581 0.6570 0.4670 0.0195  -0.0798 -0.0422 159 THR D CB    
1288 O OG1   . THR D 26 ? 0.6765 0.7609 0.5888 0.0094  -0.0808 -0.0436 159 THR D OG1   
1289 C CG2   . THR D 26 ? 0.5034 0.5928 0.4095 0.0292  -0.0747 -0.0395 159 THR D CG2   
1290 N N     . GLN D 27 ? 0.4664 0.5908 0.4064 0.0110  -0.0734 -0.0250 160 GLN D N     
1291 C CA    . GLN D 27 ? 0.4736 0.5968 0.4198 0.0099  -0.0666 -0.0192 160 GLN D CA    
1292 C C     . GLN D 27 ? 0.4545 0.5556 0.3917 0.0036  -0.0637 -0.0188 160 GLN D C     
1293 O O     . GLN D 27 ? 0.4909 0.5863 0.4251 0.0040  -0.0584 -0.0141 160 GLN D O     
1294 C CB    . GLN D 27 ? 0.4653 0.6099 0.4293 0.0058  -0.0650 -0.0177 160 GLN D CB    
1295 C CG    . GLN D 27 ? 0.5090 0.6727 0.4813 0.0143  -0.0691 -0.0154 160 GLN D CG    
1296 C CD    . GLN D 27 ? 0.5526 0.7233 0.5202 0.0137  -0.0788 -0.0195 160 GLN D CD    
1297 O OE1   . GLN D 27 ? 0.5692 0.7458 0.5421 0.0047  -0.0836 -0.0249 160 GLN D OE1   
1298 N NE2   . GLN D 27 ? 0.5055 0.6746 0.4611 0.0218  -0.0813 -0.0174 160 GLN D NE2   
1299 N N     . TYR D 28 ? 0.5449 0.6313 0.4757 -0.0019 -0.0676 -0.0238 161 TYR D N     
1300 C CA    . TYR D 28 ? 0.5567 0.6148 0.4755 -0.0058 -0.0667 -0.0221 161 TYR D CA    
1301 C C     . TYR D 28 ? 0.5927 0.6326 0.5009 0.0026  -0.0717 -0.0273 161 TYR D C     
1302 O O     . TYR D 28 ? 0.5713 0.6156 0.4793 0.0046  -0.0755 -0.0354 161 TYR D O     
1303 C CB    . TYR D 28 ? 0.5074 0.5585 0.4295 -0.0217 -0.0656 -0.0231 161 TYR D CB    
1304 C CG    . TYR D 28 ? 0.4863 0.5588 0.4224 -0.0301 -0.0585 -0.0189 161 TYR D CG    
1305 C CD1   . TYR D 28 ? 0.4976 0.5608 0.4272 -0.0359 -0.0501 -0.0114 161 TYR D CD1   
1306 C CD2   . TYR D 28 ? 0.5212 0.6246 0.4766 -0.0314 -0.0600 -0.0224 161 TYR D CD2   
1307 C CE1   . TYR D 28 ? 0.5231 0.6074 0.4658 -0.0429 -0.0409 -0.0089 161 TYR D CE1   
1308 C CE2   . TYR D 28 ? 0.4619 0.5875 0.4344 -0.0370 -0.0525 -0.0194 161 TYR D CE2   
1309 C CZ    . TYR D 28 ? 0.5369 0.6533 0.5033 -0.0428 -0.0417 -0.0135 161 TYR D CZ    
1310 O OH    . TYR D 28 ? 0.4886 0.6276 0.4710 -0.0476 -0.0314 -0.0118 161 TYR D OH    
1311 N N     . LEU D 29 ? 0.5707 0.5913 0.4699 0.0086  -0.0719 -0.0230 162 LEU D N     
1312 C CA    . LEU D 29 ? 0.6423 0.6475 0.5358 0.0192  -0.0760 -0.0283 162 LEU D CA    
1313 C C     . LEU D 29 ? 0.7116 0.6837 0.5959 0.0143  -0.0792 -0.0301 162 LEU D C     
1314 O O     . LEU D 29 ? 0.7187 0.6750 0.5972 0.0053  -0.0780 -0.0222 162 LEU D O     
1315 C CB    . LEU D 29 ? 0.6241 0.6304 0.5173 0.0310  -0.0766 -0.0229 162 LEU D CB    
1316 C CG    . LEU D 29 ? 0.6153 0.6494 0.5177 0.0359  -0.0738 -0.0218 162 LEU D CG    
1317 C CD1   . LEU D 29 ? 0.6059 0.6400 0.5102 0.0454  -0.0760 -0.0180 162 LEU D CD1   
1318 C CD2   . LEU D 29 ? 0.6038 0.6537 0.5103 0.0394  -0.0725 -0.0293 162 LEU D CD2   
1319 N N     . ALA D 30 ? 0.7230 0.6831 0.6045 0.0201  -0.0824 -0.0407 163 ALA D N     
1320 C CA    . ALA D 30 ? 0.8069 0.7291 0.6794 0.0204  -0.0862 -0.0429 163 ALA D CA    
1321 C C     . ALA D 30 ? 0.7217 0.6317 0.5919 0.0355  -0.0887 -0.0357 163 ALA D C     
1322 O O     . ALA D 30 ? 0.6140 0.5469 0.4917 0.0466  -0.0878 -0.0347 163 ALA D O     
1323 C CB    . ALA D 30 ? 0.7380 0.6501 0.6075 0.0235  -0.0884 -0.0592 163 ALA D CB    
1324 N N     . LEU D 31 ? 0.7959 0.6695 0.6564 0.0353  -0.0929 -0.0303 164 LEU D N     
1325 C CA    . LEU D 31 ? 0.7801 0.6406 0.6380 0.0500  -0.0983 -0.0219 164 LEU D CA    
1326 C C     . LEU D 31 ? 0.7290 0.6000 0.5987 0.0707  -0.1002 -0.0318 164 LEU D C     
1327 O O     . LEU D 31 ? 0.7027 0.5931 0.5808 0.0815  -0.1022 -0.0270 164 LEU D O     
1328 C CB    . LEU D 31 ? 0.8860 0.7003 0.7291 0.0466  -0.1034 -0.0134 164 LEU D CB    
1329 C CG    . LEU D 31 ? 0.9436 0.7489 0.7745 0.0254  -0.0994 -0.0012 164 LEU D CG    
1330 C CD1   . LEU D 31 ? 0.9636 0.7191 0.7793 0.0179  -0.1027 0.0056  164 LEU D CD1   
1331 C CD2   . LEU D 31 ? 0.9047 0.7274 0.7297 0.0262  -0.0989 0.0119  164 LEU D CD2   
1332 N N     . PRO D 32 ? 0.6892 0.5497 0.5601 0.0755  -0.0988 -0.0469 165 PRO D N     
1333 C CA    . PRO D 32 ? 0.6922 0.5693 0.5758 0.0953  -0.0971 -0.0576 165 PRO D CA    
1334 C C     . PRO D 32 ? 0.6118 0.5350 0.5064 0.0956  -0.0908 -0.0582 165 PRO D C     
1335 O O     . PRO D 32 ? 0.5696 0.5132 0.4781 0.1086  -0.0904 -0.0570 165 PRO D O     
1336 C CB    . PRO D 32 ? 0.7353 0.5937 0.6128 0.0964  -0.0946 -0.0756 165 PRO D CB    
1337 C CG    . PRO D 32 ? 0.7733 0.5983 0.6370 0.0783  -0.0980 -0.0731 165 PRO D CG    
1338 C CD    . PRO D 32 ? 0.7206 0.5578 0.5825 0.0628  -0.0980 -0.0563 165 PRO D CD    
1339 N N     . GLU D 33 ? 0.5848 0.5243 0.4749 0.0807  -0.0866 -0.0589 166 GLU D N     
1340 C CA    . GLU D 33 ? 0.5378 0.5151 0.4357 0.0792  -0.0812 -0.0570 166 GLU D CA    
1341 C C     . GLU D 33 ? 0.5424 0.5337 0.4485 0.0804  -0.0831 -0.0438 166 GLU D C     
1342 O O     . GLU D 33 ? 0.5337 0.5505 0.4517 0.0870  -0.0803 -0.0433 166 GLU D O     
1343 C CB    . GLU D 33 ? 0.5766 0.5630 0.4678 0.0633  -0.0793 -0.0577 166 GLU D CB    
1344 C CG    . GLU D 33 ? 0.6002 0.6203 0.4966 0.0623  -0.0744 -0.0562 166 GLU D CG    
1345 C CD    . GLU D 33 ? 0.6566 0.6856 0.5472 0.0501  -0.0747 -0.0587 166 GLU D CD    
1346 O OE1   . GLU D 33 ? 0.6747 0.6862 0.5593 0.0409  -0.0786 -0.0633 166 GLU D OE1   
1347 O OE2   . GLU D 33 ? 0.6259 0.6793 0.5192 0.0494  -0.0720 -0.0554 166 GLU D OE2   
1348 N N     . ARG D 34 ? 0.5040 0.4778 0.4022 0.0729  -0.0877 -0.0338 167 ARG D N     
1349 C CA    A ARG D 34 ? 0.5082 0.4907 0.4084 0.0729  -0.0907 -0.0227 167 ARG D CA    
1350 C CA    B ARG D 34 ? 0.5128 0.4960 0.4132 0.0730  -0.0906 -0.0228 167 ARG D CA    
1351 C C     . ARG D 34 ? 0.4831 0.4686 0.3938 0.0887  -0.0968 -0.0217 167 ARG D C     
1352 O O     . ARG D 34 ? 0.5204 0.5294 0.4418 0.0913  -0.0975 -0.0189 167 ARG D O     
1353 C CB    A ARG D 34 ? 0.5545 0.5134 0.4390 0.0623  -0.0935 -0.0129 167 ARG D CB    
1354 C CB    B ARG D 34 ? 0.5656 0.5273 0.4506 0.0619  -0.0931 -0.0127 167 ARG D CB    
1355 C CG    A ARG D 34 ? 0.5710 0.5380 0.4509 0.0594  -0.0955 -0.0030 167 ARG D CG    
1356 C CG    B ARG D 34 ? 0.5970 0.5701 0.4791 0.0592  -0.0945 -0.0036 167 ARG D CG    
1357 C CD    A ARG D 34 ? 0.6117 0.5570 0.4727 0.0469  -0.0945 0.0060  167 ARG D CD    
1358 C CD    B ARG D 34 ? 0.6656 0.6121 0.5281 0.0535  -0.0986 0.0071  167 ARG D CD    
1359 N NE    A ARG D 34 ? 0.6225 0.5380 0.4697 0.0524  -0.1032 0.0144  167 ARG D NE    
1360 N NE    B ARG D 34 ? 0.6504 0.5868 0.5030 0.0377  -0.0914 0.0093  167 ARG D NE    
1361 C CZ    A ARG D 34 ? 0.6711 0.5614 0.4977 0.0423  -0.1030 0.0248  167 ARG D CZ    
1362 C CZ    B ARG D 34 ? 0.7227 0.6286 0.5593 0.0307  -0.0925 0.0165  167 ARG D CZ    
1363 N NH1   A ARG D 34 ? 0.6138 0.5091 0.4350 0.0260  -0.0930 0.0261  167 ARG D NH1   
1364 N NH1   B ARG D 34 ? 0.7869 0.6662 0.6135 0.0398  -0.1017 0.0230  167 ARG D NH1   
1365 N NH2   A ARG D 34 ? 0.6641 0.5252 0.4760 0.0489  -0.1125 0.0345  167 ARG D NH2   
1366 N NH2   B ARG D 34 ? 0.7938 0.6961 0.6261 0.0145  -0.0846 0.0180  167 ARG D NH2   
1367 N N     . ALA D 35 ? 0.5474 0.5093 0.4570 0.0993  -0.1017 -0.0245 168 ALA D N     
1368 C CA    . ALA D 35 ? 0.5585 0.5254 0.4825 0.1168  -0.1091 -0.0234 168 ALA D CA    
1369 C C     . ALA D 35 ? 0.5492 0.5519 0.4952 0.1250  -0.1021 -0.0329 168 ALA D C     
1370 O O     . ALA D 35 ? 0.4973 0.5238 0.4602 0.1311  -0.1055 -0.0300 168 ALA D O     
1371 C CB    . ALA D 35 ? 0.6025 0.5346 0.5224 0.1289  -0.1156 -0.0249 168 ALA D CB    
1372 N N     . GLU D 36 ? 0.5312 0.5391 0.4760 0.1232  -0.0921 -0.0440 169 GLU D N     
1373 C CA    . GLU D 36 ? 0.5355 0.5761 0.4971 0.1299  -0.0828 -0.0527 169 GLU D CA    
1374 C C     . GLU D 36 ? 0.4860 0.5580 0.4549 0.1198  -0.0786 -0.0463 169 GLU D C     
1375 O O     . GLU D 36 ? 0.4449 0.5457 0.4337 0.1251  -0.0746 -0.0474 169 GLU D O     
1376 C CB    . GLU D 36 ? 0.5573 0.5914 0.5079 0.1294  -0.0740 -0.0660 169 GLU D CB    
1377 C CG    . GLU D 36 ? 0.7419 0.8088 0.6992 0.1302  -0.0617 -0.0729 169 GLU D CG    
1378 C CD    . GLU D 36 ? 0.7946 0.8807 0.7737 0.1475  -0.0559 -0.0809 169 GLU D CD    
1379 O OE1   . GLU D 36 ? 0.9126 1.0234 0.9135 0.1506  -0.0571 -0.0741 169 GLU D OE1   
1380 O OE2   . GLU D 36 ? 0.9496 1.0276 0.9248 0.1577  -0.0498 -0.0950 169 GLU D OE2   
1381 N N     . LEU D 37 ? 0.4706 0.5372 0.4251 0.1050  -0.0786 -0.0401 170 LEU D N     
1382 C CA    . LEU D 37 ? 0.4537 0.5426 0.4129 0.0958  -0.0752 -0.0341 170 LEU D CA    
1383 C C     . LEU D 37 ? 0.4231 0.5187 0.3932 0.0974  -0.0834 -0.0269 170 LEU D C     
1384 O O     . LEU D 37 ? 0.4063 0.5266 0.3931 0.0972  -0.0814 -0.0260 170 LEU D O     
1385 C CB    . LEU D 37 ? 0.4366 0.5158 0.3792 0.0821  -0.0740 -0.0302 170 LEU D CB    
1386 C CG    . LEU D 37 ? 0.5264 0.6242 0.4726 0.0738  -0.0699 -0.0249 170 LEU D CG    
1387 C CD1   . LEU D 37 ? 0.5602 0.6818 0.5177 0.0765  -0.0623 -0.0271 170 LEU D CD1   
1388 C CD2   . LEU D 37 ? 0.6053 0.6976 0.5397 0.0640  -0.0680 -0.0232 170 LEU D CD2   
1389 N N     . ALA D 38 ? 0.4664 0.5395 0.4258 0.0980  -0.0930 -0.0217 171 ALA D N     
1390 C CA    . ALA D 38 ? 0.3978 0.4746 0.3619 0.0997  -0.1034 -0.0151 171 ALA D CA    
1391 C C     . ALA D 38 ? 0.4254 0.5256 0.4165 0.1123  -0.1069 -0.0186 171 ALA D C     
1392 O O     . ALA D 38 ? 0.4497 0.5743 0.4564 0.1090  -0.1081 -0.0176 171 ALA D O     
1393 C CB    . ALA D 38 ? 0.4860 0.5316 0.4307 0.1009  -0.1132 -0.0083 171 ALA D CB    
1394 N N     . ALA D 39 ? 0.4691 0.5622 0.4674 0.1265  -0.1078 -0.0237 172 ALA D N     
1395 C CA    . ALA D 39 ? 0.4671 0.5852 0.4957 0.1414  -0.1098 -0.0285 172 ALA D CA    
1396 C C     . ALA D 39 ? 0.4846 0.6394 0.5334 0.1367  -0.0970 -0.0337 172 ALA D C     
1397 O O     . ALA D 39 ? 0.4090 0.5919 0.4819 0.1372  -0.1002 -0.0325 172 ALA D O     
1398 C CB    . ALA D 39 ? 0.5193 0.6208 0.5502 0.1577  -0.1088 -0.0359 172 ALA D CB    
1399 N N     . SER D 40 ? 0.4276 0.5819 0.4652 0.1302  -0.0831 -0.0383 173 SER D N     
1400 C CA    . SER D 40 ? 0.4338 0.6195 0.4853 0.1247  -0.0696 -0.0411 173 SER D CA    
1401 C C     . SER D 40 ? 0.4334 0.6348 0.4919 0.1106  -0.0713 -0.0332 173 SER D C     
1402 O O     . SER D 40 ? 0.4424 0.6723 0.5204 0.1066  -0.0629 -0.0336 173 SER D O     
1403 C CB    . SER D 40 ? 0.5125 0.6904 0.5432 0.1194  -0.0571 -0.0455 173 SER D CB    
1404 O OG    . SER D 40 ? 0.4926 0.6600 0.5049 0.1047  -0.0580 -0.0382 173 SER D OG    
1405 N N     . LEU D 41 ? 0.4274 0.6093 0.4695 0.1025  -0.0811 -0.0266 174 LEU D N     
1406 C CA    . LEU D 41 ? 0.4025 0.5930 0.4479 0.0897  -0.0838 -0.0212 174 LEU D CA    
1407 C C     . LEU D 41 ? 0.4132 0.6081 0.4690 0.0910  -0.0992 -0.0189 174 LEU D C     
1408 O O     . LEU D 41 ? 0.4399 0.6395 0.4969 0.0800  -0.1027 -0.0164 174 LEU D O     
1409 C CB    . LEU D 41 ? 0.3839 0.5516 0.4028 0.0792  -0.0827 -0.0171 174 LEU D CB    
1410 C CG    . LEU D 41 ? 0.3799 0.5444 0.3874 0.0763  -0.0706 -0.0183 174 LEU D CG    
1411 C CD1   . LEU D 41 ? 0.4020 0.5481 0.3896 0.0673  -0.0716 -0.0141 174 LEU D CD1   
1412 C CD2   . LEU D 41 ? 0.4127 0.6009 0.4345 0.0723  -0.0599 -0.0179 174 LEU D CD2   
1413 N N     . GLY D 42 ? 0.4676 0.6598 0.5300 0.1047  -0.1092 -0.0199 175 GLY D N     
1414 C CA    . GLY D 42 ? 0.4383 0.6361 0.5093 0.1073  -0.1269 -0.0168 175 GLY D CA    
1415 C C     . GLY D 42 ? 0.4766 0.6463 0.5156 0.0996  -0.1367 -0.0109 175 GLY D C     
1416 O O     . GLY D 42 ? 0.4485 0.6233 0.4872 0.0944  -0.1490 -0.0090 175 GLY D O     
1417 N N     . LEU D 43 ? 0.4000 0.5408 0.4116 0.0982  -0.1311 -0.0087 176 LEU D N     
1418 C CA    . LEU D 43 ? 0.4254 0.5405 0.4057 0.0904  -0.1362 -0.0032 176 LEU D CA    
1419 C C     . LEU D 43 ? 0.4335 0.5212 0.3961 0.0993  -0.1430 0.0018  176 LEU D C     
1420 O O     . LEU D 43 ? 0.4744 0.5591 0.4473 0.1105  -0.1411 -0.0006 176 LEU D O     
1421 C CB    . LEU D 43 ? 0.4158 0.5217 0.3809 0.0786  -0.1221 -0.0041 176 LEU D CB    
1422 C CG    . LEU D 43 ? 0.4473 0.5731 0.4263 0.0696  -0.1142 -0.0074 176 LEU D CG    
1423 C CD1   . LEU D 43 ? 0.4170 0.5344 0.3847 0.0627  -0.1012 -0.0076 176 LEU D CD1   
1424 C CD2   . LEU D 43 ? 0.4339 0.5626 0.4099 0.0619  -0.1232 -0.0073 176 LEU D CD2   
1425 N N     . THR D 44 ? 0.4842 0.5495 0.4178 0.0932  -0.1494 0.0086  177 THR D N     
1426 C CA    . THR D 44 ? 0.5341 0.5668 0.4440 0.0970  -0.1532 0.0160  177 THR D CA    
1427 C C     . THR D 44 ? 0.5751 0.5916 0.4719 0.0882  -0.1384 0.0147  177 THR D C     
1428 O O     . THR D 44 ? 0.4865 0.5147 0.3851 0.0782  -0.1273 0.0104  177 THR D O     
1429 C CB    . THR D 44 ? 0.6190 0.6343 0.4991 0.0927  -0.1649 0.0253  177 THR D CB    
1430 O OG1   . THR D 44 ? 0.5189 0.5302 0.3785 0.0774  -0.1549 0.0246  177 THR D OG1   
1431 C CG2   . THR D 44 ? 0.6156 0.6508 0.5082 0.0993  -0.1825 0.0255  177 THR D CG2   
1432 N N     . GLN D 45 ? 0.5853 0.5742 0.4696 0.0917  -0.1393 0.0190  178 GLN D N     
1433 C CA    . GLN D 45 ? 0.6200 0.5936 0.4928 0.0814  -0.1270 0.0178  178 GLN D CA    
1434 C C     . GLN D 45 ? 0.6160 0.5839 0.4666 0.0664  -0.1216 0.0230  178 GLN D C     
1435 O O     . GLN D 45 ? 0.5529 0.5278 0.4050 0.0566  -0.1098 0.0189  178 GLN D O     
1436 C CB    . GLN D 45 ? 0.7418 0.6831 0.6055 0.0862  -0.1298 0.0210  178 GLN D CB    
1437 C CG    . GLN D 45 ? 0.7282 0.6742 0.6143 0.1012  -0.1309 0.0120  178 GLN D CG    
1438 C CD    . GLN D 45 ? 0.8496 0.7596 0.7262 0.1040  -0.1313 0.0120  178 GLN D CD    
1439 O OE1   . GLN D 45 ? 0.8531 0.7453 0.7150 0.0903  -0.1245 0.0131  178 GLN D OE1   
1440 N NE2   . GLN D 45 ? 0.8665 0.7658 0.7537 0.1220  -0.1394 0.0102  178 GLN D NE2   
1441 N N     . THR D 46 ? 0.5996 0.5573 0.4298 0.0653  -0.1302 0.0314  179 THR D N     
1442 C CA    . THR D 46 ? 0.6042 0.5603 0.4131 0.0521  -0.1231 0.0341  179 THR D CA    
1443 C C     . THR D 46 ? 0.5193 0.5033 0.3429 0.0477  -0.1158 0.0247  179 THR D C     
1444 O O     . THR D 46 ? 0.5118 0.4984 0.3300 0.0381  -0.1038 0.0226  179 THR D O     
1445 C CB    . THR D 46 ? 0.7269 0.6677 0.5061 0.0515  -0.1338 0.0439  179 THR D CB    
1446 O OG1   . THR D 46 ? 0.7429 0.6538 0.5072 0.0565  -0.1418 0.0550  179 THR D OG1   
1447 C CG2   . THR D 46 ? 0.8235 0.7607 0.5775 0.0373  -0.1224 0.0454  179 THR D CG2   
1448 N N     . GLN D 47 ? 0.4735 0.4777 0.3162 0.0545  -0.1230 0.0196  180 GLN D N     
1449 C CA    . GLN D 47 ? 0.4731 0.4983 0.3289 0.0495  -0.1163 0.0119  180 GLN D CA    
1450 C C     . GLN D 47 ? 0.4931 0.5254 0.3627 0.0466  -0.1028 0.0077  180 GLN D C     
1451 O O     . GLN D 47 ? 0.4853 0.5219 0.3529 0.0397  -0.0934 0.0052  180 GLN D O     
1452 C CB    . GLN D 47 ? 0.4649 0.5113 0.3441 0.0555  -0.1248 0.0076  180 GLN D CB    
1453 C CG    . GLN D 47 ? 0.5362 0.5839 0.4052 0.0549  -0.1388 0.0086  180 GLN D CG    
1454 C CD    . GLN D 47 ? 0.5535 0.6252 0.4521 0.0609  -0.1485 0.0048  180 GLN D CD    
1455 O OE1   . GLN D 47 ? 0.4628 0.5425 0.3815 0.0709  -0.1505 0.0055  180 GLN D OE1   
1456 N NE2   . GLN D 47 ? 0.7062 0.7905 0.6097 0.0544  -0.1533 -0.0002 180 GLN D NE2   
1457 N N     . VAL D 48 ? 0.4764 0.5099 0.3595 0.0530  -0.1027 0.0065  181 VAL D N     
1458 C CA    . VAL D 48 ? 0.4421 0.4815 0.3344 0.0503  -0.0924 0.0025  181 VAL D CA    
1459 C C     . VAL D 48 ? 0.4821 0.5089 0.3603 0.0411  -0.0852 0.0048  181 VAL D C     
1460 O O     . VAL D 48 ? 0.3805 0.4181 0.2643 0.0358  -0.0772 0.0021  181 VAL D O     
1461 C CB    . VAL D 48 ? 0.4137 0.4546 0.3186 0.0589  -0.0935 -0.0011 181 VAL D CB    
1462 C CG1   . VAL D 48 ? 0.4122 0.4571 0.3205 0.0548  -0.0848 -0.0056 181 VAL D CG1   
1463 C CG2   . VAL D 48 ? 0.4267 0.4883 0.3511 0.0666  -0.0966 -0.0042 181 VAL D CG2   
1464 N N     . LYS D 49 ? 0.5359 0.5408 0.3970 0.0388  -0.0882 0.0106  182 LYS D N     
1465 C CA    . LYS D 49 ? 0.5575 0.5514 0.4066 0.0276  -0.0801 0.0136  182 LYS D CA    
1466 C C     . LYS D 49 ? 0.5158 0.5212 0.3604 0.0203  -0.0716 0.0130  182 LYS D C     
1467 O O     . LYS D 49 ? 0.4847 0.4992 0.3364 0.0136  -0.0623 0.0106  182 LYS D O     
1468 C CB    . LYS D 49 ? 0.6359 0.6008 0.4625 0.0255  -0.0851 0.0229  182 LYS D CB    
1469 C CG    . LYS D 49 ? 0.6655 0.6181 0.4791 0.0114  -0.0755 0.0278  182 LYS D CG    
1470 C CD    . LYS D 49 ? 0.6746 0.5961 0.4608 0.0079  -0.0797 0.0399  182 LYS D CD    
1471 C CE    . LYS D 49 ? 0.8095 0.7320 0.5722 0.0038  -0.0773 0.0454  182 LYS D CE    
1472 N NZ    . LYS D 49 ? 0.9249 0.8163 0.6556 0.0020  -0.0837 0.0593  182 LYS D NZ    
1473 N N     . ILE D 50 ? 0.4936 0.4984 0.3264 0.0221  -0.0755 0.0143  183 ILE D N     
1474 C CA    . ILE D 50 ? 0.4900 0.5026 0.3155 0.0170  -0.0677 0.0114  183 ILE D CA    
1475 C C     . ILE D 50 ? 0.4200 0.4531 0.2680 0.0192  -0.0622 0.0038  183 ILE D C     
1476 O O     . ILE D 50 ? 0.3986 0.4397 0.2500 0.0151  -0.0515 0.0009  183 ILE D O     
1477 C CB    . ILE D 50 ? 0.4875 0.4916 0.2913 0.0186  -0.0763 0.0132  183 ILE D CB    
1478 C CG1   . ILE D 50 ? 0.6156 0.5968 0.3914 0.0153  -0.0802 0.0234  183 ILE D CG1   
1479 C CG2   . ILE D 50 ? 0.4769 0.4878 0.2730 0.0147  -0.0688 0.0067  183 ILE D CG2   
1480 C CD1   . ILE D 50 ? 0.6435 0.6172 0.4072 0.0045  -0.0661 0.0274  183 ILE D CD1   
1481 N N     . TRP D 51 ? 0.4135 0.4555 0.2781 0.0258  -0.0687 0.0014  184 TRP D N     
1482 C CA    . TRP D 51 ? 0.4151 0.4729 0.2988 0.0278  -0.0645 -0.0029 184 TRP D CA    
1483 C C     . TRP D 51 ? 0.3440 0.4092 0.2375 0.0255  -0.0570 -0.0032 184 TRP D C     
1484 O O     . TRP D 51 ? 0.3437 0.4180 0.2450 0.0248  -0.0504 -0.0055 184 TRP D O     
1485 C CB    . TRP D 51 ? 0.3784 0.4447 0.2768 0.0337  -0.0710 -0.0037 184 TRP D CB    
1486 C CG    . TRP D 51 ? 0.3546 0.4334 0.2683 0.0345  -0.0670 -0.0058 184 TRP D CG    
1487 C CD1   . TRP D 51 ? 0.3860 0.4670 0.3039 0.0335  -0.0681 -0.0079 184 TRP D CD1   
1488 C CD2   . TRP D 51 ? 0.3558 0.4440 0.2805 0.0357  -0.0621 -0.0053 184 TRP D CD2   
1489 N NE1   . TRP D 51 ? 0.3765 0.4650 0.3072 0.0343  -0.0635 -0.0073 184 TRP D NE1   
1490 C CE2   . TRP D 51 ? 0.3429 0.4369 0.2769 0.0362  -0.0601 -0.0052 184 TRP D CE2   
1491 C CE3   . TRP D 51 ? 0.3270 0.4180 0.2530 0.0358  -0.0604 -0.0050 184 TRP D CE3   
1492 C CZ2   . TRP D 51 ? 0.3351 0.4373 0.2781 0.0380  -0.0567 -0.0027 184 TRP D CZ2   
1493 C CZ3   . TRP D 51 ? 0.3516 0.4538 0.2869 0.0373  -0.0580 -0.0043 184 TRP D CZ3   
1494 C CH2   . TRP D 51 ? 0.3042 0.4116 0.2468 0.0390  -0.0563 -0.0022 184 TRP D CH2   
1495 N N     . PHE D 52 ? 0.4139 0.4744 0.3073 0.0245  -0.0590 -0.0016 185 PHE D N     
1496 C CA    . PHE D 52 ? 0.4184 0.4865 0.3207 0.0203  -0.0542 -0.0027 185 PHE D CA    
1497 C C     . PHE D 52 ? 0.4483 0.5171 0.3466 0.0123  -0.0456 -0.0017 185 PHE D C     
1498 O O     . PHE D 52 ? 0.4147 0.4993 0.3271 0.0105  -0.0402 -0.0039 185 PHE D O     
1499 C CB    . PHE D 52 ? 0.4225 0.4824 0.3243 0.0197  -0.0587 -0.0033 185 PHE D CB    
1500 C CG    . PHE D 52 ? 0.4543 0.5231 0.3654 0.0267  -0.0625 -0.0069 185 PHE D CG    
1501 C CD1   . PHE D 52 ? 0.4250 0.4932 0.3368 0.0343  -0.0665 -0.0070 185 PHE D CD1   
1502 C CD2   . PHE D 52 ? 0.4145 0.4940 0.3334 0.0251  -0.0621 -0.0103 185 PHE D CD2   
1503 C CE1   . PHE D 52 ? 0.4281 0.5067 0.3478 0.0399  -0.0671 -0.0102 185 PHE D CE1   
1504 C CE2   . PHE D 52 ? 0.4015 0.4887 0.3237 0.0310  -0.0643 -0.0133 185 PHE D CE2   
1505 C CZ    . PHE D 52 ? 0.4446 0.5312 0.3668 0.0383  -0.0655 -0.0132 185 PHE D CZ    
1506 N N     . GLN D 53 ? 0.4575 0.5114 0.3369 0.0078  -0.0440 0.0018  186 GLN D N     
1507 C CA    . GLN D 53 ? 0.4710 0.5284 0.3450 0.0000  -0.0324 0.0024  186 GLN D CA    
1508 C C     . GLN D 53 ? 0.4070 0.4807 0.2917 0.0043  -0.0257 -0.0031 186 GLN D C     
1509 O O     . GLN D 53 ? 0.4363 0.5254 0.3348 0.0017  -0.0167 -0.0055 186 GLN D O     
1510 C CB    . GLN D 53 ? 0.5646 0.6025 0.4098 -0.0047 -0.0311 0.0078  186 GLN D CB    
1511 C CG    . GLN D 53 ? 0.6025 0.6195 0.4356 -0.0094 -0.0367 0.0152  186 GLN D CG    
1512 C CD    . GLN D 53 ? 0.6827 0.6783 0.4845 -0.0152 -0.0354 0.0236  186 GLN D CD    
1513 O OE1   . GLN D 53 ? 0.6455 0.6414 0.4295 -0.0154 -0.0313 0.0232  186 GLN D OE1   
1514 N NE2   . GLN D 53 ? 0.6500 0.6241 0.4422 -0.0201 -0.0392 0.0314  186 GLN D NE2   
1515 N N     . ASN D 54 ? 0.4154 0.4847 0.2944 0.0109  -0.0304 -0.0055 187 ASN D N     
1516 C CA    . ASN D 54 ? 0.3961 0.4726 0.2805 0.0152  -0.0246 -0.0115 187 ASN D CA    
1517 C C     . ASN D 54 ? 0.3644 0.4570 0.2753 0.0211  -0.0245 -0.0131 187 ASN D C     
1518 O O     . ASN D 54 ? 0.3542 0.4579 0.2774 0.0239  -0.0164 -0.0169 187 ASN D O     
1519 C CB    . ASN D 54 ? 0.3686 0.4333 0.2391 0.0183  -0.0313 -0.0142 187 ASN D CB    
1520 C CG    . ASN D 54 ? 0.4056 0.4558 0.2456 0.0131  -0.0307 -0.0134 187 ASN D CG    
1521 O OD1   . ASN D 54 ? 0.4543 0.5045 0.2830 0.0081  -0.0196 -0.0138 187 ASN D OD1   
1522 N ND2   . ASN D 54 ? 0.4168 0.4566 0.2439 0.0142  -0.0427 -0.0121 187 ASN D ND2   
1523 N N     . LYS D 55 ? 0.3915 0.4858 0.3105 0.0237  -0.0333 -0.0102 188 LYS D N     
1524 C CA    . LYS D 55 ? 0.3987 0.5070 0.3377 0.0289  -0.0349 -0.0097 188 LYS D CA    
1525 C C     . LYS D 55 ? 0.3806 0.5048 0.3334 0.0262  -0.0305 -0.0100 188 LYS D C     
1526 O O     . LYS D 55 ? 0.3871 0.5250 0.3568 0.0315  -0.0279 -0.0111 188 LYS D O     
1527 C CB    . LYS D 55 ? 0.4080 0.5156 0.3479 0.0306  -0.0434 -0.0068 188 LYS D CB    
1528 C CG    . LYS D 55 ? 0.3791 0.4979 0.3322 0.0360  -0.0459 -0.0047 188 LYS D CG    
1529 C CD    . LYS D 55 ? 0.3830 0.4973 0.3391 0.0408  -0.0449 -0.0039 188 LYS D CD    
1530 C CE    . LYS D 55 ? 0.4474 0.5685 0.4121 0.0456  -0.0480 0.0012  188 LYS D CE    
1531 N NZ    . LYS D 55 ? 0.4328 0.5448 0.4011 0.0491  -0.0462 0.0025  188 LYS D NZ    
1532 N N     . ARG D 56 ? 0.3688 0.4914 0.3168 0.0180  -0.0304 -0.0090 189 ARG D N     
1533 C CA    . ARG D 56 ? 0.4045 0.5444 0.3682 0.0124  -0.0258 -0.0099 189 ARG D CA    
1534 C C     . ARG D 56 ? 0.4218 0.5738 0.3946 0.0130  -0.0136 -0.0129 189 ARG D C     
1535 O O     . ARG D 56 ? 0.3101 0.4849 0.3070 0.0159  -0.0110 -0.0148 189 ARG D O     
1536 C CB    . ARG D 56 ? 0.4546 0.5860 0.4102 0.0007  -0.0266 -0.0083 189 ARG D CB    
1537 C CG    . ARG D 56 ? 0.4678 0.5912 0.4200 0.0007  -0.0375 -0.0084 189 ARG D CG    
1538 C CD    . ARG D 56 ? 0.4501 0.5642 0.3985 -0.0114 -0.0382 -0.0082 189 ARG D CD    
1539 N NE    . ARG D 56 ? 0.4098 0.5006 0.3379 -0.0170 -0.0340 -0.0037 189 ARG D NE    
1540 C CZ    . ARG D 56 ? 0.4318 0.4982 0.3421 -0.0142 -0.0403 -0.0013 189 ARG D CZ    
1541 N NH1   . ARG D 56 ? 0.4761 0.5394 0.3873 -0.0058 -0.0490 -0.0044 189 ARG D NH1   
1542 N NH2   . ARG D 56 ? 0.5132 0.5586 0.4039 -0.0190 -0.0376 0.0047  189 ARG D NH2   
1543 N N     . SER D 57 ? 0.4035 0.5420 0.3574 0.0114  -0.0061 -0.0140 190 SER D N     
1544 C CA    . SER D 57 ? 0.3925 0.5414 0.3519 0.0132  0.0072  -0.0189 190 SER D CA    
1545 C C     . SER D 57 ? 0.3877 0.5456 0.3653 0.0267  0.0071  -0.0233 190 SER D C     
1546 O O     . SER D 57 ? 0.3425 0.5209 0.3424 0.0314  0.0156  -0.0273 190 SER D O     
1547 C CB    . SER D 57 ? 0.4828 0.6125 0.4114 0.0089  0.0141  -0.0200 190 SER D CB    
1548 O OG    . SER D 57 ? 0.5791 0.7186 0.5118 0.0125  0.0282  -0.0271 190 SER D OG    
1549 N N     . LYS D 58 ? 0.3435 0.4864 0.3137 0.0333  -0.0019 -0.0224 191 LYS D N     
1550 C CA    . LYS D 58 ? 0.3585 0.5032 0.3435 0.0453  -0.0036 -0.0244 191 LYS D CA    
1551 C C     . LYS D 58 ? 0.3633 0.5303 0.3761 0.0510  -0.0080 -0.0209 191 LYS D C     
1552 O O     . LYS D 58 ? 0.3324 0.5105 0.3648 0.0609  -0.0039 -0.0235 191 LYS D O     
1553 C CB    . LYS D 58 ? 0.4236 0.5492 0.3971 0.0476  -0.0135 -0.0216 191 LYS D CB    
1554 C CG    . LYS D 58 ? 0.4954 0.6160 0.4809 0.0582  -0.0150 -0.0219 191 LYS D CG    
1555 C CD    . LYS D 58 ? 0.5830 0.6862 0.5587 0.0572  -0.0232 -0.0184 191 LYS D CD    
1556 C CE    . LYS D 58 ? 0.6633 0.7582 0.6507 0.0662  -0.0248 -0.0162 191 LYS D CE    
1557 N NZ    . LYS D 58 ? 0.6539 0.7385 0.6364 0.0630  -0.0326 -0.0090 191 LYS D NZ    
1558 N N     . ILE D 59 ? 0.3705 0.5430 0.3841 0.0458  -0.0174 -0.0155 192 ILE D N     
1559 C CA    . ILE D 59 ? 0.4184 0.6117 0.4539 0.0503  -0.0249 -0.0121 192 ILE D CA    
1560 C C     . ILE D 59 ? 0.3785 0.5979 0.4379 0.0493  -0.0172 -0.0161 192 ILE D C     
1561 O O     . ILE D 59 ? 0.4903 0.7278 0.5740 0.0598  -0.0187 -0.0160 192 ILE D O     
1562 C CB    . ILE D 59 ? 0.4180 0.6116 0.4455 0.0428  -0.0353 -0.0086 192 ILE D CB    
1563 C CG1   . ILE D 59 ? 0.4795 0.6527 0.4878 0.0450  -0.0414 -0.0049 192 ILE D CG1   
1564 C CG2   . ILE D 59 ? 0.4331 0.6509 0.4811 0.0453  -0.0440 -0.0066 192 ILE D CG2   
1565 C CD1   . ILE D 59 ? 0.5449 0.7128 0.5567 0.0558  -0.0440 -0.0007 192 ILE D CD1   
1566 N N     . LYS D 60 ? 0.4298 0.6517 0.4836 0.0369  -0.0085 -0.0189 193 LYS D N     
1567 C CA    . LYS D 60 ? 0.4931 0.7428 0.5714 0.0332  0.0019  -0.0227 193 LYS D CA    
1568 C C     . LYS D 60 ? 0.4728 0.7315 0.5660 0.0462  0.0132  -0.0283 193 LYS D C     
1569 O O     . LYS D 60 ? 0.4194 0.7085 0.5452 0.0514  0.0171  -0.0310 193 LYS D O     
1570 C CB    . LYS D 60 ? 0.4767 0.7217 0.5408 0.0161  0.0119  -0.0231 193 LYS D CB    
1571 C CG    . LYS D 60 ? 0.5174 0.7950 0.6103 0.0070  0.0204  -0.0253 193 LYS D CG    
1572 N N     . LYS D 61 ? 0.3750 0.6081 0.4463 0.0520  0.0179  -0.0312 194 LYS D N     
1573 C CA    . LYS D 61 ? 0.4075 0.6432 0.4896 0.0653  0.0288  -0.0388 194 LYS D CA    
1574 C C     . LYS D 61 ? 0.4048 0.6478 0.5122 0.0823  0.0192  -0.0365 194 LYS D C     
1575 O O     . LYS D 61 ? 0.3921 0.6547 0.5277 0.0946  0.0260  -0.0414 194 LYS D O     
1576 C CB    . LYS D 61 ? 0.4421 0.6457 0.4923 0.0660  0.0341  -0.0440 194 LYS D CB    
1577 C CG    . LYS D 61 ? 0.5889 0.7873 0.6144 0.0534  0.0473  -0.0479 194 LYS D CG    
1578 C CD    . LYS D 61 ? 0.6693 0.8379 0.6632 0.0554  0.0504  -0.0547 194 LYS D CD    
1579 C CE    . LYS D 61 ? 0.8044 0.9587 0.7626 0.0407  0.0531  -0.0525 194 LYS D CE    
1580 N NZ    . LYS D 61 ? 0.8055 0.9766 0.7620 0.0330  0.0715  -0.0552 194 LYS D NZ    
1581 N N     . ILE D 62 ? 0.3706 0.5984 0.4682 0.0836  0.0036  -0.0283 195 ILE D N     
1582 C CA    . ILE D 62 ? 0.3897 0.6213 0.5061 0.0986  -0.0073 -0.0226 195 ILE D CA    
1583 C C     . ILE D 62 ? 0.3985 0.6687 0.5488 0.1016  -0.0122 -0.0206 195 ILE D C     
1584 O O     . ILE D 62 ? 0.4090 0.6925 0.5856 0.1174  -0.0145 -0.0201 195 ILE D O     
1585 C CB    . ILE D 62 ? 0.4304 0.6414 0.5270 0.0963  -0.0219 -0.0127 195 ILE D CB    
1586 C CG1   . ILE D 62 ? 0.4609 0.6378 0.5303 0.0934  -0.0184 -0.0147 195 ILE D CG1   
1587 C CG2   . ILE D 62 ? 0.5011 0.7158 0.6140 0.1110  -0.0336 -0.0040 195 ILE D CG2   
1588 C CD1   . ILE D 62 ? 0.5164 0.6772 0.5666 0.0875  -0.0290 -0.0063 195 ILE D CD1   
1589 N N     . MET D 63 ? 0.4777 0.7647 0.6281 0.0862  -0.0140 -0.0201 196 MET D N     
1590 C CA    A MET D 63 ? 0.4675 0.7918 0.6486 0.0846  -0.0220 -0.0186 196 MET D CA    
1591 C CA    B MET D 63 ? 0.5031 0.8273 0.6844 0.0849  -0.0220 -0.0185 196 MET D CA    
1592 C C     . MET D 63 ? 0.5330 0.8908 0.7489 0.0871  -0.0077 -0.0264 196 MET D C     
1593 O O     . MET D 63 ? 0.7556 1.1503 1.0067 0.0897  -0.0141 -0.0261 196 MET D O     
1594 C CB    A MET D 63 ? 0.4368 0.7619 0.6035 0.0654  -0.0294 -0.0166 196 MET D CB    
1595 C CB    B MET D 63 ? 0.5230 0.8481 0.6901 0.0661  -0.0296 -0.0165 196 MET D CB    
1596 C CG    A MET D 63 ? 0.4224 0.7308 0.5679 0.0659  -0.0468 -0.0093 196 MET D CG    
1597 C CG    B MET D 63 ? 0.5876 0.9387 0.7737 0.0658  -0.0473 -0.0128 196 MET D CG    
1598 S SD    A MET D 63 ? 0.4496 0.7405 0.5649 0.0462  -0.0510 -0.0099 196 MET D SD    
1599 S SD    B MET D 63 ? 0.6195 0.9616 0.8007 0.0844  -0.0656 -0.0028 196 MET D SD    
1600 C CE    A MET D 63 ? 0.5463 0.8509 0.6637 0.0478  -0.0725 -0.0057 196 MET D CE    
1601 C CE    B MET D 63 ? 0.5245 0.9157 0.7511 0.0919  -0.0788 -0.0021 196 MET D CE    
1602 N N     . LYS D 64 ? 0.6002 0.9473 0.8062 0.0860  0.0116  -0.0338 197 LYS D N     
1603 C CA    . LYS D 64 ? 0.6216 0.9988 0.8583 0.0910  0.0293  -0.0426 197 LYS D CA    
1604 C C     . LYS D 64 ? 0.6922 1.0696 0.9496 0.1166  0.0291  -0.0455 197 LYS D C     
1605 O O     . LYS D 64 ? 0.5936 1.0043 0.8897 0.1277  0.0379  -0.0517 197 LYS D O     
1606 C CB    . LYS D 64 ? 0.6588 1.0219 0.8699 0.0795  0.0509  -0.0496 197 LYS D CB    
1607 N N     . ASN D 65 ? 0.7349 1.0747 0.9680 0.1257  0.0193  -0.0410 198 ASN D N     
1608 C CA    . ASN D 65 ? 0.7597 1.0892 1.0078 0.1497  0.0155  -0.0410 198 ASN D CA    
1609 C C     . ASN D 65 ? 0.8479 1.1701 1.1004 0.1613  0.0362  -0.0550 198 ASN D C     
1610 O O     . ASN D 65 ? 1.0077 1.3057 1.2282 0.1517  0.0488  -0.0624 198 ASN D O     
1611 C CB    . ASN D 65 ? 0.7341 1.0985 1.0239 0.1635  0.0008  -0.0344 198 ASN D CB    
1612 O OXT   . ASN D 65 ? 0.8415 1.1807 1.1283 0.1813  0.0404  -0.0601 198 ASN D OXT   
1613 O "O5'" . DC  E 1  ? 2.1377 1.1373 2.0794 -0.1016 -0.1751 0.1880  1   DC  E "O5'" 
1614 C "C5'" . DC  E 1  ? 2.1865 1.2426 2.0626 -0.1323 -0.1409 0.1687  1   DC  E "C5'" 
1615 C "C4'" . DC  E 1  ? 2.2490 1.3510 2.1647 -0.1271 -0.1056 0.1064  1   DC  E "C4'" 
1616 O "O4'" . DC  E 1  ? 2.3452 1.4222 2.2433 -0.1655 -0.0849 0.0975  1   DC  E "O4'" 
1617 C "C3'" . DC  E 1  ? 2.1023 1.2983 1.9955 -0.1219 -0.0845 0.0759  1   DC  E "C3'" 
1618 O "O3'" . DC  E 1  ? 1.9925 1.2290 1.9222 -0.0829 -0.0912 0.0601  1   DC  E "O3'" 
1619 C "C2'" . DC  E 1  ? 2.0454 1.2633 1.9463 -0.1426 -0.0551 0.0322  1   DC  E "C2'" 
1620 C "C1'" . DC  E 1  ? 2.1433 1.2948 2.0275 -0.1788 -0.0555 0.0576  1   DC  E "C1'" 
1621 N N1    . DC  E 1  ? 2.0017 1.1732 1.8249 -0.2150 -0.0435 0.0829  1   DC  E N1    
1622 C C2    . DC  E 1  ? 1.7419 0.9794 1.5605 -0.2348 -0.0171 0.0525  1   DC  E C2    
1623 O O2    . DC  E 1  ? 1.4816 0.7556 1.3358 -0.2239 -0.0102 0.0088  1   DC  E O2    
1624 N N3    . DC  E 1  ? 1.8011 1.0598 1.5778 -0.2668 0.0003  0.0715  1   DC  E N3    
1625 C C4    . DC  E 1  ? 1.8692 1.0814 1.5924 -0.2829 -0.0054 0.1177  1   DC  E C4    
1626 N N4    . DC  E 1  ? 1.8218 1.0552 1.5017 -0.3170 0.0206  0.1302  1   DC  E N4    
1627 C C5    . DC  E 1  ? 1.9858 1.1267 1.6990 -0.2661 -0.0387 0.1534  1   DC  E C5    
1628 C C6    . DC  E 1  ? 2.0666 1.1918 1.8392 -0.2305 -0.0579 0.1350  1   DC  E C6    
1629 P P     . DG  E 2  ? 2.0634 1.2821 2.0779 -0.0483 -0.0885 0.0259  2   DG  E P     
1630 O OP1   . DG  E 2  ? 1.9449 1.1029 1.9845 -0.0632 -0.0786 0.0088  2   DG  E OP1   
1631 O OP2   . DG  E 2  ? 2.1458 1.3519 2.2029 -0.0162 -0.1189 0.0547  2   DG  E OP2   
1632 O "O5'" . DG  E 2  ? 1.9590 1.2559 1.9720 -0.0385 -0.0599 -0.0233 2   DG  E "O5'" 
1633 C "C5'" . DG  E 2  ? 1.8227 1.1243 1.8458 -0.0473 -0.0327 -0.0742 2   DG  E "C5'" 
1634 C "C4'" . DG  E 2  ? 1.6274 1.0002 1.6019 -0.0637 -0.0174 -0.0945 2   DG  E "C4'" 
1635 O "O4'" . DG  E 2  ? 1.6090 0.9855 1.5413 -0.0973 -0.0201 -0.0723 2   DG  E "O4'" 
1636 C "C3'" . DG  E 2  ? 1.4711 0.9067 1.4326 -0.0440 -0.0198 -0.0861 2   DG  E "C3'" 
1637 O "O3'" . DG  E 2  ? 1.6051 1.0906 1.5516 -0.0463 -0.0008 -0.1247 2   DG  E "O3'" 
1638 C "C2'" . DG  E 2  ? 1.3694 0.8219 1.2836 -0.0638 -0.0305 -0.0486 2   DG  E "C2'" 
1639 C "C1'" . DG  E 2  ? 1.4001 0.8406 1.2981 -0.0978 -0.0195 -0.0605 2   DG  E "C1'" 
1640 N N9    . DG  E 2  ? 1.4043 0.8377 1.2671 -0.1259 -0.0212 -0.0282 2   DG  E N9    
1641 C C8    . DG  E 2  ? 1.4568 0.8542 1.2944 -0.1300 -0.0351 0.0153  2   DG  E C8    
1642 N N7    . DG  E 2  ? 1.4112 0.8099 1.2115 -0.1621 -0.0247 0.0327  2   DG  E N7    
1643 C C5    . DG  E 2  ? 1.2975 0.7414 1.1130 -0.1772 -0.0056 -0.0003 2   DG  E C5    
1644 C C6    . DG  E 2  ? 1.2282 0.6995 1.0345 -0.2108 0.0135  -0.0018 2   DG  E C6    
1645 O O6    . DG  E 2  ? 1.1535 0.6126 0.9295 -0.2360 0.0252  0.0239  2   DG  E O6    
1646 N N1    . DG  E 2  ? 1.1929 0.7106 1.0307 -0.2158 0.0195  -0.0383 2   DG  E N1    
1647 C C2    . DG  E 2  ? 1.1762 0.7059 1.0334 -0.1951 0.0109  -0.0699 2   DG  E C2    
1648 N N2    . DG  E 2  ? 1.1388 0.7100 1.0128 -0.2087 0.0126  -0.0998 2   DG  E N2    
1649 N N3    . DG  E 2  ? 1.1713 0.6740 1.0323 -0.1653 0.0016  -0.0722 2   DG  E N3    
1650 C C4    . DG  E 2  ? 1.3056 0.7691 1.1531 -0.1562 -0.0070 -0.0364 2   DG  E C4    
1651 P P     . DA  E 3  ? 1.9007 1.4411 1.8493 -0.0222 0.0057  -0.1335 3   DA  E P     
1652 O OP1   . DA  E 3  ? 1.9995 1.5181 1.9965 0.0009  0.0205  -0.1616 3   DA  E OP1   
1653 O OP2   . DA  E 3  ? 1.6071 1.1710 1.5428 -0.0152 -0.0118 -0.0934 3   DA  E OP2   
1654 O "O5'" . DA  E 3  ? 1.7928 1.3817 1.6984 -0.0418 0.0172  -0.1597 3   DA  E "O5'" 
1655 C "C5'" . DA  E 3  ? 1.5608 1.1322 1.4523 -0.0662 0.0246  -0.1911 3   DA  E "C5'" 
1656 C "C4'" . DA  E 3  ? 1.4001 1.0157 1.2584 -0.0918 0.0162  -0.1868 3   DA  E "C4'" 
1657 O "O4'" . DA  E 3  ? 1.2632 0.8717 1.1258 -0.1053 0.0071  -0.1543 3   DA  E "O4'" 
1658 C "C3'" . DA  E 3  ? 1.2700 0.9477 1.1074 -0.0826 0.0138  -0.1796 3   DA  E "C3'" 
1659 O "O3'" . DA  E 3  ? 1.3020 1.0121 1.1140 -0.1048 0.0078  -0.1971 3   DA  E "O3'" 
1660 C "C2'" . DA  E 3  ? 1.1759 0.8702 1.0181 -0.0798 0.0052  -0.1409 3   DA  E "C2'" 
1661 C "C1'" . DA  E 3  ? 1.1805 0.8431 1.0292 -0.1048 0.0029  -0.1337 3   DA  E "C1'" 
1662 N N9    . DA  E 3  ? 1.1566 0.8009 1.0039 -0.1063 0.0001  -0.0980 3   DA  E N9    
1663 C C8    . DA  E 3  ? 1.1384 0.7511 0.9879 -0.0877 -0.0066 -0.0746 3   DA  E C8    
1664 N N7    . DA  E 3  ? 1.1052 0.7015 0.9355 -0.1001 -0.0101 -0.0433 3   DA  E N7    
1665 C C5    . DA  E 3  ? 1.0451 0.6673 0.8687 -0.1273 0.0012  -0.0489 3   DA  E C5    
1666 C C6    . DA  E 3  ? 1.0299 0.6520 0.8358 -0.1531 0.0115  -0.0291 3   DA  E C6    
1667 N N6    . DA  E 3  ? 1.0541 0.6415 0.8266 -0.1588 0.0101  0.0027  3   DA  E N6    
1668 N N1    . DA  E 3  ? 0.9694 0.6284 0.7929 -0.1754 0.0238  -0.0435 3   DA  E N1    
1669 C C2    . DA  E 3  ? 0.9486 0.6391 0.7970 -0.1731 0.0180  -0.0726 3   DA  E C2    
1670 N N3    . DA  E 3  ? 0.9455 0.6340 0.7954 -0.1533 0.0079  -0.0929 3   DA  E N3    
1671 C C4    . DA  E 3  ? 1.0144 0.6685 0.8544 -0.1301 0.0037  -0.0810 3   DA  E C4    
1672 P P     . DC  E 4  ? 1.3275 1.0781 1.1073 -0.0994 0.0082  -0.2096 4   DC  E P     
1673 O OP1   . DC  E 4  ? 1.3821 1.1169 1.1286 -0.1213 0.0091  -0.2467 4   DC  E OP1   
1674 O OP2   . DC  E 4  ? 1.2691 1.0236 1.0589 -0.0698 0.0206  -0.1999 4   DC  E OP2   
1675 O "O5'" . DC  E 4  ? 1.1536 0.9590 0.9341 -0.1075 -0.0100 -0.1855 4   DC  E "O5'" 
1676 C "C5'" . DC  E 4  ? 0.9872 0.8143 0.7875 -0.0917 -0.0096 -0.1544 4   DC  E "C5'" 
1677 C "C4'" . DC  E 4  ? 0.9388 0.7840 0.7620 -0.1096 -0.0165 -0.1401 4   DC  E "C4'" 
1678 O "O4'" . DC  E 4  ? 0.9361 0.7430 0.7714 -0.1130 -0.0074 -0.1275 4   DC  E "O4'" 
1679 C "C3'" . DC  E 4  ? 0.8421 0.7337 0.6787 -0.1014 -0.0190 -0.1190 4   DC  E "C3'" 
1680 O "O3'" . DC  E 4  ? 0.7811 0.7124 0.6177 -0.1076 -0.0356 -0.1252 4   DC  E "O3'" 
1681 C "C2'" . DC  E 4  ? 0.8672 0.7569 0.7291 -0.1169 -0.0109 -0.1063 4   DC  E "C2'" 
1682 C "C1'" . DC  E 4  ? 0.8578 0.6888 0.7086 -0.1219 -0.0035 -0.1072 4   DC  E "C1'" 
1683 N N1    . DC  E 4  ? 0.8071 0.6098 0.6455 -0.1107 0.0047  -0.0844 4   DC  E N1    
1684 C C2    . DC  E 4  ? 0.8137 0.6141 0.6524 -0.1268 0.0160  -0.0666 4   DC  E C2    
1685 O O2    . DC  E 4  ? 0.7968 0.6256 0.6601 -0.1468 0.0225  -0.0719 4   DC  E O2    
1686 N N3    . DC  E 4  ? 0.7830 0.5499 0.5951 -0.1225 0.0195  -0.0444 4   DC  E N3    
1687 C C4    . DC  E 4  ? 0.8719 0.6137 0.6723 -0.1004 0.0076  -0.0382 4   DC  E C4    
1688 N N4    . DC  E 4  ? 0.9677 0.6769 0.7411 -0.0990 0.0033  -0.0133 4   DC  E N4    
1689 C C5    . DC  E 4  ? 0.8840 0.6331 0.6996 -0.0810 0.0001  -0.0578 4   DC  E C5    
1690 C C6    . DC  E 4  ? 0.8248 0.6014 0.6518 -0.0884 0.0013  -0.0812 4   DC  E C6    
1691 P P     . DT  E 5  ? 0.7573 0.7317 0.6031 -0.0916 -0.0413 -0.1079 5   DT  E P     
1692 O OP1   . DT  E 5  ? 0.7324 0.7343 0.5704 -0.1016 -0.0659 -0.1131 5   DT  E OP1   
1693 O OP2   . DT  E 5  ? 0.6962 0.6553 0.5227 -0.0685 -0.0281 -0.1003 5   DT  E OP2   
1694 O "O5'" . DT  E 5  ? 0.7023 0.6999 0.5950 -0.0974 -0.0336 -0.0943 5   DT  E "O5'" 
1695 C "C5'" . DT  E 5  ? 0.6904 0.7046 0.6219 -0.1210 -0.0392 -0.0997 5   DT  E "C5'" 
1696 C "C4'" . DT  E 5  ? 0.7060 0.7385 0.6792 -0.1234 -0.0182 -0.0884 5   DT  E "C4'" 
1697 O "O4'" . DT  E 5  ? 0.6650 0.6531 0.6067 -0.1236 0.0047  -0.0823 5   DT  E "O4'" 
1698 C "C3'" . DT  E 5  ? 0.6835 0.7493 0.6771 -0.1037 -0.0158 -0.0775 5   DT  E "C3'" 
1699 O "O3'" . DT  E 5  ? 0.8077 0.9196 0.8728 -0.1107 -0.0150 -0.0763 5   DT  E "O3'" 
1700 C "C2'" . DT  E 5  ? 0.6571 0.6926 0.6176 -0.0934 0.0094  -0.0694 5   DT  E "C2'" 
1701 C "C1'" . DT  E 5  ? 0.6423 0.6371 0.5818 -0.1119 0.0227  -0.0705 5   DT  E "C1'" 
1702 N N1    . DT  E 5  ? 0.6732 0.6202 0.5601 -0.1025 0.0277  -0.0617 5   DT  E N1    
1703 C C2    . DT  E 5  ? 0.6560 0.5759 0.5205 -0.1122 0.0474  -0.0503 5   DT  E C2    
1704 O O2    . DT  E 5  ? 0.7218 0.6551 0.6049 -0.1290 0.0691  -0.0502 5   DT  E O2    
1705 N N3    . DT  E 5  ? 0.6996 0.5755 0.5197 -0.1034 0.0410  -0.0387 5   DT  E N3    
1706 C C4    . DT  E 5  ? 0.7242 0.5855 0.5346 -0.0839 0.0225  -0.0404 5   DT  E C4    
1707 O O4    . DT  E 5  ? 0.7584 0.5832 0.5434 -0.0766 0.0156  -0.0279 5   DT  E O4    
1708 C C5    . DT  E 5  ? 0.7331 0.6243 0.5656 -0.0757 0.0120  -0.0569 5   DT  E C5    
1709 C C7    . DT  E 5  ? 0.7227 0.6007 0.5454 -0.0577 0.0017  -0.0640 5   DT  E C7    
1710 C C6    . DT  E 5  ? 0.7003 0.6300 0.5628 -0.0863 0.0123  -0.0650 5   DT  E C6    
1711 P P     . DA  E 6  ? 0.9636 1.1129 1.0685 -0.0899 -0.0193 -0.0671 6   DA  E P     
1712 O OP1   . DA  E 6  ? 0.9581 1.1518 1.1231 -0.0947 -0.0531 -0.0648 6   DA  E OP1   
1713 O OP2   . DA  E 6  ? 0.7470 0.8711 0.7930 -0.0691 -0.0197 -0.0604 6   DA  E OP2   
1714 O "O5'" . DA  E 6  ? 0.8664 1.0258 1.0145 -0.0933 0.0210  -0.0696 6   DA  E "O5'" 
1715 C "C5'" . DA  E 6  ? 0.8440 0.9803 0.9807 -0.1152 0.0516  -0.0753 6   DA  E "C5'" 
1716 C "C4'" . DA  E 6  ? 0.8578 0.9815 0.9822 -0.1130 0.0919  -0.0759 6   DA  E "C4'" 
1717 O "O4'" . DA  E 6  ? 0.8752 0.9438 0.9094 -0.1118 0.0965  -0.0688 6   DA  E "O4'" 
1718 C "C3'" . DA  E 6  ? 0.8683 1.0181 1.0265 -0.0896 0.0937  -0.0759 6   DA  E "C3'" 
1719 O "O3'" . DA  E 6  ? 1.0119 1.1731 1.2095 -0.0976 0.1380  -0.0869 6   DA  E "O3'" 
1720 C "C2'" . DA  E 6  ? 0.7668 0.8780 0.8443 -0.0736 0.0832  -0.0678 6   DA  E "C2'" 
1721 C "C1'" . DA  E 6  ? 0.7520 0.8147 0.7604 -0.0912 0.0974  -0.0655 6   DA  E "C1'" 
1722 N N9    . DA  E 6  ? 0.6821 0.7078 0.6253 -0.0811 0.0757  -0.0565 6   DA  E N9    
1723 C C8    . DA  E 6  ? 0.6746 0.7046 0.6111 -0.0660 0.0460  -0.0543 6   DA  E C8    
1724 N N7    . DA  E 6  ? 0.7206 0.7143 0.6069 -0.0599 0.0380  -0.0488 6   DA  E N7    
1725 C C5    . DA  E 6  ? 0.6985 0.6598 0.5520 -0.0719 0.0563  -0.0431 6   DA  E C5    
1726 C C6    . DA  E 6  ? 0.7284 0.6437 0.5299 -0.0726 0.0515  -0.0318 6   DA  E C6    
1727 N N6    . DA  E 6  ? 0.6852 0.5842 0.4737 -0.0573 0.0305  -0.0275 6   DA  E N6    
1728 N N1    . DA  E 6  ? 0.7766 0.6626 0.5414 -0.0912 0.0690  -0.0245 6   DA  E N1    
1729 C C2    . DA  E 6  ? 0.7782 0.6818 0.5609 -0.1080 0.0982  -0.0328 6   DA  E C2    
1730 N N3    . DA  E 6  ? 0.7843 0.7357 0.6313 -0.1064 0.1090  -0.0462 6   DA  E N3    
1731 C C4    . DA  E 6  ? 0.7270 0.7050 0.6065 -0.0872 0.0823  -0.0486 6   DA  E C4    
1732 P P     . DA  E 7  ? 1.0280 1.2131 1.2778 -0.0765 0.1523  -0.0935 7   DA  E P     
1733 O OP1   . DA  E 7  ? 0.9845 1.2136 1.3407 -0.0848 0.1826  -0.1077 7   DA  E OP1   
1734 O OP2   . DA  E 7  ? 0.8944 1.0889 1.1457 -0.0514 0.1076  -0.0803 7   DA  E OP2   
1735 O "O5'" . DA  E 7  ? 0.8500 0.9851 1.0119 -0.0818 0.1866  -0.0989 7   DA  E "O5'" 
1736 C "C5'" . DA  E 7  ? 0.8364 0.9364 0.9395 -0.1107 0.2193  -0.1023 7   DA  E "C5'" 
1737 C "C4'" . DA  E 7  ? 0.8771 0.9220 0.8738 -0.1132 0.2240  -0.0975 7   DA  E "C4'" 
1738 O "O4'" . DA  E 7  ? 0.7985 0.8198 0.7424 -0.1023 0.1798  -0.0792 7   DA  E "O4'" 
1739 C "C3'" . DA  E 7  ? 0.9603 1.0038 0.9570 -0.0971 0.2362  -0.1084 7   DA  E "C3'" 
1740 O "O3'" . DA  E 7  ? 1.0498 1.0568 0.9849 -0.1215 0.2809  -0.1212 7   DA  E "O3'" 
1741 C "C2'" . DA  E 7  ? 0.8157 0.8399 0.7631 -0.0774 0.1920  -0.0921 7   DA  E "C2'" 
1742 C "C1'" . DA  E 7  ? 0.7973 0.7928 0.6880 -0.0901 0.1714  -0.0760 7   DA  E "C1'" 
1743 N N9    . DA  E 7  ? 0.7632 0.7548 0.6386 -0.0715 0.1285  -0.0619 7   DA  E N9    
1744 C C8    . DA  E 7  ? 0.6964 0.7212 0.6197 -0.0531 0.1019  -0.0591 7   DA  E C8    
1745 N N7    . DA  E 7  ? 0.7439 0.7533 0.6342 -0.0425 0.0745  -0.0494 7   DA  E N7    
1746 C C5    . DA  E 7  ? 0.6775 0.6438 0.5056 -0.0516 0.0782  -0.0433 7   DA  E C5    
1747 C C6    . DA  E 7  ? 0.7018 0.6379 0.4883 -0.0456 0.0564  -0.0321 7   DA  E C6    
1748 N N6    . DA  E 7  ? 0.7267 0.6718 0.5263 -0.0292 0.0347  -0.0297 7   DA  E N6    
1749 N N1    . DA  E 7  ? 0.6906 0.5854 0.4227 -0.0589 0.0580  -0.0233 7   DA  E N1    
1750 C C2    . DA  E 7  ? 0.7598 0.6410 0.4660 -0.0801 0.0850  -0.0275 7   DA  E C2    
1751 N N3    . DA  E 7  ? 0.7720 0.6793 0.5129 -0.0884 0.1160  -0.0423 7   DA  E N3    
1752 C C4    . DA  E 7  ? 0.7118 0.6639 0.5215 -0.0712 0.1087  -0.0491 7   DA  E C4    
1753 P P     . DT  E 8  ? 1.1487 1.1387 1.0628 -0.1163 0.3063  -0.1405 8   DT  E P     
1754 O OP1   . DT  E 8  ? 1.3640 1.3379 1.2582 -0.1464 0.3693  -0.1641 8   DT  E OP1   
1755 O OP2   . DT  E 8  ? 0.9941 1.0245 0.9998 -0.0829 0.2879  -0.1440 8   DT  E OP2   
1756 O "O5'" . DT  E 8  ? 0.9676 0.9053 0.7682 -0.1190 0.2731  -0.1235 8   DT  E "O5'" 
1757 C "C5'" . DT  E 8  ? 0.9830 0.8763 0.6921 -0.1442 0.2646  -0.1061 8   DT  E "C5'" 
1758 C "C4'" . DT  E 8  ? 1.0076 0.8654 0.6452 -0.1370 0.2208  -0.0876 8   DT  E "C4'" 
1759 O "O4'" . DT  E 8  ? 0.8947 0.7791 0.5805 -0.1084 0.1773  -0.0725 8   DT  E "O4'" 
1760 C "C3'" . DT  E 8  ? 1.0615 0.9038 0.6697 -0.1329 0.2245  -0.1016 8   DT  E "C3'" 
1761 O "O3'" . DT  E 8  ? 1.1793 0.9640 0.6748 -0.1606 0.2189  -0.0937 8   DT  E "O3'" 
1762 C "C2'" . DT  E 8  ? 0.9394 0.8061 0.5930 -0.0998 0.1811  -0.0904 8   DT  E "C2'" 
1763 C "C1'" . DT  E 8  ? 0.9697 0.8422 0.6311 -0.0938 0.1496  -0.0674 8   DT  E "C1'" 
1764 N N1    . DT  E 8  ? 0.7674 0.6758 0.4911 -0.0646 0.1193  -0.0594 8   DT  E N1    
1765 C C2    . DT  E 8  ? 0.7325 0.6278 0.4346 -0.0550 0.0833  -0.0424 8   DT  E C2    
1766 O O2    . DT  E 8  ? 0.7644 0.6224 0.4086 -0.0664 0.0686  -0.0309 8   DT  E O2    
1767 N N3    . DT  E 8  ? 0.6664 0.5931 0.4191 -0.0330 0.0646  -0.0387 8   DT  E N3    
1768 C C4    . DT  E 8  ? 0.6870 0.6526 0.5004 -0.0211 0.0704  -0.0455 8   DT  E C4    
1769 O O4    . DT  E 8  ? 0.5800 0.5647 0.4182 -0.0063 0.0506  -0.0393 8   DT  E O4    
1770 C C5    . DT  E 8  ? 0.7239 0.7037 0.5683 -0.0291 0.1009  -0.0596 8   DT  E C5    
1771 C C7    . DT  E 8  ? 0.6802 0.7032 0.6033 -0.0158 0.1011  -0.0636 8   DT  E C7    
1772 C C6    . DT  E 8  ? 0.7157 0.6680 0.5176 -0.0497 0.1276  -0.0682 8   DT  E C6    
1773 P P     . DT  E 9  ? 1.3333 1.0854 0.7667 -0.1740 0.2330  -0.1137 9   DT  E P     
1774 O OP1   . DT  E 9  ? 1.2719 0.9724 0.5993 -0.2180 0.2659  -0.1199 9   DT  E OP1   
1775 O OP2   . DT  E 9  ? 1.2412 1.0317 0.7630 -0.1506 0.2569  -0.1403 9   DT  E OP2   
1776 O "O5'" . DT  E 9  ? 1.1380 0.8719 0.5363 -0.1628 0.1714  -0.0899 9   DT  E "O5'" 
1777 C "C5'" . DT  E 9  ? 1.1208 0.8314 0.4780 -0.1684 0.1298  -0.0569 9   DT  E "C5'" 
1778 C "C4'" . DT  E 9  ? 1.0766 0.7968 0.4597 -0.1441 0.0773  -0.0404 9   DT  E "C4'" 
1779 O "O4'" . DT  E 9  ? 1.0248 0.7972 0.5078 -0.1098 0.0723  -0.0408 9   DT  E "O4'" 
1780 C "C3'" . DT  E 9  ? 1.0825 0.7915 0.4422 -0.1462 0.0684  -0.0541 9   DT  E "C3'" 
1781 O "O3'" . DT  E 9  ? 1.1350 0.8179 0.4543 -0.1510 0.0155  -0.0291 9   DT  E "O3'" 
1782 C "C2'" . DT  E 9  ? 1.0396 0.7992 0.4992 -0.1118 0.0707  -0.0643 9   DT  E "C2'" 
1783 C "C1'" . DT  E 9  ? 0.9409 0.7285 0.4539 -0.0915 0.0517  -0.0438 9   DT  E "C1'" 
1784 N N1    . DT  E 9  ? 0.8505 0.6868 0.4518 -0.0637 0.0594  -0.0494 9   DT  E N1    
1785 C C2    . DT  E 9  ? 0.8486 0.7059 0.4905 -0.0429 0.0303  -0.0342 9   DT  E C2    
1786 O O2    . DT  E 9  ? 0.7664 0.6081 0.3901 -0.0428 0.0000  -0.0184 9   DT  E O2    
1787 N N3    . DT  E 9  ? 0.6933 0.5898 0.4003 -0.0233 0.0378  -0.0384 9   DT  E N3    
1788 C C4    . DT  E 9  ? 0.6889 0.6075 0.4350 -0.0197 0.0643  -0.0523 9   DT  E C4    
1789 O O4    . DT  E 9  ? 0.6192 0.5697 0.4189 -0.0032 0.0599  -0.0495 9   DT  E O4    
1790 C C5    . DT  E 9  ? 0.7206 0.6202 0.4394 -0.0382 0.0962  -0.0695 9   DT  E C5    
1791 C C7    . DT  E 9  ? 0.7662 0.6913 0.5447 -0.0329 0.1284  -0.0872 9   DT  E C7    
1792 C C6    . DT  E 9  ? 0.8169 0.6754 0.4594 -0.0606 0.0953  -0.0688 9   DT  E C6    
1793 P P     . DA  E 10 ? 1.3304 0.9869 0.5998 -0.1653 -0.0083 -0.0359 10  DA  E P     
1794 O OP1   . DA  E 10 ? 1.2483 0.8580 0.4361 -0.1897 -0.0545 -0.0078 10  DA  E OP1   
1795 O OP2   . DA  E 10 ? 1.2355 0.8836 0.4819 -0.1790 0.0401  -0.0726 10  DA  E OP2   
1796 O "O5'" . DA  E 10 ? 1.2201 0.9214 0.5862 -0.1303 -0.0356 -0.0314 10  DA  E "O5'" 
1797 C "C5'" . DA  E 10 ? 1.0993 0.8147 0.5080 -0.1127 -0.0786 -0.0034 10  DA  E "C5'" 
1798 C "C4'" . DA  E 10 ? 0.9793 0.7408 0.4797 -0.0829 -0.0836 -0.0075 10  DA  E "C4'" 
1799 O "O4'" . DA  E 10 ? 0.8762 0.6716 0.4287 -0.0649 -0.0446 -0.0214 10  DA  E "O4'" 
1800 C "C3'" . DA  E 10 ? 0.9383 0.6971 0.4375 -0.0889 -0.0914 -0.0215 10  DA  E "C3'" 
1801 O "O3'" . DA  E 10 ? 0.9144 0.7019 0.4823 -0.0704 -0.1219 -0.0088 10  DA  E "O3'" 
1802 C "C2'" . DA  E 10 ? 0.8765 0.6558 0.4103 -0.0782 -0.0460 -0.0459 10  DA  E "C2'" 
1803 C "C1'" . DA  E 10 ? 0.7947 0.6102 0.3882 -0.0541 -0.0356 -0.0355 10  DA  E "C1'" 
1804 N N9    . DA  E 10 ? 0.7671 0.6042 0.3961 -0.0438 0.0028  -0.0507 10  DA  E N9    
1805 C C8    . DA  E 10 ? 0.7882 0.6129 0.3971 -0.0555 0.0391  -0.0720 10  DA  E C8    
1806 N N7    . DA  E 10 ? 0.7785 0.6339 0.4492 -0.0388 0.0626  -0.0792 10  DA  E N7    
1807 C C5    . DA  E 10 ? 0.6935 0.5789 0.4124 -0.0180 0.0396  -0.0610 10  DA  E C5    
1808 C C6    . DA  E 10 ? 0.6410 0.5618 0.4224 0.0017  0.0428  -0.0556 10  DA  E C6    
1809 N N6    . DA  E 10 ? 0.6457 0.5825 0.4679 0.0077  0.0654  -0.0654 10  DA  E N6    
1810 N N1    . DA  E 10 ? 0.5667 0.5052 0.3688 0.0140  0.0208  -0.0396 10  DA  E N1    
1811 C C2    . DA  E 10 ? 0.6086 0.5353 0.3882 0.0103  -0.0008 -0.0307 10  DA  E C2    
1812 N N3    . DA  E 10 ? 0.6699 0.5672 0.4034 -0.0050 -0.0127 -0.0311 10  DA  E N3    
1813 C C4    . DA  E 10 ? 0.6916 0.5669 0.3879 -0.0205 0.0077  -0.0460 10  DA  E C4    
1814 P P     . DG  E 11 ? 1.0810 0.8570 0.6437 -0.0836 -0.1634 -0.0048 11  DG  E P     
1815 O OP1   . DG  E 11 ? 1.0633 0.8104 0.5830 -0.0990 -0.2092 0.0190  11  DG  E OP1   
1816 O OP2   . DG  E 11 ? 0.9870 0.7444 0.5144 -0.1000 -0.1435 -0.0310 11  DG  E OP2   
1817 O "O5'" . DG  E 11 ? 0.9506 0.7751 0.6180 -0.0564 -0.1702 0.0022  11  DG  E "O5'" 
1818 C "C5'" . DG  E 11 ? 0.8433 0.6924 0.5669 -0.0358 -0.1797 0.0195  11  DG  E "C5'" 
1819 C "C4'" . DG  E 11 ? 0.7570 0.6493 0.5582 -0.0132 -0.1558 0.0143  11  DG  E "C4'" 
1820 O "O4'" . DG  E 11 ? 0.6854 0.5831 0.4729 -0.0071 -0.1161 0.0018  11  DG  E "O4'" 
1821 C "C3'" . DG  E 11 ? 0.6743 0.5818 0.5151 -0.0162 -0.1623 0.0090  11  DG  E "C3'" 
1822 O "O3'" . DG  E 11 ? 0.6990 0.6446 0.6195 0.0016  -0.1577 0.0156  11  DG  E "O3'" 
1823 C "C2'" . DG  E 11 ? 0.6678 0.5678 0.4833 -0.0194 -0.1288 -0.0081 11  DG  E "C2'" 
1824 C "C1'" . DG  E 11 ? 0.6497 0.5603 0.4628 -0.0048 -0.1005 -0.0079 11  DG  E "C1'" 
1825 N N9    . DG  E 11 ? 0.6472 0.5457 0.4294 -0.0077 -0.0714 -0.0219 11  DG  E N9    
1826 C C8    . DG  E 11 ? 0.6765 0.5426 0.3988 -0.0251 -0.0634 -0.0347 11  DG  E C8    
1827 N N7    . DG  E 11 ? 0.6491 0.5169 0.3747 -0.0210 -0.0313 -0.0479 11  DG  E N7    
1828 C C5    . DG  E 11 ? 0.6431 0.5444 0.4271 -0.0004 -0.0246 -0.0390 11  DG  E C5    
1829 C C6    . DG  E 11 ? 0.6100 0.5280 0.4277 0.0120  -0.0020 -0.0422 11  DG  E C6    
1830 O O6    . DG  E 11 ? 0.6350 0.5461 0.4524 0.0106  0.0203  -0.0557 11  DG  E O6    
1831 N N1    . DG  E 11 ? 0.5503 0.4955 0.4075 0.0261  -0.0074 -0.0273 11  DG  E N1    
1832 C C2    . DG  E 11 ? 0.5386 0.4954 0.4081 0.0285  -0.0233 -0.0159 11  DG  E C2    
1833 N N2    . DG  E 11 ? 0.5560 0.5351 0.4542 0.0382  -0.0192 -0.0054 11  DG  E N2    
1834 N N3    . DG  E 11 ? 0.5739 0.5208 0.4306 0.0204  -0.0422 -0.0147 11  DG  E N3    
1835 C C4    . DG  E 11 ? 0.6300 0.5484 0.4419 0.0060  -0.0458 -0.0245 11  DG  E C4    
1836 P P     . DT  E 12 ? 0.8901 0.8608 0.8729 0.0003  -0.1582 0.0138  12  DT  E P     
1837 O OP1   . DT  E 12 ? 0.9580 0.9613 1.0204 0.0129  -0.1656 0.0227  12  DT  E OP1   
1838 O OP2   . DT  E 12 ? 0.9218 0.8678 0.8723 -0.0216 -0.1816 0.0078  12  DT  E OP2   
1839 O "O5'" . DT  E 12 ? 0.7555 0.7395 0.7437 0.0095  -0.1158 0.0071  12  DT  E "O5'" 
1840 C "C5'" . DT  E 12 ? 0.7730 0.7705 0.7626 0.0245  -0.0915 0.0088  12  DT  E "C5'" 
1841 C "C4'" . DT  E 12 ? 0.7166 0.7314 0.7263 0.0292  -0.0629 0.0092  12  DT  E "C4'" 
1842 O "O4'" . DT  E 12 ? 0.7516 0.7502 0.7217 0.0286  -0.0499 0.0055  12  DT  E "O4'" 
1843 C "C3'" . DT  E 12 ? 0.6786 0.7042 0.7311 0.0210  -0.0626 0.0118  12  DT  E "C3'" 
1844 O "O3'" . DT  E 12 ? 0.7060 0.7534 0.7835 0.0260  -0.0354 0.0171  12  DT  E "O3'" 
1845 C "C2'" . DT  E 12 ? 0.6793 0.6780 0.6989 0.0120  -0.0637 0.0062  12  DT  E "C2'" 
1846 C "C1'" . DT  E 12 ? 0.6754 0.6653 0.6554 0.0212  -0.0471 0.0045  12  DT  E "C1'" 
1847 N N1    . DT  E 12 ? 0.6493 0.6114 0.5912 0.0164  -0.0462 -0.0069 12  DT  E N1    
1848 C C2    . DT  E 12 ? 0.6150 0.5747 0.5534 0.0242  -0.0281 -0.0068 12  DT  E C2    
1849 O O2    . DT  E 12 ? 0.6444 0.6202 0.6004 0.0321  -0.0191 0.0054  12  DT  E O2    
1850 N N3    . DT  E 12 ? 0.6629 0.5996 0.5774 0.0205  -0.0210 -0.0216 12  DT  E N3    
1851 C C4    . DT  E 12 ? 0.6494 0.5608 0.5263 0.0062  -0.0277 -0.0372 12  DT  E C4    
1852 O O4    . DT  E 12 ? 0.6875 0.5783 0.5423 0.0019  -0.0118 -0.0537 12  DT  E O4    
1853 C C5    . DT  E 12 ? 0.6614 0.5726 0.5300 -0.0039 -0.0539 -0.0326 12  DT  E C5    
1854 C C7    . DT  E 12 ? 0.6943 0.5735 0.5096 -0.0244 -0.0700 -0.0449 12  DT  E C7    
1855 C C6    . DT  E 12 ? 0.6745 0.6135 0.5841 0.0035  -0.0627 -0.0175 12  DT  E C6    
1856 P P     . DC  E 13 ? 0.7582 0.8219 0.8854 0.0160  -0.0230 0.0227  13  DC  E P     
1857 O OP1   . DC  E 13 ? 0.6887 0.7759 0.8364 0.0195  0.0063  0.0247  13  DC  E OP1   
1858 O OP2   . DC  E 13 ? 0.6408 0.7072 0.8084 0.0066  -0.0499 0.0198  13  DC  E OP2   
1859 O "O5'" . DC  E 13 ? 0.6439 0.6848 0.7392 0.0105  -0.0144 0.0288  13  DC  E "O5'" 
1860 C "C5'" . DC  E 13 ? 0.6955 0.7306 0.7535 0.0168  0.0018  0.0365  13  DC  E "C5'" 
1861 C "C4'" . DC  E 13 ? 0.6979 0.7085 0.7444 0.0135  0.0011  0.0438  13  DC  E "C4'" 
1862 O "O4'" . DC  E 13 ? 0.6805 0.6706 0.7087 0.0174  -0.0122 0.0306  13  DC  E "O4'" 
1863 C "C3'" . DC  E 13 ? 0.7268 0.7301 0.8079 -0.0001 0.0028  0.0498  13  DC  E "C3'" 
1864 O "O3'" . DC  E 13 ? 0.7699 0.7573 0.8428 -0.0029 0.0132  0.0686  13  DC  E "O3'" 
1865 C "C2'" . DC  E 13 ? 0.6679 0.6484 0.7495 -0.0037 -0.0155 0.0339  13  DC  E "C2'" 
1866 C "C1'" . DC  E 13 ? 0.6621 0.6293 0.7053 0.0089  -0.0158 0.0275  13  DC  E "C1'" 
1867 N N1    . DC  E 13 ? 0.6931 0.6396 0.7146 0.0060  -0.0270 0.0068  13  DC  E N1    
1868 C C2    . DC  E 13 ? 0.6483 0.5751 0.6512 0.0130  -0.0187 -0.0021 13  DC  E C2    
1869 O O2    . DC  E 13 ? 0.6362 0.5659 0.6498 0.0236  -0.0093 0.0104  13  DC  E O2    
1870 N N3    . DC  E 13 ? 0.7305 0.6349 0.7049 0.0062  -0.0210 -0.0242 13  DC  E N3    
1871 C C4    . DC  E 13 ? 0.7628 0.6611 0.7182 -0.0082 -0.0388 -0.0334 13  DC  E C4    
1872 N N4    . DC  E 13 ? 0.7636 0.6336 0.6743 -0.0197 -0.0404 -0.0546 13  DC  E N4    
1873 C C5    . DC  E 13 ? 0.7386 0.6594 0.7217 -0.0134 -0.0556 -0.0213 13  DC  E C5    
1874 C C6    . DC  E 13 ? 0.6798 0.6258 0.6998 -0.0052 -0.0453 -0.0033 13  DC  E C6    
1875 P P     . DG  E 14 ? 1.0091 1.0008 1.1024 -0.0194 0.0313  0.0874  14  DG  E P     
1876 O OP1   . DG  E 14 ? 0.9920 1.0112 1.0732 -0.0209 0.0509  0.0894  14  DG  E OP1   
1877 O OP2   . DG  E 14 ? 0.7522 0.7394 0.8917 -0.0327 0.0256  0.0805  14  DG  E OP2   
1878 O "O5'" . DG  E 14 ? 0.8390 0.8006 0.9084 -0.0194 0.0309  0.1117  14  DG  E "O5'" 
1879 C "C5'" . DG  E 14 ? 0.9184 0.8784 0.9479 -0.0078 0.0256  0.1210  14  DG  E "C5'" 
1880 C "C4'" . DG  E 14 ? 0.8675 0.7989 0.9060 0.0029  0.0093  0.1274  14  DG  E "C4'" 
1881 O "O4'" . DG  E 14 ? 0.8349 0.7640 0.8903 0.0130  0.0028  0.0986  14  DG  E "O4'" 
1882 C "C3'" . DG  E 14 ? 0.9080 0.8065 0.9722 -0.0064 0.0082  0.1469  14  DG  E "C3'" 
1883 O "O3'" . DG  E 14 ? 0.9008 0.7771 0.9605 0.0016  -0.0057 0.1725  14  DG  E "O3'" 
1884 C "C2'" . DG  E 14 ? 0.8698 0.7533 0.9698 -0.0040 0.0048  0.1197  14  DG  E "C2'" 
1885 C "C1'" . DG  E 14 ? 0.8167 0.7134 0.9030 0.0122  -0.0005 0.0957  14  DG  E "C1'" 
1886 N N9    . DG  E 14 ? 0.8602 0.7530 0.9524 0.0096  -0.0019 0.0637  14  DG  E N9    
1887 C C8    . DG  E 14 ? 0.7613 0.6663 0.8575 -0.0037 -0.0042 0.0519  14  DG  E C8    
1888 N N7    . DG  E 14 ? 0.6632 0.5566 0.7516 -0.0068 -0.0117 0.0256  14  DG  E N7    
1889 C C5    . DG  E 14 ? 0.6890 0.5619 0.7688 0.0052  -0.0064 0.0160  14  DG  E C5    
1890 C C6    . DG  E 14 ? 0.7013 0.5517 0.7638 0.0044  -0.0036 -0.0137 14  DG  E C6    
1891 O O6    . DG  E 14 ? 0.7678 0.6075 0.8059 -0.0095 -0.0107 -0.0356 14  DG  E O6    
1892 N N1    . DG  E 14 ? 0.6976 0.5367 0.7728 0.0198  0.0086  -0.0167 14  DG  E N1    
1893 C C2    . DG  E 14 ? 0.7139 0.5621 0.8163 0.0344  0.0085  0.0097  14  DG  E C2    
1894 N N2    . DG  E 14 ? 0.7262 0.5657 0.8541 0.0493  0.0169  0.0032  14  DG  E N2    
1895 N N3    . DG  E 14 ? 0.7765 0.6403 0.8807 0.0324  0.0007  0.0404  14  DG  E N3    
1896 C C4    . DG  E 14 ? 0.7350 0.6104 0.8265 0.0174  -0.0021 0.0398  14  DG  E C4    
1897 O "O5'" . DC  F 1  ? 1.3488 0.9259 1.0998 -0.0161 0.0197  -0.2697 1   DC  F "O5'" 
1898 C "C5'" . DC  F 1  ? 1.3222 0.9491 1.1034 0.0013  0.0328  -0.2496 1   DC  F "C5'" 
1899 C "C4'" . DC  F 1  ? 1.2724 0.9093 1.1219 0.0215  0.0325  -0.2297 1   DC  F "C4'" 
1900 O "O4'" . DC  F 1  ? 1.1908 0.8327 1.0598 0.0096  0.0045  -0.2030 1   DC  F "O4'" 
1901 C "C3'" . DC  F 1  ? 1.1658 0.8529 1.0505 0.0399  0.0440  -0.2114 1   DC  F "C3'" 
1902 O "O3'" . DC  F 1  ? 1.1816 0.8634 1.1213 0.0644  0.0538  -0.2098 1   DC  F "O3'" 
1903 C "C2'" . DC  F 1  ? 1.0948 0.8169 0.9868 0.0295  0.0191  -0.1785 1   DC  F "C2'" 
1904 C "C1'" . DC  F 1  ? 1.1183 0.8097 1.0172 0.0174  -0.0015 -0.1716 1   DC  F "C1'" 
1905 N N1    . DC  F 1  ? 1.0491 0.7601 0.9337 -0.0032 -0.0247 -0.1531 1   DC  F N1    
1906 C C2    . DC  F 1  ? 0.9289 0.6637 0.8476 -0.0026 -0.0382 -0.1223 1   DC  F C2    
1907 O O2    . DC  F 1  ? 0.9170 0.6535 0.8714 0.0144  -0.0334 -0.1096 1   DC  F O2    
1908 N N3    . DC  F 1  ? 0.8776 0.6338 0.7893 -0.0201 -0.0560 -0.1070 1   DC  F N3    
1909 C C4    . DC  F 1  ? 0.9266 0.6812 0.8019 -0.0371 -0.0649 -0.1196 1   DC  F C4    
1910 N N4    . DC  F 1  ? 0.8525 0.6327 0.7308 -0.0518 -0.0834 -0.1034 1   DC  F N4    
1911 C C5    . DC  F 1  ? 0.9884 0.7161 0.8217 -0.0392 -0.0550 -0.1492 1   DC  F C5    
1912 C C6    . DC  F 1  ? 1.0402 0.7467 0.8785 -0.0224 -0.0328 -0.1659 1   DC  F C6    
1913 P P     . DG  F 2  ? 1.2029 0.9280 1.1845 0.0871  0.0724  -0.2044 2   DG  F P     
1914 O OP1   . DG  F 2  ? 1.1853 0.8939 1.2223 0.1123  0.0790  -0.2071 2   DG  F OP1   
1915 O OP2   . DG  F 2  ? 1.1479 0.8871 1.0932 0.0813  0.0963  -0.2241 2   DG  F OP2   
1916 O "O5'" . DG  F 2  ? 1.1140 0.8832 1.1134 0.0837  0.0498  -0.1678 2   DG  F "O5'" 
1917 C "C5'" . DG  F 2  ? 1.0524 0.8163 1.0807 0.0871  0.0277  -0.1425 2   DG  F "C5'" 
1918 C "C4'" . DG  F 2  ? 0.9366 0.7443 0.9694 0.0827  0.0119  -0.1137 2   DG  F "C4'" 
1919 O "O4'" . DG  F 2  ? 0.8792 0.6868 0.8740 0.0598  -0.0015 -0.1071 2   DG  F "O4'" 
1920 C "C3'" . DG  F 2  ? 0.8938 0.7446 0.9317 0.0883  0.0231  -0.1146 2   DG  F "C3'" 
1921 O "O3'" . DG  F 2  ? 0.8959 0.7791 0.9562 0.0933  0.0074  -0.0883 2   DG  F "O3'" 
1922 C "C2'" . DG  F 2  ? 0.8525 0.7080 0.8400 0.0674  0.0229  -0.1199 2   DG  F "C2'" 
1923 C "C1'" . DG  F 2  ? 0.7955 0.6391 0.7717 0.0542  0.0004  -0.1037 2   DG  F "C1'" 
1924 N N9    . DG  F 2  ? 0.8612 0.6953 0.7936 0.0335  -0.0065 -0.1102 2   DG  F N9    
1925 C C8    . DG  F 2  ? 0.8987 0.7159 0.7904 0.0241  0.0035  -0.1329 2   DG  F C8    
1926 N N7    . DG  F 2  ? 0.8737 0.6879 0.7322 0.0056  -0.0118 -0.1306 2   DG  F N7    
1927 C C5    . DG  F 2  ? 0.7912 0.6246 0.6751 0.0033  -0.0298 -0.1061 2   DG  F C5    
1928 C C6    . DG  F 2  ? 0.7822 0.6268 0.6578 -0.0121 -0.0500 -0.0932 2   DG  F C6    
1929 O O6    . DG  F 2  ? 0.8000 0.6394 0.6440 -0.0272 -0.0607 -0.0999 2   DG  F O6    
1930 N N1    . DG  F 2  ? 0.6607 0.5257 0.5701 -0.0086 -0.0580 -0.0697 2   DG  F N1    
1931 C C2    . DG  F 2  ? 0.6925 0.5633 0.6323 0.0070  -0.0512 -0.0587 2   DG  F C2    
1932 N N2    . DG  F 2  ? 0.6902 0.5788 0.6503 0.0066  -0.0597 -0.0357 2   DG  F N2    
1933 N N3    . DG  F 2  ? 0.6829 0.5434 0.6331 0.0220  -0.0374 -0.0692 2   DG  F N3    
1934 C C4    . DG  F 2  ? 0.7336 0.5774 0.6581 0.0196  -0.0258 -0.0933 2   DG  F C4    
1935 P P     . DA  F 3  ? 0.9307 0.8525 1.0303 0.1095  0.0124  -0.0840 3   DA  F P     
1936 O OP1   . DA  F 3  ? 0.8078 0.7177 0.9536 0.1309  0.0145  -0.0859 3   DA  F OP1   
1937 O OP2   . DA  F 3  ? 0.8782 0.8197 0.9610 0.1021  0.0306  -0.0991 3   DA  F OP2   
1938 O "O5'" . DA  F 3  ? 0.8141 0.7604 0.9136 0.1064  -0.0103 -0.0559 3   DA  F "O5'" 
1939 C "C5'" . DA  F 3  ? 0.7453 0.6741 0.8478 0.1078  -0.0277 -0.0358 3   DA  F "C5'" 
1940 C "C4'" . DA  F 3  ? 0.6592 0.6074 0.7386 0.0965  -0.0415 -0.0163 3   DA  F "C4'" 
1941 O "O4'" . DA  F 3  ? 0.6681 0.6078 0.7132 0.0781  -0.0391 -0.0221 3   DA  F "O4'" 
1942 C "C3'" . DA  F 3  ? 0.6030 0.5902 0.6854 0.0988  -0.0439 -0.0132 3   DA  F "C3'" 
1943 O "O3'" . DA  F 3  ? 0.6144 0.6127 0.6897 0.0986  -0.0601 0.0090  3   DA  F "O3'" 
1944 C "C2'" . DA  F 3  ? 0.5572 0.5494 0.6099 0.0843  -0.0337 -0.0264 3   DA  F "C2'" 
1945 C "C1'" . DA  F 3  ? 0.5953 0.5625 0.6232 0.0717  -0.0373 -0.0242 3   DA  F "C1'" 
1946 N N9    . DA  F 3  ? 0.6032 0.5580 0.6043 0.0596  -0.0283 -0.0413 3   DA  F N9    
1947 C C8    . DA  F 3  ? 0.6144 0.5588 0.6099 0.0606  -0.0123 -0.0623 3   DA  F C8    
1948 N N7    . DA  F 3  ? 0.6192 0.5512 0.5788 0.0466  -0.0097 -0.0727 3   DA  F N7    
1949 C C5    . DA  F 3  ? 0.5630 0.5003 0.5120 0.0368  -0.0263 -0.0576 3   DA  F C5    
1950 C C6    . DA  F 3  ? 0.5822 0.5152 0.5025 0.0215  -0.0355 -0.0578 3   DA  F C6    
1951 N N6    . DA  F 3  ? 0.6025 0.5197 0.4892 0.0119  -0.0314 -0.0734 3   DA  F N6    
1952 N N1    . DA  F 3  ? 0.5561 0.5030 0.4833 0.0164  -0.0495 -0.0408 3   DA  F N1    
1953 C C2    . DA  F 3  ? 0.5769 0.5376 0.5289 0.0250  -0.0521 -0.0250 3   DA  F C2    
1954 N N3    . DA  F 3  ? 0.5321 0.4946 0.5048 0.0386  -0.0471 -0.0220 3   DA  F N3    
1955 C C4    . DA  F 3  ? 0.6044 0.5564 0.5784 0.0445  -0.0352 -0.0389 3   DA  F C4    
1956 P P     . DC  F 4  ? 0.6090 0.6417 0.6819 0.0998  -0.0680 0.0145  4   DC  F P     
1957 O OP1   . DC  F 4  ? 0.6037 0.6392 0.6767 0.1065  -0.0851 0.0361  4   DC  F OP1   
1958 O OP2   . DC  F 4  ? 0.5308 0.5820 0.6281 0.1049  -0.0595 -0.0013 4   DC  F OP2   
1959 O "O5'" . DC  F 4  ? 0.5414 0.5791 0.5795 0.0845  -0.0638 0.0122  4   DC  F "O5'" 
1960 C "C5'" . DC  F 4  ? 0.5457 0.5726 0.5635 0.0757  -0.0668 0.0235  4   DC  F "C5'" 
1961 C "C4'" . DC  F 4  ? 0.5419 0.5768 0.5381 0.0644  -0.0622 0.0172  4   DC  F "C4'" 
1962 O "O4'" . DC  F 4  ? 0.4747 0.4959 0.4667 0.0584  -0.0537 0.0013  4   DC  F "O4'" 
1963 C "C3'" . DC  F 4  ? 0.4653 0.5225 0.4539 0.0657  -0.0632 0.0139  4   DC  F "C3'" 
1964 O "O3'" . DC  F 4  ? 0.4490 0.5153 0.4219 0.0626  -0.0669 0.0246  4   DC  F "O3'" 
1965 C "C2'" . DC  F 4  ? 0.4683 0.5221 0.4506 0.0596  -0.0542 -0.0012 4   DC  F "C2'" 
1966 C "C1'" . DC  F 4  ? 0.4730 0.5059 0.4484 0.0525  -0.0515 -0.0044 4   DC  F "C1'" 
1967 N N1    . DC  F 4  ? 0.5159 0.5354 0.4816 0.0474  -0.0419 -0.0203 4   DC  F N1    
1968 C C2    . DC  F 4  ? 0.4697 0.4795 0.4114 0.0359  -0.0440 -0.0237 4   DC  F C2    
1969 O O2    . DC  F 4  ? 0.4900 0.5068 0.4283 0.0315  -0.0534 -0.0136 4   DC  F O2    
1970 N N3    . DC  F 4  ? 0.4307 0.4250 0.3534 0.0300  -0.0358 -0.0380 4   DC  F N3    
1971 C C4    . DC  F 4  ? 0.5341 0.5247 0.4646 0.0355  -0.0214 -0.0496 4   DC  F C4    
1972 N N4    . DC  F 4  ? 0.5428 0.5174 0.4479 0.0286  -0.0099 -0.0641 4   DC  F N4    
1973 C C5    . DC  F 4  ? 0.4940 0.4986 0.4590 0.0482  -0.0184 -0.0466 4   DC  F C5    
1974 C C6    . DC  F 4  ? 0.5097 0.5274 0.4893 0.0536  -0.0312 -0.0314 4   DC  F C6    
1975 P P     . DT  F 5  ? 0.4492 0.5332 0.4095 0.0646  -0.0692 0.0231  5   DT  F P     
1976 O OP1   . DT  F 5  ? 0.4204 0.5109 0.3671 0.0643  -0.0698 0.0351  5   DT  F OP1   
1977 O OP2   . DT  F 5  ? 0.4270 0.5187 0.3978 0.0704  -0.0740 0.0174  5   DT  F OP2   
1978 O "O5'" . DT  F 5  ? 0.4264 0.5090 0.3796 0.0584  -0.0638 0.0127  5   DT  F "O5'" 
1979 C "C5'" . DT  F 5  ? 0.4428 0.5214 0.3913 0.0519  -0.0625 0.0157  5   DT  F "C5'" 
1980 C "C4'" . DT  F 5  ? 0.3841 0.4584 0.3236 0.0473  -0.0614 0.0073  5   DT  F "C4'" 
1981 O "O4'" . DT  F 5  ? 0.3772 0.4367 0.3142 0.0427  -0.0573 -0.0016 5   DT  F "O4'" 
1982 C "C3'" . DT  F 5  ? 0.4044 0.4841 0.3377 0.0508  -0.0611 0.0029  5   DT  F "C3'" 
1983 O "O3'" . DT  F 5  ? 0.4091 0.4872 0.3338 0.0491  -0.0632 0.0033  5   DT  F "O3'" 
1984 C "C2'" . DT  F 5  ? 0.3808 0.4527 0.3155 0.0478  -0.0561 -0.0059 5   DT  F "C2'" 
1985 C "C1'" . DT  F 5  ? 0.3736 0.4320 0.3019 0.0414  -0.0536 -0.0083 5   DT  F "C1'" 
1986 N N1    . DT  F 5  ? 0.4317 0.4804 0.3611 0.0388  -0.0441 -0.0180 5   DT  F N1    
1987 C C2    . DT  F 5  ? 0.4780 0.5102 0.3868 0.0306  -0.0408 -0.0237 5   DT  F C2    
1988 O O2    . DT  F 5  ? 0.4632 0.4903 0.3564 0.0254  -0.0493 -0.0196 5   DT  F O2    
1989 N N3    . DT  F 5  ? 0.4626 0.4857 0.3700 0.0289  -0.0275 -0.0349 5   DT  F N3    
1990 C C4    . DT  F 5  ? 0.5402 0.5731 0.4739 0.0357  -0.0178 -0.0402 5   DT  F C4    
1991 O O4    . DT  F 5  ? 0.5089 0.5349 0.4433 0.0346  -0.0029 -0.0516 5   DT  F O4    
1992 C C5    . DT  F 5  ? 0.4615 0.5136 0.4200 0.0440  -0.0268 -0.0319 5   DT  F C5    
1993 C C7    . DT  F 5  ? 0.4907 0.5580 0.4831 0.0517  -0.0224 -0.0357 5   DT  F C7    
1994 C C6    . DT  F 5  ? 0.4770 0.5338 0.4275 0.0446  -0.0389 -0.0219 5   DT  F C6    
1995 P P     . DA  F 6  ? 0.3899 0.4791 0.3156 0.0561  -0.0646 0.0069  6   DA  F P     
1996 O OP1   . DA  F 6  ? 0.3869 0.4897 0.3215 0.0578  -0.0628 0.0150  6   DA  F OP1   
1997 O OP2   . DA  F 6  ? 0.3943 0.4811 0.3138 0.0605  -0.0638 0.0002  6   DA  F OP2   
1998 O "O5'" . DA  F 6  ? 0.3708 0.4535 0.2930 0.0540  -0.0697 0.0081  6   DA  F "O5'" 
1999 C "C5'" . DA  F 6  ? 0.4674 0.5522 0.3944 0.0481  -0.0756 0.0130  6   DA  F "C5'" 
2000 C "C4'" . DA  F 6  ? 0.4063 0.4768 0.3190 0.0436  -0.0837 0.0131  6   DA  F "C4'" 
2001 O "O4'" . DA  F 6  ? 0.4242 0.4769 0.3175 0.0351  -0.0793 0.0068  6   DA  F "O4'" 
2002 C "C3'" . DA  F 6  ? 0.4533 0.5165 0.3606 0.0506  -0.0852 0.0137  6   DA  F "C3'" 
2003 O "O3'" . DA  F 6  ? 0.4824 0.5402 0.3859 0.0502  -0.0980 0.0205  6   DA  F "O3'" 
2004 C "C2'" . DA  F 6  ? 0.4557 0.5017 0.3455 0.0450  -0.0778 0.0076  6   DA  F "C2'" 
2005 C "C1'" . DA  F 6  ? 0.4032 0.4422 0.2810 0.0347  -0.0763 0.0052  6   DA  F "C1'" 
2006 N N9    . DA  F 6  ? 0.4361 0.4705 0.3114 0.0307  -0.0643 -0.0025 6   DA  F N9    
2007 C C8    . DA  F 6  ? 0.4139 0.4600 0.3073 0.0357  -0.0585 -0.0063 6   DA  F C8    
2008 N N7    . DA  F 6  ? 0.4606 0.5041 0.3565 0.0319  -0.0490 -0.0130 6   DA  F N7    
2009 C C5    . DA  F 6  ? 0.4289 0.4563 0.3024 0.0233  -0.0451 -0.0150 6   DA  F C5    
2010 C C6    . DA  F 6  ? 0.4414 0.4596 0.3051 0.0165  -0.0315 -0.0229 6   DA  F C6    
2011 N N6    . DA  F 6  ? 0.4279 0.4562 0.3141 0.0187  -0.0196 -0.0302 6   DA  F N6    
2012 N N1    . DA  F 6  ? 0.5166 0.5161 0.3466 0.0075  -0.0302 -0.0234 6   DA  F N1    
2013 C C2    . DA  F 6  ? 0.5283 0.5206 0.3406 0.0062  -0.0461 -0.0148 6   DA  F C2    
2014 N N3    . DA  F 6  ? 0.4809 0.4844 0.3093 0.0136  -0.0602 -0.0066 6   DA  F N3    
2015 C C4    . DA  F 6  ? 0.4474 0.4678 0.3049 0.0219  -0.0567 -0.0079 6   DA  F C4    
2016 P P     . DA  F 7  ? 0.5435 0.5854 0.4401 0.0573  -0.1039 0.0249  7   DA  F P     
2017 O OP1   . DA  F 7  ? 0.5138 0.5680 0.4297 0.0648  -0.1181 0.0334  7   DA  F OP1   
2018 O OP2   . DA  F 7  ? 0.4594 0.4963 0.3590 0.0642  -0.0932 0.0181  7   DA  F OP2   
2019 O "O5'" . DA  F 7  ? 0.5410 0.5555 0.4021 0.0447  -0.1052 0.0265  7   DA  F "O5'" 
2020 C "C5'" . DA  F 7  ? 0.5884 0.5970 0.4301 0.0350  -0.1163 0.0305  7   DA  F "C5'" 
2021 C "C4'" . DA  F 7  ? 0.6046 0.5849 0.4058 0.0234  -0.1110 0.0309  7   DA  F "C4'" 
2022 O "O4'" . DA  F 7  ? 0.5416 0.5235 0.3429 0.0181  -0.0912 0.0195  7   DA  F "O4'" 
2023 C "C3'" . DA  F 7  ? 0.7001 0.6584 0.4891 0.0260  -0.1125 0.0398  7   DA  F "C3'" 
2024 O "O3'" . DA  F 7  ? 0.7516 0.6862 0.5010 0.0174  -0.1243 0.0506  7   DA  F "O3'" 
2025 C "C2'" . DA  F 7  ? 0.6602 0.6132 0.4487 0.0206  -0.0917 0.0312  7   DA  F "C2'" 
2026 C "C1'" . DA  F 7  ? 0.6282 0.5922 0.4132 0.0128  -0.0804 0.0204  7   DA  F "C1'" 
2027 N N9    . DA  F 7  ? 0.5785 0.5552 0.3853 0.0132  -0.0644 0.0099  7   DA  F N9    
2028 C C8    . DA  F 7  ? 0.4834 0.4775 0.3207 0.0229  -0.0642 0.0059  7   DA  F C8    
2029 N N7    . DA  F 7  ? 0.4842 0.4876 0.3354 0.0206  -0.0526 -0.0023 7   DA  F N7    
2030 C C5    . DA  F 7  ? 0.5060 0.4997 0.3399 0.0098  -0.0411 -0.0049 7   DA  F C5    
2031 C C6    . DA  F 7  ? 0.5189 0.5196 0.3635 0.0041  -0.0246 -0.0135 7   DA  F C6    
2032 N N6    . DA  F 7  ? 0.4839 0.5039 0.3612 0.0086  -0.0216 -0.0196 7   DA  F N6    
2033 N N1    . DA  F 7  ? 0.5482 0.5364 0.3684 -0.0059 -0.0113 -0.0159 7   DA  F N1    
2034 C C2    . DA  F 7  ? 0.5515 0.5186 0.3325 -0.0113 -0.0179 -0.0090 7   DA  F C2    
2035 N N3    . DA  F 7  ? 0.5849 0.5445 0.3545 -0.0068 -0.0378 0.0008  7   DA  F N3    
2036 C C4    . DA  F 7  ? 0.5956 0.5707 0.3969 0.0044  -0.0472 0.0021  7   DA  F C4    
2037 P P     . DT  F 8  ? 0.7780 0.6786 0.5000 0.0148  -0.1265 0.0645  8   DT  F P     
2038 O OP1   . DT  F 8  ? 0.8519 0.7358 0.5409 0.0118  -0.1499 0.0797  8   DT  F OP1   
2039 O OP2   . DT  F 8  ? 0.7740 0.6749 0.5289 0.0277  -0.1244 0.0646  8   DT  F OP2   
2040 O "O5'" . DT  F 8  ? 0.8095 0.6951 0.5003 -0.0023 -0.1024 0.0584  8   DT  F "O5'" 
2041 C "C5'" . DT  F 8  ? 0.8249 0.7029 0.4747 -0.0155 -0.0992 0.0556  8   DT  F "C5'" 
2042 C "C4'" . DT  F 8  ? 0.8913 0.7567 0.5173 -0.0300 -0.0715 0.0502  8   DT  F "C4'" 
2043 O "O4'" . DT  F 8  ? 0.8218 0.7119 0.4914 -0.0262 -0.0533 0.0351  8   DT  F "O4'" 
2044 C "C3'" . DT  F 8  ? 0.9447 0.7807 0.5479 -0.0380 -0.0661 0.0657  8   DT  F "C3'" 
2045 O "O3'" . DT  F 8  ? 0.9890 0.8029 0.5361 -0.0554 -0.0521 0.0693  8   DT  F "O3'" 
2046 C "C2'" . DT  F 8  ? 0.8371 0.6869 0.4836 -0.0372 -0.0475 0.0566  8   DT  F "C2'" 
2047 C "C1'" . DT  F 8  ? 0.7779 0.6588 0.4490 -0.0350 -0.0346 0.0369  8   DT  F "C1'" 
2048 N N1    . DT  F 8  ? 0.7276 0.6335 0.4504 -0.0271 -0.0290 0.0261  8   DT  F N1    
2049 C C2    . DT  F 8  ? 0.6969 0.6190 0.4385 -0.0335 -0.0071 0.0141  8   DT  F C2    
2050 O O2    . DT  F 8  ? 0.6994 0.6165 0.4190 -0.0447 0.0114  0.0110  8   DT  F O2    
2051 N N3    . DT  F 8  ? 0.6264 0.5718 0.4137 -0.0259 -0.0077 0.0056  8   DT  F N3    
2052 C C4    . DT  F 8  ? 0.6450 0.5963 0.4535 -0.0135 -0.0246 0.0062  8   DT  F C4    
2053 O O4    . DT  F 8  ? 0.6044 0.5751 0.4456 -0.0089 -0.0242 -0.0023 8   DT  F O4    
2054 C C5    . DT  F 8  ? 0.6491 0.5836 0.4385 -0.0064 -0.0423 0.0172  8   DT  F C5    
2055 C C7    . DT  F 8  ? 0.6062 0.5474 0.4185 0.0084  -0.0563 0.0164  8   DT  F C7    
2056 C C6    . DT  F 8  ? 0.6387 0.5530 0.3900 -0.0130 -0.0453 0.0272  8   DT  F C6    
2057 P P     . DT  F 9  ? 1.0409 0.8188 0.5503 -0.0695 -0.0429 0.0887  9   DT  F P     
2058 O OP1   . DT  F 9  ? 1.1029 0.8534 0.5387 -0.0823 -0.0461 0.0990  9   DT  F OP1   
2059 O OP2   . DT  F 9  ? 0.9525 0.7189 0.4907 -0.0586 -0.0607 0.1023  9   DT  F OP2   
2060 O "O5'" . DT  F 9  ? 0.9277 0.7191 0.4562 -0.0817 -0.0052 0.0755  9   DT  F "O5'" 
2061 C "C5'" . DT  F 9  ? 0.9284 0.7367 0.4478 -0.0876 0.0174  0.0571  9   DT  F "C5'" 
2062 C "C4'" . DT  F 9  ? 0.9856 0.8102 0.5383 -0.0971 0.0504  0.0484  9   DT  F "C4'" 
2063 O "O4'" . DT  F 9  ? 0.8918 0.7464 0.5136 -0.0841 0.0437  0.0381  9   DT  F "O4'" 
2064 C "C3'" . DT  F 9  ? 1.0201 0.8177 0.5535 -0.1140 0.0619  0.0676  9   DT  F "C3'" 
2065 O "O3'" . DT  F 9  ? 1.1747 0.9780 0.6962 -0.1312 0.1001  0.0614  9   DT  F "O3'" 
2066 C "C2'" . DT  F 9  ? 1.0056 0.8152 0.6004 -0.1072 0.0527  0.0672  9   DT  F "C2'" 
2067 C "C1'" . DT  F 9  ? 0.8957 0.7484 0.5437 -0.0938 0.0550  0.0438  9   DT  F "C1'" 
2068 N N1    . DT  F 9  ? 0.7990 0.6687 0.4992 -0.0796 0.0364  0.0382  9   DT  F N1    
2069 C C2    . DT  F 9  ? 0.7570 0.6610 0.5100 -0.0777 0.0469  0.0224  9   DT  F C2    
2070 O O2    . DT  F 9  ? 0.7845 0.7072 0.5511 -0.0862 0.0714  0.0136  9   DT  F O2    
2071 N N3    . DT  F 9  ? 0.7369 0.6532 0.5267 -0.0648 0.0279  0.0171  9   DT  F N3    
2072 C C4    . DT  F 9  ? 0.6948 0.5944 0.4771 -0.0528 0.0040  0.0239  9   DT  F C4    
2073 O O4    . DT  F 9  ? 0.7105 0.6232 0.5239 -0.0422 -0.0076 0.0160  9   DT  F O4    
2074 C C5    . DT  F 9  ? 0.7453 0.6125 0.4811 -0.0535 -0.0053 0.0403  9   DT  F C5    
2075 C C7    . DT  F 9  ? 0.7078 0.5593 0.4424 -0.0383 -0.0304 0.0483  9   DT  F C7    
2076 C C6    . DT  F 9  ? 0.8035 0.6572 0.4991 -0.0669 0.0088  0.0473  9   DT  F C6    
2077 P P     . DA  F 10 ? 1.2947 1.0673 0.7799 -0.1554 0.1213  0.0824  10  DA  F P     
2078 O OP1   . DA  F 10 ? 1.2855 1.0415 0.6995 -0.1689 0.1445  0.0832  10  DA  F OP1   
2079 O OP2   . DA  F 10 ? 1.2249 0.9639 0.7019 -0.1533 0.0922  0.1056  10  DA  F OP2   
2080 O "O5'" . DA  F 10 ? 1.2434 1.0506 0.7991 -0.1638 0.1498  0.0704  10  DA  F "O5'" 
2081 C "C5'" . DA  F 10 ? 1.1867 1.0397 0.7928 -0.1550 0.1664  0.0445  10  DA  F "C5'" 
2082 C "C4'" . DA  F 10 ? 1.1192 1.0026 0.7988 -0.1626 0.1804  0.0391  10  DA  F "C4'" 
2083 O "O4'" . DA  F 10 ? 1.1093 1.0056 0.8373 -0.1460 0.1482  0.0340  10  DA  F "O4'" 
2084 C "C3'" . DA  F 10 ? 1.2040 1.0618 0.8718 -0.1877 0.1943  0.0597  10  DA  F "C3'" 
2085 O "O3'" . DA  F 10 ? 1.2467 1.1388 0.9597 -0.2035 0.2321  0.0507  10  DA  F "O3'" 
2086 C "C2'" . DA  F 10 ? 1.1544 0.9965 0.8476 -0.1806 0.1593  0.0676  10  DA  F "C2'" 
2087 C "C1'" . DA  F 10 ? 1.0105 0.8934 0.7607 -0.1582 0.1421  0.0453  10  DA  F "C1'" 
2088 N N9    . DA  F 10 ? 0.9057 0.7770 0.6647 -0.1406 0.1052  0.0463  10  DA  F N9    
2089 C C8    . DA  F 10 ? 0.9078 0.7423 0.6233 -0.1312 0.0805  0.0602  10  DA  F C8    
2090 N N7    . DA  F 10 ? 0.8859 0.7234 0.6276 -0.1141 0.0542  0.0547  10  DA  F N7    
2091 C C5    . DA  F 10 ? 0.7948 0.6706 0.5939 -0.1133 0.0596  0.0367  10  DA  F C5    
2092 C C6    . DA  F 10 ? 0.7605 0.6554 0.6013 -0.1000 0.0409  0.0235  10  DA  F C6    
2093 N N6    . DA  F 10 ? 0.7383 0.6170 0.5715 -0.0838 0.0165  0.0246  10  DA  F N6    
2094 N N1    . DA  F 10 ? 0.7152 0.6480 0.6060 -0.1035 0.0483  0.0089  10  DA  F N1    
2095 C C2    . DA  F 10 ? 0.7033 0.6569 0.6099 -0.1181 0.0750  0.0069  10  DA  F C2    
2096 N N3    . DA  F 10 ? 0.7792 0.7190 0.6518 -0.1314 0.0992  0.0167  10  DA  F N3    
2097 C C4    . DA  F 10 ? 0.8075 0.7061 0.6220 -0.1288 0.0891  0.0319  10  DA  F C4    
2098 P P     . DG  F 11 ? 1.4169 1.3027 1.1578 -0.2313 0.2486  0.0653  11  DG  F P     
2099 O OP1   . DG  F 11 ? 1.4807 1.3990 1.2446 -0.2491 0.2967  0.0583  11  DG  F OP1   
2100 O OP2   . DG  F 11 ? 1.4952 1.3204 1.1730 -0.2414 0.2324  0.0928  11  DG  F OP2   
2101 O "O5'" . DG  F 11 ? 1.3826 1.3000 1.2074 -0.2214 0.2233  0.0517  11  DG  F "O5'" 
2102 C "C5'" . DG  F 11 ? 1.2433 1.2146 1.1298 -0.2043 0.2229  0.0276  11  DG  F "C5'" 
2103 C "C4'" . DG  F 11 ? 1.1904 1.1860 1.1496 -0.2054 0.2027  0.0201  11  DG  F "C4'" 
2104 O "O4'" . DG  F 11 ? 1.1334 1.1058 1.0766 -0.1868 0.1620  0.0202  11  DG  F "O4'" 
2105 C "C3'" . DG  F 11 ? 1.2395 1.2206 1.2169 -0.2361 0.2140  0.0331  11  DG  F "C3'" 
2106 O "O3'" . DG  F 11 ? 1.2485 1.2803 1.3118 -0.2462 0.2213  0.0201  11  DG  F "O3'" 
2107 C "C2'" . DG  F 11 ? 1.2247 1.1562 1.1715 -0.2321 0.1787  0.0438  11  DG  F "C2'" 
2108 C "C1'" . DG  F 11 ? 1.0941 1.0410 1.0486 -0.2006 0.1471  0.0283  11  DG  F "C1'" 
2109 N N9    . DG  F 11 ? 0.9601 0.8613 0.8655 -0.1862 0.1186  0.0375  11  DG  F N9    
2110 C C8    . DG  F 11 ? 0.9658 0.8197 0.8045 -0.1878 0.1186  0.0573  11  DG  F C8    
2111 N N7    . DG  F 11 ? 0.9134 0.7377 0.7308 -0.1711 0.0889  0.0614  11  DG  F N7    
2112 C C5    . DG  F 11 ? 0.8164 0.6677 0.6836 -0.1591 0.0709  0.0424  11  DG  F C5    
2113 C C6    . DG  F 11 ? 0.8033 0.6421 0.6732 -0.1392 0.0413  0.0357  11  DG  F C6    
2114 O O6    . DG  F 11 ? 0.8604 0.6643 0.6967 -0.1263 0.0246  0.0453  11  DG  F O6    
2115 N N1    . DG  F 11 ? 0.7340 0.6080 0.6525 -0.1340 0.0317  0.0156  11  DG  F N1    
2116 C C2    . DG  F 11 ? 0.7350 0.6522 0.7003 -0.1456 0.0450  0.0047  11  DG  F C2    
2117 N N2    . DG  F 11 ? 0.7100 0.6554 0.7150 -0.1382 0.0279  -0.0124 11  DG  F N2    
2118 N N3    . DG  F 11 ? 0.7763 0.7093 0.7491 -0.1624 0.0732  0.0102  11  DG  F N3    
2119 C C4    . DG  F 11 ? 0.8550 0.7524 0.7745 -0.1688 0.0865  0.0285  11  DG  F C4    
2120 P P     . DT  F 12 ? 1.5387 1.5617 1.6412 -0.2775 0.2215  0.0283  12  DT  F P     
2121 O OP1   . DT  F 12 ? 1.6796 1.7624 1.8614 -0.2945 0.2500  0.0191  12  DT  F OP1   
2122 O OP2   . DT  F 12 ? 1.3875 1.3457 1.4210 -0.2949 0.2284  0.0531  12  DT  F OP2   
2123 O "O5'" . DT  F 12 ? 1.4028 1.4239 1.5327 -0.2630 0.1748  0.0159  12  DT  F "O5'" 
2124 C "C5'" . DT  F 12 ? 1.1835 1.2489 1.3513 -0.2374 0.1548  -0.0038 12  DT  F "C5'" 
2125 C "C4'" . DT  F 12 ? 1.0609 1.1182 1.2472 -0.2314 0.1145  -0.0136 12  DT  F "C4'" 
2126 O "O4'" . DT  F 12 ? 0.9198 0.9238 1.0402 -0.2157 0.0937  -0.0070 12  DT  F "O4'" 
2127 C "C3'" . DT  F 12 ? 1.0674 1.1175 1.2939 -0.2617 0.1098  -0.0134 12  DT  F "C3'" 
2128 O "O3'" . DT  F 12 ? 1.1346 1.2178 1.4132 -0.2565 0.0793  -0.0322 12  DT  F "O3'" 
2129 C "C2'" . DT  F 12 ? 1.0242 1.0020 1.1889 -0.2653 0.0980  -0.0006 12  DT  F "C2'" 
2130 C "C1'" . DT  F 12 ? 0.9086 0.8746 1.0285 -0.2300 0.0760  -0.0055 12  DT  F "C1'" 
2131 N N1    . DT  F 12 ? 0.9000 0.8048 0.9516 -0.2213 0.0696  0.0093  12  DT  F N1    
2132 C C2    . DT  F 12 ? 0.8502 0.7302 0.8825 -0.2010 0.0397  0.0014  12  DT  F C2    
2133 O O2    . DT  F 12 ? 0.8718 0.7744 0.9327 -0.1919 0.0191  -0.0171 12  DT  F O2    
2134 N N3    . DT  F 12 ? 0.8256 0.6537 0.8028 -0.1913 0.0347  0.0165  12  DT  F N3    
2135 C C4    . DT  F 12 ? 0.8809 0.6773 0.8159 -0.2006 0.0526  0.0398  12  DT  F C4    
2136 O O4    . DT  F 12 ? 0.9094 0.6608 0.7998 -0.1889 0.0411  0.0528  12  DT  F O4    
2137 C C5    . DT  F 12 ? 0.8906 0.7122 0.8387 -0.2235 0.0846  0.0470  12  DT  F C5    
2138 C C7    . DT  F 12 ? 0.9600 0.7476 0.8540 -0.2362 0.1067  0.0723  12  DT  F C7    
2139 C C6    . DT  F 12 ? 0.9223 0.7977 0.9304 -0.2320 0.0932  0.0308  12  DT  F C6    
2140 P P     . DC  F 13 ? 1.2042 1.2977 1.5436 -0.2880 0.0691  -0.0390 13  DC  F P     
2141 O OP1   . DC  F 13 ? 1.1655 1.3269 1.5778 -0.2829 0.0541  -0.0557 13  DC  F OP1   
2142 O OP2   . DC  F 13 ? 1.2907 1.3665 1.6338 -0.3206 0.1032  -0.0221 13  DC  F OP2   
2143 O "O5'" . DC  F 13 ? 1.3215 1.3568 1.6186 -0.2837 0.0344  -0.0449 13  DC  F "O5'" 
2144 C "C5'" . DC  F 13 ? 1.2427 1.2901 1.5461 -0.2657 -0.0029 -0.0646 13  DC  F "C5'" 
2145 C "C4'" . DC  F 13 ? 1.1637 1.1463 1.4161 -0.2613 -0.0251 -0.0692 13  DC  F "C4'" 
2146 O "O4'" . DC  F 13 ? 1.0697 1.0047 1.2603 -0.2493 -0.0093 -0.0515 13  DC  F "O4'" 
2147 C "C3'" . DC  F 13 ? 1.2111 1.1606 1.4853 -0.2939 -0.0339 -0.0743 13  DC  F "C3'" 
2148 O "O3'" . DC  F 13 ? 1.2260 1.1700 1.5051 -0.2912 -0.0700 -0.0981 13  DC  F "O3'" 
2149 C "C2'" . DC  F 13 ? 1.1876 1.0641 1.4060 -0.2964 -0.0215 -0.0571 13  DC  F "C2'" 
2150 C "C1'" . DC  F 13 ? 1.0728 0.9429 1.2366 -0.2608 -0.0171 -0.0486 13  DC  F "C1'" 
2151 N N1    . DC  F 13 ? 0.9670 0.7962 1.0862 -0.2618 0.0057  -0.0231 13  DC  F N1    
2152 C C2    . DC  F 13 ? 0.9469 0.7253 1.0099 -0.2388 -0.0046 -0.0168 13  DC  F C2    
2153 O O2    . DC  F 13 ? 0.9823 0.7525 1.0355 -0.2183 -0.0283 -0.0341 13  DC  F O2    
2154 N N3    . DC  F 13 ? 0.9252 0.6663 0.9460 -0.2393 0.0112  0.0081  13  DC  F N3    
2155 C C4    . DC  F 13 ? 0.9104 0.6605 0.9355 -0.2625 0.0394  0.0260  13  DC  F C4    
2156 N N4    . DC  F 13 ? 0.9289 0.6385 0.9030 -0.2629 0.0523  0.0516  13  DC  F N4    
2157 C C5    . DC  F 13 ? 0.9423 0.7449 1.0251 -0.2864 0.0557  0.0188  13  DC  F C5    
2158 C C6    . DC  F 13 ? 0.9343 0.7763 1.0664 -0.2845 0.0367  -0.0054 13  DC  F C6    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  0   ?   ?   ?   A . n 
A 1 2  HIS 2  135 ?   ?   ?   A . n 
A 1 3  MET 3  136 ?   ?   ?   A . n 
A 1 4  VAL 4  137 ?   ?   ?   A . n 
A 1 5  ARG 5  138 138 ARG ARG A . n 
A 1 6  LYS 6  139 139 LYS LYS A . n 
A 1 7  PRO 7  140 140 PRO PRO A . n 
A 1 8  ARG 8  141 141 ARG ARG A . n 
A 1 9  THR 9  142 142 THR THR A . n 
A 1 10 ILE 10 143 143 ILE ILE A . n 
A 1 11 TYR 11 144 144 TYR TYR A . n 
A 1 12 SER 12 145 145 SER SER A . n 
A 1 13 SER 13 146 146 SER SER A . n 
A 1 14 PHE 14 147 147 PHE PHE A . n 
A 1 15 GLN 15 148 148 GLN GLN A . n 
A 1 16 LEU 16 149 149 LEU LEU A . n 
A 1 17 ALA 17 150 150 ALA ALA A . n 
A 1 18 ALA 18 151 151 ALA ALA A . n 
A 1 19 LEU 19 152 152 LEU LEU A . n 
A 1 20 GLN 20 153 153 GLN GLN A . n 
A 1 21 ARG 21 154 154 ARG ARG A . n 
A 1 22 ARG 22 155 155 ARG ARG A . n 
A 1 23 PHE 23 156 156 PHE PHE A . n 
A 1 24 GLN 24 157 157 GLN GLN A . n 
A 1 25 LYS 25 158 158 LYS LYS A . n 
A 1 26 THR 26 159 159 THR THR A . n 
A 1 27 GLN 27 160 160 GLN GLN A . n 
A 1 28 TYR 28 161 161 TYR TYR A . n 
A 1 29 LEU 29 162 162 LEU LEU A . n 
A 1 30 ALA 30 163 163 ALA ALA A . n 
A 1 31 LEU 31 164 164 LEU LEU A . n 
A 1 32 PRO 32 165 165 PRO PRO A . n 
A 1 33 GLU 33 166 166 GLU GLU A . n 
A 1 34 ARG 34 167 167 ARG ARG A . n 
A 1 35 ALA 35 168 168 ALA ALA A . n 
A 1 36 GLU 36 169 169 GLU GLU A . n 
A 1 37 LEU 37 170 170 LEU LEU A . n 
A 1 38 ALA 38 171 171 ALA ALA A . n 
A 1 39 ALA 39 172 172 ALA ALA A . n 
A 1 40 SER 40 173 173 SER SER A . n 
A 1 41 LEU 41 174 174 LEU LEU A . n 
A 1 42 GLY 42 175 175 GLY GLY A . n 
A 1 43 LEU 43 176 176 LEU LEU A . n 
A 1 44 THR 44 177 177 THR THR A . n 
A 1 45 GLN 45 178 178 GLN GLN A . n 
A 1 46 THR 46 179 179 THR THR A . n 
A 1 47 GLN 47 180 180 GLN GLN A . n 
A 1 48 VAL 48 181 181 VAL VAL A . n 
A 1 49 LYS 49 182 182 LYS LYS A . n 
A 1 50 ILE 50 183 183 ILE ILE A . n 
A 1 51 TRP 51 184 184 TRP TRP A . n 
A 1 52 PHE 52 185 185 PHE PHE A . n 
A 1 53 GLN 53 186 186 GLN GLN A . n 
A 1 54 ASN 54 187 187 ASN ASN A . n 
A 1 55 LYS 55 188 188 LYS LYS A . n 
A 1 56 ARG 56 189 189 ARG ARG A . n 
A 1 57 SER 57 190 190 SER SER A . n 
A 1 58 LYS 58 191 191 LYS LYS A . n 
A 1 59 ILE 59 192 192 ILE ILE A . n 
A 1 60 LYS 60 193 193 LYS LYS A . n 
A 1 61 LYS 61 194 194 LYS LYS A . n 
A 1 62 ILE 62 195 195 ILE ILE A . n 
A 1 63 MET 63 196 196 MET MET A . n 
A 1 64 LYS 64 197 197 LYS LYS A . n 
A 1 65 ASN 65 198 198 ASN ASN A . n 
B 2 1  DC  1  1   1   DC  DC  B . n 
B 2 2  DG  2  2   2   DG  DG  B . n 
B 2 3  DA  3  3   3   DA  DA  B . n 
B 2 4  DC  4  4   4   DC  DC  B . n 
B 2 5  DT  5  5   5   DT  DT  B . n 
B 2 6  DA  6  6   6   DA  DA  B . n 
B 2 7  DA  7  7   7   DA  DA  B . n 
B 2 8  DT  8  8   8   DT  DT  B . n 
B 2 9  DT  9  9   9   DT  DT  B . n 
B 2 10 DA  10 10  10  DA  DA  B . n 
B 2 11 DG  11 11  11  DG  DG  B . n 
B 2 12 DT  12 12  12  DT  DT  B . n 
B 2 13 DC  13 13  13  DC  DC  B . n 
B 2 14 DG  14 14  14  DG  DG  B . n 
C 2 1  DC  1  1   1   DC  DC  C . n 
C 2 2  DG  2  2   2   DG  DG  C . n 
C 2 3  DA  3  3   3   DA  DA  C . n 
C 2 4  DC  4  4   4   DC  DC  C . n 
C 2 5  DT  5  5   5   DT  DT  C . n 
C 2 6  DA  6  6   6   DA  DA  C . n 
C 2 7  DA  7  7   7   DA  DA  C . n 
C 2 8  DT  8  8   8   DT  DT  C . n 
C 2 9  DT  9  9   9   DT  DT  C . n 
C 2 10 DA  10 10  10  DA  DA  C . n 
C 2 11 DG  11 11  11  DG  DG  C . n 
C 2 12 DT  12 12  12  DT  DT  C . n 
C 2 13 DC  13 13  13  DC  DC  C . n 
C 2 14 DG  14 14  14  DG  DG  C . n 
D 1 1  GLY 1  0   ?   ?   ?   D . n 
D 1 2  HIS 2  135 ?   ?   ?   D . n 
D 1 3  MET 3  136 ?   ?   ?   D . n 
D 1 4  VAL 4  137 137 VAL VAL D . n 
D 1 5  ARG 5  138 138 ARG ARG D . n 
D 1 6  LYS 6  139 139 LYS LYS D . n 
D 1 7  PRO 7  140 140 PRO PRO D . n 
D 1 8  ARG 8  141 141 ARG ARG D . n 
D 1 9  THR 9  142 142 THR THR D . n 
D 1 10 ILE 10 143 143 ILE ILE D . n 
D 1 11 TYR 11 144 144 TYR TYR D . n 
D 1 12 SER 12 145 145 SER SER D . n 
D 1 13 SER 13 146 146 SER SER D . n 
D 1 14 PHE 14 147 147 PHE PHE D . n 
D 1 15 GLN 15 148 148 GLN GLN D . n 
D 1 16 LEU 16 149 149 LEU LEU D . n 
D 1 17 ALA 17 150 150 ALA ALA D . n 
D 1 18 ALA 18 151 151 ALA ALA D . n 
D 1 19 LEU 19 152 152 LEU LEU D . n 
D 1 20 GLN 20 153 153 GLN GLN D . n 
D 1 21 ARG 21 154 154 ARG ARG D . n 
D 1 22 ARG 22 155 155 ARG ARG D . n 
D 1 23 PHE 23 156 156 PHE PHE D . n 
D 1 24 GLN 24 157 157 GLN GLN D . n 
D 1 25 LYS 25 158 158 LYS LYS D . n 
D 1 26 THR 26 159 159 THR THR D . n 
D 1 27 GLN 27 160 160 GLN GLN D . n 
D 1 28 TYR 28 161 161 TYR TYR D . n 
D 1 29 LEU 29 162 162 LEU LEU D . n 
D 1 30 ALA 30 163 163 ALA ALA D . n 
D 1 31 LEU 31 164 164 LEU LEU D . n 
D 1 32 PRO 32 165 165 PRO PRO D . n 
D 1 33 GLU 33 166 166 GLU GLU D . n 
D 1 34 ARG 34 167 167 ARG ARG D . n 
D 1 35 ALA 35 168 168 ALA ALA D . n 
D 1 36 GLU 36 169 169 GLU GLU D . n 
D 1 37 LEU 37 170 170 LEU LEU D . n 
D 1 38 ALA 38 171 171 ALA ALA D . n 
D 1 39 ALA 39 172 172 ALA ALA D . n 
D 1 40 SER 40 173 173 SER SER D . n 
D 1 41 LEU 41 174 174 LEU LEU D . n 
D 1 42 GLY 42 175 175 GLY GLY D . n 
D 1 43 LEU 43 176 176 LEU LEU D . n 
D 1 44 THR 44 177 177 THR THR D . n 
D 1 45 GLN 45 178 178 GLN GLN D . n 
D 1 46 THR 46 179 179 THR THR D . n 
D 1 47 GLN 47 180 180 GLN GLN D . n 
D 1 48 VAL 48 181 181 VAL VAL D . n 
D 1 49 LYS 49 182 182 LYS LYS D . n 
D 1 50 ILE 50 183 183 ILE ILE D . n 
D 1 51 TRP 51 184 184 TRP TRP D . n 
D 1 52 PHE 52 185 185 PHE PHE D . n 
D 1 53 GLN 53 186 186 GLN GLN D . n 
D 1 54 ASN 54 187 187 ASN ASN D . n 
D 1 55 LYS 55 188 188 LYS LYS D . n 
D 1 56 ARG 56 189 189 ARG ARG D . n 
D 1 57 SER 57 190 190 SER SER D . n 
D 1 58 LYS 58 191 191 LYS LYS D . n 
D 1 59 ILE 59 192 192 ILE ILE D . n 
D 1 60 LYS 60 193 193 LYS LYS D . n 
D 1 61 LYS 61 194 194 LYS LYS D . n 
D 1 62 ILE 62 195 195 ILE ILE D . n 
D 1 63 MET 63 196 196 MET MET D . n 
D 1 64 LYS 64 197 197 LYS LYS D . n 
D 1 65 ASN 65 198 198 ASN ASN D . n 
E 2 1  DC  1  1   1   DC  DC  E . n 
E 2 2  DG  2  2   2   DG  DG  E . n 
E 2 3  DA  3  3   3   DA  DA  E . n 
E 2 4  DC  4  4   4   DC  DC  E . n 
E 2 5  DT  5  5   5   DT  DT  E . n 
E 2 6  DA  6  6   6   DA  DA  E . n 
E 2 7  DA  7  7   7   DA  DA  E . n 
E 2 8  DT  8  8   8   DT  DT  E . n 
E 2 9  DT  9  9   9   DT  DT  E . n 
E 2 10 DA  10 10  10  DA  DA  E . n 
E 2 11 DG  11 11  11  DG  DG  E . n 
E 2 12 DT  12 12  12  DT  DT  E . n 
E 2 13 DC  13 13  13  DC  DC  E . n 
E 2 14 DG  14 14  14  DG  DG  E . n 
F 2 1  DC  1  1   1   DC  DC  F . n 
F 2 2  DG  2  2   2   DG  DG  F . n 
F 2 3  DA  3  3   3   DA  DA  F . n 
F 2 4  DC  4  4   4   DC  DC  F . n 
F 2 5  DT  5  5   5   DT  DT  F . n 
F 2 6  DA  6  6   6   DA  DA  F . n 
F 2 7  DA  7  7   7   DA  DA  F . n 
F 2 8  DT  8  8   8   DT  DT  F . n 
F 2 9  DT  9  9   9   DT  DT  F . n 
F 2 10 DA  10 10  10  DA  DA  F . n 
F 2 11 DG  11 11  11  DG  DG  F . n 
F 2 12 DT  12 12  12  DT  DT  F . n 
F 2 13 DC  13 13  13  DC  DC  F . n 
F 2 14 DG  14 14  ?   ?   ?   F . n 
# 
loop_
_pdbx_SG_project.project_name 
_pdbx_SG_project.full_name_of_center 
_pdbx_SG_project.id 
_pdbx_SG_project.initial_of_center 
PSI:Biology 'Joint Center for Structural Genomics' 1 JCSG     
PSI:Biology 'Partnership for Stem Cell Biology'    2 STEMCELL 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,G,H,I 
2 1 D,E,F,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3310 ? 
1 MORE         -17  ? 
1 'SSA (A^2)'  8020 ? 
2 'ABSA (A^2)' 3100 ? 
2 MORE         -16  ? 
2 'SSA (A^2)'  8010 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2014-11-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 43.5709 18.6864 64.8952 0.0661 0.2269 0.0670 0.0266  -0.0565 -0.0080 2.2604 1.7535 1.5004 -0.2119 
-0.3260 -0.1581 -0.0456 0.0240  0.0215  -0.0001 0.1175  0.0004  0.1013  -0.1491 0.0356  
'X-RAY DIFFRACTION' 2 ? refined 47.0531 18.3199 53.3141 0.1109 0.3359 0.1155 0.0242  -0.0739 -0.0032 1.4100 6.7192 3.1087 0.4243  
-0.9798 -1.0038 -0.0893 0.0728  0.0164  0.0722  0.0750  0.0460  -0.4759 0.0542  -0.0889 
'X-RAY DIFFRACTION' 3 ? refined 48.6210 16.1753 52.5788 0.0888 0.3008 0.0782 0.0292  -0.0227 0.0221  2.4302 7.8270 3.6764 0.4885  
-0.0219 1.2875  -0.0845 0.0446  0.0399  0.1058  -0.1050 -0.4550 -0.3058 0.1033  0.1779  
'X-RAY DIFFRACTION' 4 ? refined 45.0864 1.1239  76.8714 0.1259 0.2034 0.0413 0.0372  -0.0672 -0.0046 2.5654 2.8222 2.7639 0.1825  
0.1324  0.2273  0.0777  -0.0356 -0.0421 -0.0157 -0.0653 -0.0668 0.2301  0.2059  0.0216  
'X-RAY DIFFRACTION' 5 ? refined 40.1001 3.2042  88.1196 0.2473 0.1712 0.0198 -0.0043 0.0050  -0.0164 5.5024 8.7214 3.0855 2.9492  
0.0154  0.2655  0.2491  -0.2764 0.0273  -0.1552 -0.2222 0.1367  0.7125  0.4237  -0.2555 
'X-RAY DIFFRACTION' 6 ? refined 38.4843 5.0608  89.0283 0.2296 0.2456 0.0974 -0.0046 0.0095  -0.0303 3.6647 5.0134 3.2435 0.5540  
0.2111  -0.0515 0.1789  -0.2378 0.0589  -0.3262 0.0116  0.5197  0.7119  0.1669  -0.2804 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 138 A 198 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 1   B 14  ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 C 1   C 14  ? . . . . ? 
'X-RAY DIFFRACTION' 4 4 D 137 D 198 ? . . . . ? 
'X-RAY DIFFRACTION' 5 5 E 1   E 14  ? . . . . ? 
'X-RAY DIFFRACTION' 6 6 F 1   F 13  ? . . . . ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 MOLPROBITY  3beta29  ?               package 'D.C. & J.S. Richardson lab' molprobity@kinemage.biochem.duke.edu validation        
http://kinemage.biochem.duke.edu/molprobity/ ?          ? 
2 PDB_EXTRACT 3.10     'June 10, 2010' package PDB                          deposit@deposit.rcsb.org             'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
3 PHASER      2.3.0    ?               program 'Randy J. Read'              cimr-phaser@lists.cam.ac.uk          phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 SCALA       3.3.20   ?               package 'Phil Evans'                 pre@mrc-lmb.cam.ac.uk                'data scaling'    
?                                            ?          ? 
5 REFMAC      5.7.0029 ?               program 'Garib N. Murshudov'         garib@ysbl.york.ac.uk                refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
6 MOSFLM      .        ?               ?       ?                            ?                                    'data reduction'  
?                                            ?          ? 
# 
_pdbx_entry_details.entry_id             4RDU 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;THE CONSTRUCT (135-198) WAS EXPRESSED WITH A PURIFICATION TAG MGSDKIHHHHHHENLYFQG. THE TAG WAS REMOVED WITH TEV PROTEASE LEAVING ONLY A GLYCINE (0) FOLLOWED BY THE TARGET SEQUENCE. IN THE CONSTRUCT LYS 135 WAS MUTATED TO HIS AND LYS 136 WAS MUTATED TO MET.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    271 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    113 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE    A ARG 189 ? ? CZ    A ARG 189 ? ? NH2   A ARG 189 ? ? 116.95 120.30 -3.35 0.50 N 
2 1 "C5'" C DC  1   ? ? "C4'" C DC  1   ? ? "C3'" C DC  1   ? ? 123.25 115.70 7.55  1.20 N 
3 1 "C5'" C DC  1   ? ? "C4'" C DC  1   ? ? "O4'" C DC  1   ? ? 119.53 109.80 9.73  1.10 N 
4 1 NE    D ARG 154 ? ? CZ    D ARG 154 ? ? NH1   D ARG 154 ? ? 123.38 120.30 3.08  0.50 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 154 ? CD  ? A ARG 21 CD  
2  1 Y 1 A ARG 154 ? NE  ? A ARG 21 NE  
3  1 Y 1 A ARG 154 ? CZ  ? A ARG 21 CZ  
4  1 Y 1 A ARG 154 ? NH1 ? A ARG 21 NH1 
5  1 Y 1 A ARG 154 ? NH2 ? A ARG 21 NH2 
6  1 Y 1 A LYS 193 ? CE  ? A LYS 60 CE  
7  1 Y 1 A LYS 193 ? NZ  ? A LYS 60 NZ  
8  1 Y 1 D VAL 137 ? CG1 ? D VAL 4  CG1 
9  1 Y 1 D VAL 137 ? CG2 ? D VAL 4  CG2 
10 1 Y 1 D LYS 193 ? CD  ? D LYS 60 CD  
11 1 Y 1 D LYS 193 ? CE  ? D LYS 60 CE  
12 1 Y 1 D LYS 193 ? NZ  ? D LYS 60 NZ  
13 1 Y 1 D LYS 197 ? CG  ? D LYS 64 CG  
14 1 Y 1 D LYS 197 ? CD  ? D LYS 64 CD  
15 1 Y 1 D LYS 197 ? CE  ? D LYS 64 CE  
16 1 Y 1 D LYS 197 ? NZ  ? D LYS 64 NZ  
17 1 Y 1 D ASN 198 ? CG  ? D ASN 65 CG  
18 1 Y 1 D ASN 198 ? OD1 ? D ASN 65 OD1 
19 1 Y 1 D ASN 198 ? ND2 ? D ASN 65 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 0   ? A GLY 1  
2 1 Y 1 A HIS 135 ? A HIS 2  
3 1 Y 1 A MET 136 ? A MET 3  
4 1 Y 1 A VAL 137 ? A VAL 4  
5 1 Y 1 D GLY 0   ? D GLY 1  
6 1 Y 1 D HIS 135 ? D HIS 2  
7 1 Y 1 D MET 136 ? D MET 3  
8 1 Y 1 F DG  14  ? F DG  14 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4RDU 'double helix'        
4RDU 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 2  1_555 C DC 13 1_555 -0.362 -0.241 -0.190 7.868   -0.065  -0.137  1  B_DG2:DC13_C B 2  ? C 13 ? 19 1 
1 B DA 3  1_555 C DT 12 1_555 -0.048 -0.120 0.271  3.022   -13.654 -1.542  2  B_DA3:DT12_C B 3  ? C 12 ? 20 1 
1 B DC 4  1_555 C DG 11 1_555 0.130  -0.213 0.461  1.157   -15.114 -1.185  3  B_DC4:DG11_C B 4  ? C 11 ? 19 1 
1 B DT 5  1_555 C DA 10 1_555 -0.078 -0.117 0.086  -3.170  -12.692 2.980   4  B_DT5:DA10_C B 5  ? C 10 ? 20 1 
1 B DA 6  1_555 C DT 9  1_555 0.054  -0.097 -0.162 7.465   -9.803  4.793   5  B_DA6:DT9_C  B 6  ? C 9  ? 20 1 
1 B DA 7  1_555 C DT 8  1_555 0.050  -0.174 0.092  7.589   -14.117 3.250   6  B_DA7:DT8_C  B 7  ? C 8  ? 20 1 
1 B DT 8  1_555 C DA 7  1_555 0.067  -0.043 0.000  4.404   -14.580 6.649   7  B_DT8:DA7_C  B 8  ? C 7  ? 20 1 
1 B DT 9  1_555 C DA 6  1_555 -0.070 -0.123 -0.341 3.370   -15.084 4.027   8  B_DT9:DA6_C  B 9  ? C 6  ? 20 1 
1 B DA 10 1_555 C DT 5  1_555 -0.045 -0.190 -0.231 -7.868  -7.934  5.037   9  B_DA10:DT5_C B 10 ? C 5  ? 20 1 
1 B DG 11 1_555 C DC 4  1_555 -0.327 -0.219 -0.027 -10.015 -7.467  0.329   10 B_DG11:DC4_C B 11 ? C 4  ? 19 1 
1 B DT 12 1_555 C DA 3  1_555 0.114  -0.037 0.122  -7.766  -7.203  -0.880  11 B_DT12:DA3_C B 12 ? C 3  ? 20 1 
1 B DC 13 1_555 C DG 2  1_555 0.415  -0.152 -0.103 3.860   -4.931  2.401   12 B_DC13:DG2_C B 13 ? C 2  ? 19 1 
1 B DG 14 1_555 C DC 1  1_555 0.192  -0.139 0.473  7.643   -16.037 -7.425  13 B_DG14:DC1_C B 14 ? C 1  ? 19 1 
1 E DG 2  1_555 F DC 13 1_555 -0.414 0.205  -0.082 6.232   -2.407  5.895   14 E_DG2:DC13_F E 2  ? F 13 ? 19 1 
1 E DA 3  1_555 F DT 12 1_555 0.441  0.023  0.096  10.331  -13.373 0.932   15 E_DA3:DT12_F E 3  ? F 12 ? 20 1 
1 E DC 4  1_555 F DG 11 1_555 0.058  -0.080 0.145  4.824   -18.090 5.351   16 E_DC4:DG11_F E 4  ? F 11 ? 19 1 
1 E DT 5  1_555 F DA 10 1_555 0.220  -0.359 0.124  3.650   -6.665  1.723   17 E_DT5:DA10_F E 5  ? F 10 ? 20 1 
1 E DA 6  1_555 F DT 9  1_555 -0.199 -0.136 0.004  6.120   -14.221 3.500   18 E_DA6:DT9_F  E 6  ? F 9  ? 20 1 
1 E DA 7  1_555 F DT 8  1_555 -0.130 -0.040 0.134  3.015   -14.700 1.219   19 E_DA7:DT8_F  E 7  ? F 8  ? 20 1 
1 E DT 8  1_555 F DA 7  1_555 -0.073 -0.078 0.298  1.012   -16.242 6.029   20 E_DT8:DA7_F  E 8  ? F 7  ? 20 1 
1 E DT 9  1_555 F DA 6  1_555 -0.099 -0.079 -0.071 -0.240  -13.267 2.709   21 E_DT9:DA6_F  E 9  ? F 6  ? 20 1 
1 E DA 10 1_555 F DT 5  1_555 0.096  -0.167 -0.293 -12.526 -6.452  6.245   22 E_DA10:DT5_F E 10 ? F 5  ? 20 1 
1 E DG 11 1_555 F DC 4  1_555 -0.196 -0.122 0.006  -8.620  -5.830  -0.787  23 E_DG11:DC4_F E 11 ? F 4  ? 19 1 
1 E DT 12 1_555 F DA 3  1_555 -0.019 0.042  0.220  -6.150  -6.410  -1.284  24 E_DT12:DA3_F E 12 ? F 3  ? 20 1 
1 E DC 13 1_555 F DG 2  1_555 0.208  -0.073 -0.001 -0.037  -0.931  3.578   25 E_DC13:DG2_F E 13 ? F 2  ? 19 1 
1 E DG 14 1_555 F DC 1  1_555 0.104  -0.131 0.153  4.441   -10.550 -10.064 26 E_DG14:DC1_F E 14 ? F 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 2  1_555 C DC 13 1_555 B DA 3  1_555 C DT 12 1_555 -0.650 -0.249 3.408 -5.834 -2.763 39.346 -0.027 0.239  3.474 -4.070 
8.594   39.851 1  BB_DG2DA3:DT12DC13_CC B 2  ? C 13 ? B 3  ? C 12 ? 
1 B DA 3  1_555 C DT 12 1_555 B DC 4  1_555 C DG 11 1_555 0.492  -1.300 3.298 -2.022 4.748  35.092 -2.816 -1.098 3.069 7.823  
3.331   35.458 2  BB_DA3DC4:DG11DT12_CC B 3  ? C 12 ? B 4  ? C 11 ? 
1 B DC 4  1_555 C DG 11 1_555 B DT 5  1_555 C DA 10 1_555 -0.138 -0.745 3.349 6.234  3.033  32.619 -1.808 1.288  3.189 5.325  
-10.945 33.328 3  BB_DC4DT5:DA10DG11_CC B 4  ? C 11 ? B 5  ? C 10 ? 
1 B DT 5  1_555 C DA 10 1_555 B DA 6  1_555 C DT 9  1_555 -0.298 0.763  3.186 3.216  7.661  33.007 0.085  1.021  3.234 13.224 
-5.551  34.008 4  BB_DT5DA6:DT9DA10_CC  B 5  ? C 10 ? B 6  ? C 9  ? 
1 B DA 6  1_555 C DT 9  1_555 B DA 7  1_555 C DT 8  1_555 0.211  -0.532 3.193 -2.921 2.805  32.628 -1.404 -0.856 3.107 4.969  
5.175   32.871 5  BB_DA6DA7:DT8DT9_CC   B 6  ? C 9  ? B 7  ? C 8  ? 
1 B DA 7  1_555 C DT 8  1_555 B DT 8  1_555 C DA 7  1_555 0.677  -0.921 3.265 1.327  0.417  32.738 -1.704 -0.972 3.278 0.740  
-2.353  32.766 6  BB_DA7DT8:DA7DT8_CC   B 7  ? C 8  ? B 8  ? C 7  ? 
1 B DT 8  1_555 C DA 7  1_555 B DT 9  1_555 C DA 6  1_555 -0.169 -0.353 3.209 4.056  4.811  34.517 -1.287 0.871  3.095 8.026  
-6.765  35.069 7  BB_DT8DT9:DA6DA7_CC   B 8  ? C 7  ? B 9  ? C 6  ? 
1 B DT 9  1_555 C DA 6  1_555 B DA 10 1_555 C DT 5  1_555 1.201  0.635  3.521 3.209  8.456  38.436 -0.170 -1.358 3.659 12.632 
-4.794  39.446 8  BB_DT9DA10:DT5DA6_CC  B 9  ? C 6  ? B 10 ? C 5  ? 
1 B DA 10 1_555 C DT 5  1_555 B DG 11 1_555 C DC 4  1_555 -1.345 -0.005 3.283 -7.626 8.615  33.105 -1.373 1.028  3.395 14.582 
12.908  34.995 9  BB_DA10DG11:DC4DT5_CC B 10 ? C 5  ? B 11 ? C 4  ? 
1 B DG 11 1_555 C DC 4  1_555 B DT 12 1_555 C DA 3  1_555 -0.806 -0.721 3.256 0.301  0.269  34.901 -1.242 1.390  3.244 0.448  
-0.502  34.904 10 BB_DG11DT12:DA3DC4_CC B 11 ? C 4  ? B 12 ? C 3  ? 
1 B DT 12 1_555 C DA 3  1_555 B DC 13 1_555 C DG 2  1_555 0.983  0.833  3.076 3.737  1.950  35.819 1.080  -1.078 3.198 3.158  
-6.050  36.058 11 BB_DT12DC13:DG2DA3_CC B 12 ? C 3  ? B 13 ? C 2  ? 
1 B DC 13 1_555 C DG 2  1_555 B DG 14 1_555 C DC 1  1_555 -0.952 0.807  3.213 -4.879 2.783  38.250 0.874  0.832  3.353 4.220  
7.396   38.645 12 BB_DC13DG14:DC1DG2_CC B 13 ? C 2  ? B 14 ? C 1  ? 
1 E DG 2  1_555 F DC 13 1_555 E DA 3  1_555 F DT 12 1_555 -0.533 0.327  3.239 -3.335 0.213  41.632 0.436  0.399  3.271 0.298  
4.683   41.760 13 EE_DG2DA3:DT12DC13_FF E 2  ? F 13 ? E 3  ? F 12 ? 
1 E DA 3  1_555 F DT 12 1_555 E DC 4  1_555 F DG 11 1_555 0.649  -0.943 3.394 -0.487 -2.308 29.059 -1.346 -1.400 3.445 -4.591 
0.969   29.153 14 EE_DA3DC4:DG11DT12_FF E 3  ? F 12 ? E 4  ? F 11 ? 
1 E DC 4  1_555 F DG 11 1_555 E DT 5  1_555 F DA 10 1_555 -0.266 -0.560 3.297 1.718  4.773  35.201 -1.610 0.685  3.180 7.842  
-2.822  35.553 15 EE_DC4DT5:DA10DG11_FF E 4  ? F 11 ? E 5  ? F 10 ? 
1 E DT 5  1_555 F DA 10 1_555 E DA 6  1_555 F DT 9  1_555 0.078  0.258  3.221 2.984  5.529  33.868 -0.419 0.329  3.217 9.391  
-5.068  34.429 16 EE_DT5DA6:DT9DA10_FF  E 5  ? F 10 ? E 6  ? F 9  ? 
1 E DA 6  1_555 F DT 9  1_555 E DA 7  1_555 F DT 8  1_555 0.132  -0.447 3.239 -2.807 1.973  33.462 -1.091 -0.679 3.187 3.415  
4.860   33.632 17 EE_DA6DA7:DT8DT9_FF   E 6  ? F 9  ? E 7  ? F 8  ? 
1 E DA 7  1_555 F DT 8  1_555 E DT 8  1_555 F DA 7  1_555 0.516  -0.911 3.281 -0.172 -0.844 33.917 -1.426 -0.911 3.299 -1.447 
0.295   33.928 18 EE_DA7DT8:DA7DT8_FF   E 7  ? F 8  ? E 8  ? F 7  ? 
1 E DT 8  1_555 F DA 7  1_555 E DT 9  1_555 F DA 6  1_555 -0.213 -0.291 3.183 2.929  -0.011 35.510 -0.474 0.762  3.156 -0.018 
-4.793  35.626 19 EE_DT8DT9:DA6DA7_FF   E 8  ? F 7  ? E 9  ? F 6  ? 
1 E DT 9  1_555 F DA 6  1_555 E DA 10 1_555 F DT 5  1_555 1.330  0.621  3.596 5.906  6.561  40.297 0.073  -1.161 3.797 9.388  
-8.450  41.213 20 EE_DT9DA10:DT5DA6_FF  E 9  ? F 6  ? E 10 ? F 5  ? 
1 E DA 10 1_555 F DT 5  1_555 E DG 11 1_555 F DC 4  1_555 -1.578 0.196  3.105 -7.674 7.135  33.490 -0.757 1.457  3.345 12.022 
12.929  35.046 21 EE_DA10DG11:DC4DT5_FF E 10 ? F 5  ? E 11 ? F 4  ? 
1 E DG 11 1_555 F DC 4  1_555 E DT 12 1_555 F DA 3  1_555 -0.798 -0.671 3.209 -1.658 -1.234 33.906 -0.954 1.104  3.265 -2.113 
2.841   33.967 22 EE_DG11DT12:DA3DC4_FF E 11 ? F 4  ? E 12 ? F 3  ? 
1 E DT 12 1_555 F DA 3  1_555 E DC 13 1_555 F DG 2  1_555 1.233  0.662  3.183 3.161  2.353  36.195 0.734  -1.536 3.311 3.773  
-5.070  36.401 23 EE_DT12DC13:DG2DA3_FF E 12 ? F 3  ? E 13 ? F 2  ? 
1 E DC 13 1_555 F DG 2  1_555 E DG 14 1_555 F DC 1  1_555 -1.470 0.714  3.267 -3.537 1.093  34.771 1.020  1.900  3.416 1.822  
5.898   34.962 24 EE_DC13DG14:DC1DG2_FF E 13 ? F 2  ? E 14 ? F 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 HOH 1   201 205 HOH HOH A . 
G 3 HOH 2   202 211 HOH HOH A . 
G 3 HOH 3   203 215 HOH HOH A . 
G 3 HOH 4   204 219 HOH HOH A . 
G 3 HOH 5   205 222 HOH HOH A . 
G 3 HOH 6   206 228 HOH HOH A . 
G 3 HOH 7   207 231 HOH HOH A . 
G 3 HOH 8   208 239 HOH HOH A . 
G 3 HOH 9   209 240 HOH HOH A . 
G 3 HOH 10  210 241 HOH HOH A . 
G 3 HOH 11  211 244 HOH HOH A . 
G 3 HOH 12  212 246 HOH HOH A . 
G 3 HOH 13  213 247 HOH HOH A . 
G 3 HOH 14  214 249 HOH HOH A . 
G 3 HOH 15  215 252 HOH HOH A . 
G 3 HOH 16  216 253 HOH HOH A . 
G 3 HOH 17  217 255 HOH HOH A . 
G 3 HOH 18  218 257 HOH HOH A . 
G 3 HOH 19  219 271 HOH HOH A . 
G 3 HOH 20  220 273 HOH HOH A . 
G 3 HOH 21  221 281 HOH HOH A . 
G 3 HOH 22  222 284 HOH HOH A . 
G 3 HOH 23  223 286 HOH HOH A . 
G 3 HOH 24  224 287 HOH HOH A . 
G 3 HOH 25  225 288 HOH HOH A . 
G 3 HOH 26  226 296 HOH HOH A . 
G 3 HOH 27  227 297 HOH HOH A . 
G 3 HOH 28  228 299 HOH HOH A . 
G 3 HOH 29  229 301 HOH HOH A . 
G 3 HOH 30  230 303 HOH HOH A . 
G 3 HOH 31  231 305 HOH HOH A . 
G 3 HOH 32  232 310 HOH HOH A . 
G 3 HOH 33  233 312 HOH HOH A . 
G 3 HOH 34  234 313 HOH HOH A . 
G 3 HOH 35  235 316 HOH HOH A . 
G 3 HOH 36  236 320 HOH HOH A . 
G 3 HOH 37  237 321 HOH HOH A . 
G 3 HOH 38  238 323 HOH HOH A . 
G 3 HOH 39  239 324 HOH HOH A . 
G 3 HOH 40  240 325 HOH HOH A . 
G 3 HOH 41  241 326 HOH HOH A . 
G 3 HOH 42  242 327 HOH HOH A . 
G 3 HOH 43  243 328 HOH HOH A . 
G 3 HOH 44  244 329 HOH HOH A . 
G 3 HOH 45  245 330 HOH HOH A . 
G 3 HOH 46  246 331 HOH HOH A . 
G 3 HOH 47  247 332 HOH HOH A . 
G 3 HOH 48  248 333 HOH HOH A . 
G 3 HOH 49  249 334 HOH HOH A . 
G 3 HOH 50  250 335 HOH HOH A . 
G 3 HOH 51  251 336 HOH HOH A . 
G 3 HOH 52  252 337 HOH HOH A . 
G 3 HOH 53  253 342 HOH HOH A . 
G 3 HOH 54  254 343 HOH HOH A . 
G 3 HOH 55  255 344 HOH HOH A . 
G 3 HOH 56  256 346 HOH HOH A . 
G 3 HOH 57  257 347 HOH HOH A . 
G 3 HOH 58  258 348 HOH HOH A . 
G 3 HOH 59  259 349 HOH HOH A . 
G 3 HOH 60  260 350 HOH HOH A . 
G 3 HOH 61  261 351 HOH HOH A . 
G 3 HOH 62  262 353 HOH HOH A . 
G 3 HOH 63  263 355 HOH HOH A . 
G 3 HOH 64  264 356 HOH HOH A . 
G 3 HOH 65  265 359 HOH HOH A . 
G 3 HOH 66  266 360 HOH HOH A . 
G 3 HOH 67  267 362 HOH HOH A . 
G 3 HOH 68  268 367 HOH HOH A . 
G 3 HOH 69  269 370 HOH HOH A . 
G 3 HOH 70  270 372 HOH HOH A . 
G 3 HOH 71  271 376 HOH HOH A . 
G 3 HOH 72  272 378 HOH HOH A . 
G 3 HOH 73  273 379 HOH HOH A . 
G 3 HOH 74  274 383 HOH HOH A . 
G 3 HOH 75  275 384 HOH HOH A . 
G 3 HOH 76  276 385 HOH HOH A . 
G 3 HOH 77  277 386 HOH HOH A . 
G 3 HOH 78  278 387 HOH HOH A . 
G 3 HOH 79  279 388 HOH HOH A . 
G 3 HOH 80  280 389 HOH HOH A . 
G 3 HOH 81  281 390 HOH HOH A . 
G 3 HOH 82  282 396 HOH HOH A . 
G 3 HOH 83  283 397 HOH HOH A . 
G 3 HOH 84  284 404 HOH HOH A . 
G 3 HOH 85  285 405 HOH HOH A . 
G 3 HOH 86  286 406 HOH HOH A . 
G 3 HOH 87  287 407 HOH HOH A . 
G 3 HOH 88  288 408 HOH HOH A . 
G 3 HOH 89  289 409 HOH HOH A . 
G 3 HOH 90  290 410 HOH HOH A . 
G 3 HOH 91  291 412 HOH HOH A . 
G 3 HOH 92  292 413 HOH HOH A . 
G 3 HOH 93  293 415 HOH HOH A . 
G 3 HOH 94  294 417 HOH HOH A . 
G 3 HOH 95  295 425 HOH HOH A . 
G 3 HOH 96  296 428 HOH HOH A . 
G 3 HOH 97  297 429 HOH HOH A . 
G 3 HOH 98  298 430 HOH HOH A . 
G 3 HOH 99  299 212 HOH HOH A . 
G 3 HOH 100 300 216 HOH HOH A . 
G 3 HOH 101 301 214 HOH HOH A . 
H 3 HOH 1   101 203 HOH HOH B . 
H 3 HOH 2   102 204 HOH HOH B . 
H 3 HOH 3   103 208 HOH HOH B . 
H 3 HOH 4   104 217 HOH HOH B . 
H 3 HOH 5   105 225 HOH HOH B . 
H 3 HOH 6   106 227 HOH HOH B . 
H 3 HOH 7   107 229 HOH HOH B . 
H 3 HOH 8   108 232 HOH HOH B . 
H 3 HOH 9   109 234 HOH HOH B . 
H 3 HOH 10  110 242 HOH HOH B . 
H 3 HOH 11  111 258 HOH HOH B . 
H 3 HOH 12  112 266 HOH HOH B . 
H 3 HOH 13  113 280 HOH HOH B . 
H 3 HOH 14  114 298 HOH HOH B . 
H 3 HOH 15  115 307 HOH HOH B . 
H 3 HOH 16  116 314 HOH HOH B . 
H 3 HOH 17  117 357 HOH HOH B . 
H 3 HOH 18  118 358 HOH HOH B . 
H 3 HOH 19  119 363 HOH HOH B . 
H 3 HOH 20  120 368 HOH HOH B . 
H 3 HOH 21  121 369 HOH HOH B . 
H 3 HOH 22  122 391 HOH HOH B . 
H 3 HOH 23  123 392 HOH HOH B . 
H 3 HOH 24  124 393 HOH HOH B . 
H 3 HOH 25  125 394 HOH HOH B . 
H 3 HOH 26  126 395 HOH HOH B . 
H 3 HOH 27  127 402 HOH HOH B . 
H 3 HOH 28  128 411 HOH HOH B . 
H 3 HOH 29  129 419 HOH HOH B . 
H 3 HOH 30  130 420 HOH HOH B . 
H 3 HOH 31  131 421 HOH HOH B . 
H 3 HOH 32  132 422 HOH HOH B . 
H 3 HOH 33  133 423 HOH HOH B . 
H 3 HOH 34  134 424 HOH HOH B . 
H 3 HOH 35  135 426 HOH HOH B . 
I 3 HOH 1   101 199 HOH HOH C . 
I 3 HOH 2   102 201 HOH HOH C . 
I 3 HOH 3   103 206 HOH HOH C . 
I 3 HOH 4   104 209 HOH HOH C . 
I 3 HOH 5   105 210 HOH HOH C . 
I 3 HOH 6   106 218 HOH HOH C . 
I 3 HOH 7   107 226 HOH HOH C . 
I 3 HOH 8   108 243 HOH HOH C . 
I 3 HOH 9   109 254 HOH HOH C . 
I 3 HOH 10  110 260 HOH HOH C . 
I 3 HOH 11  111 261 HOH HOH C . 
I 3 HOH 12  112 264 HOH HOH C . 
I 3 HOH 13  113 265 HOH HOH C . 
I 3 HOH 14  114 269 HOH HOH C . 
I 3 HOH 15  115 270 HOH HOH C . 
I 3 HOH 16  116 291 HOH HOH C . 
I 3 HOH 17  117 294 HOH HOH C . 
I 3 HOH 18  118 302 HOH HOH C . 
I 3 HOH 19  119 306 HOH HOH C . 
I 3 HOH 20  120 315 HOH HOH C . 
I 3 HOH 21  121 361 HOH HOH C . 
I 3 HOH 22  122 373 HOH HOH C . 
I 3 HOH 23  123 374 HOH HOH C . 
I 3 HOH 24  124 377 HOH HOH C . 
I 3 HOH 25  125 382 HOH HOH C . 
I 3 HOH 26  126 403 HOH HOH C . 
I 3 HOH 27  127 416 HOH HOH C . 
I 3 HOH 28  128 431 HOH HOH C . 
J 3 HOH 1   201 202 HOH HOH D . 
J 3 HOH 2   202 221 HOH HOH D . 
J 3 HOH 3   203 223 HOH HOH D . 
J 3 HOH 4   204 230 HOH HOH D . 
J 3 HOH 5   205 233 HOH HOH D . 
J 3 HOH 6   206 235 HOH HOH D . 
J 3 HOH 7   207 238 HOH HOH D . 
J 3 HOH 8   208 245 HOH HOH D . 
J 3 HOH 9   209 248 HOH HOH D . 
J 3 HOH 10  210 251 HOH HOH D . 
J 3 HOH 11  211 256 HOH HOH D . 
J 3 HOH 12  212 259 HOH HOH D . 
J 3 HOH 13  213 262 HOH HOH D . 
J 3 HOH 14  214 268 HOH HOH D . 
J 3 HOH 15  215 272 HOH HOH D . 
J 3 HOH 16  216 274 HOH HOH D . 
J 3 HOH 17  217 275 HOH HOH D . 
J 3 HOH 18  218 276 HOH HOH D . 
J 3 HOH 19  219 277 HOH HOH D . 
J 3 HOH 20  220 278 HOH HOH D . 
J 3 HOH 21  221 282 HOH HOH D . 
J 3 HOH 22  222 283 HOH HOH D . 
J 3 HOH 23  223 289 HOH HOH D . 
J 3 HOH 24  224 292 HOH HOH D . 
J 3 HOH 25  225 293 HOH HOH D . 
J 3 HOH 26  226 295 HOH HOH D . 
J 3 HOH 27  227 300 HOH HOH D . 
J 3 HOH 28  228 304 HOH HOH D . 
J 3 HOH 29  229 308 HOH HOH D . 
J 3 HOH 30  230 318 HOH HOH D . 
J 3 HOH 31  231 338 HOH HOH D . 
J 3 HOH 32  232 345 HOH HOH D . 
J 3 HOH 33  233 352 HOH HOH D . 
J 3 HOH 34  234 354 HOH HOH D . 
J 3 HOH 35  235 364 HOH HOH D . 
J 3 HOH 36  236 365 HOH HOH D . 
J 3 HOH 37  237 375 HOH HOH D . 
J 3 HOH 38  238 380 HOH HOH D . 
J 3 HOH 39  239 381 HOH HOH D . 
J 3 HOH 40  240 398 HOH HOH D . 
J 3 HOH 41  241 399 HOH HOH D . 
J 3 HOH 42  242 401 HOH HOH D . 
J 3 HOH 43  243 414 HOH HOH D . 
J 3 HOH 44  244 418 HOH HOH D . 
K 3 HOH 1   101 250 HOH HOH E . 
K 3 HOH 2   102 267 HOH HOH E . 
K 3 HOH 3   103 279 HOH HOH E . 
K 3 HOH 4   104 290 HOH HOH E . 
K 3 HOH 5   105 309 HOH HOH E . 
K 3 HOH 6   106 319 HOH HOH E . 
K 3 HOH 7   107 366 HOH HOH E . 
K 3 HOH 8   108 371 HOH HOH E . 
K 3 HOH 9   109 400 HOH HOH E . 
L 3 HOH 1   101 200 HOH HOH F . 
L 3 HOH 2   102 207 HOH HOH F . 
L 3 HOH 3   103 213 HOH HOH F . 
L 3 HOH 4   104 220 HOH HOH F . 
L 3 HOH 5   105 224 HOH HOH F . 
L 3 HOH 6   106 236 HOH HOH F . 
L 3 HOH 7   107 237 HOH HOH F . 
L 3 HOH 8   108 263 HOH HOH F . 
L 3 HOH 9   109 285 HOH HOH F . 
L 3 HOH 10  110 311 HOH HOH F . 
L 3 HOH 11  111 317 HOH HOH F . 
L 3 HOH 12  112 322 HOH HOH F . 
L 3 HOH 13  113 339 HOH HOH F . 
L 3 HOH 14  114 340 HOH HOH F . 
L 3 HOH 15  115 341 HOH HOH F . 
L 3 HOH 16  116 427 HOH HOH F . 
#