data_4RG7
# 
_entry.id   4RG7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4RG7         
RCSB  RCSB087306   
WWPDB D_1000087306 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4RG6 . unspecified 
PDB 4RG9 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4RG7 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yamaguchi, M.'  1 
'Yu, S.'         2 
'Miller, D.J.'   3 
'Schulman, B.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Structure of an APC3-APC16 Complex: Insights into Assembly of the Anaphase-Promoting Complex/Cyclosome.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            427 
_citation.page_first                1748 
_citation.page_last                 1764 
_citation.year                      2015 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25490258 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2014.11.020 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yamaguchi, M.'    1  
primary 'Yu, S.'           2  
primary 'Qiao, R.'         3  
primary 'Weissmann, F.'    4  
primary 'Miller, D.J.'     5  
primary 'VanderLinden, R.' 6  
primary 'Brown, N.G.'      7  
primary 'Frye, J.J.'       8  
primary 'Peters, J.M.'     9  
primary 'Schulman, B.A.'   10 
# 
_cell.entry_id           4RG7 
_cell.length_a           118.408 
_cell.length_b           118.408 
_cell.length_c           273.739 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RG7 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Cell division cycle protein 27 homolog' 
_entity.formula_weight             63892.691 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 1-180, 447-824' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Anaphase-promoting complex subunit 3, APC3, CDC27 homolog, CDC27Hs, H-NUC' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSMTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKC
CVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEI
GEKPDPDQTFKFTSLQNFSNCLPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQ
IGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHD
IAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDI
NPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIG
KVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSMTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKC
CVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEI
GEKPDPDQTFKFTSLQNFSNCLPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQ
IGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHD
IAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDI
NPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIG
KVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   MET n 
1 4   THR n 
1 5   VAL n 
1 6   LEU n 
1 7   GLN n 
1 8   GLU n 
1 9   PRO n 
1 10  VAL n 
1 11  GLN n 
1 12  ALA n 
1 13  ALA n 
1 14  ILE n 
1 15  TRP n 
1 16  GLN n 
1 17  ALA n 
1 18  LEU n 
1 19  ASN n 
1 20  HIS n 
1 21  TYR n 
1 22  ALA n 
1 23  TYR n 
1 24  ARG n 
1 25  ASP n 
1 26  ALA n 
1 27  VAL n 
1 28  PHE n 
1 29  LEU n 
1 30  ALA n 
1 31  GLU n 
1 32  ARG n 
1 33  LEU n 
1 34  TYR n 
1 35  ALA n 
1 36  GLU n 
1 37  VAL n 
1 38  HIS n 
1 39  SER n 
1 40  GLU n 
1 41  GLU n 
1 42  ALA n 
1 43  LEU n 
1 44  PHE n 
1 45  LEU n 
1 46  LEU n 
1 47  ALA n 
1 48  THR n 
1 49  CYS n 
1 50  TYR n 
1 51  TYR n 
1 52  ARG n 
1 53  SER n 
1 54  GLY n 
1 55  LYS n 
1 56  ALA n 
1 57  TYR n 
1 58  LYS n 
1 59  ALA n 
1 60  TYR n 
1 61  ARG n 
1 62  LEU n 
1 63  LEU n 
1 64  LYS n 
1 65  GLY n 
1 66  HIS n 
1 67  SER n 
1 68  CYS n 
1 69  THR n 
1 70  THR n 
1 71  PRO n 
1 72  GLN n 
1 73  CYS n 
1 74  LYS n 
1 75  TYR n 
1 76  LEU n 
1 77  LEU n 
1 78  ALA n 
1 79  LYS n 
1 80  CYS n 
1 81  CYS n 
1 82  VAL n 
1 83  ASP n 
1 84  LEU n 
1 85  SER n 
1 86  LYS n 
1 87  LEU n 
1 88  ALA n 
1 89  GLU n 
1 90  GLY n 
1 91  GLU n 
1 92  GLN n 
1 93  ILE n 
1 94  LEU n 
1 95  SER n 
1 96  GLY n 
1 97  GLY n 
1 98  VAL n 
1 99  PHE n 
1 100 ASN n 
1 101 LYS n 
1 102 GLN n 
1 103 LYS n 
1 104 SER n 
1 105 HIS n 
1 106 ASP n 
1 107 ASP n 
1 108 ILE n 
1 109 VAL n 
1 110 THR n 
1 111 GLU n 
1 112 PHE n 
1 113 GLY n 
1 114 ASP n 
1 115 SER n 
1 116 ALA n 
1 117 CYS n 
1 118 PHE n 
1 119 THR n 
1 120 LEU n 
1 121 SER n 
1 122 LEU n 
1 123 LEU n 
1 124 GLY n 
1 125 HIS n 
1 126 VAL n 
1 127 TYR n 
1 128 CYS n 
1 129 LYS n 
1 130 THR n 
1 131 ASP n 
1 132 ARG n 
1 133 LEU n 
1 134 ALA n 
1 135 LYS n 
1 136 GLY n 
1 137 SER n 
1 138 GLU n 
1 139 CYS n 
1 140 TYR n 
1 141 GLN n 
1 142 LYS n 
1 143 SER n 
1 144 LEU n 
1 145 SER n 
1 146 LEU n 
1 147 ASN n 
1 148 PRO n 
1 149 PHE n 
1 150 LEU n 
1 151 TRP n 
1 152 SER n 
1 153 PRO n 
1 154 PHE n 
1 155 GLU n 
1 156 SER n 
1 157 LEU n 
1 158 CYS n 
1 159 GLU n 
1 160 ILE n 
1 161 GLY n 
1 162 GLU n 
1 163 LYS n 
1 164 PRO n 
1 165 ASP n 
1 166 PRO n 
1 167 ASP n 
1 168 GLN n 
1 169 THR n 
1 170 PHE n 
1 171 LYS n 
1 172 PHE n 
1 173 THR n 
1 174 SER n 
1 175 LEU n 
1 176 GLN n 
1 177 ASN n 
1 178 PHE n 
1 179 SER n 
1 180 ASN n 
1 181 CYS n 
1 182 LEU n 
1 183 PRO n 
1 184 GLN n 
1 185 ILE n 
1 186 GLN n 
1 187 ALA n 
1 188 PHE n 
1 189 ASN n 
1 190 LEU n 
1 191 GLN n 
1 192 LYS n 
1 193 ALA n 
1 194 ALA n 
1 195 ALA n 
1 196 GLU n 
1 197 GLY n 
1 198 LEU n 
1 199 MET n 
1 200 SER n 
1 201 LEU n 
1 202 LEU n 
1 203 ARG n 
1 204 GLU n 
1 205 MET n 
1 206 GLY n 
1 207 LYS n 
1 208 GLY n 
1 209 TYR n 
1 210 LEU n 
1 211 ALA n 
1 212 LEU n 
1 213 CYS n 
1 214 SER n 
1 215 TYR n 
1 216 ASN n 
1 217 CYS n 
1 218 LYS n 
1 219 GLU n 
1 220 ALA n 
1 221 ILE n 
1 222 ASN n 
1 223 ILE n 
1 224 LEU n 
1 225 SER n 
1 226 HIS n 
1 227 LEU n 
1 228 PRO n 
1 229 SER n 
1 230 HIS n 
1 231 HIS n 
1 232 TYR n 
1 233 ASN n 
1 234 THR n 
1 235 GLY n 
1 236 TRP n 
1 237 VAL n 
1 238 LEU n 
1 239 CYS n 
1 240 GLN n 
1 241 ILE n 
1 242 GLY n 
1 243 ARG n 
1 244 ALA n 
1 245 TYR n 
1 246 PHE n 
1 247 GLU n 
1 248 LEU n 
1 249 SER n 
1 250 GLU n 
1 251 TYR n 
1 252 MET n 
1 253 GLN n 
1 254 ALA n 
1 255 GLU n 
1 256 ARG n 
1 257 ILE n 
1 258 PHE n 
1 259 SER n 
1 260 GLU n 
1 261 VAL n 
1 262 ARG n 
1 263 ARG n 
1 264 ILE n 
1 265 GLU n 
1 266 ASN n 
1 267 TYR n 
1 268 ARG n 
1 269 VAL n 
1 270 GLU n 
1 271 GLY n 
1 272 MET n 
1 273 GLU n 
1 274 ILE n 
1 275 TYR n 
1 276 SER n 
1 277 THR n 
1 278 THR n 
1 279 LEU n 
1 280 TRP n 
1 281 HIS n 
1 282 LEU n 
1 283 GLN n 
1 284 LYS n 
1 285 ASP n 
1 286 VAL n 
1 287 ALA n 
1 288 LEU n 
1 289 SER n 
1 290 VAL n 
1 291 LEU n 
1 292 SER n 
1 293 LYS n 
1 294 ASP n 
1 295 LEU n 
1 296 THR n 
1 297 ASP n 
1 298 MET n 
1 299 ASP n 
1 300 LYS n 
1 301 ASN n 
1 302 SER n 
1 303 PRO n 
1 304 GLU n 
1 305 ALA n 
1 306 TRP n 
1 307 CYS n 
1 308 ALA n 
1 309 ALA n 
1 310 GLY n 
1 311 ASN n 
1 312 CYS n 
1 313 PHE n 
1 314 SER n 
1 315 LEU n 
1 316 GLN n 
1 317 ARG n 
1 318 GLU n 
1 319 HIS n 
1 320 ASP n 
1 321 ILE n 
1 322 ALA n 
1 323 ILE n 
1 324 LYS n 
1 325 PHE n 
1 326 PHE n 
1 327 GLN n 
1 328 ARG n 
1 329 ALA n 
1 330 ILE n 
1 331 GLN n 
1 332 VAL n 
1 333 ASP n 
1 334 PRO n 
1 335 ASN n 
1 336 TYR n 
1 337 ALA n 
1 338 TYR n 
1 339 ALA n 
1 340 TYR n 
1 341 THR n 
1 342 LEU n 
1 343 LEU n 
1 344 GLY n 
1 345 HIS n 
1 346 GLU n 
1 347 PHE n 
1 348 VAL n 
1 349 LEU n 
1 350 THR n 
1 351 GLU n 
1 352 GLU n 
1 353 LEU n 
1 354 ASP n 
1 355 LYS n 
1 356 ALA n 
1 357 LEU n 
1 358 ALA n 
1 359 CYS n 
1 360 PHE n 
1 361 ARG n 
1 362 ASN n 
1 363 ALA n 
1 364 ILE n 
1 365 ARG n 
1 366 VAL n 
1 367 ASN n 
1 368 PRO n 
1 369 ARG n 
1 370 HIS n 
1 371 TYR n 
1 372 ASN n 
1 373 ALA n 
1 374 TRP n 
1 375 TYR n 
1 376 GLY n 
1 377 LEU n 
1 378 GLY n 
1 379 MET n 
1 380 ILE n 
1 381 TYR n 
1 382 TYR n 
1 383 LYS n 
1 384 GLN n 
1 385 GLU n 
1 386 LYS n 
1 387 PHE n 
1 388 SER n 
1 389 LEU n 
1 390 ALA n 
1 391 GLU n 
1 392 MET n 
1 393 HIS n 
1 394 PHE n 
1 395 GLN n 
1 396 LYS n 
1 397 ALA n 
1 398 LEU n 
1 399 ASP n 
1 400 ILE n 
1 401 ASN n 
1 402 PRO n 
1 403 GLN n 
1 404 SER n 
1 405 SER n 
1 406 VAL n 
1 407 LEU n 
1 408 LEU n 
1 409 CYS n 
1 410 HIS n 
1 411 ILE n 
1 412 GLY n 
1 413 VAL n 
1 414 VAL n 
1 415 GLN n 
1 416 HIS n 
1 417 ALA n 
1 418 LEU n 
1 419 LYS n 
1 420 LYS n 
1 421 SER n 
1 422 GLU n 
1 423 LYS n 
1 424 ALA n 
1 425 LEU n 
1 426 ASP n 
1 427 THR n 
1 428 LEU n 
1 429 ASN n 
1 430 LYS n 
1 431 ALA n 
1 432 ILE n 
1 433 VAL n 
1 434 ILE n 
1 435 ASP n 
1 436 PRO n 
1 437 LYS n 
1 438 ASN n 
1 439 PRO n 
1 440 LEU n 
1 441 CYS n 
1 442 LYS n 
1 443 PHE n 
1 444 HIS n 
1 445 ARG n 
1 446 ALA n 
1 447 SER n 
1 448 VAL n 
1 449 LEU n 
1 450 PHE n 
1 451 ALA n 
1 452 ASN n 
1 453 GLU n 
1 454 LYS n 
1 455 TYR n 
1 456 LYS n 
1 457 SER n 
1 458 ALA n 
1 459 LEU n 
1 460 GLN n 
1 461 GLU n 
1 462 LEU n 
1 463 GLU n 
1 464 GLU n 
1 465 LEU n 
1 466 LYS n 
1 467 GLN n 
1 468 ILE n 
1 469 VAL n 
1 470 PRO n 
1 471 LYS n 
1 472 GLU n 
1 473 SER n 
1 474 LEU n 
1 475 VAL n 
1 476 TYR n 
1 477 PHE n 
1 478 LEU n 
1 479 ILE n 
1 480 GLY n 
1 481 LYS n 
1 482 VAL n 
1 483 TYR n 
1 484 LYS n 
1 485 LYS n 
1 486 LEU n 
1 487 GLY n 
1 488 GLN n 
1 489 THR n 
1 490 HIS n 
1 491 LEU n 
1 492 ALA n 
1 493 LEU n 
1 494 MET n 
1 495 ASN n 
1 496 PHE n 
1 497 SER n 
1 498 TRP n 
1 499 ALA n 
1 500 MET n 
1 501 ASP n 
1 502 LEU n 
1 503 ASP n 
1 504 PRO n 
1 505 LYS n 
1 506 GLY n 
1 507 ALA n 
1 508 ASN n 
1 509 ASN n 
1 510 GLN n 
1 511 ILE n 
1 512 LYS n 
1 513 GLU n 
1 514 ALA n 
1 515 ILE n 
1 516 ASP n 
1 517 LYS n 
1 518 ARG n 
1 519 TYR n 
1 520 LEU n 
1 521 PRO n 
1 522 ASP n 
1 523 ASP n 
1 524 GLU n 
1 525 GLU n 
1 526 PRO n 
1 527 ILE n 
1 528 THR n 
1 529 GLN n 
1 530 GLU n 
1 531 GLU n 
1 532 GLN n 
1 533 ILE n 
1 534 MET n 
1 535 GLY n 
1 536 THR n 
1 537 ASP n 
1 538 GLU n 
1 539 SER n 
1 540 GLN n 
1 541 GLU n 
1 542 SER n 
1 543 SER n 
1 544 MET n 
1 545 THR n 
1 546 ASP n 
1 547 ALA n 
1 548 ASP n 
1 549 ASP n 
1 550 THR n 
1 551 GLN n 
1 552 LEU n 
1 553 HIS n 
1 554 ALA n 
1 555 ALA n 
1 556 GLU n 
1 557 SER n 
1 558 ASP n 
1 559 GLU n 
1 560 PHE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 3   182 human ? 'CDC27, ANAPC3, D0S1430E, D17S978E' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample ? 183 560 human ? 'CDC27, ANAPC3, D0S1430E, D17S978E' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP CDC27_HUMAN P30260 1 
;MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCV
DLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGE
KPDPDQTFKFTSLQNFSNCL
;
1   ? 
2 UNP CDC27_HUMAN P30260 1 
;PQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVR
RIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTL
LGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSE
KALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDL
DPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
;
447 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4RG7 A 3   ? 182 ? P30260 1   ? 180 ? 1   180 
2 2 4RG7 A 183 ? 560 ? P30260 447 ? 824 ? 453 830 
3 1 4RG7 B 3   ? 182 ? P30260 1   ? 180 ? 1   180 
4 2 4RG7 B 183 ? 560 ? P30260 447 ? 824 ? 453 830 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4RG7 GLY A 1 ? UNP P30260 ? ? 'EXPRESSION TAG' -1 1 
1 4RG7 SER A 2 ? UNP P30260 ? ? 'EXPRESSION TAG' 0  2 
2 4RG7 GLY B 1 ? UNP P30260 ? ? 'EXPRESSION TAG' -1 3 
2 4RG7 SER B 2 ? UNP P30260 ? ? 'EXPRESSION TAG' 0  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4RG7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.34 
_exptl_crystal.density_percent_sol   71.63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    
'0.1M MES, pH 6.0, 0.2M magnesium chloride, 8% PEG6000, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2014-02-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97920 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97920 
# 
_reflns.entry_id                     4RG7 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            4.25 
_reflns.number_obs                   15458 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.119 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.number_all                   ? 
# 
_reflns_shell.d_res_high             4.25 
_reflns_shell.d_res_low              4.4 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.826 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4RG7 
_refine.ls_number_reflns_obs                     15211 
_refine.ls_number_reflns_all                     15458 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.666 
_refine.ls_d_res_high                            4.250 
_refine.ls_percent_reflns_obs                    99.57 
_refine.ls_R_factor_obs                          0.2560 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2548 
_refine.ls_R_factor_R_free                       0.2823 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.03 
_refine.ls_number_reflns_R_free                  765 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.68 
_refine.pdbx_overall_phase_error                 33.31 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6066 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6066 
_refine_hist.d_res_high                       4.250 
_refine_hist.d_res_low                        49.666 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.005  ? ? 6192 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.243  ? ? 8529 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 13.409 ? ? 1748 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.046  ? ? 1005 ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 1137 ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 4.25   4.5784  2883 0.3003 100.00 0.3415 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 4.5784 5.0387  2866 0.2992 100.00 0.3022 . . 166 . . . . 'X-RAY DIFFRACTION' 
. 5.0387 5.7669  2874 0.3262 99.00  0.3367 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 5.7669 7.2620  2900 0.3008 100.00 0.3497 . . 167 . . . . 'X-RAY DIFFRACTION' 
. 7.2620 49.6690 2923 0.1986 99.00  0.2136 . . 134 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4RG7 
_struct.title                     'Crystal structure of APC3' 
_struct.pdbx_descriptor           'Cell division cycle protein 27 homolog' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4RG7 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'Symmetric homodimer, TPR fplding, Protein assembly, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLN A 7   ? HIS A 20  ? GLN A 5   HIS A 18  1 ? 14 
HELX_P HELX_P2  2  ALA A 22  ? VAL A 37  ? ALA A 20  VAL A 35  1 ? 16 
HELX_P HELX_P3  3  SER A 39  ? SER A 53  ? SER A 37  SER A 51  1 ? 15 
HELX_P HELX_P4  4  LYS A 55  ? HIS A 66  ? LYS A 53  HIS A 64  1 ? 12 
HELX_P HELX_P5  5  THR A 70  ? LEU A 84  ? THR A 68  LEU A 82  1 ? 15 
HELX_P HELX_P6  6  LYS A 86  ? SER A 95  ? LYS A 84  SER A 93  1 ? 10 
HELX_P HELX_P7  7  SER A 104 ? GLY A 113 ? SER A 102 GLY A 111 1 ? 10 
HELX_P HELX_P8  8  SER A 115 ? THR A 130 ? SER A 113 THR A 128 1 ? 16 
HELX_P HELX_P9  9  ARG A 132 ? ASN A 147 ? ARG A 130 ASN A 145 1 ? 16 
HELX_P HELX_P10 10 LEU A 150 ? GLY A 161 ? LEU A 148 GLY A 159 1 ? 12 
HELX_P HELX_P11 11 ASP A 165 ? PHE A 170 ? ASP A 163 PHE A 168 1 ? 6  
HELX_P HELX_P12 12 ALA A 193 ? SER A 214 ? ALA A 463 SER A 484 1 ? 22 
HELX_P HELX_P13 13 ASN A 216 ? LEU A 227 ? ASN A 486 LEU A 497 1 ? 12 
HELX_P HELX_P14 14 SER A 229 ? THR A 234 ? SER A 499 THR A 504 1 ? 6  
HELX_P HELX_P15 15 THR A 234 ? SER A 249 ? THR A 504 SER A 519 1 ? 16 
HELX_P HELX_P16 16 GLU A 250 ? GLU A 265 ? GLU A 520 GLU A 535 1 ? 16 
HELX_P HELX_P17 17 GLY A 271 ? GLN A 283 ? GLY A 541 GLN A 553 1 ? 13 
HELX_P HELX_P18 18 LYS A 284 ? ASP A 299 ? LYS A 554 ASP A 569 1 ? 16 
HELX_P HELX_P19 19 SER A 302 ? GLN A 316 ? SER A 572 GLN A 586 1 ? 15 
HELX_P HELX_P20 20 GLU A 318 ? ASP A 333 ? GLU A 588 ASP A 603 1 ? 16 
HELX_P HELX_P21 21 TYR A 336 ? THR A 350 ? TYR A 606 THR A 620 1 ? 15 
HELX_P HELX_P22 22 GLU A 352 ? ASN A 367 ? GLU A 622 ASN A 637 1 ? 16 
HELX_P HELX_P23 23 HIS A 370 ? GLN A 384 ? HIS A 640 GLN A 654 1 ? 15 
HELX_P HELX_P24 24 LYS A 386 ? ASN A 401 ? LYS A 656 ASN A 671 1 ? 16 
HELX_P HELX_P25 25 SER A 404 ? LEU A 418 ? SER A 674 LEU A 688 1 ? 15 
HELX_P HELX_P26 26 LEU A 428 ? ASP A 435 ? LEU A 698 ASP A 705 1 ? 8  
HELX_P HELX_P27 27 ASN A 438 ? ASN A 452 ? ASN A 708 ASN A 722 1 ? 15 
HELX_P HELX_P28 28 LYS A 454 ? VAL A 469 ? LYS A 724 VAL A 739 1 ? 16 
HELX_P HELX_P29 29 GLU A 472 ? LYS A 485 ? GLU A 742 LYS A 755 1 ? 14 
HELX_P HELX_P30 30 GLN A 488 ? LEU A 502 ? GLN A 758 LEU A 772 1 ? 15 
HELX_P HELX_P31 31 PRO B 9   ? HIS B 20  ? PRO B 7   HIS B 18  1 ? 12 
HELX_P HELX_P32 32 ALA B 22  ? VAL B 37  ? ALA B 20  VAL B 35  1 ? 16 
HELX_P HELX_P33 33 SER B 39  ? SER B 53  ? SER B 37  SER B 51  1 ? 15 
HELX_P HELX_P34 34 LYS B 55  ? GLY B 65  ? LYS B 53  GLY B 63  1 ? 11 
HELX_P HELX_P35 35 THR B 70  ? LEU B 84  ? THR B 68  LEU B 82  1 ? 15 
HELX_P HELX_P36 36 LYS B 86  ? SER B 95  ? LYS B 84  SER B 93  1 ? 10 
HELX_P HELX_P37 37 SER B 104 ? GLY B 113 ? SER B 102 GLY B 111 1 ? 10 
HELX_P HELX_P38 38 SER B 115 ? THR B 130 ? SER B 113 THR B 128 1 ? 16 
HELX_P HELX_P39 39 ARG B 132 ? ASN B 147 ? ARG B 130 ASN B 145 1 ? 16 
HELX_P HELX_P40 40 TRP B 151 ? ILE B 160 ? TRP B 149 ILE B 158 1 ? 10 
HELX_P HELX_P41 41 ASP B 165 ? PHE B 170 ? ASP B 163 PHE B 168 1 ? 6  
HELX_P HELX_P42 42 GLU B 196 ? SER B 214 ? GLU B 466 SER B 484 1 ? 19 
HELX_P HELX_P43 43 ASN B 216 ? SER B 225 ? ASN B 486 SER B 495 1 ? 10 
HELX_P HELX_P44 44 PRO B 228 ? ASN B 233 ? PRO B 498 ASN B 503 1 ? 6  
HELX_P HELX_P45 45 THR B 234 ? LEU B 248 ? THR B 504 LEU B 518 1 ? 15 
HELX_P HELX_P46 46 GLU B 250 ? GLU B 265 ? GLU B 520 GLU B 535 1 ? 16 
HELX_P HELX_P47 47 MET B 272 ? LEU B 282 ? MET B 542 LEU B 552 1 ? 11 
HELX_P HELX_P48 48 LYS B 284 ? ASP B 297 ? LYS B 554 ASP B 567 1 ? 14 
HELX_P HELX_P49 49 SER B 302 ? GLN B 316 ? SER B 572 GLN B 586 1 ? 15 
HELX_P HELX_P50 50 GLU B 318 ? ASP B 333 ? GLU B 588 ASP B 603 1 ? 16 
HELX_P HELX_P51 51 TYR B 336 ? THR B 350 ? TYR B 606 THR B 620 1 ? 15 
HELX_P HELX_P52 52 GLU B 352 ? ASN B 367 ? GLU B 622 ASN B 637 1 ? 16 
HELX_P HELX_P53 53 HIS B 370 ? GLN B 384 ? HIS B 640 GLN B 654 1 ? 15 
HELX_P HELX_P54 54 LYS B 386 ? ASN B 401 ? LYS B 656 ASN B 671 1 ? 16 
HELX_P HELX_P55 55 GLN B 403 ? ALA B 417 ? GLN B 673 ALA B 687 1 ? 15 
HELX_P HELX_P56 56 ASN B 429 ? ASN B 438 ? ASN B 699 ASN B 708 1 ? 10 
HELX_P HELX_P57 57 ASN B 438 ? ASN B 452 ? ASN B 708 ASN B 722 1 ? 15 
HELX_P HELX_P58 58 LYS B 454 ? VAL B 469 ? LYS B 724 VAL B 739 1 ? 16 
HELX_P HELX_P59 59 GLU B 472 ? LYS B 485 ? GLU B 742 LYS B 755 1 ? 14 
HELX_P HELX_P60 60 GLN B 488 ? ASP B 503 ? GLN B 758 ASP B 773 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          4RG7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4RG7 
_atom_sites.fract_transf_matrix[1][1]   0.008445 
_atom_sites.fract_transf_matrix[1][2]   0.004876 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009752 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003653 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . GLN A 1 7   ? 35.341  21.116  -10.070 1.00 194.64 ? 5   GLN A N   1 
ATOM 2    C CA  . GLN A 1 7   ? 34.631  20.423  -11.142 1.00 175.87 ? 5   GLN A CA  1 
ATOM 3    C C   . GLN A 1 7   ? 33.691  19.351  -10.555 1.00 177.81 ? 5   GLN A C   1 
ATOM 4    O O   . GLN A 1 7   ? 32.487  19.559  -10.450 1.00 175.75 ? 5   GLN A O   1 
ATOM 5    C CB  . GLN A 1 7   ? 35.646  19.799  -12.115 1.00 176.32 ? 5   GLN A CB  1 
ATOM 6    N N   . GLU A 1 8   ? 34.267  18.194  -10.249 1.00 186.34 ? 6   GLU A N   1 
ATOM 7    C CA  . GLU A 1 8   ? 33.793  17.174  -9.309  1.00 191.25 ? 6   GLU A CA  1 
ATOM 8    C C   . GLU A 1 8   ? 32.982  17.612  -8.077  1.00 182.69 ? 6   GLU A C   1 
ATOM 9    O O   . GLU A 1 8   ? 31.823  17.200  -7.919  1.00 171.89 ? 6   GLU A O   1 
ATOM 10   C CB  . GLU A 1 8   ? 34.979  16.303  -8.850  1.00 200.33 ? 6   GLU A CB  1 
ATOM 11   N N   . PRO A 1 9   ? 33.482  18.604  -7.308  1.00 186.41 ? 7   PRO A N   1 
ATOM 12   C CA  . PRO A 1 9   ? 32.587  18.910  -6.189  1.00 187.59 ? 7   PRO A CA  1 
ATOM 13   C C   . PRO A 1 9   ? 31.485  19.841  -6.595  1.00 176.93 ? 7   PRO A C   1 
ATOM 14   O O   . PRO A 1 9   ? 30.531  19.978  -5.831  1.00 181.33 ? 7   PRO A O   1 
ATOM 15   C CB  . PRO A 1 9   ? 33.533  19.544  -5.162  1.00 179.67 ? 7   PRO A CB  1 
ATOM 16   C CG  . PRO A 1 9   ? 34.501  20.318  -6.001  1.00 182.72 ? 7   PRO A CG  1 
ATOM 17   C CD  . PRO A 1 9   ? 34.697  19.465  -7.274  1.00 194.18 ? 7   PRO A CD  1 
ATOM 18   N N   . VAL A 1 10  ? 31.665  20.552  -7.696  1.00 165.31 ? 8   VAL A N   1 
ATOM 19   C CA  . VAL A 1 10  ? 30.638  21.448  -8.156  1.00 153.15 ? 8   VAL A CA  1 
ATOM 20   C C   . VAL A 1 10  ? 29.357  20.635  -8.442  1.00 146.17 ? 8   VAL A C   1 
ATOM 21   O O   . VAL A 1 10  ? 28.320  20.883  -7.842  1.00 142.45 ? 8   VAL A O   1 
ATOM 22   C CB  . VAL A 1 10  ? 31.056  22.152  -9.439  1.00 152.02 ? 8   VAL A CB  1 
ATOM 23   N N   . GLN A 1 11  ? 29.452  19.617  -9.295  1.00 155.78 ? 9   GLN A N   1 
ATOM 24   C CA  . GLN A 1 11  ? 28.310  18.786  -9.704  1.00 154.19 ? 9   GLN A CA  1 
ATOM 25   C C   . GLN A 1 11  ? 27.914  17.720  -8.630  1.00 153.10 ? 9   GLN A C   1 
ATOM 26   O O   . GLN A 1 11  ? 26.975  16.956  -8.857  1.00 151.47 ? 9   GLN A O   1 
ATOM 27   C CB  . GLN A 1 11  ? 28.579  18.144  -11.077 1.00 152.82 ? 9   GLN A CB  1 
ATOM 28   N N   . ALA A 1 12  ? 28.755  17.518  -7.610  1.00 161.89 ? 10  ALA A N   1 
ATOM 29   C CA  . ALA A 1 12  ? 28.299  16.803  -6.420  1.00 162.24 ? 10  ALA A CA  1 
ATOM 30   C C   . ALA A 1 12  ? 27.229  17.630  -5.681  1.00 154.09 ? 10  ALA A C   1 
ATOM 31   O O   . ALA A 1 12  ? 26.141  17.149  -5.369  1.00 145.72 ? 10  ALA A O   1 
ATOM 32   C CB  . ALA A 1 12  ? 29.483  16.490  -5.467  1.00 172.35 ? 10  ALA A CB  1 
ATOM 33   N N   . ALA A 1 13  ? 27.574  18.902  -5.483  1.00 160.94 ? 11  ALA A N   1 
ATOM 34   C CA  . ALA A 1 13  ? 26.783  19.961  -4.833  1.00 171.82 ? 11  ALA A CA  1 
ATOM 35   C C   . ALA A 1 13  ? 25.426  20.345  -5.516  1.00 145.71 ? 11  ALA A C   1 
ATOM 36   O O   . ALA A 1 13  ? 24.506  20.780  -4.855  1.00 147.60 ? 11  ALA A O   1 
ATOM 37   C CB  . ALA A 1 13  ? 27.653  21.207  -4.668  1.00 186.03 ? 11  ALA A CB  1 
ATOM 38   N N   . ILE A 1 14  ? 25.384  20.220  -6.842  1.00 137.93 ? 12  ILE A N   1 
ATOM 39   C CA  . ILE A 1 14  ? 24.193  20.463  -7.638  1.00 138.85 ? 12  ILE A CA  1 
ATOM 40   C C   . ILE A 1 14  ? 23.180  19.437  -7.217  1.00 140.52 ? 12  ILE A C   1 
ATOM 41   O O   . ILE A 1 14  ? 22.075  19.780  -6.775  1.00 142.07 ? 12  ILE A O   1 
ATOM 42   C CB  . ILE A 1 14  ? 24.467  20.399  -9.172  1.00 140.27 ? 12  ILE A CB  1 
ATOM 43   C CG1 . ILE A 1 14  ? 25.180  21.652  -9.627  1.00 141.41 ? 12  ILE A CG1 1 
ATOM 44   C CG2 . ILE A 1 14  ? 23.150  20.324  -9.913  1.00 128.98 ? 12  ILE A CG2 1 
ATOM 45   C CD1 . ILE A 1 14  ? 25.648  21.676  -11.042 1.00 131.43 ? 12  ILE A CD1 1 
ATOM 46   N N   . TRP A 1 15  ? 23.568  18.180  -7.247  1.00 141.58 ? 13  TRP A N   1 
ATOM 47   C CA  . TRP A 1 15  ? 22.655  17.090  -6.959  1.00 140.92 ? 13  TRP A CA  1 
ATOM 48   C C   . TRP A 1 15  ? 22.169  17.177  -5.529  1.00 144.52 ? 13  TRP A C   1 
ATOM 49   O O   . TRP A 1 15  ? 21.053  16.761  -5.242  1.00 148.74 ? 13  TRP A O   1 
ATOM 50   C CB  . TRP A 1 15  ? 23.289  15.721  -7.197  1.00 142.69 ? 13  TRP A CB  1 
ATOM 51   C CG  . TRP A 1 15  ? 23.066  15.211  -8.579  1.00 139.92 ? 13  TRP A CG  1 
ATOM 52   C CD1 . TRP A 1 15  ? 22.649  15.931  -9.654  1.00 137.17 ? 13  TRP A CD1 1 
ATOM 53   C CD2 . TRP A 1 15  ? 23.209  13.858  -9.031  1.00 145.07 ? 13  TRP A CD2 1 
ATOM 54   N NE1 . TRP A 1 15  ? 22.542  15.119  -10.756 1.00 139.95 ? 13  TRP A NE1 1 
ATOM 55   C CE2 . TRP A 1 15  ? 22.880  13.840  -10.401 1.00 145.62 ? 13  TRP A CE2 1 
ATOM 56   C CE3 . TRP A 1 15  ? 23.594  12.663  -8.415  1.00 156.85 ? 13  TRP A CE3 1 
ATOM 57   C CZ2 . TRP A 1 15  ? 22.924  12.678  -11.165 1.00 149.84 ? 13  TRP A CZ2 1 
ATOM 58   C CZ3 . TRP A 1 15  ? 23.637  11.510  -9.175  1.00 164.10 ? 13  TRP A CZ3 1 
ATOM 59   C CH2 . TRP A 1 15  ? 23.303  11.526  -10.536 1.00 159.13 ? 13  TRP A CH2 1 
ATOM 60   N N   . GLN A 1 16  ? 22.987  17.720  -4.633  1.00 156.06 ? 14  GLN A N   1 
ATOM 61   C CA  . GLN A 1 16  ? 22.535  17.922  -3.264  1.00 165.98 ? 14  GLN A CA  1 
ATOM 62   C C   . GLN A 1 16  ? 21.372  18.916  -3.289  1.00 167.66 ? 14  GLN A C   1 
ATOM 63   O O   . GLN A 1 16  ? 20.361  18.704  -2.619  1.00 182.77 ? 14  GLN A O   1 
ATOM 64   C CB  . GLN A 1 16  ? 23.674  18.437  -2.384  1.00 170.68 ? 14  GLN A CB  1 
ATOM 65   N N   . ALA A 1 17  ? 21.523  20.003  -4.042  1.00 149.97 ? 15  ALA A N   1 
ATOM 66   C CA  . ALA A 1 17  ? 20.444  20.978  -4.209  1.00 135.10 ? 15  ALA A CA  1 
ATOM 67   C C   . ALA A 1 17  ? 19.175  20.349  -4.802  1.00 128.86 ? 15  ALA A C   1 
ATOM 68   O O   . ALA A 1 17  ? 18.064  20.691  -4.397  1.00 128.87 ? 15  ALA A O   1 
ATOM 69   C CB  . ALA A 1 17  ? 20.909  22.138  -5.080  1.00 129.97 ? 15  ALA A CB  1 
ATOM 70   N N   . LEU A 1 18  ? 19.339  19.442  -5.762  1.00 139.95 ? 16  LEU A N   1 
ATOM 71   C CA  . LEU A 1 18  ? 18.195  18.802  -6.414  1.00 136.64 ? 16  LEU A CA  1 
ATOM 72   C C   . LEU A 1 18  ? 17.429  17.842  -5.506  1.00 138.28 ? 16  LEU A C   1 
ATOM 73   O O   . LEU A 1 18  ? 16.201  17.778  -5.566  1.00 139.49 ? 16  LEU A O   1 
ATOM 74   C CB  . LEU A 1 18  ? 18.649  18.049  -7.667  1.00 133.99 ? 16  LEU A CB  1 
ATOM 75   C CG  . LEU A 1 18  ? 19.060  18.885  -8.878  1.00 131.40 ? 16  LEU A CG  1 
ATOM 76   C CD1 . LEU A 1 18  ? 19.797  18.027  -9.894  1.00 135.17 ? 16  LEU A CD1 1 
ATOM 77   C CD2 . LEU A 1 18  ? 17.836  19.528  -9.510  1.00 128.13 ? 16  LEU A CD2 1 
ATOM 78   N N   . ASN A 1 19  ? 18.142  17.091  -4.673  1.00 142.10 ? 17  ASN A N   1 
ATOM 79   C CA  . ASN A 1 19  ? 17.476  16.174  -3.753  1.00 145.09 ? 17  ASN A CA  1 
ATOM 80   C C   . ASN A 1 19  ? 16.812  16.917  -2.600  1.00 154.21 ? 17  ASN A C   1 
ATOM 81   O O   . ASN A 1 19  ? 15.990  16.353  -1.878  1.00 168.04 ? 17  ASN A O   1 
ATOM 82   C CB  . ASN A 1 19  ? 18.455  15.124  -3.222  1.00 149.59 ? 17  ASN A CB  1 
ATOM 83   C CG  . ASN A 1 19  ? 19.126  14.338  -4.333  1.00 165.63 ? 17  ASN A CG  1 
ATOM 84   O OD1 . ASN A 1 19  ? 19.200  14.792  -5.474  1.00 174.21 ? 17  ASN A OD1 1 
ATOM 85   N ND2 . ASN A 1 19  ? 19.599  13.141  -4.008  1.00 177.59 ? 17  ASN A ND2 1 
ATOM 86   N N   . HIS A 1 20  ? 17.178  18.183  -2.427  1.00 147.20 ? 18  HIS A N   1 
ATOM 87   C CA  . HIS A 1 20  ? 16.463  19.070  -1.517  1.00 140.58 ? 18  HIS A CA  1 
ATOM 88   C C   . HIS A 1 20  ? 15.480  19.964  -2.270  1.00 136.05 ? 18  HIS A C   1 
ATOM 89   O O   . HIS A 1 20  ? 14.817  20.809  -1.669  1.00 138.46 ? 18  HIS A O   1 
ATOM 90   C CB  . HIS A 1 20  ? 17.444  19.914  -0.703  1.00 143.21 ? 18  HIS A CB  1 
ATOM 91   C CG  . HIS A 1 20  ? 18.244  19.120  0.281   1.00 147.19 ? 18  HIS A CG  1 
ATOM 92   N ND1 . HIS A 1 20  ? 19.526  18.685  0.023   1.00 147.86 ? 18  HIS A ND1 1 
ATOM 93   C CD2 . HIS A 1 20  ? 17.937  18.670  1.521   1.00 153.61 ? 18  HIS A CD2 1 
ATOM 94   C CE1 . HIS A 1 20  ? 19.977  18.008  1.064   1.00 154.47 ? 18  HIS A CE1 1 
ATOM 95   N NE2 . HIS A 1 20  ? 19.032  17.984  1.986   1.00 158.02 ? 18  HIS A NE2 1 
ATOM 96   N N   . TYR A 1 21  ? 15.421  19.786  -3.588  1.00 132.23 ? 19  TYR A N   1 
ATOM 97   C CA  . TYR A 1 21  ? 14.511  20.531  -4.461  1.00 129.39 ? 19  TYR A CA  1 
ATOM 98   C C   . TYR A 1 21  ? 14.782  22.031  -4.488  1.00 129.40 ? 19  TYR A C   1 
ATOM 99   O O   . TYR A 1 21  ? 13.867  22.832  -4.683  1.00 130.18 ? 19  TYR A O   1 
ATOM 100  C CB  . TYR A 1 21  ? 13.055  20.266  -4.067  1.00 131.36 ? 19  TYR A CB  1 
ATOM 101  C CG  . TYR A 1 21  ? 12.780  18.814  -3.755  1.00 132.72 ? 19  TYR A CG  1 
ATOM 102  C CD1 . TYR A 1 21  ? 12.883  17.846  -4.744  1.00 130.25 ? 19  TYR A CD1 1 
ATOM 103  C CD2 . TYR A 1 21  ? 12.428  18.409  -2.475  1.00 143.88 ? 19  TYR A CD2 1 
ATOM 104  C CE1 . TYR A 1 21  ? 12.638  16.516  -4.471  1.00 131.95 ? 19  TYR A CE1 1 
ATOM 105  C CE2 . TYR A 1 21  ? 12.181  17.079  -2.191  1.00 149.30 ? 19  TYR A CE2 1 
ATOM 106  C CZ  . TYR A 1 21  ? 12.287  16.137  -3.193  1.00 136.80 ? 19  TYR A CZ  1 
ATOM 107  O OH  . TYR A 1 21  ? 12.042  14.812  -2.917  1.00 137.66 ? 19  TYR A OH  1 
ATOM 108  N N   . ALA A 1 22  ? 16.040  22.405  -4.289  1.00 131.04 ? 20  ALA A N   1 
ATOM 109  C CA  . ALA A 1 22  ? 16.456  23.790  -4.457  1.00 135.68 ? 20  ALA A CA  1 
ATOM 110  C C   . ALA A 1 22  ? 16.820  24.002  -5.920  1.00 131.68 ? 20  ALA A C   1 
ATOM 111  O O   . ALA A 1 22  ? 17.997  24.104  -6.264  1.00 128.23 ? 20  ALA A O   1 
ATOM 112  C CB  . ALA A 1 22  ? 17.629  24.120  -3.553  1.00 150.45 ? 20  ALA A CB  1 
ATOM 113  N N   . TYR A 1 23  ? 15.807  24.062  -6.779  1.00 133.13 ? 21  TYR A N   1 
ATOM 114  C CA  . TYR A 1 23  ? 16.036  24.015  -8.219  1.00 128.47 ? 21  TYR A CA  1 
ATOM 115  C C   . TYR A 1 23  ? 16.771  25.234  -8.779  1.00 127.98 ? 21  TYR A C   1 
ATOM 116  O O   . TYR A 1 23  ? 17.691  25.074  -9.579  1.00 129.84 ? 21  TYR A O   1 
ATOM 117  C CB  . TYR A 1 23  ? 14.705  23.818  -8.955  1.00 126.95 ? 21  TYR A CB  1 
ATOM 118  C CG  . TYR A 1 23  ? 14.013  22.508  -8.633  1.00 128.63 ? 21  TYR A CG  1 
ATOM 119  C CD1 . TYR A 1 23  ? 12.703  22.476  -8.172  1.00 146.68 ? 21  TYR A CD1 1 
ATOM 120  C CD2 . TYR A 1 23  ? 14.672  21.298  -8.812  1.00 129.87 ? 21  TYR A CD2 1 
ATOM 121  C CE1 . TYR A 1 23  ? 12.073  21.272  -7.889  1.00 151.40 ? 21  TYR A CE1 1 
ATOM 122  C CE2 . TYR A 1 23  ? 14.054  20.094  -8.532  1.00 137.27 ? 21  TYR A CE2 1 
ATOM 123  C CZ  . TYR A 1 23  ? 12.755  20.085  -8.072  1.00 141.75 ? 21  TYR A CZ  1 
ATOM 124  O OH  . TYR A 1 23  ? 12.142  18.884  -7.790  1.00 134.27 ? 21  TYR A OH  1 
ATOM 125  N N   . ARG A 1 24  ? 16.372  26.439  -8.387  1.00 134.42 ? 22  ARG A N   1 
ATOM 126  C CA  . ARG A 1 24  ? 17.052  27.641  -8.873  1.00 134.93 ? 22  ARG A CA  1 
ATOM 127  C C   . ARG A 1 24  ? 18.547  27.670  -8.537  1.00 142.75 ? 22  ARG A C   1 
ATOM 128  O O   . ARG A 1 24  ? 19.355  28.173  -9.318  1.00 147.18 ? 22  ARG A O   1 
ATOM 129  C CB  . ARG A 1 24  ? 16.365  28.901  -8.344  1.00 155.75 ? 22  ARG A CB  1 
ATOM 130  C CG  . ARG A 1 24  ? 16.981  30.188  -8.876  1.00 173.32 ? 22  ARG A CG  1 
ATOM 131  C CD  . ARG A 1 24  ? 16.020  31.350  -8.766  1.00 186.73 ? 22  ARG A CD  1 
ATOM 132  N NE  . ARG A 1 24  ? 14.924  31.172  -9.714  1.00 185.33 ? 22  ARG A NE  1 
ATOM 133  C CZ  . ARG A 1 24  ? 14.051  32.116  -10.048 1.00 182.30 ? 22  ARG A CZ  1 
ATOM 134  N NH1 . ARG A 1 24  ? 14.134  33.324  -9.507  1.00 186.51 ? 22  ARG A NH1 1 
ATOM 135  N NH2 . ARG A 1 24  ? 13.099  31.853  -10.933 1.00 171.68 ? 22  ARG A NH2 1 
ATOM 136  N N   . ASP A 1 25  ? 18.910  27.119  -7.383  1.00 148.13 ? 23  ASP A N   1 
ATOM 137  C CA  . ASP A 1 25  ? 20.311  27.045  -6.981  1.00 147.35 ? 23  ASP A CA  1 
ATOM 138  C C   . ASP A 1 25  ? 21.081  26.021  -7.813  1.00 138.89 ? 23  ASP A C   1 
ATOM 139  O O   . ASP A 1 25  ? 22.208  26.274  -8.238  1.00 138.44 ? 23  ASP A O   1 
ATOM 140  C CB  . ASP A 1 25  ? 20.424  26.704  -5.493  1.00 152.85 ? 23  ASP A CB  1 
ATOM 141  N N   . ALA A 1 26  ? 20.460  24.868  -8.041  1.00 130.70 ? 24  ALA A N   1 
ATOM 142  C CA  . ALA A 1 26  ? 21.055  23.808  -8.849  1.00 126.12 ? 24  ALA A CA  1 
ATOM 143  C C   . ALA A 1 26  ? 21.239  24.239  -10.302 1.00 123.41 ? 24  ALA A C   1 
ATOM 144  O O   . ALA A 1 26  ? 22.325  24.107  -10.865 1.00 126.03 ? 24  ALA A O   1 
ATOM 145  C CB  . ALA A 1 26  ? 20.202  22.551  -8.778  1.00 128.54 ? 24  ALA A CB  1 
ATOM 146  N N   . VAL A 1 27  ? 20.161  24.740  -10.899 1.00 124.07 ? 25  VAL A N   1 
ATOM 147  C CA  . VAL A 1 27  ? 20.159  25.199  -12.287 1.00 120.94 ? 25  VAL A CA  1 
ATOM 148  C C   . VAL A 1 27  ? 21.226  26.256  -12.577 1.00 120.86 ? 25  VAL A C   1 
ATOM 149  O O   . VAL A 1 27  ? 21.871  26.228  -13.628 1.00 122.04 ? 25  VAL A O   1 
ATOM 150  C CB  . VAL A 1 27  ? 18.773  25.771  -12.668 1.00 119.40 ? 25  VAL A CB  1 
ATOM 151  C CG1 . VAL A 1 27  ? 18.839  26.549  -13.972 1.00 118.62 ? 25  VAL A CG1 1 
ATOM 152  C CG2 . VAL A 1 27  ? 17.741  24.656  -12.750 1.00 119.34 ? 25  VAL A CG2 1 
ATOM 153  N N   . PHE A 1 28  ? 21.436  27.162  -11.627 1.00 127.14 ? 26  PHE A N   1 
ATOM 154  C CA  . PHE A 1 28  ? 22.443  28.206  -11.775 1.00 126.01 ? 26  PHE A CA  1 
ATOM 155  C C   . PHE A 1 28  ? 23.836  27.609  -11.905 1.00 128.70 ? 26  PHE A C   1 
ATOM 156  O O   . PHE A 1 28  ? 24.564  27.924  -12.845 1.00 139.68 ? 26  PHE A O   1 
ATOM 157  C CB  . PHE A 1 28  ? 22.406  29.177  -10.598 1.00 129.98 ? 26  PHE A CB  1 
ATOM 158  C CG  . PHE A 1 28  ? 23.068  30.491  -10.888 1.00 132.96 ? 26  PHE A CG  1 
ATOM 159  C CD1 . PHE A 1 28  ? 24.365  30.738  -10.472 1.00 138.59 ? 26  PHE A CD1 1 
ATOM 160  C CD2 . PHE A 1 28  ? 22.393  31.477  -11.586 1.00 132.82 ? 26  PHE A CD2 1 
ATOM 161  C CE1 . PHE A 1 28  ? 24.974  31.949  -10.742 1.00 152.44 ? 26  PHE A CE1 1 
ATOM 162  C CE2 . PHE A 1 28  ? 22.995  32.689  -11.860 1.00 138.12 ? 26  PHE A CE2 1 
ATOM 163  C CZ  . PHE A 1 28  ? 24.288  32.926  -11.438 1.00 145.56 ? 26  PHE A CZ  1 
ATOM 164  N N   . LEU A 1 29  ? 24.193  26.741  -10.963 1.00 126.12 ? 27  LEU A N   1 
ATOM 165  C CA  . LEU A 1 29  ? 25.489  26.072  -10.977 1.00 129.03 ? 27  LEU A CA  1 
ATOM 166  C C   . LEU A 1 29  ? 25.657  25.274  -12.266 1.00 126.13 ? 27  LEU A C   1 
ATOM 167  O O   . LEU A 1 29  ? 26.697  25.356  -12.921 1.00 133.46 ? 27  LEU A O   1 
ATOM 168  C CB  . LEU A 1 29  ? 25.636  25.146  -9.767  1.00 130.92 ? 27  LEU A CB  1 
ATOM 169  C CG  . LEU A 1 29  ? 25.921  25.710  -8.376  1.00 137.06 ? 27  LEU A CG  1 
ATOM 170  C CD1 . LEU A 1 29  ? 25.604  24.664  -7.322  1.00 137.47 ? 27  LEU A CD1 1 
ATOM 171  C CD2 . LEU A 1 29  ? 27.378  26.132  -8.266  1.00 143.97 ? 27  LEU A CD2 1 
ATOM 172  N N   . ALA A 1 30  ? 24.635  24.499  -12.618 1.00 123.33 ? 28  ALA A N   1 
ATOM 173  C CA  . ALA A 1 30  ? 24.650  23.711  -13.846 1.00 123.06 ? 28  ALA A CA  1 
ATOM 174  C C   . ALA A 1 30  ? 24.925  24.565  -15.081 1.00 126.16 ? 28  ALA A C   1 
ATOM 175  O O   . ALA A 1 30  ? 25.727  24.183  -15.935 1.00 131.84 ? 28  ALA A O   1 
ATOM 176  C CB  . ALA A 1 30  ? 23.335  22.965  -14.004 1.00 128.66 ? 28  ALA A CB  1 
ATOM 177  N N   . GLU A 1 31  ? 24.252  25.709  -15.182 1.00 127.19 ? 29  GLU A N   1 
ATOM 178  C CA  . GLU A 1 31  ? 24.487  26.626  -16.293 1.00 129.20 ? 29  GLU A CA  1 
ATOM 179  C C   . GLU A 1 31  ? 25.946  27.072  -16.374 1.00 133.05 ? 29  GLU A C   1 
ATOM 180  O O   . GLU A 1 31  ? 26.508  27.162  -17.464 1.00 136.12 ? 29  GLU A O   1 
ATOM 181  C CB  . GLU A 1 31  ? 23.576  27.854  -16.199 1.00 130.82 ? 29  GLU A CB  1 
ATOM 182  C CG  . GLU A 1 31  ? 22.135  27.608  -16.622 1.00 142.47 ? 29  GLU A CG  1 
ATOM 183  C CD  . GLU A 1 31  ? 21.273  28.853  -16.514 1.00 150.01 ? 29  GLU A CD  1 
ATOM 184  O OE1 . GLU A 1 31  ? 21.795  29.906  -16.090 1.00 152.08 ? 29  GLU A OE1 1 
ATOM 185  O OE2 . GLU A 1 31  ? 20.075  28.781  -16.863 1.00 146.05 ? 29  GLU A OE2 1 
ATOM 186  N N   . ARG A 1 32  ? 26.557  27.357  -15.227 1.00 129.94 ? 30  ARG A N   1 
ATOM 187  C CA  . ARG A 1 32  ? 27.938  27.826  -15.232 1.00 134.75 ? 30  ARG A CA  1 
ATOM 188  C C   . ARG A 1 32  ? 28.901  26.680  -15.493 1.00 139.45 ? 30  ARG A C   1 
ATOM 189  O O   . ARG A 1 32  ? 29.944  26.862  -16.121 1.00 154.00 ? 30  ARG A O   1 
ATOM 190  C CB  . ARG A 1 32  ? 28.316  28.522  -13.921 1.00 140.14 ? 30  ARG A CB  1 
ATOM 191  C CG  . ARG A 1 32  ? 27.244  29.401  -13.291 1.00 165.55 ? 30  ARG A CG  1 
ATOM 192  C CD  . ARG A 1 32  ? 27.218  30.809  -13.855 1.00 167.15 ? 30  ARG A CD  1 
ATOM 193  N NE  . ARG A 1 32  ? 27.012  30.759  -15.297 1.00 168.57 ? 30  ARG A NE  1 
ATOM 194  C CZ  . ARG A 1 32  ? 25.807  30.666  -15.849 1.00 167.05 ? 30  ARG A CZ  1 
ATOM 195  N NH1 . ARG A 1 32  ? 24.730  30.635  -15.076 1.00 157.37 ? 30  ARG A NH1 1 
ATOM 196  N NH2 . ARG A 1 32  ? 25.669  30.624  -17.163 1.00 171.10 ? 30  ARG A NH2 1 
ATOM 197  N N   . LEU A 1 33  ? 28.544  25.497  -15.006 1.00 143.08 ? 31  LEU A N   1 
ATOM 198  C CA  . LEU A 1 33  ? 29.393  24.326  -15.155 1.00 149.51 ? 31  LEU A CA  1 
ATOM 199  C C   . LEU A 1 33  ? 29.472  23.947  -16.624 1.00 160.60 ? 31  LEU A C   1 
ATOM 200  O O   . LEU A 1 33  ? 30.564  23.809  -17.177 1.00 154.93 ? 31  LEU A O   1 
ATOM 201  C CB  . LEU A 1 33  ? 28.862  23.157  -14.326 1.00 147.34 ? 31  LEU A CB  1 
ATOM 202  C CG  . LEU A 1 33  ? 29.605  21.830  -14.484 1.00 153.12 ? 31  LEU A CG  1 
ATOM 203  C CD1 . LEU A 1 33  ? 31.071  21.981  -14.100 1.00 165.69 ? 31  LEU A CD1 1 
ATOM 204  C CD2 . LEU A 1 33  ? 28.937  20.746  -13.656 1.00 155.41 ? 31  LEU A CD2 1 
ATOM 205  N N   . TYR A 1 34  ? 28.314  23.766  -17.249 1.00 168.14 ? 32  TYR A N   1 
ATOM 206  C CA  . TYR A 1 34  ? 28.272  23.454  -18.670 1.00 162.40 ? 32  TYR A CA  1 
ATOM 207  C C   . TYR A 1 34  ? 28.958  24.512  -19.533 1.00 163.29 ? 32  TYR A C   1 
ATOM 208  O O   . TYR A 1 34  ? 29.564  24.188  -20.555 1.00 168.35 ? 32  TYR A O   1 
ATOM 209  C CB  . TYR A 1 34  ? 26.830  23.269  -19.143 1.00 152.24 ? 32  TYR A CB  1 
ATOM 210  C CG  . TYR A 1 34  ? 26.780  22.866  -20.591 1.00 156.96 ? 32  TYR A CG  1 
ATOM 211  C CD1 . TYR A 1 34  ? 27.306  21.654  -21.004 1.00 163.67 ? 32  TYR A CD1 1 
ATOM 212  C CD2 . TYR A 1 34  ? 26.226  23.705  -21.548 1.00 168.62 ? 32  TYR A CD2 1 
ATOM 213  C CE1 . TYR A 1 34  ? 27.285  21.284  -22.322 1.00 171.67 ? 32  TYR A CE1 1 
ATOM 214  C CE2 . TYR A 1 34  ? 26.194  23.338  -22.876 1.00 177.24 ? 32  TYR A CE2 1 
ATOM 215  C CZ  . TYR A 1 34  ? 26.726  22.124  -23.252 1.00 179.06 ? 32  TYR A CZ  1 
ATOM 216  O OH  . TYR A 1 34  ? 26.713  21.738  -24.563 1.00 184.97 ? 32  TYR A OH  1 
ATOM 217  N N   . ALA A 1 35  ? 28.859  25.774  -19.128 1.00 151.23 ? 33  ALA A N   1 
ATOM 218  C CA  . ALA A 1 35  ? 29.483  26.852  -19.885 1.00 142.93 ? 33  ALA A CA  1 
ATOM 219  C C   . ALA A 1 35  ? 31.006  26.813  -19.790 1.00 151.17 ? 33  ALA A C   1 
ATOM 220  O O   . ALA A 1 35  ? 31.700  27.141  -20.752 1.00 171.26 ? 33  ALA A O   1 
ATOM 221  C CB  . ALA A 1 35  ? 28.963  28.199  -19.408 1.00 138.22 ? 33  ALA A CB  1 
ATOM 222  N N   . GLU A 1 36  ? 31.524  26.418  -18.631 1.00 153.77 ? 34  GLU A N   1 
ATOM 223  C CA  . GLU A 1 36  ? 32.968  26.348  -18.441 1.00 173.58 ? 34  GLU A CA  1 
ATOM 224  C C   . GLU A 1 36  ? 33.462  25.131  -19.228 1.00 185.78 ? 34  GLU A C   1 
ATOM 225  O O   . GLU A 1 36  ? 34.240  25.264  -20.174 1.00 189.27 ? 34  GLU A O   1 
ATOM 226  C CB  . GLU A 1 36  ? 33.326  26.268  -16.950 1.00 171.87 ? 34  GLU A CB  1 
ATOM 227  C CG  . GLU A 1 36  ? 34.823  26.355  -16.614 1.00 181.06 ? 34  GLU A CG  1 
ATOM 228  C CD  . GLU A 1 36  ? 35.620  25.112  -16.944 1.00 185.88 ? 34  GLU A CD  1 
ATOM 229  O OE1 . GLU A 1 36  ? 35.048  24.006  -16.911 1.00 184.43 ? 34  GLU A OE1 1 
ATOM 230  O OE2 . GLU A 1 36  ? 36.828  25.247  -17.230 1.00 190.53 ? 34  GLU A OE2 1 
ATOM 231  N N   . VAL A 1 37  ? 33.008  23.945  -18.822 1.00 183.91 ? 35  VAL A N   1 
ATOM 232  C CA  . VAL A 1 37  ? 33.331  22.703  -19.526 1.00 189.81 ? 35  VAL A CA  1 
ATOM 233  C C   . VAL A 1 37  ? 32.098  22.175  -20.268 1.00 193.06 ? 35  VAL A C   1 
ATOM 234  O O   . VAL A 1 37  ? 31.035  21.980  -19.679 1.00 187.98 ? 35  VAL A O   1 
ATOM 235  C CB  . VAL A 1 37  ? 33.884  21.619  -18.560 1.00 180.19 ? 35  VAL A CB  1 
ATOM 236  C CG1 . VAL A 1 37  ? 32.897  21.306  -17.435 1.00 172.79 ? 35  VAL A CG1 1 
ATOM 237  C CG2 . VAL A 1 37  ? 34.283  20.366  -19.328 1.00 175.17 ? 35  VAL A CG2 1 
ATOM 238  N N   . HIS A 1 38  ? 32.235  21.972  -21.574 1.00 199.16 ? 36  HIS A N   1 
ATOM 239  C CA  . HIS A 1 38  ? 31.083  21.634  -22.407 1.00 191.98 ? 36  HIS A CA  1 
ATOM 240  C C   . HIS A 1 38  ? 30.757  20.138  -22.455 1.00 189.43 ? 36  HIS A C   1 
ATOM 241  O O   . HIS A 1 38  ? 30.173  19.664  -23.430 1.00 185.64 ? 36  HIS A O   1 
ATOM 242  C CB  . HIS A 1 38  ? 31.311  22.156  -23.827 1.00 194.94 ? 36  HIS A CB  1 
ATOM 243  C CG  . HIS A 1 38  ? 31.348  23.650  -23.919 1.00 202.00 ? 36  HIS A CG  1 
ATOM 244  N ND1 . HIS A 1 38  ? 32.346  24.406  -23.343 1.00 216.07 ? 36  HIS A ND1 1 
ATOM 245  C CD2 . HIS A 1 38  ? 30.508  24.528  -24.517 1.00 197.93 ? 36  HIS A CD2 1 
ATOM 246  C CE1 . HIS A 1 38  ? 32.120  25.686  -23.582 1.00 218.26 ? 36  HIS A CE1 1 
ATOM 247  N NE2 . HIS A 1 38  ? 31.012  25.787  -24.293 1.00 208.88 ? 36  HIS A NE2 1 
ATOM 248  N N   . SER A 1 39  ? 31.149  19.402  -21.418 1.00 193.69 ? 37  SER A N   1 
ATOM 249  C CA  . SER A 1 39  ? 31.047  17.941  -21.417 1.00 188.69 ? 37  SER A CA  1 
ATOM 250  C C   . SER A 1 39  ? 29.617  17.437  -21.628 1.00 177.19 ? 37  SER A C   1 
ATOM 251  O O   . SER A 1 39  ? 28.649  18.159  -21.381 1.00 169.45 ? 37  SER A O   1 
ATOM 252  C CB  . SER A 1 39  ? 31.612  17.366  -20.117 1.00 195.11 ? 37  SER A CB  1 
ATOM 253  O OG  . SER A 1 39  ? 30.933  17.881  -18.989 1.00 195.44 ? 37  SER A OG  1 
ATOM 254  N N   . GLU A 1 40  ? 29.494  16.192  -22.079 1.00 183.75 ? 38  GLU A N   1 
ATOM 255  C CA  . GLU A 1 40  ? 28.193  15.551  -22.233 1.00 183.91 ? 38  GLU A CA  1 
ATOM 256  C C   . GLU A 1 40  ? 27.539  15.250  -20.886 1.00 182.68 ? 38  GLU A C   1 
ATOM 257  O O   . GLU A 1 40  ? 26.319  15.111  -20.795 1.00 180.30 ? 38  GLU A O   1 
ATOM 258  C CB  . GLU A 1 40  ? 28.333  14.259  -23.039 1.00 191.83 ? 38  GLU A CB  1 
ATOM 259  N N   . GLU A 1 41  ? 28.356  15.163  -19.842 1.00 182.53 ? 39  GLU A N   1 
ATOM 260  C CA  . GLU A 1 41  ? 27.860  14.825  -18.514 1.00 173.42 ? 39  GLU A CA  1 
ATOM 261  C C   . GLU A 1 41  ? 27.305  16.070  -17.838 1.00 164.73 ? 39  GLU A C   1 
ATOM 262  O O   . GLU A 1 41  ? 26.290  16.011  -17.143 1.00 168.71 ? 39  GLU A O   1 
ATOM 263  C CB  . GLU A 1 41  ? 28.966  14.198  -17.663 1.00 180.12 ? 39  GLU A CB  1 
ATOM 264  N N   . ALA A 1 42  ? 27.980  17.197  -18.041 1.00 153.77 ? 40  ALA A N   1 
ATOM 265  C CA  . ALA A 1 42  ? 27.519  18.465  -17.492 1.00 146.15 ? 40  ALA A CA  1 
ATOM 266  C C   . ALA A 1 42  ? 26.277  18.915  -18.247 1.00 150.35 ? 40  ALA A C   1 
ATOM 267  O O   . ALA A 1 42  ? 25.365  19.503  -17.667 1.00 157.74 ? 40  ALA A O   1 
ATOM 268  C CB  . ALA A 1 42  ? 28.609  19.519  -17.574 1.00 144.13 ? 40  ALA A CB  1 
ATOM 269  N N   . LEU A 1 43  ? 26.261  18.639  -19.548 1.00 146.60 ? 41  LEU A N   1 
ATOM 270  C CA  . LEU A 1 43  ? 25.104  18.921  -20.388 1.00 140.54 ? 41  LEU A CA  1 
ATOM 271  C C   . LEU A 1 43  ? 23.884  18.181  -19.864 1.00 135.78 ? 41  LEU A C   1 
ATOM 272  O O   . LEU A 1 43  ? 22.819  18.767  -19.665 1.00 130.65 ? 41  LEU A O   1 
ATOM 273  C CB  . LEU A 1 43  ? 25.376  18.520  -21.838 1.00 141.86 ? 41  LEU A CB  1 
ATOM 274  N N   . PHE A 1 44  ? 24.062  16.882  -19.650 1.00 144.30 ? 42  PHE A N   1 
ATOM 275  C CA  . PHE A 1 44  ? 23.025  16.027  -19.089 1.00 140.14 ? 42  PHE A CA  1 
ATOM 276  C C   . PHE A 1 44  ? 22.511  16.567  -17.762 1.00 137.33 ? 42  PHE A C   1 
ATOM 277  O O   . PHE A 1 44  ? 21.302  16.666  -17.555 1.00 131.68 ? 42  PHE A O   1 
ATOM 278  C CB  . PHE A 1 44  ? 23.554  14.600  -18.918 1.00 144.06 ? 42  PHE A CB  1 
ATOM 279  C CG  . PHE A 1 44  ? 22.666  13.716  -18.090 1.00 142.44 ? 42  PHE A CG  1 
ATOM 280  C CD1 . PHE A 1 44  ? 21.401  13.367  -18.532 1.00 135.91 ? 42  PHE A CD1 1 
ATOM 281  C CD2 . PHE A 1 44  ? 23.107  13.217  -16.876 1.00 143.53 ? 42  PHE A CD2 1 
ATOM 282  C CE1 . PHE A 1 44  ? 20.586  12.550  -17.771 1.00 130.65 ? 42  PHE A CE1 1 
ATOM 283  C CE2 . PHE A 1 44  ? 22.298  12.398  -16.112 1.00 146.36 ? 42  PHE A CE2 1 
ATOM 284  C CZ  . PHE A 1 44  ? 21.036  12.063  -16.561 1.00 137.97 ? 42  PHE A CZ  1 
ATOM 285  N N   . LEU A 1 45  ? 23.433  16.908  -16.866 1.00 152.80 ? 43  LEU A N   1 
ATOM 286  C CA  . LEU A 1 45  ? 23.069  17.431  -15.554 1.00 161.45 ? 43  LEU A CA  1 
ATOM 287  C C   . LEU A 1 45  ? 22.211  18.691  -15.654 1.00 161.55 ? 43  LEU A C   1 
ATOM 288  O O   . LEU A 1 45  ? 21.205  18.814  -14.959 1.00 169.56 ? 43  LEU A O   1 
ATOM 289  C CB  . LEU A 1 45  ? 24.326  17.721  -14.730 1.00 155.67 ? 43  LEU A CB  1 
ATOM 290  N N   . LEU A 1 46  ? 22.616  19.629  -16.507 1.00 137.52 ? 44  LEU A N   1 
ATOM 291  C CA  . LEU A 1 46  ? 21.818  20.828  -16.760 1.00 122.77 ? 44  LEU A CA  1 
ATOM 292  C C   . LEU A 1 46  ? 20.415  20.495  -17.265 1.00 116.72 ? 44  LEU A C   1 
ATOM 293  O O   . LEU A 1 46  ? 19.422  20.977  -16.720 1.00 123.40 ? 44  LEU A O   1 
ATOM 294  C CB  . LEU A 1 46  ? 22.524  21.748  -17.757 1.00 120.07 ? 44  LEU A CB  1 
ATOM 295  C CG  . LEU A 1 46  ? 21.783  23.046  -18.096 1.00 117.62 ? 44  LEU A CG  1 
ATOM 296  C CD1 . LEU A 1 46  ? 21.298  23.757  -16.840 1.00 115.34 ? 44  LEU A CD1 1 
ATOM 297  C CD2 . LEU A 1 46  ? 22.669  23.968  -18.915 1.00 125.53 ? 44  LEU A CD2 1 
ATOM 298  N N   . ALA A 1 47  ? 20.348  19.678  -18.314 1.00 117.29 ? 45  ALA A N   1 
ATOM 299  C CA  . ALA A 1 47  ? 19.074  19.246  -18.881 1.00 115.89 ? 45  ALA A CA  1 
ATOM 300  C C   . ALA A 1 47  ? 18.243  18.551  -17.813 1.00 117.16 ? 45  ALA A C   1 
ATOM 301  O O   . ALA A 1 47  ? 17.025  18.719  -17.746 1.00 120.13 ? 45  ALA A O   1 
ATOM 302  C CB  . ALA A 1 47  ? 19.300  18.330  -20.069 1.00 132.69 ? 45  ALA A CB  1 
ATOM 303  N N   . THR A 1 48  ? 18.925  17.764  -16.987 1.00 124.83 ? 46  THR A N   1 
ATOM 304  C CA  . THR A 1 48  ? 18.311  17.097  -15.848 1.00 123.91 ? 46  THR A CA  1 
ATOM 305  C C   . THR A 1 48  ? 17.671  18.153  -14.956 1.00 122.70 ? 46  THR A C   1 
ATOM 306  O O   . THR A 1 48  ? 16.504  18.040  -14.583 1.00 133.94 ? 46  THR A O   1 
ATOM 307  C CB  . THR A 1 48  ? 19.332  16.265  -15.050 1.00 126.10 ? 46  THR A CB  1 
ATOM 308  O OG1 . THR A 1 48  ? 19.886  15.249  -15.895 1.00 128.01 ? 46  THR A OG1 1 
ATOM 309  C CG2 . THR A 1 48  ? 18.670  15.609  -13.855 1.00 128.41 ? 46  THR A CG2 1 
ATOM 310  N N   . CYS A 1 49  ? 18.451  19.176  -14.614 1.00 116.58 ? 47  CYS A N   1 
ATOM 311  C CA  . CYS A 1 49  ? 17.984  20.251  -13.744 1.00 114.43 ? 47  CYS A CA  1 
ATOM 312  C C   . CYS A 1 49  ? 16.769  20.966  -14.330 1.00 112.10 ? 47  CYS A C   1 
ATOM 313  O O   . CYS A 1 49  ? 15.783  21.182  -13.626 1.00 112.77 ? 47  CYS A O   1 
ATOM 314  C CB  . CYS A 1 49  ? 19.101  21.264  -13.477 1.00 115.07 ? 47  CYS A CB  1 
ATOM 315  S SG  . CYS A 1 49  ? 20.517  20.613  -12.566 1.00 161.95 ? 47  CYS A SG  1 
ATOM 316  N N   . TYR A 1 50  ? 16.845  21.352  -15.602 1.00 110.39 ? 48  TYR A N   1 
ATOM 317  C CA  . TYR A 1 50  ? 15.695  21.956  -16.273 1.00 107.60 ? 48  TYR A CA  1 
ATOM 318  C C   . TYR A 1 50  ? 14.452  21.071  -16.204 1.00 106.64 ? 48  TYR A C   1 
ATOM 319  O O   . TYR A 1 50  ? 13.343  21.570  -16.014 1.00 107.74 ? 48  TYR A O   1 
ATOM 320  C CB  . TYR A 1 50  ? 16.026  22.280  -17.733 1.00 107.87 ? 48  TYR A CB  1 
ATOM 321  C CG  . TYR A 1 50  ? 16.987  23.436  -17.906 1.00 109.13 ? 48  TYR A CG  1 
ATOM 322  C CD1 . TYR A 1 50  ? 17.813  23.523  -19.019 1.00 111.16 ? 48  TYR A CD1 1 
ATOM 323  C CD2 . TYR A 1 50  ? 17.044  24.458  -16.969 1.00 120.46 ? 48  TYR A CD2 1 
ATOM 324  C CE1 . TYR A 1 50  ? 18.683  24.588  -19.181 1.00 112.89 ? 48  TYR A CE1 1 
ATOM 325  C CE2 . TYR A 1 50  ? 17.907  25.524  -17.124 1.00 128.05 ? 48  TYR A CE2 1 
ATOM 326  C CZ  . TYR A 1 50  ? 18.725  25.586  -18.230 1.00 115.98 ? 48  TYR A CZ  1 
ATOM 327  O OH  . TYR A 1 50  ? 19.586  26.649  -18.382 1.00 114.48 ? 48  TYR A OH  1 
ATOM 328  N N   . TYR A 1 51  ? 14.633  19.763  -16.361 1.00 109.12 ? 49  TYR A N   1 
ATOM 329  C CA  . TYR A 1 51  ? 13.501  18.843  -16.340 1.00 111.25 ? 49  TYR A CA  1 
ATOM 330  C C   . TYR A 1 51  ? 12.831  18.657  -14.989 1.00 122.11 ? 49  TYR A C   1 
ATOM 331  O O   . TYR A 1 51  ? 11.604  18.585  -14.905 1.00 132.33 ? 49  TYR A O   1 
ATOM 332  C CB  . TYR A 1 51  ? 13.938  17.469  -16.854 1.00 109.68 ? 49  TYR A CB  1 
ATOM 333  C CG  . TYR A 1 51  ? 12.791  16.496  -17.003 1.00 110.40 ? 49  TYR A CG  1 
ATOM 334  C CD1 . TYR A 1 51  ? 12.473  15.616  -15.974 1.00 112.42 ? 49  TYR A CD1 1 
ATOM 335  C CD2 . TYR A 1 51  ? 11.987  16.498  -18.128 1.00 112.33 ? 49  TYR A CD2 1 
ATOM 336  C CE1 . TYR A 1 51  ? 11.419  14.736  -16.084 1.00 113.20 ? 49  TYR A CE1 1 
ATOM 337  C CE2 . TYR A 1 51  ? 10.928  15.621  -18.250 1.00 111.19 ? 49  TYR A CE2 1 
ATOM 338  C CZ  . TYR A 1 51  ? 10.648  14.743  -17.223 1.00 111.82 ? 49  TYR A CZ  1 
ATOM 339  O OH  . TYR A 1 51  ? 9.594   13.867  -17.338 1.00 116.71 ? 49  TYR A OH  1 
ATOM 340  N N   . ARG A 1 52  ? 13.628  18.578  -13.933 1.00 124.92 ? 50  ARG A N   1 
ATOM 341  C CA  . ARG A 1 52  ? 13.073  18.369  -12.605 1.00 127.34 ? 50  ARG A CA  1 
ATOM 342  C C   . ARG A 1 52  ? 12.508  19.651  -12.008 1.00 129.52 ? 50  ARG A C   1 
ATOM 343  O O   . ARG A 1 52  ? 11.666  19.618  -11.110 1.00 147.37 ? 50  ARG A O   1 
ATOM 344  C CB  . ARG A 1 52  ? 14.119  17.742  -11.694 1.00 129.05 ? 50  ARG A CB  1 
ATOM 345  C CG  . ARG A 1 52  ? 14.541  16.374  -12.202 1.00 129.79 ? 50  ARG A CG  1 
ATOM 346  C CD  . ARG A 1 52  ? 15.488  15.691  -11.256 1.00 144.25 ? 50  ARG A CD  1 
ATOM 347  N NE  . ARG A 1 52  ? 14.739  15.243  -10.090 1.00 164.96 ? 50  ARG A NE  1 
ATOM 348  C CZ  . ARG A 1 52  ? 15.255  15.080  -8.880  1.00 178.37 ? 50  ARG A CZ  1 
ATOM 349  N NH1 . ARG A 1 52  ? 16.541  15.316  -8.664  1.00 179.62 ? 50  ARG A NH1 1 
ATOM 350  N NH2 . ARG A 1 52  ? 14.481  14.670  -7.889  1.00 183.53 ? 50  ARG A NH2 1 
ATOM 351  N N   . SER A 1 53  ? 12.982  20.780  -12.521 1.00 116.18 ? 51  SER A N   1 
ATOM 352  C CA  . SER A 1 53  ? 12.440  22.092  -12.187 1.00 115.72 ? 51  SER A CA  1 
ATOM 353  C C   . SER A 1 53  ? 11.024  22.279  -12.736 1.00 118.36 ? 51  SER A C   1 
ATOM 354  O O   . SER A 1 53  ? 10.386  23.303  -12.494 1.00 117.63 ? 51  SER A O   1 
ATOM 355  C CB  . SER A 1 53  ? 13.364  23.193  -12.706 1.00 125.60 ? 51  SER A CB  1 
ATOM 356  O OG  . SER A 1 53  ? 13.224  23.354  -14.105 1.00 138.51 ? 51  SER A OG  1 
ATOM 357  N N   . GLY A 1 54  ? 10.537  21.279  -13.468 1.00 126.27 ? 52  GLY A N   1 
ATOM 358  C CA  . GLY A 1 54  ? 9.176   21.286  -13.972 1.00 130.95 ? 52  GLY A CA  1 
ATOM 359  C C   . GLY A 1 54  ? 9.000   21.905  -15.346 1.00 124.67 ? 52  GLY A C   1 
ATOM 360  O O   . GLY A 1 54  ? 7.880   22.200  -15.760 1.00 133.96 ? 52  GLY A O   1 
ATOM 361  N N   . LYS A 1 55  ? 10.107  22.111  -16.051 1.00 113.08 ? 53  LYS A N   1 
ATOM 362  C CA  . LYS A 1 55  ? 10.067  22.750  -17.362 1.00 112.43 ? 53  LYS A CA  1 
ATOM 363  C C   . LYS A 1 55  ? 10.733  21.848  -18.399 1.00 128.53 ? 53  LYS A C   1 
ATOM 364  O O   . LYS A 1 55  ? 11.866  22.095  -18.816 1.00 121.96 ? 53  LYS A O   1 
ATOM 365  C CB  . LYS A 1 55  ? 10.752  24.116  -17.319 1.00 108.81 ? 53  LYS A CB  1 
ATOM 366  N N   . ALA A 1 56  ? 10.020  20.797  -18.801 1.00 142.53 ? 54  ALA A N   1 
ATOM 367  C CA  . ALA A 1 56  ? 10.501  19.862  -19.816 1.00 137.66 ? 54  ALA A CA  1 
ATOM 368  C C   . ALA A 1 56  ? 10.914  20.548  -21.115 1.00 119.61 ? 54  ALA A C   1 
ATOM 369  O O   . ALA A 1 56  ? 11.960  20.227  -21.680 1.00 121.88 ? 54  ALA A O   1 
ATOM 370  C CB  . ALA A 1 56  ? 9.436   18.811  -20.100 1.00 153.26 ? 54  ALA A CB  1 
ATOM 371  N N   . TYR A 1 57  ? 10.077  21.471  -21.590 1.00 119.77 ? 55  TYR A N   1 
ATOM 372  C CA  . TYR A 1 57  ? 10.309  22.175  -22.853 1.00 122.41 ? 55  TYR A CA  1 
ATOM 373  C C   . TYR A 1 57  ? 11.721  22.749  -22.932 1.00 121.95 ? 55  TYR A C   1 
ATOM 374  O O   . TYR A 1 57  ? 12.331  22.775  -23.996 1.00 127.58 ? 55  TYR A O   1 
ATOM 375  C CB  . TYR A 1 57  ? 9.261   23.278  -23.065 1.00 126.02 ? 55  TYR A CB  1 
ATOM 376  C CG  . TYR A 1 57  ? 9.439   24.534  -22.236 1.00 131.18 ? 55  TYR A CG  1 
ATOM 377  C CD1 . TYR A 1 57  ? 10.340  25.527  -22.614 1.00 125.82 ? 55  TYR A CD1 1 
ATOM 378  C CD2 . TYR A 1 57  ? 8.699   24.731  -21.080 1.00 143.98 ? 55  TYR A CD2 1 
ATOM 379  C CE1 . TYR A 1 57  ? 10.498  26.671  -21.861 1.00 126.98 ? 55  TYR A CE1 1 
ATOM 380  C CE2 . TYR A 1 57  ? 8.851   25.873  -20.321 1.00 146.78 ? 55  TYR A CE2 1 
ATOM 381  C CZ  . TYR A 1 57  ? 9.751   26.840  -20.716 1.00 137.85 ? 55  TYR A CZ  1 
ATOM 382  O OH  . TYR A 1 57  ? 9.906   27.978  -19.959 1.00 146.08 ? 55  TYR A OH  1 
ATOM 383  N N   . LYS A 1 58  ? 12.236  23.193  -21.790 1.00 119.33 ? 56  LYS A N   1 
ATOM 384  C CA  . LYS A 1 58  ? 13.572  23.763  -21.726 1.00 120.28 ? 56  LYS A CA  1 
ATOM 385  C C   . LYS A 1 58  ? 14.599  22.671  -21.970 1.00 119.93 ? 56  LYS A C   1 
ATOM 386  O O   . LYS A 1 58  ? 15.525  22.842  -22.762 1.00 126.65 ? 56  LYS A O   1 
ATOM 387  C CB  . LYS A 1 58  ? 13.813  24.433  -20.372 1.00 117.41 ? 56  LYS A CB  1 
ATOM 388  N N   . ALA A 1 59  ? 14.434  21.553  -21.274 1.00 114.15 ? 57  ALA A N   1 
ATOM 389  C CA  . ALA A 1 59  ? 15.315  20.410  -21.454 1.00 115.69 ? 57  ALA A CA  1 
ATOM 390  C C   . ALA A 1 59  ? 15.300  19.909  -22.898 1.00 126.18 ? 57  ALA A C   1 
ATOM 391  O O   . ALA A 1 59  ? 16.342  19.531  -23.434 1.00 131.58 ? 57  ALA A O   1 
ATOM 392  C CB  . ALA A 1 59  ? 14.925  19.292  -20.502 1.00 121.83 ? 57  ALA A CB  1 
ATOM 393  N N   . TYR A 1 60  ? 14.121  19.897  -23.520 1.00 137.13 ? 58  TYR A N   1 
ATOM 394  C CA  . TYR A 1 60  ? 14.005  19.504  -24.925 1.00 140.57 ? 58  TYR A CA  1 
ATOM 395  C C   . TYR A 1 60  ? 14.858  20.341  -25.878 1.00 143.76 ? 58  TYR A C   1 
ATOM 396  O O   . TYR A 1 60  ? 15.639  19.784  -26.640 1.00 153.38 ? 58  TYR A O   1 
ATOM 397  C CB  . TYR A 1 60  ? 12.541  19.553  -25.374 1.00 135.33 ? 58  TYR A CB  1 
ATOM 398  C CG  . TYR A 1 60  ? 12.343  19.243  -26.844 1.00 128.92 ? 58  TYR A CG  1 
ATOM 399  C CD1 . TYR A 1 60  ? 12.176  17.935  -27.277 1.00 131.33 ? 58  TYR A CD1 1 
ATOM 400  C CD2 . TYR A 1 60  ? 12.302  20.256  -27.796 1.00 135.88 ? 58  TYR A CD2 1 
ATOM 401  C CE1 . TYR A 1 60  ? 11.991  17.641  -28.615 1.00 141.72 ? 58  TYR A CE1 1 
ATOM 402  C CE2 . TYR A 1 60  ? 12.120  19.970  -29.138 1.00 145.29 ? 58  TYR A CE2 1 
ATOM 403  C CZ  . TYR A 1 60  ? 11.962  18.661  -29.541 1.00 145.56 ? 58  TYR A CZ  1 
ATOM 404  O OH  . TYR A 1 60  ? 11.780  18.366  -30.873 1.00 145.79 ? 58  TYR A OH  1 
ATOM 405  N N   . ARG A 1 61  ? 14.732  21.666  -25.830 1.00 138.09 ? 59  ARG A N   1 
ATOM 406  C CA  . ARG A 1 61  ? 15.450  22.509  -26.789 1.00 143.04 ? 59  ARG A CA  1 
ATOM 407  C C   . ARG A 1 61  ? 16.942  22.478  -26.498 1.00 145.25 ? 59  ARG A C   1 
ATOM 408  O O   . ARG A 1 61  ? 17.760  22.501  -27.416 1.00 151.70 ? 59  ARG A O   1 
ATOM 409  C CB  . ARG A 1 61  ? 14.941  23.957  -26.816 1.00 143.52 ? 59  ARG A CB  1 
ATOM 410  C CG  . ARG A 1 61  ? 13.481  24.174  -26.470 1.00 141.86 ? 59  ARG A CG  1 
ATOM 411  C CD  . ARG A 1 61  ? 13.049  25.561  -26.944 1.00 150.06 ? 59  ARG A CD  1 
ATOM 412  N NE  . ARG A 1 61  ? 11.642  25.628  -27.333 1.00 165.39 ? 59  ARG A NE  1 
ATOM 413  C CZ  . ARG A 1 61  ? 11.193  25.392  -28.563 1.00 177.28 ? 59  ARG A CZ  1 
ATOM 414  N NH1 . ARG A 1 61  ? 12.039  25.060  -29.529 1.00 180.95 ? 59  ARG A NH1 1 
ATOM 415  N NH2 . ARG A 1 61  ? 9.897   25.487  -28.828 1.00 181.68 ? 59  ARG A NH2 1 
ATOM 416  N N   . LEU A 1 62  ? 17.289  22.445  -25.216 1.00 146.03 ? 60  LEU A N   1 
ATOM 417  C CA  . LEU A 1 62  ? 18.687  22.395  -24.812 1.00 146.65 ? 60  LEU A CA  1 
ATOM 418  C C   . LEU A 1 62  ? 19.380  21.148  -25.366 1.00 153.63 ? 60  LEU A C   1 
ATOM 419  O O   . LEU A 1 62  ? 20.366  21.265  -26.091 1.00 171.46 ? 60  LEU A O   1 
ATOM 420  C CB  . LEU A 1 62  ? 18.803  22.432  -23.287 1.00 137.22 ? 60  LEU A CB  1 
ATOM 421  N N   . LEU A 1 63  ? 18.875  19.964  -25.029 1.00 142.48 ? 61  LEU A N   1 
ATOM 422  C CA  . LEU A 1 63  ? 19.484  18.719  -25.501 1.00 138.92 ? 61  LEU A CA  1 
ATOM 423  C C   . LEU A 1 63  ? 19.475  18.608  -27.026 1.00 152.33 ? 61  LEU A C   1 
ATOM 424  O O   . LEU A 1 63  ? 20.452  18.173  -27.638 1.00 157.87 ? 61  LEU A O   1 
ATOM 425  C CB  . LEU A 1 63  ? 18.760  17.513  -24.897 1.00 128.74 ? 61  LEU A CB  1 
ATOM 426  N N   . LYS A 1 64  ? 18.353  19.000  -27.620 1.00 147.76 ? 62  LYS A N   1 
ATOM 427  C CA  . LYS A 1 64  ? 18.133  18.945  -29.065 1.00 148.41 ? 62  LYS A CA  1 
ATOM 428  C C   . LYS A 1 64  ? 19.044  19.835  -29.908 1.00 151.50 ? 62  LYS A C   1 
ATOM 429  O O   . LYS A 1 64  ? 19.501  19.421  -30.973 1.00 155.45 ? 62  LYS A O   1 
ATOM 430  C CB  . LYS A 1 64  ? 16.679  19.291  -29.393 1.00 143.44 ? 62  LYS A CB  1 
ATOM 431  N N   . GLY A 1 65  ? 19.316  21.051  -29.436 1.00 155.10 ? 63  GLY A N   1 
ATOM 432  C CA  . GLY A 1 65  ? 20.014  22.034  -30.254 1.00 174.29 ? 63  GLY A CA  1 
ATOM 433  C C   . GLY A 1 65  ? 21.458  21.757  -30.614 1.00 185.43 ? 63  GLY A C   1 
ATOM 434  O O   . GLY A 1 65  ? 21.897  22.132  -31.701 1.00 199.74 ? 63  GLY A O   1 
ATOM 435  N N   . HIS A 1 66  ? 22.204  21.109  -29.733 1.00 176.61 ? 64  HIS A N   1 
ATOM 436  C CA  . HIS A 1 66  ? 23.516  20.600  -30.112 1.00 182.84 ? 64  HIS A CA  1 
ATOM 437  C C   . HIS A 1 66  ? 23.524  19.164  -29.604 1.00 176.29 ? 64  HIS A C   1 
ATOM 438  O O   . HIS A 1 66  ? 23.623  18.898  -28.408 1.00 178.40 ? 64  HIS A O   1 
ATOM 439  C CB  . HIS A 1 66  ? 24.679  21.441  -29.578 1.00 189.61 ? 64  HIS A CB  1 
ATOM 440  C CG  . HIS A 1 66  ? 24.752  21.511  -28.089 1.00 181.04 ? 64  HIS A CG  1 
ATOM 441  N ND1 . HIS A 1 66  ? 23.794  22.140  -27.325 1.00 178.31 ? 64  HIS A ND1 1 
ATOM 442  C CD2 . HIS A 1 66  ? 25.663  21.018  -27.221 1.00 182.70 ? 64  HIS A CD2 1 
ATOM 443  C CE1 . HIS A 1 66  ? 24.118  22.041  -26.048 1.00 184.29 ? 64  HIS A CE1 1 
ATOM 444  N NE2 . HIS A 1 66  ? 25.245  21.361  -25.958 1.00 186.39 ? 64  HIS A NE2 1 
ATOM 445  N N   . SER A 1 67  ? 23.422  18.243  -30.549 1.00 183.99 ? 65  SER A N   1 
ATOM 446  C CA  . SER A 1 67  ? 22.961  16.883  -30.296 1.00 186.58 ? 65  SER A CA  1 
ATOM 447  C C   . SER A 1 67  ? 23.942  15.976  -29.564 1.00 176.34 ? 65  SER A C   1 
ATOM 448  O O   . SER A 1 67  ? 25.087  15.806  -29.982 1.00 183.06 ? 65  SER A O   1 
ATOM 449  C CB  . SER A 1 67  ? 22.562  16.227  -31.614 1.00 201.12 ? 65  SER A CB  1 
ATOM 450  O OG  . SER A 1 67  ? 21.389  15.451  -31.449 1.00 206.62 ? 65  SER A OG  1 
ATOM 451  N N   . CYS A 1 68  ? 23.475  15.399  -28.460 1.00 164.10 ? 66  CYS A N   1 
ATOM 452  C CA  . CYS A 1 68  ? 24.265  14.441  -27.703 1.00 164.85 ? 66  CYS A CA  1 
ATOM 453  C C   . CYS A 1 68  ? 23.678  13.053  -27.924 1.00 158.46 ? 66  CYS A C   1 
ATOM 454  O O   . CYS A 1 68  ? 22.461  12.883  -28.016 1.00 151.86 ? 66  CYS A O   1 
ATOM 455  C CB  . CYS A 1 68  ? 24.272  14.786  -26.212 1.00 173.50 ? 66  CYS A CB  1 
ATOM 456  S SG  . CYS A 1 68  ? 25.686  14.138  -25.302 1.00 233.06 ? 66  CYS A SG  1 
ATOM 457  N N   . THR A 1 69  ? 24.560  12.064  -28.002 1.00 171.27 ? 67  THR A N   1 
ATOM 458  C CA  . THR A 1 69  ? 24.181  10.690  -28.312 1.00 168.01 ? 67  THR A CA  1 
ATOM 459  C C   . THR A 1 69  ? 24.310  9.724   -27.143 1.00 167.22 ? 67  THR A C   1 
ATOM 460  O O   . THR A 1 69  ? 24.045  8.531   -27.289 1.00 180.34 ? 67  THR A O   1 
ATOM 461  C CB  . THR A 1 69  ? 25.023  10.142  -29.481 1.00 179.68 ? 67  THR A CB  1 
ATOM 462  N N   . THR A 1 70  ? 24.730  10.229  -25.991 1.00 161.32 ? 68  THR A N   1 
ATOM 463  C CA  . THR A 1 70  ? 24.945  9.373   -24.834 1.00 159.99 ? 68  THR A CA  1 
ATOM 464  C C   . THR A 1 70  ? 23.617  8.865   -24.273 1.00 153.28 ? 68  THR A C   1 
ATOM 465  O O   . THR A 1 70  ? 22.606  9.564   -24.340 1.00 154.32 ? 68  THR A O   1 
ATOM 466  C CB  . THR A 1 70  ? 25.707  10.124  -23.726 1.00 169.91 ? 68  THR A CB  1 
ATOM 467  O OG1 . THR A 1 70  ? 24.930  11.245  -23.283 1.00 165.23 ? 68  THR A OG1 1 
ATOM 468  C CG2 . THR A 1 70  ? 27.053  10.607  -24.245 1.00 180.43 ? 68  THR A CG2 1 
ATOM 469  N N   . PRO A 1 71  ? 23.616  7.634   -23.732 1.00 150.23 ? 69  PRO A N   1 
ATOM 470  C CA  . PRO A 1 71  ? 22.414  6.978   -23.202 1.00 146.20 ? 69  PRO A CA  1 
ATOM 471  C C   . PRO A 1 71  ? 21.665  7.825   -22.178 1.00 151.03 ? 69  PRO A C   1 
ATOM 472  O O   . PRO A 1 71  ? 20.435  7.832   -22.166 1.00 148.18 ? 69  PRO A O   1 
ATOM 473  C CB  . PRO A 1 71  ? 22.967  5.705   -22.555 1.00 151.37 ? 69  PRO A CB  1 
ATOM 474  C CG  . PRO A 1 71  ? 24.219  5.426   -23.301 1.00 161.11 ? 69  PRO A CG  1 
ATOM 475  C CD  . PRO A 1 71  ? 24.803  6.767   -23.618 1.00 158.95 ? 69  PRO A CD  1 
ATOM 476  N N   . GLN A 1 72  ? 22.407  8.532   -21.332 1.00 162.49 ? 70  GLN A N   1 
ATOM 477  C CA  . GLN A 1 72  ? 21.808  9.388   -20.315 1.00 161.52 ? 70  GLN A CA  1 
ATOM 478  C C   . GLN A 1 72  ? 21.064  10.583  -20.903 1.00 156.41 ? 70  GLN A C   1 
ATOM 479  O O   . GLN A 1 72  ? 20.009  10.972  -20.403 1.00 165.35 ? 70  GLN A O   1 
ATOM 480  C CB  . GLN A 1 72  ? 22.894  9.891   -19.362 1.00 179.65 ? 70  GLN A CB  1 
ATOM 481  C CG  . GLN A 1 72  ? 24.175  9.070   -19.395 1.00 199.90 ? 70  GLN A CG  1 
ATOM 482  C CD  . GLN A 1 72  ? 25.422  9.935   -19.427 1.00 211.13 ? 70  GLN A CD  1 
ATOM 483  O OE1 . GLN A 1 72  ? 25.363  11.118  -19.763 1.00 209.37 ? 70  GLN A OE1 1 
ATOM 484  N NE2 . GLN A 1 72  ? 26.559  9.347   -19.072 1.00 220.53 ? 70  GLN A NE2 1 
ATOM 485  N N   . CYS A 1 73  ? 21.612  11.159  -21.966 1.00 144.64 ? 71  CYS A N   1 
ATOM 486  C CA  . CYS A 1 73  ? 20.924  12.213  -22.702 1.00 139.62 ? 71  CYS A CA  1 
ATOM 487  C C   . CYS A 1 73  ? 19.758  11.687  -23.534 1.00 133.45 ? 71  CYS A C   1 
ATOM 488  O O   . CYS A 1 73  ? 18.686  12.293  -23.568 1.00 130.30 ? 71  CYS A O   1 
ATOM 489  C CB  . CYS A 1 73  ? 21.909  12.959  -23.603 1.00 147.99 ? 71  CYS A CB  1 
ATOM 490  S SG  . CYS A 1 73  ? 23.059  14.033  -22.714 1.00 170.28 ? 71  CYS A SG  1 
ATOM 491  N N   . LYS A 1 74  ? 19.975  10.561  -24.206 1.00 126.63 ? 72  LYS A N   1 
ATOM 492  C CA  . LYS A 1 74  ? 18.946  9.950   -25.042 1.00 122.45 ? 72  LYS A CA  1 
ATOM 493  C C   . LYS A 1 74  ? 17.684  9.543   -24.284 1.00 116.24 ? 72  LYS A C   1 
ATOM 494  O O   . LYS A 1 74  ? 16.574  9.775   -24.764 1.00 112.67 ? 72  LYS A O   1 
ATOM 495  C CB  . LYS A 1 74  ? 19.520  8.728   -25.763 1.00 124.52 ? 72  LYS A CB  1 
ATOM 496  N N   . TYR A 1 75  ? 17.849  8.922   -23.119 1.00 123.44 ? 73  TYR A N   1 
ATOM 497  C CA  . TYR A 1 75  ? 16.701  8.578   -22.282 1.00 122.29 ? 73  TYR A CA  1 
ATOM 498  C C   . TYR A 1 75  ? 15.902  9.824   -21.929 1.00 123.39 ? 73  TYR A C   1 
ATOM 499  O O   . TYR A 1 75  ? 14.681  9.867   -22.079 1.00 134.25 ? 73  TYR A O   1 
ATOM 500  C CB  . TYR A 1 75  ? 17.110  7.867   -20.997 1.00 116.12 ? 73  TYR A CB  1 
ATOM 501  C CG  . TYR A 1 75  ? 15.900  7.542   -20.152 1.00 113.09 ? 73  TYR A CG  1 
ATOM 502  C CD1 . TYR A 1 75  ? 14.997  6.573   -20.566 1.00 119.46 ? 73  TYR A CD1 1 
ATOM 503  C CD2 . TYR A 1 75  ? 15.633  8.224   -18.974 1.00 113.06 ? 73  TYR A CD2 1 
ATOM 504  C CE1 . TYR A 1 75  ? 13.879  6.267   -19.821 1.00 116.78 ? 73  TYR A CE1 1 
ATOM 505  C CE2 . TYR A 1 75  ? 14.509  7.925   -18.219 1.00 119.58 ? 73  TYR A CE2 1 
ATOM 506  C CZ  . TYR A 1 75  ? 13.636  6.945   -18.650 1.00 108.31 ? 73  TYR A CZ  1 
ATOM 507  O OH  . TYR A 1 75  ? 12.518  6.638   -17.909 1.00 109.55 ? 73  TYR A OH  1 
ATOM 508  N N   . LEU A 1 76  ? 16.619  10.832  -21.449 1.00 110.54 ? 74  LEU A N   1 
ATOM 509  C CA  . LEU A 1 76  ? 16.023  12.071  -20.976 1.00 110.63 ? 74  LEU A CA  1 
ATOM 510  C C   . LEU A 1 76  ? 15.360  12.848  -22.103 1.00 110.63 ? 74  LEU A C   1 
ATOM 511  O O   . LEU A 1 76  ? 14.239  13.334  -21.949 1.00 111.48 ? 74  LEU A O   1 
ATOM 512  C CB  . LEU A 1 76  ? 17.084  12.943  -20.306 1.00 113.71 ? 74  LEU A CB  1 
ATOM 513  C CG  . LEU A 1 76  ? 16.625  14.310  -19.801 1.00 112.63 ? 74  LEU A CG  1 
ATOM 514  C CD1 . LEU A 1 76  ? 15.537  14.166  -18.749 1.00 111.53 ? 74  LEU A CD1 1 
ATOM 515  C CD2 . LEU A 1 76  ? 17.808  15.090  -19.254 1.00 120.00 ? 74  LEU A CD2 1 
ATOM 516  N N   . LEU A 1 77  ? 16.055  12.973  -23.228 1.00 116.16 ? 75  LEU A N   1 
ATOM 517  C CA  . LEU A 1 77  ? 15.481  13.652  -24.379 1.00 117.61 ? 75  LEU A CA  1 
ATOM 518  C C   . LEU A 1 77  ? 14.198  12.972  -24.841 1.00 114.13 ? 75  LEU A C   1 
ATOM 519  O O   . LEU A 1 77  ? 13.229  13.645  -25.169 1.00 114.05 ? 75  LEU A O   1 
ATOM 520  C CB  . LEU A 1 77  ? 16.488  13.700  -25.531 1.00 116.16 ? 75  LEU A CB  1 
ATOM 521  N N   . ALA A 1 78  ? 14.179  11.643  -24.835 1.00 113.71 ? 76  ALA A N   1 
ATOM 522  C CA  . ALA A 1 78  ? 12.966  10.906  -25.175 1.00 113.48 ? 76  ALA A CA  1 
ATOM 523  C C   . ALA A 1 78  ? 11.823  11.146  -24.186 1.00 119.14 ? 76  ALA A C   1 
ATOM 524  O O   . ALA A 1 78  ? 10.672  11.310  -24.587 1.00 120.45 ? 76  ALA A O   1 
ATOM 525  C CB  . ALA A 1 78  ? 13.269  9.416   -25.267 1.00 109.08 ? 76  ALA A CB  1 
ATOM 526  N N   . LYS A 1 79  ? 12.149  11.168  -22.898 1.00 124.10 ? 77  LYS A N   1 
ATOM 527  C CA  . LYS A 1 79  ? 11.160  11.421  -21.851 1.00 122.51 ? 77  LYS A CA  1 
ATOM 528  C C   . LYS A 1 79  ? 10.515  12.808  -21.897 1.00 124.40 ? 77  LYS A C   1 
ATOM 529  O O   . LYS A 1 79  ? 9.308   12.935  -21.690 1.00 139.93 ? 77  LYS A O   1 
ATOM 530  C CB  . LYS A 1 79  ? 11.795  11.209  -20.473 1.00 121.31 ? 77  LYS A CB  1 
ATOM 531  C CG  . LYS A 1 79  ? 10.789  11.069  -19.337 1.00 124.26 ? 77  LYS A CG  1 
ATOM 532  C CD  . LYS A 1 79  ? 11.164  9.936   -18.393 1.00 142.56 ? 77  LYS A CD  1 
ATOM 533  C CE  . LYS A 1 79  ? 10.010  8.962   -18.207 1.00 158.92 ? 77  LYS A CE  1 
ATOM 534  N NZ  . LYS A 1 79  ? 8.778   9.636   -17.710 1.00 155.28 ? 77  LYS A NZ  1 
ATOM 535  N N   . CYS A 1 80  ? 11.310  13.839  -22.175 1.00 112.02 ? 78  CYS A N   1 
ATOM 536  C CA  . CYS A 1 80  ? 10.771  15.189  -22.337 1.00 110.98 ? 78  CYS A CA  1 
ATOM 537  C C   . CYS A 1 80  ? 9.785   15.254  -23.491 1.00 113.39 ? 78  CYS A C   1 
ATOM 538  O O   . CYS A 1 80  ? 8.764   15.936  -23.430 1.00 114.10 ? 78  CYS A O   1 
ATOM 539  C CB  . CYS A 1 80  ? 11.906  16.181  -22.591 1.00 111.52 ? 78  CYS A CB  1 
ATOM 540  S SG  . CYS A 1 80  ? 13.070  16.376  -21.235 1.00 110.82 ? 78  CYS A SG  1 
ATOM 541  N N   . CYS A 1 81  ? 10.112  14.509  -24.536 1.00 122.22 ? 79  CYS A N   1 
ATOM 542  C CA  . CYS A 1 81  ? 9.293   14.379  -25.730 1.00 121.89 ? 79  CYS A CA  1 
ATOM 543  C C   . CYS A 1 81  ? 7.947   13.759  -25.396 1.00 120.80 ? 79  CYS A C   1 
ATOM 544  O O   . CYS A 1 81  ? 6.899   14.262  -25.803 1.00 125.20 ? 79  CYS A O   1 
ATOM 545  C CB  . CYS A 1 81  ? 10.040  13.587  -26.788 1.00 122.96 ? 79  CYS A CB  1 
ATOM 546  S SG  . CYS A 1 81  ? 11.466  14.526  -27.367 1.00 199.31 ? 79  CYS A SG  1 
ATOM 547  N N   . VAL A 1 82  ? 7.993   12.651  -24.666 1.00 110.78 ? 80  VAL A N   1 
ATOM 548  C CA  . VAL A 1 82  ? 6.791   11.938  -24.264 1.00 111.13 ? 80  VAL A CA  1 
ATOM 549  C C   . VAL A 1 82  ? 5.908   12.874  -23.439 1.00 115.25 ? 80  VAL A C   1 
ATOM 550  O O   . VAL A 1 82  ? 4.695   12.923  -23.639 1.00 124.88 ? 80  VAL A O   1 
ATOM 551  C CB  . VAL A 1 82  ? 7.135   10.673  -23.449 1.00 116.58 ? 80  VAL A CB  1 
ATOM 552  C CG1 . VAL A 1 82  ? 5.875   10.022  -22.905 1.00 117.86 ? 80  VAL A CG1 1 
ATOM 553  C CG2 . VAL A 1 82  ? 7.919   9.687   -24.303 1.00 122.21 ? 80  VAL A CG2 1 
ATOM 554  N N   . ASP A 1 83  ? 6.517   13.602  -22.508 1.00 120.89 ? 81  ASP A N   1 
ATOM 555  C CA  . ASP A 1 83  ? 5.803   14.593  -21.701 1.00 127.11 ? 81  ASP A CA  1 
ATOM 556  C C   . ASP A 1 83  ? 5.080   15.631  -22.568 1.00 128.04 ? 81  ASP A C   1 
ATOM 557  O O   . ASP A 1 83  ? 3.966   16.055  -22.259 1.00 139.77 ? 81  ASP A O   1 
ATOM 558  C CB  . ASP A 1 83  ? 6.773   15.299  -20.752 1.00 135.35 ? 81  ASP A CB  1 
ATOM 559  C CG  . ASP A 1 83  ? 7.215   14.415  -19.604 1.00 145.94 ? 81  ASP A CG  1 
ATOM 560  O OD1 . ASP A 1 83  ? 6.342   13.865  -18.903 1.00 153.14 ? 81  ASP A OD1 1 
ATOM 561  O OD2 . ASP A 1 83  ? 8.438   14.264  -19.407 1.00 144.59 ? 81  ASP A OD2 1 
ATOM 562  N N   . LEU A 1 84  ? 5.743   16.037  -23.648 1.00 116.91 ? 82  LEU A N   1 
ATOM 563  C CA  . LEU A 1 84  ? 5.227   17.012  -24.613 1.00 116.57 ? 82  LEU A CA  1 
ATOM 564  C C   . LEU A 1 84  ? 4.435   16.410  -25.780 1.00 124.71 ? 82  LEU A C   1 
ATOM 565  O O   . LEU A 1 84  ? 4.150   17.096  -26.764 1.00 117.51 ? 82  LEU A O   1 
ATOM 566  C CB  . LEU A 1 84  ? 6.371   17.883  -25.130 1.00 112.53 ? 82  LEU A CB  1 
ATOM 567  C CG  . LEU A 1 84  ? 7.090   18.576  -23.969 1.00 110.68 ? 82  LEU A CG  1 
ATOM 568  C CD1 . LEU A 1 84  ? 8.477   19.055  -24.360 1.00 111.31 ? 82  LEU A CD1 1 
ATOM 569  C CD2 . LEU A 1 84  ? 6.244   19.733  -23.444 1.00 135.93 ? 82  LEU A CD2 1 
ATOM 570  N N   . SER A 1 85  ? 4.078   15.137  -25.652 1.00 136.18 ? 83  SER A N   1 
ATOM 571  C CA  . SER A 1 85  ? 3.430   14.373  -26.717 1.00 139.52 ? 83  SER A CA  1 
ATOM 572  C C   . SER A 1 85  ? 4.120   14.398  -28.080 1.00 140.65 ? 83  SER A C   1 
ATOM 573  O O   . SER A 1 85  ? 3.461   14.513  -29.113 1.00 167.72 ? 83  SER A O   1 
ATOM 574  C CB  . SER A 1 85  ? 1.994   14.879  -26.895 1.00 147.78 ? 83  SER A CB  1 
ATOM 575  O OG  . SER A 1 85  ? 1.096   14.218  -26.024 1.00 152.41 ? 83  SER A OG  1 
ATOM 576  N N   . LYS A 1 86  ? 5.445   14.304  -28.085 1.00 125.13 ? 84  LYS A N   1 
ATOM 577  C CA  . LYS A 1 86  ? 6.159   14.123  -29.342 1.00 135.14 ? 84  LYS A CA  1 
ATOM 578  C C   . LYS A 1 86  ? 6.507   12.640  -29.518 1.00 139.95 ? 84  LYS A C   1 
ATOM 579  O O   . LYS A 1 86  ? 7.675   12.275  -29.645 1.00 135.70 ? 84  LYS A O   1 
ATOM 580  C CB  . LYS A 1 86  ? 7.422   14.989  -29.379 1.00 123.68 ? 84  LYS A CB  1 
ATOM 581  N N   . LEU A 1 87  ? 5.475   11.797  -29.510 1.00 138.80 ? 85  LEU A N   1 
ATOM 582  C CA  . LEU A 1 87  ? 5.634   10.342  -29.401 1.00 135.99 ? 85  LEU A CA  1 
ATOM 583  C C   . LEU A 1 87  ? 6.359   9.650   -30.562 1.00 148.14 ? 85  LEU A C   1 
ATOM 584  O O   . LEU A 1 87  ? 7.138   8.720   -30.350 1.00 157.89 ? 85  LEU A O   1 
ATOM 585  C CB  . LEU A 1 87  ? 4.257   9.694   -29.231 1.00 131.33 ? 85  LEU A CB  1 
ATOM 586  N N   . ALA A 1 88  ? 6.108   10.119  -31.781 1.00 147.87 ? 86  ALA A N   1 
ATOM 587  C CA  . ALA A 1 88  ? 6.737   9.570   -32.982 1.00 157.85 ? 86  ALA A CA  1 
ATOM 588  C C   . ALA A 1 88  ? 8.240   9.797   -32.963 1.00 159.17 ? 86  ALA A C   1 
ATOM 589  O O   . ALA A 1 88  ? 9.028   8.933   -33.353 1.00 157.48 ? 86  ALA A O   1 
ATOM 590  C CB  . ALA A 1 88  ? 6.123   10.181  -34.229 1.00 171.63 ? 86  ALA A CB  1 
ATOM 591  N N   . GLU A 1 89  ? 8.613   10.979  -32.495 1.00 156.70 ? 87  GLU A N   1 
ATOM 592  C CA  . GLU A 1 89  ? 9.999   11.382  -32.327 1.00 148.48 ? 87  GLU A CA  1 
ATOM 593  C C   . GLU A 1 89  ? 10.615  10.535  -31.214 1.00 130.23 ? 87  GLU A C   1 
ATOM 594  O O   . GLU A 1 89  ? 11.672  9.930   -31.398 1.00 129.79 ? 87  GLU A O   1 
ATOM 595  C CB  . GLU A 1 89  ? 10.082  12.882  -32.021 1.00 154.84 ? 87  GLU A CB  1 
ATOM 596  C CG  . GLU A 1 89  ? 11.483  13.435  -31.811 1.00 160.97 ? 87  GLU A CG  1 
ATOM 597  C CD  . GLU A 1 89  ? 11.961  13.302  -30.389 1.00 163.27 ? 87  GLU A CD  1 
ATOM 598  O OE1 . GLU A 1 89  ? 11.233  12.701  -29.577 1.00 152.27 ? 87  GLU A OE1 1 
ATOM 599  O OE2 . GLU A 1 89  ? 13.060  13.806  -30.081 1.00 175.80 ? 87  GLU A OE2 1 
ATOM 600  N N   . GLY A 1 90  ? 9.954   10.530  -30.058 1.00 111.84 ? 88  GLY A N   1 
ATOM 601  C CA  . GLY A 1 90  ? 10.367  9.756   -28.896 1.00 112.58 ? 88  GLY A CA  1 
ATOM 602  C C   . GLY A 1 90  ? 10.801  8.346   -29.248 1.00 120.97 ? 88  GLY A C   1 
ATOM 603  O O   . GLY A 1 90  ? 11.788  7.845   -28.709 1.00 129.15 ? 88  GLY A O   1 
ATOM 604  N N   . GLU A 1 91  ? 10.048  7.695   -30.127 1.00 124.93 ? 89  GLU A N   1 
ATOM 605  C CA  . GLU A 1 91  ? 10.427  6.380   -30.629 1.00 139.98 ? 89  GLU A CA  1 
ATOM 606  C C   . GLU A 1 91  ? 11.800  6.430   -31.295 1.00 140.19 ? 89  GLU A C   1 
ATOM 607  O O   . GLU A 1 91  ? 12.704  5.678   -30.929 1.00 125.84 ? 89  GLU A O   1 
ATOM 608  C CB  . GLU A 1 91  ? 9.394   5.858   -31.628 1.00 154.97 ? 89  GLU A CB  1 
ATOM 609  C CG  . GLU A 1 91  ? 9.809   4.567   -32.325 1.00 169.63 ? 89  GLU A CG  1 
ATOM 610  C CD  . GLU A 1 91  ? 8.815   4.125   -33.382 1.00 187.79 ? 89  GLU A CD  1 
ATOM 611  O OE1 . GLU A 1 91  ? 9.013   3.043   -33.974 1.00 197.74 ? 89  GLU A OE1 1 
ATOM 612  O OE2 . GLU A 1 91  ? 7.838   4.865   -33.626 1.00 190.03 ? 89  GLU A OE2 1 
ATOM 613  N N   . GLN A 1 92  ? 11.941  7.314   -32.280 1.00 145.17 ? 90  GLN A N   1 
ATOM 614  C CA  . GLN A 1 92  ? 13.173  7.436   -33.058 1.00 136.00 ? 90  GLN A CA  1 
ATOM 615  C C   . GLN A 1 92  ? 14.447  7.656   -32.250 1.00 136.19 ? 90  GLN A C   1 
ATOM 616  O O   . GLN A 1 92  ? 15.515  7.204   -32.662 1.00 150.52 ? 90  GLN A O   1 
ATOM 617  C CB  . GLN A 1 92  ? 13.040  8.562   -34.075 1.00 122.26 ? 90  GLN A CB  1 
ATOM 618  C CG  . GLN A 1 92  ? 12.034  8.290   -35.164 1.00 124.60 ? 90  GLN A CG  1 
ATOM 619  C CD  . GLN A 1 92  ? 11.478  9.562   -35.758 1.00 141.41 ? 90  GLN A CD  1 
ATOM 620  O OE1 . GLN A 1 92  ? 11.801  10.662  -35.311 1.00 131.60 ? 90  GLN A OE1 1 
ATOM 621  N NE2 . GLN A 1 92  ? 10.645  9.422   -36.780 1.00 181.97 ? 90  GLN A NE2 1 
ATOM 622  N N   . ILE A 1 93  ? 14.362  8.363   -31.126 1.00 115.16 ? 91  ILE A N   1 
ATOM 623  C CA  . ILE A 1 93  ? 15.566  8.533   -30.324 1.00 108.83 ? 91  ILE A CA  1 
ATOM 624  C C   . ILE A 1 93  ? 15.946  7.171   -29.782 1.00 110.86 ? 91  ILE A C   1 
ATOM 625  O O   . ILE A 1 93  ? 17.087  6.732   -29.917 1.00 116.69 ? 91  ILE A O   1 
ATOM 626  C CB  . ILE A 1 93  ? 15.410  9.518   -29.156 1.00 112.46 ? 91  ILE A CB  1 
ATOM 627  C CG1 . ILE A 1 93  ? 14.884  10.868  -29.635 1.00 111.21 ? 91  ILE A CG1 1 
ATOM 628  C CG2 . ILE A 1 93  ? 16.758  9.746   -28.494 1.00 127.87 ? 91  ILE A CG2 1 
ATOM 629  C CD1 . ILE A 1 93  ? 14.994  11.950  -28.574 1.00 120.18 ? 91  ILE A CD1 1 
ATOM 630  N N   . LEU A 1 94  ? 14.977  6.501   -29.170 1.00 116.89 ? 92  LEU A N   1 
ATOM 631  C CA  . LEU A 1 94  ? 15.263  5.226   -28.546 1.00 136.05 ? 92  LEU A CA  1 
ATOM 632  C C   . LEU A 1 94  ? 15.396  4.095   -29.550 1.00 157.01 ? 92  LEU A C   1 
ATOM 633  O O   . LEU A 1 94  ? 16.428  3.432   -29.611 1.00 174.75 ? 92  LEU A O   1 
ATOM 634  C CB  . LEU A 1 94  ? 14.161  4.859   -27.552 1.00 137.40 ? 92  LEU A CB  1 
ATOM 635  C CG  . LEU A 1 94  ? 13.868  5.779   -26.370 1.00 128.55 ? 92  LEU A CG  1 
ATOM 636  C CD1 . LEU A 1 94  ? 12.629  5.285   -25.643 1.00 128.53 ? 92  LEU A CD1 1 
ATOM 637  C CD2 . LEU A 1 94  ? 15.054  5.839   -25.427 1.00 126.75 ? 92  LEU A CD2 1 
ATOM 638  N N   . SER A 1 95  ? 14.361  3.881   -30.354 1.00 147.64 ? 93  SER A N   1 
ATOM 639  C CA  . SER A 1 95  ? 14.398  2.738   -31.250 1.00 146.17 ? 93  SER A CA  1 
ATOM 640  C C   . SER A 1 95  ? 15.346  2.859   -32.441 1.00 147.76 ? 93  SER A C   1 
ATOM 641  O O   . SER A 1 95  ? 15.985  1.883   -32.824 1.00 144.72 ? 93  SER A O   1 
ATOM 642  C CB  . SER A 1 95  ? 12.983  2.454   -31.760 1.00 154.96 ? 93  SER A CB  1 
ATOM 643  O OG  . SER A 1 95  ? 12.967  1.339   -32.634 1.00 170.04 ? 93  SER A OG  1 
ATOM 644  N N   . GLY A 1 96  ? 15.440  4.045   -33.033 1.00 160.08 ? 94  GLY A N   1 
ATOM 645  C CA  . GLY A 1 96  ? 16.170  4.146   -34.281 1.00 185.64 ? 94  GLY A CA  1 
ATOM 646  C C   . GLY A 1 96  ? 15.118  3.611   -35.222 1.00 192.66 ? 94  GLY A C   1 
ATOM 647  O O   . GLY A 1 96  ? 15.406  2.953   -36.224 1.00 196.65 ? 94  GLY A O   1 
ATOM 648  N N   . GLY A 1 97  ? 13.873  3.838   -34.832 1.00 186.84 ? 95  GLY A N   1 
ATOM 649  C CA  . GLY A 1 97  ? 12.797  2.960   -35.230 1.00 173.17 ? 95  GLY A CA  1 
ATOM 650  C C   . GLY A 1 97  ? 12.477  2.905   -36.695 1.00 174.35 ? 95  GLY A C   1 
ATOM 651  O O   . GLY A 1 97  ? 12.599  1.871   -37.350 1.00 180.90 ? 95  GLY A O   1 
ATOM 652  N N   . VAL A 1 98  ? 12.084  4.055   -37.208 1.00 178.37 ? 96  VAL A N   1 
ATOM 653  C CA  . VAL A 1 98  ? 11.316  4.107   -38.424 1.00 184.31 ? 96  VAL A CA  1 
ATOM 654  C C   . VAL A 1 98  ? 12.114  4.606   -39.628 1.00 175.42 ? 96  VAL A C   1 
ATOM 655  O O   . VAL A 1 98  ? 11.820  4.279   -40.773 1.00 182.77 ? 96  VAL A O   1 
ATOM 656  C CB  . VAL A 1 98  ? 10.086  4.992   -38.197 1.00 188.20 ? 96  VAL A CB  1 
ATOM 657  N N   . PHE A 1 99  ? 13.148  5.389   -39.382 1.00 165.75 ? 97  PHE A N   1 
ATOM 658  C CA  . PHE A 1 99  ? 13.936  5.891   -40.496 1.00 179.84 ? 97  PHE A CA  1 
ATOM 659  C C   . PHE A 1 99  ? 14.876  4.812   -41.005 1.00 191.02 ? 97  PHE A C   1 
ATOM 660  O O   . PHE A 1 99  ? 14.621  4.174   -42.036 1.00 174.61 ? 97  PHE A O   1 
ATOM 661  C CB  . PHE A 1 99  ? 14.722  7.127   -40.063 1.00 174.77 ? 97  PHE A CB  1 
ATOM 662  N N   . ASN A 1 100 ? 15.970  4.642   -40.276 1.00 200.54 ? 98  ASN A N   1 
ATOM 663  C CA  . ASN A 1 100 ? 16.850  3.484   -40.362 1.00 184.52 ? 98  ASN A CA  1 
ATOM 664  C C   . ASN A 1 100 ? 16.214  2.243   -39.745 1.00 159.60 ? 98  ASN A C   1 
ATOM 665  O O   . ASN A 1 100 ? 15.165  2.334   -39.106 1.00 152.62 ? 98  ASN A O   1 
ATOM 666  C CB  . ASN A 1 100 ? 18.165  3.774   -39.651 1.00 187.34 ? 98  ASN A CB  1 
ATOM 667  N N   . LYS A 1 101 ? 16.875  1.095   -39.897 1.00 149.76 ? 99  LYS A N   1 
ATOM 668  C CA  . LYS A 1 101 ? 16.407  -0.139  -39.271 1.00 146.42 ? 99  LYS A CA  1 
ATOM 669  C C   . LYS A 1 101 ? 16.250  0.053   -37.766 1.00 159.14 ? 99  LYS A C   1 
ATOM 670  O O   . LYS A 1 101 ? 17.125  0.584   -37.075 1.00 174.50 ? 99  LYS A O   1 
ATOM 671  C CB  . LYS A 1 101 ? 17.347  -1.310  -39.570 1.00 150.19 ? 99  LYS A CB  1 
ATOM 672  N N   . GLN A 1 102 ? 15.106  -0.424  -37.298 1.00 164.22 ? 100 GLN A N   1 
ATOM 673  C CA  . GLN A 1 102 ? 14.744  -0.578  -35.898 1.00 151.86 ? 100 GLN A CA  1 
ATOM 674  C C   . GLN A 1 102 ? 15.685  -1.451  -35.088 1.00 148.83 ? 100 GLN A C   1 
ATOM 675  O O   . GLN A 1 102 ? 15.888  -2.627  -35.391 1.00 157.63 ? 100 GLN A O   1 
ATOM 676  C CB  . GLN A 1 102 ? 13.324  -1.136  -35.786 1.00 144.66 ? 100 GLN A CB  1 
ATOM 677  N N   . LYS A 1 103 ? 16.267  -0.849  -34.059 1.00 144.29 ? 101 LYS A N   1 
ATOM 678  C CA  . LYS A 1 103 ? 17.327  -1.467  -33.292 1.00 145.35 ? 101 LYS A CA  1 
ATOM 679  C C   . LYS A 1 103 ? 16.584  -2.464  -32.427 1.00 144.01 ? 101 LYS A C   1 
ATOM 680  O O   . LYS A 1 103 ? 15.484  -2.194  -31.945 1.00 148.91 ? 101 LYS A O   1 
ATOM 681  C CB  . LYS A 1 103 ? 18.113  -0.450  -32.464 1.00 142.06 ? 101 LYS A CB  1 
ATOM 682  N N   . SER A 1 104 ? 17.206  -3.615  -32.228 1.00 143.16 ? 102 SER A N   1 
ATOM 683  C CA  . SER A 1 104 ? 16.671  -4.649  -31.360 1.00 140.92 ? 102 SER A CA  1 
ATOM 684  C C   . SER A 1 104 ? 16.826  -4.387  -29.875 1.00 139.04 ? 102 SER A C   1 
ATOM 685  O O   . SER A 1 104 ? 17.668  -3.610  -29.431 1.00 143.01 ? 102 SER A O   1 
ATOM 686  C CB  . SER A 1 104 ? 17.324  -5.988  -31.704 1.00 155.34 ? 102 SER A CB  1 
ATOM 687  O OG  . SER A 1 104 ? 17.172  -6.918  -30.647 1.00 159.55 ? 102 SER A OG  1 
ATOM 688  N N   . HIS A 1 105 ? 15.952  -5.045  -29.125 1.00 127.02 ? 103 HIS A N   1 
ATOM 689  C CA  . HIS A 1 105 ? 16.024  -5.098  -27.677 1.00 126.58 ? 103 HIS A CA  1 
ATOM 690  C C   . HIS A 1 105 ? 17.406  -5.509  -27.196 1.00 133.98 ? 103 HIS A C   1 
ATOM 691  O O   . HIS A 1 105 ? 17.872  -4.998  -26.181 1.00 138.09 ? 103 HIS A O   1 
ATOM 692  C CB  . HIS A 1 105 ? 14.971  -6.064  -27.130 1.00 121.69 ? 103 HIS A CB  1 
ATOM 693  N N   . ASP A 1 106 ? 18.069  -6.421  -27.897 1.00 141.70 ? 104 ASP A N   1 
ATOM 694  C CA  . ASP A 1 106 ? 19.409  -6.781  -27.467 1.00 147.96 ? 104 ASP A CA  1 
ATOM 695  C C   . ASP A 1 106 ? 20.351  -5.599  -27.701 1.00 149.93 ? 104 ASP A C   1 
ATOM 696  O O   . ASP A 1 106 ? 21.245  -5.347  -26.894 1.00 152.50 ? 104 ASP A O   1 
ATOM 697  C CB  . ASP A 1 106 ? 19.915  -8.010  -28.223 1.00 166.39 ? 104 ASP A CB  1 
ATOM 698  C CG  . ASP A 1 106 ? 19.093  -9.251  -27.940 1.00 167.45 ? 104 ASP A CG  1 
ATOM 699  O OD1 . ASP A 1 106 ? 18.676  -9.444  -26.779 1.00 151.78 ? 104 ASP A OD1 1 
ATOM 700  O OD2 . ASP A 1 106 ? 18.875  -10.044 -28.880 1.00 186.05 ? 104 ASP A OD2 1 
ATOM 701  N N   . ASP A 1 107 ? 20.157  -4.882  -28.805 1.00 156.67 ? 105 ASP A N   1 
ATOM 702  C CA  . ASP A 1 107 ? 20.881  -3.634  -29.027 1.00 159.38 ? 105 ASP A CA  1 
ATOM 703  C C   . ASP A 1 107 ? 20.564  -2.596  -27.952 1.00 160.84 ? 105 ASP A C   1 
ATOM 704  O O   . ASP A 1 107 ? 21.464  -1.997  -27.364 1.00 168.84 ? 105 ASP A O   1 
ATOM 705  C CB  . ASP A 1 107 ? 20.548  -3.059  -30.405 1.00 152.95 ? 105 ASP A CB  1 
ATOM 706  C CG  . ASP A 1 107 ? 21.105  -3.894  -31.536 1.00 161.68 ? 105 ASP A CG  1 
ATOM 707  O OD1 . ASP A 1 107 ? 22.298  -4.255  -31.482 1.00 171.75 ? 105 ASP A OD1 1 
ATOM 708  O OD2 . ASP A 1 107 ? 20.342  -4.193  -32.478 1.00 165.08 ? 105 ASP A OD2 1 
ATOM 709  N N   . ILE A 1 108 ? 19.268  -2.386  -27.723 1.00 149.17 ? 106 ILE A N   1 
ATOM 710  C CA  . ILE A 1 108 ? 18.773  -1.439  -26.722 1.00 136.02 ? 106 ILE A CA  1 
ATOM 711  C C   . ILE A 1 108 ? 19.358  -1.658  -25.329 1.00 139.40 ? 106 ILE A C   1 
ATOM 712  O O   . ILE A 1 108 ? 19.789  -0.710  -24.669 1.00 141.97 ? 106 ILE A O   1 
ATOM 713  C CB  . ILE A 1 108 ? 17.229  -1.486  -26.636 1.00 126.91 ? 106 ILE A CB  1 
ATOM 714  C CG1 . ILE A 1 108 ? 16.611  -0.726  -27.810 1.00 126.15 ? 106 ILE A CG1 1 
ATOM 715  C CG2 . ILE A 1 108 ? 16.734  -0.912  -25.314 1.00 125.37 ? 106 ILE A CG2 1 
ATOM 716  C CD1 . ILE A 1 108 ? 15.137  -0.991  -28.002 1.00 126.50 ? 106 ILE A CD1 1 
ATOM 717  N N   . VAL A 1 109 ? 19.379  -2.915  -24.896 1.00 143.21 ? 107 VAL A N   1 
ATOM 718  C CA  . VAL A 1 109 ? 19.969  -3.274  -23.614 1.00 143.91 ? 107 VAL A CA  1 
ATOM 719  C C   . VAL A 1 109 ? 21.457  -2.945  -23.588 1.00 149.34 ? 107 VAL A C   1 
ATOM 720  O O   . VAL A 1 109 ? 21.959  -2.412  -22.609 1.00 154.77 ? 107 VAL A O   1 
ATOM 721  C CB  . VAL A 1 109 ? 19.749  -4.765  -23.294 1.00 149.33 ? 107 VAL A CB  1 
ATOM 722  C CG1 . VAL A 1 109 ? 20.561  -5.179  -22.080 1.00 157.01 ? 107 VAL A CG1 1 
ATOM 723  C CG2 . VAL A 1 109 ? 18.270  -5.034  -23.059 1.00 151.12 ? 107 VAL A CG2 1 
ATOM 724  N N   . THR A 1 110 ? 22.151  -3.247  -24.679 1.00 162.37 ? 108 THR A N   1 
ATOM 725  C CA  . THR A 1 110 ? 23.578  -2.957  -24.787 1.00 177.86 ? 108 THR A CA  1 
ATOM 726  C C   . THR A 1 110 ? 23.829  -1.457  -24.667 1.00 183.36 ? 108 THR A C   1 
ATOM 727  O O   . THR A 1 110 ? 24.752  -1.026  -23.976 1.00 186.22 ? 108 THR A O   1 
ATOM 728  C CB  . THR A 1 110 ? 24.178  -3.477  -26.104 1.00 183.57 ? 108 THR A CB  1 
ATOM 729  O OG1 . THR A 1 110 ? 24.032  -4.901  -26.164 1.00 188.48 ? 108 THR A OG1 1 
ATOM 730  C CG2 . THR A 1 110 ? 25.658  -3.136  -26.178 1.00 189.42 ? 108 THR A CG2 1 
ATOM 731  N N   . GLU A 1 111 ? 23.000  -0.668  -25.342 1.00 183.35 ? 109 GLU A N   1 
ATOM 732  C CA  . GLU A 1 111 ? 23.164  0.781   -25.367 1.00 184.31 ? 109 GLU A CA  1 
ATOM 733  C C   . GLU A 1 111 ? 22.918  1.322   -23.958 1.00 174.12 ? 109 GLU A C   1 
ATOM 734  O O   . GLU A 1 111 ? 23.775  2.002   -23.396 1.00 178.39 ? 109 GLU A O   1 
ATOM 735  C CB  . GLU A 1 111 ? 22.232  1.427   -26.397 1.00 193.71 ? 109 GLU A CB  1 
ATOM 736  C CG  . GLU A 1 111 ? 22.755  2.760   -26.936 1.00 201.01 ? 109 GLU A CG  1 
ATOM 737  C CD  . GLU A 1 111 ? 21.736  3.520   -27.766 1.00 197.29 ? 109 GLU A CD  1 
ATOM 738  O OE1 . GLU A 1 111 ? 20.724  2.916   -28.178 1.00 196.44 ? 109 GLU A OE1 1 
ATOM 739  O OE2 . GLU A 1 111 ? 21.962  4.721   -28.028 1.00 194.77 ? 109 GLU A OE2 1 
ATOM 740  N N   . PHE A 1 112 ? 21.751  1.027   -23.394 1.00 167.10 ? 110 PHE A N   1 
ATOM 741  C CA  . PHE A 1 112 ? 21.331  1.653   -22.147 1.00 172.46 ? 110 PHE A CA  1 
ATOM 742  C C   . PHE A 1 112 ? 21.802  0.876   -20.915 1.00 180.74 ? 110 PHE A C   1 
ATOM 743  O O   . PHE A 1 112 ? 22.108  1.470   -19.880 1.00 182.76 ? 110 PHE A O   1 
ATOM 744  C CB  . PHE A 1 112 ? 19.804  1.785   -22.093 1.00 162.96 ? 110 PHE A CB  1 
ATOM 745  C CG  . PHE A 1 112 ? 19.221  2.629   -23.193 1.00 158.02 ? 110 PHE A CG  1 
ATOM 746  C CD1 . PHE A 1 112 ? 19.979  3.597   -23.819 1.00 159.45 ? 110 PHE A CD1 1 
ATOM 747  C CD2 . PHE A 1 112 ? 17.912  2.458   -23.597 1.00 161.49 ? 110 PHE A CD2 1 
ATOM 748  C CE1 . PHE A 1 112 ? 19.440  4.379   -24.823 1.00 159.37 ? 110 PHE A CE1 1 
ATOM 749  C CE2 . PHE A 1 112 ? 17.361  3.246   -24.595 1.00 162.28 ? 110 PHE A CE2 1 
ATOM 750  C CZ  . PHE A 1 112 ? 18.128  4.204   -25.210 1.00 161.77 ? 110 PHE A CZ  1 
ATOM 751  N N   . GLY A 1 113 ? 21.900  -0.443  -21.033 1.00 182.66 ? 111 GLY A N   1 
ATOM 752  C CA  . GLY A 1 113 ? 22.495  -1.238  -19.974 1.00 183.20 ? 111 GLY A CA  1 
ATOM 753  C C   . GLY A 1 113 ? 21.489  -1.302  -18.844 1.00 172.99 ? 111 GLY A C   1 
ATOM 754  O O   . GLY A 1 113 ? 20.451  -1.953  -18.955 1.00 166.39 ? 111 GLY A O   1 
ATOM 755  N N   . ASP A 1 114 ? 21.810  -0.621  -17.751 1.00 174.11 ? 112 ASP A N   1 
ATOM 756  C CA  . ASP A 1 114 ? 20.965  -0.581  -16.561 1.00 170.08 ? 112 ASP A CA  1 
ATOM 757  C C   . ASP A 1 114 ? 19.709  0.268   -16.761 1.00 159.38 ? 112 ASP A C   1 
ATOM 758  O O   . ASP A 1 114 ? 18.722  0.106   -16.043 1.00 158.20 ? 112 ASP A O   1 
ATOM 759  C CB  . ASP A 1 114 ? 21.753  -0.063  -15.348 1.00 182.17 ? 112 ASP A CB  1 
ATOM 760  C CG  . ASP A 1 114 ? 22.202  1.388   -15.495 1.00 198.13 ? 112 ASP A CG  1 
ATOM 761  O OD1 . ASP A 1 114 ? 21.526  2.191   -16.172 1.00 201.45 ? 112 ASP A OD1 1 
ATOM 762  O OD2 . ASP A 1 114 ? 23.238  1.741   -14.896 1.00 208.19 ? 112 ASP A OD2 1 
ATOM 763  N N   . SER A 1 115 ? 19.743  1.157   -17.751 1.00 153.85 ? 113 SER A N   1 
ATOM 764  C CA  . SER A 1 115 ? 18.575  1.976   -18.058 1.00 142.64 ? 113 SER A CA  1 
ATOM 765  C C   . SER A 1 115 ? 17.610  1.279   -18.992 1.00 133.86 ? 113 SER A C   1 
ATOM 766  O O   . SER A 1 115 ? 16.486  1.737   -19.158 1.00 125.19 ? 113 SER A O   1 
ATOM 767  C CB  . SER A 1 115 ? 19.004  3.308   -18.684 1.00 136.94 ? 113 SER A CB  1 
ATOM 768  O OG  . SER A 1 115 ? 19.987  3.957   -17.900 1.00 141.72 ? 113 SER A OG  1 
ATOM 769  N N   . ALA A 1 116 ? 18.045  0.165   -19.572 1.00 136.11 ? 114 ALA A N   1 
ATOM 770  C CA  . ALA A 1 116 ? 17.244  -0.588  -20.530 1.00 133.36 ? 114 ALA A CA  1 
ATOM 771  C C   . ALA A 1 116 ? 15.812  -0.775  -20.021 1.00 130.14 ? 114 ALA A C   1 
ATOM 772  O O   . ALA A 1 116 ? 14.852  -0.630  -20.775 1.00 147.62 ? 114 ALA A O   1 
ATOM 773  C CB  . ALA A 1 116 ? 17.886  -1.931  -20.817 1.00 135.80 ? 114 ALA A CB  1 
ATOM 774  N N   . CYS A 1 117 ? 15.683  -1.100  -18.737 1.00 122.20 ? 115 CYS A N   1 
ATOM 775  C CA  . CYS A 1 117 ? 14.377  -1.310  -18.122 1.00 119.83 ? 115 CYS A CA  1 
ATOM 776  C C   . CYS A 1 117 ? 13.405  -0.116  -18.185 1.00 115.78 ? 115 CYS A C   1 
ATOM 777  O O   . CYS A 1 117 ? 12.204  -0.324  -18.362 1.00 115.34 ? 115 CYS A O   1 
ATOM 778  C CB  . CYS A 1 117 ? 14.583  -1.737  -16.661 1.00 122.38 ? 115 CYS A CB  1 
ATOM 779  S SG  . CYS A 1 117 ? 15.466  -0.548  -15.619 1.00 214.03 ? 115 CYS A SG  1 
ATOM 780  N N   . PHE A 1 118 ? 13.893  1.114   -18.033 1.00 128.74 ? 116 PHE A N   1 
ATOM 781  C CA  . PHE A 1 118 ? 12.995  2.276   -18.059 1.00 127.45 ? 116 PHE A CA  1 
ATOM 782  C C   . PHE A 1 118 ? 12.600  2.701   -19.471 1.00 123.96 ? 116 PHE A C   1 
ATOM 783  O O   . PHE A 1 118 ? 11.475  3.125   -19.728 1.00 124.10 ? 116 PHE A O   1 
ATOM 784  C CB  . PHE A 1 118 ? 13.650  3.476   -17.380 1.00 134.33 ? 116 PHE A CB  1 
ATOM 785  C CG  . PHE A 1 118 ? 14.104  3.210   -15.982 1.00 127.64 ? 116 PHE A CG  1 
ATOM 786  C CD1 . PHE A 1 118 ? 13.227  3.287   -14.915 1.00 126.97 ? 116 PHE A CD1 1 
ATOM 787  C CD2 . PHE A 1 118 ? 15.427  2.891   -15.737 1.00 127.63 ? 116 PHE A CD2 1 
ATOM 788  C CE1 . PHE A 1 118 ? 13.667  3.043   -13.630 1.00 128.28 ? 116 PHE A CE1 1 
ATOM 789  C CE2 . PHE A 1 118 ? 15.872  2.651   -14.458 1.00 127.70 ? 116 PHE A CE2 1 
ATOM 790  C CZ  . PHE A 1 118 ? 14.994  2.725   -13.402 1.00 129.18 ? 116 PHE A CZ  1 
ATOM 791  N N   . THR A 1 119 ? 13.560  2.608   -20.378 1.00 125.07 ? 117 THR A N   1 
ATOM 792  C CA  . THR A 1 119 ? 13.345  2.922   -21.784 1.00 125.65 ? 117 THR A CA  1 
ATOM 793  C C   . THR A 1 119 ? 12.472  1.926   -22.522 1.00 130.40 ? 117 THR A C   1 
ATOM 794  O O   . THR A 1 119 ? 11.727  2.302   -23.424 1.00 145.88 ? 117 THR A O   1 
ATOM 795  C CB  . THR A 1 119 ? 14.679  3.059   -22.483 1.00 131.64 ? 117 THR A CB  1 
ATOM 796  O OG1 . THR A 1 119 ? 15.005  1.826   -23.137 1.00 149.43 ? 117 THR A OG1 1 
ATOM 797  C CG2 . THR A 1 119 ? 15.725  3.372   -21.448 1.00 132.19 ? 117 THR A CG2 1 
ATOM 798  N N   . LEU A 1 120 ? 12.541  0.664   -22.119 1.00 126.48 ? 118 LEU A N   1 
ATOM 799  C CA  . LEU A 1 120 ? 11.678  -0.339  -22.709 1.00 123.57 ? 118 LEU A CA  1 
ATOM 800  C C   . LEU A 1 120 ? 10.293  -0.030  -22.169 1.00 132.93 ? 118 LEU A C   1 
ATOM 801  O O   . LEU A 1 120 ? 9.298   -0.119  -22.893 1.00 152.27 ? 118 LEU A O   1 
ATOM 802  C CB  . LEU A 1 120 ? 12.141  -1.754  -22.356 1.00 125.18 ? 118 LEU A CB  1 
ATOM 803  C CG  . LEU A 1 120 ? 13.332  -2.245  -23.187 1.00 130.06 ? 118 LEU A CG  1 
ATOM 804  C CD1 . LEU A 1 120 ? 14.072  -3.382  -22.492 1.00 139.76 ? 118 LEU A CD1 1 
ATOM 805  C CD2 . LEU A 1 120 ? 12.897  -2.655  -24.585 1.00 134.24 ? 118 LEU A CD2 1 
ATOM 806  N N   . SER A 1 121 ? 10.233  0.308   -20.883 1.00 116.89 ? 119 SER A N   1 
ATOM 807  C CA  . SER A 1 121 ? 9.000   0.810   -20.300 1.00 113.37 ? 119 SER A CA  1 
ATOM 808  C C   . SER A 1 121 ? 8.534   2.037   -21.092 1.00 113.41 ? 119 SER A C   1 
ATOM 809  O O   . SER A 1 121 ? 7.356   2.158   -21.429 1.00 119.01 ? 119 SER A O   1 
ATOM 810  C CB  . SER A 1 121 ? 9.212   1.171   -18.827 1.00 117.49 ? 119 SER A CB  1 
ATOM 811  O OG  . SER A 1 121 ? 9.266   0.012   -18.015 1.00 131.01 ? 119 SER A OG  1 
ATOM 812  N N   . LEU A 1 122 ? 9.468   2.942   -21.389 1.00 108.06 ? 120 LEU A N   1 
ATOM 813  C CA  . LEU A 1 122 ? 9.135   4.158   -22.129 1.00 106.94 ? 120 LEU A CA  1 
ATOM 814  C C   . LEU A 1 122 ? 8.677   3.827   -23.546 1.00 108.13 ? 120 LEU A C   1 
ATOM 815  O O   . LEU A 1 122 ? 7.602   4.243   -23.979 1.00 109.76 ? 120 LEU A O   1 
ATOM 816  C CB  . LEU A 1 122 ? 10.325  5.126   -22.171 1.00 110.49 ? 120 LEU A CB  1 
ATOM 817  C CG  . LEU A 1 122 ? 9.993   6.545   -22.652 1.00 113.69 ? 120 LEU A CG  1 
ATOM 818  C CD1 . LEU A 1 122 ? 8.897   7.149   -21.795 1.00 111.55 ? 120 LEU A CD1 1 
ATOM 819  C CD2 . LEU A 1 122 ? 11.222  7.446   -22.652 1.00 118.31 ? 120 LEU A CD2 1 
ATOM 820  N N   . LEU A 1 123 ? 9.511   3.066   -24.255 1.00 116.46 ? 121 LEU A N   1 
ATOM 821  C CA  . LEU A 1 123 ? 9.173   2.532   -25.573 1.00 116.85 ? 121 LEU A CA  1 
ATOM 822  C C   . LEU A 1 123 ? 7.878   1.732   -25.582 1.00 115.98 ? 121 LEU A C   1 
ATOM 823  O O   . LEU A 1 123 ? 7.089   1.827   -26.518 1.00 136.01 ? 121 LEU A O   1 
ATOM 824  C CB  . LEU A 1 123 ? 10.315  1.655   -26.097 1.00 118.36 ? 121 LEU A CB  1 
ATOM 825  C CG  . LEU A 1 123 ? 11.154  2.195   -27.257 1.00 147.89 ? 121 LEU A CG  1 
ATOM 826  C CD1 . LEU A 1 123 ? 12.052  1.102   -27.820 1.00 170.11 ? 121 LEU A CD1 1 
ATOM 827  C CD2 . LEU A 1 123 ? 10.273  2.784   -28.349 1.00 161.77 ? 121 LEU A CD2 1 
ATOM 828  N N   . GLY A 1 124 ? 7.662   0.947   -24.533 1.00 114.13 ? 122 GLY A N   1 
ATOM 829  C CA  . GLY A 1 124 ? 6.397   0.263   -24.344 1.00 126.63 ? 122 GLY A CA  1 
ATOM 830  C C   . GLY A 1 124 ? 5.200   1.191   -24.393 1.00 126.36 ? 122 GLY A C   1 
ATOM 831  O O   . GLY A 1 124 ? 4.274   0.991   -25.177 1.00 132.67 ? 122 GLY A O   1 
ATOM 832  N N   . HIS A 1 125 ? 5.230   2.202   -23.532 1.00 112.64 ? 123 HIS A N   1 
ATOM 833  C CA  . HIS A 1 125 ? 4.148   3.173   -23.392 1.00 113.35 ? 123 HIS A CA  1 
ATOM 834  C C   . HIS A 1 125 ? 3.745   3.843   -24.711 1.00 115.63 ? 123 HIS A C   1 
ATOM 835  O O   . HIS A 1 125 ? 2.559   3.929   -25.030 1.00 115.16 ? 123 HIS A O   1 
ATOM 836  C CB  . HIS A 1 125 ? 4.539   4.229   -22.353 1.00 120.79 ? 123 HIS A CB  1 
ATOM 837  C CG  . HIS A 1 125 ? 3.569   5.363   -22.238 1.00 119.95 ? 123 HIS A CG  1 
ATOM 838  N ND1 . HIS A 1 125 ? 2.234   5.241   -22.561 1.00 120.44 ? 123 HIS A ND1 1 
ATOM 839  C CD2 . HIS A 1 125 ? 3.735   6.636   -21.807 1.00 118.53 ? 123 HIS A CD2 1 
ATOM 840  C CE1 . HIS A 1 125 ? 1.624   6.393   -22.351 1.00 122.37 ? 123 HIS A CE1 1 
ATOM 841  N NE2 . HIS A 1 125 ? 2.512   7.256   -21.892 1.00 121.68 ? 123 HIS A NE2 1 
ATOM 842  N N   . VAL A 1 126 ? 4.730   4.304   -25.476 1.00 123.42 ? 124 VAL A N   1 
ATOM 843  C CA  . VAL A 1 126 ? 4.467   4.977   -26.749 1.00 127.44 ? 124 VAL A CA  1 
ATOM 844  C C   . VAL A 1 126 ? 3.929   4.029   -27.820 1.00 131.33 ? 124 VAL A C   1 
ATOM 845  O O   . VAL A 1 126 ? 2.998   4.385   -28.540 1.00 141.90 ? 124 VAL A O   1 
ATOM 846  C CB  . VAL A 1 126 ? 5.719   5.704   -27.293 1.00 131.25 ? 124 VAL A CB  1 
ATOM 847  C CG1 . VAL A 1 126 ? 5.875   7.060   -26.621 1.00 132.65 ? 124 VAL A CG1 1 
ATOM 848  C CG2 . VAL A 1 126 ? 6.961   4.869   -27.106 1.00 146.17 ? 124 VAL A CG2 1 
ATOM 849  N N   . TYR A 1 127 ? 4.518   2.841   -27.938 1.00 126.10 ? 125 TYR A N   1 
ATOM 850  C CA  . TYR A 1 127 ? 4.009   1.837   -28.870 1.00 121.56 ? 125 TYR A CA  1 
ATOM 851  C C   . TYR A 1 127 ? 2.530   1.564   -28.601 1.00 124.99 ? 125 TYR A C   1 
ATOM 852  O O   . TYR A 1 127 ? 1.736   1.443   -29.533 1.00 136.04 ? 125 TYR A O   1 
ATOM 853  C CB  . TYR A 1 127 ? 4.794   0.524   -28.771 1.00 118.05 ? 125 TYR A CB  1 
ATOM 854  C CG  . TYR A 1 127 ? 6.143   0.528   -29.458 1.00 118.19 ? 125 TYR A CG  1 
ATOM 855  C CD1 . TYR A 1 127 ? 6.287   1.006   -30.753 1.00 134.42 ? 125 TYR A CD1 1 
ATOM 856  C CD2 . TYR A 1 127 ? 7.262   -0.004  -28.830 1.00 118.79 ? 125 TYR A CD2 1 
ATOM 857  C CE1 . TYR A 1 127 ? 7.519   0.994   -31.387 1.00 144.97 ? 125 TYR A CE1 1 
ATOM 858  C CE2 . TYR A 1 127 ? 8.494   -0.021  -29.453 1.00 140.66 ? 125 TYR A CE2 1 
ATOM 859  C CZ  . TYR A 1 127 ? 8.617   0.478   -30.732 1.00 145.45 ? 125 TYR A CZ  1 
ATOM 860  O OH  . TYR A 1 127 ? 9.845   0.463   -31.355 1.00 144.14 ? 125 TYR A OH  1 
ATOM 861  N N   . CYS A 1 128 ? 2.165   1.475   -27.326 1.00 128.19 ? 126 CYS A N   1 
ATOM 862  C CA  . CYS A 1 128 ? 0.779   1.227   -26.947 1.00 133.54 ? 126 CYS A CA  1 
ATOM 863  C C   . CYS A 1 128 ? -0.116  2.428   -27.252 1.00 139.46 ? 126 CYS A C   1 
ATOM 864  O O   . CYS A 1 128 ? -1.208  2.273   -27.800 1.00 154.35 ? 126 CYS A O   1 
ATOM 865  C CB  . CYS A 1 128 ? 0.686   0.876   -25.461 1.00 135.21 ? 126 CYS A CB  1 
ATOM 866  S SG  . CYS A 1 128 ? 1.535   -0.651  -25.000 1.00 203.97 ? 126 CYS A SG  1 
ATOM 867  N N   . LYS A 1 129 ? 0.348   3.624   -26.900 1.00 134.33 ? 127 LYS A N   1 
ATOM 868  C CA  . LYS A 1 129 ? -0.426  4.840   -27.131 1.00 137.61 ? 127 LYS A CA  1 
ATOM 869  C C   . LYS A 1 129 ? -0.427  5.258   -28.601 1.00 150.78 ? 127 LYS A C   1 
ATOM 870  O O   . LYS A 1 129 ? -1.190  6.138   -29.000 1.00 172.61 ? 127 LYS A O   1 
ATOM 871  C CB  . LYS A 1 129 ? 0.112   5.983   -26.268 1.00 127.43 ? 127 LYS A CB  1 
ATOM 872  N N   . THR A 1 130 ? 0.423   4.624   -29.403 1.00 150.35 ? 128 THR A N   1 
ATOM 873  C CA  . THR A 1 130 ? 0.385   4.806   -30.851 1.00 131.89 ? 128 THR A CA  1 
ATOM 874  C C   . THR A 1 130 ? -0.057  3.548   -31.594 1.00 128.65 ? 128 THR A C   1 
ATOM 875  O O   . THR A 1 130 ? 0.450   3.258   -32.679 1.00 123.33 ? 128 THR A O   1 
ATOM 876  C CB  . THR A 1 130 ? 1.760   5.246   -31.401 1.00 126.43 ? 128 THR A CB  1 
ATOM 877  O OG1 . THR A 1 130 ? 2.755   4.286   -31.025 1.00 123.68 ? 128 THR A OG1 1 
ATOM 878  C CG2 . THR A 1 130 ? 2.151   6.603   -30.842 1.00 127.95 ? 128 THR A CG2 1 
ATOM 879  N N   . ASP A 1 131 ? -0.983  2.797   -31.001 1.00 138.83 ? 129 ASP A N   1 
ATOM 880  C CA  . ASP A 1 131 ? -1.744  1.778   -31.728 1.00 138.37 ? 129 ASP A CA  1 
ATOM 881  C C   . ASP A 1 131 ? -0.905  0.571   -32.129 1.00 132.83 ? 129 ASP A C   1 
ATOM 882  O O   . ASP A 1 131 ? -1.100  0.005   -33.204 1.00 130.43 ? 129 ASP A O   1 
ATOM 883  C CB  . ASP A 1 131 ? -2.423  2.365   -32.966 1.00 143.16 ? 129 ASP A CB  1 
ATOM 884  C CG  . ASP A 1 131 ? -3.736  1.673   -33.285 1.00 162.93 ? 129 ASP A CG  1 
ATOM 885  O OD1 . ASP A 1 131 ? -4.163  0.810   -32.488 1.00 165.55 ? 129 ASP A OD1 1 
ATOM 886  O OD2 . ASP A 1 131 ? -4.339  1.986   -34.332 1.00 183.72 ? 129 ASP A OD2 1 
ATOM 887  N N   . ARG A 1 132 ? 0.030   0.178   -31.274 1.00 129.12 ? 130 ARG A N   1 
ATOM 888  C CA  . ARG A 1 132 ? 0.888   -0.955  -31.587 1.00 137.18 ? 130 ARG A CA  1 
ATOM 889  C C   . ARG A 1 132 ? 1.113   -1.811  -30.350 1.00 135.13 ? 130 ARG A C   1 
ATOM 890  O O   . ARG A 1 132 ? 2.248   -2.045  -29.934 1.00 135.68 ? 130 ARG A O   1 
ATOM 891  C CB  . ARG A 1 132 ? 2.228   -0.476  -32.149 1.00 135.63 ? 130 ARG A CB  1 
ATOM 892  N N   . LEU A 1 133 ? 0.001   -2.244  -29.759 1.00 126.25 ? 131 LEU A N   1 
ATOM 893  C CA  . LEU A 1 133 ? -0.002  -3.039  -28.536 1.00 124.26 ? 131 LEU A CA  1 
ATOM 894  C C   . LEU A 1 133 ? 0.923   -4.246  -28.658 1.00 122.80 ? 131 LEU A C   1 
ATOM 895  O O   . LEU A 1 133 ? 1.538   -4.669  -27.681 1.00 125.24 ? 131 LEU A O   1 
ATOM 896  C CB  . LEU A 1 133 ? -1.423  -3.494  -28.198 1.00 119.65 ? 131 LEU A CB  1 
ATOM 897  N N   . ALA A 1 134 ? 0.986   -4.806  -29.864 1.00 117.21 ? 132 ALA A N   1 
ATOM 898  C CA  . ALA A 1 134 ? 1.892   -5.906  -30.177 1.00 121.17 ? 132 ALA A CA  1 
ATOM 899  C C   . ALA A 1 134 ? 3.322   -5.572  -29.766 1.00 127.82 ? 132 ALA A C   1 
ATOM 900  O O   . ALA A 1 134 ? 3.923   -6.268  -28.949 1.00 123.39 ? 132 ALA A O   1 
ATOM 901  C CB  . ALA A 1 134 ? 1.830   -6.238  -31.661 1.00 129.59 ? 132 ALA A CB  1 
ATOM 902  N N   . LYS A 1 135 ? 3.861   -4.507  -30.349 1.00 141.44 ? 133 LYS A N   1 
ATOM 903  C CA  . LYS A 1 135 ? 5.234   -4.093  -30.084 1.00 140.33 ? 133 LYS A CA  1 
ATOM 904  C C   . LYS A 1 135 ? 5.399   -3.612  -28.645 1.00 128.00 ? 133 LYS A C   1 
ATOM 905  O O   . LYS A 1 135 ? 6.422   -3.861  -28.008 1.00 128.08 ? 133 LYS A O   1 
ATOM 906  C CB  . LYS A 1 135 ? 5.659   -2.994  -31.060 1.00 148.23 ? 133 LYS A CB  1 
ATOM 907  N N   . GLY A 1 136 ? 4.382   -2.919  -28.142 1.00 108.17 ? 134 GLY A N   1 
ATOM 908  C CA  . GLY A 1 136 ? 4.380   -2.414  -26.781 1.00 107.77 ? 134 GLY A CA  1 
ATOM 909  C C   . GLY A 1 136 ? 4.377   -3.458  -25.679 1.00 109.32 ? 134 GLY A C   1 
ATOM 910  O O   . GLY A 1 136 ? 5.030   -3.281  -24.651 1.00 111.91 ? 134 GLY A O   1 
ATOM 911  N N   . SER A 1 137 ? 3.648   -4.549  -25.891 1.00 108.38 ? 135 SER A N   1 
ATOM 912  C CA  . SER A 1 137 ? 3.634   -5.648  -24.931 1.00 107.94 ? 135 SER A CA  1 
ATOM 913  C C   . SER A 1 137 ? 4.982   -6.352  -24.882 1.00 106.94 ? 135 SER A C   1 
ATOM 914  O O   . SER A 1 137 ? 5.466   -6.703  -23.806 1.00 108.45 ? 135 SER A O   1 
ATOM 915  C CB  . SER A 1 137 ? 2.531   -6.651  -25.274 1.00 112.73 ? 135 SER A CB  1 
ATOM 916  O OG  . SER A 1 137 ? 1.248   -6.063  -25.141 1.00 117.59 ? 135 SER A OG  1 
ATOM 917  N N   . GLU A 1 138 ? 5.572   -6.575  -26.050 1.00 111.85 ? 136 GLU A N   1 
ATOM 918  C CA  . GLU A 1 138 ? 6.894   -7.180  -26.137 1.00 118.78 ? 136 GLU A CA  1 
ATOM 919  C C   . GLU A 1 138 ? 7.922   -6.370  -25.347 1.00 120.24 ? 136 GLU A C   1 
ATOM 920  O O   . GLU A 1 138 ? 8.810   -6.934  -24.708 1.00 130.32 ? 136 GLU A O   1 
ATOM 921  C CB  . GLU A 1 138 ? 7.331   -7.313  -27.598 1.00 123.07 ? 136 GLU A CB  1 
ATOM 922  N N   . CYS A 1 139 ? 7.798   -5.047  -25.401 1.00 113.59 ? 137 CYS A N   1 
ATOM 923  C CA  . CYS A 1 139 ? 8.698   -4.159  -24.672 1.00 113.51 ? 137 CYS A CA  1 
ATOM 924  C C   . CYS A 1 139 ? 8.531   -4.287  -23.158 1.00 112.17 ? 137 CYS A C   1 
ATOM 925  O O   . CYS A 1 139 ? 9.512   -4.452  -22.431 1.00 114.27 ? 137 CYS A O   1 
ATOM 926  C CB  . CYS A 1 139 ? 8.455   -2.709  -25.096 1.00 113.09 ? 137 CYS A CB  1 
ATOM 927  S SG  . CYS A 1 139 ? 9.197   -2.253  -26.678 1.00 120.56 ? 137 CYS A SG  1 
ATOM 928  N N   . TYR A 1 140 ? 7.286   -4.208  -22.694 1.00 114.89 ? 138 TYR A N   1 
ATOM 929  C CA  . TYR A 1 140 ? 6.972   -4.355  -21.274 1.00 115.21 ? 138 TYR A CA  1 
ATOM 930  C C   . TYR A 1 140 ? 7.506   -5.661  -20.714 1.00 124.30 ? 138 TYR A C   1 
ATOM 931  O O   . TYR A 1 140 ? 8.121   -5.688  -19.648 1.00 148.37 ? 138 TYR A O   1 
ATOM 932  C CB  . TYR A 1 140 ? 5.466   -4.277  -21.031 1.00 113.04 ? 138 TYR A CB  1 
ATOM 933  C CG  . TYR A 1 140 ? 4.881   -2.896  -21.172 1.00 109.89 ? 138 TYR A CG  1 
ATOM 934  C CD1 . TYR A 1 140 ? 5.551   -1.784  -20.681 1.00 108.54 ? 138 TYR A CD1 1 
ATOM 935  C CD2 . TYR A 1 140 ? 3.646   -2.705  -21.774 1.00 114.45 ? 138 TYR A CD2 1 
ATOM 936  C CE1 . TYR A 1 140 ? 5.015   -0.519  -20.799 1.00 108.70 ? 138 TYR A CE1 1 
ATOM 937  C CE2 . TYR A 1 140 ? 3.102   -1.445  -21.897 1.00 115.96 ? 138 TYR A CE2 1 
ATOM 938  C CZ  . TYR A 1 140 ? 3.789   -0.356  -21.408 1.00 110.00 ? 138 TYR A CZ  1 
ATOM 939  O OH  . TYR A 1 140 ? 3.243   0.898   -21.525 1.00 110.62 ? 138 TYR A OH  1 
ATOM 940  N N   . GLN A 1 141 ? 7.254   -6.741  -21.445 1.00 113.54 ? 139 GLN A N   1 
ATOM 941  C CA  . GLN A 1 141 ? 7.737   -8.057  -21.059 1.00 116.29 ? 139 GLN A CA  1 
ATOM 942  C C   . GLN A 1 141 ? 9.253   -8.052  -20.925 1.00 117.51 ? 139 GLN A C   1 
ATOM 943  O O   . GLN A 1 141 ? 9.790   -8.509  -19.917 1.00 124.05 ? 139 GLN A O   1 
ATOM 944  C CB  . GLN A 1 141 ? 7.295   -9.112  -22.074 1.00 117.48 ? 139 GLN A CB  1 
ATOM 945  N N   . LYS A 1 142 ? 9.942   -7.555  -21.949 1.00 121.37 ? 140 LYS A N   1 
ATOM 946  C CA  . LYS A 1 142 ? 11.397  -7.485  -21.905 1.00 124.81 ? 140 LYS A CA  1 
ATOM 947  C C   . LYS A 1 142 ? 11.892  -6.633  -20.735 1.00 131.56 ? 140 LYS A C   1 
ATOM 948  O O   . LYS A 1 142 ? 12.898  -6.958  -20.106 1.00 143.86 ? 140 LYS A O   1 
ATOM 949  C CB  . LYS A 1 142 ? 11.941  -6.927  -23.221 1.00 129.16 ? 140 LYS A CB  1 
ATOM 950  N N   . SER A 1 143 ? 11.189  -5.535  -20.462 1.00 127.44 ? 141 SER A N   1 
ATOM 951  C CA  . SER A 1 143 ? 11.519  -4.668  -19.332 1.00 120.39 ? 141 SER A CA  1 
ATOM 952  C C   . SER A 1 143 ? 11.487  -5.407  -17.997 1.00 122.02 ? 141 SER A C   1 
ATOM 953  O O   . SER A 1 143 ? 12.408  -5.292  -17.188 1.00 130.07 ? 141 SER A O   1 
ATOM 954  C CB  . SER A 1 143 ? 10.570  -3.471  -19.281 1.00 116.91 ? 141 SER A CB  1 
ATOM 955  O OG  . SER A 1 143 ? 10.813  -2.688  -18.125 1.00 115.34 ? 141 SER A OG  1 
ATOM 956  N N   . LEU A 1 144 ? 10.415  -6.166  -17.780 1.00 119.82 ? 142 LEU A N   1 
ATOM 957  C CA  . LEU A 1 144 ? 10.239  -6.926  -16.548 1.00 121.74 ? 142 LEU A CA  1 
ATOM 958  C C   . LEU A 1 144 ? 11.314  -7.994  -16.408 1.00 130.74 ? 142 LEU A C   1 
ATOM 959  O O   . LEU A 1 144 ? 11.723  -8.336  -15.298 1.00 136.50 ? 142 LEU A O   1 
ATOM 960  C CB  . LEU A 1 144 ? 8.850   -7.565  -16.506 1.00 118.10 ? 142 LEU A CB  1 
ATOM 961  N N   . SER A 1 145 ? 11.756  -8.524  -17.543 1.00 140.02 ? 143 SER A N   1 
ATOM 962  C CA  . SER A 1 145 ? 12.872  -9.458  -17.574 1.00 143.17 ? 143 SER A CA  1 
ATOM 963  C C   . SER A 1 145 ? 14.134  -8.797  -17.033 1.00 144.17 ? 143 SER A C   1 
ATOM 964  O O   . SER A 1 145 ? 14.882  -9.401  -16.266 1.00 154.42 ? 143 SER A O   1 
ATOM 965  C CB  . SER A 1 145 ? 13.110  -9.969  -18.996 1.00 157.63 ? 143 SER A CB  1 
ATOM 966  O OG  . SER A 1 145 ? 11.885  -10.132 -19.691 1.00 170.91 ? 143 SER A OG  1 
ATOM 967  N N   . LEU A 1 146 ? 14.357  -7.548  -17.431 1.00 137.09 ? 144 LEU A N   1 
ATOM 968  C CA  . LEU A 1 146 ? 15.549  -6.820  -17.015 1.00 136.64 ? 144 LEU A CA  1 
ATOM 969  C C   . LEU A 1 146 ? 15.416  -6.313  -15.583 1.00 149.90 ? 144 LEU A C   1 
ATOM 970  O O   . LEU A 1 146 ? 16.411  -6.169  -14.874 1.00 166.26 ? 144 LEU A O   1 
ATOM 971  C CB  . LEU A 1 146 ? 15.818  -5.650  -17.965 1.00 127.19 ? 144 LEU A CB  1 
ATOM 972  N N   . ASN A 1 147 ? 14.184  -6.047  -15.160 1.00 140.55 ? 145 ASN A N   1 
ATOM 973  C CA  . ASN A 1 147 ? 13.947  -5.486  -13.837 1.00 126.50 ? 145 ASN A CA  1 
ATOM 974  C C   . ASN A 1 147 ? 12.584  -5.936  -13.325 1.00 124.24 ? 145 ASN A C   1 
ATOM 975  O O   . ASN A 1 147 ? 11.551  -5.475  -13.808 1.00 135.40 ? 145 ASN A O   1 
ATOM 976  C CB  . ASN A 1 147 ? 14.038  -3.956  -13.888 1.00 122.68 ? 145 ASN A CB  1 
ATOM 977  C CG  . ASN A 1 147 ? 13.831  -3.296  -12.533 1.00 122.18 ? 145 ASN A CG  1 
ATOM 978  O OD1 . ASN A 1 147 ? 13.530  -3.953  -11.536 1.00 131.39 ? 145 ASN A OD1 1 
ATOM 979  N ND2 . ASN A 1 147 ? 14.003  -1.980  -12.494 1.00 132.73 ? 145 ASN A ND2 1 
ATOM 980  N N   . PRO A 1 148 ? 12.581  -6.838  -12.334 1.00 138.32 ? 146 PRO A N   1 
ATOM 981  C CA  . PRO A 1 148 ? 11.330  -7.374  -11.793 1.00 137.01 ? 146 PRO A CA  1 
ATOM 982  C C   . PRO A 1 148 ? 10.703  -6.483  -10.724 1.00 133.53 ? 146 PRO A C   1 
ATOM 983  O O   . PRO A 1 148 ? 9.566   -6.734  -10.326 1.00 132.67 ? 146 PRO A O   1 
ATOM 984  C CB  . PRO A 1 148 ? 11.752  -8.720  -11.199 1.00 146.59 ? 146 PRO A CB  1 
ATOM 985  C CG  . PRO A 1 148 ? 13.209  -8.579  -10.896 1.00 159.30 ? 146 PRO A CG  1 
ATOM 986  C CD  . PRO A 1 148 ? 13.769  -7.434  -11.698 1.00 150.33 ? 146 PRO A CD  1 
ATOM 987  N N   . PHE A 1 149 ? 11.427  -5.464  -10.267 1.00 124.13 ? 147 PHE A N   1 
ATOM 988  C CA  . PHE A 1 149 ? 10.889  -4.543  -9.270  1.00 120.27 ? 147 PHE A CA  1 
ATOM 989  C C   . PHE A 1 149 ? 9.917   -3.529  -9.869  1.00 120.11 ? 147 PHE A C   1 
ATOM 990  O O   . PHE A 1 149 ? 9.264   -2.783  -9.138  1.00 128.60 ? 147 PHE A O   1 
ATOM 991  C CB  . PHE A 1 149 ? 12.024  -3.789  -8.568  1.00 120.04 ? 147 PHE A CB  1 
ATOM 992  C CG  . PHE A 1 149 ? 12.970  -4.674  -7.806  1.00 124.38 ? 147 PHE A CG  1 
ATOM 993  C CD1 . PHE A 1 149 ? 12.677  -5.078  -6.515  1.00 140.12 ? 147 PHE A CD1 1 
ATOM 994  C CD2 . PHE A 1 149 ? 14.169  -5.077  -8.372  1.00 128.74 ? 147 PHE A CD2 1 
ATOM 995  C CE1 . PHE A 1 149 ? 13.551  -5.884  -5.809  1.00 160.14 ? 147 PHE A CE1 1 
ATOM 996  C CE2 . PHE A 1 149 ? 15.049  -5.882  -7.672  1.00 143.07 ? 147 PHE A CE2 1 
ATOM 997  C CZ  . PHE A 1 149 ? 14.739  -6.286  -6.389  1.00 159.73 ? 147 PHE A CZ  1 
ATOM 998  N N   . LEU A 1 150 ? 9.817   -3.506  -11.194 1.00 114.98 ? 148 LEU A N   1 
ATOM 999  C CA  . LEU A 1 150 ? 8.947   -2.549  -11.868 1.00 110.99 ? 148 LEU A CA  1 
ATOM 1000 C C   . LEU A 1 150 ? 7.518   -3.074  -11.928 1.00 114.09 ? 148 LEU A C   1 
ATOM 1001 O O   . LEU A 1 150 ? 7.230   -4.020  -12.662 1.00 118.81 ? 148 LEU A O   1 
ATOM 1002 C CB  . LEU A 1 150 ? 9.471   -2.252  -13.274 1.00 104.91 ? 148 LEU A CB  1 
ATOM 1003 N N   . TRP A 1 151 ? 6.623   -2.457  -11.162 1.00 114.52 ? 149 TRP A N   1 
ATOM 1004 C CA  . TRP A 1 151 ? 5.216   -2.840  -11.192 1.00 117.24 ? 149 TRP A CA  1 
ATOM 1005 C C   . TRP A 1 151 ? 4.476   -2.319  -12.429 1.00 115.25 ? 149 TRP A C   1 
ATOM 1006 O O   . TRP A 1 151 ? 3.559   -2.973  -12.924 1.00 128.41 ? 149 TRP A O   1 
ATOM 1007 C CB  . TRP A 1 151 ? 4.531   -2.372  -9.909  1.00 117.76 ? 149 TRP A CB  1 
ATOM 1008 C CG  . TRP A 1 151 ? 3.060   -2.564  -9.913  1.00 129.20 ? 149 TRP A CG  1 
ATOM 1009 C CD1 . TRP A 1 151 ? 2.118   -1.613  -10.136 1.00 149.87 ? 149 TRP A CD1 1 
ATOM 1010 C CD2 . TRP A 1 151 ? 2.355   -3.796  -9.725  1.00 125.89 ? 149 TRP A CD2 1 
ATOM 1011 N NE1 . TRP A 1 151 ? 0.861   -2.167  -10.076 1.00 148.16 ? 149 TRP A NE1 1 
ATOM 1012 C CE2 . TRP A 1 151 ? 0.980   -3.508  -9.828  1.00 130.55 ? 149 TRP A CE2 1 
ATOM 1013 C CE3 . TRP A 1 151 ? 2.752   -5.112  -9.471  1.00 128.42 ? 149 TRP A CE3 1 
ATOM 1014 C CZ2 . TRP A 1 151 ? 0.000   -4.488  -9.686  1.00 132.85 ? 149 TRP A CZ2 1 
ATOM 1015 C CZ3 . TRP A 1 151 ? 1.778   -6.083  -9.330  1.00 133.26 ? 149 TRP A CZ3 1 
ATOM 1016 C CH2 . TRP A 1 151 ? 0.418   -5.766  -9.438  1.00 134.41 ? 149 TRP A CH2 1 
ATOM 1017 N N   . SER A 1 152 ? 4.868   -1.146  -12.920 1.00 113.32 ? 150 SER A N   1 
ATOM 1018 C CA  . SER A 1 152 ? 4.123   -0.452  -13.982 1.00 115.98 ? 150 SER A CA  1 
ATOM 1019 C C   . SER A 1 152 ? 4.034   -1.263  -15.290 1.00 113.96 ? 150 SER A C   1 
ATOM 1020 O O   . SER A 1 152 ? 2.950   -1.359  -15.864 1.00 115.95 ? 150 SER A O   1 
ATOM 1021 C CB  . SER A 1 152 ? 4.697   0.942   -14.244 1.00 134.23 ? 150 SER A CB  1 
ATOM 1022 O OG  . SER A 1 152 ? 5.049   1.564   -13.025 1.00 147.19 ? 150 SER A OG  1 
ATOM 1023 N N   . PRO A 1 153 ? 5.169   -1.811  -15.786 1.00 109.61 ? 151 PRO A N   1 
ATOM 1024 C CA  . PRO A 1 153 ? 5.099   -2.628  -17.006 1.00 109.28 ? 151 PRO A CA  1 
ATOM 1025 C C   . PRO A 1 153 ? 4.098   -3.762  -16.827 1.00 111.44 ? 151 PRO A C   1 
ATOM 1026 O O   . PRO A 1 153 ? 3.273   -4.001  -17.709 1.00 125.52 ? 151 PRO A O   1 
ATOM 1027 C CB  . PRO A 1 153 ? 6.527   -3.157  -17.174 1.00 111.33 ? 151 PRO A CB  1 
ATOM 1028 C CG  . PRO A 1 153 ? 7.373   -2.212  -16.419 1.00 114.87 ? 151 PRO A CG  1 
ATOM 1029 C CD  . PRO A 1 153 ? 6.549   -1.750  -15.268 1.00 114.88 ? 151 PRO A CD  1 
ATOM 1030 N N   . PHE A 1 154 ? 4.188   -4.455  -15.699 1.00 116.68 ? 152 PHE A N   1 
ATOM 1031 C CA  . PHE A 1 154 ? 3.295   -5.562  -15.396 1.00 121.57 ? 152 PHE A CA  1 
ATOM 1032 C C   . PHE A 1 154 ? 1.855   -5.041  -15.394 1.00 123.86 ? 152 PHE A C   1 
ATOM 1033 O O   . PHE A 1 154 ? 0.965   -5.666  -15.969 1.00 120.19 ? 152 PHE A O   1 
ATOM 1034 C CB  . PHE A 1 154 ? 3.637   -6.215  -14.054 1.00 127.27 ? 152 PHE A CB  1 
ATOM 1035 C CG  . PHE A 1 154 ? 2.669   -7.290  -13.644 1.00 138.42 ? 152 PHE A CG  1 
ATOM 1036 C CD1 . PHE A 1 154 ? 2.878   -8.603  -14.032 1.00 145.51 ? 152 PHE A CD1 1 
ATOM 1037 C CD2 . PHE A 1 154 ? 1.550   -6.993  -12.883 1.00 146.31 ? 152 PHE A CD2 1 
ATOM 1038 C CE1 . PHE A 1 154 ? 1.994   -9.599  -13.668 1.00 150.97 ? 152 PHE A CE1 1 
ATOM 1039 C CE2 . PHE A 1 154 ? 0.661   -7.984  -12.519 1.00 150.24 ? 152 PHE A CE2 1 
ATOM 1040 C CZ  . PHE A 1 154 ? 0.885   -9.289  -12.913 1.00 150.79 ? 152 PHE A CZ  1 
ATOM 1041 N N   . GLU A 1 155 ? 1.630   -3.903  -14.741 1.00 135.91 ? 153 GLU A N   1 
ATOM 1042 C CA  . GLU A 1 155 ? 0.286   -3.341  -14.616 1.00 140.99 ? 153 GLU A CA  1 
ATOM 1043 C C   . GLU A 1 155 ? -0.302  -2.902  -15.961 1.00 149.99 ? 153 GLU A C   1 
ATOM 1044 O O   . GLU A 1 155 ? -1.511  -2.996  -16.173 1.00 163.45 ? 153 GLU A O   1 
ATOM 1045 C CB  . GLU A 1 155 ? 0.319   -2.125  -13.678 1.00 144.81 ? 153 GLU A CB  1 
ATOM 1046 C CG  . GLU A 1 155 ? -1.010  -1.385  -13.542 1.00 151.83 ? 153 GLU A CG  1 
ATOM 1047 C CD  . GLU A 1 155 ? -1.085  -0.518  -12.296 1.00 149.99 ? 153 GLU A CD  1 
ATOM 1048 O OE1 . GLU A 1 155 ? -0.207  -0.645  -11.425 1.00 142.35 ? 153 GLU A OE1 1 
ATOM 1049 O OE2 . GLU A 1 155 ? -2.028  0.294   -12.188 1.00 153.29 ? 153 GLU A OE2 1 
ATOM 1050 N N   . SER A 1 156 ? 0.549   -2.435  -16.869 1.00 136.41 ? 154 SER A N   1 
ATOM 1051 C CA  . SER A 1 156 ? 0.124   -2.141  -18.238 1.00 118.71 ? 154 SER A CA  1 
ATOM 1052 C C   . SER A 1 156 ? -0.302  -3.371  -19.046 1.00 113.96 ? 154 SER A C   1 
ATOM 1053 O O   . SER A 1 156 ? -1.322  -3.349  -19.732 1.00 116.82 ? 154 SER A O   1 
ATOM 1054 C CB  . SER A 1 156 ? 1.235   -1.404  -18.987 1.00 124.78 ? 154 SER A CB  1 
ATOM 1055 O OG  . SER A 1 156 ? 1.669   -0.263  -18.268 1.00 126.61 ? 154 SER A OG  1 
ATOM 1056 N N   . LEU A 1 157 ? 0.487   -4.436  -18.952 1.00 111.83 ? 155 LEU A N   1 
ATOM 1057 C CA  . LEU A 1 157 ? 0.203   -5.699  -19.633 1.00 112.66 ? 155 LEU A CA  1 
ATOM 1058 C C   . LEU A 1 157 ? -1.140  -6.329  -19.272 1.00 129.62 ? 155 LEU A C   1 
ATOM 1059 O O   . LEU A 1 157 ? -1.850  -6.829  -20.144 1.00 141.54 ? 155 LEU A O   1 
ATOM 1060 C CB  . LEU A 1 157 ? 1.321   -6.706  -19.349 1.00 113.50 ? 155 LEU A CB  1 
ATOM 1061 C CG  . LEU A 1 157 ? 2.620   -6.521  -20.135 1.00 110.89 ? 155 LEU A CG  1 
ATOM 1062 C CD1 . LEU A 1 157 ? 3.736   -7.362  -19.540 1.00 113.14 ? 155 LEU A CD1 1 
ATOM 1063 C CD2 . LEU A 1 157 ? 2.411   -6.873  -21.598 1.00 115.03 ? 155 LEU A CD2 1 
ATOM 1064 N N   . CYS A 1 158 ? -1.486  -6.302  -17.991 1.00 133.29 ? 156 CYS A N   1 
ATOM 1065 C CA  . CYS A 1 158 ? -2.791  -6.775  -17.547 1.00 135.34 ? 156 CYS A CA  1 
ATOM 1066 C C   . CYS A 1 158 ? -3.931  -5.958  -18.148 1.00 134.53 ? 156 CYS A C   1 
ATOM 1067 O O   . CYS A 1 158 ? -4.902  -6.523  -18.649 1.00 134.87 ? 156 CYS A O   1 
ATOM 1068 C CB  . CYS A 1 158 ? -2.874  -6.746  -16.019 1.00 134.94 ? 156 CYS A CB  1 
ATOM 1069 S SG  . CYS A 1 158 ? -1.603  -7.729  -15.185 1.00 161.29 ? 156 CYS A SG  1 
ATOM 1070 N N   . GLU A 1 159 ? -3.793  -4.636  -18.133 1.00 136.88 ? 157 GLU A N   1 
ATOM 1071 C CA  . GLU A 1 159 ? -4.835  -3.746  -18.641 1.00 136.88 ? 157 GLU A CA  1 
ATOM 1072 C C   . GLU A 1 159 ? -5.065  -3.888  -20.146 1.00 136.84 ? 157 GLU A C   1 
ATOM 1073 O O   . GLU A 1 159 ? -6.173  -3.652  -20.629 1.00 137.65 ? 157 GLU A O   1 
ATOM 1074 C CB  . GLU A 1 159 ? -4.500  -2.290  -18.301 1.00 137.18 ? 157 GLU A CB  1 
ATOM 1075 C CG  . GLU A 1 159 ? -4.691  -1.936  -16.831 1.00 144.85 ? 157 GLU A CG  1 
ATOM 1076 C CD  . GLU A 1 159 ? -3.924  -0.693  -16.420 1.00 144.76 ? 157 GLU A CD  1 
ATOM 1077 O OE1 . GLU A 1 159 ? -4.268  -0.097  -15.376 1.00 142.33 ? 157 GLU A OE1 1 
ATOM 1078 O OE2 . GLU A 1 159 ? -2.974  -0.314  -17.137 1.00 146.24 ? 157 GLU A OE2 1 
ATOM 1079 N N   . ILE A 1 160 ? -4.028  -4.266  -20.886 1.00 131.33 ? 158 ILE A N   1 
ATOM 1080 C CA  . ILE A 1 160 ? -4.160  -4.444  -22.329 1.00 130.34 ? 158 ILE A CA  1 
ATOM 1081 C C   . ILE A 1 160 ? -5.024  -5.657  -22.680 1.00 146.77 ? 158 ILE A C   1 
ATOM 1082 O O   . ILE A 1 160 ? -5.791  -5.628  -23.645 1.00 156.66 ? 158 ILE A O   1 
ATOM 1083 C CB  . ILE A 1 160 ? -2.775  -4.608  -22.997 1.00 121.15 ? 158 ILE A CB  1 
ATOM 1084 C CG1 . ILE A 1 160 ? -1.963  -3.319  -22.878 1.00 116.93 ? 158 ILE A CG1 1 
ATOM 1085 C CG2 . ILE A 1 160 ? -2.912  -5.006  -24.460 1.00 122.78 ? 158 ILE A CG2 1 
ATOM 1086 C CD1 . ILE A 1 160 ? -0.481  -3.518  -23.102 1.00 113.60 ? 158 ILE A CD1 1 
ATOM 1087 N N   . GLY A 1 161 ? -4.937  -6.703  -21.867 1.00 154.37 ? 159 GLY A N   1 
ATOM 1088 C CA  . GLY A 1 161 ? -5.568  -7.967  -22.201 1.00 166.73 ? 159 GLY A CA  1 
ATOM 1089 C C   . GLY A 1 161 ? -4.557  -9.092  -22.303 1.00 168.41 ? 159 GLY A C   1 
ATOM 1090 O O   . GLY A 1 161 ? -4.921  -10.266 -22.375 1.00 181.29 ? 159 GLY A O   1 
ATOM 1091 N N   . GLU A 1 162 ? -3.279  -8.727  -22.317 1.00 151.97 ? 160 GLU A N   1 
ATOM 1092 C CA  . GLU A 1 162 ? -2.203  -9.699  -22.179 1.00 143.57 ? 160 GLU A CA  1 
ATOM 1093 C C   . GLU A 1 162 ? -2.295  -10.391 -20.825 1.00 136.33 ? 160 GLU A C   1 
ATOM 1094 O O   . GLU A 1 162 ? -2.742  -9.799  -19.843 1.00 140.04 ? 160 GLU A O   1 
ATOM 1095 C CB  . GLU A 1 162 ? -0.838  -9.029  -22.346 1.00 137.20 ? 160 GLU A CB  1 
ATOM 1096 N N   . LYS A 1 163 ? -1.870  -11.648 -20.780 1.00 131.37 ? 161 LYS A N   1 
ATOM 1097 C CA  . LYS A 1 163 ? -1.844  -12.401 -19.534 1.00 134.05 ? 161 LYS A CA  1 
ATOM 1098 C C   . LYS A 1 163 ? -0.441  -12.882 -19.191 1.00 138.15 ? 161 LYS A C   1 
ATOM 1099 O O   . LYS A 1 163 ? -0.092  -14.033 -19.454 1.00 161.93 ? 161 LYS A O   1 
ATOM 1100 C CB  . LYS A 1 163 ? -2.798  -13.594 -19.617 1.00 133.25 ? 161 LYS A CB  1 
ATOM 1101 N N   . PRO A 1 164 ? 0.370   -11.996 -18.596 1.00 133.12 ? 162 PRO A N   1 
ATOM 1102 C CA  . PRO A 1 164 ? 1.709   -12.422 -18.181 1.00 136.04 ? 162 PRO A CA  1 
ATOM 1103 C C   . PRO A 1 164 ? 1.655   -13.338 -16.963 1.00 146.92 ? 162 PRO A C   1 
ATOM 1104 O O   . PRO A 1 164 ? 0.664   -13.337 -16.236 1.00 152.87 ? 162 PRO A O   1 
ATOM 1105 C CB  . PRO A 1 164 ? 2.410   -11.103 -17.849 1.00 123.12 ? 162 PRO A CB  1 
ATOM 1106 N N   . ASP A 1 165 ? 2.714   -14.118 -16.772 1.00 152.36 ? 163 ASP A N   1 
ATOM 1107 C CA  . ASP A 1 165 ? 2.781   -15.146 -15.737 1.00 161.55 ? 163 ASP A CA  1 
ATOM 1108 C C   . ASP A 1 165 ? 3.515   -14.673 -14.483 1.00 158.78 ? 163 ASP A C   1 
ATOM 1109 O O   . ASP A 1 165 ? 4.745   -14.671 -14.460 1.00 162.18 ? 163 ASP A O   1 
ATOM 1110 C CB  . ASP A 1 165 ? 3.455   -16.405 -16.287 1.00 161.35 ? 163 ASP A CB  1 
ATOM 1111 N N   . PRO A 1 166 ? 2.761   -14.249 -13.450 1.00 144.31 ? 164 PRO A N   1 
ATOM 1112 C CA  . PRO A 1 166 ? 3.307   -13.661 -12.220 1.00 146.52 ? 164 PRO A CA  1 
ATOM 1113 C C   . PRO A 1 166 ? 4.503   -14.438 -11.669 1.00 162.75 ? 164 PRO A C   1 
ATOM 1114 O O   . PRO A 1 166 ? 5.484   -13.830 -11.242 1.00 179.81 ? 164 PRO A O   1 
ATOM 1115 C CB  . PRO A 1 166 ? 2.128   -13.738 -11.248 1.00 146.47 ? 164 PRO A CB  1 
ATOM 1116 C CG  . PRO A 1 166 ? 0.930   -13.653 -12.113 1.00 145.07 ? 164 PRO A CG  1 
ATOM 1117 C CD  . PRO A 1 166 ? 1.290   -14.319 -13.416 1.00 143.96 ? 164 PRO A CD  1 
ATOM 1118 N N   . ASP A 1 167 ? 4.419   -15.765 -11.690 1.00 159.92 ? 165 ASP A N   1 
ATOM 1119 C CA  . ASP A 1 167 ? 5.474   -16.606 -11.137 1.00 163.71 ? 165 ASP A CA  1 
ATOM 1120 C C   . ASP A 1 167 ? 6.755   -16.525 -11.966 1.00 161.96 ? 165 ASP A C   1 
ATOM 1121 O O   . ASP A 1 167 ? 7.852   -16.718 -11.443 1.00 168.48 ? 165 ASP A O   1 
ATOM 1122 C CB  . ASP A 1 167 ? 5.006   -18.062 -11.044 1.00 178.74 ? 165 ASP A CB  1 
ATOM 1123 C CG  . ASP A 1 167 ? 3.905   -18.259 -10.017 1.00 186.83 ? 165 ASP A CG  1 
ATOM 1124 O OD1 . ASP A 1 167 ? 3.363   -17.250 -9.518  1.00 184.46 ? 165 ASP A OD1 1 
ATOM 1125 O OD2 . ASP A 1 167 ? 3.581   -19.426 -9.710  1.00 193.13 ? 165 ASP A OD2 1 
ATOM 1126 N N   . GLN A 1 168 ? 6.616   -16.240 -13.256 1.00 154.79 ? 166 GLN A N   1 
ATOM 1127 C CA  . GLN A 1 168 ? 7.782   -16.064 -14.112 1.00 157.59 ? 166 GLN A CA  1 
ATOM 1128 C C   . GLN A 1 168 ? 8.211   -14.604 -14.249 1.00 157.92 ? 166 GLN A C   1 
ATOM 1129 O O   . GLN A 1 168 ? 9.398   -14.312 -14.390 1.00 171.60 ? 166 GLN A O   1 
ATOM 1130 C CB  . GLN A 1 168 ? 7.506   -16.647 -15.502 1.00 156.87 ? 166 GLN A CB  1 
ATOM 1131 N N   . THR A 1 169 ? 7.247   -13.690 -14.187 1.00 144.36 ? 167 THR A N   1 
ATOM 1132 C CA  . THR A 1 169 ? 7.534   -12.258 -14.252 1.00 142.20 ? 167 THR A CA  1 
ATOM 1133 C C   . THR A 1 169 ? 8.344   -11.683 -13.087 1.00 150.18 ? 167 THR A C   1 
ATOM 1134 O O   . THR A 1 169 ? 9.313   -10.955 -13.305 1.00 156.20 ? 167 THR A O   1 
ATOM 1135 C CB  . THR A 1 169 ? 6.226   -11.450 -14.355 1.00 129.73 ? 167 THR A CB  1 
ATOM 1136 N N   . PHE A 1 170 ? 7.967   -12.017 -11.858 1.00 150.87 ? 168 PHE A N   1 
ATOM 1137 C CA  . PHE A 1 170 ? 8.719   -11.549 -10.699 1.00 139.78 ? 168 PHE A CA  1 
ATOM 1138 C C   . PHE A 1 170 ? 9.595   -12.638 -10.099 1.00 142.72 ? 168 PHE A C   1 
ATOM 1139 O O   . PHE A 1 170 ? 9.159   -13.374 -9.215  1.00 143.54 ? 168 PHE A O   1 
ATOM 1140 C CB  . PHE A 1 170 ? 7.764   -11.012 -9.629  1.00 129.62 ? 168 PHE A CB  1 
ATOM 1141 N N   . LYS A 1 171 ? 10.838  -12.723 -10.560 1.00 148.86 ? 169 LYS A N   1 
ATOM 1142 C CA  . LYS A 1 171 ? 11.803  -13.617 -9.937  1.00 158.61 ? 169 LYS A CA  1 
ATOM 1143 C C   . LYS A 1 171 ? 13.246  -13.214 -10.218 1.00 175.68 ? 169 LYS A C   1 
ATOM 1144 O O   . LYS A 1 171 ? 13.717  -13.302 -11.350 1.00 171.95 ? 169 LYS A O   1 
ATOM 1145 C CB  . LYS A 1 171 ? 11.572  -15.053 -10.414 1.00 150.49 ? 169 LYS A CB  1 
ATOM 1146 N N   . PHE A 1 172 ? 13.932  -12.768 -9.170  1.00 180.70 ? 170 PHE A N   1 
ATOM 1147 C CA  . PHE A 1 172 ? 15.302  -12.261 -9.259  1.00 169.75 ? 170 PHE A CA  1 
ATOM 1148 C C   . PHE A 1 172 ? 16.270  -13.279 -9.868  1.00 178.02 ? 170 PHE A C   1 
ATOM 1149 O O   . PHE A 1 172 ? 16.385  -14.396 -9.370  1.00 177.09 ? 170 PHE A O   1 
ATOM 1150 C CB  . PHE A 1 172 ? 15.798  -11.838 -7.875  1.00 152.29 ? 170 PHE A CB  1 
ATOM 1151 N N   . THR A 1 173 ? 16.988  -12.894 -10.918 1.00 183.70 ? 171 THR A N   1 
ATOM 1152 C CA  . THR A 1 173 ? 17.812  -13.853 -11.648 1.00 190.37 ? 171 THR A CA  1 
ATOM 1153 C C   . THR A 1 173 ? 19.145  -13.234 -12.041 1.00 195.44 ? 171 THR A C   1 
ATOM 1154 O O   . THR A 1 173 ? 19.573  -13.328 -13.189 1.00 192.46 ? 171 THR A O   1 
ATOM 1155 C CB  . THR A 1 173 ? 17.108  -14.361 -12.925 1.00 183.59 ? 171 THR A CB  1 
ATOM 1156 N N   . LYS A 1 192 ? 21.881  -10.718 3.044   1.00 156.85 ? 462 LYS A N   1 
ATOM 1157 C CA  . LYS A 1 192 ? 20.508  -11.210 3.063   1.00 148.69 ? 462 LYS A CA  1 
ATOM 1158 C C   . LYS A 1 192 ? 19.832  -11.034 1.704   1.00 152.41 ? 462 LYS A C   1 
ATOM 1159 O O   . LYS A 1 192 ? 20.150  -10.106 0.959   1.00 156.54 ? 462 LYS A O   1 
ATOM 1160 C CB  . LYS A 1 192 ? 19.701  -10.497 4.149   1.00 142.06 ? 462 LYS A CB  1 
ATOM 1161 N N   . ALA A 1 193 ? 18.899  -11.928 1.389   1.00 150.20 ? 463 ALA A N   1 
ATOM 1162 C CA  . ALA A 1 193 ? 18.187  -11.893 0.112   1.00 121.70 ? 463 ALA A CA  1 
ATOM 1163 C C   . ALA A 1 193 ? 16.785  -11.306 0.281   1.00 120.48 ? 463 ALA A C   1 
ATOM 1164 O O   . ALA A 1 193 ? 15.795  -12.032 0.386   1.00 132.19 ? 463 ALA A O   1 
ATOM 1165 C CB  . ALA A 1 193 ? 18.117  -13.283 -0.490  1.00 120.48 ? 463 ALA A CB  1 
ATOM 1166 N N   . ALA A 1 194 ? 16.732  -9.978  0.296   1.00 255.36 ? 464 ALA A N   1 
ATOM 1167 C CA  . ALA A 1 194 ? 15.503  -9.194  0.434   1.00 214.45 ? 464 ALA A CA  1 
ATOM 1168 C C   . ALA A 1 194 ? 14.500  -9.254  -0.722  1.00 191.36 ? 464 ALA A C   1 
ATOM 1169 O O   . ALA A 1 194 ? 13.290  -9.217  -0.486  1.00 186.05 ? 464 ALA A O   1 
ATOM 1170 C CB  . ALA A 1 194 ? 15.872  -7.741  0.691   1.00 207.41 ? 464 ALA A CB  1 
ATOM 1171 N N   . ALA A 1 195 ? 14.992  -9.333  -1.958  1.00 178.32 ? 465 ALA A N   1 
ATOM 1172 C CA  . ALA A 1 195 ? 14.118  -9.480  -3.125  1.00 167.10 ? 465 ALA A CA  1 
ATOM 1173 C C   . ALA A 1 195 ? 13.109  -10.611 -2.947  1.00 157.58 ? 465 ALA A C   1 
ATOM 1174 O O   . ALA A 1 195 ? 11.907  -10.366 -3.068  1.00 153.41 ? 465 ALA A O   1 
ATOM 1175 C CB  . ALA A 1 195 ? 14.948  -9.702  -4.380  1.00 175.56 ? 465 ALA A CB  1 
ATOM 1176 N N   . GLU A 1 196 ? 13.599  -11.835 -2.742  1.00 151.82 ? 466 GLU A N   1 
ATOM 1177 C CA  . GLU A 1 196 ? 12.761  -13.032 -2.581  1.00 141.07 ? 466 GLU A CA  1 
ATOM 1178 C C   . GLU A 1 196 ? 11.447  -12.695 -1.871  1.00 141.57 ? 466 GLU A C   1 
ATOM 1179 O O   . GLU A 1 196 ? 10.361  -13.078 -2.304  1.00 130.87 ? 466 GLU A O   1 
ATOM 1180 C CB  . GLU A 1 196 ? 13.516  -14.122 -1.820  1.00 140.04 ? 466 GLU A CB  1 
ATOM 1181 N N   . GLY A 1 197 ? 11.584  -11.971 -0.764  1.00 156.67 ? 467 GLY A N   1 
ATOM 1182 C CA  . GLY A 1 197 ? 10.472  -11.519 0.051   1.00 156.22 ? 467 GLY A CA  1 
ATOM 1183 C C   . GLY A 1 197 ? 9.546   -10.529 -0.633  1.00 164.21 ? 467 GLY A C   1 
ATOM 1184 O O   . GLY A 1 197 ? 8.328   -10.711 -0.624  1.00 173.53 ? 467 GLY A O   1 
ATOM 1185 N N   . LEU A 1 198 ? 10.111  -9.477  -1.220  1.00 160.25 ? 468 LEU A N   1 
ATOM 1186 C CA  . LEU A 1 198 ? 9.297   -8.491  -1.925  1.00 143.65 ? 468 LEU A CA  1 
ATOM 1187 C C   . LEU A 1 198 ? 8.575   -9.103  -3.120  1.00 148.17 ? 468 LEU A C   1 
ATOM 1188 O O   . LEU A 1 198 ? 7.436   -8.741  -3.415  1.00 156.40 ? 468 LEU A O   1 
ATOM 1189 C CB  . LEU A 1 198 ? 10.169  -7.323  -2.395  1.00 129.07 ? 468 LEU A CB  1 
ATOM 1190 N N   . MET A 1 199 ? 9.233   -10.035 -3.798  1.00 145.79 ? 469 MET A N   1 
ATOM 1191 C CA  . MET A 1 199 ? 8.663   -10.643 -4.993  1.00 140.52 ? 469 MET A CA  1 
ATOM 1192 C C   . MET A 1 199 ? 7.474   -11.535 -4.641  1.00 133.60 ? 469 MET A C   1 
ATOM 1193 O O   . MET A 1 199 ? 6.527   -11.649 -5.415  1.00 130.51 ? 469 MET A O   1 
ATOM 1194 C CB  . MET A 1 199 ? 9.723   -11.446 -5.750  1.00 142.69 ? 469 MET A CB  1 
ATOM 1195 N N   . SER A 1 200 ? 7.521   -12.142 -3.456  1.00 133.75 ? 470 SER A N   1 
ATOM 1196 C CA  . SER A 1 200 ? 6.429   -12.981 -2.960  1.00 140.55 ? 470 SER A CA  1 
ATOM 1197 C C   . SER A 1 200 ? 5.129   -12.197 -2.834  1.00 135.76 ? 470 SER A C   1 
ATOM 1198 O O   . SER A 1 200 ? 4.070   -12.674 -3.245  1.00 135.07 ? 470 SER A O   1 
ATOM 1199 C CB  . SER A 1 200 ? 6.801   -13.602 -1.612  1.00 166.11 ? 470 SER A CB  1 
ATOM 1200 O OG  . SER A 1 200 ? 5.861   -14.592 -1.231  1.00 175.70 ? 470 SER A OG  1 
ATOM 1201 N N   . LEU A 1 201 ? 5.210   -11.007 -2.247  1.00 140.17 ? 471 LEU A N   1 
ATOM 1202 C CA  . LEU A 1 201 ? 4.045   -10.141 -2.108  1.00 136.41 ? 471 LEU A CA  1 
ATOM 1203 C C   . LEU A 1 201 ? 3.569   -9.831  -3.520  1.00 149.12 ? 471 LEU A C   1 
ATOM 1204 O O   . LEU A 1 201 ? 2.400   -10.015 -3.861  1.00 165.26 ? 471 LEU A O   1 
ATOM 1205 C CB  . LEU A 1 201 ? 4.386   -8.864  -1.340  1.00 122.59 ? 471 LEU A CB  1 
ATOM 1206 N N   . LEU A 1 202 ? 4.509   -9.345  -4.322  1.00 148.98 ? 472 LEU A N   1 
ATOM 1207 C CA  . LEU A 1 202 ? 4.289   -8.954  -5.709  1.00 129.22 ? 472 LEU A CA  1 
ATOM 1208 C C   . LEU A 1 202 ? 3.672   -10.078 -6.543  1.00 121.73 ? 472 LEU A C   1 
ATOM 1209 O O   . LEU A 1 202 ? 2.853   -9.825  -7.426  1.00 116.88 ? 472 LEU A O   1 
ATOM 1210 C CB  . LEU A 1 202 ? 5.605   -8.499  -6.345  1.00 114.20 ? 472 LEU A CB  1 
ATOM 1211 N N   . ARG A 1 203 ? 4.055   -11.317 -6.245  1.00 128.82 ? 473 ARG A N   1 
ATOM 1212 C CA  . ARG A 1 203 ? 3.501   -12.477 -6.938  1.00 127.80 ? 473 ARG A CA  1 
ATOM 1213 C C   . ARG A 1 203 ? 2.010   -12.656 -6.692  1.00 127.72 ? 473 ARG A C   1 
ATOM 1214 O O   . ARG A 1 203 ? 1.234   -12.769 -7.641  1.00 131.53 ? 473 ARG A O   1 
ATOM 1215 C CB  . ARG A 1 203 ? 4.222   -13.750 -6.481  1.00 132.20 ? 473 ARG A CB  1 
ATOM 1216 C CG  . ARG A 1 203 ? 5.583   -14.016 -7.097  1.00 144.65 ? 473 ARG A CG  1 
ATOM 1217 C CD  . ARG A 1 203 ? 6.023   -15.438 -6.775  1.00 157.72 ? 473 ARG A CD  1 
ATOM 1218 N NE  . ARG A 1 203 ? 7.320   -15.482 -6.103  1.00 170.28 ? 473 ARG A NE  1 
ATOM 1219 C CZ  . ARG A 1 203 ? 8.480   -15.636 -6.732  1.00 181.94 ? 473 ARG A CZ  1 
ATOM 1220 N NH1 . ARG A 1 203 ? 8.504   -15.771 -8.050  1.00 185.54 ? 473 ARG A NH1 1 
ATOM 1221 N NH2 . ARG A 1 203 ? 9.614   -15.670 -6.044  1.00 188.38 ? 473 ARG A NH2 1 
ATOM 1222 N N   . GLU A 1 204 ? 1.605   -12.685 -5.428  1.00 123.41 ? 474 GLU A N   1 
ATOM 1223 C CA  . GLU A 1 204 ? 0.201   -12.901 -5.100  1.00 123.37 ? 474 GLU A CA  1 
ATOM 1224 C C   . GLU A 1 204 ? -0.628  -11.691 -5.513  1.00 130.21 ? 474 GLU A C   1 
ATOM 1225 O O   . GLU A 1 204 ? -1.784  -11.820 -5.922  1.00 138.01 ? 474 GLU A O   1 
ATOM 1226 C CB  . GLU A 1 204 ? 0.030   -13.177 -3.605  1.00 118.42 ? 474 GLU A CB  1 
ATOM 1227 N N   . MET A 1 205 ? -0.014  -10.516 -5.415  1.00 122.16 ? 475 MET A N   1 
ATOM 1228 C CA  . MET A 1 205 ? -0.613  -9.281  -5.905  1.00 116.44 ? 475 MET A CA  1 
ATOM 1229 C C   . MET A 1 205 ? -0.750  -9.262  -7.422  1.00 115.51 ? 475 MET A C   1 
ATOM 1230 O O   . MET A 1 205 ? -1.785  -8.853  -7.950  1.00 127.22 ? 475 MET A O   1 
ATOM 1231 C CB  . MET A 1 205 ? 0.213   -8.078  -5.443  1.00 112.20 ? 475 MET A CB  1 
ATOM 1232 N N   . GLY A 1 206 ? 0.299   -9.687  -8.120  1.00 116.66 ? 476 GLY A N   1 
ATOM 1233 C CA  . GLY A 1 206 ? 0.258   -9.750  -9.569  1.00 116.90 ? 476 GLY A CA  1 
ATOM 1234 C C   . GLY A 1 206 ? -0.845  -10.680 -10.026 1.00 117.69 ? 476 GLY A C   1 
ATOM 1235 O O   . GLY A 1 206 ? -1.670  -10.331 -10.872 1.00 121.85 ? 476 GLY A O   1 
ATOM 1236 N N   . LYS A 1 207 ? -0.838  -11.879 -9.452  1.00 116.35 ? 477 LYS A N   1 
ATOM 1237 C CA  . LYS A 1 207 ? -1.862  -12.891 -9.680  1.00 117.29 ? 477 LYS A CA  1 
ATOM 1238 C C   . LYS A 1 207 ? -3.265  -12.345 -9.442  1.00 120.44 ? 477 LYS A C   1 
ATOM 1239 O O   . LYS A 1 207 ? -4.199  -12.678 -10.165 1.00 128.72 ? 477 LYS A O   1 
ATOM 1240 C CB  . LYS A 1 207 ? -1.618  -14.107 -8.784  1.00 114.48 ? 477 LYS A CB  1 
ATOM 1241 N N   . GLY A 1 208 ? -3.397  -11.495 -8.427  1.00 128.00 ? 478 GLY A N   1 
ATOM 1242 C CA  . GLY A 1 208 ? -4.667  -10.873 -8.101  1.00 130.86 ? 478 GLY A CA  1 
ATOM 1243 C C   . GLY A 1 208 ? -5.119  -9.720  -8.978  1.00 125.77 ? 478 GLY A C   1 
ATOM 1244 O O   . GLY A 1 208 ? -6.312  -9.600  -9.256  1.00 118.82 ? 478 GLY A O   1 
ATOM 1245 N N   . TYR A 1 209 ? -4.196  -8.871  -9.420  1.00 130.03 ? 479 TYR A N   1 
ATOM 1246 C CA  . TYR A 1 209 ? -4.589  -7.748  -10.267 1.00 131.23 ? 479 TYR A CA  1 
ATOM 1247 C C   . TYR A 1 209 ? -4.942  -8.167  -11.685 1.00 158.95 ? 479 TYR A C   1 
ATOM 1248 O O   . TYR A 1 209 ? -5.854  -7.605  -12.293 1.00 184.65 ? 479 TYR A O   1 
ATOM 1249 C CB  . TYR A 1 209 ? -3.489  -6.690  -10.328 1.00 128.72 ? 479 TYR A CB  1 
ATOM 1250 C CG  . TYR A 1 209 ? -3.960  -5.429  -11.012 1.00 137.46 ? 479 TYR A CG  1 
ATOM 1251 C CD1 . TYR A 1 209 ? -4.942  -4.629  -10.445 1.00 149.30 ? 479 TYR A CD1 1 
ATOM 1252 C CD2 . TYR A 1 209 ? -3.449  -5.061  -12.251 1.00 133.08 ? 479 TYR A CD2 1 
ATOM 1253 C CE1 . TYR A 1 209 ? -5.385  -3.485  -11.082 1.00 154.73 ? 479 TYR A CE1 1 
ATOM 1254 C CE2 . TYR A 1 209 ? -3.885  -3.920  -12.894 1.00 131.24 ? 479 TYR A CE2 1 
ATOM 1255 C CZ  . TYR A 1 209 ? -4.853  -3.135  -12.306 1.00 140.28 ? 479 TYR A CZ  1 
ATOM 1256 O OH  . TYR A 1 209 ? -5.291  -1.998  -12.943 1.00 139.90 ? 479 TYR A OH  1 
ATOM 1257 N N   . LEU A 1 210 ? -4.220  -9.148  -12.213 1.00 156.31 ? 480 LEU A N   1 
ATOM 1258 C CA  . LEU A 1 210 ? -4.618  -9.791  -13.456 1.00 143.42 ? 480 LEU A CA  1 
ATOM 1259 C C   . LEU A 1 210 ? -6.000  -10.411 -13.255 1.00 143.31 ? 480 LEU A C   1 
ATOM 1260 O O   . LEU A 1 210 ? -6.883  -10.279 -14.103 1.00 147.89 ? 480 LEU A O   1 
ATOM 1261 C CB  . LEU A 1 210 ? -3.583  -10.833 -13.889 1.00 132.10 ? 480 LEU A CB  1 
ATOM 1262 C CG  . LEU A 1 210 ? -3.866  -11.652 -15.151 1.00 141.08 ? 480 LEU A CG  1 
ATOM 1263 C CD1 . LEU A 1 210 ? -4.473  -10.788 -16.244 1.00 163.16 ? 480 LEU A CD1 1 
ATOM 1264 C CD2 . LEU A 1 210 ? -2.583  -12.294 -15.653 1.00 149.93 ? 480 LEU A CD2 1 
ATOM 1265 N N   . ALA A 1 211 ? -6.170  -11.077 -12.116 1.00 140.53 ? 481 ALA A N   1 
ATOM 1266 C CA  . ALA A 1 211 ? -7.428  -11.724 -11.744 1.00 141.73 ? 481 ALA A CA  1 
ATOM 1267 C C   . ALA A 1 211 ? -8.579  -10.729 -11.644 1.00 138.80 ? 481 ALA A C   1 
ATOM 1268 O O   . ALA A 1 211 ? -9.745  -11.118 -11.677 1.00 141.02 ? 481 ALA A O   1 
ATOM 1269 C CB  . ALA A 1 211 ? -7.274  -12.469 -10.431 1.00 147.75 ? 481 ALA A CB  1 
ATOM 1270 N N   . LEU A 1 212 ? -8.249  -9.459  -11.442 1.00 139.76 ? 482 LEU A N   1 
ATOM 1271 C CA  . LEU A 1 212 ? -9.257  -8.408  -11.424 1.00 141.09 ? 482 LEU A CA  1 
ATOM 1272 C C   . LEU A 1 212 ? -9.509  -7.880  -12.837 1.00 165.31 ? 482 LEU A C   1 
ATOM 1273 O O   . LEU A 1 212 ? -10.653 -7.648  -13.228 1.00 192.99 ? 482 LEU A O   1 
ATOM 1274 C CB  . LEU A 1 212 ? -8.826  -7.268  -10.501 1.00 125.39 ? 482 LEU A CB  1 
ATOM 1275 N N   . CYS A 1 213 ? -8.430  -7.694  -13.594 1.00 156.66 ? 483 CYS A N   1 
ATOM 1276 C CA  . CYS A 1 213 ? -8.504  -7.154  -14.952 1.00 157.79 ? 483 CYS A CA  1 
ATOM 1277 C C   . CYS A 1 213 ? -9.258  -8.068  -15.917 1.00 163.09 ? 483 CYS A C   1 
ATOM 1278 O O   . CYS A 1 213 ? -10.108 -7.611  -16.676 1.00 175.41 ? 483 CYS A O   1 
ATOM 1279 C CB  . CYS A 1 213 ? -7.109  -6.868  -15.495 1.00 155.60 ? 483 CYS A CB  1 
ATOM 1280 S SG  . CYS A 1 213 ? -7.142  -5.655  -16.824 1.00 243.81 ? 483 CYS A SG  1 
ATOM 1281 N N   . SER A 1 214 ? -8.908  -9.349  -15.919 1.00 151.48 ? 484 SER A N   1 
ATOM 1282 C CA  . SER A 1 214 ? -9.819  -10.369 -16.419 1.00 148.96 ? 484 SER A CA  1 
ATOM 1283 C C   . SER A 1 214 ? -10.768 -10.637 -15.267 1.00 147.14 ? 484 SER A C   1 
ATOM 1284 O O   . SER A 1 214 ? -10.327 -10.898 -14.159 1.00 149.74 ? 484 SER A O   1 
ATOM 1285 C CB  . SER A 1 214 ? -9.077  -11.635 -16.847 1.00 140.69 ? 484 SER A CB  1 
ATOM 1286 O OG  . SER A 1 214 ? -8.108  -12.008 -15.884 1.00 136.89 ? 484 SER A OG  1 
ATOM 1287 N N   . TYR A 1 215 ? -12.069 -10.588 -15.522 1.00 155.57 ? 485 TYR A N   1 
ATOM 1288 C CA  . TYR A 1 215 ? -13.032 -10.284 -14.462 1.00 157.27 ? 485 TYR A CA  1 
ATOM 1289 C C   . TYR A 1 215 ? -13.367 -11.442 -13.528 1.00 154.02 ? 485 TYR A C   1 
ATOM 1290 O O   . TYR A 1 215 ? -14.534 -11.741 -13.272 1.00 155.21 ? 485 TYR A O   1 
ATOM 1291 C CB  . TYR A 1 215 ? -14.312 -9.706  -15.064 1.00 173.22 ? 485 TYR A CB  1 
ATOM 1292 C CG  . TYR A 1 215 ? -14.172 -8.234  -15.386 1.00 174.76 ? 485 TYR A CG  1 
ATOM 1293 C CD1 . TYR A 1 215 ? -12.936 -7.692  -15.708 1.00 164.30 ? 485 TYR A CD1 1 
ATOM 1294 C CD2 . TYR A 1 215 ? -15.259 -7.381  -15.323 1.00 184.62 ? 485 TYR A CD2 1 
ATOM 1295 C CE1 . TYR A 1 215 ? -12.791 -6.351  -15.987 1.00 166.52 ? 485 TYR A CE1 1 
ATOM 1296 C CE2 . TYR A 1 215 ? -15.124 -6.036  -15.604 1.00 185.16 ? 485 TYR A CE2 1 
ATOM 1297 C CZ  . TYR A 1 215 ? -13.885 -5.526  -15.936 1.00 172.98 ? 485 TYR A CZ  1 
ATOM 1298 O OH  . TYR A 1 215 ? -13.731 -4.188  -16.219 1.00 172.08 ? 485 TYR A OH  1 
ATOM 1299 N N   . ASN A 1 216 ? -12.320 -12.092 -13.034 1.00 147.42 ? 486 ASN A N   1 
ATOM 1300 C CA  . ASN A 1 216 ? -12.453 -13.144 -12.041 1.00 144.02 ? 486 ASN A CA  1 
ATOM 1301 C C   . ASN A 1 216 ? -12.529 -12.503 -10.657 1.00 150.88 ? 486 ASN A C   1 
ATOM 1302 O O   . ASN A 1 216 ? -11.622 -12.649 -9.837  1.00 147.26 ? 486 ASN A O   1 
ATOM 1303 C CB  . ASN A 1 216 ? -11.274 -14.109 -12.119 1.00 139.05 ? 486 ASN A CB  1 
ATOM 1304 C CG  . ASN A 1 216 ? -11.015 -14.597 -13.528 1.00 153.91 ? 486 ASN A CG  1 
ATOM 1305 O OD1 . ASN A 1 216 ? -11.931 -14.691 -14.345 1.00 172.73 ? 486 ASN A OD1 1 
ATOM 1306 N ND2 . ASN A 1 216 ? -9.760  -14.919 -13.819 1.00 154.28 ? 486 ASN A ND2 1 
ATOM 1307 N N   . CYS A 1 217 ? -13.618 -11.776 -10.422 1.00 171.66 ? 487 CYS A N   1 
ATOM 1308 C CA  . CYS A 1 217 ? -13.768 -10.900 -9.262  1.00 174.19 ? 487 CYS A CA  1 
ATOM 1309 C C   . CYS A 1 217 ? -13.722 -11.641 -7.929  1.00 155.66 ? 487 CYS A C   1 
ATOM 1310 O O   . CYS A 1 217 ? -13.119 -11.164 -6.967  1.00 152.16 ? 487 CYS A O   1 
ATOM 1311 C CB  . CYS A 1 217 ? -15.081 -10.123 -9.365  1.00 194.78 ? 487 CYS A CB  1 
ATOM 1312 S SG  . CYS A 1 217 ? -15.233 -9.084  -10.837 1.00 242.63 ? 487 CYS A SG  1 
ATOM 1313 N N   . LYS A 1 218 ? -14.360 -12.805 -7.873  1.00 145.78 ? 488 LYS A N   1 
ATOM 1314 C CA  . LYS A 1 218 ? -14.316 -13.627 -6.672  1.00 139.47 ? 488 LYS A CA  1 
ATOM 1315 C C   . LYS A 1 218 ? -12.900 -14.117 -6.402  1.00 139.73 ? 488 LYS A C   1 
ATOM 1316 O O   . LYS A 1 218 ? -12.460 -14.158 -5.252  1.00 142.27 ? 488 LYS A O   1 
ATOM 1317 C CB  . LYS A 1 218 ? -15.267 -14.818 -6.802  1.00 138.89 ? 488 LYS A CB  1 
ATOM 1318 N N   . GLU A 1 219 ? -12.191 -14.496 -7.459  1.00 136.90 ? 489 GLU A N   1 
ATOM 1319 C CA  . GLU A 1 219 ? -10.808 -14.926 -7.315  1.00 122.21 ? 489 GLU A CA  1 
ATOM 1320 C C   . GLU A 1 219 ? -9.924  -13.802 -6.779  1.00 124.73 ? 489 GLU A C   1 
ATOM 1321 O O   . GLU A 1 219 ? -9.166  -14.007 -5.837  1.00 122.61 ? 489 GLU A O   1 
ATOM 1322 C CB  . GLU A 1 219 ? -10.259 -15.431 -8.651  1.00 121.05 ? 489 GLU A CB  1 
ATOM 1323 N N   . ALA A 1 220 ? -10.066 -12.607 -7.348  1.00 131.80 ? 490 ALA A N   1 
ATOM 1324 C CA  . ALA A 1 220 ? -9.212  -11.475 -6.990  1.00 131.05 ? 490 ALA A CA  1 
ATOM 1325 C C   . ALA A 1 220 ? -9.318  -11.081 -5.521  1.00 136.68 ? 490 ALA A C   1 
ATOM 1326 O O   . ALA A 1 220 ? -8.315  -10.753 -4.887  1.00 145.91 ? 490 ALA A O   1 
ATOM 1327 C CB  . ALA A 1 220 ? -9.541  -10.280 -7.872  1.00 149.79 ? 490 ALA A CB  1 
ATOM 1328 N N   . ILE A 1 221 ? -10.531 -11.120 -4.981  1.00 136.87 ? 491 ILE A N   1 
ATOM 1329 C CA  . ILE A 1 221 ? -10.730 -10.846 -3.565  1.00 134.13 ? 491 ILE A CA  1 
ATOM 1330 C C   . ILE A 1 221 ? -10.117 -11.975 -2.752  1.00 133.59 ? 491 ILE A C   1 
ATOM 1331 O O   . ILE A 1 221 ? -9.468  -11.736 -1.737  1.00 134.02 ? 491 ILE A O   1 
ATOM 1332 C CB  . ILE A 1 221 ? -12.215 -10.680 -3.199  1.00 142.48 ? 491 ILE A CB  1 
ATOM 1333 C CG1 . ILE A 1 221 ? -12.836 -9.540  -4.003  1.00 157.35 ? 491 ILE A CG1 1 
ATOM 1334 C CG2 . ILE A 1 221 ? -12.366 -10.382 -1.718  1.00 138.61 ? 491 ILE A CG2 1 
ATOM 1335 C CD1 . ILE A 1 221 ? -14.345 -9.597  -4.084  1.00 162.44 ? 491 ILE A CD1 1 
ATOM 1336 N N   . ASN A 1 222 ? -10.316 -13.205 -3.218  1.00 123.89 ? 492 ASN A N   1 
ATOM 1337 C CA  . ASN A 1 222 ? -9.753  -14.375 -2.556  1.00 122.23 ? 492 ASN A CA  1 
ATOM 1338 C C   . ASN A 1 222 ? -8.228  -14.307 -2.487  1.00 130.48 ? 492 ASN A C   1 
ATOM 1339 O O   . ASN A 1 222 ? -7.641  -14.655 -1.463  1.00 135.55 ? 492 ASN A O   1 
ATOM 1340 C CB  . ASN A 1 222 ? -10.197 -15.657 -3.263  1.00 116.30 ? 492 ASN A CB  1 
ATOM 1341 N N   . ILE A 1 223 ? -7.582  -13.887 -3.573  1.00 138.77 ? 493 ILE A N   1 
ATOM 1342 C CA  . ILE A 1 223 ? -6.122  -13.814 -3.575  1.00 142.40 ? 493 ILE A CA  1 
ATOM 1343 C C   . ILE A 1 223 ? -5.672  -12.677 -2.666  1.00 160.01 ? 493 ILE A C   1 
ATOM 1344 O O   . ILE A 1 223 ? -4.815  -12.861 -1.801  1.00 168.92 ? 493 ILE A O   1 
ATOM 1345 C CB  . ILE A 1 223 ? -5.519  -13.595 -4.985  1.00 143.76 ? 493 ILE A CB  1 
ATOM 1346 C CG1 . ILE A 1 223 ? -6.230  -14.440 -6.041  1.00 164.47 ? 493 ILE A CG1 1 
ATOM 1347 C CG2 . ILE A 1 223 ? -4.064  -14.015 -5.000  1.00 138.70 ? 493 ILE A CG2 1 
ATOM 1348 C CD1 . ILE A 1 223 ? -6.343  -15.915 -5.696  1.00 174.95 ? 493 ILE A CD1 1 
ATOM 1349 N N   . LEU A 1 224 ? -6.259  -11.501 -2.871  1.00 162.09 ? 494 LEU A N   1 
ATOM 1350 C CA  . LEU A 1 224 ? -5.875  -10.308 -2.124  1.00 151.45 ? 494 LEU A CA  1 
ATOM 1351 C C   . LEU A 1 224 ? -6.138  -10.431 -0.626  1.00 138.85 ? 494 LEU A C   1 
ATOM 1352 O O   . LEU A 1 224 ? -5.326  -9.996  0.186   1.00 137.47 ? 494 LEU A O   1 
ATOM 1353 C CB  . LEU A 1 224 ? -6.611  -9.085  -2.675  1.00 150.24 ? 494 LEU A CB  1 
ATOM 1354 N N   . SER A 1 225 ? -7.279  -11.008 -0.260  1.00 134.51 ? 495 SER A N   1 
ATOM 1355 C CA  . SER A 1 225 ? -7.616  -11.172 1.151   1.00 139.11 ? 495 SER A CA  1 
ATOM 1356 C C   . SER A 1 225 ? -6.655  -12.113 1.872   1.00 133.89 ? 495 SER A C   1 
ATOM 1357 O O   . SER A 1 225 ? -6.365  -11.926 3.053   1.00 140.19 ? 495 SER A O   1 
ATOM 1358 C CB  . SER A 1 225 ? -9.051  -11.683 1.307   1.00 157.01 ? 495 SER A CB  1 
ATOM 1359 O OG  . SER A 1 225 ? -9.975  -10.812 0.677   1.00 164.58 ? 495 SER A OG  1 
ATOM 1360 N N   . HIS A 1 226 ? -6.161  -13.122 1.159   1.00 124.11 ? 496 HIS A N   1 
ATOM 1361 C CA  . HIS A 1 226 ? -5.160  -14.024 1.721   1.00 120.11 ? 496 HIS A CA  1 
ATOM 1362 C C   . HIS A 1 226 ? -3.797  -13.365 1.948   1.00 128.37 ? 496 HIS A C   1 
ATOM 1363 O O   . HIS A 1 226 ? -2.951  -13.920 2.648   1.00 140.85 ? 496 HIS A O   1 
ATOM 1364 C CB  . HIS A 1 226 ? -4.996  -15.249 0.818   1.00 115.58 ? 496 HIS A CB  1 
ATOM 1365 N N   . LEU A 1 227 ? -3.578  -12.197 1.350   1.00 130.87 ? 497 LEU A N   1 
ATOM 1366 C CA  . LEU A 1 227 ? -2.330  -11.459 1.545   1.00 134.21 ? 497 LEU A CA  1 
ATOM 1367 C C   . LEU A 1 227 ? -2.175  -11.015 3.005   1.00 143.12 ? 497 LEU A C   1 
ATOM 1368 O O   . LEU A 1 227 ? -3.174  -10.765 3.680   1.00 147.79 ? 497 LEU A O   1 
ATOM 1369 C CB  . LEU A 1 227 ? -2.272  -10.249 0.606   1.00 118.26 ? 497 LEU A CB  1 
ATOM 1370 N N   . PRO A 1 228 ? -0.924  -10.929 3.500   1.00 125.84 ? 498 PRO A N   1 
ATOM 1371 C CA  . PRO A 1 228 ? -0.694  -10.620 4.922   1.00 124.38 ? 498 PRO A CA  1 
ATOM 1372 C C   . PRO A 1 228 ? -1.265  -9.256  5.335   1.00 127.83 ? 498 PRO A C   1 
ATOM 1373 O O   . PRO A 1 228 ? -1.247  -8.318  4.537   1.00 126.66 ? 498 PRO A O   1 
ATOM 1374 C CB  . PRO A 1 228 ? 0.834   -10.655 5.058   1.00 126.02 ? 498 PRO A CB  1 
ATOM 1375 C CG  . PRO A 1 228 ? 1.382   -10.598 3.686   1.00 125.44 ? 498 PRO A CG  1 
ATOM 1376 C CD  . PRO A 1 228 ? 0.323   -11.002 2.718   1.00 122.79 ? 498 PRO A CD  1 
ATOM 1377 N N   . SER A 1 229 ? -1.765  -9.165  6.568   1.00 138.94 ? 499 SER A N   1 
ATOM 1378 C CA  . SER A 1 229 ? -2.605  -8.037  6.984   1.00 149.39 ? 499 SER A CA  1 
ATOM 1379 C C   . SER A 1 229 ? -1.995  -6.630  6.899   1.00 167.30 ? 499 SER A C   1 
ATOM 1380 O O   . SER A 1 229 ? -2.718  -5.660  6.670   1.00 181.63 ? 499 SER A O   1 
ATOM 1381 C CB  . SER A 1 229 ? -3.066  -8.274  8.426   1.00 143.53 ? 499 SER A CB  1 
ATOM 1382 O OG  . SER A 1 229 ? -1.967  -8.570  9.271   1.00 140.64 ? 499 SER A OG  1 
ATOM 1383 N N   . HIS A 1 230 ? -0.681  -6.516  7.063   1.00 173.90 ? 500 HIS A N   1 
ATOM 1384 C CA  . HIS A 1 230 ? 0.006   -5.239  6.858   1.00 176.64 ? 500 HIS A CA  1 
ATOM 1385 C C   . HIS A 1 230 ? -0.098  -4.790  5.404   1.00 176.05 ? 500 HIS A C   1 
ATOM 1386 O O   . HIS A 1 230 ? -0.267  -3.604  5.123   1.00 186.01 ? 500 HIS A O   1 
ATOM 1387 C CB  . HIS A 1 230 ? 1.447   -5.286  7.363   1.00 179.26 ? 500 HIS A CB  1 
ATOM 1388 C CG  . HIS A 1 230 ? 1.562   -4.922  8.813   1.00 215.31 ? 500 HIS A CG  1 
ATOM 1389 N ND1 . HIS A 1 230 ? 0.457   -4.786  9.626   1.00 229.10 ? 500 HIS A ND1 1 
ATOM 1390 C CD2 . HIS A 1 230 ? 2.634   -4.621  9.583   1.00 226.46 ? 500 HIS A CD2 1 
ATOM 1391 C CE1 . HIS A 1 230 ? 0.845   -4.440  10.841  1.00 228.33 ? 500 HIS A CE1 1 
ATOM 1392 N NE2 . HIS A 1 230 ? 2.162   -4.333  10.842  1.00 228.36 ? 500 HIS A NE2 1 
ATOM 1393 N N   . HIS A 1 231 ? -0.002  -5.745  4.486   1.00 167.45 ? 501 HIS A N   1 
ATOM 1394 C CA  . HIS A 1 231 ? -0.092  -5.441  3.064   1.00 142.41 ? 501 HIS A CA  1 
ATOM 1395 C C   . HIS A 1 231 ? -1.526  -5.603  2.617   1.00 132.28 ? 501 HIS A C   1 
ATOM 1396 O O   . HIS A 1 231 ? -1.840  -5.460  1.440   1.00 127.74 ? 501 HIS A O   1 
ATOM 1397 C CB  . HIS A 1 231 ? 0.804   -6.350  2.224   1.00 127.55 ? 501 HIS A CB  1 
ATOM 1398 C CG  . HIS A 1 231 ? 2.264   -6.153  2.461   1.00 125.23 ? 501 HIS A CG  1 
ATOM 1399 N ND1 . HIS A 1 231 ? 2.998   -5.213  1.771   1.00 125.60 ? 501 HIS A ND1 1 
ATOM 1400 C CD2 . HIS A 1 231 ? 3.132   -6.775  3.292   1.00 126.83 ? 501 HIS A CD2 1 
ATOM 1401 C CE1 . HIS A 1 231 ? 4.253   -5.258  2.173   1.00 128.06 ? 501 HIS A CE1 1 
ATOM 1402 N NE2 . HIS A 1 231 ? 4.362   -6.198  3.095   1.00 128.34 ? 501 HIS A NE2 1 
ATOM 1403 N N   . TYR A 1 232 ? -2.394  -5.935  3.560   1.00 131.99 ? 502 TYR A N   1 
ATOM 1404 C CA  . TYR A 1 232 ? -3.811  -5.952  3.270   1.00 128.85 ? 502 TYR A CA  1 
ATOM 1405 C C   . TYR A 1 232 ? -4.409  -4.561  3.481   1.00 129.08 ? 502 TYR A C   1 
ATOM 1406 O O   . TYR A 1 232 ? -5.237  -4.109  2.696   1.00 128.46 ? 502 TYR A O   1 
ATOM 1407 C CB  . TYR A 1 232 ? -4.522  -6.977  4.148   1.00 122.93 ? 502 TYR A CB  1 
ATOM 1408 C CG  . TYR A 1 232 ? -6.009  -7.009  3.936   1.00 125.05 ? 502 TYR A CG  1 
ATOM 1409 C CD1 . TYR A 1 232 ? -6.556  -7.605  2.810   1.00 119.51 ? 502 TYR A CD1 1 
ATOM 1410 C CD2 . TYR A 1 232 ? -6.867  -6.423  4.854   1.00 142.82 ? 502 TYR A CD2 1 
ATOM 1411 C CE1 . TYR A 1 232 ? -7.919  -7.626  2.610   1.00 118.16 ? 502 TYR A CE1 1 
ATOM 1412 C CE2 . TYR A 1 232 ? -8.229  -6.438  4.664   1.00 144.95 ? 502 TYR A CE2 1 
ATOM 1413 C CZ  . TYR A 1 232 ? -8.751  -7.040  3.541   1.00 131.58 ? 502 TYR A CZ  1 
ATOM 1414 O OH  . TYR A 1 232 ? -10.113 -7.055  3.353   1.00 131.79 ? 502 TYR A OH  1 
ATOM 1415 N N   . ASN A 1 233 ? -3.968  -3.885  4.537   1.00 125.77 ? 503 ASN A N   1 
ATOM 1416 C CA  . ASN A 1 233 ? -4.556  -2.609  4.945   1.00 129.53 ? 503 ASN A CA  1 
ATOM 1417 C C   . ASN A 1 233 ? -4.150  -1.380  4.130   1.00 131.07 ? 503 ASN A C   1 
ATOM 1418 O O   . ASN A 1 233 ? -4.856  -0.370  4.136   1.00 135.29 ? 503 ASN A O   1 
ATOM 1419 C CB  . ASN A 1 233 ? -4.238  -2.346  6.416   1.00 147.27 ? 503 ASN A CB  1 
ATOM 1420 C CG  . ASN A 1 233 ? -4.987  -3.276  7.343   1.00 140.04 ? 503 ASN A CG  1 
ATOM 1421 O OD1 . ASN A 1 233 ? -6.203  -3.173  7.495   1.00 128.69 ? 503 ASN A OD1 1 
ATOM 1422 N ND2 . ASN A 1 233 ? -4.257  -4.173  7.996   1.00 138.30 ? 503 ASN A ND2 1 
ATOM 1423 N N   . THR A 1 234 ? -3.002  -1.457  3.462   1.00 128.20 ? 504 THR A N   1 
ATOM 1424 C CA  . THR A 1 234 ? -2.655  -0.523  2.390   1.00 138.78 ? 504 THR A CA  1 
ATOM 1425 C C   . THR A 1 234 ? -3.827  -0.174  1.481   1.00 151.98 ? 504 THR A C   1 
ATOM 1426 O O   . THR A 1 234 ? -4.662  -1.020  1.155   1.00 148.59 ? 504 THR A O   1 
ATOM 1427 C CB  . THR A 1 234 ? -1.528  -1.067  1.517   1.00 138.74 ? 504 THR A CB  1 
ATOM 1428 O OG1 . THR A 1 234 ? -1.259  -0.144  0.454   1.00 146.22 ? 504 THR A OG1 1 
ATOM 1429 C CG2 . THR A 1 234 ? -1.927  -2.398  0.931   1.00 136.64 ? 504 THR A CG2 1 
ATOM 1430 N N   . GLY A 1 235 ? -3.888  1.092   1.090   1.00 127.77 ? 505 GLY A N   1 
ATOM 1431 C CA  . GLY A 1 235 ? -4.995  1.580   0.301   1.00 128.85 ? 505 GLY A CA  1 
ATOM 1432 C C   . GLY A 1 235 ? -5.026  1.082   -1.129  1.00 128.47 ? 505 GLY A C   1 
ATOM 1433 O O   . GLY A 1 235 ? -6.080  1.117   -1.754  1.00 136.61 ? 505 GLY A O   1 
ATOM 1434 N N   . TRP A 1 236 ? -3.895  0.618   -1.658  1.00 119.78 ? 506 TRP A N   1 
ATOM 1435 C CA  . TRP A 1 236 ? -3.907  0.073   -3.012  1.00 119.12 ? 506 TRP A CA  1 
ATOM 1436 C C   . TRP A 1 236 ? -4.738  -1.199  -3.062  1.00 116.73 ? 506 TRP A C   1 
ATOM 1437 O O   . TRP A 1 236 ? -5.612  -1.342  -3.916  1.00 118.16 ? 506 TRP A O   1 
ATOM 1438 C CB  . TRP A 1 236 ? -2.492  -0.217  -3.517  1.00 119.48 ? 506 TRP A CB  1 
ATOM 1439 C CG  . TRP A 1 236 ? -2.488  -0.769  -4.917  1.00 118.07 ? 506 TRP A CG  1 
ATOM 1440 C CD1 . TRP A 1 236 ? -2.525  -0.054  -6.078  1.00 116.29 ? 506 TRP A CD1 1 
ATOM 1441 C CD2 . TRP A 1 236 ? -2.471  -2.151  -5.299  1.00 116.09 ? 506 TRP A CD2 1 
ATOM 1442 N NE1 . TRP A 1 236 ? -2.522  -0.903  -7.158  1.00 110.94 ? 506 TRP A NE1 1 
ATOM 1443 C CE2 . TRP A 1 236 ? -2.489  -2.196  -6.707  1.00 111.64 ? 506 TRP A CE2 1 
ATOM 1444 C CE3 . TRP A 1 236 ? -2.437  -3.354  -4.587  1.00 128.91 ? 506 TRP A CE3 1 
ATOM 1445 C CZ2 . TRP A 1 236 ? -2.474  -3.394  -7.416  1.00 113.47 ? 506 TRP A CZ2 1 
ATOM 1446 C CZ3 . TRP A 1 236 ? -2.422  -4.543  -5.294  1.00 125.62 ? 506 TRP A CZ3 1 
ATOM 1447 C CH2 . TRP A 1 236 ? -2.441  -4.554  -6.694  1.00 115.45 ? 506 TRP A CH2 1 
ATOM 1448 N N   . VAL A 1 237 ? -4.455  -2.119  -2.144  1.00 109.64 ? 507 VAL A N   1 
ATOM 1449 C CA  . VAL A 1 237 ? -5.142  -3.404  -2.110  1.00 107.85 ? 507 VAL A CA  1 
ATOM 1450 C C   . VAL A 1 237 ? -6.641  -3.182  -1.959  1.00 115.36 ? 507 VAL A C   1 
ATOM 1451 O O   . VAL A 1 237 ? -7.430  -3.647  -2.780  1.00 121.32 ? 507 VAL A O   1 
ATOM 1452 C CB  . VAL A 1 237 ? -4.612  -4.310  -0.989  1.00 105.64 ? 507 VAL A CB  1 
ATOM 1453 C CG1 . VAL A 1 237 ? -5.525  -5.505  -0.791  1.00 109.44 ? 507 VAL A CG1 1 
ATOM 1454 C CG2 . VAL A 1 237 ? -3.199  -4.762  -1.317  1.00 103.94 ? 507 VAL A CG2 1 
ATOM 1455 N N   . LEU A 1 238 ? -7.023  -2.491  -0.889  1.00 121.48 ? 508 LEU A N   1 
ATOM 1456 C CA  . LEU A 1 238 ? -8.428  -2.227  -0.596  1.00 130.41 ? 508 LEU A CA  1 
ATOM 1457 C C   . LEU A 1 238 ? -9.164  -1.558  -1.755  1.00 152.54 ? 508 LEU A C   1 
ATOM 1458 O O   . LEU A 1 238 ? -10.338 -1.831  -2.003  1.00 166.71 ? 508 LEU A O   1 
ATOM 1459 C CB  . LEU A 1 238 ? -8.546  -1.339  0.647   1.00 124.57 ? 508 LEU A CB  1 
ATOM 1460 C CG  . LEU A 1 238 ? -7.838  -1.751  1.936   1.00 123.16 ? 508 LEU A CG  1 
ATOM 1461 C CD1 . LEU A 1 238 ? -8.296  -0.878  3.086   1.00 122.88 ? 508 LEU A CD1 1 
ATOM 1462 C CD2 . LEU A 1 238 ? -8.151  -3.200  2.242   1.00 136.35 ? 508 LEU A CD2 1 
ATOM 1463 N N   . CYS A 1 239 ? -8.460  -0.670  -2.450  1.00 141.51 ? 509 CYS A N   1 
ATOM 1464 C CA  . CYS A 1 239 ? -8.951  -0.036  -3.670  1.00 125.36 ? 509 CYS A CA  1 
ATOM 1465 C C   . CYS A 1 239 ? -9.291  -1.030  -4.785  1.00 126.64 ? 509 CYS A C   1 
ATOM 1466 O O   . CYS A 1 239 ? -10.320 -0.907  -5.450  1.00 133.90 ? 509 CYS A O   1 
ATOM 1467 C CB  . CYS A 1 239 ? -7.917  0.974   -4.156  1.00 125.50 ? 509 CYS A CB  1 
ATOM 1468 S SG  . CYS A 1 239 ? -8.321  2.671   -3.697  1.00 235.06 ? 509 CYS A SG  1 
ATOM 1469 N N   . GLN A 1 240 ? -8.420  -2.019  -4.973  1.00 116.52 ? 510 GLN A N   1 
ATOM 1470 C CA  . GLN A 1 240 ? -8.631  -3.069  -5.970  1.00 117.02 ? 510 GLN A CA  1 
ATOM 1471 C C   . GLN A 1 240 ? -9.821  -3.927  -5.571  1.00 118.79 ? 510 GLN A C   1 
ATOM 1472 O O   . GLN A 1 240 ? -10.672 -4.266  -6.394  1.00 130.54 ? 510 GLN A O   1 
ATOM 1473 C CB  . GLN A 1 240 ? -7.382  -3.942  -6.135  1.00 116.05 ? 510 GLN A CB  1 
ATOM 1474 C CG  . GLN A 1 240 ? -6.079  -3.192  -6.407  1.00 115.68 ? 510 GLN A CG  1 
ATOM 1475 C CD  . GLN A 1 240 ? -6.236  -2.015  -7.355  1.00 132.26 ? 510 GLN A CD  1 
ATOM 1476 O OE1 . GLN A 1 240 ? -5.759  -0.916  -7.075  1.00 153.98 ? 510 GLN A OE1 1 
ATOM 1477 N NE2 . GLN A 1 240 ? -6.886  -2.245  -8.491  1.00 129.64 ? 510 GLN A NE2 1 
ATOM 1478 N N   . ILE A 1 241 ? -9.865  -4.263  -4.289  1.00 111.55 ? 511 ILE A N   1 
ATOM 1479 C CA  . ILE A 1 241 ? -10.962 -5.019  -3.705  1.00 111.38 ? 511 ILE A CA  1 
ATOM 1480 C C   . ILE A 1 241 ? -12.263 -4.238  -3.867  1.00 112.70 ? 511 ILE A C   1 
ATOM 1481 O O   . ILE A 1 241 ? -13.316 -4.815  -4.139  1.00 120.71 ? 511 ILE A O   1 
ATOM 1482 C CB  . ILE A 1 241 ? -10.693 -5.332  -2.223  1.00 109.61 ? 511 ILE A CB  1 
ATOM 1483 C CG1 . ILE A 1 241 ? -9.561  -6.352  -2.101  1.00 115.26 ? 511 ILE A CG1 1 
ATOM 1484 C CG2 . ILE A 1 241 ? -11.936 -5.859  -1.544  1.00 109.98 ? 511 ILE A CG2 1 
ATOM 1485 C CD1 . ILE A 1 241 ? -9.009  -6.480  -0.704  1.00 123.08 ? 511 ILE A CD1 1 
ATOM 1486 N N   . GLY A 1 242 ? -12.185 -2.923  -3.699  1.00 115.18 ? 512 GLY A N   1 
ATOM 1487 C CA  . GLY A 1 242 ? -13.329 -2.065  -3.943  1.00 114.40 ? 512 GLY A CA  1 
ATOM 1488 C C   . GLY A 1 242 ? -13.814 -2.165  -5.372  1.00 113.30 ? 512 GLY A C   1 
ATOM 1489 O O   . GLY A 1 242 ? -15.014 -2.262  -5.619  1.00 114.39 ? 512 GLY A O   1 
ATOM 1490 N N   . ARG A 1 243 ? -12.877 -2.131  -6.311  1.00 122.56 ? 513 ARG A N   1 
ATOM 1491 C CA  . ARG A 1 243 ? -13.198 -2.326  -7.718  1.00 124.03 ? 513 ARG A CA  1 
ATOM 1492 C C   . ARG A 1 243 ? -13.815 -3.704  -7.929  1.00 125.29 ? 513 ARG A C   1 
ATOM 1493 O O   . ARG A 1 243 ? -14.767 -3.860  -8.693  1.00 145.62 ? 513 ARG A O   1 
ATOM 1494 C CB  . ARG A 1 243 ? -11.948 -2.162  -8.584  1.00 109.73 ? 513 ARG A CB  1 
ATOM 1495 N N   . ALA A 1 244 ? -13.271 -4.696  -7.231  1.00 111.00 ? 514 ALA A N   1 
ATOM 1496 C CA  . ALA A 1 244 ? -13.789 -6.060  -7.274  1.00 111.50 ? 514 ALA A CA  1 
ATOM 1497 C C   . ALA A 1 244 ? -15.246 -6.169  -6.819  1.00 120.90 ? 514 ALA A C   1 
ATOM 1498 O O   . ALA A 1 244 ? -16.098 -6.609  -7.591  1.00 117.42 ? 514 ALA A O   1 
ATOM 1499 C CB  . ALA A 1 244 ? -12.910 -6.973  -6.441  1.00 110.90 ? 514 ALA A CB  1 
ATOM 1500 N N   . TYR A 1 245 ? -15.533 -5.794  -5.573  1.00 138.33 ? 515 TYR A N   1 
ATOM 1501 C CA  . TYR A 1 245 ? -16.910 -5.817  -5.072  1.00 138.17 ? 515 TYR A CA  1 
ATOM 1502 C C   . TYR A 1 245 ? -17.856 -4.998  -5.945  1.00 138.25 ? 515 TYR A C   1 
ATOM 1503 O O   . TYR A 1 245 ? -19.034 -5.325  -6.084  1.00 138.62 ? 515 TYR A O   1 
ATOM 1504 C CB  . TYR A 1 245 ? -16.977 -5.293  -3.633  1.00 138.19 ? 515 TYR A CB  1 
ATOM 1505 C CG  . TYR A 1 245 ? -16.567 -6.295  -2.578  1.00 137.51 ? 515 TYR A CG  1 
ATOM 1506 C CD1 . TYR A 1 245 ? -17.310 -7.448  -2.363  1.00 147.86 ? 515 TYR A CD1 1 
ATOM 1507 C CD2 . TYR A 1 245 ? -15.453 -6.077  -1.780  1.00 138.33 ? 515 TYR A CD2 1 
ATOM 1508 C CE1 . TYR A 1 245 ? -16.943 -8.366  -1.397  1.00 163.34 ? 515 TYR A CE1 1 
ATOM 1509 C CE2 . TYR A 1 245 ? -15.081 -6.989  -0.808  1.00 150.66 ? 515 TYR A CE2 1 
ATOM 1510 C CZ  . TYR A 1 245 ? -15.828 -8.131  -0.622  1.00 166.21 ? 515 TYR A CZ  1 
ATOM 1511 O OH  . TYR A 1 245 ? -15.459 -9.039  0.343   1.00 178.75 ? 515 TYR A OH  1 
ATOM 1512 N N   . PHE A 1 246 ? -17.331 -3.927  -6.525  1.00 127.75 ? 516 PHE A N   1 
ATOM 1513 C CA  . PHE A 1 246 ? -18.112 -3.059  -7.394  1.00 128.05 ? 516 PHE A CA  1 
ATOM 1514 C C   . PHE A 1 246 ? -18.542 -3.724  -8.697  1.00 129.28 ? 516 PHE A C   1 
ATOM 1515 O O   . PHE A 1 246 ? -19.666 -3.538  -9.159  1.00 129.62 ? 516 PHE A O   1 
ATOM 1516 C CB  . PHE A 1 246 ? -17.350 -1.784  -7.720  1.00 127.17 ? 516 PHE A CB  1 
ATOM 1517 C CG  . PHE A 1 246 ? -18.026 -0.953  -8.755  1.00 125.98 ? 516 PHE A CG  1 
ATOM 1518 C CD1 . PHE A 1 246 ? -17.506 -0.855  -10.032 1.00 139.74 ? 516 PHE A CD1 1 
ATOM 1519 C CD2 . PHE A 1 246 ? -19.220 -0.316  -8.469  1.00 126.30 ? 516 PHE A CD2 1 
ATOM 1520 C CE1 . PHE A 1 246 ? -18.143 -0.105  -10.993 1.00 156.99 ? 516 PHE A CE1 1 
ATOM 1521 C CE2 . PHE A 1 246 ? -19.862 0.431   -9.424  1.00 137.15 ? 516 PHE A CE2 1 
ATOM 1522 C CZ  . PHE A 1 246 ? -19.324 0.534   -10.691 1.00 151.37 ? 516 PHE A CZ  1 
ATOM 1523 N N   . GLU A 1 247 ? -17.634 -4.490  -9.290  1.00 133.58 ? 517 GLU A N   1 
ATOM 1524 C CA  . GLU A 1 247 ? -17.893 -5.138  -10.569 1.00 145.56 ? 517 GLU A CA  1 
ATOM 1525 C C   . GLU A 1 247 ? -18.926 -6.248  -10.401 1.00 154.74 ? 517 GLU A C   1 
ATOM 1526 O O   . GLU A 1 247 ? -19.790 -6.443  -11.255 1.00 166.09 ? 517 GLU A O   1 
ATOM 1527 C CB  . GLU A 1 247 ? -16.598 -5.711  -11.147 1.00 135.15 ? 517 GLU A CB  1 
ATOM 1528 C CG  . GLU A 1 247 ? -15.615 -4.676  -11.686 1.00 133.96 ? 517 GLU A CG  1 
ATOM 1529 C CD  . GLU A 1 247 ? -16.216 -3.769  -12.738 1.00 132.58 ? 517 GLU A CD  1 
ATOM 1530 O OE1 . GLU A 1 247 ? -16.972 -4.269  -13.596 1.00 139.86 ? 517 GLU A OE1 1 
ATOM 1531 O OE2 . GLU A 1 247 ? -15.906 -2.558  -12.727 1.00 128.94 ? 517 GLU A OE2 1 
ATOM 1532 N N   . LEU A 1 248 ? -18.823 -6.970  -9.292  1.00 137.80 ? 518 LEU A N   1 
ATOM 1533 C CA  . LEU A 1 248 ? -19.863 -7.899  -8.859  1.00 134.32 ? 518 LEU A CA  1 
ATOM 1534 C C   . LEU A 1 248 ? -21.204 -7.205  -8.642  1.00 143.10 ? 518 LEU A C   1 
ATOM 1535 O O   . LEU A 1 248 ? -22.255 -7.837  -8.762  1.00 141.76 ? 518 LEU A O   1 
ATOM 1536 C CB  . LEU A 1 248 ? -19.438 -8.620  -7.582  1.00 129.46 ? 518 LEU A CB  1 
ATOM 1537 C CG  . LEU A 1 248 ? -18.207 -9.509  -7.737  1.00 127.52 ? 518 LEU A CG  1 
ATOM 1538 C CD1 . LEU A 1 248 ? -17.652 -9.904  -6.381  1.00 136.66 ? 518 LEU A CD1 1 
ATOM 1539 C CD2 . LEU A 1 248 ? -18.558 -10.740 -8.558  1.00 123.86 ? 518 LEU A CD2 1 
ATOM 1540 N N   . SER A 1 249 ? -21.135 -5.929  -8.256  1.00 147.75 ? 519 SER A N   1 
ATOM 1541 C CA  . SER A 1 249 ? -22.286 -5.043  -8.045  1.00 144.54 ? 519 SER A CA  1 
ATOM 1542 C C   . SER A 1 249 ? -22.842 -5.292  -6.654  1.00 147.91 ? 519 SER A C   1 
ATOM 1543 O O   . SER A 1 249 ? -24.017 -5.050  -6.379  1.00 148.81 ? 519 SER A O   1 
ATOM 1544 C CB  . SER A 1 249 ? -23.375 -5.222  -9.112  1.00 141.49 ? 519 SER A CB  1 
ATOM 1545 O OG  . SER A 1 249 ? -24.232 -6.306  -8.795  1.00 143.58 ? 519 SER A OG  1 
ATOM 1546 N N   . GLU A 1 250 ? -21.971 -5.788  -5.782  1.00 149.89 ? 520 GLU A N   1 
ATOM 1547 C CA  . GLU A 1 250 ? -22.210 -5.753  -4.349  1.00 146.60 ? 520 GLU A CA  1 
ATOM 1548 C C   . GLU A 1 250 ? -21.838 -4.367  -3.837  1.00 142.01 ? 520 GLU A C   1 
ATOM 1549 O O   . GLU A 1 250 ? -20.735 -4.153  -3.335  1.00 138.12 ? 520 GLU A O   1 
ATOM 1550 C CB  . GLU A 1 250 ? -21.403 -6.835  -3.630  1.00 142.48 ? 520 GLU A CB  1 
ATOM 1551 N N   . TYR A 1 251 ? -22.770 -3.431  -3.976  1.00 153.44 ? 521 TYR A N   1 
ATOM 1552 C CA  . TYR A 1 251 ? -22.502 -2.017  -3.734  1.00 153.70 ? 521 TYR A CA  1 
ATOM 1553 C C   . TYR A 1 251 ? -22.190 -1.702  -2.274  1.00 154.93 ? 521 TYR A C   1 
ATOM 1554 O O   . TYR A 1 251 ? -21.295 -0.909  -1.983  1.00 166.83 ? 521 TYR A O   1 
ATOM 1555 C CB  . TYR A 1 251 ? -23.689 -1.157  -4.175  1.00 163.37 ? 521 TYR A CB  1 
ATOM 1556 C CG  . TYR A 1 251 ? -24.087 -1.253  -5.632  1.00 174.26 ? 521 TYR A CG  1 
ATOM 1557 C CD1 . TYR A 1 251 ? -23.137 -1.437  -6.628  1.00 177.08 ? 521 TYR A CD1 1 
ATOM 1558 C CD2 . TYR A 1 251 ? -25.417 -1.121  -6.013  1.00 177.68 ? 521 TYR A CD2 1 
ATOM 1559 C CE1 . TYR A 1 251 ? -23.506 -1.512  -7.962  1.00 176.09 ? 521 TYR A CE1 1 
ATOM 1560 C CE2 . TYR A 1 251 ? -25.794 -1.193  -7.341  1.00 174.87 ? 521 TYR A CE2 1 
ATOM 1561 C CZ  . TYR A 1 251 ? -24.835 -1.388  -8.311  1.00 170.50 ? 521 TYR A CZ  1 
ATOM 1562 O OH  . TYR A 1 251 ? -25.206 -1.458  -9.634  1.00 165.47 ? 521 TYR A OH  1 
ATOM 1563 N N   . MET A 1 252 ? -22.923 -2.327  -1.359  1.00 154.71 ? 522 MET A N   1 
ATOM 1564 C CA  . MET A 1 252 ? -22.728 -2.079  0.067   1.00 156.09 ? 522 MET A CA  1 
ATOM 1565 C C   . MET A 1 252 ? -21.464 -2.732  0.617   1.00 162.67 ? 522 MET A C   1 
ATOM 1566 O O   . MET A 1 252 ? -20.810 -2.174  1.497   1.00 168.16 ? 522 MET A O   1 
ATOM 1567 C CB  . MET A 1 252 ? -23.944 -2.569  0.856   1.00 151.66 ? 522 MET A CB  1 
ATOM 1568 N N   . GLN A 1 253 ? -21.120 -3.907  0.105   1.00 156.70 ? 523 GLN A N   1 
ATOM 1569 C CA  . GLN A 1 253 ? -19.869 -4.547  0.491   1.00 143.82 ? 523 GLN A CA  1 
ATOM 1570 C C   . GLN A 1 253 ? -18.684 -3.755  -0.055  1.00 139.35 ? 523 GLN A C   1 
ATOM 1571 O O   . GLN A 1 253 ? -17.610 -3.723  0.547   1.00 131.81 ? 523 GLN A O   1 
ATOM 1572 C CB  . GLN A 1 253 ? -19.821 -5.992  -0.010  1.00 134.56 ? 523 GLN A CB  1 
ATOM 1573 N N   . ALA A 1 254 ? -18.893 -3.118  -1.203  1.00 141.86 ? 524 ALA A N   1 
ATOM 1574 C CA  . ALA A 1 254 ? -17.917 -2.201  -1.782  1.00 140.65 ? 524 ALA A CA  1 
ATOM 1575 C C   . ALA A 1 254 ? -17.729 -0.910  -0.984  1.00 139.46 ? 524 ALA A C   1 
ATOM 1576 O O   . ALA A 1 254 ? -16.611 -0.552  -0.630  1.00 137.20 ? 524 ALA A O   1 
ATOM 1577 C CB  . ALA A 1 254 ? -18.308 -1.869  -3.214  1.00 143.39 ? 524 ALA A CB  1 
ATOM 1578 N N   . GLU A 1 255 ? -18.818 -0.199  -0.717  1.00 137.01 ? 525 GLU A N   1 
ATOM 1579 C CA  . GLU A 1 255 ? -18.730 1.064   0.013   1.00 137.03 ? 525 GLU A CA  1 
ATOM 1580 C C   . GLU A 1 255 ? -18.129 0.931   1.411   1.00 135.33 ? 525 GLU A C   1 
ATOM 1581 O O   . GLU A 1 255 ? -17.604 1.902   1.956   1.00 146.28 ? 525 GLU A O   1 
ATOM 1582 C CB  . GLU A 1 255 ? -20.116 1.706   0.119   1.00 127.50 ? 525 GLU A CB  1 
ATOM 1583 N N   . ARG A 1 256 ? -18.195 -0.266  1.985   1.00 139.73 ? 526 ARG A N   1 
ATOM 1584 C CA  . ARG A 1 256 ? -17.553 -0.523  3.271   1.00 154.07 ? 526 ARG A CA  1 
ATOM 1585 C C   . ARG A 1 256 ? -16.034 -0.344  3.259   1.00 149.41 ? 526 ARG A C   1 
ATOM 1586 O O   . ARG A 1 256 ? -15.477 0.306   4.144   1.00 145.35 ? 526 ARG A O   1 
ATOM 1587 C CB  . ARG A 1 256 ? -17.895 -1.937  3.747   1.00 160.28 ? 526 ARG A CB  1 
ATOM 1588 N N   . ILE A 1 257 ? -15.363 -0.915  2.262   1.00 138.69 ? 527 ILE A N   1 
ATOM 1589 C CA  . ILE A 1 257 ? -13.904 -0.847  2.221   1.00 134.78 ? 527 ILE A CA  1 
ATOM 1590 C C   . ILE A 1 257 ? -13.374 0.368   1.439   1.00 129.24 ? 527 ILE A C   1 
ATOM 1591 O O   . ILE A 1 257 ? -12.167 0.614   1.412   1.00 127.62 ? 527 ILE A O   1 
ATOM 1592 C CB  . ILE A 1 257 ? -13.289 -2.178  1.705   1.00 131.18 ? 527 ILE A CB  1 
ATOM 1593 C CG1 . ILE A 1 257 ? -14.099 -2.782  0.563   1.00 124.89 ? 527 ILE A CG1 1 
ATOM 1594 C CG2 . ILE A 1 257 ? -13.281 -3.206  2.817   1.00 147.81 ? 527 ILE A CG2 1 
ATOM 1595 C CD1 . ILE A 1 257 ? -14.022 -2.028  -0.694  1.00 126.51 ? 527 ILE A CD1 1 
ATOM 1596 N N   . PHE A 1 258 ? -14.273 1.114   0.800   1.00 129.88 ? 528 PHE A N   1 
ATOM 1597 C CA  . PHE A 1 258 ? -13.907 2.399   0.199   1.00 129.13 ? 528 PHE A CA  1 
ATOM 1598 C C   . PHE A 1 258 ? -13.992 3.527   1.217   1.00 129.36 ? 528 PHE A C   1 
ATOM 1599 O O   . PHE A 1 258 ? -13.215 4.480   1.174   1.00 128.97 ? 528 PHE A O   1 
ATOM 1600 C CB  . PHE A 1 258 ? -14.790 2.732   -0.998  1.00 136.49 ? 528 PHE A CB  1 
ATOM 1601 C CG  . PHE A 1 258 ? -14.269 2.211   -2.297  1.00 137.65 ? 528 PHE A CG  1 
ATOM 1602 C CD1 . PHE A 1 258 ? -15.107 1.579   -3.196  1.00 131.21 ? 528 PHE A CD1 1 
ATOM 1603 C CD2 . PHE A 1 258 ? -12.933 2.369   -2.625  1.00 140.34 ? 528 PHE A CD2 1 
ATOM 1604 C CE1 . PHE A 1 258 ? -14.619 1.113   -4.392  1.00 128.54 ? 528 PHE A CE1 1 
ATOM 1605 C CE2 . PHE A 1 258 ? -12.439 1.901   -3.821  1.00 135.64 ? 528 PHE A CE2 1 
ATOM 1606 C CZ  . PHE A 1 258 ? -13.282 1.274   -4.707  1.00 125.77 ? 528 PHE A CZ  1 
ATOM 1607 N N   . SER A 1 259 ? -14.955 3.420   2.122   1.00 143.82 ? 529 SER A N   1 
ATOM 1608 C CA  . SER A 1 259 ? -15.017 4.295   3.282   1.00 156.62 ? 529 SER A CA  1 
ATOM 1609 C C   . SER A 1 259 ? -13.751 4.043   4.094   1.00 154.35 ? 529 SER A C   1 
ATOM 1610 O O   . SER A 1 259 ? -13.235 4.929   4.774   1.00 178.80 ? 529 SER A O   1 
ATOM 1611 C CB  . SER A 1 259 ? -16.280 4.039   4.105   1.00 178.06 ? 529 SER A CB  1 
ATOM 1612 O OG  . SER A 1 259 ? -17.442 4.196   3.308   1.00 185.40 ? 529 SER A OG  1 
ATOM 1613 N N   . GLU A 1 260 ? -13.267 2.808   3.998   1.00 127.52 ? 530 GLU A N   1 
ATOM 1614 C CA  . GLU A 1 260 ? -12.063 2.347   4.679   1.00 122.64 ? 530 GLU A CA  1 
ATOM 1615 C C   . GLU A 1 260 ? -10.755 2.909   4.134   1.00 126.20 ? 530 GLU A C   1 
ATOM 1616 O O   . GLU A 1 260 ? -9.958  3.463   4.891   1.00 135.09 ? 530 GLU A O   1 
ATOM 1617 C CB  . GLU A 1 260 ? -12.006 0.820   4.601   1.00 120.08 ? 530 GLU A CB  1 
ATOM 1618 C CG  . GLU A 1 260 ? -10.849 0.156   5.322   1.00 118.23 ? 530 GLU A CG  1 
ATOM 1619 C CD  . GLU A 1 260 ? -10.824 0.423   6.801   1.00 119.85 ? 530 GLU A CD  1 
ATOM 1620 O OE1 . GLU A 1 260 ? -11.860 0.842   7.358   1.00 122.97 ? 530 GLU A OE1 1 
ATOM 1621 O OE2 . GLU A 1 260 ? -9.761  0.204   7.420   1.00 122.11 ? 530 GLU A OE2 1 
ATOM 1622 N N   . VAL A 1 261 ? -10.536 2.766   2.829   1.00 116.84 ? 531 VAL A N   1 
ATOM 1623 C CA  . VAL A 1 261 ? -9.335  3.300   2.186   1.00 114.60 ? 531 VAL A CA  1 
ATOM 1624 C C   . VAL A 1 261 ? -9.222  4.803   2.428   1.00 115.93 ? 531 VAL A C   1 
ATOM 1625 O O   . VAL A 1 261 ? -8.124  5.360   2.491   1.00 115.17 ? 531 VAL A O   1 
ATOM 1626 C CB  . VAL A 1 261 ? -9.302  3.001   0.661   1.00 113.89 ? 531 VAL A CB  1 
ATOM 1627 C CG1 . VAL A 1 261 ? -10.527 3.554   -0.031  1.00 122.88 ? 531 VAL A CG1 1 
ATOM 1628 C CG2 . VAL A 1 261 ? -8.042  3.574   0.022   1.00 115.77 ? 531 VAL A CG2 1 
ATOM 1629 N N   . ARG A 1 262 ? -10.363 5.451   2.616   1.00 124.56 ? 532 ARG A N   1 
ATOM 1630 C CA  . ARG A 1 262 ? -10.366 6.866   2.938   1.00 128.61 ? 532 ARG A CA  1 
ATOM 1631 C C   . ARG A 1 262 ? -9.927  7.195   4.371   1.00 145.98 ? 532 ARG A C   1 
ATOM 1632 O O   . ARG A 1 262 ? -9.148  8.126   4.554   1.00 166.30 ? 532 ARG A O   1 
ATOM 1633 C CB  . ARG A 1 262 ? -11.750 7.469   2.677   1.00 124.29 ? 532 ARG A CB  1 
ATOM 1634 C CG  . ARG A 1 262 ? -12.048 7.703   1.199   1.00 122.86 ? 532 ARG A CG  1 
ATOM 1635 C CD  . ARG A 1 262 ? -12.502 9.127   0.911   1.00 121.45 ? 532 ARG A CD  1 
ATOM 1636 N NE  . ARG A 1 262 ? -11.416 10.085  1.109   1.00 121.61 ? 532 ARG A NE  1 
ATOM 1637 C CZ  . ARG A 1 262 ? -11.585 11.357  1.455   1.00 124.75 ? 532 ARG A CZ  1 
ATOM 1638 N NH1 . ARG A 1 262 ? -12.805 11.842  1.640   1.00 125.88 ? 532 ARG A NH1 1 
ATOM 1639 N NH2 . ARG A 1 262 ? -10.531 12.146  1.615   1.00 125.90 ? 532 ARG A NH2 1 
ATOM 1640 N N   . ARG A 1 263 ? -10.408 6.483   5.391   1.00 133.32 ? 533 ARG A N   1 
ATOM 1641 C CA  . ARG A 1 263 ? -9.965  6.841   6.743   1.00 135.26 ? 533 ARG A CA  1 
ATOM 1642 C C   . ARG A 1 263 ? -8.512  6.403   6.959   1.00 135.29 ? 533 ARG A C   1 
ATOM 1643 O O   . ARG A 1 263 ? -7.829  6.934   7.833   1.00 152.28 ? 533 ARG A O   1 
ATOM 1644 C CB  . ARG A 1 263 ? -10.768 6.222   7.891   1.00 141.12 ? 533 ARG A CB  1 
ATOM 1645 C CG  . ARG A 1 263 ? -10.705 4.728   8.067   1.00 134.65 ? 533 ARG A CG  1 
ATOM 1646 C CD  . ARG A 1 263 ? -11.035 4.540   9.556   1.00 137.92 ? 533 ARG A CD  1 
ATOM 1647 N NE  . ARG A 1 263 ? -10.101 3.687   10.295  1.00 147.40 ? 533 ARG A NE  1 
ATOM 1648 C CZ  . ARG A 1 263 ? -9.987  2.370   10.200  1.00 150.14 ? 533 ARG A CZ  1 
ATOM 1649 N NH1 . ARG A 1 263 ? -10.752 1.688   9.370   1.00 153.04 ? 533 ARG A NH1 1 
ATOM 1650 N NH2 . ARG A 1 263 ? -9.098  1.736   10.954  1.00 147.68 ? 533 ARG A NH2 1 
ATOM 1651 N N   . ILE A 1 264 ? -8.039  5.431   6.179   1.00 119.90 ? 534 ILE A N   1 
ATOM 1652 C CA  . ILE A 1 264 ? -6.669  4.942   6.354   1.00 123.81 ? 534 ILE A CA  1 
ATOM 1653 C C   . ILE A 1 264 ? -5.621  5.711   5.551   1.00 134.23 ? 534 ILE A C   1 
ATOM 1654 O O   . ILE A 1 264 ? -4.469  5.799   5.976   1.00 142.58 ? 534 ILE A O   1 
ATOM 1655 C CB  . ILE A 1 264 ? -6.571  3.427   5.982   1.00 118.10 ? 534 ILE A CB  1 
ATOM 1656 C CG1 . ILE A 1 264 ? -5.232  2.832   6.417   1.00 118.80 ? 534 ILE A CG1 1 
ATOM 1657 C CG2 . ILE A 1 264 ? -6.750  3.208   4.496   1.00 117.25 ? 534 ILE A CG2 1 
ATOM 1658 C CD1 . ILE A 1 264 ? -5.008  2.857   7.903   1.00 133.10 ? 534 ILE A CD1 1 
ATOM 1659 N N   . GLU A 1 265 ? -5.987  6.259   4.400   1.00 131.02 ? 535 GLU A N   1 
ATOM 1660 C CA  . GLU A 1 265 ? -5.017  7.016   3.619   1.00 135.21 ? 535 GLU A CA  1 
ATOM 1661 C C   . GLU A 1 265 ? -5.402  8.497   3.572   1.00 145.33 ? 535 GLU A C   1 
ATOM 1662 O O   . GLU A 1 265 ? -4.616  9.357   3.969   1.00 172.65 ? 535 GLU A O   1 
ATOM 1663 C CB  . GLU A 1 265 ? -4.851  6.432   2.218   1.00 131.11 ? 535 GLU A CB  1 
ATOM 1664 C CG  . GLU A 1 265 ? -4.203  5.051   2.242   1.00 134.96 ? 535 GLU A CG  1 
ATOM 1665 C CD  . GLU A 1 265 ? -3.188  4.848   1.135   1.00 137.95 ? 535 GLU A CD  1 
ATOM 1666 O OE1 . GLU A 1 265 ? -1.997  5.140   1.367   1.00 129.29 ? 535 GLU A OE1 1 
ATOM 1667 O OE2 . GLU A 1 265 ? -3.574  4.388   0.041   1.00 147.67 ? 535 GLU A OE2 1 
ATOM 1668 N N   . ASN A 1 266 ? -6.616  8.774   3.090   1.00 128.45 ? 536 ASN A N   1 
ATOM 1669 C CA  . ASN A 1 266 ? -7.210  10.121  3.090   1.00 135.44 ? 536 ASN A CA  1 
ATOM 1670 C C   . ASN A 1 266 ? -6.532  11.090  2.124   1.00 151.03 ? 536 ASN A C   1 
ATOM 1671 O O   . ASN A 1 266 ? -6.975  12.226  1.955   1.00 165.13 ? 536 ASN A O   1 
ATOM 1672 C CB  . ASN A 1 266 ? -7.214  10.716  4.503   1.00 129.75 ? 536 ASN A CB  1 
ATOM 1673 N N   . TYR A 1 267 ? -5.417  10.659  1.553   1.00 145.55 ? 537 TYR A N   1 
ATOM 1674 C CA  . TYR A 1 267 ? -4.731  11.416  0.518   1.00 142.14 ? 537 TYR A CA  1 
ATOM 1675 C C   . TYR A 1 267 ? -4.838  10.705  -0.830  1.00 145.93 ? 537 TYR A C   1 
ATOM 1676 O O   . TYR A 1 267 ? -4.259  11.146  -1.823  1.00 157.66 ? 537 TYR A O   1 
ATOM 1677 C CB  . TYR A 1 267 ? -3.267  11.635  0.908   1.00 132.06 ? 537 TYR A CB  1 
ATOM 1678 C CG  . TYR A 1 267 ? -2.501  10.352  1.147   1.00 130.31 ? 537 TYR A CG  1 
ATOM 1679 C CD1 . TYR A 1 267 ? -2.116  9.532   0.094   1.00 130.78 ? 537 TYR A CD1 1 
ATOM 1680 C CD2 . TYR A 1 267 ? -2.155  9.968   2.433   1.00 132.52 ? 537 TYR A CD2 1 
ATOM 1681 C CE1 . TYR A 1 267 ? -1.423  8.362   0.320   1.00 131.96 ? 537 TYR A CE1 1 
ATOM 1682 C CE2 . TYR A 1 267 ? -1.463  8.801   2.669   1.00 138.42 ? 537 TYR A CE2 1 
ATOM 1683 C CZ  . TYR A 1 267 ? -1.096  8.003   1.608   1.00 133.41 ? 537 TYR A CZ  1 
ATOM 1684 O OH  . TYR A 1 267 ? -0.404  6.837   1.836   1.00 139.22 ? 537 TYR A OH  1 
ATOM 1685 N N   . ARG A 1 268 ? -5.596  9.614   -0.857  1.00 138.77 ? 538 ARG A N   1 
ATOM 1686 C CA  . ARG A 1 268 ? -5.736  8.796   -2.059  1.00 139.94 ? 538 ARG A CA  1 
ATOM 1687 C C   . ARG A 1 268 ? -6.949  9.190   -2.894  1.00 141.95 ? 538 ARG A C   1 
ATOM 1688 O O   . ARG A 1 268 ? -8.075  9.237   -2.397  1.00 167.29 ? 538 ARG A O   1 
ATOM 1689 C CB  . ARG A 1 268 ? -5.806  7.308   -1.716  1.00 135.90 ? 538 ARG A CB  1 
ATOM 1690 C CG  . ARG A 1 268 ? -6.007  6.443   -2.951  1.00 134.54 ? 538 ARG A CG  1 
ATOM 1691 C CD  . ARG A 1 268 ? -5.607  5.000   -2.715  1.00 132.17 ? 538 ARG A CD  1 
ATOM 1692 N NE  . ARG A 1 268 ? -5.706  4.214   -3.942  1.00 141.00 ? 538 ARG A NE  1 
ATOM 1693 C CZ  . ARG A 1 268 ? -4.657  3.713   -4.587  1.00 158.05 ? 538 ARG A CZ  1 
ATOM 1694 N NH1 . ARG A 1 268 ? -3.432  3.920   -4.122  1.00 165.25 ? 538 ARG A NH1 1 
ATOM 1695 N NH2 . ARG A 1 268 ? -4.827  3.023   -5.707  1.00 156.55 ? 538 ARG A NH2 1 
ATOM 1696 N N   . VAL A 1 269 ? -6.703  9.475   -4.167  1.00 118.13 ? 539 VAL A N   1 
ATOM 1697 C CA  . VAL A 1 269 ? -7.769  9.783   -5.110  1.00 117.03 ? 539 VAL A CA  1 
ATOM 1698 C C   . VAL A 1 269 ? -7.950  8.673   -6.139  1.00 121.55 ? 539 VAL A C   1 
ATOM 1699 O O   . VAL A 1 269 ? -8.942  8.656   -6.866  1.00 133.88 ? 539 VAL A O   1 
ATOM 1700 C CB  . VAL A 1 269 ? -7.494  11.104  -5.855  1.00 119.44 ? 539 VAL A CB  1 
ATOM 1701 C CG1 . VAL A 1 269 ? -7.217  12.226  -4.869  1.00 135.45 ? 539 VAL A CG1 1 
ATOM 1702 C CG2 . VAL A 1 269 ? -6.329  10.936  -6.821  1.00 119.89 ? 539 VAL A CG2 1 
ATOM 1703 N N   . GLU A 1 270 ? -7.004  7.740   -6.191  1.00 125.06 ? 540 GLU A N   1 
ATOM 1704 C CA  . GLU A 1 270 ? -6.889  6.845   -7.337  1.00 124.73 ? 540 GLU A CA  1 
ATOM 1705 C C   . GLU A 1 270 ? -8.036  5.838   -7.409  1.00 121.04 ? 540 GLU A C   1 
ATOM 1706 O O   . GLU A 1 270 ? -8.506  5.512   -8.499  1.00 123.85 ? 540 GLU A O   1 
ATOM 1707 C CB  . GLU A 1 270 ? -5.552  6.100   -7.293  1.00 133.16 ? 540 GLU A CB  1 
ATOM 1708 N N   . GLY A 1 271 ? -8.491  5.348   -6.259  1.00 111.88 ? 541 GLY A N   1 
ATOM 1709 C CA  . GLY A 1 271 ? -9.602  4.413   -6.247  1.00 112.02 ? 541 GLY A CA  1 
ATOM 1710 C C   . GLY A 1 271 ? -10.941 5.107   -6.128  1.00 115.65 ? 541 GLY A C   1 
ATOM 1711 O O   . GLY A 1 271 ? -11.991 4.507   -6.362  1.00 108.64 ? 541 GLY A O   1 
ATOM 1712 N N   . MET A 1 272 ? -10.898 6.385   -5.767  1.00 120.18 ? 542 MET A N   1 
ATOM 1713 C CA  . MET A 1 272 ? -12.082 7.117   -5.334  1.00 114.32 ? 542 MET A CA  1 
ATOM 1714 C C   . MET A 1 272 ? -12.894 7.395   -6.584  1.00 114.93 ? 542 MET A C   1 
ATOM 1715 O O   . MET A 1 272 ? -14.070 7.759   -6.533  1.00 117.73 ? 542 MET A O   1 
ATOM 1716 C CB  . MET A 1 272 ? -11.709 8.416   -4.617  1.00 106.77 ? 542 MET A CB  1 
ATOM 1717 N N   . GLU A 1 273 ? -12.212 7.224   -7.710  1.00 120.76 ? 543 GLU A N   1 
ATOM 1718 C CA  . GLU A 1 273 ? -12.816 7.103   -9.021  1.00 121.56 ? 543 GLU A CA  1 
ATOM 1719 C C   . GLU A 1 273 ? -14.106 6.293   -9.098  1.00 124.72 ? 543 GLU A C   1 
ATOM 1720 O O   . GLU A 1 273 ? -15.143 6.804   -9.521  1.00 133.23 ? 543 GLU A O   1 
ATOM 1721 C CB  . GLU A 1 273 ? -11.753 6.394   -9.870  1.00 128.66 ? 543 GLU A CB  1 
ATOM 1722 C CG  . GLU A 1 273 ? -12.111 5.899   -11.240 1.00 142.75 ? 543 GLU A CG  1 
ATOM 1723 C CD  . GLU A 1 273 ? -10.912 5.223   -11.896 1.00 140.93 ? 543 GLU A CD  1 
ATOM 1724 O OE1 . GLU A 1 273 ? -9.819  5.830   -11.926 1.00 149.12 ? 543 GLU A OE1 1 
ATOM 1725 O OE2 . GLU A 1 273 ? -11.067 4.084   -12.387 1.00 123.81 ? 543 GLU A OE2 1 
ATOM 1726 N N   . ILE A 1 274 ? -14.037 5.034   -8.688  1.00 128.89 ? 544 ILE A N   1 
ATOM 1727 C CA  . ILE A 1 274 ? -15.155 4.120   -8.898  1.00 136.34 ? 544 ILE A CA  1 
ATOM 1728 C C   . ILE A 1 274 ? -16.100 4.089   -7.693  1.00 142.72 ? 544 ILE A C   1 
ATOM 1729 O O   . ILE A 1 274 ? -17.295 3.844   -7.832  1.00 171.37 ? 544 ILE A O   1 
ATOM 1730 C CB  . ILE A 1 274 ? -14.675 2.699   -9.274  1.00 152.31 ? 544 ILE A CB  1 
ATOM 1731 C CG1 . ILE A 1 274 ? -14.108 1.950   -8.075  1.00 165.38 ? 544 ILE A CG1 1 
ATOM 1732 C CG2 . ILE A 1 274 ? -13.695 2.752   -10.440 1.00 156.91 ? 544 ILE A CG2 1 
ATOM 1733 C CD1 . ILE A 1 274 ? -14.974 0.796   -7.683  1.00 168.55 ? 544 ILE A CD1 1 
ATOM 1734 N N   . TYR A 1 275 ? -15.536 4.418   -6.529  1.00 115.54 ? 545 TYR A N   1 
ATOM 1735 C CA  . TYR A 1 275 ? -16.263 4.710   -5.290  1.00 116.22 ? 545 TYR A CA  1 
ATOM 1736 C C   . TYR A 1 275 ? -17.282 5.822   -5.446  1.00 117.56 ? 545 TYR A C   1 
ATOM 1737 O O   . TYR A 1 275 ? -18.359 5.771   -4.850  1.00 121.27 ? 545 TYR A O   1 
ATOM 1738 C CB  . TYR A 1 275 ? -15.245 5.064   -4.193  1.00 122.61 ? 545 TYR A CB  1 
ATOM 1739 C CG  . TYR A 1 275 ? -15.797 5.426   -2.823  1.00 130.06 ? 545 TYR A CG  1 
ATOM 1740 C CD1 . TYR A 1 275 ? -16.995 4.896   -2.356  1.00 122.56 ? 545 TYR A CD1 1 
ATOM 1741 C CD2 . TYR A 1 275 ? -15.093 6.282   -1.984  1.00 145.87 ? 545 TYR A CD2 1 
ATOM 1742 C CE1 . TYR A 1 275 ? -17.481 5.223   -1.100  1.00 123.74 ? 545 TYR A CE1 1 
ATOM 1743 C CE2 . TYR A 1 275 ? -15.571 6.614   -0.730  1.00 149.97 ? 545 TYR A CE2 1 
ATOM 1744 C CZ  . TYR A 1 275 ? -16.765 6.083   -0.293  1.00 139.08 ? 545 TYR A CZ  1 
ATOM 1745 O OH  . TYR A 1 275 ? -17.240 6.411   0.957   1.00 155.95 ? 545 TYR A OH  1 
ATOM 1746 N N   . SER A 1 276 ? -16.953 6.820   -6.250  1.00 114.42 ? 546 SER A N   1 
ATOM 1747 C CA  . SER A 1 276 ? -17.876 7.909   -6.500  1.00 114.32 ? 546 SER A CA  1 
ATOM 1748 C C   . SER A 1 276 ? -19.147 7.346   -7.130  1.00 118.95 ? 546 SER A C   1 
ATOM 1749 O O   . SER A 1 276 ? -20.260 7.686   -6.732  1.00 128.63 ? 546 SER A O   1 
ATOM 1750 C CB  . SER A 1 276 ? -17.242 8.959   -7.405  1.00 116.48 ? 546 SER A CB  1 
ATOM 1751 O OG  . SER A 1 276 ? -17.346 8.585   -8.766  1.00 130.66 ? 546 SER A OG  1 
ATOM 1752 N N   . THR A 1 277 ? -18.964 6.469   -8.111  1.00 121.13 ? 547 THR A N   1 
ATOM 1753 C CA  . THR A 1 277 ? -20.078 5.839   -8.810  1.00 114.35 ? 547 THR A CA  1 
ATOM 1754 C C   . THR A 1 277 ? -20.834 4.783   -7.971  1.00 116.83 ? 547 THR A C   1 
ATOM 1755 O O   . THR A 1 277 ? -22.022 4.552   -8.203  1.00 119.44 ? 547 THR A O   1 
ATOM 1756 C CB  . THR A 1 277 ? -19.577 5.224   -10.143 1.00 113.05 ? 547 THR A CB  1 
ATOM 1757 O OG1 . THR A 1 277 ? -20.136 5.951   -11.244 1.00 127.59 ? 547 THR A OG1 1 
ATOM 1758 C CG2 . THR A 1 277 ? -19.960 3.775   -10.269 1.00 114.59 ? 547 THR A CG2 1 
ATOM 1759 N N   . THR A 1 278 ? -20.178 4.150   -7.000  1.00 117.35 ? 548 THR A N   1 
ATOM 1760 C CA  . THR A 1 278 ? -20.902 3.237   -6.105  1.00 118.59 ? 548 THR A CA  1 
ATOM 1761 C C   . THR A 1 278 ? -21.883 4.030   -5.256  1.00 133.35 ? 548 THR A C   1 
ATOM 1762 O O   . THR A 1 278 ? -23.059 3.678   -5.154  1.00 133.56 ? 548 THR A O   1 
ATOM 1763 C CB  . THR A 1 278 ? -19.992 2.408   -5.166  1.00 118.26 ? 548 THR A CB  1 
ATOM 1764 O OG1 . THR A 1 278 ? -19.833 3.105   -3.924  1.00 124.11 ? 548 THR A OG1 1 
ATOM 1765 C CG2 . THR A 1 278 ? -18.637 2.182   -5.764  1.00 116.20 ? 548 THR A CG2 1 
ATOM 1766 N N   . LEU A 1 279 ? -21.386 5.101   -4.647  1.00 146.04 ? 549 LEU A N   1 
ATOM 1767 C CA  . LEU A 1 279 ? -22.230 6.030   -3.907  1.00 146.49 ? 549 LEU A CA  1 
ATOM 1768 C C   . LEU A 1 279 ? -23.340 6.572   -4.801  1.00 142.85 ? 549 LEU A C   1 
ATOM 1769 O O   . LEU A 1 279 ? -24.400 6.968   -4.318  1.00 154.89 ? 549 LEU A O   1 
ATOM 1770 C CB  . LEU A 1 279 ? -21.394 7.182   -3.344  1.00 148.67 ? 549 LEU A CB  1 
ATOM 1771 C CG  . LEU A 1 279 ? -20.456 6.832   -2.188  1.00 154.67 ? 549 LEU A CG  1 
ATOM 1772 C CD1 . LEU A 1 279 ? -19.528 7.997   -1.871  1.00 156.69 ? 549 LEU A CD1 1 
ATOM 1773 C CD2 . LEU A 1 279 ? -21.247 6.416   -0.959  1.00 162.88 ? 549 LEU A CD2 1 
ATOM 1774 N N   . TRP A 1 280 ? -23.083 6.604   -6.104  1.00 136.37 ? 550 TRP A N   1 
ATOM 1775 C CA  . TRP A 1 280 ? -24.087 7.019   -7.072  1.00 140.92 ? 550 TRP A CA  1 
ATOM 1776 C C   . TRP A 1 280 ? -25.262 6.042   -7.196  1.00 140.24 ? 550 TRP A C   1 
ATOM 1777 O O   . TRP A 1 280 ? -26.420 6.458   -7.178  1.00 152.73 ? 550 TRP A O   1 
ATOM 1778 C CB  . TRP A 1 280 ? -23.441 7.200   -8.443  1.00 150.15 ? 550 TRP A CB  1 
ATOM 1779 C CG  . TRP A 1 280 ? -24.361 7.776   -9.440  1.00 152.96 ? 550 TRP A CG  1 
ATOM 1780 C CD1 . TRP A 1 280 ? -24.674 9.082   -9.584  1.00 167.57 ? 550 TRP A CD1 1 
ATOM 1781 C CD2 . TRP A 1 280 ? -25.122 7.064   -10.424 1.00 138.24 ? 550 TRP A CD2 1 
ATOM 1782 N NE1 . TRP A 1 280 ? -25.574 9.244   -10.609 1.00 165.44 ? 550 TRP A NE1 1 
ATOM 1783 C CE2 . TRP A 1 280 ? -25.866 8.018   -11.142 1.00 148.62 ? 550 TRP A CE2 1 
ATOM 1784 C CE3 . TRP A 1 280 ? -25.242 5.716   -10.770 1.00 133.66 ? 550 TRP A CE3 1 
ATOM 1785 C CZ2 . TRP A 1 280 ? -26.718 7.670   -12.186 1.00 152.41 ? 550 TRP A CZ2 1 
ATOM 1786 C CZ3 . TRP A 1 280 ? -26.089 5.372   -11.807 1.00 133.08 ? 550 TRP A CZ3 1 
ATOM 1787 C CH2 . TRP A 1 280 ? -26.816 6.345   -12.502 1.00 148.79 ? 550 TRP A CH2 1 
ATOM 1788 N N   . HIS A 1 281 ? -24.963 4.750   -7.324  1.00 141.51 ? 551 HIS A N   1 
ATOM 1789 C CA  . HIS A 1 281 ? -26.007 3.727   -7.432  1.00 142.91 ? 551 HIS A CA  1 
ATOM 1790 C C   . HIS A 1 281 ? -26.828 3.530   -6.161  1.00 146.35 ? 551 HIS A C   1 
ATOM 1791 O O   . HIS A 1 281 ? -28.040 3.319   -6.215  1.00 153.26 ? 551 HIS A O   1 
ATOM 1792 C CB  . HIS A 1 281 ? -25.387 2.379   -7.812  1.00 142.74 ? 551 HIS A CB  1 
ATOM 1793 C CG  . HIS A 1 281 ? -24.851 2.323   -9.207  1.00 144.30 ? 551 HIS A CG  1 
ATOM 1794 N ND1 . HIS A 1 281 ? -25.659 2.417   -10.319 1.00 158.68 ? 551 HIS A ND1 1 
ATOM 1795 C CD2 . HIS A 1 281 ? -23.589 2.158   -9.671  1.00 143.56 ? 551 HIS A CD2 1 
ATOM 1796 C CE1 . HIS A 1 281 ? -24.917 2.323   -11.409 1.00 157.95 ? 551 HIS A CE1 1 
ATOM 1797 N NE2 . HIS A 1 281 ? -23.658 2.167   -11.043 1.00 150.23 ? 551 HIS A NE2 1 
ATOM 1798 N N   . LEU A 1 282 ? -26.154 3.618   -5.023  1.00 143.39 ? 552 LEU A N   1 
ATOM 1799 C CA  . LEU A 1 282 ? -26.781 3.562   -3.703  1.00 144.82 ? 552 LEU A CA  1 
ATOM 1800 C C   . LEU A 1 282 ? -27.608 4.786   -3.362  1.00 142.72 ? 552 LEU A C   1 
ATOM 1801 O O   . LEU A 1 282 ? -28.424 4.757   -2.439  1.00 143.91 ? 552 LEU A O   1 
ATOM 1802 C CB  . LEU A 1 282 ? -25.719 3.331   -2.631  1.00 145.13 ? 552 LEU A CB  1 
ATOM 1803 C CG  . LEU A 1 282 ? -25.020 1.995   -2.857  1.00 140.58 ? 552 LEU A CG  1 
ATOM 1804 C CD1 . LEU A 1 282 ? -23.930 1.756   -1.830  1.00 143.31 ? 552 LEU A CD1 1 
ATOM 1805 C CD2 . LEU A 1 282 ? -26.076 0.903   -2.798  1.00 140.18 ? 552 LEU A CD2 1 
ATOM 1806 N N   . GLN A 1 283 ? -27.376 5.855   -4.114  1.00 139.30 ? 553 GLN A N   1 
ATOM 1807 C CA  . GLN A 1 283 ? -28.103 7.112   -3.975  1.00 137.50 ? 553 GLN A CA  1 
ATOM 1808 C C   . GLN A 1 283 ? -27.860 7.697   -2.590  1.00 145.32 ? 553 GLN A C   1 
ATOM 1809 O O   . GLN A 1 283 ? -28.800 8.015   -1.862  1.00 153.15 ? 553 GLN A O   1 
ATOM 1810 C CB  . GLN A 1 283 ? -29.608 6.907   -4.211  1.00 135.37 ? 553 GLN A CB  1 
ATOM 1811 C CG  . GLN A 1 283 ? -29.961 6.080   -5.438  1.00 134.23 ? 553 GLN A CG  1 
ATOM 1812 C CD  . GLN A 1 283 ? -31.412 6.238   -5.851  1.00 135.31 ? 553 GLN A CD  1 
ATOM 1813 O OE1 . GLN A 1 283 ? -32.088 7.182   -5.442  1.00 134.72 ? 553 GLN A OE1 1 
ATOM 1814 N NE2 . GLN A 1 283 ? -31.899 5.310   -6.667  1.00 143.17 ? 553 GLN A NE2 1 
ATOM 1815 N N   . LYS A 1 284 ? -26.586 7.822   -2.231  1.00 143.66 ? 554 LYS A N   1 
ATOM 1816 C CA  . LYS A 1 284 ? -26.229 8.443   -0.973  1.00 144.41 ? 554 LYS A CA  1 
ATOM 1817 C C   . LYS A 1 284 ? -25.720 9.839   -1.285  1.00 151.73 ? 554 LYS A C   1 
ATOM 1818 O O   . LYS A 1 284 ? -24.527 10.057  -1.539  1.00 153.99 ? 554 LYS A O   1 
ATOM 1819 C CB  . LYS A 1 284 ? -25.175 7.626   -0.221  1.00 141.50 ? 554 LYS A CB  1 
ATOM 1820 N N   . ASP A 1 285 ? -26.657 10.778  -1.234  1.00 160.39 ? 555 ASP A N   1 
ATOM 1821 C CA  . ASP A 1 285 ? -26.399 12.176  -1.548  1.00 164.15 ? 555 ASP A CA  1 
ATOM 1822 C C   . ASP A 1 285 ? -25.248 12.771  -0.716  1.00 163.99 ? 555 ASP A C   1 
ATOM 1823 O O   . ASP A 1 285 ? -24.228 13.164  -1.289  1.00 176.20 ? 555 ASP A O   1 
ATOM 1824 C CB  . ASP A 1 285 ? -27.690 13.015  -1.412  1.00 177.85 ? 555 ASP A CB  1 
ATOM 1825 C CG  . ASP A 1 285 ? -28.362 12.889  -0.046  1.00 196.82 ? 555 ASP A CG  1 
ATOM 1826 O OD1 . ASP A 1 285 ? -27.996 11.970  0.735   1.00 199.50 ? 555 ASP A OD1 1 
ATOM 1827 O OD2 . ASP A 1 285 ? -29.242 13.712  0.257   1.00 210.50 ? 555 ASP A OD2 1 
ATOM 1828 N N   . VAL A 1 286 ? -25.350 12.754  0.609   1.00 156.28 ? 556 VAL A N   1 
ATOM 1829 C CA  . VAL A 1 286 ? -24.367 13.433  1.462   1.00 166.50 ? 556 VAL A CA  1 
ATOM 1830 C C   . VAL A 1 286 ? -22.945 12.890  1.303   1.00 171.08 ? 556 VAL A C   1 
ATOM 1831 O O   . VAL A 1 286 ? -21.992 13.662  1.258   1.00 183.56 ? 556 VAL A O   1 
ATOM 1832 C CB  . VAL A 1 286 ? -24.755 13.391  2.978   1.00 163.40 ? 556 VAL A CB  1 
ATOM 1833 C CG1 . VAL A 1 286 ? -24.667 11.976  3.557   1.00 158.87 ? 556 VAL A CG1 1 
ATOM 1834 C CG2 . VAL A 1 286 ? -23.911 14.375  3.798   1.00 170.48 ? 556 VAL A CG2 1 
ATOM 1835 N N   . ALA A 1 287 ? -22.811 11.572  1.185   1.00 153.77 ? 557 ALA A N   1 
ATOM 1836 C CA  . ALA A 1 287 ? -21.510 10.911  1.113   1.00 137.67 ? 557 ALA A CA  1 
ATOM 1837 C C   . ALA A 1 287 ? -20.762 11.246  -0.168  1.00 142.41 ? 557 ALA A C   1 
ATOM 1838 O O   . ALA A 1 287 ? -19.547 11.450  -0.160  1.00 159.52 ? 557 ALA A O   1 
ATOM 1839 C CB  . ALA A 1 287 ? -21.676 9.413   1.246   1.00 136.24 ? 557 ALA A CB  1 
ATOM 1840 N N   . LEU A 1 288 ? -21.492 11.277  -1.276  1.00 134.14 ? 558 LEU A N   1 
ATOM 1841 C CA  . LEU A 1 288 ? -20.892 11.595  -2.557  1.00 136.45 ? 558 LEU A CA  1 
ATOM 1842 C C   . LEU A 1 288 ? -20.592 13.086  -2.621  1.00 134.27 ? 558 LEU A C   1 
ATOM 1843 O O   . LEU A 1 288 ? -19.566 13.495  -3.165  1.00 145.45 ? 558 LEU A O   1 
ATOM 1844 C CB  . LEU A 1 288 ? -21.811 11.147  -3.694  1.00 142.94 ? 558 LEU A CB  1 
ATOM 1845 C CG  . LEU A 1 288 ? -21.324 11.289  -5.133  1.00 148.88 ? 558 LEU A CG  1 
ATOM 1846 C CD1 . LEU A 1 288 ? -20.045 10.517  -5.322  1.00 152.03 ? 558 LEU A CD1 1 
ATOM 1847 C CD2 . LEU A 1 288 ? -22.387 10.732  -6.063  1.00 145.05 ? 558 LEU A CD2 1 
ATOM 1848 N N   . SER A 1 289 ? -21.498 13.897  -2.084  1.00 133.14 ? 559 SER A N   1 
ATOM 1849 C CA  . SER A 1 289 ? -21.229 15.316  -1.879  1.00 133.27 ? 559 SER A CA  1 
ATOM 1850 C C   . SER A 1 289 ? -19.937 15.547  -1.093  1.00 134.28 ? 559 SER A C   1 
ATOM 1851 O O   . SER A 1 289 ? -19.078 16.331  -1.498  1.00 150.48 ? 559 SER A O   1 
ATOM 1852 C CB  . SER A 1 289 ? -22.402 15.986  -1.166  1.00 136.88 ? 559 SER A CB  1 
ATOM 1853 O OG  . SER A 1 289 ? -22.050 17.286  -0.726  1.00 144.78 ? 559 SER A OG  1 
ATOM 1854 N N   . VAL A 1 290 ? -19.817 14.858  0.040   1.00 123.56 ? 560 VAL A N   1 
ATOM 1855 C CA  . VAL A 1 290 ? -18.630 14.945  0.890   1.00 125.66 ? 560 VAL A CA  1 
ATOM 1856 C C   . VAL A 1 290 ? -17.365 14.464  0.188   1.00 135.88 ? 560 VAL A C   1 
ATOM 1857 O O   . VAL A 1 290 ? -16.302 15.077  0.317   1.00 142.05 ? 560 VAL A O   1 
ATOM 1858 C CB  . VAL A 1 290 ? -18.825 14.136  2.197   1.00 123.78 ? 560 VAL A CB  1 
ATOM 1859 C CG1 . VAL A 1 290 ? -17.497 13.897  2.901   1.00 122.35 ? 560 VAL A CG1 1 
ATOM 1860 C CG2 . VAL A 1 290 ? -19.805 14.847  3.118   1.00 126.80 ? 560 VAL A CG2 1 
ATOM 1861 N N   . LEU A 1 291 ? -17.488 13.387  -0.581  1.00 133.76 ? 561 LEU A N   1 
ATOM 1862 C CA  . LEU A 1 291 ? -16.347 12.858  -1.315  1.00 120.28 ? 561 LEU A CA  1 
ATOM 1863 C C   . LEU A 1 291 ? -15.884 13.840  -2.380  1.00 122.35 ? 561 LEU A C   1 
ATOM 1864 O O   . LEU A 1 291 ? -14.700 14.165  -2.456  1.00 120.74 ? 561 LEU A O   1 
ATOM 1865 C CB  . LEU A 1 291 ? -16.698 11.514  -1.958  1.00 110.43 ? 561 LEU A CB  1 
ATOM 1866 N N   . SER A 1 292 ? -16.825 14.315  -3.192  1.00 122.15 ? 562 SER A N   1 
ATOM 1867 C CA  . SER A 1 292 ? -16.520 15.285  -4.236  1.00 120.56 ? 562 SER A CA  1 
ATOM 1868 C C   . SER A 1 292 ? -15.824 16.517  -3.674  1.00 136.79 ? 562 SER A C   1 
ATOM 1869 O O   . SER A 1 292 ? -14.842 16.997  -4.241  1.00 138.82 ? 562 SER A O   1 
ATOM 1870 C CB  . SER A 1 292 ? -17.798 15.703  -4.963  1.00 119.92 ? 562 SER A CB  1 
ATOM 1871 O OG  . SER A 1 292 ? -18.686 16.367  -4.081  1.00 125.36 ? 562 SER A OG  1 
ATOM 1872 N N   . LYS A 1 293 ? -16.345 17.028  -2.562  1.00 143.16 ? 563 LYS A N   1 
ATOM 1873 C CA  . LYS A 1 293 ? -15.724 18.156  -1.884  1.00 127.35 ? 563 LYS A CA  1 
ATOM 1874 C C   . LYS A 1 293 ? -14.288 17.822  -1.505  1.00 123.96 ? 563 LYS A C   1 
ATOM 1875 O O   . LYS A 1 293 ? -13.357 18.527  -1.885  1.00 126.10 ? 563 LYS A O   1 
ATOM 1876 C CB  . LYS A 1 293 ? -16.525 18.547  -0.639  1.00 116.66 ? 563 LYS A CB  1 
ATOM 1877 N N   . ASP A 1 294 ? -14.123 16.732  -0.762  1.00 124.77 ? 564 ASP A N   1 
ATOM 1878 C CA  . ASP A 1 294 ? -12.813 16.308  -0.283  1.00 129.30 ? 564 ASP A CA  1 
ATOM 1879 C C   . ASP A 1 294 ? -11.811 16.031  -1.409  1.00 137.57 ? 564 ASP A C   1 
ATOM 1880 O O   . ASP A 1 294 ? -10.613 16.272  -1.257  1.00 156.69 ? 564 ASP A O   1 
ATOM 1881 C CB  . ASP A 1 294 ? -12.972 15.058  0.586   1.00 127.25 ? 564 ASP A CB  1 
ATOM 1882 C CG  . ASP A 1 294 ? -13.540 15.372  1.957   1.00 135.06 ? 564 ASP A CG  1 
ATOM 1883 O OD1 . ASP A 1 294 ? -13.253 14.623  2.913   1.00 132.43 ? 564 ASP A OD1 1 
ATOM 1884 O OD2 . ASP A 1 294 ? -14.285 16.369  2.073   1.00 151.71 ? 564 ASP A OD2 1 
ATOM 1885 N N   . LEU A 1 295 ? -12.306 15.525  -2.535  1.00 116.15 ? 565 LEU A N   1 
ATOM 1886 C CA  . LEU A 1 295 ? -11.453 15.228  -3.686  1.00 117.05 ? 565 LEU A CA  1 
ATOM 1887 C C   . LEU A 1 295 ? -11.061 16.440  -4.530  1.00 129.62 ? 565 LEU A C   1 
ATOM 1888 O O   . LEU A 1 295 ? -9.909  16.562  -4.945  1.00 137.58 ? 565 LEU A O   1 
ATOM 1889 C CB  . LEU A 1 295 ? -12.118 14.177  -4.577  1.00 116.59 ? 565 LEU A CB  1 
ATOM 1890 C CG  . LEU A 1 295 ? -12.311 12.799  -3.942  1.00 112.56 ? 565 LEU A CG  1 
ATOM 1891 C CD1 . LEU A 1 295 ? -12.971 11.845  -4.920  1.00 116.96 ? 565 LEU A CD1 1 
ATOM 1892 C CD2 . LEU A 1 295 ? -10.970 12.249  -3.481  1.00 112.51 ? 565 LEU A CD2 1 
ATOM 1893 N N   . THR A 1 296 ? -12.014 17.329  -4.788  1.00 131.64 ? 566 THR A N   1 
ATOM 1894 C CA  . THR A 1 296 ? -11.715 18.567  -5.501  1.00 143.38 ? 566 THR A CA  1 
ATOM 1895 C C   . THR A 1 296 ? -10.792 19.439  -4.655  1.00 148.58 ? 566 THR A C   1 
ATOM 1896 O O   . THR A 1 296 ? -9.889  20.092  -5.180  1.00 163.39 ? 566 THR A O   1 
ATOM 1897 C CB  . THR A 1 296 ? -12.993 19.342  -5.866  1.00 147.32 ? 566 THR A CB  1 
ATOM 1898 O OG1 . THR A 1 296 ? -13.791 19.543  -4.694  1.00 160.12 ? 566 THR A OG1 1 
ATOM 1899 C CG2 . THR A 1 296 ? -13.798 18.572  -6.909  1.00 134.60 ? 566 THR A CG2 1 
ATOM 1900 N N   . ASP A 1 297 ? -11.026 19.445  -3.345  1.00 128.24 ? 567 ASP A N   1 
ATOM 1901 C CA  . ASP A 1 297 ? -10.190 20.194  -2.410  1.00 129.45 ? 567 ASP A CA  1 
ATOM 1902 C C   . ASP A 1 297 ? -8.733  19.741  -2.453  1.00 129.06 ? 567 ASP A C   1 
ATOM 1903 O O   . ASP A 1 297 ? -7.829  20.541  -2.214  1.00 138.36 ? 567 ASP A O   1 
ATOM 1904 C CB  . ASP A 1 297 ? -10.721 20.068  -0.978  1.00 146.04 ? 567 ASP A CB  1 
ATOM 1905 C CG  . ASP A 1 297 ? -11.994 20.859  -0.756  1.00 164.59 ? 567 ASP A CG  1 
ATOM 1906 O OD1 . ASP A 1 297 ? -12.537 21.399  -1.742  1.00 155.68 ? 567 ASP A OD1 1 
ATOM 1907 O OD2 . ASP A 1 297 ? -12.453 20.936  0.404   1.00 183.46 ? 567 ASP A OD2 1 
ATOM 1908 N N   . MET A 1 298 ? -8.497  18.474  -2.776  1.00 119.80 ? 568 MET A N   1 
ATOM 1909 C CA  . MET A 1 298 ? -7.137  17.954  -2.726  1.00 120.85 ? 568 MET A CA  1 
ATOM 1910 C C   . MET A 1 298 ? -6.440  18.123  -4.072  1.00 134.15 ? 568 MET A C   1 
ATOM 1911 O O   . MET A 1 298 ? -5.322  18.634  -4.130  1.00 143.59 ? 568 MET A O   1 
ATOM 1912 C CB  . MET A 1 298 ? -7.144  16.478  -2.319  1.00 117.97 ? 568 MET A CB  1 
ATOM 1913 N N   . ASP A 1 299 ? -7.088  17.696  -5.150  1.00 132.30 ? 569 ASP A N   1 
ATOM 1914 C CA  . ASP A 1 299 ? -6.393  17.541  -6.426  1.00 134.43 ? 569 ASP A CA  1 
ATOM 1915 C C   . ASP A 1 299 ? -7.323  17.834  -7.605  1.00 130.74 ? 569 ASP A C   1 
ATOM 1916 O O   . ASP A 1 299 ? -7.972  16.928  -8.128  1.00 126.96 ? 569 ASP A O   1 
ATOM 1917 C CB  . ASP A 1 299 ? -5.769  16.157  -6.575  1.00 144.53 ? 569 ASP A CB  1 
ATOM 1918 C CG  . ASP A 1 299 ? -4.792  16.097  -7.739  1.00 167.31 ? 569 ASP A CG  1 
ATOM 1919 O OD1 . ASP A 1 299 ? -3.570  16.010  -7.512  1.00 173.07 ? 569 ASP A OD1 1 
ATOM 1920 O OD2 . ASP A 1 299 ? -5.237  16.176  -8.894  1.00 181.00 ? 569 ASP A OD2 1 
ATOM 1921 N N   . LYS A 1 300 ? -7.385  19.095  -8.016  1.00 139.75 ? 570 LYS A N   1 
ATOM 1922 C CA  . LYS A 1 300 ? -8.232  19.501  -9.134  1.00 136.48 ? 570 LYS A CA  1 
ATOM 1923 C C   . LYS A 1 300 ? -7.605  19.174  -10.490 1.00 140.62 ? 570 LYS A C   1 
ATOM 1924 O O   . LYS A 1 300 ? -8.226  19.386  -11.531 1.00 148.99 ? 570 LYS A O   1 
ATOM 1925 C CB  . LYS A 1 300 ? -8.540  20.997  -9.054  1.00 135.19 ? 570 LYS A CB  1 
ATOM 1926 N N   . ASN A 1 301 ? -6.377  18.664  -10.480 1.00 132.79 ? 571 ASN A N   1 
ATOM 1927 C CA  . ASN A 1 301 ? -5.797  18.110  -11.699 1.00 123.43 ? 571 ASN A CA  1 
ATOM 1928 C C   . ASN A 1 301 ? -5.823  16.586  -11.658 1.00 124.79 ? 571 ASN A C   1 
ATOM 1929 O O   . ASN A 1 301 ? -4.846  15.916  -11.994 1.00 133.84 ? 571 ASN A O   1 
ATOM 1930 C CB  . ASN A 1 301 ? -4.365  18.608  -11.894 1.00 109.57 ? 571 ASN A CB  1 
ATOM 1931 N N   . SER A 1 302 ? -6.969  16.057  -11.242 1.00 131.11 ? 572 SER A N   1 
ATOM 1932 C CA  . SER A 1 302 ? -7.208  14.621  -11.184 1.00 132.57 ? 572 SER A CA  1 
ATOM 1933 C C   . SER A 1 302 ? -8.570  14.330  -11.767 1.00 128.61 ? 572 SER A C   1 
ATOM 1934 O O   . SER A 1 302 ? -9.566  14.922  -11.352 1.00 126.67 ? 572 SER A O   1 
ATOM 1935 C CB  . SER A 1 302 ? -7.142  14.080  -9.754  1.00 146.37 ? 572 SER A CB  1 
ATOM 1936 O OG  . SER A 1 302 ? -5.804  13.875  -9.342  1.00 162.66 ? 572 SER A OG  1 
ATOM 1937 N N   . PRO A 1 303 ? -8.621  13.418  -12.739 1.00 138.57 ? 573 PRO A N   1 
ATOM 1938 C CA  . PRO A 1 303 ? -9.907  13.110  -13.357 1.00 140.20 ? 573 PRO A CA  1 
ATOM 1939 C C   . PRO A 1 303 ? -10.819 12.411  -12.357 1.00 136.79 ? 573 PRO A C   1 
ATOM 1940 O O   . PRO A 1 303 ? -12.039 12.534  -12.455 1.00 146.33 ? 573 PRO A O   1 
ATOM 1941 C CB  . PRO A 1 303 ? -9.526  12.194  -14.522 1.00 137.18 ? 573 PRO A CB  1 
ATOM 1942 C CG  . PRO A 1 303 ? -8.243  11.556  -14.099 1.00 139.11 ? 573 PRO A CG  1 
ATOM 1943 C CD  . PRO A 1 303 ? -7.525  12.588  -13.272 1.00 141.65 ? 573 PRO A CD  1 
ATOM 1944 N N   . GLU A 1 304 ? -10.225 11.699  -11.402 1.00 121.94 ? 574 GLU A N   1 
ATOM 1945 C CA  . GLU A 1 304 ? -10.989 11.026  -10.358 1.00 111.74 ? 574 GLU A CA  1 
ATOM 1946 C C   . GLU A 1 304 ? -11.865 11.983  -9.538  1.00 107.22 ? 574 GLU A C   1 
ATOM 1947 O O   . GLU A 1 304 ? -13.047 11.716  -9.320  1.00 111.12 ? 574 GLU A O   1 
ATOM 1948 C CB  . GLU A 1 304 ? -10.031 10.295  -9.412  1.00 126.30 ? 574 GLU A CB  1 
ATOM 1949 C CG  . GLU A 1 304 ? -9.296  9.126   -10.051 1.00 136.64 ? 574 GLU A CG  1 
ATOM 1950 C CD  . GLU A 1 304 ? -7.957  9.549   -10.636 1.00 141.17 ? 574 GLU A CD  1 
ATOM 1951 O OE1 . GLU A 1 304 ? -7.740  10.766  -10.804 1.00 132.33 ? 574 GLU A OE1 1 
ATOM 1952 O OE2 . GLU A 1 304 ? -7.131  8.666   -10.950 1.00 145.94 ? 574 GLU A OE2 1 
ATOM 1953 N N   . ALA A 1 305 ? -11.275 13.081  -9.068  1.00 102.28 ? 575 ALA A N   1 
ATOM 1954 C CA  . ALA A 1 305 ? -12.003 14.074  -8.274  1.00 103.67 ? 575 ALA A CA  1 
ATOM 1955 C C   . ALA A 1 305 ? -13.165 14.694  -9.044  1.00 107.77 ? 575 ALA A C   1 
ATOM 1956 O O   . ALA A 1 305 ? -14.249 14.921  -8.506  1.00 114.04 ? 575 ALA A O   1 
ATOM 1957 C CB  . ALA A 1 305 ? -11.052 15.163  -7.800  1.00 118.09 ? 575 ALA A CB  1 
ATOM 1958 N N   . TRP A 1 306 ? -12.905 14.954  -10.320 1.00 114.29 ? 576 TRP A N   1 
ATOM 1959 C CA  . TRP A 1 306 ? -13.855 15.565  -11.243 1.00 118.22 ? 576 TRP A CA  1 
ATOM 1960 C C   . TRP A 1 306 ? -14.896 14.585  -11.755 1.00 120.98 ? 576 TRP A C   1 
ATOM 1961 O O   . TRP A 1 306 ? -16.005 14.977  -12.120 1.00 125.79 ? 576 TRP A O   1 
ATOM 1962 C CB  . TRP A 1 306 ? -13.093 16.213  -12.397 1.00 117.65 ? 576 TRP A CB  1 
ATOM 1963 C CG  . TRP A 1 306 ? -12.345 17.439  -11.962 1.00 137.97 ? 576 TRP A CG  1 
ATOM 1964 C CD1 . TRP A 1 306 ? -10.993 17.592  -11.871 1.00 144.12 ? 576 TRP A CD1 1 
ATOM 1965 C CD2 . TRP A 1 306 ? -12.916 18.711  -11.627 1.00 149.91 ? 576 TRP A CD2 1 
ATOM 1966 N NE1 . TRP A 1 306 ? -10.688 18.868  -11.458 1.00 149.60 ? 576 TRP A NE1 1 
ATOM 1967 C CE2 . TRP A 1 306 ? -11.851 19.576  -11.309 1.00 155.12 ? 576 TRP A CE2 1 
ATOM 1968 C CE3 . TRP A 1 306 ? -14.224 19.197  -11.553 1.00 149.68 ? 576 TRP A CE3 1 
ATOM 1969 C CZ2 . TRP A 1 306 ? -12.055 20.900  -10.922 1.00 161.56 ? 576 TRP A CZ2 1 
ATOM 1970 C CZ3 . TRP A 1 306 ? -14.423 20.511  -11.168 1.00 157.64 ? 576 TRP A CZ3 1 
ATOM 1971 C CH2 . TRP A 1 306 ? -13.345 21.347  -10.859 1.00 165.41 ? 576 TRP A CH2 1 
ATOM 1972 N N   . CYS A 1 307 ? -14.532 13.310  -11.786 1.00 121.41 ? 577 CYS A N   1 
ATOM 1973 C CA  . CYS A 1 307 ? -15.498 12.280  -12.112 1.00 116.95 ? 577 CYS A CA  1 
ATOM 1974 C C   . CYS A 1 307 ? -16.475 12.236  -10.954 1.00 120.30 ? 577 CYS A C   1 
ATOM 1975 O O   . CYS A 1 307 ? -17.682 12.214  -11.159 1.00 126.50 ? 577 CYS A O   1 
ATOM 1976 C CB  . CYS A 1 307 ? -14.826 10.921  -12.319 1.00 115.13 ? 577 CYS A CB  1 
ATOM 1977 S SG  . CYS A 1 307 ? -14.047 10.708  -13.935 1.00 181.96 ? 577 CYS A SG  1 
ATOM 1978 N N   . ALA A 1 308 ? -15.930 12.270  -9.740  1.00 120.06 ? 578 ALA A N   1 
ATOM 1979 C CA  . ALA A 1 308 ? -16.712 12.292  -8.506  1.00 115.66 ? 578 ALA A CA  1 
ATOM 1980 C C   . ALA A 1 308 ? -17.639 13.501  -8.397  1.00 121.45 ? 578 ALA A C   1 
ATOM 1981 O O   . ALA A 1 308 ? -18.835 13.357  -8.146  1.00 123.75 ? 578 ALA A O   1 
ATOM 1982 C CB  . ALA A 1 308 ? -15.782 12.247  -7.305  1.00 107.83 ? 578 ALA A CB  1 
ATOM 1983 N N   . ALA A 1 309 ? -17.076 14.694  -8.564  1.00 140.40 ? 579 ALA A N   1 
ATOM 1984 C CA  . ALA A 1 309 ? -17.869 15.919  -8.580  1.00 151.06 ? 579 ALA A CA  1 
ATOM 1985 C C   . ALA A 1 309 ? -18.989 15.827  -9.613  1.00 138.98 ? 579 ALA A C   1 
ATOM 1986 O O   . ALA A 1 309 ? -20.102 16.294  -9.381  1.00 145.75 ? 579 ALA A O   1 
ATOM 1987 C CB  . ALA A 1 309 ? -16.981 17.119  -8.854  1.00 167.41 ? 579 ALA A CB  1 
ATOM 1988 N N   . GLY A 1 310 ? -18.669 15.242  -10.762 1.00 132.11 ? 580 GLY A N   1 
ATOM 1989 C CA  . GLY A 1 310 ? -19.623 15.070  -11.842 1.00 138.51 ? 580 GLY A CA  1 
ATOM 1990 C C   . GLY A 1 310 ? -20.906 14.312  -11.509 1.00 140.50 ? 580 GLY A C   1 
ATOM 1991 O O   . GLY A 1 310 ? -21.999 14.860  -11.649 1.00 152.14 ? 580 GLY A O   1 
ATOM 1992 N N   . ASN A 1 311 ? -20.769 13.072  -11.044 1.00 132.21 ? 581 ASN A N   1 
ATOM 1993 C CA  . ASN A 1 311 ? -21.905 12.211  -10.719 1.00 134.48 ? 581 ASN A CA  1 
ATOM 1994 C C   . ASN A 1 311 ? -22.504 12.454  -9.331  1.00 138.47 ? 581 ASN A C   1 
ATOM 1995 O O   . ASN A 1 311 ? -23.492 11.846  -8.954  1.00 144.50 ? 581 ASN A O   1 
ATOM 1996 C CB  . ASN A 1 311 ? -21.498 10.731  -10.793 1.00 131.90 ? 581 ASN A CB  1 
ATOM 1997 C CG  . ASN A 1 311 ? -20.216 10.444  -10.044 1.00 140.26 ? 581 ASN A CG  1 
ATOM 1998 O OD1 . ASN A 1 311 ? -19.515 11.364  -9.639  1.00 157.11 ? 581 ASN A OD1 1 
ATOM 1999 N ND2 . ASN A 1 311 ? -19.910 9.176   -9.846  1.00 136.27 ? 581 ASN A ND2 1 
ATOM 2000 N N   . CYS A 1 312 ? -21.915 13.403  -8.617  1.00 147.25 ? 582 CYS A N   1 
ATOM 2001 C CA  . CYS A 1 312 ? -22.546 13.983  -7.445  1.00 161.95 ? 582 CYS A CA  1 
ATOM 2002 C C   . CYS A 1 312 ? -23.789 14.806  -7.894  1.00 157.28 ? 582 CYS A C   1 
ATOM 2003 O O   . CYS A 1 312 ? -24.771 14.840  -7.189  1.00 161.03 ? 582 CYS A O   1 
ATOM 2004 C CB  . CYS A 1 312 ? -21.622 14.837  -6.624  1.00 165.05 ? 582 CYS A CB  1 
ATOM 2005 S SG  . CYS A 1 312 ? -22.448 15.536  -5.165  1.00 170.98 ? 582 CYS A SG  1 
ATOM 2006 N N   . PHE A 1 313 ? -23.742 15.426  -9.073  1.00 153.28 ? 583 PHE A N   1 
ATOM 2007 C CA  . PHE A 1 313 ? -24.815 16.254  -9.596  1.00 159.69 ? 583 PHE A CA  1 
ATOM 2008 C C   . PHE A 1 313 ? -25.756 15.498  -10.536 1.00 162.30 ? 583 PHE A C   1 
ATOM 2009 O O   . PHE A 1 313 ? -26.598 16.076  -11.176 1.00 169.07 ? 583 PHE A O   1 
ATOM 2010 C CB  . PHE A 1 313 ? -24.352 17.403  -10.505 1.00 174.85 ? 583 PHE A CB  1 
ATOM 2011 C CG  . PHE A 1 313 ? -23.840 18.592  -9.826  1.00 180.26 ? 583 PHE A CG  1 
ATOM 2012 C CD1 . PHE A 1 313 ? -24.589 19.768  -9.693  1.00 184.82 ? 583 PHE A CD1 1 
ATOM 2013 C CD2 . PHE A 1 313 ? -22.517 18.608  -9.475  1.00 174.23 ? 583 PHE A CD2 1 
ATOM 2014 C CE1 . PHE A 1 313 ? -24.012 20.895  -9.184  1.00 186.02 ? 583 PHE A CE1 1 
ATOM 2015 C CE2 . PHE A 1 313 ? -21.926 19.736  -8.936  1.00 178.60 ? 583 PHE A CE2 1 
ATOM 2016 C CZ  . PHE A 1 313 ? -22.678 20.901  -8.785  1.00 186.48 ? 583 PHE A CZ  1 
ATOM 2017 N N   . SER A 1 314 ? -25.457 14.233  -10.721 1.00 152.32 ? 584 SER A N   1 
ATOM 2018 C CA  . SER A 1 314 ? -26.272 13.268  -11.454 1.00 153.31 ? 584 SER A CA  1 
ATOM 2019 C C   . SER A 1 314 ? -27.199 12.642  -10.403 1.00 159.42 ? 584 SER A C   1 
ATOM 2020 O O   . SER A 1 314 ? -28.325 12.285  -10.707 1.00 162.70 ? 584 SER A O   1 
ATOM 2021 C CB  . SER A 1 314 ? -25.388 12.233  -12.180 1.00 146.73 ? 584 SER A CB  1 
ATOM 2022 O OG  . SER A 1 314 ? -25.124 11.132  -11.374 1.00 156.76 ? 584 SER A OG  1 
ATOM 2023 N N   . LEU A 1 315 ? -26.632 12.448  -9.214  1.00 164.35 ? 585 LEU A N   1 
ATOM 2024 C CA  . LEU A 1 315 ? -27.338 12.067  -8.024  1.00 167.86 ? 585 LEU A CA  1 
ATOM 2025 C C   . LEU A 1 315 ? -28.485 13.115  -7.857  1.00 172.81 ? 585 LEU A C   1 
ATOM 2026 O O   . LEU A 1 315 ? -29.663 12.763  -7.904  1.00 175.53 ? 585 LEU A O   1 
ATOM 2027 C CB  . LEU A 1 315 ? -26.416 12.046  -6.796  1.00 177.98 ? 585 LEU A CB  1 
ATOM 2028 N N   . GLN A 1 316 ? -28.154 14.373  -7.603  1.00 182.44 ? 586 GLN A N   1 
ATOM 2029 C CA  . GLN A 1 316 ? -29.144 15.453  -7.783  1.00 191.02 ? 586 GLN A CA  1 
ATOM 2030 C C   . GLN A 1 316 ? -29.785 15.663  -9.204  1.00 196.26 ? 586 GLN A C   1 
ATOM 2031 O O   . GLN A 1 316 ? -30.704 16.474  -9.370  1.00 195.61 ? 586 GLN A O   1 
ATOM 2032 C CB  . GLN A 1 316 ? -28.510 16.773  -7.351  1.00 183.79 ? 586 GLN A CB  1 
ATOM 2033 N N   . ARG A 1 317 ? -29.316 14.878  -10.178 1.00 200.28 ? 587 ARG A N   1 
ATOM 2034 C CA  . ARG A 1 317 ? -30.001 14.702  -11.470 1.00 213.03 ? 587 ARG A CA  1 
ATOM 2035 C C   . ARG A 1 317 ? -30.155 15.944  -12.316 1.00 217.41 ? 587 ARG A C   1 
ATOM 2036 O O   . ARG A 1 317 ? -31.093 16.083  -13.130 1.00 217.53 ? 587 ARG A O   1 
ATOM 2037 C CB  . ARG A 1 317 ? -31.395 14.152  -11.234 1.00 210.06 ? 587 ARG A CB  1 
ATOM 2038 N N   . GLU A 1 318 ? -29.130 16.756  -12.271 1.00 210.11 ? 588 GLU A N   1 
ATOM 2039 C CA  . GLU A 1 318 ? -29.135 17.949  -13.068 1.00 193.84 ? 588 GLU A CA  1 
ATOM 2040 C C   . GLU A 1 318 ? -27.998 17.618  -13.969 1.00 176.45 ? 588 GLU A C   1 
ATOM 2041 O O   . GLU A 1 318 ? -26.928 17.100  -13.567 1.00 174.94 ? 588 GLU A O   1 
ATOM 2042 C CB  . GLU A 1 318 ? -28.956 19.215  -12.269 1.00 184.28 ? 588 GLU A CB  1 
ATOM 2043 N N   . HIS A 1 319 ? -28.241 17.827  -15.229 1.00 162.90 ? 589 HIS A N   1 
ATOM 2044 C CA  . HIS A 1 319 ? -27.379 17.274  -16.226 1.00 160.39 ? 589 HIS A CA  1 
ATOM 2045 C C   . HIS A 1 319 ? -26.443 18.244  -16.874 1.00 167.67 ? 589 HIS A C   1 
ATOM 2046 O O   . HIS A 1 319 ? -25.399 17.837  -17.373 1.00 179.02 ? 589 HIS A O   1 
ATOM 2047 C CB  . HIS A 1 319 ? -28.271 16.623  -17.289 1.00 163.28 ? 589 HIS A CB  1 
ATOM 2048 N N   . ASP A 1 320 ? -26.826 19.512  -16.868 1.00 163.88 ? 590 ASP A N   1 
ATOM 2049 C CA  . ASP A 1 320 ? -25.953 20.572  -17.347 1.00 163.77 ? 590 ASP A CA  1 
ATOM 2050 C C   . ASP A 1 320 ? -24.634 20.649  -16.580 1.00 160.50 ? 590 ASP A C   1 
ATOM 2051 O O   . ASP A 1 320 ? -23.572 20.804  -17.175 1.00 162.33 ? 590 ASP A O   1 
ATOM 2052 C CB  . ASP A 1 320 ? -26.677 21.918  -17.279 1.00 165.61 ? 590 ASP A CB  1 
ATOM 2053 C CG  . ASP A 1 320 ? -27.767 22.045  -18.329 1.00 167.12 ? 590 ASP A CG  1 
ATOM 2054 O OD1 . ASP A 1 320 ? -27.593 21.502  -19.441 1.00 173.50 ? 590 ASP A OD1 1 
ATOM 2055 O OD2 . ASP A 1 320 ? -28.780 22.721  -18.053 1.00 162.87 ? 590 ASP A OD2 1 
ATOM 2056 N N   . ILE A 1 321 ? -24.714 20.536  -15.255 1.00 159.91 ? 591 ILE A N   1 
ATOM 2057 C CA  . ILE A 1 321 ? -23.558 20.772  -14.387 1.00 154.82 ? 591 ILE A CA  1 
ATOM 2058 C C   . ILE A 1 321 ? -22.568 19.611  -14.372 1.00 153.38 ? 591 ILE A C   1 
ATOM 2059 O O   . ILE A 1 321 ? -21.350 19.804  -14.370 1.00 159.97 ? 591 ILE A O   1 
ATOM 2060 C CB  . ILE A 1 321 ? -23.993 21.044  -12.933 1.00 153.49 ? 591 ILE A CB  1 
ATOM 2061 N N   . ALA A 1 322 ? -23.121 18.405  -14.388 1.00 141.25 ? 592 ALA A N   1 
ATOM 2062 C CA  . ALA A 1 322 ? -22.356 17.167  -14.433 1.00 137.33 ? 592 ALA A CA  1 
ATOM 2063 C C   . ALA A 1 322 ? -21.531 17.032  -15.707 1.00 137.14 ? 592 ALA A C   1 
ATOM 2064 O O   . ALA A 1 322 ? -20.385 16.585  -15.665 1.00 133.67 ? 592 ALA A O   1 
ATOM 2065 C CB  . ALA A 1 322 ? -23.292 15.984  -14.290 1.00 137.41 ? 592 ALA A CB  1 
ATOM 2066 N N   . ILE A 1 323 ? -22.126 17.402  -16.835 1.00 137.37 ? 593 ILE A N   1 
ATOM 2067 C CA  . ILE A 1 323 ? -21.438 17.389  -18.123 1.00 134.96 ? 593 ILE A CA  1 
ATOM 2068 C C   . ILE A 1 323 ? -20.137 18.188  -18.061 1.00 137.89 ? 593 ILE A C   1 
ATOM 2069 O O   . ILE A 1 323 ? -19.086 17.713  -18.493 1.00 150.69 ? 593 ILE A O   1 
ATOM 2070 C CB  . ILE A 1 323 ? -22.326 17.953  -19.247 1.00 130.24 ? 593 ILE A CB  1 
ATOM 2071 N N   . LYS A 1 324 ? -20.223 19.402  -17.531 1.00 137.11 ? 594 LYS A N   1 
ATOM 2072 C CA  . LYS A 1 324 ? -19.066 20.279  -17.385 1.00 130.89 ? 594 LYS A CA  1 
ATOM 2073 C C   . LYS A 1 324 ? -17.913 19.672  -16.577 1.00 133.92 ? 594 LYS A C   1 
ATOM 2074 O O   . LYS A 1 324 ? -16.755 19.796  -16.960 1.00 139.25 ? 594 LYS A O   1 
ATOM 2075 C CB  . LYS A 1 324 ? -19.497 21.596  -16.733 1.00 126.74 ? 594 LYS A CB  1 
ATOM 2076 N N   . PHE A 1 325 ? -18.216 19.066  -15.436 1.00 136.27 ? 595 PHE A N   1 
ATOM 2077 C CA  . PHE A 1 325 ? -17.186 18.386  -14.641 1.00 132.44 ? 595 PHE A CA  1 
ATOM 2078 C C   . PHE A 1 325 ? -16.520 17.205  -15.324 1.00 130.95 ? 595 PHE A C   1 
ATOM 2079 O O   . PHE A 1 325 ? -15.301 17.049  -15.251 1.00 135.89 ? 595 PHE A O   1 
ATOM 2080 C CB  . PHE A 1 325 ? -17.734 17.966  -13.297 1.00 134.80 ? 595 PHE A CB  1 
ATOM 2081 C CG  . PHE A 1 325 ? -18.050 19.123  -12.435 1.00 141.76 ? 595 PHE A CG  1 
ATOM 2082 C CD1 . PHE A 1 325 ? -17.383 20.319  -12.635 1.00 152.52 ? 595 PHE A CD1 1 
ATOM 2083 C CD2 . PHE A 1 325 ? -18.948 19.021  -11.395 1.00 140.10 ? 595 PHE A CD2 1 
ATOM 2084 C CE1 . PHE A 1 325 ? -17.646 21.412  -11.856 1.00 148.56 ? 595 PHE A CE1 1 
ATOM 2085 C CE2 . PHE A 1 325 ? -19.203 20.113  -10.597 1.00 142.16 ? 595 PHE A CE2 1 
ATOM 2086 C CZ  . PHE A 1 325 ? -18.557 21.313  -10.826 1.00 139.02 ? 595 PHE A CZ  1 
ATOM 2087 N N   . PHE A 1 326 ? -17.328 16.358  -15.948 1.00 121.07 ? 596 PHE A N   1 
ATOM 2088 C CA  . PHE A 1 326 ? -16.837 15.168  -16.629 1.00 116.27 ? 596 PHE A CA  1 
ATOM 2089 C C   . PHE A 1 326 ? -15.875 15.651  -17.687 1.00 117.78 ? 596 PHE A C   1 
ATOM 2090 O O   . PHE A 1 326 ? -14.895 14.985  -18.022 1.00 114.53 ? 596 PHE A O   1 
ATOM 2091 C CB  . PHE A 1 326 ? -17.967 14.346  -17.242 1.00 117.17 ? 596 PHE A CB  1 
ATOM 2092 C CG  . PHE A 1 326 ? -18.686 13.483  -16.251 1.00 117.05 ? 596 PHE A CG  1 
ATOM 2093 C CD1 . PHE A 1 326 ? -17.972 12.623  -15.435 1.00 124.66 ? 596 PHE A CD1 1 
ATOM 2094 C CD2 . PHE A 1 326 ? -20.064 13.518  -16.138 1.00 119.54 ? 596 PHE A CD2 1 
ATOM 2095 C CE1 . PHE A 1 326 ? -18.614 11.818  -14.522 1.00 126.96 ? 596 PHE A CE1 1 
ATOM 2096 C CE2 . PHE A 1 326 ? -20.716 12.714  -15.222 1.00 120.44 ? 596 PHE A CE2 1 
ATOM 2097 C CZ  . PHE A 1 326 ? -19.988 11.861  -14.413 1.00 122.50 ? 596 PHE A CZ  1 
ATOM 2098 N N   . GLN A 1 327 ? -16.183 16.825  -18.214 1.00 123.15 ? 597 GLN A N   1 
ATOM 2099 C CA  . GLN A 1 327 ? -15.325 17.471  -19.171 1.00 122.33 ? 597 GLN A CA  1 
ATOM 2100 C C   . GLN A 1 327 ? -13.949 17.818  -18.628 1.00 133.58 ? 597 GLN A C   1 
ATOM 2101 O O   . GLN A 1 327 ? -12.940 17.595  -19.301 1.00 139.48 ? 597 GLN A O   1 
ATOM 2102 C CB  . GLN A 1 327 ? -15.990 18.761  -19.625 1.00 113.48 ? 597 GLN A CB  1 
ATOM 2103 N N   . ARG A 1 328 ? -13.906 18.370  -17.421 1.00 136.78 ? 598 ARG A N   1 
ATOM 2104 C CA  . ARG A 1 328 ? -12.633 18.680  -16.787 1.00 130.34 ? 598 ARG A CA  1 
ATOM 2105 C C   . ARG A 1 328 ? -11.776 17.430  -16.619 1.00 114.59 ? 598 ARG A C   1 
ATOM 2106 O O   . ARG A 1 328 ? -10.557 17.478  -16.762 1.00 116.11 ? 598 ARG A O   1 
ATOM 2107 C CB  . ARG A 1 328 ? -12.863 19.346  -15.430 1.00 124.73 ? 598 ARG A CB  1 
ATOM 2108 N N   . ALA A 1 329 ? -12.429 16.305  -16.344 1.00 110.10 ? 599 ALA A N   1 
ATOM 2109 C CA  . ALA A 1 329 ? -11.741 15.024  -16.249 1.00 119.93 ? 599 ALA A CA  1 
ATOM 2110 C C   . ALA A 1 329 ? -11.115 14.633  -17.580 1.00 130.01 ? 599 ALA A C   1 
ATOM 2111 O O   . ALA A 1 329 ? -10.051 14.014  -17.621 1.00 134.97 ? 599 ALA A O   1 
ATOM 2112 C CB  . ALA A 1 329 ? -12.700 13.943  -15.775 1.00 114.12 ? 599 ALA A CB  1 
ATOM 2113 N N   . ILE A 1 330 ? -11.784 15.000  -18.667 1.00 124.07 ? 600 ILE A N   1 
ATOM 2114 C CA  . ILE A 1 330 ? -11.263 14.737  -19.999 1.00 124.86 ? 600 ILE A CA  1 
ATOM 2115 C C   . ILE A 1 330 ? -10.123 15.680  -20.363 1.00 129.94 ? 600 ILE A C   1 
ATOM 2116 O O   . ILE A 1 330 ? -9.138  15.265  -20.976 1.00 141.98 ? 600 ILE A O   1 
ATOM 2117 C CB  . ILE A 1 330 ? -12.389 14.847  -21.051 1.00 131.37 ? 600 ILE A CB  1 
ATOM 2118 C CG1 . ILE A 1 330 ? -13.456 13.783  -20.773 1.00 123.70 ? 600 ILE A CG1 1 
ATOM 2119 C CG2 . ILE A 1 330 ? -11.837 14.694  -22.460 1.00 150.30 ? 600 ILE A CG2 1 
ATOM 2120 C CD1 . ILE A 1 330 ? -14.832 14.094  -21.310 1.00 132.27 ? 600 ILE A CD1 1 
ATOM 2121 N N   . GLN A 1 331 ? -10.242 16.944  -19.967 1.00 125.02 ? 601 GLN A N   1 
ATOM 2122 C CA  . GLN A 1 331 ? -9.188  17.908  -20.251 1.00 132.00 ? 601 GLN A CA  1 
ATOM 2123 C C   . GLN A 1 331 ? -7.901  17.608  -19.485 1.00 134.74 ? 601 GLN A C   1 
ATOM 2124 O O   . GLN A 1 331 ? -6.811  17.643  -20.055 1.00 146.13 ? 601 GLN A O   1 
ATOM 2125 C CB  . GLN A 1 331 ? -9.666  19.325  -19.926 1.00 125.60 ? 601 GLN A CB  1 
ATOM 2126 N N   . VAL A 1 332 ? -8.031  17.316  -18.193 1.00 120.39 ? 602 VAL A N   1 
ATOM 2127 C CA  . VAL A 1 332 ? -6.867  17.001  -17.368 1.00 127.51 ? 602 VAL A CA  1 
ATOM 2128 C C   . VAL A 1 332 ? -6.245  15.635  -17.660 1.00 141.02 ? 602 VAL A C   1 
ATOM 2129 O O   . VAL A 1 332 ? -5.095  15.391  -17.293 1.00 158.27 ? 602 VAL A O   1 
ATOM 2130 C CB  . VAL A 1 332 ? -7.203  17.086  -15.861 1.00 124.36 ? 602 VAL A CB  1 
ATOM 2131 C CG1 . VAL A 1 332 ? -7.864  18.420  -15.531 1.00 122.02 ? 602 VAL A CG1 1 
ATOM 2132 C CG2 . VAL A 1 332 ? -8.059  15.905  -15.425 1.00 124.67 ? 602 VAL A CG2 1 
ATOM 2133 N N   . ASP A 1 333 ? -6.989  14.752  -18.324 1.00 131.54 ? 603 ASP A N   1 
ATOM 2134 C CA  . ASP A 1 333 ? -6.413  13.495  -18.792 1.00 124.49 ? 603 ASP A CA  1 
ATOM 2135 C C   . ASP A 1 333 ? -7.281  12.877  -19.886 1.00 120.99 ? 603 ASP A C   1 
ATOM 2136 O O   . ASP A 1 333 ? -8.262  12.193  -19.594 1.00 115.66 ? 603 ASP A O   1 
ATOM 2137 C CB  . ASP A 1 333 ? -6.262  12.521  -17.610 1.00 117.85 ? 603 ASP A CB  1 
ATOM 2138 C CG  . ASP A 1 333 ? -5.629  11.187  -18.000 1.00 117.85 ? 603 ASP A CG  1 
ATOM 2139 O OD1 . ASP A 1 333 ? -5.412  10.922  -19.201 1.00 127.12 ? 603 ASP A OD1 1 
ATOM 2140 O OD2 . ASP A 1 333 ? -5.348  10.388  -17.081 1.00 113.31 ? 603 ASP A OD2 1 
ATOM 2141 N N   . PRO A 1 334 ? -6.922  13.127  -21.155 1.00 133.36 ? 604 PRO A N   1 
ATOM 2142 C CA  . PRO A 1 334 ? -7.685  12.616  -22.298 1.00 136.93 ? 604 PRO A CA  1 
ATOM 2143 C C   . PRO A 1 334 ? -7.372  11.158  -22.637 1.00 130.60 ? 604 PRO A C   1 
ATOM 2144 O O   . PRO A 1 334 ? -7.977  10.606  -23.556 1.00 132.95 ? 604 PRO A O   1 
ATOM 2145 C CB  . PRO A 1 334 ? -7.256  13.539  -23.438 1.00 153.59 ? 604 PRO A CB  1 
ATOM 2146 C CG  . PRO A 1 334 ? -5.871  13.956  -23.079 1.00 155.32 ? 604 PRO A CG  1 
ATOM 2147 C CD  . PRO A 1 334 ? -5.758  13.926  -21.575 1.00 144.55 ? 604 PRO A CD  1 
ATOM 2148 N N   . ASN A 1 335 ? -6.446  10.544  -21.909 1.00 131.60 ? 605 ASN A N   1 
ATOM 2149 C CA  . ASN A 1 335 ? -6.184  9.119   -22.069 1.00 136.79 ? 605 ASN A CA  1 
ATOM 2150 C C   . ASN A 1 335 ? -6.805  8.347   -20.923 1.00 141.80 ? 605 ASN A C   1 
ATOM 2151 O O   . ASN A 1 335 ? -6.379  7.240   -20.591 1.00 141.36 ? 605 ASN A O   1 
ATOM 2152 C CB  . ASN A 1 335 ? -4.681  8.846   -22.144 1.00 137.37 ? 605 ASN A CB  1 
ATOM 2153 N N   . TYR A 1 336 ? -7.817  8.953   -20.318 1.00 147.95 ? 606 TYR A N   1 
ATOM 2154 C CA  . TYR A 1 336 ? -8.510  8.349   -19.199 1.00 148.11 ? 606 TYR A CA  1 
ATOM 2155 C C   . TYR A 1 336 ? -9.905  7.939   -19.657 1.00 138.49 ? 606 TYR A C   1 
ATOM 2156 O O   . TYR A 1 336 ? -10.816 8.764   -19.723 1.00 136.62 ? 606 TYR A O   1 
ATOM 2157 C CB  . TYR A 1 336 ? -8.548  9.351   -18.047 1.00 156.12 ? 606 TYR A CB  1 
ATOM 2158 C CG  . TYR A 1 336 ? -9.304  8.935   -16.818 1.00 152.74 ? 606 TYR A CG  1 
ATOM 2159 C CD1 . TYR A 1 336 ? -8.771  8.016   -15.925 1.00 142.64 ? 606 TYR A CD1 1 
ATOM 2160 C CD2 . TYR A 1 336 ? -10.532 9.498   -16.524 1.00 153.78 ? 606 TYR A CD2 1 
ATOM 2161 C CE1 . TYR A 1 336 ? -9.460  7.654   -14.788 1.00 139.84 ? 606 TYR A CE1 1 
ATOM 2162 C CE2 . TYR A 1 336 ? -11.226 9.145   -15.397 1.00 151.49 ? 606 TYR A CE2 1 
ATOM 2163 C CZ  . TYR A 1 336 ? -10.688 8.225   -14.532 1.00 143.49 ? 606 TYR A CZ  1 
ATOM 2164 O OH  . TYR A 1 336 ? -11.391 7.881   -13.408 1.00 142.35 ? 606 TYR A OH  1 
ATOM 2165 N N   . ALA A 1 337 ? -10.053 6.656   -19.975 1.00 131.71 ? 607 ALA A N   1 
ATOM 2166 C CA  . ALA A 1 337 ? -11.249 6.153   -20.643 1.00 130.93 ? 607 ALA A CA  1 
ATOM 2167 C C   . ALA A 1 337 ? -12.544 6.417   -19.882 1.00 120.58 ? 607 ALA A C   1 
ATOM 2168 O O   . ALA A 1 337 ? -13.512 6.926   -20.444 1.00 120.69 ? 607 ALA A O   1 
ATOM 2169 C CB  . ALA A 1 337 ? -11.101 4.659   -20.905 1.00 144.65 ? 607 ALA A CB  1 
ATOM 2170 N N   . TYR A 1 338 ? -12.545 6.044   -18.606 1.00 125.97 ? 608 TYR A N   1 
ATOM 2171 C CA  . TYR A 1 338 ? -13.759 6.014   -17.791 1.00 132.72 ? 608 TYR A CA  1 
ATOM 2172 C C   . TYR A 1 338 ? -14.535 7.337   -17.801 1.00 132.22 ? 608 TYR A C   1 
ATOM 2173 O O   . TYR A 1 338 ? -15.765 7.337   -17.795 1.00 132.41 ? 608 TYR A O   1 
ATOM 2174 C CB  . TYR A 1 338 ? -13.424 5.604   -16.356 1.00 128.40 ? 608 TYR A CB  1 
ATOM 2175 C CG  . TYR A 1 338 ? -14.648 5.310   -15.518 1.00 121.28 ? 608 TYR A CG  1 
ATOM 2176 C CD1 . TYR A 1 338 ? -15.735 4.642   -16.069 1.00 124.48 ? 608 TYR A CD1 1 
ATOM 2177 C CD2 . TYR A 1 338 ? -14.702 5.650   -14.173 1.00 114.62 ? 608 TYR A CD2 1 
ATOM 2178 C CE1 . TYR A 1 338 ? -16.855 4.353   -15.318 1.00 124.93 ? 608 TYR A CE1 1 
ATOM 2179 C CE2 . TYR A 1 338 ? -15.819 5.356   -13.408 1.00 123.01 ? 608 TYR A CE2 1 
ATOM 2180 C CZ  . TYR A 1 338 ? -16.893 4.711   -13.989 1.00 132.53 ? 608 TYR A CZ  1 
ATOM 2181 O OH  . TYR A 1 338 ? -18.008 4.418   -13.238 1.00 147.67 ? 608 TYR A OH  1 
ATOM 2182 N N   . ALA A 1 339 ? -13.814 8.457   -17.792 1.00 124.03 ? 609 ALA A N   1 
ATOM 2183 C CA  . ALA A 1 339 ? -14.450 9.774   -17.761 1.00 121.09 ? 609 ALA A CA  1 
ATOM 2184 C C   . ALA A 1 339 ? -15.326 9.999   -18.985 1.00 125.17 ? 609 ALA A C   1 
ATOM 2185 O O   . ALA A 1 339 ? -16.409 10.575  -18.887 1.00 125.65 ? 609 ALA A O   1 
ATOM 2186 C CB  . ALA A 1 339 ? -13.405 10.869  -17.662 1.00 120.92 ? 609 ALA A CB  1 
ATOM 2187 N N   . TYR A 1 340 ? -14.839 9.558   -20.139 1.00 128.61 ? 610 TYR A N   1 
ATOM 2188 C CA  . TYR A 1 340 ? -15.611 9.613   -21.373 1.00 132.31 ? 610 TYR A CA  1 
ATOM 2189 C C   . TYR A 1 340 ? -16.899 8.818   -21.179 1.00 133.21 ? 610 TYR A C   1 
ATOM 2190 O O   . TYR A 1 340 ? -17.996 9.300   -21.459 1.00 134.85 ? 610 TYR A O   1 
ATOM 2191 C CB  . TYR A 1 340 ? -14.800 9.064   -22.554 1.00 143.19 ? 610 TYR A CB  1 
ATOM 2192 C CG  . TYR A 1 340 ? -13.601 9.903   -22.974 1.00 144.83 ? 610 TYR A CG  1 
ATOM 2193 C CD1 . TYR A 1 340 ? -12.773 10.511  -22.039 1.00 156.27 ? 610 TYR A CD1 1 
ATOM 2194 C CD2 . TYR A 1 340 ? -13.288 10.062  -24.314 1.00 137.00 ? 610 TYR A CD2 1 
ATOM 2195 C CE1 . TYR A 1 340 ? -11.682 11.266  -22.431 1.00 153.85 ? 610 TYR A CE1 1 
ATOM 2196 C CE2 . TYR A 1 340 ? -12.200 10.812  -24.716 1.00 143.09 ? 610 TYR A CE2 1 
ATOM 2197 C CZ  . TYR A 1 340 ? -11.401 11.414  -23.772 1.00 149.54 ? 610 TYR A CZ  1 
ATOM 2198 O OH  . TYR A 1 340 ? -10.317 12.160  -24.173 1.00 152.53 ? 610 TYR A OH  1 
ATOM 2199 N N   . THR A 1 341 ? -16.733 7.589   -20.701 1.00 127.57 ? 611 THR A N   1 
ATOM 2200 C CA  . THR A 1 341 ? -17.826 6.651   -20.459 1.00 124.11 ? 611 THR A CA  1 
ATOM 2201 C C   . THR A 1 341 ? -18.966 7.210   -19.604 1.00 121.35 ? 611 THR A C   1 
ATOM 2202 O O   . THR A 1 341 ? -20.131 7.172   -19.999 1.00 124.45 ? 611 THR A O   1 
ATOM 2203 C CB  . THR A 1 341 ? -17.303 5.372   -19.779 1.00 121.63 ? 611 THR A CB  1 
ATOM 2204 O OG1 . THR A 1 341 ? -16.410 4.685   -20.665 1.00 126.42 ? 611 THR A OG1 1 
ATOM 2205 C CG2 . THR A 1 341 ? -18.453 4.456   -19.412 1.00 122.28 ? 611 THR A CG2 1 
ATOM 2206 N N   . LEU A 1 342 ? -18.614 7.728   -18.431 1.00 121.54 ? 612 LEU A N   1 
ATOM 2207 C CA  . LEU A 1 342 ? -19.580 8.316   -17.504 1.00 126.60 ? 612 LEU A CA  1 
ATOM 2208 C C   . LEU A 1 342 ? -20.382 9.484   -18.065 1.00 137.44 ? 612 LEU A C   1 
ATOM 2209 O O   . LEU A 1 342 ? -21.520 9.713   -17.657 1.00 147.83 ? 612 LEU A O   1 
ATOM 2210 C CB  . LEU A 1 342 ? -18.874 8.791   -16.235 1.00 116.03 ? 612 LEU A CB  1 
ATOM 2211 C CG  . LEU A 1 342 ? -18.404 7.769   -15.205 1.00 113.93 ? 612 LEU A CG  1 
ATOM 2212 C CD1 . LEU A 1 342 ? -17.123 8.271   -14.567 1.00 111.10 ? 612 LEU A CD1 1 
ATOM 2213 C CD2 . LEU A 1 342 ? -19.477 7.521   -14.157 1.00 117.40 ? 612 LEU A CD2 1 
ATOM 2214 N N   . LEU A 1 343 ? -19.793 10.219  -19.000 1.00 133.84 ? 613 LEU A N   1 
ATOM 2215 C CA  . LEU A 1 343 ? -20.530 11.249  -19.721 1.00 126.30 ? 613 LEU A CA  1 
ATOM 2216 C C   . LEU A 1 343 ? -21.610 10.662  -20.617 1.00 131.15 ? 613 LEU A C   1 
ATOM 2217 O O   . LEU A 1 343 ? -22.756 11.111  -20.580 1.00 133.85 ? 613 LEU A O   1 
ATOM 2218 C CB  . LEU A 1 343 ? -19.572 12.102  -20.554 1.00 125.82 ? 613 LEU A CB  1 
ATOM 2219 N N   . GLY A 1 344 ? -21.237 9.677   -21.429 1.00 138.66 ? 614 GLY A N   1 
ATOM 2220 C CA  . GLY A 1 344 ? -22.181 8.981   -22.286 1.00 150.13 ? 614 GLY A CA  1 
ATOM 2221 C C   . GLY A 1 344 ? -23.470 8.588   -21.590 1.00 151.87 ? 614 GLY A C   1 
ATOM 2222 O O   . GLY A 1 344 ? -24.557 8.934   -22.050 1.00 165.14 ? 614 GLY A O   1 
ATOM 2223 N N   . HIS A 1 345 ? -23.341 7.853   -20.488 1.00 135.41 ? 615 HIS A N   1 
ATOM 2224 C CA  . HIS A 1 345 ? -24.484 7.440   -19.675 1.00 137.82 ? 615 HIS A CA  1 
ATOM 2225 C C   . HIS A 1 345 ? -25.405 8.611   -19.313 1.00 139.09 ? 615 HIS A C   1 
ATOM 2226 O O   . HIS A 1 345 ? -26.627 8.499   -19.393 1.00 149.54 ? 615 HIS A O   1 
ATOM 2227 C CB  . HIS A 1 345 ? -23.996 6.736   -18.405 1.00 137.89 ? 615 HIS A CB  1 
ATOM 2228 C CG  . HIS A 1 345 ? -23.349 5.408   -18.658 1.00 135.65 ? 615 HIS A CG  1 
ATOM 2229 N ND1 . HIS A 1 345 ? -22.391 5.220   -19.631 1.00 131.08 ? 615 HIS A ND1 1 
ATOM 2230 C CD2 . HIS A 1 345 ? -23.518 4.204   -18.061 1.00 134.62 ? 615 HIS A CD2 1 
ATOM 2231 C CE1 . HIS A 1 345 ? -22.001 3.958   -19.625 1.00 128.17 ? 615 HIS A CE1 1 
ATOM 2232 N NE2 . HIS A 1 345 ? -22.669 3.320   -18.681 1.00 126.64 ? 615 HIS A NE2 1 
ATOM 2233 N N   . GLU A 1 346 ? -24.808 9.723   -18.893 1.00 131.95 ? 616 GLU A N   1 
ATOM 2234 C CA  . GLU A 1 346 ? -25.555 10.924  -18.517 1.00 135.73 ? 616 GLU A CA  1 
ATOM 2235 C C   . GLU A 1 346 ? -26.275 11.597  -19.688 1.00 139.43 ? 616 GLU A C   1 
ATOM 2236 O O   . GLU A 1 346 ? -27.347 12.177  -19.519 1.00 143.65 ? 616 GLU A O   1 
ATOM 2237 C CB  . GLU A 1 346 ? -24.619 11.934  -17.850 1.00 126.56 ? 616 GLU A CB  1 
ATOM 2238 N N   . PHE A 1 347 ? -25.680 11.506  -20.873 1.00 139.20 ? 617 PHE A N   1 
ATOM 2239 C CA  . PHE A 1 347 ? -26.275 12.037  -22.099 1.00 135.17 ? 617 PHE A CA  1 
ATOM 2240 C C   . PHE A 1 347 ? -27.415 11.155  -22.589 1.00 136.43 ? 617 PHE A C   1 
ATOM 2241 O O   . PHE A 1 347 ? -28.310 11.614  -23.299 1.00 142.96 ? 617 PHE A O   1 
ATOM 2242 C CB  . PHE A 1 347 ? -25.216 12.185  -23.192 1.00 130.80 ? 617 PHE A CB  1 
ATOM 2243 N N   . VAL A 1 348 ? -27.371 9.886   -22.200 1.00 136.10 ? 618 VAL A N   1 
ATOM 2244 C CA  . VAL A 1 348 ? -28.455 8.956   -22.477 1.00 136.92 ? 618 VAL A CA  1 
ATOM 2245 C C   . VAL A 1 348 ? -29.718 9.441   -21.777 1.00 143.48 ? 618 VAL A C   1 
ATOM 2246 O O   . VAL A 1 348 ? -30.805 9.417   -22.355 1.00 154.80 ? 618 VAL A O   1 
ATOM 2247 C CB  . VAL A 1 348 ? -28.112 7.524   -22.018 1.00 141.78 ? 618 VAL A CB  1 
ATOM 2248 C CG1 . VAL A 1 348 ? -29.327 6.615   -22.128 1.00 143.83 ? 618 VAL A CG1 1 
ATOM 2249 C CG2 . VAL A 1 348 ? -26.952 6.972   -22.831 1.00 153.19 ? 618 VAL A CG2 1 
ATOM 2250 N N   . LEU A 1 349 ? -29.575 9.885   -20.533 1.00 143.77 ? 619 LEU A N   1 
ATOM 2251 C CA  . LEU A 1 349 ? -30.730 10.309  -19.753 1.00 147.48 ? 619 LEU A CA  1 
ATOM 2252 C C   . LEU A 1 349 ? -31.307 11.605  -20.322 1.00 148.75 ? 619 LEU A C   1 
ATOM 2253 O O   . LEU A 1 349 ? -32.523 11.746  -20.443 1.00 154.19 ? 619 LEU A O   1 
ATOM 2254 C CB  . LEU A 1 349 ? -30.350 10.496  -18.283 1.00 147.11 ? 619 LEU A CB  1 
ATOM 2255 N N   . THR A 1 350 ? -30.439 12.555  -20.659 1.00 150.00 ? 620 THR A N   1 
ATOM 2256 C CA  . THR A 1 350 ? -30.874 13.790  -21.310 1.00 154.24 ? 620 THR A CA  1 
ATOM 2257 C C   . THR A 1 350 ? -31.348 13.569  -22.747 1.00 164.44 ? 620 THR A C   1 
ATOM 2258 O O   . THR A 1 350 ? -31.808 14.509  -23.398 1.00 171.26 ? 620 THR A O   1 
ATOM 2259 C CB  . THR A 1 350 ? -29.751 14.844  -21.327 1.00 149.92 ? 620 THR A CB  1 
ATOM 2260 N N   . GLU A 1 351 ? -31.199 12.340  -23.239 1.00 171.83 ? 621 GLU A N   1 
ATOM 2261 C CA  . GLU A 1 351 ? -31.662 11.942  -24.569 1.00 185.16 ? 621 GLU A CA  1 
ATOM 2262 C C   . GLU A 1 351 ? -30.841 12.646  -25.647 1.00 189.77 ? 621 GLU A C   1 
ATOM 2263 O O   . GLU A 1 351 ? -31.381 13.103  -26.654 1.00 191.67 ? 621 GLU A O   1 
ATOM 2264 C CB  . GLU A 1 351 ? -33.156 12.238  -24.752 1.00 180.25 ? 621 GLU A CB  1 
ATOM 2265 N N   . GLU A 1 352 ? -29.531 12.723  -25.430 1.00 183.23 ? 622 GLU A N   1 
ATOM 2266 C CA  . GLU A 1 352 ? -28.619 13.310  -26.408 1.00 181.01 ? 622 GLU A CA  1 
ATOM 2267 C C   . GLU A 1 352 ? -27.825 12.236  -27.149 1.00 174.45 ? 622 GLU A C   1 
ATOM 2268 O O   . GLU A 1 352 ? -26.605 12.329  -27.274 1.00 177.42 ? 622 GLU A O   1 
ATOM 2269 C CB  . GLU A 1 352 ? -27.666 14.294  -25.727 1.00 188.55 ? 622 GLU A CB  1 
ATOM 2270 N N   . LEU A 1 353 ? -28.542 11.217  -27.618 1.00 165.43 ? 623 LEU A N   1 
ATOM 2271 C CA  . LEU A 1 353 ? -27.972 9.978   -28.156 1.00 163.85 ? 623 LEU A CA  1 
ATOM 2272 C C   . LEU A 1 353 ? -26.777 10.135  -29.106 1.00 167.34 ? 623 LEU A C   1 
ATOM 2273 O O   . LEU A 1 353 ? -25.883 9.288   -29.128 1.00 163.49 ? 623 LEU A O   1 
ATOM 2274 C CB  . LEU A 1 353 ? -29.069 9.187   -28.874 1.00 165.88 ? 623 LEU A CB  1 
ATOM 2275 N N   . ASP A 1 354 ? -26.759 11.217  -29.878 1.00 174.04 ? 624 ASP A N   1 
ATOM 2276 C CA  . ASP A 1 354 ? -25.698 11.444  -30.857 1.00 180.85 ? 624 ASP A CA  1 
ATOM 2277 C C   . ASP A 1 354 ? -24.361 11.808  -30.217 1.00 183.04 ? 624 ASP A C   1 
ATOM 2278 O O   . ASP A 1 354 ? -23.313 11.319  -30.640 1.00 192.88 ? 624 ASP A O   1 
ATOM 2279 C CB  . ASP A 1 354 ? -26.113 12.545  -31.836 1.00 178.43 ? 624 ASP A CB  1 
ATOM 2280 N N   . LYS A 1 355 ? -24.397 12.668  -29.206 1.00 166.90 ? 625 LYS A N   1 
ATOM 2281 C CA  . LYS A 1 355 ? -23.203 12.975  -28.429 1.00 158.45 ? 625 LYS A CA  1 
ATOM 2282 C C   . LYS A 1 355 ? -22.700 11.736  -27.695 1.00 156.13 ? 625 LYS A C   1 
ATOM 2283 O O   . LYS A 1 355 ? -21.504 11.441  -27.695 1.00 164.57 ? 625 LYS A O   1 
ATOM 2284 C CB  . LYS A 1 355 ? -23.487 14.099  -27.431 1.00 160.52 ? 625 LYS A CB  1 
ATOM 2285 N N   . ALA A 1 356 ? -23.632 11.022  -27.070 1.00 146.54 ? 626 ALA A N   1 
ATOM 2286 C CA  . ALA A 1 356 ? -23.349 9.780   -26.355 1.00 146.69 ? 626 ALA A CA  1 
ATOM 2287 C C   . ALA A 1 356 ? -22.544 8.764   -27.168 1.00 150.52 ? 626 ALA A C   1 
ATOM 2288 O O   . ALA A 1 356 ? -21.599 8.169   -26.651 1.00 153.36 ? 626 ALA A O   1 
ATOM 2289 C CB  . ALA A 1 356 ? -24.652 9.150   -25.887 1.00 143.87 ? 626 ALA A CB  1 
ATOM 2290 N N   . LEU A 1 357 ? -22.926 8.562   -28.427 1.00 140.76 ? 627 LEU A N   1 
ATOM 2291 C CA  . LEU A 1 357 ? -22.202 7.661   -29.325 1.00 142.14 ? 627 LEU A CA  1 
ATOM 2292 C C   . LEU A 1 357 ? -20.715 8.002   -29.372 1.00 152.78 ? 627 LEU A C   1 
ATOM 2293 O O   . LEU A 1 357 ? -19.866 7.157   -29.085 1.00 157.35 ? 627 LEU A O   1 
ATOM 2294 C CB  . LEU A 1 357 ? -22.799 7.711   -30.733 1.00 132.62 ? 627 LEU A CB  1 
ATOM 2295 N N   . ALA A 1 358 ? -20.416 9.238   -29.759 1.00 163.23 ? 628 ALA A N   1 
ATOM 2296 C CA  . ALA A 1 358 ? -19.045 9.729   -29.876 1.00 168.25 ? 628 ALA A CA  1 
ATOM 2297 C C   . ALA A 1 358 ? -18.253 9.520   -28.584 1.00 171.21 ? 628 ALA A C   1 
ATOM 2298 O O   . ALA A 1 358 ? -17.077 9.160   -28.616 1.00 176.04 ? 628 ALA A O   1 
ATOM 2299 C CB  . ALA A 1 358 ? -19.044 11.199  -30.263 1.00 160.30 ? 628 ALA A CB  1 
ATOM 2300 N N   . CYS A 1 359 ? -18.914 9.756   -27.454 1.00 157.89 ? 629 CYS A N   1 
ATOM 2301 C CA  . CYS A 1 359 ? -18.351 9.474   -26.136 1.00 147.44 ? 629 CYS A CA  1 
ATOM 2302 C C   . CYS A 1 359 ? -17.901 8.026   -25.978 1.00 147.09 ? 629 CYS A C   1 
ATOM 2303 O O   . CYS A 1 359 ? -16.758 7.762   -25.603 1.00 146.46 ? 629 CYS A O   1 
ATOM 2304 C CB  . CYS A 1 359 ? -19.372 9.806   -25.045 1.00 146.96 ? 629 CYS A CB  1 
ATOM 2305 S SG  . CYS A 1 359 ? -19.542 11.564  -24.673 1.00 209.05 ? 629 CYS A SG  1 
ATOM 2306 N N   . PHE A 1 360 ? -18.799 7.089   -26.261 1.00 138.72 ? 630 PHE A N   1 
ATOM 2307 C CA  . PHE A 1 360 ? -18.481 5.676   -26.112 1.00 147.64 ? 630 PHE A CA  1 
ATOM 2308 C C   . PHE A 1 360 ? -17.418 5.248   -27.118 1.00 146.07 ? 630 PHE A C   1 
ATOM 2309 O O   . PHE A 1 360 ? -16.555 4.435   -26.803 1.00 147.09 ? 630 PHE A O   1 
ATOM 2310 C CB  . PHE A 1 360 ? -19.741 4.825   -26.280 1.00 156.50 ? 630 PHE A CB  1 
ATOM 2311 C CG  . PHE A 1 360 ? -20.728 4.978   -25.159 1.00 147.49 ? 630 PHE A CG  1 
ATOM 2312 C CD1 . PHE A 1 360 ? -20.364 4.711   -23.852 1.00 142.79 ? 630 PHE A CD1 1 
ATOM 2313 C CD2 . PHE A 1 360 ? -22.024 5.391   -25.416 1.00 141.50 ? 630 PHE A CD2 1 
ATOM 2314 C CE1 . PHE A 1 360 ? -21.273 4.855   -22.822 1.00 147.83 ? 630 PHE A CE1 1 
ATOM 2315 C CE2 . PHE A 1 360 ? -22.938 5.537   -24.392 1.00 138.19 ? 630 PHE A CE2 1 
ATOM 2316 C CZ  . PHE A 1 360 ? -22.562 5.268   -23.093 1.00 138.62 ? 630 PHE A CZ  1 
ATOM 2317 N N   . ARG A 1 361 ? -17.467 5.826   -28.316 1.00 147.99 ? 631 ARG A N   1 
ATOM 2318 C CA  . ARG A 1 361 ? -16.483 5.532   -29.355 1.00 153.12 ? 631 ARG A CA  1 
ATOM 2319 C C   . ARG A 1 361 ? -15.104 6.038   -28.951 1.00 156.47 ? 631 ARG A C   1 
ATOM 2320 O O   . ARG A 1 361 ? -14.100 5.350   -29.136 1.00 166.27 ? 631 ARG A O   1 
ATOM 2321 C CB  . ARG A 1 361 ? -16.904 6.154   -30.687 1.00 160.84 ? 631 ARG A CB  1 
ATOM 2322 N N   . ASN A 1 362 ? -15.062 7.254   -28.417 1.00 150.45 ? 632 ASN A N   1 
ATOM 2323 C CA  . ASN A 1 362 ? -13.823 7.836   -27.917 1.00 151.71 ? 632 ASN A CA  1 
ATOM 2324 C C   . ASN A 1 362 ? -13.283 6.951   -26.803 1.00 157.41 ? 632 ASN A C   1 
ATOM 2325 O O   . ASN A 1 362 ? -12.094 6.641   -26.760 1.00 173.89 ? 632 ASN A O   1 
ATOM 2326 C CB  . ASN A 1 362 ? -14.041 9.266   -27.436 1.00 147.17 ? 632 ASN A CB  1 
ATOM 2327 C CG  . ASN A 1 362 ? -13.722 10.292  -28.503 1.00 147.72 ? 632 ASN A CG  1 
ATOM 2328 O OD1 . ASN A 1 362 ? -12.578 10.408  -28.944 1.00 146.24 ? 632 ASN A OD1 1 
ATOM 2329 N ND2 . ASN A 1 362 ? -14.731 11.044  -28.924 1.00 149.55 ? 632 ASN A ND2 1 
ATOM 2330 N N   . ALA A 1 363 ? -14.177 6.569   -25.897 1.00 139.71 ? 633 ALA A N   1 
ATOM 2331 C CA  . ALA A 1 363 ? -13.870 5.648   -24.810 1.00 137.21 ? 633 ALA A CA  1 
ATOM 2332 C C   . ALA A 1 363 ? -13.241 4.378   -25.382 1.00 138.35 ? 633 ALA A C   1 
ATOM 2333 O O   . ALA A 1 363 ? -12.325 3.806   -24.791 1.00 135.11 ? 633 ALA A O   1 
ATOM 2334 C CB  . ALA A 1 363 ? -15.115 5.327   -24.010 1.00 135.38 ? 633 ALA A CB  1 
ATOM 2335 N N   . ILE A 1 364 ? -13.744 3.942   -26.535 1.00 150.49 ? 634 ILE A N   1 
ATOM 2336 C CA  . ILE A 1 364 ? -13.207 2.766   -27.209 1.00 157.82 ? 634 ILE A CA  1 
ATOM 2337 C C   . ILE A 1 364 ? -11.838 3.081   -27.819 1.00 164.19 ? 634 ILE A C   1 
ATOM 2338 O O   . ILE A 1 364 ? -10.963 2.216   -27.867 1.00 165.55 ? 634 ILE A O   1 
ATOM 2339 C CB  . ILE A 1 364 ? -14.160 2.269   -28.336 1.00 141.30 ? 634 ILE A CB  1 
ATOM 2340 C CG1 . ILE A 1 364 ? -15.483 1.766   -27.757 1.00 138.16 ? 634 ILE A CG1 1 
ATOM 2341 C CG2 . ILE A 1 364 ? -13.512 1.177   -29.176 1.00 156.73 ? 634 ILE A CG2 1 
ATOM 2342 C CD1 . ILE A 1 364 ? -15.326 0.745   -26.665 1.00 135.09 ? 634 ILE A CD1 1 
ATOM 2343 N N   . ARG A 1 365 ? -11.635 4.323   -28.251 1.00 167.65 ? 635 ARG A N   1 
ATOM 2344 C CA  . ARG A 1 365 ? -10.328 4.718   -28.774 1.00 165.86 ? 635 ARG A CA  1 
ATOM 2345 C C   . ARG A 1 365 ? -9.184  4.662   -27.760 1.00 169.20 ? 635 ARG A C   1 
ATOM 2346 O O   . ARG A 1 365 ? -8.135  4.085   -28.044 1.00 190.84 ? 635 ARG A O   1 
ATOM 2347 C CB  . ARG A 1 365 ? -10.367 6.129   -29.372 1.00 166.44 ? 635 ARG A CB  1 
ATOM 2348 C CG  . ARG A 1 365 ? -8.988  6.559   -29.871 1.00 172.88 ? 635 ARG A CG  1 
ATOM 2349 C CD  . ARG A 1 365 ? -9.020  7.390   -31.141 1.00 191.68 ? 635 ARG A CD  1 
ATOM 2350 N NE  . ARG A 1 365 ? -9.823  8.602   -31.030 1.00 203.06 ? 635 ARG A NE  1 
ATOM 2351 C CZ  . ARG A 1 365 ? -10.369 9.224   -32.069 1.00 214.71 ? 635 ARG A CZ  1 
ATOM 2352 N NH1 . ARG A 1 365 ? -10.216 8.731   -33.289 1.00 213.54 ? 635 ARG A NH1 1 
ATOM 2353 N NH2 . ARG A 1 365 ? -11.088 10.322  -31.892 1.00 221.47 ? 635 ARG A NH2 1 
ATOM 2354 N N   . VAL A 1 366 ? -9.371  5.254   -26.584 1.00 152.18 ? 636 VAL A N   1 
ATOM 2355 C CA  . VAL A 1 366 ? -8.318  5.215   -25.572 1.00 140.75 ? 636 VAL A CA  1 
ATOM 2356 C C   . VAL A 1 366 ? -8.044  3.831   -24.970 1.00 137.10 ? 636 VAL A C   1 
ATOM 2357 O O   . VAL A 1 366 ? -6.886  3.422   -24.863 1.00 135.37 ? 636 VAL A O   1 
ATOM 2358 C CB  . VAL A 1 366 ? -8.650  6.202   -24.413 1.00 150.77 ? 636 VAL A CB  1 
ATOM 2359 C CG1 . VAL A 1 366 ? -10.154 6.398   -24.302 1.00 137.47 ? 636 VAL A CG1 1 
ATOM 2360 C CG2 . VAL A 1 366 ? -8.091  5.714   -23.080 1.00 163.81 ? 636 VAL A CG2 1 
ATOM 2361 N N   . ASN A 1 367 ? -9.094  3.109   -24.590 1.00 141.50 ? 637 ASN A N   1 
ATOM 2362 C CA  . ASN A 1 367 ? -8.956  1.723   -24.137 1.00 144.75 ? 637 ASN A CA  1 
ATOM 2363 C C   . ASN A 1 367 ? -9.930  0.777   -24.840 1.00 154.23 ? 637 ASN A C   1 
ATOM 2364 O O   . ASN A 1 367 ? -11.137 0.866   -24.619 1.00 148.38 ? 637 ASN A O   1 
ATOM 2365 C CB  . ASN A 1 367 ? -9.123  1.623   -22.624 1.00 146.64 ? 637 ASN A CB  1 
ATOM 2366 C CG  . ASN A 1 367 ? -8.636  0.291   -22.074 1.00 150.30 ? 637 ASN A CG  1 
ATOM 2367 O OD1 . ASN A 1 367 ? -8.299  -0.623  -22.828 1.00 147.46 ? 637 ASN A OD1 1 
ATOM 2368 N ND2 . ASN A 1 367 ? -8.589  0.180   -20.753 1.00 156.18 ? 637 ASN A ND2 1 
ATOM 2369 N N   . PRO A 1 368 ? -9.426  -0.126  -25.688 1.00 164.61 ? 638 PRO A N   1 
ATOM 2370 C CA  . PRO A 1 368 ? -10.380 -1.063  -26.295 1.00 161.00 ? 638 PRO A CA  1 
ATOM 2371 C C   . PRO A 1 368 ? -10.937 -2.137  -25.342 1.00 157.84 ? 638 PRO A C   1 
ATOM 2372 O O   . PRO A 1 368 ? -11.948 -2.748  -25.691 1.00 168.33 ? 638 PRO A O   1 
ATOM 2373 C CB  . PRO A 1 368 ? -9.560  -1.724  -27.420 1.00 167.05 ? 638 PRO A CB  1 
ATOM 2374 C CG  . PRO A 1 368 ? -8.169  -1.108  -27.363 1.00 169.97 ? 638 PRO A CG  1 
ATOM 2375 C CD  . PRO A 1 368 ? -8.032  -0.439  -26.038 1.00 167.95 ? 638 PRO A CD  1 
ATOM 2376 N N   . ARG A 1 369 ? -10.326 -2.362  -24.178 1.00 140.70 ? 639 ARG A N   1 
ATOM 2377 C CA  . ARG A 1 369 ? -10.889 -3.310  -23.206 1.00 128.28 ? 639 ARG A CA  1 
ATOM 2378 C C   . ARG A 1 369 ? -11.792 -2.736  -22.097 1.00 143.19 ? 639 ARG A C   1 
ATOM 2379 O O   . ARG A 1 369 ? -12.143 -3.452  -21.158 1.00 164.57 ? 639 ARG A O   1 
ATOM 2380 C CB  . ARG A 1 369 ? -9.747  -4.083  -22.541 1.00 112.54 ? 639 ARG A CB  1 
ATOM 2381 N N   . HIS A 1 370 ? -12.178 -1.469  -22.204 1.00 146.01 ? 640 HIS A N   1 
ATOM 2382 C CA  . HIS A 1 370 ? -13.082 -0.839  -21.232 1.00 144.20 ? 640 HIS A CA  1 
ATOM 2383 C C   . HIS A 1 370 ? -14.535 -1.190  -21.584 1.00 146.70 ? 640 HIS A C   1 
ATOM 2384 O O   . HIS A 1 370 ? -15.172 -0.482  -22.363 1.00 150.92 ? 640 HIS A O   1 
ATOM 2385 C CB  . HIS A 1 370 ? -12.894 0.673   -21.136 1.00 142.05 ? 640 HIS A CB  1 
ATOM 2386 C CG  . HIS A 1 370 ? -13.666 1.289   -20.009 1.00 143.10 ? 640 HIS A CG  1 
ATOM 2387 N ND1 . HIS A 1 370 ? -13.457 0.934   -18.692 1.00 151.85 ? 640 HIS A ND1 1 
ATOM 2388 C CD2 . HIS A 1 370 ? -14.656 2.213   -19.995 1.00 138.38 ? 640 HIS A CD2 1 
ATOM 2389 C CE1 . HIS A 1 370 ? -14.276 1.621   -17.917 1.00 154.56 ? 640 HIS A CE1 1 
ATOM 2390 N NE2 . HIS A 1 370 ? -15.015 2.404   -18.682 1.00 148.44 ? 640 HIS A NE2 1 
ATOM 2391 N N   . TYR A 1 371 ? -15.048 -2.275  -21.011 1.00 137.89 ? 641 TYR A N   1 
ATOM 2392 C CA  . TYR A 1 371 ? -16.345 -2.857  -21.377 1.00 125.81 ? 641 TYR A CA  1 
ATOM 2393 C C   . TYR A 1 371 ? -17.552 -1.908  -21.316 1.00 126.51 ? 641 TYR A C   1 
ATOM 2394 O O   . TYR A 1 371 ? -18.472 -2.052  -22.122 1.00 129.43 ? 641 TYR A O   1 
ATOM 2395 C CB  . TYR A 1 371 ? -16.596 -4.078  -20.468 1.00 124.49 ? 641 TYR A CB  1 
ATOM 2396 C CG  . TYR A 1 371 ? -17.100 -3.761  -19.060 1.00 134.13 ? 641 TYR A CG  1 
ATOM 2397 C CD1 . TYR A 1 371 ? -18.437 -3.443  -18.819 1.00 130.70 ? 641 TYR A CD1 1 
ATOM 2398 C CD2 . TYR A 1 371 ? -16.222 -3.712  -17.986 1.00 148.76 ? 641 TYR A CD2 1 
ATOM 2399 C CE1 . TYR A 1 371 ? -18.886 -3.136  -17.547 1.00 143.14 ? 641 TYR A CE1 1 
ATOM 2400 C CE2 . TYR A 1 371 ? -16.665 -3.397  -16.710 1.00 158.89 ? 641 TYR A CE2 1 
ATOM 2401 C CZ  . TYR A 1 371 ? -17.995 -3.114  -16.496 1.00 162.54 ? 641 TYR A CZ  1 
ATOM 2402 O OH  . TYR A 1 371 ? -18.436 -2.805  -15.229 1.00 174.25 ? 641 TYR A OH  1 
ATOM 2403 N N   . ASN A 1 372 ? -17.583 -0.988  -20.358 1.00 131.44 ? 642 ASN A N   1 
ATOM 2404 C CA  . ASN A 1 372 ? -18.726 -0.084  -20.172 1.00 134.40 ? 642 ASN A CA  1 
ATOM 2405 C C   . ASN A 1 372 ? -19.190 0.606   -21.452 1.00 148.57 ? 642 ASN A C   1 
ATOM 2406 O O   . ASN A 1 372 ? -20.383 0.751   -21.708 1.00 156.69 ? 642 ASN A O   1 
ATOM 2407 C CB  . ASN A 1 372 ? -18.474 0.954   -19.090 1.00 132.43 ? 642 ASN A CB  1 
ATOM 2408 C CG  . ASN A 1 372 ? -18.015 0.359   -17.779 1.00 152.73 ? 642 ASN A CG  1 
ATOM 2409 O OD1 . ASN A 1 372 ? -17.139 -0.499  -17.738 1.00 165.94 ? 642 ASN A OD1 1 
ATOM 2410 N ND2 . ASN A 1 372 ? -18.646 0.793   -16.689 1.00 158.96 ? 642 ASN A ND2 1 
ATOM 2411 N N   . ALA A 1 373 ? -18.219 1.055   -22.245 1.00 147.94 ? 643 ALA A N   1 
ATOM 2412 C CA  . ALA A 1 373 ? -18.482 1.827   -23.457 1.00 140.29 ? 643 ALA A CA  1 
ATOM 2413 C C   . ALA A 1 373 ? -19.066 0.996   -24.595 1.00 147.98 ? 643 ALA A C   1 
ATOM 2414 O O   . ALA A 1 373 ? -19.970 1.461   -25.291 1.00 156.58 ? 643 ALA A O   1 
ATOM 2415 C CB  . ALA A 1 373 ? -17.213 2.508   -23.917 1.00 138.62 ? 643 ALA A CB  1 
ATOM 2416 N N   . TRP A 1 374 ? -18.533 -0.204  -24.809 1.00 155.91 ? 644 TRP A N   1 
ATOM 2417 C CA  . TRP A 1 374 ? -19.087 -1.116  -25.807 1.00 163.36 ? 644 TRP A CA  1 
ATOM 2418 C C   . TRP A 1 374 ? -20.581 -1.290  -25.583 1.00 166.25 ? 644 TRP A C   1 
ATOM 2419 O O   . TRP A 1 374 ? -21.395 -1.005  -26.463 1.00 185.93 ? 644 TRP A O   1 
ATOM 2420 C CB  . TRP A 1 374 ? -18.414 -2.488  -25.747 1.00 159.89 ? 644 TRP A CB  1 
ATOM 2421 C CG  . TRP A 1 374 ? -17.001 -2.528  -26.210 1.00 153.06 ? 644 TRP A CG  1 
ATOM 2422 C CD1 . TRP A 1 374 ? -15.893 -2.723  -25.440 1.00 159.90 ? 644 TRP A CD1 1 
ATOM 2423 C CD2 . TRP A 1 374 ? -16.537 -2.403  -27.558 1.00 145.89 ? 644 TRP A CD2 1 
ATOM 2424 N NE1 . TRP A 1 374 ? -14.765 -2.713  -26.223 1.00 154.80 ? 644 TRP A NE1 1 
ATOM 2425 C CE2 . TRP A 1 374 ? -15.133 -2.520  -27.528 1.00 153.47 ? 644 TRP A CE2 1 
ATOM 2426 C CE3 . TRP A 1 374 ? -17.171 -2.197  -28.787 1.00 147.70 ? 644 TRP A CE3 1 
ATOM 2427 C CZ2 . TRP A 1 374 ? -14.353 -2.435  -28.678 1.00 168.46 ? 644 TRP A CZ2 1 
ATOM 2428 C CZ3 . TRP A 1 374 ? -16.394 -2.114  -29.928 1.00 154.43 ? 644 TRP A CZ3 1 
ATOM 2429 C CH2 . TRP A 1 374 ? -15.001 -2.233  -29.865 1.00 164.98 ? 644 TRP A CH2 1 
ATOM 2430 N N   . TYR A 1 375 ? -20.921 -1.771  -24.395 1.00 142.89 ? 645 TYR A N   1 
ATOM 2431 C CA  . TYR A 1 375 ? -22.301 -2.030  -24.021 1.00 139.31 ? 645 TYR A CA  1 
ATOM 2432 C C   . TYR A 1 375 ? -23.161 -0.770  -24.113 1.00 145.29 ? 645 TYR A C   1 
ATOM 2433 O O   . TYR A 1 375 ? -24.299 -0.827  -24.582 1.00 146.39 ? 645 TYR A O   1 
ATOM 2434 C CB  . TYR A 1 375 ? -22.365 -2.600  -22.605 1.00 133.80 ? 645 TYR A CB  1 
ATOM 2435 C CG  . TYR A 1 375 ? -23.621 -3.390  -22.333 1.00 135.75 ? 645 TYR A CG  1 
ATOM 2436 C CD1 . TYR A 1 375 ? -23.622 -4.774  -22.442 1.00 141.86 ? 645 TYR A CD1 1 
ATOM 2437 C CD2 . TYR A 1 375 ? -24.810 -2.757  -21.998 1.00 136.43 ? 645 TYR A CD2 1 
ATOM 2438 C CE1 . TYR A 1 375 ? -24.765 -5.508  -22.206 1.00 146.00 ? 645 TYR A CE1 1 
ATOM 2439 C CE2 . TYR A 1 375 ? -25.961 -3.484  -21.762 1.00 141.79 ? 645 TYR A CE2 1 
ATOM 2440 C CZ  . TYR A 1 375 ? -25.932 -4.859  -21.867 1.00 145.26 ? 645 TYR A CZ  1 
ATOM 2441 O OH  . TYR A 1 375 ? -27.073 -5.590  -21.631 1.00 142.15 ? 645 TYR A OH  1 
ATOM 2442 N N   . GLY A 1 376 ? -22.621 0.363   -23.667 1.00 142.12 ? 646 GLY A N   1 
ATOM 2443 C CA  . GLY A 1 376 ? -23.358 1.613   -23.728 1.00 141.50 ? 646 GLY A CA  1 
ATOM 2444 C C   . GLY A 1 376 ? -23.718 1.985   -25.152 1.00 146.60 ? 646 GLY A C   1 
ATOM 2445 O O   . GLY A 1 376 ? -24.788 2.542   -25.400 1.00 142.28 ? 646 GLY A O   1 
ATOM 2446 N N   . LEU A 1 377 ? -22.825 1.690   -26.091 1.00 149.16 ? 647 LEU A N   1 
ATOM 2447 C CA  . LEU A 1 377 ? -23.131 1.907   -27.497 1.00 141.94 ? 647 LEU A CA  1 
ATOM 2448 C C   . LEU A 1 377 ? -24.242 0.940   -27.884 1.00 144.66 ? 647 LEU A C   1 
ATOM 2449 O O   . LEU A 1 377 ? -25.285 1.337   -28.405 1.00 150.50 ? 647 LEU A O   1 
ATOM 2450 C CB  . LEU A 1 377 ? -21.894 1.702   -28.373 1.00 110.92 ? 647 LEU A CB  1 
ATOM 2451 N N   . GLY A 1 378 ? -23.992 -0.340  -27.609 1.00 129.16 ? 648 GLY A N   1 
ATOM 2452 C CA  . GLY A 1 378 ? -24.940 -1.412  -27.854 1.00 132.94 ? 648 GLY A CA  1 
ATOM 2453 C C   . GLY A 1 378 ? -26.318 -1.204  -27.257 1.00 139.72 ? 648 GLY A C   1 
ATOM 2454 O O   . GLY A 1 378 ? -27.318 -1.661  -27.808 1.00 149.45 ? 648 GLY A O   1 
ATOM 2455 N N   . MET A 1 379 ? -26.370 -0.517  -26.121 1.00 141.94 ? 649 MET A N   1 
ATOM 2456 C CA  . MET A 1 379 ? -27.632 -0.275  -25.435 1.00 147.54 ? 649 MET A CA  1 
ATOM 2457 C C   . MET A 1 379 ? -28.481 0.699   -26.240 1.00 154.24 ? 649 MET A C   1 
ATOM 2458 O O   . MET A 1 379 ? -29.684 0.501   -26.416 1.00 156.87 ? 649 MET A O   1 
ATOM 2459 C CB  . MET A 1 379 ? -27.391 0.264   -24.024 1.00 142.17 ? 649 MET A CB  1 
ATOM 2460 N N   . ILE A 1 380 ? -27.836 1.757   -26.719 1.00 146.47 ? 650 ILE A N   1 
ATOM 2461 C CA  . ILE A 1 380 ? -28.498 2.795   -27.501 1.00 141.58 ? 650 ILE A CA  1 
ATOM 2462 C C   . ILE A 1 380 ? -28.780 2.384   -28.946 1.00 144.83 ? 650 ILE A C   1 
ATOM 2463 O O   . ILE A 1 380 ? -29.593 3.014   -29.621 1.00 146.28 ? 650 ILE A O   1 
ATOM 2464 C CB  . ILE A 1 380 ? -27.665 4.089   -27.517 1.00 133.48 ? 650 ILE A CB  1 
ATOM 2465 N N   . TYR A 1 381 ? -28.123 1.329   -29.419 1.00 151.37 ? 651 TYR A N   1 
ATOM 2466 C CA  . TYR A 1 381 ? -28.500 0.739   -30.698 1.00 155.21 ? 651 TYR A CA  1 
ATOM 2467 C C   . TYR A 1 381 ? -29.760 -0.091  -30.524 1.00 168.43 ? 651 TYR A C   1 
ATOM 2468 O O   . TYR A 1 381 ? -30.714 0.030   -31.295 1.00 177.27 ? 651 TYR A O   1 
ATOM 2469 C CB  . TYR A 1 381 ? -27.390 -0.163  -31.243 1.00 153.60 ? 651 TYR A CB  1 
ATOM 2470 C CG  . TYR A 1 381 ? -26.214 0.533   -31.885 1.00 152.32 ? 651 TYR A CG  1 
ATOM 2471 C CD1 . TYR A 1 381 ? -26.386 1.418   -32.941 1.00 152.95 ? 651 TYR A CD1 1 
ATOM 2472 C CD2 . TYR A 1 381 ? -24.921 0.272   -31.453 1.00 151.43 ? 651 TYR A CD2 1 
ATOM 2473 C CE1 . TYR A 1 381 ? -25.300 2.040   -33.532 1.00 152.78 ? 651 TYR A CE1 1 
ATOM 2474 C CE2 . TYR A 1 381 ? -23.834 0.886   -32.034 1.00 150.14 ? 651 TYR A CE2 1 
ATOM 2475 C CZ  . TYR A 1 381 ? -24.026 1.769   -33.073 1.00 151.98 ? 651 TYR A CZ  1 
ATOM 2476 O OH  . TYR A 1 381 ? -22.938 2.380   -33.651 1.00 153.39 ? 651 TYR A OH  1 
ATOM 2477 N N   . TYR A 1 382 ? -29.734 -0.947  -29.507 1.00 168.43 ? 652 TYR A N   1 
ATOM 2478 C CA  . TYR A 1 382 ? -30.883 -1.741  -29.083 1.00 173.17 ? 652 TYR A CA  1 
ATOM 2479 C C   . TYR A 1 382 ? -32.099 -0.846  -28.861 1.00 176.44 ? 652 TYR A C   1 
ATOM 2480 O O   . TYR A 1 382 ? -33.212 -1.183  -29.262 1.00 190.81 ? 652 TYR A O   1 
ATOM 2481 C CB  . TYR A 1 382 ? -30.543 -2.552  -27.825 1.00 158.15 ? 652 TYR A CB  1 
ATOM 2482 C CG  . TYR A 1 382 ? -31.724 -3.199  -27.124 1.00 160.54 ? 652 TYR A CG  1 
ATOM 2483 C CD1 . TYR A 1 382 ? -31.968 -4.560  -27.269 1.00 162.60 ? 652 TYR A CD1 1 
ATOM 2484 C CD2 . TYR A 1 382 ? -32.559 -2.475  -26.280 1.00 160.53 ? 652 TYR A CD2 1 
ATOM 2485 C CE1 . TYR A 1 382 ? -33.029 -5.171  -26.631 1.00 170.32 ? 652 TYR A CE1 1 
ATOM 2486 C CE2 . TYR A 1 382 ? -33.626 -3.079  -25.638 1.00 166.79 ? 652 TYR A CE2 1 
ATOM 2487 C CZ  . TYR A 1 382 ? -33.853 -4.428  -25.815 1.00 175.06 ? 652 TYR A CZ  1 
ATOM 2488 O OH  . TYR A 1 382 ? -34.910 -5.033  -25.175 1.00 185.70 ? 652 TYR A OH  1 
ATOM 2489 N N   . LYS A 1 383 ? -31.877 0.281   -28.190 1.00 152.42 ? 653 LYS A N   1 
ATOM 2490 C CA  . LYS A 1 383 ? -32.948 1.221   -27.880 1.00 153.37 ? 653 LYS A CA  1 
ATOM 2491 C C   . LYS A 1 383 ? -33.548 1.768   -29.170 1.00 171.13 ? 653 LYS A C   1 
ATOM 2492 O O   . LYS A 1 383 ? -34.745 2.040   -29.239 1.00 167.63 ? 653 LYS A O   1 
ATOM 2493 C CB  . LYS A 1 383 ? -32.435 2.361   -26.998 1.00 150.66 ? 653 LYS A CB  1 
ATOM 2494 N N   . GLN A 1 384 ? -32.710 1.944   -30.186 1.00 186.77 ? 654 GLN A N   1 
ATOM 2495 C CA  . GLN A 1 384 ? -33.184 2.405   -31.486 1.00 182.06 ? 654 GLN A CA  1 
ATOM 2496 C C   . GLN A 1 384 ? -33.450 1.209   -32.394 1.00 175.21 ? 654 GLN A C   1 
ATOM 2497 O O   . GLN A 1 384 ? -33.809 1.378   -33.560 1.00 181.50 ? 654 GLN A O   1 
ATOM 2498 C CB  . GLN A 1 384 ? -32.176 3.353   -32.137 1.00 175.07 ? 654 GLN A CB  1 
ATOM 2499 N N   . GLU A 1 385 ? -33.209 0.011   -31.862 1.00 166.97 ? 655 GLU A N   1 
ATOM 2500 C CA  . GLU A 1 385 ? -33.677 -1.248  -32.448 1.00 166.71 ? 655 GLU A CA  1 
ATOM 2501 C C   . GLU A 1 385 ? -32.793 -1.673  -33.615 1.00 177.57 ? 655 GLU A C   1 
ATOM 2502 O O   . GLU A 1 385 ? -33.217 -2.439  -34.479 1.00 196.82 ? 655 GLU A O   1 
ATOM 2503 C CB  . GLU A 1 385 ? -35.140 -1.146  -32.895 1.00 165.51 ? 655 GLU A CB  1 
ATOM 2504 N N   . LYS A 1 386 ? -31.554 -1.192  -33.619 1.00 172.33 ? 656 LYS A N   1 
ATOM 2505 C CA  . LYS A 1 386 ? -30.545 -1.703  -34.537 1.00 176.42 ? 656 LYS A CA  1 
ATOM 2506 C C   . LYS A 1 386 ? -29.786 -2.845  -33.875 1.00 178.94 ? 656 LYS A C   1 
ATOM 2507 O O   . LYS A 1 386 ? -28.773 -2.633  -33.213 1.00 189.68 ? 656 LYS A O   1 
ATOM 2508 C CB  . LYS A 1 386 ? -29.582 -0.591  -34.959 1.00 177.41 ? 656 LYS A CB  1 
ATOM 2509 N N   . PHE A 1 387 ? -30.290 -4.060  -34.069 1.00 167.10 ? 657 PHE A N   1 
ATOM 2510 C CA  . PHE A 1 387 ? -29.938 -5.198  -33.226 1.00 161.22 ? 657 PHE A CA  1 
ATOM 2511 C C   . PHE A 1 387 ? -28.650 -5.906  -33.636 1.00 163.36 ? 657 PHE A C   1 
ATOM 2512 O O   . PHE A 1 387 ? -27.752 -6.089  -32.814 1.00 162.44 ? 657 PHE A O   1 
ATOM 2513 C CB  . PHE A 1 387 ? -31.086 -6.210  -33.210 1.00 168.69 ? 657 PHE A CB  1 
ATOM 2514 N N   . SER A 1 388 ? -28.571 -6.330  -34.894 1.00 169.57 ? 658 SER A N   1 
ATOM 2515 C CA  . SER A 1 388 ? -27.439 -7.129  -35.355 1.00 177.65 ? 658 SER A CA  1 
ATOM 2516 C C   . SER A 1 388 ? -26.098 -6.415  -35.208 1.00 167.53 ? 658 SER A C   1 
ATOM 2517 O O   . SER A 1 388 ? -25.053 -7.065  -35.163 1.00 168.63 ? 658 SER A O   1 
ATOM 2518 C CB  . SER A 1 388 ? -27.639 -7.536  -36.815 1.00 199.03 ? 658 SER A CB  1 
ATOM 2519 O OG  . SER A 1 388 ? -28.553 -6.669  -37.462 1.00 208.29 ? 658 SER A OG  1 
ATOM 2520 N N   . LEU A 1 389 ? -26.114 -5.088  -35.133 1.00 160.74 ? 659 LEU A N   1 
ATOM 2521 C CA  . LEU A 1 389 ? -24.896 -4.382  -34.767 1.00 159.80 ? 659 LEU A CA  1 
ATOM 2522 C C   . LEU A 1 389 ? -24.756 -4.344  -33.250 1.00 160.88 ? 659 LEU A C   1 
ATOM 2523 O O   . LEU A 1 389 ? -23.664 -4.549  -32.717 1.00 166.04 ? 659 LEU A O   1 
ATOM 2524 C CB  . LEU A 1 389 ? -24.898 -2.963  -35.338 1.00 156.77 ? 659 LEU A CB  1 
ATOM 2525 N N   . ALA A 1 390 ? -25.861 -4.057  -32.563 1.00 151.94 ? 660 ALA A N   1 
ATOM 2526 C CA  . ALA A 1 390 ? -25.889 -4.079  -31.103 1.00 145.46 ? 660 ALA A CA  1 
ATOM 2527 C C   . ALA A 1 390 ? -25.356 -5.394  -30.541 1.00 154.08 ? 660 ALA A C   1 
ATOM 2528 O O   . ALA A 1 390 ? -24.664 -5.409  -29.523 1.00 173.26 ? 660 ALA A O   1 
ATOM 2529 C CB  . ALA A 1 390 ? -27.302 -3.824  -30.598 1.00 145.04 ? 660 ALA A CB  1 
ATOM 2530 N N   . GLU A 1 391 ? -25.707 -6.495  -31.207 1.00 149.16 ? 661 GLU A N   1 
ATOM 2531 C CA  . GLU A 1 391 ? -25.155 -7.812  -30.899 1.00 149.50 ? 661 GLU A CA  1 
ATOM 2532 C C   . GLU A 1 391 ? -23.636 -7.781  -30.818 1.00 163.43 ? 661 GLU A C   1 
ATOM 2533 O O   . GLU A 1 391 ? -23.046 -8.186  -29.816 1.00 169.08 ? 661 GLU A O   1 
ATOM 2534 C CB  . GLU A 1 391 ? -25.602 -8.836  -31.945 1.00 145.67 ? 661 GLU A CB  1 
ATOM 2535 N N   . MET A 1 392 ? -23.020 -7.308  -31.899 1.00 169.46 ? 662 MET A N   1 
ATOM 2536 C CA  . MET A 1 392 ? -21.569 -7.311  -32.048 1.00 171.79 ? 662 MET A CA  1 
ATOM 2537 C C   . MET A 1 392 ? -20.901 -6.575  -30.895 1.00 166.25 ? 662 MET A C   1 
ATOM 2538 O O   . MET A 1 392 ? -19.880 -7.011  -30.365 1.00 175.18 ? 662 MET A O   1 
ATOM 2539 C CB  . MET A 1 392 ? -21.166 -6.678  -33.381 1.00 175.01 ? 662 MET A CB  1 
ATOM 2540 N N   . HIS A 1 393 ? -21.502 -5.452  -30.514 1.00 156.98 ? 663 HIS A N   1 
ATOM 2541 C CA  . HIS A 1 393 ? -21.031 -4.670  -29.381 1.00 150.96 ? 663 HIS A CA  1 
ATOM 2542 C C   . HIS A 1 393 ? -21.203 -5.422  -28.071 1.00 141.37 ? 663 HIS A C   1 
ATOM 2543 O O   . HIS A 1 393 ? -20.269 -5.514  -27.275 1.00 134.07 ? 663 HIS A O   1 
ATOM 2544 C CB  . HIS A 1 393 ? -21.773 -3.333  -29.311 1.00 149.26 ? 663 HIS A CB  1 
ATOM 2545 C CG  . HIS A 1 393 ? -21.547 -2.452  -30.500 1.00 153.89 ? 663 HIS A CG  1 
ATOM 2546 N ND1 . HIS A 1 393 ? -22.021 -2.760  -31.757 1.00 159.74 ? 663 HIS A ND1 1 
ATOM 2547 C CD2 . HIS A 1 393 ? -20.895 -1.272  -30.623 1.00 157.15 ? 663 HIS A CD2 1 
ATOM 2548 C CE1 . HIS A 1 393 ? -21.671 -1.807  -32.603 1.00 163.52 ? 663 HIS A CE1 1 
ATOM 2549 N NE2 . HIS A 1 393 ? -20.987 -0.892  -31.940 1.00 162.02 ? 663 HIS A NE2 1 
ATOM 2550 N N   . PHE A 1 394 ? -22.405 -5.950  -27.854 1.00 140.66 ? 664 PHE A N   1 
ATOM 2551 C CA  . PHE A 1 394 ? -22.688 -6.745  -26.667 1.00 137.82 ? 664 PHE A CA  1 
ATOM 2552 C C   . PHE A 1 394 ? -21.748 -7.937  -26.542 1.00 141.32 ? 664 PHE A C   1 
ATOM 2553 O O   . PHE A 1 394 ? -21.279 -8.258  -25.450 1.00 160.99 ? 664 PHE A O   1 
ATOM 2554 C CB  . PHE A 1 394 ? -24.131 -7.256  -26.702 1.00 139.32 ? 664 PHE A CB  1 
ATOM 2555 C CG  . PHE A 1 394 ? -25.165 -6.202  -26.432 1.00 139.82 ? 664 PHE A CG  1 
ATOM 2556 C CD1 . PHE A 1 394 ? -24.822 -5.002  -25.831 1.00 138.51 ? 664 PHE A CD1 1 
ATOM 2557 C CD2 . PHE A 1 394 ? -26.489 -6.417  -26.781 1.00 143.47 ? 664 PHE A CD2 1 
ATOM 2558 C CE1 . PHE A 1 394 ? -25.782 -4.038  -25.585 1.00 141.01 ? 664 PHE A CE1 1 
ATOM 2559 C CE2 . PHE A 1 394 ? -27.451 -5.457  -26.539 1.00 145.93 ? 664 PHE A CE2 1 
ATOM 2560 C CZ  . PHE A 1 394 ? -27.098 -4.266  -25.940 1.00 144.25 ? 664 PHE A CZ  1 
ATOM 2561 N N   . GLN A 1 395 ? -21.477 -8.587  -27.671 1.00 143.11 ? 665 GLN A N   1 
ATOM 2562 C CA  . GLN A 1 395 ? -20.566 -9.727  -27.703 1.00 153.03 ? 665 GLN A CA  1 
ATOM 2563 C C   . GLN A 1 395 ? -19.133 -9.374  -27.328 1.00 169.82 ? 665 GLN A C   1 
ATOM 2564 O O   . GLN A 1 395 ? -18.535 -10.010 -26.460 1.00 182.17 ? 665 GLN A O   1 
ATOM 2565 C CB  . GLN A 1 395 ? -20.591 -10.373 -29.090 1.00 150.65 ? 665 GLN A CB  1 
ATOM 2566 N N   . LYS A 1 396 ? -18.588 -8.368  -28.005 1.00 172.92 ? 666 LYS A N   1 
ATOM 2567 C CA  . LYS A 1 396 ? -17.228 -7.897  -27.755 1.00 168.38 ? 666 LYS A CA  1 
ATOM 2568 C C   . LYS A 1 396 ? -17.043 -7.428  -26.315 1.00 156.69 ? 666 LYS A C   1 
ATOM 2569 O O   . LYS A 1 396 ? -15.986 -7.614  -25.711 1.00 159.25 ? 666 LYS A O   1 
ATOM 2570 C CB  . LYS A 1 396 ? -16.875 -6.767  -28.723 1.00 160.74 ? 666 LYS A CB  1 
ATOM 2571 N N   . ALA A 1 397 ? -18.103 -6.833  -25.780 1.00 147.56 ? 667 ALA A N   1 
ATOM 2572 C CA  . ALA A 1 397 ? -18.180 -6.387  -24.392 1.00 145.78 ? 667 ALA A CA  1 
ATOM 2573 C C   . ALA A 1 397 ? -18.196 -7.530  -23.381 1.00 133.90 ? 667 ALA A C   1 
ATOM 2574 O O   . ALA A 1 397 ? -17.415 -7.537  -22.430 1.00 130.03 ? 667 ALA A O   1 
ATOM 2575 C CB  . ALA A 1 397 ? -19.406 -5.512  -24.199 1.00 151.51 ? 667 ALA A CB  1 
ATOM 2576 N N   . LEU A 1 398 ? -19.088 -8.492  -23.597 1.00 135.45 ? 668 LEU A N   1 
ATOM 2577 C CA  . LEU A 1 398 ? -19.302 -9.591  -22.659 1.00 134.63 ? 668 LEU A CA  1 
ATOM 2578 C C   . LEU A 1 398 ? -18.141 -10.571 -22.689 1.00 141.57 ? 668 LEU A C   1 
ATOM 2579 O O   . LEU A 1 398 ? -17.969 -11.378 -21.774 1.00 156.88 ? 668 LEU A O   1 
ATOM 2580 C CB  . LEU A 1 398 ? -20.607 -10.322 -22.977 1.00 134.26 ? 668 LEU A CB  1 
ATOM 2581 N N   . ASP A 1 399 ? -17.336 -10.480 -23.740 1.00 139.78 ? 669 ASP A N   1 
ATOM 2582 C CA  . ASP A 1 399 ? -16.072 -11.196 -23.788 1.00 145.14 ? 669 ASP A CA  1 
ATOM 2583 C C   . ASP A 1 399 ? -15.122 -10.570 -22.782 1.00 149.58 ? 669 ASP A C   1 
ATOM 2584 O O   . ASP A 1 399 ? -14.395 -11.278 -22.087 1.00 170.41 ? 669 ASP A O   1 
ATOM 2585 C CB  . ASP A 1 399 ? -15.463 -11.175 -25.188 1.00 155.25 ? 669 ASP A CB  1 
ATOM 2586 C CG  . ASP A 1 399 ? -16.105 -12.182 -26.115 1.00 178.17 ? 669 ASP A CG  1 
ATOM 2587 O OD1 . ASP A 1 399 ? -16.997 -12.926 -25.655 1.00 187.42 ? 669 ASP A OD1 1 
ATOM 2588 O OD2 . ASP A 1 399 ? -15.697 -12.253 -27.293 1.00 185.40 ? 669 ASP A OD2 1 
ATOM 2589 N N   . ILE A 1 400 ? -15.133 -9.243  -22.701 1.00 135.45 ? 670 ILE A N   1 
ATOM 2590 C CA  . ILE A 1 400 ? -14.308 -8.546  -21.725 1.00 128.14 ? 670 ILE A CA  1 
ATOM 2591 C C   . ILE A 1 400 ? -14.889 -8.832  -20.349 1.00 135.95 ? 670 ILE A C   1 
ATOM 2592 O O   . ILE A 1 400 ? -14.171 -9.256  -19.442 1.00 136.26 ? 670 ILE A O   1 
ATOM 2593 C CB  . ILE A 1 400 ? -14.257 -7.029  -21.973 1.00 114.96 ? 670 ILE A CB  1 
ATOM 2594 N N   . ASN A 1 401 ? -16.185 -8.580  -20.185 1.00 144.06 ? 671 ASN A N   1 
ATOM 2595 C CA  . ASN A 1 401 ? -16.826 -8.807  -18.898 1.00 141.95 ? 671 ASN A CA  1 
ATOM 2596 C C   . ASN A 1 401 ? -18.181 -9.488  -19.029 1.00 158.77 ? 671 ASN A C   1 
ATOM 2597 O O   . ASN A 1 401 ? -19.123 -8.903  -19.563 1.00 157.39 ? 671 ASN A O   1 
ATOM 2598 C CB  . ASN A 1 401 ? -17.006 -7.479  -18.165 1.00 124.27 ? 671 ASN A CB  1 
ATOM 2599 N N   . PRO A 1 402 ? -18.298 -10.715 -18.503 1.00 132.13 ? 672 PRO A N   1 
ATOM 2600 C CA  . PRO A 1 402 ? -19.624 -11.282 -18.247 1.00 161.93 ? 672 PRO A CA  1 
ATOM 2601 C C   . PRO A 1 402 ? -20.234 -10.684 -16.985 1.00 170.81 ? 672 PRO A C   1 
ATOM 2602 O O   . PRO A 1 402 ? -19.475 -10.357 -16.071 1.00 175.76 ? 672 PRO A O   1 
ATOM 2603 C CB  . PRO A 1 402 ? -19.350 -12.779 -18.080 1.00 143.41 ? 672 PRO A CB  1 
ATOM 2604 C CG  . PRO A 1 402 ? -17.908 -12.885 -17.725 1.00 142.24 ? 672 PRO A CG  1 
ATOM 2605 C CD  . PRO A 1 402 ? -17.202 -11.648 -18.190 1.00 135.32 ? 672 PRO A CD  1 
ATOM 2606 N N   . GLN A 1 403 ? -21.555 -10.509 -16.972 1.00 174.42 ? 673 GLN A N   1 
ATOM 2607 C CA  . GLN A 1 403 ? -22.285 -9.842  -15.888 1.00 165.88 ? 673 GLN A CA  1 
ATOM 2608 C C   . GLN A 1 403 ? -22.073 -8.337  -16.006 1.00 149.88 ? 673 GLN A C   1 
ATOM 2609 O O   . GLN A 1 403 ? -22.079 -7.617  -15.009 1.00 152.85 ? 673 GLN A O   1 
ATOM 2610 C CB  . GLN A 1 403 ? -21.877 -10.356 -14.502 1.00 157.99 ? 673 GLN A CB  1 
ATOM 2611 N N   . SER A 1 404 ? -21.890 -7.874  -17.237 1.00 134.03 ? 674 SER A N   1 
ATOM 2612 C CA  . SER A 1 404 ? -21.897 -6.452  -17.550 1.00 140.31 ? 674 SER A CA  1 
ATOM 2613 C C   . SER A 1 404 ? -23.284 -5.871  -17.345 1.00 147.24 ? 674 SER A C   1 
ATOM 2614 O O   . SER A 1 404 ? -23.438 -4.772  -16.809 1.00 139.02 ? 674 SER A O   1 
ATOM 2615 C CB  . SER A 1 404 ? -21.428 -6.216  -18.987 1.00 147.07 ? 674 SER A CB  1 
ATOM 2616 O OG  . SER A 1 404 ? -20.219 -6.907  -19.245 1.00 155.45 ? 674 SER A OG  1 
ATOM 2617 N N   . SER A 1 405 ? -24.285 -6.623  -17.789 1.00 158.14 ? 675 SER A N   1 
ATOM 2618 C CA  . SER A 1 405 ? -25.670 -6.172  -17.811 1.00 160.81 ? 675 SER A CA  1 
ATOM 2619 C C   . SER A 1 405 ? -26.153 -5.626  -16.467 1.00 160.79 ? 675 SER A C   1 
ATOM 2620 O O   . SER A 1 405 ? -26.872 -4.633  -16.434 1.00 155.35 ? 675 SER A O   1 
ATOM 2621 C CB  . SER A 1 405 ? -26.578 -7.324  -18.248 1.00 152.20 ? 675 SER A CB  1 
ATOM 2622 O OG  . SER A 1 405 ? -25.900 -8.212  -19.120 1.00 143.31 ? 675 SER A OG  1 
ATOM 2623 N N   . VAL A 1 406 ? -25.748 -6.256  -15.368 1.00 156.87 ? 676 VAL A N   1 
ATOM 2624 C CA  . VAL A 1 406 ? -26.226 -5.859  -14.043 1.00 160.12 ? 676 VAL A CA  1 
ATOM 2625 C C   . VAL A 1 406 ? -25.976 -4.369  -13.753 1.00 165.44 ? 676 VAL A C   1 
ATOM 2626 O O   . VAL A 1 406 ? -26.894 -3.665  -13.331 1.00 169.75 ? 676 VAL A O   1 
ATOM 2627 C CB  . VAL A 1 406 ? -25.611 -6.755  -12.919 1.00 181.70 ? 676 VAL A CB  1 
ATOM 2628 C CG1 . VAL A 1 406 ? -24.106 -6.552  -12.758 1.00 173.51 ? 676 VAL A CG1 1 
ATOM 2629 C CG2 . VAL A 1 406 ? -26.356 -6.550  -11.602 1.00 192.65 ? 676 VAL A CG2 1 
ATOM 2630 N N   . LEU A 1 407 ? -24.757 -3.886  -13.974 1.00 161.87 ? 677 LEU A N   1 
ATOM 2631 C CA  . LEU A 1 407 ? -24.414 -2.516  -13.617 1.00 156.07 ? 677 LEU A CA  1 
ATOM 2632 C C   . LEU A 1 407 ? -25.083 -1.503  -14.545 1.00 156.61 ? 677 LEU A C   1 
ATOM 2633 O O   . LEU A 1 407 ? -25.716 -0.553  -14.083 1.00 154.63 ? 677 LEU A O   1 
ATOM 2634 C CB  . LEU A 1 407 ? -22.896 -2.322  -13.642 1.00 149.59 ? 677 LEU A CB  1 
ATOM 2635 N N   . LEU A 1 408 ? -24.942 -1.706  -15.852 1.00 161.02 ? 678 LEU A N   1 
ATOM 2636 C CA  . LEU A 1 408 ? -25.400 -0.713  -16.819 1.00 174.50 ? 678 LEU A CA  1 
ATOM 2637 C C   . LEU A 1 408 ? -26.920 -0.699  -16.988 1.00 177.71 ? 678 LEU A C   1 
ATOM 2638 O O   . LEU A 1 408 ? -27.486 0.295   -17.443 1.00 188.95 ? 678 LEU A O   1 
ATOM 2639 C CB  . LEU A 1 408 ? -24.735 -0.949  -18.179 1.00 182.84 ? 678 LEU A CB  1 
ATOM 2640 C CG  . LEU A 1 408 ? -23.261 -0.555  -18.313 1.00 178.41 ? 678 LEU A CG  1 
ATOM 2641 C CD1 . LEU A 1 408 ? -22.345 -1.721  -17.966 1.00 171.49 ? 678 LEU A CD1 1 
ATOM 2642 C CD2 . LEU A 1 408 ? -22.968 -0.034  -19.713 1.00 177.62 ? 678 LEU A CD2 1 
ATOM 2643 N N   . CYS A 1 409 ? -27.579 -1.794  -16.620 1.00 166.20 ? 679 CYS A N   1 
ATOM 2644 C CA  . CYS A 1 409 ? -29.039 -1.817  -16.568 1.00 157.65 ? 679 CYS A CA  1 
ATOM 2645 C C   . CYS A 1 409 ? -29.562 -1.244  -15.258 1.00 152.74 ? 679 CYS A C   1 
ATOM 2646 O O   . CYS A 1 409 ? -30.658 -0.686  -15.213 1.00 156.66 ? 679 CYS A O   1 
ATOM 2647 C CB  . CYS A 1 409 ? -29.576 -3.236  -16.769 1.00 156.03 ? 679 CYS A CB  1 
ATOM 2648 S SG  . CYS A 1 409 ? -29.148 -3.982  -18.361 1.00 251.31 ? 679 CYS A SG  1 
ATOM 2649 N N   . HIS A 1 410 ? -28.779 -1.391  -14.193 1.00 144.81 ? 680 HIS A N   1 
ATOM 2650 C CA  . HIS A 1 410 ? -29.090 -0.728  -12.933 1.00 146.71 ? 680 HIS A CA  1 
ATOM 2651 C C   . HIS A 1 410 ? -29.082 0.781   -13.149 1.00 147.30 ? 680 HIS A C   1 
ATOM 2652 O O   . HIS A 1 410 ? -29.834 1.509   -12.502 1.00 150.92 ? 680 HIS A O   1 
ATOM 2653 C CB  . HIS A 1 410 ? -28.102 -1.128  -11.838 1.00 145.64 ? 680 HIS A CB  1 
ATOM 2654 C CG  . HIS A 1 410 ? -28.599 -0.861  -10.451 1.00 153.87 ? 680 HIS A CG  1 
ATOM 2655 N ND1 . HIS A 1 410 ? -29.208 0.323   -10.093 1.00 157.00 ? 680 HIS A ND1 1 
ATOM 2656 C CD2 . HIS A 1 410 ? -28.582 -1.627  -9.335  1.00 166.85 ? 680 HIS A CD2 1 
ATOM 2657 C CE1 . HIS A 1 410 ? -29.543 0.275   -8.816  1.00 168.53 ? 680 HIS A CE1 1 
ATOM 2658 N NE2 . HIS A 1 410 ? -29.174 -0.897  -8.332  1.00 176.17 ? 680 HIS A NE2 1 
ATOM 2659 N N   . ILE A 1 411 ? -28.196 1.244   -14.027 1.00 133.56 ? 681 ILE A N   1 
ATOM 2660 C CA  . ILE A 1 411 ? -28.059 2.667   -14.318 1.00 132.82 ? 681 ILE A CA  1 
ATOM 2661 C C   . ILE A 1 411 ? -29.413 3.212   -14.768 1.00 146.91 ? 681 ILE A C   1 
ATOM 2662 O O   . ILE A 1 411 ? -29.918 4.193   -14.222 1.00 149.40 ? 681 ILE A O   1 
ATOM 2663 C CB  . ILE A 1 411 ? -27.003 2.933   -15.404 1.00 124.09 ? 681 ILE A CB  1 
ATOM 2664 N N   . GLY A 1 412 ? -29.980 2.558   -15.779 1.00 169.96 ? 682 GLY A N   1 
ATOM 2665 C CA  . GLY A 1 412 ? -31.269 2.919   -16.348 1.00 178.47 ? 682 GLY A CA  1 
ATOM 2666 C C   . GLY A 1 412 ? -32.389 2.907   -15.323 1.00 173.01 ? 682 GLY A C   1 
ATOM 2667 O O   . GLY A 1 412 ? -33.361 3.654   -15.432 1.00 177.17 ? 682 GLY A O   1 
ATOM 2668 N N   . VAL A 1 413 ? -32.234 2.053   -14.318 1.00 158.44 ? 683 VAL A N   1 
ATOM 2669 C CA  . VAL A 1 413 ? -33.158 1.964   -13.192 1.00 149.15 ? 683 VAL A CA  1 
ATOM 2670 C C   . VAL A 1 413 ? -33.080 3.248   -12.382 1.00 147.27 ? 683 VAL A C   1 
ATOM 2671 O O   . VAL A 1 413 ? -34.097 3.892   -12.125 1.00 150.24 ? 683 VAL A O   1 
ATOM 2672 C CB  . VAL A 1 413 ? -32.860 0.755   -12.292 1.00 146.26 ? 683 VAL A CB  1 
ATOM 2673 C CG1 . VAL A 1 413 ? -33.592 0.885   -10.965 1.00 151.46 ? 683 VAL A CG1 1 
ATOM 2674 C CG2 . VAL A 1 413 ? -33.250 -0.526  -12.997 1.00 145.88 ? 683 VAL A CG2 1 
ATOM 2675 N N   . VAL A 1 414 ? -31.867 3.601   -11.972 1.00 151.63 ? 684 VAL A N   1 
ATOM 2676 C CA  . VAL A 1 414 ? -31.621 4.782   -11.152 1.00 151.58 ? 684 VAL A CA  1 
ATOM 2677 C C   . VAL A 1 414 ? -32.160 6.035   -11.842 1.00 156.65 ? 684 VAL A C   1 
ATOM 2678 O O   . VAL A 1 414 ? -32.649 6.952   -11.182 1.00 157.55 ? 684 VAL A O   1 
ATOM 2679 C CB  . VAL A 1 414 ? -30.120 4.965   -10.861 1.00 141.59 ? 684 VAL A CB  1 
ATOM 2680 N N   . GLN A 1 415 ? -32.059 6.076   -13.167 1.00 158.98 ? 685 GLN A N   1 
ATOM 2681 C CA  . GLN A 1 415 ? -32.540 7.217   -13.938 1.00 160.12 ? 685 GLN A CA  1 
ATOM 2682 C C   . GLN A 1 415 ? -34.070 7.258   -13.967 1.00 163.49 ? 685 GLN A C   1 
ATOM 2683 O O   . GLN A 1 415 ? -34.685 8.258   -13.596 1.00 166.86 ? 685 GLN A O   1 
ATOM 2684 C CB  . GLN A 1 415 ? -32.011 7.150   -15.373 1.00 164.29 ? 685 GLN A CB  1 
ATOM 2685 C CG  . GLN A 1 415 ? -30.512 7.337   -15.517 1.00 163.88 ? 685 GLN A CG  1 
ATOM 2686 C CD  . GLN A 1 415 ? -30.015 6.941   -16.895 1.00 172.13 ? 685 GLN A CD  1 
ATOM 2687 O OE1 . GLN A 1 415 ? -30.638 6.132   -17.583 1.00 188.46 ? 685 GLN A OE1 1 
ATOM 2688 N NE2 . GLN A 1 415 ? -28.890 7.513   -17.306 1.00 163.89 ? 685 GLN A NE2 1 
ATOM 2689 N N   . HIS A 1 416 ? -34.670 6.156   -14.408 1.00 170.16 ? 686 HIS A N   1 
ATOM 2690 C CA  . HIS A 1 416 ? -36.118 6.046   -14.595 1.00 193.34 ? 686 HIS A CA  1 
ATOM 2691 C C   . HIS A 1 416 ? -36.923 6.066   -13.295 1.00 207.47 ? 686 HIS A C   1 
ATOM 2692 O O   . HIS A 1 416 ? -38.149 6.174   -13.320 1.00 209.65 ? 686 HIS A O   1 
ATOM 2693 C CB  . HIS A 1 416 ? -36.446 4.769   -15.370 1.00 196.49 ? 686 HIS A CB  1 
ATOM 2694 N N   . ALA A 1 417 ? -36.235 5.969   -12.163 1.00 207.17 ? 687 ALA A N   1 
ATOM 2695 C CA  . ALA A 1 417 ? -36.870 6.167   -10.865 1.00 208.40 ? 687 ALA A CA  1 
ATOM 2696 C C   . ALA A 1 417 ? -36.864 7.634   -10.450 1.00 205.08 ? 687 ALA A C   1 
ATOM 2697 O O   . ALA A 1 417 ? -37.820 8.117   -9.843  1.00 213.06 ? 687 ALA A O   1 
ATOM 2698 C CB  . ALA A 1 417 ? -36.182 5.316   -9.807  1.00 213.72 ? 687 ALA A CB  1 
ATOM 2699 N N   . LEU A 1 418 ? -35.800 8.349   -10.796 1.00 280.16 ? 688 LEU A N   1 
ATOM 2700 C CA  . LEU A 1 418 ? -35.719 9.770   -10.488 1.00 267.37 ? 688 LEU A CA  1 
ATOM 2701 C C   . LEU A 1 418 ? -36.225 10.598  -11.663 1.00 262.42 ? 688 LEU A C   1 
ATOM 2702 O O   . LEU A 1 418 ? -35.660 11.638  -11.994 1.00 253.29 ? 688 LEU A O   1 
ATOM 2703 C CB  . LEU A 1 418 ? -34.281 10.168  -10.148 1.00 250.11 ? 688 LEU A CB  1 
ATOM 2704 N N   . THR A 1 427 ? -43.209 -4.366  -30.637 1.00 316.16 ? 697 THR A N   1 
ATOM 2705 C CA  . THR A 1 427 ? -41.782 -4.091  -30.516 1.00 302.10 ? 697 THR A CA  1 
ATOM 2706 C C   . THR A 1 427 ? -41.131 -5.082  -29.562 1.00 299.83 ? 697 THR A C   1 
ATOM 2707 O O   . THR A 1 427 ? -40.094 -5.671  -29.873 1.00 295.20 ? 697 THR A O   1 
ATOM 2708 C CB  . THR A 1 427 ? -41.518 -2.658  -30.024 1.00 297.59 ? 697 THR A CB  1 
ATOM 2709 N N   . LEU A 1 428 ? -41.749 -5.257  -28.398 1.00 304.92 ? 698 LEU A N   1 
ATOM 2710 C CA  . LEU A 1 428 ? -41.309 -6.263  -27.443 1.00 300.28 ? 698 LEU A CA  1 
ATOM 2711 C C   . LEU A 1 428 ? -41.378 -7.637  -28.092 1.00 301.30 ? 698 LEU A C   1 
ATOM 2712 O O   . LEU A 1 428 ? -40.554 -8.507  -27.809 1.00 302.50 ? 698 LEU A O   1 
ATOM 2713 C CB  . LEU A 1 428 ? -42.160 -6.223  -26.173 1.00 312.40 ? 698 LEU A CB  1 
ATOM 2714 N N   . ASN A 1 429 ? -42.358 -7.829  -28.973 1.00 305.98 ? 699 ASN A N   1 
ATOM 2715 C CA  . ASN A 1 429 ? -42.407 -9.065  -29.734 1.00 311.00 ? 699 ASN A CA  1 
ATOM 2716 C C   . ASN A 1 429 ? -41.501 -8.977  -30.954 1.00 302.33 ? 699 ASN A C   1 
ATOM 2717 O O   . ASN A 1 429 ? -40.937 -9.985  -31.381 1.00 303.34 ? 699 ASN A O   1 
ATOM 2718 C CB  . ASN A 1 429 ? -43.843 -9.369  -30.167 1.00 325.69 ? 699 ASN A CB  1 
ATOM 2719 N N   . LYS A 1 430 ? -41.389 -7.780  -31.530 1.00 297.78 ? 700 LYS A N   1 
ATOM 2720 C CA  . LYS A 1 430 ? -40.498 -7.562  -32.667 1.00 293.21 ? 700 LYS A CA  1 
ATOM 2721 C C   . LYS A 1 430 ? -39.091 -8.008  -32.281 1.00 285.29 ? 700 LYS A C   1 
ATOM 2722 O O   . LYS A 1 430 ? -38.399 -8.689  -33.037 1.00 284.66 ? 700 LYS A O   1 
ATOM 2723 C CB  . LYS A 1 430 ? -40.505 -6.100  -33.112 1.00 286.28 ? 700 LYS A CB  1 
ATOM 2724 N N   . ALA A 1 431 ? -38.689 -7.591  -31.082 1.00 287.29 ? 701 ALA A N   1 
ATOM 2725 C CA  . ALA A 1 431 ? -37.374 -7.887  -30.527 1.00 279.49 ? 701 ALA A CA  1 
ATOM 2726 C C   . ALA A 1 431 ? -37.156 -9.381  -30.351 1.00 282.56 ? 701 ALA A C   1 
ATOM 2727 O O   . ALA A 1 431 ? -36.124 -9.915  -30.747 1.00 278.26 ? 701 ALA A O   1 
ATOM 2728 C CB  . ALA A 1 431 ? -37.187 -7.168  -29.199 1.00 280.28 ? 701 ALA A CB  1 
ATOM 2729 N N   . ILE A 1 432 ? -38.143 -10.047 -29.754 1.00 286.52 ? 702 ILE A N   1 
ATOM 2730 C CA  . ILE A 1 432 ? -38.098 -11.491 -29.554 1.00 286.46 ? 702 ILE A CA  1 
ATOM 2731 C C   . ILE A 1 432 ? -38.009 -12.219 -30.889 1.00 284.15 ? 702 ILE A C   1 
ATOM 2732 O O   . ILE A 1 432 ? -37.342 -13.247 -31.003 1.00 288.33 ? 702 ILE A O   1 
ATOM 2733 C CB  . ILE A 1 432 ? -39.332 -11.992 -28.780 1.00 301.75 ? 702 ILE A CB  1 
ATOM 2734 N N   . VAL A 1 433 ? -38.688 -11.677 -31.894 1.00 284.65 ? 703 VAL A N   1 
ATOM 2735 C CA  . VAL A 1 433 ? -38.660 -12.236 -33.239 1.00 294.93 ? 703 VAL A CA  1 
ATOM 2736 C C   . VAL A 1 433 ? -37.248 -12.080 -33.788 1.00 285.40 ? 703 VAL A C   1 
ATOM 2737 O O   . VAL A 1 433 ? -36.676 -13.012 -34.350 1.00 296.19 ? 703 VAL A O   1 
ATOM 2738 C CB  . VAL A 1 433 ? -39.672 -11.553 -34.173 1.00 299.85 ? 703 VAL A CB  1 
ATOM 2739 N N   . ILE A 1 434 ? -36.708 -10.876 -33.637 1.00 265.31 ? 704 ILE A N   1 
ATOM 2740 C CA  . ILE A 1 434 ? -35.325 -10.587 -33.988 1.00 259.36 ? 704 ILE A CA  1 
ATOM 2741 C C   . ILE A 1 434 ? -34.372 -11.405 -33.124 1.00 253.91 ? 704 ILE A C   1 
ATOM 2742 O O   . ILE A 1 434 ? -33.350 -11.897 -33.605 1.00 255.31 ? 704 ILE A O   1 
ATOM 2743 C CB  . ILE A 1 434 ? -34.997 -9.091  -33.825 1.00 258.93 ? 704 ILE A CB  1 
ATOM 2744 N N   . ASP A 1 435 ? -34.715 -11.542 -31.846 1.00 275.57 ? 705 ASP A N   1 
ATOM 2745 C CA  . ASP A 1 435 ? -33.880 -12.273 -30.899 1.00 271.49 ? 705 ASP A CA  1 
ATOM 2746 C C   . ASP A 1 435 ? -33.689 -13.732 -31.280 1.00 274.57 ? 705 ASP A C   1 
ATOM 2747 O O   . ASP A 1 435 ? -32.741 -14.364 -30.814 1.00 285.34 ? 705 ASP A O   1 
ATOM 2748 C CB  . ASP A 1 435 ? -34.482 -12.197 -29.497 1.00 282.53 ? 705 ASP A CB  1 
ATOM 2749 N N   . PRO A 1 436 ? -34.616 -14.282 -32.083 1.00 269.90 ? 706 PRO A N   1 
ATOM 2750 C CA  . PRO A 1 436 ? -34.419 -15.646 -32.585 1.00 259.77 ? 706 PRO A CA  1 
ATOM 2751 C C   . PRO A 1 436 ? -33.005 -15.808 -33.137 1.00 254.38 ? 706 PRO A C   1 
ATOM 2752 O O   . PRO A 1 436 ? -32.271 -16.698 -32.708 1.00 221.26 ? 706 PRO A O   1 
ATOM 2753 C CB  . PRO A 1 436 ? -35.474 -15.781 -33.683 1.00 266.82 ? 706 PRO A CB  1 
ATOM 2754 N N   . LYS A 1 437 ? -32.646 -14.961 -34.099 1.00 218.15 ? 707 LYS A N   1 
ATOM 2755 C CA  . LYS A 1 437 ? -31.323 -15.019 -34.710 1.00 222.67 ? 707 LYS A CA  1 
ATOM 2756 C C   . LYS A 1 437 ? -30.170 -14.773 -33.725 1.00 219.67 ? 707 LYS A C   1 
ATOM 2757 O O   . LYS A 1 437 ? -29.157 -15.468 -33.784 1.00 198.68 ? 707 LYS A O   1 
ATOM 2758 C CB  . LYS A 1 437 ? -31.237 -14.009 -35.858 1.00 210.14 ? 707 LYS A CB  1 
ATOM 2759 N N   . ASN A 1 438 ? -30.316 -13.800 -32.823 1.00 226.22 ? 708 ASN A N   1 
ATOM 2760 C CA  . ASN A 1 438 ? -29.164 -13.361 -32.027 1.00 212.01 ? 708 ASN A CA  1 
ATOM 2761 C C   . ASN A 1 438 ? -29.419 -13.178 -30.521 1.00 199.15 ? 708 ASN A C   1 
ATOM 2762 O O   . ASN A 1 438 ? -30.208 -12.321 -30.119 1.00 191.44 ? 708 ASN A O   1 
ATOM 2763 C CB  . ASN A 1 438 ? -28.619 -12.050 -32.601 1.00 197.43 ? 708 ASN A CB  1 
ATOM 2764 N N   . PRO A 1 439 ? -28.736 -13.992 -29.695 1.00 204.46 ? 709 PRO A N   1 
ATOM 2765 C CA  . PRO A 1 439 ? -28.934 -14.224 -28.254 1.00 207.08 ? 709 PRO A CA  1 
ATOM 2766 C C   . PRO A 1 439 ? -28.787 -13.023 -27.308 1.00 196.53 ? 709 PRO A C   1 
ATOM 2767 O O   . PRO A 1 439 ? -29.637 -12.799 -26.445 1.00 201.67 ? 709 PRO A O   1 
ATOM 2768 C CB  . PRO A 1 439 ? -27.864 -15.265 -27.926 1.00 202.16 ? 709 PRO A CB  1 
ATOM 2769 C CG  . PRO A 1 439 ? -26.788 -15.001 -28.900 1.00 199.12 ? 709 PRO A CG  1 
ATOM 2770 C CD  . PRO A 1 439 ? -27.504 -14.645 -30.172 1.00 206.32 ? 709 PRO A CD  1 
ATOM 2771 N N   . LEU A 1 440 ? -27.693 -12.280 -27.467 1.00 185.29 ? 710 LEU A N   1 
ATOM 2772 C CA  . LEU A 1 440 ? -27.302 -11.249 -26.500 1.00 178.14 ? 710 LEU A CA  1 
ATOM 2773 C C   . LEU A 1 440 ? -28.197 -10.032 -26.454 1.00 186.43 ? 710 LEU A C   1 
ATOM 2774 O O   . LEU A 1 440 ? -28.342 -9.409  -25.403 1.00 193.24 ? 710 LEU A O   1 
ATOM 2775 C CB  . LEU A 1 440 ? -25.862 -10.804 -26.744 1.00 168.84 ? 710 LEU A CB  1 
ATOM 2776 C CG  . LEU A 1 440 ? -24.852 -11.943 -26.681 1.00 173.90 ? 710 LEU A CG  1 
ATOM 2777 C CD1 . LEU A 1 440 ? -23.512 -11.514 -27.240 1.00 182.34 ? 710 LEU A CD1 1 
ATOM 2778 C CD2 . LEU A 1 440 ? -24.732 -12.426 -25.252 1.00 162.05 ? 710 LEU A CD2 1 
ATOM 2779 N N   . CYS A 1 441 ? -28.758 -9.661  -27.597 1.00 196.94 ? 711 CYS A N   1 
ATOM 2780 C CA  . CYS A 1 441 ? -29.745 -8.597  -27.619 1.00 209.76 ? 711 CYS A CA  1 
ATOM 2781 C C   . CYS A 1 441 ? -30.915 -8.985  -26.722 1.00 226.18 ? 711 CYS A C   1 
ATOM 2782 O O   . CYS A 1 441 ? -31.372 -8.193  -25.899 1.00 234.51 ? 711 CYS A O   1 
ATOM 2783 C CB  . CYS A 1 441 ? -30.214 -8.345  -29.050 1.00 221.53 ? 711 CYS A CB  1 
ATOM 2784 S SG  . CYS A 1 441 ? -28.875 -8.364  -30.268 1.00 260.89 ? 711 CYS A SG  1 
ATOM 2785 N N   . LYS A 1 442 ? -31.402 -10.209 -26.911 1.00 225.80 ? 712 LYS A N   1 
ATOM 2786 C CA  . LYS A 1 442 ? -32.446 -10.790 -26.072 1.00 226.22 ? 712 LYS A CA  1 
ATOM 2787 C C   . LYS A 1 442 ? -32.060 -10.776 -24.596 1.00 222.14 ? 712 LYS A C   1 
ATOM 2788 O O   . LYS A 1 442 ? -32.842 -10.379 -23.734 1.00 228.20 ? 712 LYS A O   1 
ATOM 2789 C CB  . LYS A 1 442 ? -32.757 -12.220 -26.510 1.00 231.82 ? 712 LYS A CB  1 
ATOM 2790 N N   . PHE A 1 443 ? -30.845 -11.246 -24.327 1.00 213.62 ? 713 PHE A N   1 
ATOM 2791 C CA  . PHE A 1 443 ? -30.308 -11.347 -22.973 1.00 206.02 ? 713 PHE A CA  1 
ATOM 2792 C C   . PHE A 1 443 ? -30.342 -10.013 -22.235 1.00 207.23 ? 713 PHE A C   1 
ATOM 2793 O O   . PHE A 1 443 ? -30.571 -9.972  -21.026 1.00 208.49 ? 713 PHE A O   1 
ATOM 2794 C CB  . PHE A 1 443 ? -28.881 -11.895 -23.004 1.00 191.52 ? 713 PHE A CB  1 
ATOM 2795 C CG  . PHE A 1 443 ? -28.289 -12.108 -21.641 1.00 182.59 ? 713 PHE A CG  1 
ATOM 2796 C CD1 . PHE A 1 443 ? -28.552 -13.272 -20.937 1.00 182.37 ? 713 PHE A CD1 1 
ATOM 2797 C CD2 . PHE A 1 443 ? -27.473 -11.151 -21.062 1.00 179.34 ? 713 PHE A CD2 1 
ATOM 2798 C CE1 . PHE A 1 443 ? -28.014 -13.477 -19.682 1.00 187.18 ? 713 PHE A CE1 1 
ATOM 2799 C CE2 . PHE A 1 443 ? -26.932 -11.350 -19.806 1.00 179.22 ? 713 PHE A CE2 1 
ATOM 2800 C CZ  . PHE A 1 443 ? -27.203 -12.515 -19.115 1.00 185.99 ? 713 PHE A CZ  1 
ATOM 2801 N N   . HIS A 1 444 ? -30.101 -8.927  -22.961 1.00 218.61 ? 714 HIS A N   1 
ATOM 2802 C CA  . HIS A 1 444 ? -30.201 -7.602  -22.371 1.00 219.81 ? 714 HIS A CA  1 
ATOM 2803 C C   . HIS A 1 444 ? -31.651 -7.336  -21.979 1.00 231.67 ? 714 HIS A C   1 
ATOM 2804 O O   . HIS A 1 444 ? -31.924 -6.874  -20.872 1.00 241.94 ? 714 HIS A O   1 
ATOM 2805 C CB  . HIS A 1 444 ? -29.711 -6.537  -23.353 1.00 215.18 ? 714 HIS A CB  1 
ATOM 2806 C CG  . HIS A 1 444 ? -29.918 -5.134  -22.878 1.00 208.97 ? 714 HIS A CG  1 
ATOM 2807 N ND1 . HIS A 1 444 ? -29.200 -4.583  -21.838 1.00 208.01 ? 714 HIS A ND1 1 
ATOM 2808 C CD2 . HIS A 1 444 ? -30.792 -4.180  -23.277 1.00 213.72 ? 714 HIS A CD2 1 
ATOM 2809 C CE1 . HIS A 1 444 ? -29.604 -3.342  -21.636 1.00 210.60 ? 714 HIS A CE1 1 
ATOM 2810 N NE2 . HIS A 1 444 ? -30.572 -3.074  -22.493 1.00 213.03 ? 714 HIS A NE2 1 
ATOM 2811 N N   . ARG A 1 445 ? -32.573 -7.628  -22.894 1.00 241.42 ? 715 ARG A N   1 
ATOM 2812 C CA  . ARG A 1 445 ? -34.007 -7.466  -22.649 1.00 245.71 ? 715 ARG A CA  1 
ATOM 2813 C C   . ARG A 1 445 ? -34.482 -8.176  -21.379 1.00 240.27 ? 715 ARG A C   1 
ATOM 2814 O O   . ARG A 1 445 ? -35.433 -7.736  -20.733 1.00 255.27 ? 715 ARG A O   1 
ATOM 2815 C CB  . ARG A 1 445 ? -34.815 -7.966  -23.849 1.00 256.87 ? 715 ARG A CB  1 
ATOM 2816 N N   . ALA A 1 446 ? -33.816 -9.271  -21.023 1.00 224.66 ? 716 ALA A N   1 
ATOM 2817 C CA  . ALA A 1 446 ? -34.107 -9.965  -19.774 1.00 221.33 ? 716 ALA A CA  1 
ATOM 2818 C C   . ALA A 1 446 ? -33.454 -9.237  -18.609 1.00 208.68 ? 716 ALA A C   1 
ATOM 2819 O O   . ALA A 1 446 ? -34.092 -8.976  -17.589 1.00 217.61 ? 716 ALA A O   1 
ATOM 2820 C CB  . ALA A 1 446 ? -33.633 -11.408 -19.838 1.00 224.51 ? 716 ALA A CB  1 
ATOM 2821 N N   . SER A 1 447 ? -32.172 -8.926  -18.766 1.00 202.33 ? 717 SER A N   1 
ATOM 2822 C CA  . SER A 1 447 ? -31.415 -8.224  -17.739 1.00 185.65 ? 717 SER A CA  1 
ATOM 2823 C C   . SER A 1 447 ? -32.042 -6.862  -17.459 1.00 194.46 ? 717 SER A C   1 
ATOM 2824 O O   . SER A 1 447 ? -32.014 -6.371  -16.331 1.00 209.32 ? 717 SER A O   1 
ATOM 2825 C CB  . SER A 1 447 ? -29.958 -8.064  -18.161 1.00 177.56 ? 717 SER A CB  1 
ATOM 2826 N N   . VAL A 1 448 ? -32.597 -6.253  -18.502 1.00 197.59 ? 718 VAL A N   1 
ATOM 2827 C CA  . VAL A 1 448 ? -33.291 -4.978  -18.373 1.00 198.98 ? 718 VAL A CA  1 
ATOM 2828 C C   . VAL A 1 448 ? -34.576 -5.115  -17.558 1.00 212.68 ? 718 VAL A C   1 
ATOM 2829 O O   . VAL A 1 448 ? -34.989 -4.177  -16.877 1.00 228.60 ? 718 VAL A O   1 
ATOM 2830 C CB  . VAL A 1 448 ? -33.637 -4.383  -19.753 1.00 204.30 ? 718 VAL A CB  1 
ATOM 2831 N N   . LEU A 1 449 ? -35.206 -6.283  -17.639 1.00 213.23 ? 719 LEU A N   1 
ATOM 2832 C CA  . LEU A 1 449 ? -36.393 -6.579  -16.836 1.00 234.45 ? 719 LEU A CA  1 
ATOM 2833 C C   . LEU A 1 449 ? -36.128 -6.920  -15.365 1.00 233.76 ? 719 LEU A C   1 
ATOM 2834 O O   . LEU A 1 449 ? -36.878 -6.494  -14.487 1.00 237.74 ? 719 LEU A O   1 
ATOM 2835 C CB  . LEU A 1 449 ? -37.168 -7.731  -17.480 1.00 211.60 ? 719 LEU A CB  1 
ATOM 2836 N N   . PHE A 1 450 ? -35.070 -7.681  -15.097 1.00 220.81 ? 720 PHE A N   1 
ATOM 2837 C CA  . PHE A 1 450 ? -34.704 -8.035  -13.724 1.00 216.34 ? 720 PHE A CA  1 
ATOM 2838 C C   . PHE A 1 450 ? -34.284 -6.806  -12.919 1.00 206.61 ? 720 PHE A C   1 
ATOM 2839 O O   . PHE A 1 450 ? -34.557 -6.712  -11.724 1.00 206.67 ? 720 PHE A O   1 
ATOM 2840 C CB  . PHE A 1 450 ? -33.591 -9.084  -13.694 1.00 192.55 ? 720 PHE A CB  1 
ATOM 2841 C CG  . PHE A 1 450 ? -33.036 -9.335  -12.317 1.00 191.67 ? 720 PHE A CG  1 
ATOM 2842 C CD1 . PHE A 1 450 ? -33.800 -9.995  -11.366 1.00 201.63 ? 720 PHE A CD1 1 
ATOM 2843 C CD2 . PHE A 1 450 ? -31.762 -8.919  -11.971 1.00 187.61 ? 720 PHE A CD2 1 
ATOM 2844 C CE1 . PHE A 1 450 ? -33.307 -10.232 -10.096 1.00 206.66 ? 720 PHE A CE1 1 
ATOM 2845 C CE2 . PHE A 1 450 ? -31.261 -9.155  -10.700 1.00 189.23 ? 720 PHE A CE2 1 
ATOM 2846 C CZ  . PHE A 1 450 ? -32.036 -9.812  -9.763  1.00 201.12 ? 720 PHE A CZ  1 
ATOM 2847 N N   . ALA A 1 451 ? -33.592 -5.885  -13.581 1.00 220.53 ? 721 ALA A N   1 
ATOM 2848 C CA  . ALA A 1 451 ? -33.161 -4.632  -12.966 1.00 229.46 ? 721 ALA A CA  1 
ATOM 2849 C C   . ALA A 1 451 ? -34.355 -3.776  -12.545 1.00 247.49 ? 721 ALA A C   1 
ATOM 2850 O O   . ALA A 1 451 ? -34.359 -3.197  -11.459 1.00 255.39 ? 721 ALA A O   1 
ATOM 2851 C CB  . ALA A 1 451 ? -32.263 -3.861  -13.919 1.00 226.46 ? 721 ALA A CB  1 
ATOM 2852 N N   . ASN A 1 452 ? -35.364 -3.698  -13.405 1.00 257.65 ? 722 ASN A N   1 
ATOM 2853 C CA  . ASN A 1 452 ? -36.672 -3.195  -12.998 1.00 297.11 ? 722 ASN A CA  1 
ATOM 2854 C C   . ASN A 1 452 ? -37.310 -4.173  -12.019 1.00 221.27 ? 722 ASN A C   1 
ATOM 2855 O O   . ASN A 1 452 ? -36.856 -5.308  -11.894 1.00 219.01 ? 722 ASN A O   1 
ATOM 2856 C CB  . ASN A 1 452 ? -37.579 -2.980  -14.210 1.00 215.03 ? 722 ASN A CB  1 
ATOM 2857 N N   . GLU A 1 453 ? -38.362 -3.752  -11.323 1.00 232.69 ? 723 GLU A N   1 
ATOM 2858 C CA  . GLU A 1 453 ? -38.952 -4.622  -10.312 1.00 242.90 ? 723 GLU A CA  1 
ATOM 2859 C C   . GLU A 1 453 ? -39.925 -5.631  -10.915 1.00 274.11 ? 723 GLU A C   1 
ATOM 2860 O O   . GLU A 1 453 ? -40.848 -6.099  -10.249 1.00 286.05 ? 723 GLU A O   1 
ATOM 2861 C CB  . GLU A 1 453 ? -39.669 -3.785  -9.249  1.00 253.29 ? 723 GLU A CB  1 
ATOM 2862 N N   . LYS A 1 454 ? -39.706 -5.948  -12.187 1.00 257.59 ? 724 LYS A N   1 
ATOM 2863 C CA  . LYS A 1 454 ? -40.617 -6.781  -12.960 1.00 270.14 ? 724 LYS A CA  1 
ATOM 2864 C C   . LYS A 1 454 ? -40.013 -8.177  -13.109 1.00 273.61 ? 724 LYS A C   1 
ATOM 2865 O O   . LYS A 1 454 ? -39.495 -8.522  -14.170 1.00 260.63 ? 724 LYS A O   1 
ATOM 2866 C CB  . LYS A 1 454 ? -40.899 -6.161  -14.328 1.00 260.72 ? 724 LYS A CB  1 
ATOM 2867 N N   . TYR A 1 455 ? -40.071 -8.972  -12.047 1.00 282.09 ? 725 TYR A N   1 
ATOM 2868 C CA  . TYR A 1 455 ? -39.241 -10.169 -11.939 1.00 291.58 ? 725 TYR A CA  1 
ATOM 2869 C C   . TYR A 1 455 ? -39.818 -11.335 -12.747 1.00 256.41 ? 725 TYR A C   1 
ATOM 2870 O O   . TYR A 1 455 ? -39.081 -12.091 -13.381 1.00 249.84 ? 725 TYR A O   1 
ATOM 2871 C CB  . TYR A 1 455 ? -39.065 -10.555 -10.469 1.00 253.72 ? 725 TYR A CB  1 
ATOM 2872 C CG  . TYR A 1 455 ? -38.245 -9.547  -9.689  1.00 248.78 ? 725 TYR A CG  1 
ATOM 2873 C CD1 . TYR A 1 455 ? -37.388 -8.668  -10.341 1.00 236.05 ? 725 TYR A CD1 1 
ATOM 2874 C CD2 . TYR A 1 455 ? -38.335 -9.466  -8.305  1.00 251.87 ? 725 TYR A CD2 1 
ATOM 2875 C CE1 . TYR A 1 455 ? -36.641 -7.742  -9.637  1.00 229.14 ? 725 TYR A CE1 1 
ATOM 2876 C CE2 . TYR A 1 455 ? -37.590 -8.542  -7.593  1.00 245.88 ? 725 TYR A CE2 1 
ATOM 2877 C CZ  . TYR A 1 455 ? -36.745 -7.683  -8.265  1.00 234.09 ? 725 TYR A CZ  1 
ATOM 2878 O OH  . TYR A 1 455 ? -36.002 -6.763  -7.562  1.00 229.04 ? 725 TYR A OH  1 
ATOM 2879 N N   . LYS A 1 456 ? -41.140 -11.465 -12.712 1.00 283.40 ? 726 LYS A N   1 
ATOM 2880 C CA  . LYS A 1 456 ? -41.868 -12.519 -13.418 1.00 302.94 ? 726 LYS A CA  1 
ATOM 2881 C C   . LYS A 1 456 ? -41.692 -12.457 -14.936 1.00 301.15 ? 726 LYS A C   1 
ATOM 2882 O O   . LYS A 1 456 ? -41.378 -13.461 -15.572 1.00 300.88 ? 726 LYS A O   1 
ATOM 2883 C CB  . LYS A 1 456 ? -43.357 -12.454 -13.072 1.00 295.67 ? 726 LYS A CB  1 
ATOM 2884 N N   . SER A 1 457 ? -41.907 -11.277 -15.507 1.00 295.90 ? 727 SER A N   1 
ATOM 2885 C CA  . SER A 1 457 ? -41.759 -11.054 -16.945 1.00 291.63 ? 727 SER A CA  1 
ATOM 2886 C C   . SER A 1 457 ? -40.394 -11.504 -17.472 1.00 275.11 ? 727 SER A C   1 
ATOM 2887 O O   . SER A 1 457 ? -40.278 -11.951 -18.612 1.00 278.27 ? 727 SER A O   1 
ATOM 2888 C CB  . SER A 1 457 ? -41.979 -9.576  -17.273 1.00 286.13 ? 727 SER A CB  1 
ATOM 2889 N N   . ALA A 1 458 ? -39.371 -11.379 -16.635 1.00 256.51 ? 728 ALA A N   1 
ATOM 2890 C CA  . ALA A 1 458 ? -38.020 -11.819 -16.973 1.00 243.54 ? 728 ALA A CA  1 
ATOM 2891 C C   . ALA A 1 458 ? -37.911 -13.330 -17.214 1.00 243.52 ? 728 ALA A C   1 
ATOM 2892 O O   . ALA A 1 458 ? -37.234 -13.760 -18.146 1.00 235.69 ? 728 ALA A O   1 
ATOM 2893 C CB  . ALA A 1 458 ? -37.049 -11.398 -15.880 1.00 245.19 ? 728 ALA A CB  1 
ATOM 2894 N N   . LEU A 1 459 ? -38.575 -14.131 -16.384 1.00 246.27 ? 729 LEU A N   1 
ATOM 2895 C CA  . LEU A 1 459 ? -38.434 -15.589 -16.443 1.00 250.74 ? 729 LEU A CA  1 
ATOM 2896 C C   . LEU A 1 459 ? -39.114 -16.222 -17.661 1.00 264.75 ? 729 LEU A C   1 
ATOM 2897 O O   . LEU A 1 459 ? -38.663 -17.255 -18.155 1.00 267.49 ? 729 LEU A O   1 
ATOM 2898 C CB  . LEU A 1 459 ? -38.978 -16.231 -15.157 1.00 260.53 ? 729 LEU A CB  1 
ATOM 2899 C CG  . LEU A 1 459 ? -40.490 -16.369 -14.934 1.00 276.75 ? 729 LEU A CG  1 
ATOM 2900 C CD1 . LEU A 1 459 ? -41.024 -17.721 -15.404 1.00 289.01 ? 729 LEU A CD1 1 
ATOM 2901 C CD2 . LEU A 1 459 ? -40.840 -16.135 -13.472 1.00 282.17 ? 729 LEU A CD2 1 
ATOM 2902 N N   . GLN A 1 460 ? -40.195 -15.612 -18.137 1.00 272.21 ? 730 GLN A N   1 
ATOM 2903 C CA  . GLN A 1 460 ? -40.818 -16.034 -19.390 1.00 276.85 ? 730 GLN A CA  1 
ATOM 2904 C C   . GLN A 1 460 ? -39.852 -15.863 -20.562 1.00 262.02 ? 730 GLN A C   1 
ATOM 2905 O O   . GLN A 1 460 ? -39.589 -16.808 -21.306 1.00 264.05 ? 730 GLN A O   1 
ATOM 2906 C CB  . GLN A 1 460 ? -42.105 -15.247 -19.644 1.00 281.79 ? 730 GLN A CB  1 
ATOM 2907 N N   . GLU A 1 461 ? -39.339 -14.647 -20.720 1.00 251.37 ? 731 GLU A N   1 
ATOM 2908 C CA  . GLU A 1 461 ? -38.369 -14.318 -21.762 1.00 240.64 ? 731 GLU A CA  1 
ATOM 2909 C C   . GLU A 1 461 ? -37.075 -15.119 -21.621 1.00 232.90 ? 731 GLU A C   1 
ATOM 2910 O O   . GLU A 1 461 ? -36.425 -15.449 -22.614 1.00 228.98 ? 731 GLU A O   1 
ATOM 2911 C CB  . GLU A 1 461 ? -38.053 -12.822 -21.740 1.00 231.34 ? 731 GLU A CB  1 
ATOM 2912 N N   . LEU A 1 462 ? -36.714 -15.429 -20.380 1.00 243.19 ? 732 LEU A N   1 
ATOM 2913 C CA  . LEU A 1 462 ? -35.497 -16.176 -20.079 1.00 224.12 ? 732 LEU A CA  1 
ATOM 2914 C C   . LEU A 1 462 ? -35.535 -17.609 -20.605 1.00 231.19 ? 732 LEU A C   1 
ATOM 2915 O O   . LEU A 1 462 ? -34.606 -18.037 -21.289 1.00 225.57 ? 732 LEU A O   1 
ATOM 2916 C CB  . LEU A 1 462 ? -35.243 -16.188 -18.570 1.00 222.35 ? 732 LEU A CB  1 
ATOM 2917 N N   . GLU A 1 463 ? -36.588 -18.352 -20.280 1.00 244.19 ? 733 GLU A N   1 
ATOM 2918 C CA  . GLU A 1 463 ? -36.684 -19.745 -20.709 1.00 252.53 ? 733 GLU A CA  1 
ATOM 2919 C C   . GLU A 1 463 ? -36.700 -19.841 -22.233 1.00 254.02 ? 733 GLU A C   1 
ATOM 2920 O O   . GLU A 1 463 ? -36.078 -20.734 -22.810 1.00 254.12 ? 733 GLU A O   1 
ATOM 2921 C CB  . GLU A 1 463 ? -37.935 -20.405 -20.125 1.00 267.75 ? 733 GLU A CB  1 
ATOM 2922 N N   . GLU A 1 464 ? -37.434 -18.936 -22.873 1.00 257.96 ? 734 GLU A N   1 
ATOM 2923 C CA  . GLU A 1 464 ? -37.438 -18.819 -24.330 1.00 259.96 ? 734 GLU A CA  1 
ATOM 2924 C C   . GLU A 1 464 ? -36.025 -18.696 -24.908 1.00 249.78 ? 734 GLU A C   1 
ATOM 2925 O O   . GLU A 1 464 ? -35.741 -19.199 -25.995 1.00 246.27 ? 734 GLU A O   1 
ATOM 2926 C CB  . GLU A 1 464 ? -38.280 -17.617 -24.763 1.00 262.51 ? 734 GLU A CB  1 
ATOM 2927 N N   . LEU A 1 465 ? -35.147 -18.027 -24.166 1.00 242.74 ? 735 LEU A N   1 
ATOM 2928 C CA  . LEU A 1 465 ? -33.733 -17.921 -24.523 1.00 232.08 ? 735 LEU A CA  1 
ATOM 2929 C C   . LEU A 1 465 ? -32.906 -19.131 -24.088 1.00 220.03 ? 735 LEU A C   1 
ATOM 2930 O O   . LEU A 1 465 ? -31.957 -19.513 -24.773 1.00 215.82 ? 735 LEU A O   1 
ATOM 2931 C CB  . LEU A 1 465 ? -33.134 -16.647 -23.922 1.00 208.90 ? 735 LEU A CB  1 
ATOM 2932 N N   . LYS A 1 466 ? -33.253 -19.715 -22.944 1.00 224.47 ? 736 LYS A N   1 
ATOM 2933 C CA  . LYS A 1 466 ? -32.574 -20.912 -22.448 1.00 224.91 ? 736 LYS A CA  1 
ATOM 2934 C C   . LYS A 1 466 ? -32.622 -22.040 -23.477 1.00 233.30 ? 736 LYS A C   1 
ATOM 2935 O O   . LYS A 1 466 ? -31.697 -22.845 -23.585 1.00 230.85 ? 736 LYS A O   1 
ATOM 2936 C CB  . LYS A 1 466 ? -33.200 -21.375 -21.131 1.00 231.17 ? 736 LYS A CB  1 
ATOM 2937 N N   . GLN A 1 467 ? -33.718 -22.081 -24.226 1.00 243.83 ? 737 GLN A N   1 
ATOM 2938 C CA  . GLN A 1 467 ? -33.892 -22.997 -25.348 1.00 259.05 ? 737 GLN A CA  1 
ATOM 2939 C C   . GLN A 1 467 ? -33.074 -22.573 -26.567 1.00 256.36 ? 737 GLN A C   1 
ATOM 2940 O O   . GLN A 1 467 ? -32.531 -23.410 -27.289 1.00 267.62 ? 737 GLN A O   1 
ATOM 2941 C CB  . GLN A 1 467 ? -35.371 -23.095 -25.724 1.00 269.95 ? 737 GLN A CB  1 
ATOM 2942 N N   . ILE A 1 468 ? -32.987 -21.265 -26.779 1.00 242.46 ? 738 ILE A N   1 
ATOM 2943 C CA  . ILE A 1 468 ? -32.193 -20.685 -27.859 1.00 238.84 ? 738 ILE A CA  1 
ATOM 2944 C C   . ILE A 1 468 ? -30.684 -20.856 -27.701 1.00 244.11 ? 738 ILE A C   1 
ATOM 2945 O O   . ILE A 1 468 ? -29.971 -21.006 -28.694 1.00 239.38 ? 738 ILE A O   1 
ATOM 2946 C CB  . ILE A 1 468 ? -32.486 -19.179 -28.006 1.00 224.42 ? 738 ILE A CB  1 
ATOM 2947 N N   . VAL A 1 469 ? -30.192 -20.834 -26.468 1.00 185.04 ? 739 VAL A N   1 
ATOM 2948 C CA  . VAL A 1 469 ? -28.772 -21.072 -26.234 1.00 175.35 ? 739 VAL A CA  1 
ATOM 2949 C C   . VAL A 1 469 ? -28.511 -21.871 -24.967 1.00 161.95 ? 739 VAL A C   1 
ATOM 2950 O O   . VAL A 1 469 ? -28.468 -21.314 -23.870 1.00 164.44 ? 739 VAL A O   1 
ATOM 2951 C CB  . VAL A 1 469 ? -27.990 -19.747 -26.144 1.00 168.34 ? 739 VAL A CB  1 
ATOM 2952 N N   . PRO A 1 470 ? -28.328 -23.191 -25.124 1.00 157.56 ? 740 PRO A N   1 
ATOM 2953 C CA  . PRO A 1 470 ? -27.979 -24.030 -23.976 1.00 157.41 ? 740 PRO A CA  1 
ATOM 2954 C C   . PRO A 1 470 ? -26.471 -24.090 -23.799 1.00 169.82 ? 740 PRO A C   1 
ATOM 2955 O O   . PRO A 1 470 ? -25.967 -24.845 -22.971 1.00 165.58 ? 740 PRO A O   1 
ATOM 2956 C CB  . PRO A 1 470 ? -28.539 -25.401 -24.359 1.00 161.00 ? 740 PRO A CB  1 
ATOM 2957 N N   . LYS A 1 471 ? -25.758 -23.304 -24.595 1.00 190.49 ? 741 LYS A N   1 
ATOM 2958 C CA  . LYS A 1 471 ? -24.306 -23.285 -24.534 1.00 201.37 ? 741 LYS A CA  1 
ATOM 2959 C C   . LYS A 1 471 ? -23.853 -22.300 -23.460 1.00 198.32 ? 741 LYS A C   1 
ATOM 2960 O O   . LYS A 1 471 ? -22.946 -22.586 -22.680 1.00 193.44 ? 741 LYS A O   1 
ATOM 2961 C CB  . LYS A 1 471 ? -23.706 -22.924 -25.893 1.00 199.18 ? 741 LYS A CB  1 
ATOM 2962 N N   . GLU A 1 472 ? -24.471 -21.121 -23.459 1.00 190.13 ? 742 GLU A N   1 
ATOM 2963 C CA  . GLU A 1 472 ? -23.968 -19.980 -22.698 1.00 172.31 ? 742 GLU A CA  1 
ATOM 2964 C C   . GLU A 1 472 ? -24.227 -20.091 -21.197 1.00 172.32 ? 742 GLU A C   1 
ATOM 2965 O O   . GLU A 1 472 ? -25.370 -20.254 -20.762 1.00 170.68 ? 742 GLU A O   1 
ATOM 2966 C CB  . GLU A 1 472 ? -24.582 -18.684 -23.228 1.00 157.11 ? 742 GLU A CB  1 
ATOM 2967 N N   . SER A 1 473 ? -23.157 -19.998 -20.413 1.00 175.47 ? 743 SER A N   1 
ATOM 2968 C CA  . SER A 1 473 ? -23.256 -19.959 -18.957 1.00 173.52 ? 743 SER A CA  1 
ATOM 2969 C C   . SER A 1 473 ? -24.145 -18.814 -18.471 1.00 160.54 ? 743 SER A C   1 
ATOM 2970 O O   . SER A 1 473 ? -24.848 -18.944 -17.468 1.00 158.78 ? 743 SER A O   1 
ATOM 2971 C CB  . SER A 1 473 ? -21.863 -19.834 -18.338 1.00 175.77 ? 743 SER A CB  1 
ATOM 2972 O OG  . SER A 1 473 ? -20.982 -20.810 -18.866 1.00 179.00 ? 743 SER A OG  1 
ATOM 2973 N N   . LEU A 1 474 ? -24.092 -17.693 -19.189 1.00 148.36 ? 744 LEU A N   1 
ATOM 2974 C CA  . LEU A 1 474 ? -24.873 -16.494 -18.877 1.00 137.06 ? 744 LEU A CA  1 
ATOM 2975 C C   . LEU A 1 474 ? -26.352 -16.776 -18.624 1.00 150.78 ? 744 LEU A C   1 
ATOM 2976 O O   . LEU A 1 474 ? -26.963 -16.189 -17.730 1.00 153.23 ? 744 LEU A O   1 
ATOM 2977 C CB  . LEU A 1 474 ? -24.735 -15.470 -20.006 1.00 125.31 ? 744 LEU A CB  1 
ATOM 2978 N N   . VAL A 1 475 ? -26.919 -17.674 -19.422 1.00 163.38 ? 745 VAL A N   1 
ATOM 2979 C CA  . VAL A 1 475 ? -28.323 -18.051 -19.301 1.00 166.06 ? 745 VAL A CA  1 
ATOM 2980 C C   . VAL A 1 475 ? -28.621 -18.782 -17.994 1.00 163.83 ? 745 VAL A C   1 
ATOM 2981 O O   . VAL A 1 475 ? -29.621 -18.501 -17.334 1.00 168.12 ? 745 VAL A O   1 
ATOM 2982 C CB  . VAL A 1 475 ? -28.764 -18.937 -20.481 1.00 160.69 ? 745 VAL A CB  1 
ATOM 2983 N N   . TYR A 1 476 ? -27.759 -19.722 -17.624 1.00 156.25 ? 746 TYR A N   1 
ATOM 2984 C CA  . TYR A 1 476 ? -27.983 -20.533 -16.432 1.00 163.54 ? 746 TYR A CA  1 
ATOM 2985 C C   . TYR A 1 476 ? -27.643 -19.750 -15.164 1.00 161.60 ? 746 TYR A C   1 
ATOM 2986 O O   . TYR A 1 476 ? -28.223 -19.982 -14.102 1.00 166.35 ? 746 TYR A O   1 
ATOM 2987 C CB  . TYR A 1 476 ? -27.165 -21.823 -16.501 1.00 168.20 ? 746 TYR A CB  1 
ATOM 2988 N N   . PHE A 1 477 ? -26.696 -18.826 -15.288 1.00 154.18 ? 747 PHE A N   1 
ATOM 2989 C CA  . PHE A 1 477 ? -26.310 -17.936 -14.195 1.00 151.96 ? 747 PHE A CA  1 
ATOM 2990 C C   . PHE A 1 477 ? -27.418 -16.951 -13.831 1.00 145.57 ? 747 PHE A C   1 
ATOM 2991 O O   . PHE A 1 477 ? -27.570 -16.573 -12.669 1.00 146.99 ? 747 PHE A O   1 
ATOM 2992 C CB  . PHE A 1 477 ? -25.038 -17.169 -14.561 1.00 150.67 ? 747 PHE A CB  1 
ATOM 2993 N N   . LEU A 1 478 ? -28.193 -16.546 -14.831 1.00 140.56 ? 748 LEU A N   1 
ATOM 2994 C CA  . LEU A 1 478 ? -29.314 -15.636 -14.623 1.00 134.12 ? 748 LEU A CA  1 
ATOM 2995 C C   . LEU A 1 478 ? -30.483 -16.363 -13.970 1.00 141.57 ? 748 LEU A C   1 
ATOM 2996 O O   . LEU A 1 478 ? -31.161 -15.809 -13.105 1.00 147.67 ? 748 LEU A O   1 
ATOM 2997 C CB  . LEU A 1 478 ? -29.751 -15.005 -15.946 1.00 125.85 ? 748 LEU A CB  1 
ATOM 2998 N N   . ILE A 1 479 ? -30.725 -17.598 -14.399 1.00 147.37 ? 749 ILE A N   1 
ATOM 2999 C CA  . ILE A 1 479 ? -31.717 -18.446 -13.748 1.00 160.35 ? 749 ILE A CA  1 
ATOM 3000 C C   . ILE A 1 479 ? -31.352 -18.625 -12.278 1.00 177.41 ? 749 ILE A C   1 
ATOM 3001 O O   . ILE A 1 479 ? -32.225 -18.616 -11.409 1.00 189.27 ? 749 ILE A O   1 
ATOM 3002 C CB  . ILE A 1 479 ? -31.825 -19.825 -14.423 1.00 155.59 ? 749 ILE A CB  1 
ATOM 3003 N N   . GLY A 1 480 ? -30.061 -18.807 -12.012 1.00 173.00 ? 750 GLY A N   1 
ATOM 3004 C CA  . GLY A 1 480 ? -29.565 -18.912 -10.653 1.00 168.29 ? 750 GLY A CA  1 
ATOM 3005 C C   . GLY A 1 480 ? -29.968 -17.719 -9.805  1.00 163.16 ? 750 GLY A C   1 
ATOM 3006 O O   . GLY A 1 480 ? -30.473 -17.880 -8.695  1.00 167.03 ? 750 GLY A O   1 
ATOM 3007 N N   . LYS A 1 481 ? -29.734 -16.517 -10.324 1.00 156.71 ? 751 LYS A N   1 
ATOM 3008 C CA  . LYS A 1 481 ? -30.094 -15.296 -9.611  1.00 149.27 ? 751 LYS A CA  1 
ATOM 3009 C C   . LYS A 1 481 ? -31.606 -15.162 -9.437  1.00 154.20 ? 751 LYS A C   1 
ATOM 3010 O O   . LYS A 1 481 ? -32.096 -14.933 -8.332  1.00 175.65 ? 751 LYS A O   1 
ATOM 3011 C CB  . LYS A 1 481 ? -29.543 -14.069 -10.341 1.00 143.39 ? 751 LYS A CB  1 
ATOM 3012 N N   . VAL A 1 482 ? -32.333 -15.295 -10.543 1.00 142.41 ? 752 VAL A N   1 
ATOM 3013 C CA  . VAL A 1 482 ? -33.786 -15.136 -10.554 1.00 142.39 ? 752 VAL A CA  1 
ATOM 3014 C C   . VAL A 1 482 ? -34.544 -16.069 -9.605  1.00 151.38 ? 752 VAL A C   1 
ATOM 3015 O O   . VAL A 1 482 ? -35.606 -15.712 -9.097  1.00 161.40 ? 752 VAL A O   1 
ATOM 3016 C CB  . VAL A 1 482 ? -34.346 -15.345 -11.975 1.00 132.20 ? 752 VAL A CB  1 
ATOM 3017 N N   . TYR A 1 483 ? -34.000 -17.259 -9.369  1.00 154.26 ? 753 TYR A N   1 
ATOM 3018 C CA  . TYR A 1 483 ? -34.544 -18.163 -8.357  1.00 159.04 ? 753 TYR A CA  1 
ATOM 3019 C C   . TYR A 1 483 ? -34.267 -17.714 -6.925  1.00 165.98 ? 753 TYR A C   1 
ATOM 3020 O O   . TYR A 1 483 ? -35.154 -17.763 -6.071  1.00 172.06 ? 753 TYR A O   1 
ATOM 3021 C CB  . TYR A 1 483 ? -33.994 -19.576 -8.564  1.00 157.49 ? 753 TYR A CB  1 
ATOM 3022 N N   . LYS A 1 484 ? -33.033 -17.290 -6.672  1.00 161.90 ? 754 LYS A N   1 
ATOM 3023 C CA  . LYS A 1 484 ? -32.624 -16.820 -5.351  1.00 155.54 ? 754 LYS A CA  1 
ATOM 3024 C C   . LYS A 1 484 ? -33.538 -15.716 -4.825  1.00 150.97 ? 754 LYS A C   1 
ATOM 3025 O O   . LYS A 1 484 ? -33.942 -15.735 -3.663  1.00 150.60 ? 754 LYS A O   1 
ATOM 3026 C CB  . LYS A 1 484 ? -31.176 -16.327 -5.388  1.00 152.08 ? 754 LYS A CB  1 
ATOM 3027 N N   . LYS A 1 485 ? -33.859 -14.756 -5.685  1.00 153.44 ? 755 LYS A N   1 
ATOM 3028 C CA  . LYS A 1 485 ? -34.716 -13.643 -5.295  1.00 165.30 ? 755 LYS A CA  1 
ATOM 3029 C C   . LYS A 1 485 ? -36.185 -14.055 -5.213  1.00 175.33 ? 755 LYS A C   1 
ATOM 3030 O O   . LYS A 1 485 ? -37.010 -13.326 -4.658  1.00 183.67 ? 755 LYS A O   1 
ATOM 3031 C CB  . LYS A 1 485 ? -34.552 -12.478 -6.274  1.00 158.12 ? 755 LYS A CB  1 
ATOM 3032 N N   . LEU A 1 486 ? -36.508 -15.225 -5.761  1.00 171.11 ? 756 LEU A N   1 
ATOM 3033 C CA  . LEU A 1 486 ? -37.885 -15.708 -5.764  1.00 179.00 ? 756 LEU A CA  1 
ATOM 3034 C C   . LEU A 1 486 ? -38.166 -16.666 -4.609  1.00 187.96 ? 756 LEU A C   1 
ATOM 3035 O O   . LEU A 1 486 ? -39.317 -17.032 -4.363  1.00 193.95 ? 756 LEU A O   1 
ATOM 3036 C CB  . LEU A 1 486 ? -38.197 -16.399 -7.094  1.00 175.53 ? 756 LEU A CB  1 
ATOM 3037 N N   . GLY A 1 487 ? -37.118 -17.051 -3.889  1.00 188.58 ? 757 GLY A N   1 
ATOM 3038 C CA  . GLY A 1 487 ? -37.265 -17.957 -2.764  1.00 190.70 ? 757 GLY A CA  1 
ATOM 3039 C C   . GLY A 1 487 ? -36.772 -19.379 -2.973  1.00 189.92 ? 757 GLY A C   1 
ATOM 3040 O O   . GLY A 1 487 ? -36.281 -20.009 -2.036  1.00 191.02 ? 757 GLY A O   1 
ATOM 3041 N N   . GLN A 1 488 ? -36.903 -19.888 -4.196  1.00 187.79 ? 758 GLN A N   1 
ATOM 3042 C CA  . GLN A 1 488 ? -36.477 -21.251 -4.504  1.00 181.19 ? 758 GLN A CA  1 
ATOM 3043 C C   . GLN A 1 488 ? -34.967 -21.399 -4.364  1.00 182.74 ? 758 GLN A C   1 
ATOM 3044 O O   . GLN A 1 488 ? -34.225 -21.288 -5.340  1.00 180.93 ? 758 GLN A O   1 
ATOM 3045 C CB  . GLN A 1 488 ? -36.917 -21.646 -5.916  1.00 170.90 ? 758 GLN A CB  1 
ATOM 3046 N N   . THR A 1 489 ? -34.524 -21.654 -3.138  1.00 184.30 ? 759 THR A N   1 
ATOM 3047 C CA  . THR A 1 489 ? -33.105 -21.784 -2.829  1.00 185.07 ? 759 THR A CA  1 
ATOM 3048 C C   . THR A 1 489 ? -32.472 -23.042 -3.423  1.00 197.54 ? 759 THR A C   1 
ATOM 3049 O O   . THR A 1 489 ? -31.336 -23.010 -3.895  1.00 195.18 ? 759 THR A O   1 
ATOM 3050 C CB  . THR A 1 489 ? -32.868 -21.784 -1.307  1.00 186.23 ? 759 THR A CB  1 
ATOM 3051 N N   . HIS A 1 490 ? -33.211 -24.148 -3.396  1.00 211.65 ? 760 HIS A N   1 
ATOM 3052 C CA  . HIS A 1 490 ? -32.726 -25.424 -3.922  1.00 209.64 ? 760 HIS A CA  1 
ATOM 3053 C C   . HIS A 1 490 ? -32.518 -25.419 -5.437  1.00 201.09 ? 760 HIS A C   1 
ATOM 3054 O O   . HIS A 1 490 ? -31.613 -26.080 -5.950  1.00 201.12 ? 760 HIS A O   1 
ATOM 3055 C CB  . HIS A 1 490 ? -33.693 -26.547 -3.543  1.00 207.28 ? 760 HIS A CB  1 
ATOM 3056 N N   . LEU A 1 491 ? -33.358 -24.671 -6.144  1.00 192.11 ? 761 LEU A N   1 
ATOM 3057 C CA  . LEU A 1 491 ? -33.331 -24.623 -7.603  1.00 184.07 ? 761 LEU A CA  1 
ATOM 3058 C C   . LEU A 1 491 ? -32.360 -23.572 -8.129  1.00 178.41 ? 761 LEU A C   1 
ATOM 3059 O O   . LEU A 1 491 ? -31.879 -23.667 -9.259  1.00 179.12 ? 761 LEU A O   1 
ATOM 3060 C CB  . LEU A 1 491 ? -34.732 -24.347 -8.149  1.00 181.74 ? 761 LEU A CB  1 
ATOM 3061 N N   . ALA A 1 492 ? -32.055 -22.585 -7.295  1.00 173.52 ? 762 ALA A N   1 
ATOM 3062 C CA  . ALA A 1 492 ? -31.012 -21.618 -7.609  1.00 174.31 ? 762 ALA A CA  1 
ATOM 3063 C C   . ALA A 1 492 ? -29.627 -22.248 -7.560  1.00 184.54 ? 762 ALA A C   1 
ATOM 3064 O O   . ALA A 1 492 ? -28.899 -22.210 -8.553  1.00 186.27 ? 762 ALA A O   1 
ATOM 3065 C CB  . ALA A 1 492 ? -31.088 -20.439 -6.652  1.00 172.90 ? 762 ALA A CB  1 
ATOM 3066 N N   . LEU A 1 493 ? -29.250 -22.771 -6.395  1.00 186.67 ? 763 LEU A N   1 
ATOM 3067 C CA  . LEU A 1 493 ? -27.995 -23.507 -6.236  1.00 182.49 ? 763 LEU A CA  1 
ATOM 3068 C C   . LEU A 1 493 ? -27.757 -24.485 -7.387  1.00 186.58 ? 763 LEU A C   1 
ATOM 3069 O O   . LEU A 1 493 ? -26.638 -24.622 -7.881  1.00 188.63 ? 763 LEU A O   1 
ATOM 3070 C CB  . LEU A 1 493 ? -27.983 -24.255 -4.902  1.00 178.61 ? 763 LEU A CB  1 
ATOM 3071 N N   . MET A 1 494 ? -28.825 -25.170 -7.784  1.00 186.69 ? 764 MET A N   1 
ATOM 3072 C CA  . MET A 1 494 ? -28.808 -26.129 -8.885  1.00 183.67 ? 764 MET A CA  1 
ATOM 3073 C C   . MET A 1 494 ? -28.233 -25.554 -10.178 1.00 175.60 ? 764 MET A C   1 
ATOM 3074 O O   . MET A 1 494 ? -27.217 -26.029 -10.685 1.00 176.16 ? 764 MET A O   1 
ATOM 3075 C CB  . MET A 1 494 ? -30.219 -26.662 -9.144  1.00 184.83 ? 764 MET A CB  1 
ATOM 3076 N N   . ASN A 1 495 ? -28.889 -24.524 -10.703 1.00 166.19 ? 765 ASN A N   1 
ATOM 3077 C CA  . ASN A 1 495 ? -28.525 -23.971 -12.000 1.00 162.38 ? 765 ASN A CA  1 
ATOM 3078 C C   . ASN A 1 495 ? -27.207 -23.214 -11.994 1.00 166.01 ? 765 ASN A C   1 
ATOM 3079 O O   . ASN A 1 495 ? -26.583 -23.049 -13.042 1.00 167.80 ? 765 ASN A O   1 
ATOM 3080 C CB  . ASN A 1 495 ? -29.635 -23.045 -12.505 1.00 155.51 ? 765 ASN A CB  1 
ATOM 3081 N N   . PHE A 1 496 ? -26.767 -22.767 -10.822 1.00 172.31 ? 766 PHE A N   1 
ATOM 3082 C CA  . PHE A 1 496 ? -25.487 -22.068 -10.762 1.00 172.58 ? 766 PHE A CA  1 
ATOM 3083 C C   . PHE A 1 496 ? -24.260 -22.972 -10.972 1.00 181.73 ? 766 PHE A C   1 
ATOM 3084 O O   . PHE A 1 496 ? -23.335 -22.587 -11.676 1.00 183.94 ? 766 PHE A O   1 
ATOM 3085 C CB  . PHE A 1 496 ? -25.371 -21.342 -9.422  1.00 165.93 ? 766 PHE A CB  1 
ATOM 3086 N N   . SER A 1 497 ? -24.251 -24.157 -10.352 1.00 187.31 ? 767 SER A N   1 
ATOM 3087 C CA  . SER A 1 497 ? -23.178 -25.159 -10.530 1.00 190.21 ? 767 SER A CA  1 
ATOM 3088 C C   . SER A 1 497 ? -23.100 -25.778 -11.932 1.00 191.27 ? 767 SER A C   1 
ATOM 3089 O O   . SER A 1 497 ? -22.015 -26.180 -12.392 1.00 189.71 ? 767 SER A O   1 
ATOM 3090 C CB  . SER A 1 497 ? -23.318 -26.282 -9.497  1.00 199.67 ? 767 SER A CB  1 
ATOM 3091 O OG  . SER A 1 497 ? -24.650 -26.741 -9.391  1.00 207.34 ? 767 SER A OG  1 
ATOM 3092 N N   . TRP A 1 498 ? -24.246 -25.781 -12.608 1.00 198.37 ? 768 TRP A N   1 
ATOM 3093 C CA  . TRP A 1 498 ? -24.376 -26.147 -14.013 1.00 209.79 ? 768 TRP A CA  1 
ATOM 3094 C C   . TRP A 1 498 ? -23.752 -25.008 -14.787 1.00 207.71 ? 768 TRP A C   1 
ATOM 3095 O O   . TRP A 1 498 ? -22.782 -25.184 -15.507 1.00 215.66 ? 768 TRP A O   1 
ATOM 3096 C CB  . TRP A 1 498 ? -25.869 -26.356 -14.408 1.00 219.71 ? 768 TRP A CB  1 
ATOM 3097 N N   . ALA A 1 499 ? -24.270 -23.805 -14.520 1.00 192.26 ? 769 ALA A N   1 
ATOM 3098 C CA  . ALA A 1 499 ? -23.779 -22.609 -15.185 1.00 185.83 ? 769 ALA A CA  1 
ATOM 3099 C C   . ALA A 1 499 ? -22.236 -22.578 -15.065 1.00 190.57 ? 769 ALA A C   1 
ATOM 3100 O O   . ALA A 1 499 ? -21.558 -22.234 -16.038 1.00 190.95 ? 769 ALA A O   1 
ATOM 3101 C CB  . ALA A 1 499 ? -24.374 -21.351 -14.576 1.00 183.00 ? 769 ALA A CB  1 
ATOM 3102 N N   . MET A 1 500 ? -21.694 -22.967 -13.896 1.00 200.34 ? 770 MET A N   1 
ATOM 3103 C CA  . MET A 1 500 ? -20.242 -23.002 -13.655 1.00 208.23 ? 770 MET A CA  1 
ATOM 3104 C C   . MET A 1 500 ? -19.518 -24.093 -14.458 1.00 207.76 ? 770 MET A C   1 
ATOM 3105 O O   . MET A 1 500 ? -18.408 -23.880 -14.967 1.00 211.35 ? 770 MET A O   1 
ATOM 3106 C CB  . MET A 1 500 ? -19.963 -23.218 -12.171 1.00 214.41 ? 770 MET A CB  1 
ATOM 3107 C CG  . MET A 1 500 ? -20.193 -21.980 -11.312 1.00 212.14 ? 770 MET A CG  1 
ATOM 3108 N N   . ASP A 1 501 ? -20.138 -25.269 -14.521 1.00 202.53 ? 771 ASP A N   1 
ATOM 3109 C CA  . ASP A 1 501 ? -19.599 -26.401 -15.241 1.00 202.68 ? 771 ASP A CA  1 
ATOM 3110 C C   . ASP A 1 501 ? -19.543 -26.102 -16.733 1.00 195.46 ? 771 ASP A C   1 
ATOM 3111 O O   . ASP A 1 501 ? -18.683 -26.625 -17.442 1.00 196.08 ? 771 ASP A O   1 
ATOM 3112 C CB  . ASP A 1 501 ? -20.443 -27.648 -14.970 1.00 210.07 ? 771 ASP A CB  1 
ATOM 3113 N N   . LEU A 1 502 ? -20.468 -25.285 -17.223 1.00 192.58 ? 772 LEU A N   1 
ATOM 3114 C CA  . LEU A 1 502 ? -20.513 -24.985 -18.650 1.00 201.07 ? 772 LEU A CA  1 
ATOM 3115 C C   . LEU A 1 502 ? -19.525 -23.865 -18.970 1.00 209.27 ? 772 LEU A C   1 
ATOM 3116 O O   . LEU A 1 502 ? -19.240 -23.581 -20.132 1.00 215.62 ? 772 LEU A O   1 
ATOM 3117 C CB  . LEU A 1 502 ? -21.927 -24.587 -19.081 1.00 199.77 ? 772 LEU A CB  1 
ATOM 3118 N N   . ASP A 1 503 ? -19.023 -23.230 -17.916 1.00 210.48 ? 773 ASP A N   1 
ATOM 3119 C CA  . ASP A 1 503 ? -18.164 -22.049 -18.020 1.00 214.16 ? 773 ASP A CA  1 
ATOM 3120 C C   . ASP A 1 503 ? -16.681 -22.368 -18.216 1.00 217.89 ? 773 ASP A C   1 
ATOM 3121 O O   . ASP A 1 503 ? -16.136 -23.244 -17.544 1.00 223.21 ? 773 ASP A O   1 
ATOM 3122 C CB  . ASP A 1 503 ? -18.336 -21.166 -16.784 1.00 209.83 ? 773 ASP A CB  1 
ATOM 3123 N N   . PRO A 1 504 ? -16.024 -21.649 -19.137 1.00 213.61 ? 774 PRO A N   1 
ATOM 3124 C CA  . PRO A 1 504 ? -14.584 -21.854 -19.323 1.00 213.31 ? 774 PRO A CA  1 
ATOM 3125 C C   . PRO A 1 504 ? -13.789 -20.571 -19.089 1.00 210.01 ? 774 PRO A C   1 
ATOM 3126 O O   . PRO A 1 504 ? -13.572 -20.205 -17.932 1.00 208.32 ? 774 PRO A O   1 
ATOM 3127 C CB  . PRO A 1 504 ? -14.479 -22.303 -20.782 1.00 215.77 ? 774 PRO A CB  1 
ATOM 3128 N N   . GLU B 1 8   ? 17.428  -3.005  1.816   1.00 149.27 ? 6   GLU B N   1 
ATOM 3129 C CA  . GLU B 1 8   ? 18.483  -2.313  1.081   1.00 156.77 ? 6   GLU B CA  1 
ATOM 3130 C C   . GLU B 1 8   ? 18.321  -2.415  -0.442  1.00 154.44 ? 6   GLU B C   1 
ATOM 3131 O O   . GLU B 1 8   ? 18.477  -1.411  -1.137  1.00 158.59 ? 6   GLU B O   1 
ATOM 3132 C CB  . GLU B 1 8   ? 19.857  -2.847  1.498   1.00 173.73 ? 6   GLU B CB  1 
ATOM 3133 C CG  . GLU B 1 8   ? 19.904  -3.353  2.927   1.00 184.54 ? 6   GLU B CG  1 
ATOM 3134 C CD  . GLU B 1 8   ? 20.314  -2.279  3.912   1.00 189.18 ? 6   GLU B CD  1 
ATOM 3135 O OE1 . GLU B 1 8   ? 20.703  -1.178  3.469   1.00 186.66 ? 6   GLU B OE1 1 
ATOM 3136 O OE2 . GLU B 1 8   ? 20.237  -2.535  5.132   1.00 195.81 ? 6   GLU B OE2 1 
ATOM 3137 N N   . PRO B 1 9   ? 18.023  -3.618  -0.975  1.00 154.46 ? 7   PRO B N   1 
ATOM 3138 C CA  . PRO B 1 9   ? 17.823  -3.656  -2.427  1.00 158.72 ? 7   PRO B CA  1 
ATOM 3139 C C   . PRO B 1 9   ? 16.573  -2.896  -2.862  1.00 148.84 ? 7   PRO B C   1 
ATOM 3140 O O   . PRO B 1 9   ? 16.584  -2.246  -3.907  1.00 151.76 ? 7   PRO B O   1 
ATOM 3141 C CB  . PRO B 1 9   ? 17.685  -5.154  -2.725  1.00 170.48 ? 7   PRO B CB  1 
ATOM 3142 C CG  . PRO B 1 9   ? 18.363  -5.825  -1.582  1.00 171.97 ? 7   PRO B CG  1 
ATOM 3143 C CD  . PRO B 1 9   ? 17.996  -4.979  -0.408  1.00 162.78 ? 7   PRO B CD  1 
ATOM 3144 N N   . VAL B 1 10  ? 15.510  -2.990  -2.068  1.00 132.95 ? 8   VAL B N   1 
ATOM 3145 C CA  . VAL B 1 10  ? 14.269  -2.280  -2.356  1.00 123.41 ? 8   VAL B CA  1 
ATOM 3146 C C   . VAL B 1 10  ? 14.451  -0.763  -2.351  1.00 124.73 ? 8   VAL B C   1 
ATOM 3147 O O   . VAL B 1 10  ? 13.923  -0.066  -3.218  1.00 123.55 ? 8   VAL B O   1 
ATOM 3148 C CB  . VAL B 1 10  ? 13.173  -2.652  -1.334  1.00 127.95 ? 8   VAL B CB  1 
ATOM 3149 C CG1 . VAL B 1 10  ? 11.891  -1.884  -1.617  1.00 141.36 ? 8   VAL B CG1 1 
ATOM 3150 C CG2 . VAL B 1 10  ? 12.917  -4.150  -1.352  1.00 129.56 ? 8   VAL B CG2 1 
ATOM 3151 N N   . GLN B 1 11  ? 15.203  -0.256  -1.380  1.00 128.90 ? 9   GLN B N   1 
ATOM 3152 C CA  . GLN B 1 11  ? 15.456  1.179   -1.281  1.00 131.63 ? 9   GLN B CA  1 
ATOM 3153 C C   . GLN B 1 11  ? 16.249  1.700   -2.478  1.00 138.27 ? 9   GLN B C   1 
ATOM 3154 O O   . GLN B 1 11  ? 15.893  2.711   -3.084  1.00 142.88 ? 9   GLN B O   1 
ATOM 3155 C CB  . GLN B 1 11  ? 16.199  1.501   0.016   1.00 128.83 ? 9   GLN B CB  1 
ATOM 3156 N N   . ALA B 1 12  ? 17.324  0.993   -2.810  1.00 142.10 ? 10  ALA B N   1 
ATOM 3157 C CA  . ALA B 1 12  ? 18.177  1.343   -3.942  1.00 144.30 ? 10  ALA B CA  1 
ATOM 3158 C C   . ALA B 1 12  ? 17.470  1.192   -5.287  1.00 140.31 ? 10  ALA B C   1 
ATOM 3159 O O   . ALA B 1 12  ? 17.809  1.874   -6.253  1.00 140.95 ? 10  ALA B O   1 
ATOM 3160 C CB  . ALA B 1 12  ? 19.442  0.497   -3.920  1.00 149.07 ? 10  ALA B CB  1 
ATOM 3161 N N   . ALA B 1 13  ? 16.489  0.299   -5.343  1.00 126.30 ? 11  ALA B N   1 
ATOM 3162 C CA  . ALA B 1 13  ? 15.677  0.123   -6.543  1.00 130.99 ? 11  ALA B CA  1 
ATOM 3163 C C   . ALA B 1 13  ? 14.706  1.279   -6.769  1.00 123.56 ? 11  ALA B C   1 
ATOM 3164 O O   . ALA B 1 13  ? 14.437  1.657   -7.909  1.00 128.87 ? 11  ALA B O   1 
ATOM 3165 C CB  . ALA B 1 13  ? 14.914  -1.193  -6.472  1.00 136.14 ? 11  ALA B CB  1 
ATOM 3166 N N   . ILE B 1 14  ? 14.178  1.830   -5.681  1.00 114.73 ? 12  ILE B N   1 
ATOM 3167 C CA  . ILE B 1 14  ? 13.341  3.024   -5.749  1.00 109.52 ? 12  ILE B CA  1 
ATOM 3168 C C   . ILE B 1 14  ? 14.109  4.213   -6.332  1.00 123.34 ? 12  ILE B C   1 
ATOM 3169 O O   . ILE B 1 14  ? 13.668  4.816   -7.310  1.00 137.33 ? 12  ILE B O   1 
ATOM 3170 C CB  . ILE B 1 14  ? 12.772  3.388   -4.368  1.00 108.50 ? 12  ILE B CB  1 
ATOM 3171 C CG1 . ILE B 1 14  ? 11.646  2.421   -4.000  1.00 105.54 ? 12  ILE B CG1 1 
ATOM 3172 C CG2 . ILE B 1 14  ? 12.265  4.821   -4.357  1.00 105.48 ? 12  ILE B CG2 1 
ATOM 3173 C CD1 . ILE B 1 14  ? 11.242  2.462   -2.549  1.00 105.78 ? 12  ILE B CD1 1 
ATOM 3174 N N   . TRP B 1 15  ? 15.246  4.551   -5.726  1.00 128.81 ? 13  TRP B N   1 
ATOM 3175 C CA  . TRP B 1 15  ? 16.059  5.686   -6.173  1.00 133.08 ? 13  TRP B CA  1 
ATOM 3176 C C   . TRP B 1 15  ? 16.461  5.597   -7.643  1.00 136.53 ? 13  TRP B C   1 
ATOM 3177 O O   . TRP B 1 15  ? 16.683  6.617   -8.295  1.00 138.85 ? 13  TRP B O   1 
ATOM 3178 C CB  . TRP B 1 15  ? 17.315  5.828   -5.311  1.00 136.71 ? 13  TRP B CB  1 
ATOM 3179 C CG  . TRP B 1 15  ? 17.060  6.473   -3.988  1.00 137.98 ? 13  TRP B CG  1 
ATOM 3180 C CD1 . TRP B 1 15  ? 17.063  5.873   -2.763  1.00 151.30 ? 13  TRP B CD1 1 
ATOM 3181 C CD2 . TRP B 1 15  ? 16.755  7.853   -3.760  1.00 130.88 ? 13  TRP B CD2 1 
ATOM 3182 N NE1 . TRP B 1 15  ? 16.785  6.798   -1.784  1.00 151.65 ? 13  TRP B NE1 1 
ATOM 3183 C CE2 . TRP B 1 15  ? 16.590  8.021   -2.372  1.00 139.97 ? 13  TRP B CE2 1 
ATOM 3184 C CE3 . TRP B 1 15  ? 16.607  8.963   -4.596  1.00 127.65 ? 13  TRP B CE3 1 
ATOM 3185 C CZ2 . TRP B 1 15  ? 16.285  9.254   -1.801  1.00 139.07 ? 13  TRP B CZ2 1 
ATOM 3186 C CZ3 . TRP B 1 15  ? 16.305  10.185  -4.029  1.00 125.67 ? 13  TRP B CZ3 1 
ATOM 3187 C CH2 . TRP B 1 15  ? 16.146  10.322  -2.644  1.00 135.39 ? 13  TRP B CH2 1 
ATOM 3188 N N   . GLN B 1 16  ? 16.549  4.379   -8.162  1.00 131.01 ? 14  GLN B N   1 
ATOM 3189 C CA  . GLN B 1 16  ? 16.817  4.190   -9.577  1.00 131.62 ? 14  GLN B CA  1 
ATOM 3190 C C   . GLN B 1 16  ? 15.589  4.621   -10.366 1.00 126.93 ? 14  GLN B C   1 
ATOM 3191 O O   . GLN B 1 16  ? 15.695  5.365   -11.342 1.00 143.53 ? 14  GLN B O   1 
ATOM 3192 C CB  . GLN B 1 16  ? 17.152  2.727   -9.862  1.00 136.27 ? 14  GLN B CB  1 
ATOM 3193 C CG  . GLN B 1 16  ? 17.979  2.478   -11.105 1.00 155.86 ? 14  GLN B CG  1 
ATOM 3194 C CD  . GLN B 1 16  ? 18.117  0.999   -11.405 1.00 172.46 ? 14  GLN B CD  1 
ATOM 3195 O OE1 . GLN B 1 16  ? 17.353  0.179   -10.896 1.00 165.14 ? 14  GLN B OE1 1 
ATOM 3196 N NE2 . GLN B 1 16  ? 19.098  0.648   -12.227 1.00 185.78 ? 14  GLN B NE2 1 
ATOM 3197 N N   . ALA B 1 17  ? 14.426  4.142   -9.934  1.00 129.33 ? 15  ALA B N   1 
ATOM 3198 C CA  . ALA B 1 17  ? 13.157  4.472   -10.574 1.00 132.59 ? 15  ALA B CA  1 
ATOM 3199 C C   . ALA B 1 17  ? 12.868  5.977   -10.550 1.00 119.87 ? 15  ALA B C   1 
ATOM 3200 O O   . ALA B 1 17  ? 12.353  6.533   -11.518 1.00 120.30 ? 15  ALA B O   1 
ATOM 3201 C CB  . ALA B 1 17  ? 12.024  3.704   -9.917  1.00 143.16 ? 15  ALA B CB  1 
ATOM 3202 N N   . LEU B 1 18  ? 13.202  6.621   -9.434  1.00 114.33 ? 16  LEU B N   1 
ATOM 3203 C CA  . LEU B 1 18  ? 13.100  8.075   -9.298  1.00 113.96 ? 16  LEU B CA  1 
ATOM 3204 C C   . LEU B 1 18  ? 13.978  8.838   -10.283 1.00 120.81 ? 16  LEU B C   1 
ATOM 3205 O O   . LEU B 1 18  ? 13.524  9.760   -10.961 1.00 130.80 ? 16  LEU B O   1 
ATOM 3206 C CB  . LEU B 1 18  ? 13.472  8.524   -7.877  1.00 119.09 ? 16  LEU B CB  1 
ATOM 3207 C CG  . LEU B 1 18  ? 12.430  9.016   -6.863  1.00 111.70 ? 16  LEU B CG  1 
ATOM 3208 C CD1 . LEU B 1 18  ? 11.067  8.356   -7.046  1.00 111.09 ? 16  LEU B CD1 1 
ATOM 3209 C CD2 . LEU B 1 18  ? 12.948  8.864   -5.427  1.00 108.79 ? 16  LEU B CD2 1 
ATOM 3210 N N   . ASN B 1 19  ? 15.244  8.446   -10.351 1.00 120.14 ? 17  ASN B N   1 
ATOM 3211 C CA  . ASN B 1 19  ? 16.215  9.110   -11.208 1.00 124.67 ? 17  ASN B CA  1 
ATOM 3212 C C   . ASN B 1 19  ? 15.988  8.885   -12.699 1.00 126.72 ? 17  ASN B C   1 
ATOM 3213 O O   . ASN B 1 19  ? 16.662  9.485   -13.538 1.00 131.34 ? 17  ASN B O   1 
ATOM 3214 C CB  . ASN B 1 19  ? 17.614  8.625   -10.842 1.00 130.73 ? 17  ASN B CB  1 
ATOM 3215 C CG  . ASN B 1 19  ? 18.146  9.290   -9.593  1.00 140.41 ? 17  ASN B CG  1 
ATOM 3216 O OD1 . ASN B 1 19  ? 18.310  10.508  -9.537  1.00 146.23 ? 17  ASN B OD1 1 
ATOM 3217 N ND2 . ASN B 1 19  ? 18.439  8.480   -8.582  1.00 145.93 ? 17  ASN B ND2 1 
ATOM 3218 N N   . HIS B 1 20  ? 15.021  8.039   -13.027 1.00 123.98 ? 18  HIS B N   1 
ATOM 3219 C CA  . HIS B 1 20  ? 14.557  7.931   -14.398 1.00 124.27 ? 18  HIS B CA  1 
ATOM 3220 C C   . HIS B 1 20  ? 13.136  8.461   -14.515 1.00 121.58 ? 18  HIS B C   1 
ATOM 3221 O O   . HIS B 1 20  ? 12.482  8.304   -15.546 1.00 130.57 ? 18  HIS B O   1 
ATOM 3222 C CB  . HIS B 1 20  ? 14.652  6.487   -14.870 1.00 124.58 ? 18  HIS B CB  1 
ATOM 3223 C CG  . HIS B 1 20  ? 16.060  5.994   -14.976 1.00 139.72 ? 18  HIS B CG  1 
ATOM 3224 N ND1 . HIS B 1 20  ? 16.825  5.695   -13.869 1.00 145.77 ? 18  HIS B ND1 1 
ATOM 3225 C CD2 . HIS B 1 20  ? 16.856  5.783   -16.051 1.00 156.54 ? 18  HIS B CD2 1 
ATOM 3226 C CE1 . HIS B 1 20  ? 18.024  5.299   -14.258 1.00 155.89 ? 18  HIS B CE1 1 
ATOM 3227 N NE2 . HIS B 1 20  ? 18.068  5.344   -15.578 1.00 163.79 ? 18  HIS B NE2 1 
ATOM 3228 N N   . TYR B 1 21  ? 12.680  9.095   -13.438 1.00 116.22 ? 19  TYR B N   1 
ATOM 3229 C CA  . TYR B 1 21  ? 11.357  9.707   -13.364 1.00 113.21 ? 19  TYR B CA  1 
ATOM 3230 C C   . TYR B 1 21  ? 10.250  8.703   -13.657 1.00 111.82 ? 19  TYR B C   1 
ATOM 3231 O O   . TYR B 1 21  ? 9.249   9.026   -14.296 1.00 118.01 ? 19  TYR B O   1 
ATOM 3232 C CB  . TYR B 1 21  ? 11.295  10.898  -14.321 1.00 117.07 ? 19  TYR B CB  1 
ATOM 3233 C CG  . TYR B 1 21  ? 12.601  11.658  -14.326 1.00 120.68 ? 19  TYR B CG  1 
ATOM 3234 C CD1 . TYR B 1 21  ? 12.957  12.469  -13.260 1.00 134.02 ? 19  TYR B CD1 1 
ATOM 3235 C CD2 . TYR B 1 21  ? 13.493  11.536  -15.384 1.00 124.69 ? 19  TYR B CD2 1 
ATOM 3236 C CE1 . TYR B 1 21  ? 14.158  13.146  -13.253 1.00 135.32 ? 19  TYR B CE1 1 
ATOM 3237 C CE2 . TYR B 1 21  ? 14.695  12.209  -15.385 1.00 128.80 ? 19  TYR B CE2 1 
ATOM 3238 C CZ  . TYR B 1 21  ? 15.021  13.015  -14.319 1.00 130.35 ? 19  TYR B CZ  1 
ATOM 3239 O OH  . TYR B 1 21  ? 16.219  13.688  -14.318 1.00 132.55 ? 19  TYR B OH  1 
ATOM 3240 N N   . ALA B 1 22  ? 10.445  7.482   -13.173 1.00 116.30 ? 20  ALA B N   1 
ATOM 3241 C CA  . ALA B 1 22  ? 9.404   6.467   -13.191 1.00 120.20 ? 20  ALA B CA  1 
ATOM 3242 C C   . ALA B 1 22  ? 8.693   6.464   -11.846 1.00 115.51 ? 20  ALA B C   1 
ATOM 3243 O O   . ALA B 1 22  ? 8.941   5.610   -10.995 1.00 107.74 ? 20  ALA B O   1 
ATOM 3244 C CB  . ALA B 1 22  ? 9.988   5.099   -13.497 1.00 118.74 ? 20  ALA B CB  1 
ATOM 3245 N N   . TYR B 1 23  ? 7.808   7.438   -11.668 1.00 112.63 ? 21  TYR B N   1 
ATOM 3246 C CA  . TYR B 1 23  ? 7.208   7.727   -10.374 1.00 101.70 ? 21  TYR B CA  1 
ATOM 3247 C C   . TYR B 1 23  ? 6.211   6.647   -9.972  1.00 101.91 ? 21  TYR B C   1 
ATOM 3248 O O   . TYR B 1 23  ? 6.152   6.255   -8.808  1.00 100.03 ? 21  TYR B O   1 
ATOM 3249 C CB  . TYR B 1 23  ? 6.548   9.106   -10.394 1.00 102.71 ? 21  TYR B CB  1 
ATOM 3250 C CG  . TYR B 1 23  ? 7.537   10.219  -10.660 1.00 105.88 ? 21  TYR B CG  1 
ATOM 3251 C CD1 . TYR B 1 23  ? 8.577   10.472  -9.776  1.00 113.58 ? 21  TYR B CD1 1 
ATOM 3252 C CD2 . TYR B 1 23  ? 7.446   11.000  -11.805 1.00 123.67 ? 21  TYR B CD2 1 
ATOM 3253 C CE1 . TYR B 1 23  ? 9.491   11.481  -10.015 1.00 127.64 ? 21  TYR B CE1 1 
ATOM 3254 C CE2 . TYR B 1 23  ? 8.357   12.012  -12.053 1.00 135.94 ? 21  TYR B CE2 1 
ATOM 3255 C CZ  . TYR B 1 23  ? 9.377   12.248  -11.155 1.00 136.15 ? 21  TYR B CZ  1 
ATOM 3256 O OH  . TYR B 1 23  ? 10.286  13.254  -11.394 1.00 137.74 ? 21  TYR B OH  1 
ATOM 3257 N N   . ARG B 1 24  ? 5.422   6.179   -10.934 1.00 114.30 ? 22  ARG B N   1 
ATOM 3258 C CA  . ARG B 1 24  ? 4.444   5.131   -10.666 1.00 118.47 ? 22  ARG B CA  1 
ATOM 3259 C C   . ARG B 1 24  ? 5.121   3.845   -10.184 1.00 107.71 ? 22  ARG B C   1 
ATOM 3260 O O   . ARG B 1 24  ? 4.576   3.137   -9.337  1.00 105.98 ? 22  ARG B O   1 
ATOM 3261 C CB  . ARG B 1 24  ? 3.608   4.849   -11.916 1.00 132.06 ? 22  ARG B CB  1 
ATOM 3262 N N   . ASP B 1 25  ? 6.301   3.545   -10.722 1.00 109.43 ? 23  ASP B N   1 
ATOM 3263 C CA  . ASP B 1 25  ? 7.020   2.328   -10.347 1.00 110.92 ? 23  ASP B CA  1 
ATOM 3264 C C   . ASP B 1 25  ? 7.602   2.434   -8.945  1.00 109.46 ? 23  ASP B C   1 
ATOM 3265 O O   . ASP B 1 25  ? 7.760   1.434   -8.244  1.00 109.66 ? 23  ASP B O   1 
ATOM 3266 C CB  . ASP B 1 25  ? 8.164   2.034   -11.325 1.00 143.10 ? 23  ASP B CB  1 
ATOM 3267 C CG  . ASP B 1 25  ? 7.751   2.156   -12.773 1.00 167.34 ? 23  ASP B CG  1 
ATOM 3268 O OD1 . ASP B 1 25  ? 7.920   1.171   -13.523 1.00 168.31 ? 23  ASP B OD1 1 
ATOM 3269 O OD2 . ASP B 1 25  ? 7.251   3.232   -13.165 1.00 174.61 ? 23  ASP B OD2 1 
ATOM 3270 N N   . ALA B 1 26  ? 7.900   3.663   -8.540  1.00 103.34 ? 24  ALA B N   1 
ATOM 3271 C CA  . ALA B 1 26  ? 8.609   3.930   -7.293  1.00 116.78 ? 24  ALA B CA  1 
ATOM 3272 C C   . ALA B 1 26  ? 7.702   4.079   -6.075  1.00 110.57 ? 24  ALA B C   1 
ATOM 3273 O O   . ALA B 1 26  ? 8.028   3.583   -4.996  1.00 104.74 ? 24  ALA B O   1 
ATOM 3274 C CB  . ALA B 1 26  ? 9.468   5.171   -7.451  1.00 130.05 ? 24  ALA B CB  1 
ATOM 3275 N N   . VAL B 1 27  ? 6.577   4.767   -6.241  1.00 106.10 ? 25  VAL B N   1 
ATOM 3276 C CA  . VAL B 1 27  ? 5.612   4.907   -5.155  1.00 97.94  ? 25  VAL B CA  1 
ATOM 3277 C C   . VAL B 1 27  ? 5.093   3.535   -4.728  1.00 98.20  ? 25  VAL B C   1 
ATOM 3278 O O   . VAL B 1 27  ? 4.840   3.300   -3.546  1.00 109.47 ? 25  VAL B O   1 
ATOM 3279 C CB  . VAL B 1 27  ? 4.428   5.834   -5.545  1.00 122.78 ? 25  VAL B CB  1 
ATOM 3280 C CG1 . VAL B 1 27  ? 4.933   7.224   -5.894  1.00 121.46 ? 25  VAL B CG1 1 
ATOM 3281 C CG2 . VAL B 1 27  ? 3.622   5.257   -6.702  1.00 135.82 ? 25  VAL B CG2 1 
ATOM 3282 N N   . PHE B 1 28  ? 4.933   2.636   -5.693  1.00 93.33  ? 26  PHE B N   1 
ATOM 3283 C CA  . PHE B 1 28  ? 4.463   1.285   -5.421  1.00 91.93  ? 26  PHE B CA  1 
ATOM 3284 C C   . PHE B 1 28  ? 5.431   0.488   -4.550  1.00 97.40  ? 26  PHE B C   1 
ATOM 3285 O O   . PHE B 1 28  ? 5.014   -0.203  -3.621  1.00 110.44 ? 26  PHE B O   1 
ATOM 3286 C CB  . PHE B 1 28  ? 4.216   0.539   -6.728  1.00 92.05  ? 26  PHE B CB  1 
ATOM 3287 C CG  . PHE B 1 28  ? 3.246   -0.594  -6.595  1.00 103.32 ? 26  PHE B CG  1 
ATOM 3288 C CD1 . PHE B 1 28  ? 1.901   -0.404  -6.860  1.00 117.49 ? 26  PHE B CD1 1 
ATOM 3289 C CD2 . PHE B 1 28  ? 3.677   -1.848  -6.201  1.00 94.21  ? 26  PHE B CD2 1 
ATOM 3290 C CE1 . PHE B 1 28  ? 1.003   -1.446  -6.735  1.00 122.90 ? 26  PHE B CE1 1 
ATOM 3291 C CE2 . PHE B 1 28  ? 2.786   -2.894  -6.074  1.00 111.45 ? 26  PHE B CE2 1 
ATOM 3292 C CZ  . PHE B 1 28  ? 1.447   -2.693  -6.342  1.00 118.11 ? 26  PHE B CZ  1 
ATOM 3293 N N   . LEU B 1 29  ? 6.723   0.593   -4.845  1.00 97.39  ? 27  LEU B N   1 
ATOM 3294 C CA  . LEU B 1 29  ? 7.740   -0.043  -4.016  1.00 99.90  ? 27  LEU B CA  1 
ATOM 3295 C C   . LEU B 1 29  ? 7.794   0.618   -2.651  1.00 100.96 ? 27  LEU B C   1 
ATOM 3296 O O   . LEU B 1 29  ? 7.958   -0.046  -1.628  1.00 107.47 ? 27  LEU B O   1 
ATOM 3297 C CB  . LEU B 1 29  ? 9.115   0.033   -4.681  1.00 102.93 ? 27  LEU B CB  1 
ATOM 3298 C CG  . LEU B 1 29  ? 9.321   -0.664  -6.024  1.00 117.45 ? 27  LEU B CG  1 
ATOM 3299 C CD1 . LEU B 1 29  ? 10.765  -0.510  -6.478  1.00 129.94 ? 27  LEU B CD1 1 
ATOM 3300 C CD2 . LEU B 1 29  ? 8.943   -2.130  -5.921  1.00 123.83 ? 27  LEU B CD2 1 
ATOM 3301 N N   . ALA B 1 30  ? 7.652   1.936   -2.649  1.00 94.53  ? 28  ALA B N   1 
ATOM 3302 C CA  . ALA B 1 30  ? 7.696   2.713   -1.421  1.00 96.36  ? 28  ALA B CA  1 
ATOM 3303 C C   . ALA B 1 30  ? 6.471   2.460   -0.533  1.00 97.70  ? 28  ALA B C   1 
ATOM 3304 O O   . ALA B 1 30  ? 6.585   2.493   0.691   1.00 99.17  ? 28  ALA B O   1 
ATOM 3305 C CB  . ALA B 1 30  ? 7.840   4.187   -1.746  1.00 101.75 ? 28  ALA B CB  1 
ATOM 3306 N N   . GLU B 1 31  ? 5.305   2.218   -1.136  1.00 106.84 ? 29  GLU B N   1 
ATOM 3307 C CA  . GLU B 1 31  ? 4.128   1.841   -0.349  1.00 104.09 ? 29  GLU B CA  1 
ATOM 3308 C C   . GLU B 1 31  ? 4.374   0.481   0.294   1.00 118.98 ? 29  GLU B C   1 
ATOM 3309 O O   . GLU B 1 31  ? 4.143   0.298   1.490   1.00 144.34 ? 29  GLU B O   1 
ATOM 3310 C CB  . GLU B 1 31  ? 2.864   1.799   -1.212  1.00 105.13 ? 29  GLU B CB  1 
ATOM 3311 C CG  . GLU B 1 31  ? 2.257   3.161   -1.510  1.00 124.29 ? 29  GLU B CG  1 
ATOM 3312 C CD  . GLU B 1 31  ? 1.095   3.086   -2.482  1.00 139.08 ? 29  GLU B CD  1 
ATOM 3313 O OE1 . GLU B 1 31  ? 0.675   1.961   -2.828  1.00 151.43 ? 29  GLU B OE1 1 
ATOM 3314 O OE2 . GLU B 1 31  ? 0.592   4.154   -2.891  1.00 128.19 ? 29  GLU B OE2 1 
ATOM 3315 N N   . ARG B 1 32  ? 4.836   -0.466  -0.516  1.00 104.35 ? 30  ARG B N   1 
ATOM 3316 C CA  . ARG B 1 32  ? 5.297   -1.767  -0.035  1.00 96.67  ? 30  ARG B CA  1 
ATOM 3317 C C   . ARG B 1 32  ? 6.324   -1.675  1.076   1.00 103.35 ? 30  ARG B C   1 
ATOM 3318 O O   . ARG B 1 32  ? 6.111   -2.231  2.154   1.00 114.45 ? 30  ARG B O   1 
ATOM 3319 C CB  . ARG B 1 32  ? 5.816   -2.578  -1.231  1.00 94.09  ? 30  ARG B CB  1 
ATOM 3320 C CG  . ARG B 1 32  ? 4.824   -3.593  -1.832  1.00 93.49  ? 30  ARG B CG  1 
ATOM 3321 C CD  . ARG B 1 32  ? 3.452   -3.039  -2.146  1.00 104.71 ? 30  ARG B CD  1 
ATOM 3322 N NE  . ARG B 1 32  ? 2.740   -3.082  -0.871  1.00 105.42 ? 30  ARG B NE  1 
ATOM 3323 C CZ  . ARG B 1 32  ? 1.647   -2.409  -0.548  1.00 112.48 ? 30  ARG B CZ  1 
ATOM 3324 N NH1 . ARG B 1 32  ? 1.065   -1.591  -1.413  1.00 94.21  ? 30  ARG B NH1 1 
ATOM 3325 N NH2 . ARG B 1 32  ? 1.141   -2.574  0.663   1.00 123.92 ? 30  ARG B NH2 1 
ATOM 3326 N N   . LEU B 1 33  ? 7.442   -1.009  0.812   1.00 99.58  ? 31  LEU B N   1 
ATOM 3327 C CA  . LEU B 1 33  ? 8.482   -0.879  1.822   1.00 104.95 ? 31  LEU B CA  1 
ATOM 3328 C C   . LEU B 1 33  ? 7.947   -0.287  3.134   1.00 113.78 ? 31  LEU B C   1 
ATOM 3329 O O   . LEU B 1 33  ? 8.322   -0.740  4.213   1.00 133.64 ? 31  LEU B O   1 
ATOM 3330 C CB  . LEU B 1 33  ? 9.638   -0.036  1.286   1.00 107.55 ? 31  LEU B CB  1 
ATOM 3331 C CG  . LEU B 1 33  ? 10.826  0.084   2.240   1.00 113.93 ? 31  LEU B CG  1 
ATOM 3332 C CD1 . LEU B 1 33  ? 11.651  -1.193  2.185   1.00 116.04 ? 31  LEU B CD1 1 
ATOM 3333 C CD2 . LEU B 1 33  ? 11.683  1.286   1.892   1.00 116.80 ? 31  LEU B CD2 1 
ATOM 3334 N N   . TYR B 1 34  ? 7.073   0.717   3.045   1.00 108.00 ? 32  TYR B N   1 
ATOM 3335 C CA  . TYR B 1 34  ? 6.530   1.353   4.251   1.00 110.06 ? 32  TYR B CA  1 
ATOM 3336 C C   . TYR B 1 34  ? 5.503   0.513   4.997   1.00 110.55 ? 32  TYR B C   1 
ATOM 3337 O O   . TYR B 1 34  ? 5.355   0.613   6.214   1.00 130.37 ? 32  TYR B O   1 
ATOM 3338 C CB  . TYR B 1 34  ? 5.876   2.686   3.898   1.00 105.99 ? 32  TYR B CB  1 
ATOM 3339 C CG  . TYR B 1 34  ? 5.446   3.465   5.116   1.00 105.86 ? 32  TYR B CG  1 
ATOM 3340 C CD1 . TYR B 1 34  ? 6.375   3.938   6.030   1.00 112.51 ? 32  TYR B CD1 1 
ATOM 3341 C CD2 . TYR B 1 34  ? 4.099   3.677   5.380   1.00 116.03 ? 32  TYR B CD2 1 
ATOM 3342 C CE1 . TYR B 1 34  ? 5.975   4.633   7.154   1.00 120.56 ? 32  TYR B CE1 1 
ATOM 3343 C CE2 . TYR B 1 34  ? 3.690   4.368   6.500   1.00 120.62 ? 32  TYR B CE2 1 
ATOM 3344 C CZ  . TYR B 1 34  ? 4.631   4.844   7.384   1.00 131.02 ? 32  TYR B CZ  1 
ATOM 3345 O OH  . TYR B 1 34  ? 4.227   5.537   8.501   1.00 149.66 ? 32  TYR B OH  1 
ATOM 3346 N N   . ALA B 1 35  ? 4.762   -0.282  4.244   1.00 106.61 ? 33  ALA B N   1 
ATOM 3347 C CA  . ALA B 1 35  ? 3.831   -1.240  4.807   1.00 105.26 ? 33  ALA B CA  1 
ATOM 3348 C C   . ALA B 1 35  ? 4.604   -2.323  5.519   1.00 124.06 ? 33  ALA B C   1 
ATOM 3349 O O   . ALA B 1 35  ? 4.244   -2.781  6.605   1.00 139.34 ? 33  ALA B O   1 
ATOM 3350 C CB  . ALA B 1 35  ? 2.946   -1.834  3.731   1.00 109.11 ? 33  ALA B CB  1 
ATOM 3351 N N   . GLU B 1 36  ? 5.697   -2.710  4.877   1.00 123.75 ? 34  GLU B N   1 
ATOM 3352 C CA  . GLU B 1 36  ? 6.516   -3.790  5.359   1.00 134.04 ? 34  GLU B CA  1 
ATOM 3353 C C   . GLU B 1 36  ? 7.162   -3.337  6.684   1.00 134.29 ? 34  GLU B C   1 
ATOM 3354 O O   . GLU B 1 36  ? 6.965   -3.971  7.722   1.00 152.52 ? 34  GLU B O   1 
ATOM 3355 C CB  . GLU B 1 36  ? 7.560   -4.108  4.289   1.00 148.98 ? 34  GLU B CB  1 
ATOM 3356 C CG  . GLU B 1 36  ? 8.261   -5.377  4.510   1.00 161.99 ? 34  GLU B CG  1 
ATOM 3357 C CD  . GLU B 1 36  ? 7.276   -6.510  4.274   1.00 175.78 ? 34  GLU B CD  1 
ATOM 3358 O OE1 . GLU B 1 36  ? 6.505   -6.373  3.316   1.00 181.41 ? 34  GLU B OE1 1 
ATOM 3359 O OE2 . GLU B 1 36  ? 7.192   -7.484  5.041   1.00 183.52 ? 34  GLU B OE2 1 
ATOM 3360 N N   . VAL B 1 37  ? 7.940   -2.255  6.638   1.00 122.71 ? 35  VAL B N   1 
ATOM 3361 C CA  . VAL B 1 37  ? 8.523   -1.632  7.837   1.00 130.54 ? 35  VAL B CA  1 
ATOM 3362 C C   . VAL B 1 37  ? 7.850   -0.268  8.011   1.00 137.69 ? 35  VAL B C   1 
ATOM 3363 O O   . VAL B 1 37  ? 7.793   0.501   7.057   1.00 153.70 ? 35  VAL B O   1 
ATOM 3364 C CB  . VAL B 1 37  ? 10.063  -1.486  7.775   1.00 135.41 ? 35  VAL B CB  1 
ATOM 3365 C CG1 . VAL B 1 37  ? 10.741  -2.815  8.075   1.00 142.78 ? 35  VAL B CG1 1 
ATOM 3366 C CG2 . VAL B 1 37  ? 10.518  -0.912  6.445   1.00 134.15 ? 35  VAL B CG2 1 
ATOM 3367 N N   . HIS B 1 38  ? 7.421   0.087   9.218   1.00 129.12 ? 36  HIS B N   1 
ATOM 3368 C CA  . HIS B 1 38  ? 6.859   1.426   9.427   1.00 126.07 ? 36  HIS B CA  1 
ATOM 3369 C C   . HIS B 1 38  ? 7.930   2.462   9.764   1.00 130.52 ? 36  HIS B C   1 
ATOM 3370 O O   . HIS B 1 38  ? 7.667   3.473   10.416  1.00 132.43 ? 36  HIS B O   1 
ATOM 3371 C CB  . HIS B 1 38  ? 5.791   1.386   10.520  1.00 131.18 ? 36  HIS B CB  1 
ATOM 3372 C CG  . HIS B 1 38  ? 4.833   0.244   10.380  1.00 132.30 ? 36  HIS B CG  1 
ATOM 3373 N ND1 . HIS B 1 38  ? 3.827   0.229   9.439   1.00 124.04 ? 36  HIS B ND1 1 
ATOM 3374 C CD2 . HIS B 1 38  ? 4.734   -0.926  11.055  1.00 136.42 ? 36  HIS B CD2 1 
ATOM 3375 C CE1 . HIS B 1 38  ? 3.147   -0.899  9.543   1.00 129.09 ? 36  HIS B CE1 1 
ATOM 3376 N NE2 . HIS B 1 38  ? 3.677   -1.617  10.516  1.00 129.58 ? 36  HIS B NE2 1 
ATOM 3377 N N   . SER B 1 39  ? 9.136   2.179   9.286   1.00 134.42 ? 37  SER B N   1 
ATOM 3378 C CA  . SER B 1 39  ? 10.326  3.007   9.452   1.00 141.68 ? 37  SER B CA  1 
ATOM 3379 C C   . SER B 1 39  ? 10.111  4.458   9.019   1.00 145.68 ? 37  SER B C   1 
ATOM 3380 O O   . SER B 1 39  ? 9.365   4.727   8.077   1.00 144.50 ? 37  SER B O   1 
ATOM 3381 C CB  . SER B 1 39  ? 11.488  2.403   8.669   1.00 143.97 ? 37  SER B CB  1 
ATOM 3382 O OG  . SER B 1 39  ? 12.643  3.206   8.793   1.00 152.00 ? 37  SER B OG  1 
ATOM 3383 N N   . GLU B 1 40  ? 10.758  5.392   9.711   1.00 153.68 ? 38  GLU B N   1 
ATOM 3384 C CA  . GLU B 1 40  ? 10.654  6.802   9.352   1.00 151.07 ? 38  GLU B CA  1 
ATOM 3385 C C   . GLU B 1 40  ? 11.430  7.139   8.074   1.00 153.53 ? 38  GLU B C   1 
ATOM 3386 O O   . GLU B 1 40  ? 11.154  8.149   7.427   1.00 166.45 ? 38  GLU B O   1 
ATOM 3387 C CB  . GLU B 1 40  ? 11.155  7.655   10.519  1.00 154.01 ? 38  GLU B CB  1 
ATOM 3388 C CG  . GLU B 1 40  ? 10.754  9.116   10.491  1.00 155.82 ? 38  GLU B CG  1 
ATOM 3389 C CD  . GLU B 1 40  ? 11.104  9.816   11.789  1.00 155.37 ? 38  GLU B CD  1 
ATOM 3390 O OE1 . GLU B 1 40  ? 10.313  10.662  12.254  1.00 146.08 ? 38  GLU B OE1 1 
ATOM 3391 O OE2 . GLU B 1 40  ? 12.152  9.477   12.372  1.00 167.11 ? 38  GLU B OE2 1 
ATOM 3392 N N   . GLU B 1 41  ? 12.400  6.304   7.713   1.00 146.30 ? 39  GLU B N   1 
ATOM 3393 C CA  . GLU B 1 41  ? 13.082  6.452   6.427   1.00 139.84 ? 39  GLU B CA  1 
ATOM 3394 C C   . GLU B 1 41  ? 12.257  5.808   5.316   1.00 135.93 ? 39  GLU B C   1 
ATOM 3395 O O   . GLU B 1 41  ? 12.313  6.237   4.163   1.00 132.88 ? 39  GLU B O   1 
ATOM 3396 C CB  . GLU B 1 41  ? 14.512  5.898   6.461   1.00 142.85 ? 39  GLU B CB  1 
ATOM 3397 C CG  . GLU B 1 41  ? 14.833  4.951   7.591   1.00 152.25 ? 39  GLU B CG  1 
ATOM 3398 C CD  . GLU B 1 41  ? 15.021  5.700   8.900   1.00 180.92 ? 39  GLU B CD  1 
ATOM 3399 O OE1 . GLU B 1 41  ? 15.966  6.512   8.979   1.00 192.82 ? 39  GLU B OE1 1 
ATOM 3400 O OE2 . GLU B 1 41  ? 14.222  5.493   9.838   1.00 196.01 ? 39  GLU B OE2 1 
ATOM 3401 N N   . ALA B 1 42  ? 11.498  4.773   5.663   1.00 141.63 ? 40  ALA B N   1 
ATOM 3402 C CA  . ALA B 1 42  ? 10.551  4.199   4.718   1.00 134.56 ? 40  ALA B CA  1 
ATOM 3403 C C   . ALA B 1 42  ? 9.474   5.236   4.432   1.00 129.70 ? 40  ALA B C   1 
ATOM 3404 O O   . ALA B 1 42  ? 9.021   5.387   3.298   1.00 135.10 ? 40  ALA B O   1 
ATOM 3405 C CB  . ALA B 1 42  ? 9.942   2.918   5.269   1.00 138.77 ? 40  ALA B CB  1 
ATOM 3406 N N   . LEU B 1 43  ? 9.066   5.940   5.484   1.00 130.86 ? 41  LEU B N   1 
ATOM 3407 C CA  . LEU B 1 43  ? 8.133   7.056   5.378   1.00 123.20 ? 41  LEU B CA  1 
ATOM 3408 C C   . LEU B 1 43  ? 8.662   8.191   4.506   1.00 123.63 ? 41  LEU B C   1 
ATOM 3409 O O   . LEU B 1 43  ? 7.963   8.695   3.627   1.00 137.39 ? 41  LEU B O   1 
ATOM 3410 C CB  . LEU B 1 43  ? 7.803   7.603   6.768   1.00 124.86 ? 41  LEU B CB  1 
ATOM 3411 C CG  . LEU B 1 43  ? 6.852   8.801   6.797   1.00 131.15 ? 41  LEU B CG  1 
ATOM 3412 C CD1 . LEU B 1 43  ? 5.438   8.370   6.445   1.00 143.70 ? 41  LEU B CD1 1 
ATOM 3413 C CD2 . LEU B 1 43  ? 6.890   9.493   8.149   1.00 123.74 ? 41  LEU B CD2 1 
ATOM 3414 N N   . PHE B 1 44  ? 9.906   8.583   4.768   1.00 118.85 ? 42  PHE B N   1 
ATOM 3415 C CA  . PHE B 1 44  ? 10.587  9.618   3.997   1.00 116.71 ? 42  PHE B CA  1 
ATOM 3416 C C   . PHE B 1 44  ? 10.604  9.298   2.504   1.00 125.02 ? 42  PHE B C   1 
ATOM 3417 O O   . PHE B 1 44  ? 10.375  10.181  1.682   1.00 128.65 ? 42  PHE B O   1 
ATOM 3418 C CB  . PHE B 1 44  ? 12.009  9.818   4.530   1.00 121.49 ? 42  PHE B CB  1 
ATOM 3419 C CG  . PHE B 1 44  ? 12.822  10.810  3.749   1.00 119.19 ? 42  PHE B CG  1 
ATOM 3420 C CD1 . PHE B 1 44  ? 12.477  12.152  3.747   1.00 116.62 ? 42  PHE B CD1 1 
ATOM 3421 C CD2 . PHE B 1 44  ? 13.950  10.413  3.051   1.00 128.10 ? 42  PHE B CD2 1 
ATOM 3422 C CE1 . PHE B 1 44  ? 13.224  13.075  3.041   1.00 129.97 ? 42  PHE B CE1 1 
ATOM 3423 C CE2 . PHE B 1 44  ? 14.704  11.334  2.344   1.00 141.49 ? 42  PHE B CE2 1 
ATOM 3424 C CZ  . PHE B 1 44  ? 14.340  12.667  2.340   1.00 140.95 ? 42  PHE B CZ  1 
ATOM 3425 N N   . LEU B 1 45  ? 10.863  8.039   2.160   1.00 129.21 ? 43  LEU B N   1 
ATOM 3426 C CA  . LEU B 1 45  ? 10.912  7.619   0.761   1.00 121.58 ? 43  LEU B CA  1 
ATOM 3427 C C   . LEU B 1 45  ? 9.530   7.803   0.127   1.00 117.48 ? 43  LEU B C   1 
ATOM 3428 O O   . LEU B 1 45  ? 9.409   8.480   -0.893  1.00 120.70 ? 43  LEU B O   1 
ATOM 3429 C CB  . LEU B 1 45  ? 11.408  6.175   0.629   1.00 115.04 ? 43  LEU B CB  1 
ATOM 3430 C CG  . LEU B 1 45  ? 12.850  6.084   0.101   1.00 120.86 ? 43  LEU B CG  1 
ATOM 3431 C CD1 . LEU B 1 45  ? 13.162  4.717   -0.491  1.00 122.80 ? 43  LEU B CD1 1 
ATOM 3432 C CD2 . LEU B 1 45  ? 13.136  7.185   -0.918  1.00 119.18 ? 43  LEU B CD2 1 
ATOM 3433 N N   . LEU B 1 46  ? 8.502   7.185   0.712   1.00 101.04 ? 44  LEU B N   1 
ATOM 3434 C CA  . LEU B 1 46  ? 7.128   7.326   0.213   1.00 94.30  ? 44  LEU B CA  1 
ATOM 3435 C C   . LEU B 1 46  ? 6.700   8.764   -0.010  1.00 92.21  ? 44  LEU B C   1 
ATOM 3436 O O   . LEU B 1 46  ? 6.134   9.097   -1.050  1.00 105.01 ? 44  LEU B O   1 
ATOM 3437 C CB  . LEU B 1 46  ? 6.131   6.688   1.186   1.00 93.38  ? 44  LEU B CB  1 
ATOM 3438 C CG  . LEU B 1 46  ? 4.802   6.126   0.662   1.00 104.35 ? 44  LEU B CG  1 
ATOM 3439 C CD1 . LEU B 1 46  ? 4.899   5.494   -0.713  1.00 118.62 ? 44  LEU B CD1 1 
ATOM 3440 C CD2 . LEU B 1 46  ? 4.181   5.159   1.666   1.00 123.92 ? 44  LEU B CD2 1 
ATOM 3441 N N   . ALA B 1 47  ? 6.970   9.615   0.969   1.00 95.90  ? 45  ALA B N   1 
ATOM 3442 C CA  . ALA B 1 47  ? 6.626   11.021  0.846   1.00 99.97  ? 45  ALA B CA  1 
ATOM 3443 C C   . ALA B 1 47  ? 7.500   11.707  -0.198  1.00 115.29 ? 45  ALA B C   1 
ATOM 3444 O O   . ALA B 1 47  ? 7.052   12.621  -0.887  1.00 132.12 ? 45  ALA B O   1 
ATOM 3445 C CB  . ALA B 1 47  ? 6.749   11.706  2.189   1.00 97.61  ? 45  ALA B CB  1 
ATOM 3446 N N   . THR B 1 48  ? 8.748   11.262  -0.312  1.00 110.28 ? 46  THR B N   1 
ATOM 3447 C CA  . THR B 1 48  ? 9.638   11.764  -1.352  1.00 112.31 ? 46  THR B CA  1 
ATOM 3448 C C   . THR B 1 48  ? 9.149   11.346  -2.742  1.00 112.28 ? 46  THR B C   1 
ATOM 3449 O O   . THR B 1 48  ? 9.251   12.109  -3.704  1.00 114.85 ? 46  THR B O   1 
ATOM 3450 C CB  . THR B 1 48  ? 11.091  11.271  -1.132  1.00 106.62 ? 46  THR B CB  1 
ATOM 3451 O OG1 . THR B 1 48  ? 11.758  12.135  -0.204  1.00 104.54 ? 46  THR B OG1 1 
ATOM 3452 C CG2 . THR B 1 48  ? 11.872  11.227  -2.437  1.00 124.04 ? 46  THR B CG2 1 
ATOM 3453 N N   . CYS B 1 49  ? 8.567   10.153  -2.833  1.00 100.22 ? 47  CYS B N   1 
ATOM 3454 C CA  . CYS B 1 49  ? 8.044   9.664   -4.106  1.00 97.22  ? 47  CYS B CA  1 
ATOM 3455 C C   . CYS B 1 49  ? 6.747   10.356  -4.512  1.00 94.36  ? 47  CYS B C   1 
ATOM 3456 O O   . CYS B 1 49  ? 6.523   10.607  -5.694  1.00 108.31 ? 47  CYS B O   1 
ATOM 3457 C CB  . CYS B 1 49  ? 7.829   8.150   -4.051  1.00 95.39  ? 47  CYS B CB  1 
ATOM 3458 S SG  . CYS B 1 49  ? 9.338   7.182   -3.826  1.00 122.76 ? 47  CYS B SG  1 
ATOM 3459 N N   . TYR B 1 50  ? 5.901   10.674  -3.539  1.00 97.93  ? 48  TYR B N   1 
ATOM 3460 C CA  . TYR B 1 50  ? 4.685   11.432  -3.817  1.00 112.82 ? 48  TYR B CA  1 
ATOM 3461 C C   . TYR B 1 50  ? 5.017   12.866  -4.217  1.00 105.36 ? 48  TYR B C   1 
ATOM 3462 O O   . TYR B 1 50  ? 4.392   13.426  -5.117  1.00 115.97 ? 48  TYR B O   1 
ATOM 3463 C CB  . TYR B 1 50  ? 3.732   11.414  -2.618  1.00 110.49 ? 48  TYR B CB  1 
ATOM 3464 C CG  . TYR B 1 50  ? 3.049   10.080  -2.395  1.00 100.70 ? 48  TYR B CG  1 
ATOM 3465 C CD1 . TYR B 1 50  ? 2.783   9.614   -1.115  1.00 88.34  ? 48  TYR B CD1 1 
ATOM 3466 C CD2 . TYR B 1 50  ? 2.646   9.301   -3.472  1.00 113.40 ? 48  TYR B CD2 1 
ATOM 3467 C CE1 . TYR B 1 50  ? 2.146   8.400   -0.915  1.00 96.97  ? 48  TYR B CE1 1 
ATOM 3468 C CE2 . TYR B 1 50  ? 2.013   8.088   -3.283  1.00 115.02 ? 48  TYR B CE2 1 
ATOM 3469 C CZ  . TYR B 1 50  ? 1.764   7.642   -2.004  1.00 108.95 ? 48  TYR B CZ  1 
ATOM 3470 O OH  . TYR B 1 50  ? 1.136   6.432   -1.816  1.00 107.08 ? 48  TYR B OH  1 
ATOM 3471 N N   . TYR B 1 51  ? 5.992   13.459  -3.537  1.00 92.87  ? 49  TYR B N   1 
ATOM 3472 C CA  . TYR B 1 51  ? 6.380   14.839  -3.810  1.00 96.67  ? 49  TYR B CA  1 
ATOM 3473 C C   . TYR B 1 51  ? 6.996   15.010  -5.199  1.00 114.37 ? 49  TYR B C   1 
ATOM 3474 O O   . TYR B 1 51  ? 6.649   15.941  -5.925  1.00 127.05 ? 49  TYR B O   1 
ATOM 3475 C CB  . TYR B 1 51  ? 7.355   15.338  -2.740  1.00 96.20  ? 49  TYR B CB  1 
ATOM 3476 C CG  . TYR B 1 51  ? 7.753   16.789  -2.905  1.00 99.12  ? 49  TYR B CG  1 
ATOM 3477 C CD1 . TYR B 1 51  ? 7.034   17.799  -2.283  1.00 99.38  ? 49  TYR B CD1 1 
ATOM 3478 C CD2 . TYR B 1 51  ? 8.861   17.146  -3.663  1.00 102.92 ? 49  TYR B CD2 1 
ATOM 3479 C CE1 . TYR B 1 51  ? 7.392   19.125  -2.426  1.00 102.58 ? 49  TYR B CE1 1 
ATOM 3480 C CE2 . TYR B 1 51  ? 9.227   18.470  -3.813  1.00 109.26 ? 49  TYR B CE2 1 
ATOM 3481 C CZ  . TYR B 1 51  ? 8.490   19.455  -3.190  1.00 110.90 ? 49  TYR B CZ  1 
ATOM 3482 O OH  . TYR B 1 51  ? 8.852   20.775  -3.335  1.00 133.26 ? 49  TYR B OH  1 
ATOM 3483 N N   . ARG B 1 52  ? 7.904   14.111  -5.567  1.00 110.80 ? 50  ARG B N   1 
ATOM 3484 C CA  . ARG B 1 52  ? 8.536   14.163  -6.884  1.00 121.61 ? 50  ARG B CA  1 
ATOM 3485 C C   . ARG B 1 52  ? 7.595   13.740  -8.012  1.00 119.60 ? 50  ARG B C   1 
ATOM 3486 O O   . ARG B 1 52  ? 7.787   14.130  -9.163  1.00 129.35 ? 50  ARG B O   1 
ATOM 3487 C CB  . ARG B 1 52  ? 9.792   13.284  -6.898  1.00 136.26 ? 50  ARG B CB  1 
ATOM 3488 C CG  . ARG B 1 52  ? 10.902  13.755  -5.967  1.00 144.61 ? 50  ARG B CG  1 
ATOM 3489 C CD  . ARG B 1 52  ? 12.192  12.974  -6.197  1.00 141.64 ? 50  ARG B CD  1 
ATOM 3490 N NE  . ARG B 1 52  ? 13.201  13.276  -5.184  1.00 136.40 ? 50  ARG B NE  1 
ATOM 3491 C CZ  . ARG B 1 52  ? 14.494  12.984  -5.299  1.00 132.65 ? 50  ARG B CZ  1 
ATOM 3492 N NH1 . ARG B 1 52  ? 14.942  12.346  -6.372  1.00 133.14 ? 50  ARG B NH1 1 
ATOM 3493 N NH2 . ARG B 1 52  ? 15.336  13.300  -4.325  1.00 134.06 ? 50  ARG B NH2 1 
ATOM 3494 N N   . SER B 1 53  ? 6.579   12.948  -7.679  1.00 109.70 ? 51  SER B N   1 
ATOM 3495 C CA  . SER B 1 53  ? 5.505   12.619  -8.618  1.00 105.86 ? 51  SER B CA  1 
ATOM 3496 C C   . SER B 1 53  ? 4.685   13.841  -9.025  1.00 120.86 ? 51  SER B C   1 
ATOM 3497 O O   . SER B 1 53  ? 3.883   13.777  -9.957  1.00 132.64 ? 51  SER B O   1 
ATOM 3498 C CB  . SER B 1 53  ? 4.574   11.558  -8.025  1.00 103.21 ? 51  SER B CB  1 
ATOM 3499 O OG  . SER B 1 53  ? 3.632   12.140  -7.141  1.00 104.03 ? 51  SER B OG  1 
ATOM 3500 N N   . GLY B 1 54  ? 4.892   14.953  -8.327  1.00 128.14 ? 52  GLY B N   1 
ATOM 3501 C CA  . GLY B 1 54  ? 4.163   16.176  -8.602  1.00 128.64 ? 52  GLY B CA  1 
ATOM 3502 C C   . GLY B 1 54  ? 2.848   16.216  -7.847  1.00 116.46 ? 52  GLY B C   1 
ATOM 3503 O O   . GLY B 1 54  ? 1.899   16.885  -8.255  1.00 124.85 ? 52  GLY B O   1 
ATOM 3504 N N   . LYS B 1 55  ? 2.805   15.494  -6.732  1.00 103.75 ? 53  LYS B N   1 
ATOM 3505 C CA  . LYS B 1 55  ? 1.627   15.443  -5.875  1.00 104.20 ? 53  LYS B CA  1 
ATOM 3506 C C   . LYS B 1 55  ? 2.068   15.732  -4.443  1.00 111.68 ? 53  LYS B C   1 
ATOM 3507 O O   . LYS B 1 55  ? 2.162   14.831  -3.610  1.00 106.22 ? 53  LYS B O   1 
ATOM 3508 C CB  . LYS B 1 55  ? 0.934   14.083  -5.970  1.00 100.36 ? 53  LYS B CB  1 
ATOM 3509 N N   . ALA B 1 56  ? 2.339   17.005  -4.176  1.00 120.10 ? 54  ALA B N   1 
ATOM 3510 C CA  . ALA B 1 56  ? 2.809   17.467  -2.873  1.00 115.35 ? 54  ALA B CA  1 
ATOM 3511 C C   . ALA B 1 56  ? 1.834   17.241  -1.715  1.00 106.69 ? 54  ALA B C   1 
ATOM 3512 O O   . ALA B 1 56  ? 2.254   16.876  -0.617  1.00 116.31 ? 54  ALA B O   1 
ATOM 3513 C CB  . ALA B 1 56  ? 3.169   18.946  -2.958  1.00 133.02 ? 54  ALA B CB  1 
ATOM 3514 N N   . TYR B 1 57  ? 0.546   17.471  -1.959  1.00 100.29 ? 55  TYR B N   1 
ATOM 3515 C CA  . TYR B 1 57  ? -0.502  17.240  -0.959  1.00 99.89  ? 55  TYR B CA  1 
ATOM 3516 C C   . TYR B 1 57  ? -0.422  15.818  -0.405  1.00 96.26  ? 55  TYR B C   1 
ATOM 3517 O O   . TYR B 1 57  ? -0.643  15.588  0.784   1.00 94.90  ? 55  TYR B O   1 
ATOM 3518 C CB  . TYR B 1 57  ? -1.897  17.520  -1.542  1.00 124.07 ? 55  TYR B CB  1 
ATOM 3519 C CG  . TYR B 1 57  ? -2.436  16.488  -2.510  1.00 130.29 ? 55  TYR B CG  1 
ATOM 3520 C CD1 . TYR B 1 57  ? -3.012  15.305  -2.051  1.00 130.10 ? 55  TYR B CD1 1 
ATOM 3521 C CD2 . TYR B 1 57  ? -2.347  16.680  -3.877  1.00 142.14 ? 55  TYR B CD2 1 
ATOM 3522 C CE1 . TYR B 1 57  ? -3.496  14.358  -2.925  1.00 131.42 ? 55  TYR B CE1 1 
ATOM 3523 C CE2 . TYR B 1 57  ? -2.826  15.735  -4.755  1.00 147.02 ? 55  TYR B CE2 1 
ATOM 3524 C CZ  . TYR B 1 57  ? -3.402  14.577  -4.277  1.00 137.55 ? 55  TYR B CZ  1 
ATOM 3525 O OH  . TYR B 1 57  ? -3.886  13.637  -5.157  1.00 133.70 ? 55  TYR B OH  1 
ATOM 3526 N N   . LYS B 1 58  ? -0.107  14.873  -1.285  1.00 95.61  ? 56  LYS B N   1 
ATOM 3527 C CA  . LYS B 1 58  ? -0.074  13.456  -0.949  1.00 101.27 ? 56  LYS B CA  1 
ATOM 3528 C C   . LYS B 1 58  ? 1.003   13.164  0.085   1.00 101.26 ? 56  LYS B C   1 
ATOM 3529 O O   . LYS B 1 58  ? 0.796   12.363  0.995   1.00 113.12 ? 56  LYS B O   1 
ATOM 3530 C CB  . LYS B 1 58  ? 0.159   12.612  -2.203  1.00 115.06 ? 56  LYS B CB  1 
ATOM 3531 N N   . ALA B 1 59  ? 2.151   13.817  -0.050  1.00 96.60  ? 57  ALA B N   1 
ATOM 3532 C CA  . ALA B 1 59  ? 3.224   13.635  0.916   1.00 99.64  ? 57  ALA B CA  1 
ATOM 3533 C C   . ALA B 1 59  ? 2.827   14.305  2.229   1.00 92.97  ? 57  ALA B C   1 
ATOM 3534 O O   . ALA B 1 59  ? 2.890   13.676  3.286   1.00 96.49  ? 57  ALA B O   1 
ATOM 3535 C CB  . ALA B 1 59  ? 4.528   14.202  0.388   1.00 119.27 ? 57  ALA B CB  1 
ATOM 3536 N N   . TYR B 1 60  ? 2.477   15.589  2.164   1.00 94.60  ? 58  TYR B N   1 
ATOM 3537 C CA  . TYR B 1 60  ? 1.993   16.335  3.330   1.00 94.19  ? 58  TYR B CA  1 
ATOM 3538 C C   . TYR B 1 60  ? 1.028   15.544  4.211   1.00 93.31  ? 58  TYR B C   1 
ATOM 3539 O O   . TYR B 1 60  ? 1.275   15.350  5.401   1.00 98.13  ? 58  TYR B O   1 
ATOM 3540 C CB  . TYR B 1 60  ? 1.312   17.633  2.890   1.00 94.47  ? 58  TYR B CB  1 
ATOM 3541 C CG  . TYR B 1 60  ? 0.699   18.404  4.040   1.00 101.92 ? 58  TYR B CG  1 
ATOM 3542 C CD1 . TYR B 1 60  ? 1.458   19.282  4.803   1.00 111.49 ? 58  TYR B CD1 1 
ATOM 3543 C CD2 . TYR B 1 60  ? -0.644  18.251  4.363   1.00 97.27  ? 58  TYR B CD2 1 
ATOM 3544 C CE1 . TYR B 1 60  ? 0.895   19.983  5.856   1.00 112.96 ? 58  TYR B CE1 1 
ATOM 3545 C CE2 . TYR B 1 60  ? -1.213  18.942  5.411   1.00 114.04 ? 58  TYR B CE2 1 
ATOM 3546 C CZ  . TYR B 1 60  ? -0.441  19.808  6.154   1.00 120.00 ? 58  TYR B CZ  1 
ATOM 3547 O OH  . TYR B 1 60  ? -1.010  20.500  7.198   1.00 134.89 ? 58  TYR B OH  1 
ATOM 3548 N N   . ARG B 1 61  ? -0.078  15.108  3.613   1.00 91.45  ? 59  ARG B N   1 
ATOM 3549 C CA  . ARG B 1 61  ? -1.126  14.390  4.333   1.00 96.63  ? 59  ARG B CA  1 
ATOM 3550 C C   . ARG B 1 61  ? -0.581  13.106  4.943   1.00 89.56  ? 59  ARG B C   1 
ATOM 3551 O O   . ARG B 1 61  ? -0.994  12.695  6.027   1.00 89.90  ? 59  ARG B O   1 
ATOM 3552 C CB  . ARG B 1 61  ? -2.302  14.080  3.404   1.00 93.63  ? 59  ARG B CB  1 
ATOM 3553 N N   . LEU B 1 62  ? 0.354   12.480  4.238   1.00 87.83  ? 60  LEU B N   1 
ATOM 3554 C CA  . LEU B 1 62  ? 1.031   11.298  4.748   1.00 86.25  ? 60  LEU B CA  1 
ATOM 3555 C C   . LEU B 1 62  ? 1.931   11.640  5.928   1.00 96.07  ? 60  LEU B C   1 
ATOM 3556 O O   . LEU B 1 62  ? 1.801   11.053  7.001   1.00 102.81 ? 60  LEU B O   1 
ATOM 3557 C CB  . LEU B 1 62  ? 1.848   10.631  3.638   1.00 85.83  ? 60  LEU B CB  1 
ATOM 3558 C CG  . LEU B 1 62  ? 2.651   9.385   4.016   1.00 88.25  ? 60  LEU B CG  1 
ATOM 3559 C CD1 . LEU B 1 62  ? 1.868   8.129   3.712   1.00 86.45  ? 60  LEU B CD1 1 
ATOM 3560 C CD2 . LEU B 1 62  ? 3.972   9.370   3.264   1.00 89.90  ? 60  LEU B CD2 1 
ATOM 3561 N N   . LEU B 1 63  ? 2.843   12.587  5.726   1.00 107.15 ? 61  LEU B N   1 
ATOM 3562 C CA  . LEU B 1 63  ? 3.776   12.979  6.778   1.00 110.76 ? 61  LEU B CA  1 
ATOM 3563 C C   . LEU B 1 63  ? 3.084   13.527  8.023   1.00 115.18 ? 61  LEU B C   1 
ATOM 3564 O O   . LEU B 1 63  ? 3.584   13.357  9.133   1.00 117.65 ? 61  LEU B O   1 
ATOM 3565 C CB  . LEU B 1 63  ? 4.771   14.012  6.249   1.00 121.93 ? 61  LEU B CB  1 
ATOM 3566 C CG  . LEU B 1 63  ? 5.822   13.463  5.283   1.00 134.27 ? 61  LEU B CG  1 
ATOM 3567 C CD1 . LEU B 1 63  ? 6.382   14.568  4.399   1.00 144.15 ? 61  LEU B CD1 1 
ATOM 3568 C CD2 . LEU B 1 63  ? 6.932   12.761  6.051   1.00 135.86 ? 61  LEU B CD2 1 
ATOM 3569 N N   . LYS B 1 64  ? 1.952   14.201  7.844   1.00 127.58 ? 62  LYS B N   1 
ATOM 3570 C CA  . LYS B 1 64  ? 1.207   14.702  8.992   1.00 123.55 ? 62  LYS B CA  1 
ATOM 3571 C C   . LYS B 1 64  ? 0.606   13.538  9.772   1.00 119.89 ? 62  LYS B C   1 
ATOM 3572 O O   . LYS B 1 64  ? 0.692   13.486  10.998  1.00 110.88 ? 62  LYS B O   1 
ATOM 3573 C CB  . LYS B 1 64  ? 0.108   15.670  8.548   1.00 116.27 ? 62  LYS B CB  1 
ATOM 3574 N N   . GLY B 1 65  ? -0.013  12.611  9.047   1.00 131.24 ? 63  GLY B N   1 
ATOM 3575 C CA  . GLY B 1 65  ? -0.659  11.463  9.657   1.00 129.35 ? 63  GLY B CA  1 
ATOM 3576 C C   . GLY B 1 65  ? 0.256   10.376  10.196  1.00 125.51 ? 63  GLY B C   1 
ATOM 3577 O O   . GLY B 1 65  ? -0.230  9.328   10.616  1.00 123.81 ? 63  GLY B O   1 
ATOM 3578 N N   . HIS B 1 66  ? 1.562   10.637  10.232  1.00 121.70 ? 64  HIS B N   1 
ATOM 3579 C CA  . HIS B 1 66  ? 2.526   9.730   10.858  1.00 118.90 ? 64  HIS B CA  1 
ATOM 3580 C C   . HIS B 1 66  ? 3.585   10.553  11.601  1.00 125.97 ? 64  HIS B C   1 
ATOM 3581 O O   . HIS B 1 66  ? 3.781   11.726  11.298  1.00 125.88 ? 64  HIS B O   1 
ATOM 3582 C CB  . HIS B 1 66  ? 3.183   8.821   9.807   1.00 119.26 ? 64  HIS B CB  1 
ATOM 3583 C CG  . HIS B 1 66  ? 2.237   7.864   9.142   1.00 118.10 ? 64  HIS B CG  1 
ATOM 3584 N ND1 . HIS B 1 66  ? 2.298   7.576   7.795   1.00 138.63 ? 64  HIS B ND1 1 
ATOM 3585 C CD2 . HIS B 1 66  ? 1.225   7.114   9.639   1.00 122.87 ? 64  HIS B CD2 1 
ATOM 3586 C CE1 . HIS B 1 66  ? 1.355   6.702   7.489   1.00 144.55 ? 64  HIS B CE1 1 
ATOM 3587 N NE2 . HIS B 1 66  ? 0.688   6.408   8.589   1.00 135.53 ? 64  HIS B NE2 1 
ATOM 3588 N N   . SER B 1 67  ? 4.278   9.939   12.556  1.00 138.13 ? 65  SER B N   1 
ATOM 3589 C CA  . SER B 1 67  ? 5.321   10.620  13.340  1.00 145.72 ? 65  SER B CA  1 
ATOM 3590 C C   . SER B 1 67  ? 6.626   10.986  12.623  1.00 143.23 ? 65  SER B C   1 
ATOM 3591 O O   . SER B 1 67  ? 7.538   10.166  12.538  1.00 147.05 ? 65  SER B O   1 
ATOM 3592 C CB  . SER B 1 67  ? 5.677   9.768   14.555  1.00 156.98 ? 65  SER B CB  1 
ATOM 3593 O OG  . SER B 1 67  ? 6.385   8.609   14.156  1.00 159.67 ? 65  SER B OG  1 
ATOM 3594 N N   . CYS B 1 68  ? 6.709   12.205  12.098  1.00 134.13 ? 66  CYS B N   1 
ATOM 3595 C CA  . CYS B 1 68  ? 7.951   12.702  11.505  1.00 139.03 ? 66  CYS B CA  1 
ATOM 3596 C C   . CYS B 1 68  ? 8.749   13.589  12.479  1.00 146.88 ? 66  CYS B C   1 
ATOM 3597 O O   . CYS B 1 68  ? 8.252   14.618  12.939  1.00 152.79 ? 66  CYS B O   1 
ATOM 3598 C CB  . CYS B 1 68  ? 7.648   13.439  10.191  1.00 139.64 ? 66  CYS B CB  1 
ATOM 3599 S SG  . CYS B 1 68  ? 7.925   15.228  10.134  1.00 209.97 ? 66  CYS B SG  1 
ATOM 3600 N N   . THR B 1 69  ? 9.951   13.157  12.862  1.00 147.33 ? 67  THR B N   1 
ATOM 3601 C CA  . THR B 1 69  ? 10.658  13.817  13.959  1.00 155.44 ? 67  THR B CA  1 
ATOM 3602 C C   . THR B 1 69  ? 12.133  14.033  13.619  1.00 141.08 ? 67  THR B C   1 
ATOM 3603 O O   . THR B 1 69  ? 12.940  14.391  14.478  1.00 146.92 ? 67  THR B O   1 
ATOM 3604 C CB  . THR B 1 69  ? 10.580  12.992  15.259  1.00 178.76 ? 67  THR B CB  1 
ATOM 3605 O OG1 . THR B 1 69  ? 11.148  11.695  15.036  1.00 180.83 ? 67  THR B OG1 1 
ATOM 3606 C CG2 . THR B 1 69  ? 9.137   12.842  15.726  1.00 183.19 ? 67  THR B CG2 1 
ATOM 3607 N N   . THR B 1 70  ? 12.467  13.812  12.353  1.00 134.47 ? 68  THR B N   1 
ATOM 3608 C CA  . THR B 1 70  ? 13.852  13.768  11.894  1.00 134.03 ? 68  THR B CA  1 
ATOM 3609 C C   . THR B 1 70  ? 14.100  14.931  10.932  1.00 143.61 ? 68  THR B C   1 
ATOM 3610 O O   . THR B 1 70  ? 13.145  15.441  10.348  1.00 157.08 ? 68  THR B O   1 
ATOM 3611 C CB  . THR B 1 70  ? 14.189  12.418  11.223  1.00 141.69 ? 68  THR B CB  1 
ATOM 3612 O OG1 . THR B 1 70  ? 13.067  11.956  10.463  1.00 145.50 ? 68  THR B OG1 1 
ATOM 3613 C CG2 . THR B 1 70  ? 14.554  11.388  12.279  1.00 152.26 ? 68  THR B CG2 1 
ATOM 3614 N N   . PRO B 1 71  ? 15.366  15.370  10.776  1.00 145.92 ? 69  PRO B N   1 
ATOM 3615 C CA  . PRO B 1 71  ? 15.579  16.570  9.958   1.00 148.06 ? 69  PRO B CA  1 
ATOM 3616 C C   . PRO B 1 71  ? 15.095  16.300  8.541   1.00 136.94 ? 69  PRO B C   1 
ATOM 3617 O O   . PRO B 1 71  ? 14.301  17.068  7.995   1.00 141.48 ? 69  PRO B O   1 
ATOM 3618 C CB  . PRO B 1 71  ? 17.097  16.786  10.000  1.00 162.20 ? 69  PRO B CB  1 
ATOM 3619 C CG  . PRO B 1 71  ? 17.643  15.747  10.917  1.00 165.92 ? 69  PRO B CG  1 
ATOM 3620 C CD  . PRO B 1 71  ? 16.632  14.682  11.078  1.00 154.41 ? 69  PRO B CD  1 
ATOM 3621 N N   . GLN B 1 72  ? 15.602  15.214  7.963   1.00 131.69 ? 70  GLN B N   1 
ATOM 3622 C CA  . GLN B 1 72  ? 15.223  14.753  6.632   1.00 141.54 ? 70  GLN B CA  1 
ATOM 3623 C C   . GLN B 1 72  ? 13.705  14.791  6.426   1.00 124.70 ? 70  GLN B C   1 
ATOM 3624 O O   . GLN B 1 72  ? 13.225  15.278  5.403   1.00 122.00 ? 70  GLN B O   1 
ATOM 3625 C CB  . GLN B 1 72  ? 15.781  13.343  6.413   1.00 163.48 ? 70  GLN B CB  1 
ATOM 3626 C CG  . GLN B 1 72  ? 15.713  12.468  7.665   1.00 172.50 ? 70  GLN B CG  1 
ATOM 3627 C CD  . GLN B 1 72  ? 15.701  10.981  7.368   1.00 172.11 ? 70  GLN B CD  1 
ATOM 3628 O OE1 . GLN B 1 72  ? 16.307  10.523  6.399   1.00 181.99 ? 70  GLN B OE1 1 
ATOM 3629 N NE2 . GLN B 1 72  ? 15.026  10.215  8.218   1.00 156.00 ? 70  GLN B NE2 1 
ATOM 3630 N N   . CYS B 1 73  ? 12.959  14.266  7.392   1.00 120.50 ? 71  CYS B N   1 
ATOM 3631 C CA  . CYS B 1 73  ? 11.502  14.255  7.320   1.00 118.29 ? 71  CYS B CA  1 
ATOM 3632 C C   . CYS B 1 73  ? 10.955  15.678  7.428   1.00 114.50 ? 71  CYS B C   1 
ATOM 3633 O O   . CYS B 1 73  ? 10.135  16.108  6.619   1.00 110.82 ? 71  CYS B O   1 
ATOM 3634 C CB  . CYS B 1 73  ? 10.909  13.370  8.416   1.00 121.10 ? 71  CYS B CB  1 
ATOM 3635 S SG  . CYS B 1 73  ? 10.961  11.606  8.036   1.00 183.78 ? 71  CYS B SG  1 
ATOM 3636 N N   . LYS B 1 74  ? 11.418  16.389  8.453   1.00 125.28 ? 72  LYS B N   1 
ATOM 3637 C CA  . LYS B 1 74  ? 10.986  17.754  8.753   1.00 127.55 ? 72  LYS B CA  1 
ATOM 3638 C C   . LYS B 1 74  ? 11.226  18.756  7.623   1.00 124.11 ? 72  LYS B C   1 
ATOM 3639 O O   . LYS B 1 74  ? 10.470  19.714  7.467   1.00 125.63 ? 72  LYS B O   1 
ATOM 3640 C CB  . LYS B 1 74  ? 11.685  18.253  10.021  1.00 132.00 ? 72  LYS B CB  1 
ATOM 3641 N N   . TYR B 1 75  ? 12.272  18.531  6.836   1.00 117.71 ? 73  TYR B N   1 
ATOM 3642 C CA  . TYR B 1 75  ? 12.526  19.350  5.653   1.00 117.57 ? 73  TYR B CA  1 
ATOM 3643 C C   . TYR B 1 75  ? 11.471  19.159  4.571   1.00 125.60 ? 73  TYR B C   1 
ATOM 3644 O O   . TYR B 1 75  ? 10.853  20.125  4.124   1.00 137.92 ? 73  TYR B O   1 
ATOM 3645 C CB  . TYR B 1 75  ? 13.915  19.037  5.088   1.00 118.90 ? 73  TYR B CB  1 
ATOM 3646 C CG  . TYR B 1 75  ? 14.300  19.866  3.881   1.00 119.39 ? 73  TYR B CG  1 
ATOM 3647 C CD1 . TYR B 1 75  ? 14.024  19.420  2.593   1.00 131.89 ? 73  TYR B CD1 1 
ATOM 3648 C CD2 . TYR B 1 75  ? 14.931  21.094  4.026   1.00 121.52 ? 73  TYR B CD2 1 
ATOM 3649 C CE1 . TYR B 1 75  ? 14.369  20.170  1.486   1.00 145.86 ? 73  TYR B CE1 1 
ATOM 3650 C CE2 . TYR B 1 75  ? 15.281  21.853  2.922   1.00 133.98 ? 73  TYR B CE2 1 
ATOM 3651 C CZ  . TYR B 1 75  ? 14.998  21.386  1.655   1.00 144.95 ? 73  TYR B CZ  1 
ATOM 3652 O OH  . TYR B 1 75  ? 15.344  22.136  0.554   1.00 149.91 ? 73  TYR B OH  1 
ATOM 3653 N N   . LEU B 1 76  ? 11.283  17.914  4.146   1.00 119.79 ? 74  LEU B N   1 
ATOM 3654 C CA  . LEU B 1 76  ? 10.291  17.567  3.132   1.00 105.43 ? 74  LEU B CA  1 
ATOM 3655 C C   . LEU B 1 76  ? 8.895   18.094  3.462   1.00 101.38 ? 74  LEU B C   1 
ATOM 3656 O O   . LEU B 1 76  ? 8.183   18.589  2.586   1.00 100.24 ? 74  LEU B O   1 
ATOM 3657 C CB  . LEU B 1 76  ? 10.238  16.055  2.935   1.00 102.36 ? 74  LEU B CB  1 
ATOM 3658 C CG  . LEU B 1 76  ? 9.244   15.601  1.869   1.00 99.37  ? 74  LEU B CG  1 
ATOM 3659 C CD1 . LEU B 1 76  ? 9.620   16.186  0.521   1.00 111.48 ? 74  LEU B CD1 1 
ATOM 3660 C CD2 . LEU B 1 76  ? 9.228   14.097  1.800   1.00 98.80  ? 74  LEU B CD2 1 
ATOM 3661 N N   . LEU B 1 77  ? 8.516   17.991  4.731   1.00 101.73 ? 75  LEU B N   1 
ATOM 3662 C CA  . LEU B 1 77  ? 7.216   18.464  5.193   1.00 100.18 ? 75  LEU B CA  1 
ATOM 3663 C C   . LEU B 1 77  ? 7.111   19.983  5.122   1.00 101.38 ? 75  LEU B C   1 
ATOM 3664 O O   . LEU B 1 77  ? 6.093   20.515  4.680   1.00 113.64 ? 75  LEU B O   1 
ATOM 3665 C CB  . LEU B 1 77  ? 6.953   17.989  6.623   1.00 100.79 ? 75  LEU B CB  1 
ATOM 3666 N N   . ALA B 1 78  ? 8.150   20.678  5.571   1.00 103.28 ? 76  ALA B N   1 
ATOM 3667 C CA  . ALA B 1 78  ? 8.201   22.132  5.453   1.00 106.84 ? 76  ALA B CA  1 
ATOM 3668 C C   . ALA B 1 78  ? 8.048   22.576  3.997   1.00 117.69 ? 76  ALA B C   1 
ATOM 3669 O O   . ALA B 1 78  ? 7.268   23.479  3.693   1.00 121.71 ? 76  ALA B O   1 
ATOM 3670 C CB  . ALA B 1 78  ? 9.500   22.665  6.035   1.00 106.23 ? 76  ALA B CB  1 
ATOM 3671 N N   . LYS B 1 79  ? 8.813   21.947  3.109   1.00 117.29 ? 77  LYS B N   1 
ATOM 3672 C CA  . LYS B 1 79  ? 8.732   22.212  1.675   1.00 112.15 ? 77  LYS B CA  1 
ATOM 3673 C C   . LYS B 1 79  ? 7.324   22.056  1.099   1.00 111.03 ? 77  LYS B C   1 
ATOM 3674 O O   . LYS B 1 79  ? 6.885   22.883  0.301   1.00 125.28 ? 77  LYS B O   1 
ATOM 3675 C CB  . LYS B 1 79  ? 9.694   21.296  0.916   1.00 106.10 ? 77  LYS B CB  1 
ATOM 3676 N N   . CYS B 1 80  ? 6.614   21.012  1.521   1.00 102.50 ? 78  CYS B N   1 
ATOM 3677 C CA  . CYS B 1 80  ? 5.226   20.816  1.106   1.00 100.84 ? 78  CYS B CA  1 
ATOM 3678 C C   . CYS B 1 80  ? 4.333   21.918  1.648   1.00 103.87 ? 78  CYS B C   1 
ATOM 3679 O O   . CYS B 1 80  ? 3.441   22.403  0.949   1.00 106.55 ? 78  CYS B O   1 
ATOM 3680 C CB  . CYS B 1 80  ? 4.707   19.457  1.578   1.00 97.34  ? 78  CYS B CB  1 
ATOM 3681 S SG  . CYS B 1 80  ? 5.404   18.037  0.715   1.00 124.11 ? 78  CYS B SG  1 
ATOM 3682 N N   . CYS B 1 81  ? 4.568   22.295  2.901   1.00 107.85 ? 79  CYS B N   1 
ATOM 3683 C CA  . CYS B 1 81  ? 3.810   23.364  3.538   1.00 109.32 ? 79  CYS B CA  1 
ATOM 3684 C C   . CYS B 1 81  ? 3.954   24.620  2.693   1.00 116.30 ? 79  CYS B C   1 
ATOM 3685 O O   . CYS B 1 81  ? 2.961   25.219  2.281   1.00 129.60 ? 79  CYS B O   1 
ATOM 3686 C CB  . CYS B 1 81  ? 4.289   23.598  4.969   1.00 109.80 ? 79  CYS B CB  1 
ATOM 3687 S SG  . CYS B 1 81  ? 3.697   22.356  6.141   1.00 138.24 ? 79  CYS B SG  1 
ATOM 3688 N N   . VAL B 1 82  ? 5.201   25.021  2.460   1.00 114.52 ? 80  VAL B N   1 
ATOM 3689 C CA  . VAL B 1 82  ? 5.492   26.246  1.727   1.00 118.40 ? 80  VAL B CA  1 
ATOM 3690 C C   . VAL B 1 82  ? 4.895   26.161  0.323   1.00 119.97 ? 80  VAL B C   1 
ATOM 3691 O O   . VAL B 1 82  ? 4.345   27.135  -0.188  1.00 128.36 ? 80  VAL B O   1 
ATOM 3692 C CB  . VAL B 1 82  ? 7.006   26.506  1.631   1.00 119.56 ? 80  VAL B CB  1 
ATOM 3693 N N   . ASP B 1 83  ? 5.022   24.989  -0.295  1.00 116.28 ? 81  ASP B N   1 
ATOM 3694 C CA  . ASP B 1 83  ? 4.388   24.711  -1.582  1.00 117.57 ? 81  ASP B CA  1 
ATOM 3695 C C   . ASP B 1 83  ? 2.873   24.890  -1.532  1.00 131.01 ? 81  ASP B C   1 
ATOM 3696 O O   . ASP B 1 83  ? 2.258   25.334  -2.502  1.00 148.46 ? 81  ASP B O   1 
ATOM 3697 C CB  . ASP B 1 83  ? 4.714   23.290  -2.052  1.00 113.28 ? 81  ASP B CB  1 
ATOM 3698 C CG  . ASP B 1 83  ? 6.123   23.161  -2.592  1.00 114.92 ? 81  ASP B CG  1 
ATOM 3699 O OD1 . ASP B 1 83  ? 6.889   24.143  -2.500  1.00 120.25 ? 81  ASP B OD1 1 
ATOM 3700 O OD2 . ASP B 1 83  ? 6.461   22.080  -3.119  1.00 114.87 ? 81  ASP B OD2 1 
ATOM 3701 N N   . LEU B 1 84  ? 2.280   24.543  -0.394  1.00 110.60 ? 82  LEU B N   1 
ATOM 3702 C CA  . LEU B 1 84  ? 0.832   24.605  -0.229  1.00 107.23 ? 82  LEU B CA  1 
ATOM 3703 C C   . LEU B 1 84  ? 0.336   25.945  0.301   1.00 118.27 ? 82  LEU B C   1 
ATOM 3704 O O   . LEU B 1 84  ? -0.830  26.064  0.681   1.00 128.08 ? 82  LEU B O   1 
ATOM 3705 C CB  . LEU B 1 84  ? 0.362   23.485  0.702   1.00 103.55 ? 82  LEU B CB  1 
ATOM 3706 N N   . SER B 1 85  ? 1.215   26.945  0.319   1.00 116.91 ? 83  SER B N   1 
ATOM 3707 C CA  . SER B 1 85  ? 0.896   28.246  0.906   1.00 139.05 ? 83  SER B CA  1 
ATOM 3708 C C   . SER B 1 85  ? 0.418   28.101  2.348   1.00 144.02 ? 83  SER B C   1 
ATOM 3709 O O   . SER B 1 85  ? -0.589  28.684  2.749   1.00 137.12 ? 83  SER B O   1 
ATOM 3710 C CB  . SER B 1 85  ? -0.149  28.976  0.062   1.00 132.61 ? 83  SER B CB  1 
ATOM 3711 O OG  . SER B 1 85  ? 0.381   29.308  -1.209  1.00 132.95 ? 83  SER B OG  1 
ATOM 3712 N N   . LYS B 1 86  ? 1.157   27.309  3.116   1.00 148.64 ? 84  LYS B N   1 
ATOM 3713 C CA  . LYS B 1 86  ? 0.905   27.132  4.539   1.00 121.88 ? 84  LYS B CA  1 
ATOM 3714 C C   . LYS B 1 86  ? 2.133   27.611  5.302   1.00 134.57 ? 84  LYS B C   1 
ATOM 3715 O O   . LYS B 1 86  ? 2.808   26.836  5.977   1.00 129.12 ? 84  LYS B O   1 
ATOM 3716 C CB  . LYS B 1 86  ? 0.591   25.670  4.867   1.00 116.12 ? 84  LYS B CB  1 
ATOM 3717 N N   . LEU B 1 87  ? 2.412   28.905  5.166   1.00 136.50 ? 85  LEU B N   1 
ATOM 3718 C CA  . LEU B 1 87  ? 3.660   29.512  5.624   1.00 145.61 ? 85  LEU B CA  1 
ATOM 3719 C C   . LEU B 1 87  ? 3.825   29.455  7.139   1.00 146.71 ? 85  LEU B C   1 
ATOM 3720 O O   . LEU B 1 87  ? 4.944   29.367  7.646   1.00 142.16 ? 85  LEU B O   1 
ATOM 3721 C CB  . LEU B 1 87  ? 3.735   30.967  5.155   1.00 140.27 ? 85  LEU B CB  1 
ATOM 3722 N N   . ALA B 1 88  ? 2.708   29.508  7.854   1.00 150.45 ? 86  ALA B N   1 
ATOM 3723 C CA  . ALA B 1 88  ? 2.723   29.446  9.308   1.00 151.27 ? 86  ALA B CA  1 
ATOM 3724 C C   . ALA B 1 88  ? 3.247   28.081  9.724   1.00 150.89 ? 86  ALA B C   1 
ATOM 3725 O O   . ALA B 1 88  ? 4.125   27.971  10.581  1.00 164.98 ? 86  ALA B O   1 
ATOM 3726 C CB  . ALA B 1 88  ? 1.338   29.692  9.877   1.00 162.35 ? 86  ALA B CB  1 
ATOM 3727 N N   . GLU B 1 89  ? 2.690   27.047  9.104   1.00 139.42 ? 87  GLU B N   1 
ATOM 3728 C CA  . GLU B 1 89  ? 3.151   25.679  9.290   1.00 144.61 ? 87  GLU B CA  1 
ATOM 3729 C C   . GLU B 1 89  ? 4.649   25.568  9.016   1.00 146.24 ? 87  GLU B C   1 
ATOM 3730 O O   . GLU B 1 89  ? 5.410   25.133  9.881   1.00 156.79 ? 87  GLU B O   1 
ATOM 3731 C CB  . GLU B 1 89  ? 2.379   24.741  8.359   1.00 149.01 ? 87  GLU B CB  1 
ATOM 3732 C CG  . GLU B 1 89  ? 1.264   23.952  9.021   1.00 142.18 ? 87  GLU B CG  1 
ATOM 3733 C CD  . GLU B 1 89  ? 1.771   22.813  9.879   1.00 131.77 ? 87  GLU B CD  1 
ATOM 3734 O OE1 . GLU B 1 89  ? 2.985   22.523  9.840   1.00 131.67 ? 87  GLU B OE1 1 
ATOM 3735 O OE2 . GLU B 1 89  ? 0.947   22.205  10.594  1.00 136.78 ? 87  GLU B OE2 1 
ATOM 3736 N N   . GLY B 1 90  ? 5.051   25.926  7.797   1.00 145.25 ? 88  GLY B N   1 
ATOM 3737 C CA  . GLY B 1 90  ? 6.443   25.884  7.380   1.00 150.05 ? 88  GLY B CA  1 
ATOM 3738 C C   . GLY B 1 90  ? 7.410   26.458  8.399   1.00 164.86 ? 88  GLY B C   1 
ATOM 3739 O O   . GLY B 1 90  ? 8.437   25.854  8.714   1.00 171.17 ? 88  GLY B O   1 
ATOM 3740 N N   . GLU B 1 91  ? 7.073   27.640  8.908   1.00 157.28 ? 89  GLU B N   1 
ATOM 3741 C CA  . GLU B 1 91  ? 7.842   28.284  9.964   1.00 171.49 ? 89  GLU B CA  1 
ATOM 3742 C C   . GLU B 1 91  ? 7.871   27.430  11.217  1.00 176.70 ? 89  GLU B C   1 
ATOM 3743 O O   . GLU B 1 91  ? 8.939   27.124  11.751  1.00 175.10 ? 89  GLU B O   1 
ATOM 3744 C CB  . GLU B 1 91  ? 7.265   29.663  10.290  1.00 181.37 ? 89  GLU B CB  1 
ATOM 3745 N N   . GLN B 1 92  ? 6.686   27.054  11.688  1.00 182.95 ? 90  GLN B N   1 
ATOM 3746 C CA  . GLN B 1 92  ? 6.594   26.285  12.912  1.00 183.63 ? 90  GLN B CA  1 
ATOM 3747 C C   . GLN B 1 92  ? 7.309   24.948  12.800  1.00 177.50 ? 90  GLN B C   1 
ATOM 3748 O O   . GLN B 1 92  ? 7.616   24.345  13.816  1.00 170.50 ? 90  GLN B O   1 
ATOM 3749 C CB  . GLN B 1 92  ? 5.128   26.055  13.290  1.00 175.43 ? 90  GLN B CB  1 
ATOM 3750 N N   . ILE B 1 93  ? 7.545   24.445  11.589  1.00 179.99 ? 91  ILE B N   1 
ATOM 3751 C CA  . ILE B 1 93  ? 8.293   23.200  11.531  1.00 171.03 ? 91  ILE B CA  1 
ATOM 3752 C C   . ILE B 1 93  ? 9.813   23.342  11.626  1.00 169.18 ? 91  ILE B C   1 
ATOM 3753 O O   . ILE B 1 93  ? 10.436  22.658  12.440  1.00 177.77 ? 91  ILE B O   1 
ATOM 3754 C CB  . ILE B 1 93  ? 7.989   22.428  10.225  1.00 162.00 ? 91  ILE B CB  1 
ATOM 3755 C CG1 . ILE B 1 93  ? 6.512   22.037  10.155  1.00 158.53 ? 91  ILE B CG1 1 
ATOM 3756 C CG2 . ILE B 1 93  ? 8.826   21.161  10.150  1.00 153.17 ? 91  ILE B CG2 1 
ATOM 3757 C CD1 . ILE B 1 93  ? 6.145   20.856  11.039  1.00 163.85 ? 91  ILE B CD1 1 
ATOM 3758 N N   . LEU B 1 94  ? 10.429  24.226  10.837  1.00 160.25 ? 92  LEU B N   1 
ATOM 3759 C CA  . LEU B 1 94  ? 11.885  24.280  10.936  1.00 156.29 ? 92  LEU B CA  1 
ATOM 3760 C C   . LEU B 1 94  ? 12.455  25.026  12.140  1.00 165.82 ? 92  LEU B C   1 
ATOM 3761 O O   . LEU B 1 94  ? 13.257  24.480  12.898  1.00 167.45 ? 92  LEU B O   1 
ATOM 3762 C CB  . LEU B 1 94  ? 12.446  24.915  9.659   1.00 154.14 ? 92  LEU B CB  1 
ATOM 3763 N N   . SER B 1 95  ? 12.025  26.275  12.307  1.00 180.19 ? 93  SER B N   1 
ATOM 3764 C CA  . SER B 1 95  ? 12.429  27.103  13.439  1.00 196.91 ? 93  SER B CA  1 
ATOM 3765 C C   . SER B 1 95  ? 11.765  26.671  14.722  1.00 208.69 ? 93  SER B C   1 
ATOM 3766 O O   . SER B 1 95  ? 12.344  26.656  15.806  1.00 220.46 ? 93  SER B O   1 
ATOM 3767 C CB  . SER B 1 95  ? 12.123  28.581  13.171  1.00 207.35 ? 93  SER B CB  1 
ATOM 3768 O OG  . SER B 1 95  ? 10.753  28.882  13.376  1.00 202.36 ? 93  SER B OG  1 
ATOM 3769 N N   . GLY B 1 96  ? 10.521  26.259  14.536  1.00 216.19 ? 94  GLY B N   1 
ATOM 3770 C CA  . GLY B 1 96  ? 9.642   25.985  15.638  1.00 227.78 ? 94  GLY B CA  1 
ATOM 3771 C C   . GLY B 1 96  ? 9.406   24.665  16.299  1.00 233.13 ? 94  GLY B C   1 
ATOM 3772 O O   . GLY B 1 96  ? 9.148   23.630  15.685  1.00 230.42 ? 94  GLY B O   1 
ATOM 3773 N N   . GLY B 1 97  ? 9.564   24.718  17.606  1.00 236.30 ? 95  GLY B N   1 
ATOM 3774 C CA  . GLY B 1 97  ? 9.128   23.641  18.437  1.00 219.97 ? 95  GLY B CA  1 
ATOM 3775 C C   . GLY B 1 97  ? 7.754   24.046  18.937  1.00 204.44 ? 95  GLY B C   1 
ATOM 3776 O O   . GLY B 1 97  ? 7.503   25.211  19.258  1.00 201.23 ? 95  GLY B O   1 
ATOM 3777 N N   . VAL B 1 98  ? 6.882   23.055  19.015  1.00 197.48 ? 96  VAL B N   1 
ATOM 3778 C CA  . VAL B 1 98  ? 5.526   23.166  19.523  1.00 189.56 ? 96  VAL B CA  1 
ATOM 3779 C C   . VAL B 1 98  ? 5.932   23.470  20.943  1.00 190.36 ? 96  VAL B C   1 
ATOM 3780 O O   . VAL B 1 98  ? 5.374   24.333  21.611  1.00 202.59 ? 96  VAL B O   1 
ATOM 3781 C CB  . VAL B 1 98  ? 4.583   21.938  19.352  1.00 153.32 ? 96  VAL B CB  1 
ATOM 3782 C CG1 . VAL B 1 98  ? 4.178   21.780  17.883  1.00 151.06 ? 96  VAL B CG1 1 
ATOM 3783 C CG2 . VAL B 1 98  ? 5.170   20.653  19.919  1.00 146.02 ? 96  VAL B CG2 1 
ATOM 3784 N N   . PHE B 1 99  ? 6.925   22.723  21.387  1.00 188.23 ? 97  PHE B N   1 
ATOM 3785 C CA  . PHE B 1 99  ? 7.396   22.799  22.727  1.00 213.60 ? 97  PHE B CA  1 
ATOM 3786 C C   . PHE B 1 99  ? 8.717   23.580  22.796  1.00 228.28 ? 97  PHE B C   1 
ATOM 3787 O O   . PHE B 1 99  ? 8.771   24.607  23.473  1.00 241.10 ? 97  PHE B O   1 
ATOM 3788 C CB  . PHE B 1 99  ? 7.611   21.381  23.246  1.00 213.05 ? 97  PHE B CB  1 
ATOM 3789 N N   . ASN B 1 100 ? 9.769   23.170  22.113  1.00 213.15 ? 98  ASN B N   1 
ATOM 3790 C CA  . ASN B 1 100 ? 10.879  24.109  21.880  1.00 206.51 ? 98  ASN B CA  1 
ATOM 3791 C C   . ASN B 1 100 ? 10.553  25.595  21.586  1.00 213.40 ? 98  ASN B C   1 
ATOM 3792 O O   . ASN B 1 100 ? 9.471   25.938  21.097  1.00 211.65 ? 98  ASN B O   1 
ATOM 3793 C CB  . ASN B 1 100 ? 11.729  23.587  20.730  1.00 199.21 ? 98  ASN B CB  1 
ATOM 3794 N N   . LYS B 1 101 ? 11.461  26.471  22.022  1.00 220.26 ? 99  LYS B N   1 
ATOM 3795 C CA  . LYS B 1 101 ? 11.283  27.917  21.933  1.00 222.70 ? 99  LYS B CA  1 
ATOM 3796 C C   . LYS B 1 101 ? 11.801  28.283  20.547  1.00 205.11 ? 99  LYS B C   1 
ATOM 3797 O O   . LYS B 1 101 ? 12.103  27.385  19.753  1.00 196.21 ? 99  LYS B O   1 
ATOM 3798 C CB  . LYS B 1 101 ? 12.057  28.659  23.026  1.00 250.85 ? 99  LYS B CB  1 
ATOM 3799 N N   . GLN B 1 102 ? 11.917  29.576  20.244  1.00 205.56 ? 100 GLN B N   1 
ATOM 3800 C CA  . GLN B 1 102 ? 12.399  29.971  18.928  1.00 203.56 ? 100 GLN B CA  1 
ATOM 3801 C C   . GLN B 1 102 ? 13.798  29.371  18.864  1.00 205.04 ? 100 GLN B C   1 
ATOM 3802 O O   . GLN B 1 102 ? 14.637  29.645  19.726  1.00 226.56 ? 100 GLN B O   1 
ATOM 3803 C CB  . GLN B 1 102 ? 12.397  31.491  18.751  1.00 219.17 ? 100 GLN B CB  1 
ATOM 3804 C CG  . GLN B 1 102 ? 12.806  31.975  17.365  1.00 218.03 ? 100 GLN B CG  1 
ATOM 3805 C CD  . GLN B 1 102 ? 11.919  31.435  16.255  1.00 208.86 ? 100 GLN B CD  1 
ATOM 3806 O OE1 . GLN B 1 102 ? 12.403  30.810  15.314  1.00 208.34 ? 100 GLN B OE1 1 
ATOM 3807 N NE2 . GLN B 1 102 ? 10.617  31.682  16.358  1.00 209.97 ? 100 GLN B NE2 1 
ATOM 3808 N N   . LYS B 1 103 ? 14.058  28.576  17.833  1.00 191.95 ? 101 LYS B N   1 
ATOM 3809 C CA  . LYS B 1 103 ? 15.351  27.928  17.708  1.00 181.87 ? 101 LYS B CA  1 
ATOM 3810 C C   . LYS B 1 103 ? 16.461  28.917  17.455  1.00 189.12 ? 101 LYS B C   1 
ATOM 3811 O O   . LYS B 1 103 ? 16.255  29.959  16.827  1.00 190.93 ? 101 LYS B O   1 
ATOM 3812 C CB  . LYS B 1 103 ? 15.328  26.892  16.584  1.00 172.23 ? 101 LYS B CB  1 
ATOM 3813 N N   . SER B 1 104 ? 17.656  28.566  17.921  1.00 193.52 ? 102 SER B N   1 
ATOM 3814 C CA  . SER B 1 104 ? 18.801  29.365  17.572  1.00 200.08 ? 102 SER B CA  1 
ATOM 3815 C C   . SER B 1 104 ? 19.032  29.126  16.101  1.00 193.44 ? 102 SER B C   1 
ATOM 3816 O O   . SER B 1 104 ? 18.498  28.183  15.515  1.00 184.54 ? 102 SER B O   1 
ATOM 3817 C CB  . SER B 1 104 ? 20.029  28.975  18.395  1.00 214.43 ? 102 SER B CB  1 
ATOM 3818 O OG  . SER B 1 104 ? 20.680  27.853  17.830  1.00 201.33 ? 102 SER B OG  1 
ATOM 3819 N N   . HIS B 1 105 ? 19.864  29.962  15.516  1.00 199.50 ? 103 HIS B N   1 
ATOM 3820 C CA  . HIS B 1 105 ? 20.392  29.728  14.197  1.00 199.51 ? 103 HIS B CA  1 
ATOM 3821 C C   . HIS B 1 105 ? 21.238  28.457  14.241  1.00 191.39 ? 103 HIS B C   1 
ATOM 3822 O O   . HIS B 1 105 ? 21.146  27.579  13.381  1.00 183.62 ? 103 HIS B O   1 
ATOM 3823 C CB  . HIS B 1 105 ? 21.153  30.978  13.799  1.00 215.87 ? 103 HIS B CB  1 
ATOM 3824 C CG  . HIS B 1 105 ? 20.247  32.068  13.321  1.00 213.83 ? 103 HIS B CG  1 
ATOM 3825 N ND1 . HIS B 1 105 ? 18.890  32.040  13.562  1.00 202.06 ? 103 HIS B ND1 1 
ATOM 3826 C CD2 . HIS B 1 105 ? 20.501  33.270  12.753  1.00 222.59 ? 103 HIS B CD2 1 
ATOM 3827 C CE1 . HIS B 1 105 ? 18.336  33.139  13.084  1.00 205.94 ? 103 HIS B CE1 1 
ATOM 3828 N NE2 . HIS B 1 105 ? 19.293  33.906  12.594  1.00 217.79 ? 103 HIS B NE2 1 
ATOM 3829 N N   . ASP B 1 106 ? 22.053  28.395  15.291  1.00 207.16 ? 104 ASP B N   1 
ATOM 3830 C CA  . ASP B 1 106 ? 22.946  27.284  15.616  1.00 206.91 ? 104 ASP B CA  1 
ATOM 3831 C C   . ASP B 1 106 ? 22.239  25.960  15.921  1.00 190.97 ? 104 ASP B C   1 
ATOM 3832 O O   . ASP B 1 106 ? 22.740  24.890  15.574  1.00 196.72 ? 104 ASP B O   1 
ATOM 3833 C CB  . ASP B 1 106 ? 23.834  27.669  16.801  1.00 209.91 ? 104 ASP B CB  1 
ATOM 3834 N N   . ASP B 1 107 ? 21.089  26.034  16.586  1.00 189.16 ? 105 ASP B N   1 
ATOM 3835 C CA  . ASP B 1 107 ? 20.276  24.845  16.825  1.00 181.52 ? 105 ASP B CA  1 
ATOM 3836 C C   . ASP B 1 107 ? 19.833  24.238  15.502  1.00 171.71 ? 105 ASP B C   1 
ATOM 3837 O O   . ASP B 1 107 ? 19.946  23.027  15.305  1.00 166.29 ? 105 ASP B O   1 
ATOM 3838 C CB  . ASP B 1 107 ? 19.050  25.193  17.681  1.00 189.51 ? 105 ASP B CB  1 
ATOM 3839 C CG  . ASP B 1 107 ? 19.349  25.195  19.172  1.00 194.41 ? 105 ASP B CG  1 
ATOM 3840 O OD1 . ASP B 1 107 ? 19.996  24.242  19.653  1.00 192.98 ? 105 ASP B OD1 1 
ATOM 3841 O OD2 . ASP B 1 107 ? 18.942  26.156  19.861  1.00 197.25 ? 105 ASP B OD2 1 
ATOM 3842 N N   . ILE B 1 108 ? 19.319  25.079  14.608  1.00 169.90 ? 106 ILE B N   1 
ATOM 3843 C CA  . ILE B 1 108 ? 18.832  24.622  13.312  1.00 161.37 ? 106 ILE B CA  1 
ATOM 3844 C C   . ILE B 1 108 ? 19.936  23.907  12.528  1.00 167.89 ? 106 ILE B C   1 
ATOM 3845 O O   . ILE B 1 108 ? 19.718  22.840  11.950  1.00 156.85 ? 106 ILE B O   1 
ATOM 3846 C CB  . ILE B 1 108 ? 18.305  25.810  12.476  1.00 162.90 ? 106 ILE B CB  1 
ATOM 3847 C CG1 . ILE B 1 108 ? 16.919  26.242  12.958  1.00 166.12 ? 106 ILE B CG1 1 
ATOM 3848 C CG2 . ILE B 1 108 ? 18.302  25.478  10.989  1.00 159.72 ? 106 ILE B CG2 1 
ATOM 3849 C CD1 . ILE B 1 108 ? 16.433  27.528  12.323  1.00 171.00 ? 106 ILE B CD1 1 
ATOM 3850 N N   . VAL B 1 109 ? 21.134  24.488  12.555  1.00 166.97 ? 107 VAL B N   1 
ATOM 3851 C CA  . VAL B 1 109 ? 22.290  23.936  11.854  1.00 167.06 ? 107 VAL B CA  1 
ATOM 3852 C C   . VAL B 1 109 ? 22.671  22.569  12.405  1.00 165.07 ? 107 VAL B C   1 
ATOM 3853 O O   . VAL B 1 109 ? 23.009  21.651  11.657  1.00 160.41 ? 107 VAL B O   1 
ATOM 3854 C CB  . VAL B 1 109 ? 23.508  24.874  11.946  1.00 176.63 ? 107 VAL B CB  1 
ATOM 3855 N N   . THR B 1 110 ? 22.599  22.450  13.726  1.00 169.02 ? 108 THR B N   1 
ATOM 3856 C CA  . THR B 1 110 ? 22.885  21.201  14.417  1.00 167.97 ? 108 THR B CA  1 
ATOM 3857 C C   . THR B 1 110 ? 21.909  20.124  13.969  1.00 171.77 ? 108 THR B C   1 
ATOM 3858 O O   . THR B 1 110 ? 22.310  19.020  13.599  1.00 165.33 ? 108 THR B O   1 
ATOM 3859 C CB  . THR B 1 110 ? 22.800  21.368  15.945  1.00 174.25 ? 108 THR B CB  1 
ATOM 3860 N N   . GLU B 1 111 ? 20.624  20.457  14.021  1.00 158.61 ? 109 GLU B N   1 
ATOM 3861 C CA  . GLU B 1 111 ? 19.559  19.516  13.703  1.00 150.62 ? 109 GLU B CA  1 
ATOM 3862 C C   . GLU B 1 111 ? 19.619  19.032  12.255  1.00 146.42 ? 109 GLU B C   1 
ATOM 3863 O O   . GLU B 1 111 ? 19.543  17.836  12.002  1.00 140.94 ? 109 GLU B O   1 
ATOM 3864 C CB  . GLU B 1 111 ? 18.186  20.135  13.969  1.00 154.42 ? 109 GLU B CB  1 
ATOM 3865 C CG  . GLU B 1 111 ? 17.047  19.127  13.886  1.00 149.31 ? 109 GLU B CG  1 
ATOM 3866 C CD  . GLU B 1 111 ? 15.680  19.766  14.022  1.00 150.72 ? 109 GLU B CD  1 
ATOM 3867 O OE1 . GLU B 1 111 ? 15.612  20.965  14.362  1.00 157.67 ? 109 GLU B OE1 1 
ATOM 3868 O OE2 . GLU B 1 111 ? 14.672  19.065  13.791  1.00 143.95 ? 109 GLU B OE2 1 
ATOM 3869 N N   . PHE B 1 112 ? 19.793  19.955  11.312  1.00 149.58 ? 110 PHE B N   1 
ATOM 3870 C CA  . PHE B 1 112 ? 19.676  19.624  9.891   1.00 149.79 ? 110 PHE B CA  1 
ATOM 3871 C C   . PHE B 1 112 ? 21.007  19.359  9.190   1.00 152.02 ? 110 PHE B C   1 
ATOM 3872 O O   . PHE B 1 112 ? 21.019  18.993  8.014   1.00 142.56 ? 110 PHE B O   1 
ATOM 3873 C CB  . PHE B 1 112 ? 18.950  20.747  9.141   1.00 154.58 ? 110 PHE B CB  1 
ATOM 3874 C CG  . PHE B 1 112 ? 17.523  20.947  9.565   1.00 151.26 ? 110 PHE B CG  1 
ATOM 3875 C CD1 . PHE B 1 112 ? 16.528  20.097  9.112   1.00 147.85 ? 110 PHE B CD1 1 
ATOM 3876 C CD2 . PHE B 1 112 ? 17.175  21.994  10.398  1.00 150.07 ? 110 PHE B CD2 1 
ATOM 3877 C CE1 . PHE B 1 112 ? 15.214  20.280  9.495   1.00 139.70 ? 110 PHE B CE1 1 
ATOM 3878 C CE2 . PHE B 1 112 ? 15.863  22.184  10.783  1.00 151.34 ? 110 PHE B CE2 1 
ATOM 3879 C CZ  . PHE B 1 112 ? 14.881  21.326  10.331  1.00 146.52 ? 110 PHE B CZ  1 
ATOM 3880 N N   . GLY B 1 113 ? 22.111  19.505  9.919   1.00 162.24 ? 111 GLY B N   1 
ATOM 3881 C CA  . GLY B 1 113 ? 23.435  19.185  9.405   1.00 167.62 ? 111 GLY B CA  1 
ATOM 3882 C C   . GLY B 1 113 ? 23.754  19.718  8.018   1.00 168.09 ? 111 GLY B C   1 
ATOM 3883 O O   . GLY B 1 113 ? 24.016  20.907  7.854   1.00 171.22 ? 111 GLY B O   1 
ATOM 3884 N N   . ASP B 1 114 ? 23.760  18.836  7.023   1.00 167.90 ? 112 ASP B N   1 
ATOM 3885 C CA  . ASP B 1 114 ? 24.058  19.241  5.652   1.00 169.89 ? 112 ASP B CA  1 
ATOM 3886 C C   . ASP B 1 114 ? 22.874  19.966  5.018   1.00 159.69 ? 112 ASP B C   1 
ATOM 3887 O O   . ASP B 1 114 ? 23.051  20.842  4.171   1.00 149.96 ? 112 ASP B O   1 
ATOM 3888 C CB  . ASP B 1 114 ? 24.443  18.026  4.806   1.00 164.62 ? 112 ASP B CB  1 
ATOM 3889 N N   . SER B 1 115 ? 21.668  19.592  5.432   1.00 156.51 ? 113 SER B N   1 
ATOM 3890 C CA  . SER B 1 115 ? 20.446  20.231  4.952   1.00 147.49 ? 113 SER B CA  1 
ATOM 3891 C C   . SER B 1 115 ? 20.198  21.585  5.618   1.00 150.17 ? 113 SER B C   1 
ATOM 3892 O O   . SER B 1 115 ? 19.151  22.198  5.415   1.00 149.89 ? 113 SER B O   1 
ATOM 3893 C CB  . SER B 1 115 ? 19.242  19.313  5.173   1.00 135.07 ? 113 SER B CB  1 
ATOM 3894 O OG  . SER B 1 115 ? 19.482  18.020  4.645   1.00 140.05 ? 113 SER B OG  1 
ATOM 3895 N N   . ALA B 1 116 ? 21.167  22.049  6.402   1.00 155.41 ? 114 ALA B N   1 
ATOM 3896 C CA  . ALA B 1 116 ? 21.035  23.292  7.157   1.00 157.81 ? 114 ALA B CA  1 
ATOM 3897 C C   . ALA B 1 116 ? 20.911  24.504  6.240   1.00 159.03 ? 114 ALA B C   1 
ATOM 3898 O O   . ALA B 1 116 ? 20.089  25.386  6.470   1.00 162.81 ? 114 ALA B O   1 
ATOM 3899 C CB  . ALA B 1 116 ? 22.213  23.469  8.100   1.00 163.58 ? 114 ALA B CB  1 
ATOM 3900 N N   . CYS B 1 117 ? 21.742  24.552  5.207   1.00 163.46 ? 115 CYS B N   1 
ATOM 3901 C CA  . CYS B 1 117 ? 21.733  25.675  4.280   1.00 162.11 ? 115 CYS B CA  1 
ATOM 3902 C C   . CYS B 1 117 ? 20.414  25.806  3.516   1.00 154.67 ? 115 CYS B C   1 
ATOM 3903 O O   . CYS B 1 117 ? 19.964  26.918  3.238   1.00 154.82 ? 115 CYS B O   1 
ATOM 3904 C CB  . CYS B 1 117 ? 22.898  25.548  3.293   1.00 161.74 ? 115 CYS B CB  1 
ATOM 3905 S SG  . CYS B 1 117 ? 22.976  23.972  2.407   1.00 180.54 ? 115 CYS B SG  1 
ATOM 3906 N N   . PHE B 1 118 ? 19.791  24.676  3.191   1.00 148.19 ? 116 PHE B N   1 
ATOM 3907 C CA  . PHE B 1 118 ? 18.530  24.698  2.456   1.00 143.53 ? 116 PHE B CA  1 
ATOM 3908 C C   . PHE B 1 118 ? 17.318  25.035  3.329   1.00 147.33 ? 116 PHE B C   1 
ATOM 3909 O O   . PHE B 1 118 ? 16.433  25.781  2.908   1.00 163.99 ? 116 PHE B O   1 
ATOM 3910 C CB  . PHE B 1 118 ? 18.299  23.344  1.785   1.00 136.87 ? 116 PHE B CB  1 
ATOM 3911 C CG  . PHE B 1 118 ? 19.394  22.943  0.840   1.00 137.90 ? 116 PHE B CG  1 
ATOM 3912 C CD1 . PHE B 1 118 ? 20.329  21.992  1.215   1.00 146.16 ? 116 PHE B CD1 1 
ATOM 3913 C CD2 . PHE B 1 118 ? 19.518  23.547  -0.398  1.00 153.43 ? 116 PHE B CD2 1 
ATOM 3914 C CE1 . PHE B 1 118 ? 21.346  21.622  0.356   1.00 164.18 ? 116 PHE B CE1 1 
ATOM 3915 C CE2 . PHE B 1 118 ? 20.538  23.186  -1.260  1.00 163.02 ? 116 PHE B CE2 1 
ATOM 3916 C CZ  . PHE B 1 118 ? 21.453  22.223  -0.882  1.00 164.31 ? 116 PHE B CZ  1 
ATOM 3917 N N   . THR B 1 119 ? 17.282  24.483  4.540   1.00 141.09 ? 117 THR B N   1 
ATOM 3918 C CA  . THR B 1 119 ? 16.204  24.768  5.487   1.00 144.28 ? 117 THR B CA  1 
ATOM 3919 C C   . THR B 1 119 ? 16.217  26.249  5.856   1.00 146.44 ? 117 THR B C   1 
ATOM 3920 O O   . THR B 1 119 ? 15.166  26.880  5.961   1.00 148.43 ? 117 THR B O   1 
ATOM 3921 C CB  . THR B 1 119 ? 16.260  23.883  6.760   1.00 158.71 ? 117 THR B CB  1 
ATOM 3922 O OG1 . THR B 1 119 ? 15.192  24.253  7.642   1.00 162.22 ? 117 THR B OG1 1 
ATOM 3923 C CG2 . THR B 1 119 ? 17.569  24.024  7.493   1.00 172.63 ? 117 THR B CG2 1 
ATOM 3924 N N   . LEU B 1 120 ? 17.413  26.797  6.050   1.00 156.44 ? 118 LEU B N   1 
ATOM 3925 C CA  . LEU B 1 120 ? 17.562  28.203  6.391   1.00 160.01 ? 118 LEU B CA  1 
ATOM 3926 C C   . LEU B 1 120 ? 17.150  29.050  5.198   1.00 162.24 ? 118 LEU B C   1 
ATOM 3927 O O   . LEU B 1 120 ? 16.484  30.072  5.363   1.00 175.19 ? 118 LEU B O   1 
ATOM 3928 C CB  . LEU B 1 120 ? 19.004  28.520  6.793   1.00 162.37 ? 118 LEU B CB  1 
ATOM 3929 C CG  . LEU B 1 120 ? 19.505  28.000  8.140   1.00 166.10 ? 118 LEU B CG  1 
ATOM 3930 C CD1 . LEU B 1 120 ? 21.009  28.193  8.251   1.00 171.39 ? 118 LEU B CD1 1 
ATOM 3931 C CD2 . LEU B 1 120 ? 18.790  28.702  9.279   1.00 169.96 ? 118 LEU B CD2 1 
ATOM 3932 N N   . SER B 1 121 ? 17.564  28.636  4.004   1.00 152.56 ? 119 SER B N   1 
ATOM 3933 C CA  . SER B 1 121 ? 17.150  29.316  2.783   1.00 158.03 ? 119 SER B CA  1 
ATOM 3934 C C   . SER B 1 121 ? 15.626  29.397  2.708   1.00 144.89 ? 119 SER B C   1 
ATOM 3935 O O   . SER B 1 121 ? 15.065  30.457  2.437   1.00 147.93 ? 119 SER B O   1 
ATOM 3936 C CB  . SER B 1 121 ? 17.702  28.591  1.553   1.00 163.96 ? 119 SER B CB  1 
ATOM 3937 O OG  . SER B 1 121 ? 17.327  29.251  0.357   1.00 173.02 ? 119 SER B OG  1 
ATOM 3938 N N   . LEU B 1 122 ? 14.964  28.270  2.955   1.00 138.64 ? 120 LEU B N   1 
ATOM 3939 C CA  . LEU B 1 122 ? 13.504  28.199  2.908   1.00 134.98 ? 120 LEU B CA  1 
ATOM 3940 C C   . LEU B 1 122 ? 12.834  29.055  3.982   1.00 141.91 ? 120 LEU B C   1 
ATOM 3941 O O   . LEU B 1 122 ? 11.796  29.669  3.739   1.00 141.83 ? 120 LEU B O   1 
ATOM 3942 C CB  . LEU B 1 122 ? 13.028  26.749  3.038   1.00 131.02 ? 120 LEU B CB  1 
ATOM 3943 C CG  . LEU B 1 122 ? 11.506  26.558  3.026   1.00 131.89 ? 120 LEU B CG  1 
ATOM 3944 C CD1 . LEU B 1 122 ? 10.885  27.245  1.818   1.00 139.94 ? 120 LEU B CD1 1 
ATOM 3945 C CD2 . LEU B 1 122 ? 11.131  25.085  3.051   1.00 128.47 ? 120 LEU B CD2 1 
ATOM 3946 N N   . LEU B 1 123 ? 13.450  29.115  5.159   1.00 146.47 ? 121 LEU B N   1 
ATOM 3947 C CA  . LEU B 1 123 ? 12.986  30.000  6.224   1.00 151.20 ? 121 LEU B CA  1 
ATOM 3948 C C   . LEU B 1 123 ? 13.064  31.454  5.791   1.00 161.32 ? 121 LEU B C   1 
ATOM 3949 O O   . LEU B 1 123 ? 12.099  32.202  5.956   1.00 156.69 ? 121 LEU B O   1 
ATOM 3950 C CB  . LEU B 1 123 ? 13.789  29.783  7.507   1.00 159.01 ? 121 LEU B CB  1 
ATOM 3951 C CG  . LEU B 1 123 ? 13.140  28.823  8.507   1.00 164.89 ? 121 LEU B CG  1 
ATOM 3952 C CD1 . LEU B 1 123 ? 14.022  28.626  9.730   1.00 176.21 ? 121 LEU B CD1 1 
ATOM 3953 C CD2 . LEU B 1 123 ? 11.762  29.328  8.909   1.00 168.83 ? 121 LEU B CD2 1 
ATOM 3954 N N   . GLY B 1 124 ? 14.221  31.856  5.275   1.00 157.99 ? 122 GLY B N   1 
ATOM 3955 C CA  . GLY B 1 124 ? 14.419  33.212  4.799   1.00 164.18 ? 122 GLY B CA  1 
ATOM 3956 C C   . GLY B 1 124 ? 13.307  33.603  3.842   1.00 161.80 ? 122 GLY B C   1 
ATOM 3957 O O   . GLY B 1 124 ? 12.754  34.696  3.936   1.00 166.48 ? 122 GLY B O   1 
ATOM 3958 N N   . HIS B 1 125 ? 12.980  32.697  2.925   1.00 154.95 ? 123 HIS B N   1 
ATOM 3959 C CA  . HIS B 1 125 ? 11.850  32.872  2.014   1.00 174.17 ? 123 HIS B CA  1 
ATOM 3960 C C   . HIS B 1 125 ? 10.526  33.090  2.740   1.00 161.88 ? 123 HIS B C   1 
ATOM 3961 O O   . HIS B 1 125 ? 9.749   33.972  2.373   1.00 155.22 ? 123 HIS B O   1 
ATOM 3962 C CB  . HIS B 1 125 ? 11.716  31.674  1.074   1.00 170.04 ? 123 HIS B CB  1 
ATOM 3963 C CG  . HIS B 1 125 ? 10.507  31.741  0.194   1.00 163.88 ? 123 HIS B CG  1 
ATOM 3964 N ND1 . HIS B 1 125 ? 10.380  32.660  -0.826  1.00 145.62 ? 123 HIS B ND1 1 
ATOM 3965 C CD2 . HIS B 1 125 ? 9.359   31.025  0.200   1.00 148.48 ? 123 HIS B CD2 1 
ATOM 3966 C CE1 . HIS B 1 125 ? 9.212   32.495  -1.420  1.00 166.09 ? 123 HIS B CE1 1 
ATOM 3967 N NE2 . HIS B 1 125 ? 8.572   31.510  -0.816  1.00 153.04 ? 123 HIS B NE2 1 
ATOM 3968 N N   . VAL B 1 126 ? 10.273  32.286  3.768   1.00 149.75 ? 124 VAL B N   1 
ATOM 3969 C CA  . VAL B 1 126 ? 9.054   32.417  4.561   1.00 150.17 ? 124 VAL B CA  1 
ATOM 3970 C C   . VAL B 1 126 ? 9.030   33.761  5.278   1.00 158.31 ? 124 VAL B C   1 
ATOM 3971 O O   . VAL B 1 126 ? 8.017   34.462  5.258   1.00 160.75 ? 124 VAL B O   1 
ATOM 3972 C CB  . VAL B 1 126 ? 8.923   31.277  5.590   1.00 146.34 ? 124 VAL B CB  1 
ATOM 3973 C CG1 . VAL B 1 126 ? 7.729   31.513  6.499   1.00 149.57 ? 124 VAL B CG1 1 
ATOM 3974 C CG2 . VAL B 1 126 ? 8.800   29.936  4.882   1.00 150.75 ? 124 VAL B CG2 1 
ATOM 3975 N N   . TYR B 1 127 ? 10.144  34.114  5.910   1.00 180.89 ? 125 TYR B N   1 
ATOM 3976 C CA  . TYR B 1 127 ? 10.271  35.397  6.596   1.00 194.18 ? 125 TYR B CA  1 
ATOM 3977 C C   . TYR B 1 127 ? 10.048  36.539  5.607   1.00 204.49 ? 125 TYR B C   1 
ATOM 3978 O O   . TYR B 1 127 ? 9.428   37.549  5.940   1.00 213.04 ? 125 TYR B O   1 
ATOM 3979 C CB  . TYR B 1 127 ? 11.628  35.520  7.286   1.00 197.56 ? 125 TYR B CB  1 
ATOM 3980 C CG  . TYR B 1 127 ? 11.754  34.657  8.520   1.00 192.76 ? 125 TYR B CG  1 
ATOM 3981 C CD1 . TYR B 1 127 ? 10.682  34.504  9.389   1.00 185.03 ? 125 TYR B CD1 1 
ATOM 3982 C CD2 . TYR B 1 127 ? 12.943  34.007  8.825   1.00 196.74 ? 125 TYR B CD2 1 
ATOM 3983 C CE1 . TYR B 1 127 ? 10.784  33.721  10.521  1.00 191.40 ? 125 TYR B CE1 1 
ATOM 3984 C CE2 . TYR B 1 127 ? 13.055  33.220  9.959   1.00 193.92 ? 125 TYR B CE2 1 
ATOM 3985 C CZ  . TYR B 1 127 ? 11.971  33.082  10.802  1.00 192.20 ? 125 TYR B CZ  1 
ATOM 3986 O OH  . TYR B 1 127 ? 12.074  32.303  11.931  1.00 197.91 ? 125 TYR B OH  1 
ATOM 3987 N N   . CYS B 1 128 ? 10.566  36.374  4.394   1.00 199.32 ? 126 CYS B N   1 
ATOM 3988 C CA  . CYS B 1 128 ? 10.449  37.395  3.361   1.00 196.26 ? 126 CYS B CA  1 
ATOM 3989 C C   . CYS B 1 128 ? 9.019   37.448  2.834   1.00 173.49 ? 126 CYS B C   1 
ATOM 3990 O O   . CYS B 1 128 ? 8.540   38.509  2.437   1.00 178.24 ? 126 CYS B O   1 
ATOM 3991 C CB  . CYS B 1 128 ? 11.424  37.132  2.209   1.00 174.00 ? 126 CYS B CB  1 
ATOM 3992 S SG  . CYS B 1 128 ? 13.165  37.430  2.594   1.00 251.48 ? 126 CYS B SG  1 
ATOM 3993 N N   . LYS B 1 129 ? 8.335   36.306  2.830   1.00 166.53 ? 127 LYS B N   1 
ATOM 3994 C CA  . LYS B 1 129 ? 6.948   36.270  2.376   1.00 164.47 ? 127 LYS B CA  1 
ATOM 3995 C C   . LYS B 1 129 ? 6.016   36.884  3.418   1.00 168.83 ? 127 LYS B C   1 
ATOM 3996 O O   . LYS B 1 129 ? 5.101   37.631  3.070   1.00 182.24 ? 127 LYS B O   1 
ATOM 3997 C CB  . LYS B 1 129 ? 6.520   34.834  2.066   1.00 156.17 ? 127 LYS B CB  1 
ATOM 3998 N N   . THR B 1 130 ? 6.242   36.579  4.693   1.00 169.50 ? 128 THR B N   1 
ATOM 3999 C CA  . THR B 1 130 ? 5.622   37.352  5.764   1.00 185.60 ? 128 THR B CA  1 
ATOM 4000 C C   . THR B 1 130 ? 6.328   38.701  5.859   1.00 192.74 ? 128 THR B C   1 
ATOM 4001 O O   . THR B 1 130 ? 7.162   39.031  5.016   1.00 194.94 ? 128 THR B O   1 
ATOM 4002 C CB  . THR B 1 130 ? 5.678   36.628  7.123   1.00 195.09 ? 128 THR B CB  1 
ATOM 4003 O OG1 . THR B 1 130 ? 7.044   36.404  7.491   1.00 203.08 ? 128 THR B OG1 1 
ATOM 4004 C CG2 . THR B 1 130 ? 4.958   35.291  7.046   1.00 189.10 ? 128 THR B CG2 1 
ATOM 4005 N N   . ASP B 1 131 ? 6.009   39.480  6.885   1.00 190.40 ? 129 ASP B N   1 
ATOM 4006 C CA  . ASP B 1 131 ? 6.456   40.866  6.913   1.00 199.05 ? 129 ASP B CA  1 
ATOM 4007 C C   . ASP B 1 131 ? 7.748   41.035  7.706   1.00 203.22 ? 129 ASP B C   1 
ATOM 4008 O O   . ASP B 1 131 ? 8.000   42.101  8.267   1.00 251.21 ? 129 ASP B O   1 
ATOM 4009 C CB  . ASP B 1 131 ? 5.365   41.764  7.500   1.00 205.24 ? 129 ASP B CB  1 
ATOM 4010 N N   . ARG B 1 132 ? 8.577   39.996  7.734   1.00 197.98 ? 130 ARG B N   1 
ATOM 4011 C CA  . ARG B 1 132 ? 9.818   40.058  8.496   1.00 202.09 ? 130 ARG B CA  1 
ATOM 4012 C C   . ARG B 1 132 ? 11.032  39.864  7.592   1.00 200.44 ? 130 ARG B C   1 
ATOM 4013 O O   . ARG B 1 132 ? 11.619  38.783  7.541   1.00 195.03 ? 130 ARG B O   1 
ATOM 4014 C CB  . ARG B 1 132 ? 9.814   39.006  9.609   1.00 202.85 ? 130 ARG B CB  1 
ATOM 4015 N N   . LEU B 1 133 ? 11.396  40.928  6.886   1.00 205.59 ? 131 LEU B N   1 
ATOM 4016 C CA  . LEU B 1 133 ? 12.531  40.934  5.965   1.00 205.40 ? 131 LEU B CA  1 
ATOM 4017 C C   . LEU B 1 133 ? 13.876  40.735  6.660   1.00 214.33 ? 131 LEU B C   1 
ATOM 4018 O O   . LEU B 1 133 ? 14.742  40.006  6.173   1.00 210.46 ? 131 LEU B O   1 
ATOM 4019 C CB  . LEU B 1 133 ? 12.554  42.239  5.169   1.00 211.43 ? 131 LEU B CB  1 
ATOM 4020 N N   . ALA B 1 134 ? 14.035  41.393  7.804   1.00 221.35 ? 132 ALA B N   1 
ATOM 4021 C CA  . ALA B 1 134 ? 15.271  41.356  8.581   1.00 221.41 ? 132 ALA B CA  1 
ATOM 4022 C C   . ALA B 1 134 ? 15.607  39.958  9.089   1.00 215.45 ? 132 ALA B C   1 
ATOM 4023 O O   . ALA B 1 134 ? 16.746  39.506  8.968   1.00 215.75 ? 132 ALA B O   1 
ATOM 4024 C CB  . ALA B 1 134 ? 15.180  42.331  9.746   1.00 230.88 ? 132 ALA B CB  1 
ATOM 4025 N N   . LYS B 1 135 ? 14.619  39.286  9.667   1.00 210.69 ? 133 LYS B N   1 
ATOM 4026 C CA  . LYS B 1 135 ? 14.758  37.887  10.060  1.00 204.16 ? 133 LYS B CA  1 
ATOM 4027 C C   . LYS B 1 135 ? 15.105  36.995  8.867   1.00 205.83 ? 133 LYS B C   1 
ATOM 4028 O O   . LYS B 1 135 ? 15.835  36.013  9.006   1.00 205.50 ? 133 LYS B O   1 
ATOM 4029 C CB  . LYS B 1 135 ? 13.475  37.391  10.730  1.00 200.30 ? 133 LYS B CB  1 
ATOM 4030 N N   . GLY B 1 136 ? 14.579  37.347  7.699   1.00 193.62 ? 134 GLY B N   1 
ATOM 4031 C CA  . GLY B 1 136 ? 14.838  36.615  6.470   1.00 186.96 ? 134 GLY B CA  1 
ATOM 4032 C C   . GLY B 1 136 ? 16.242  36.737  5.909   1.00 189.86 ? 134 GLY B C   1 
ATOM 4033 O O   . GLY B 1 136 ? 16.863  35.731  5.563   1.00 185.30 ? 134 GLY B O   1 
ATOM 4034 N N   . SER B 1 137 ? 16.752  37.961  5.824   1.00 197.85 ? 135 SER B N   1 
ATOM 4035 C CA  . SER B 1 137 ? 18.066  38.202  5.237   1.00 208.66 ? 135 SER B CA  1 
ATOM 4036 C C   . SER B 1 137 ? 19.161  37.675  6.154   1.00 204.49 ? 135 SER B C   1 
ATOM 4037 O O   . SER B 1 137 ? 20.275  37.390  5.710   1.00 205.54 ? 135 SER B O   1 
ATOM 4038 C CB  . SER B 1 137 ? 18.273  39.693  4.957   1.00 223.28 ? 135 SER B CB  1 
ATOM 4039 O OG  . SER B 1 137 ? 17.521  40.493  5.852   1.00 231.13 ? 135 SER B OG  1 
ATOM 4040 N N   . GLU B 1 138 ? 18.837  37.542  7.435   1.00 206.23 ? 136 GLU B N   1 
ATOM 4041 C CA  . GLU B 1 138 ? 19.749  36.914  8.376   1.00 208.65 ? 136 GLU B CA  1 
ATOM 4042 C C   . GLU B 1 138 ? 19.796  35.409  8.129   1.00 222.08 ? 136 GLU B C   1 
ATOM 4043 O O   . GLU B 1 138 ? 20.867  34.803  8.179   1.00 222.13 ? 136 GLU B O   1 
ATOM 4044 C CB  . GLU B 1 138 ? 19.321  37.204  9.816   1.00 213.36 ? 136 GLU B CB  1 
ATOM 4045 N N   . CYS B 1 139 ? 18.638  34.807  7.866   1.00 210.45 ? 137 CYS B N   1 
ATOM 4046 C CA  . CYS B 1 139 ? 18.586  33.384  7.537   1.00 198.89 ? 137 CYS B CA  1 
ATOM 4047 C C   . CYS B 1 139 ? 19.299  33.088  6.218   1.00 180.77 ? 137 CYS B C   1 
ATOM 4048 O O   . CYS B 1 139 ? 19.950  32.053  6.076   1.00 179.47 ? 137 CYS B O   1 
ATOM 4049 C CB  . CYS B 1 139 ? 17.135  32.903  7.468   1.00 176.22 ? 137 CYS B CB  1 
ATOM 4050 S SG  . CYS B 1 139 ? 16.426  32.427  9.061   1.00 269.09 ? 137 CYS B SG  1 
ATOM 4051 N N   . TYR B 1 140 ? 19.183  34.006  5.261   1.00 182.66 ? 138 TYR B N   1 
ATOM 4052 C CA  . TYR B 1 140 ? 19.843  33.846  3.967   1.00 181.07 ? 138 TYR B CA  1 
ATOM 4053 C C   . TYR B 1 140 ? 21.355  33.926  4.075   1.00 187.07 ? 138 TYR B C   1 
ATOM 4054 O O   . TYR B 1 140 ? 22.068  33.100  3.505   1.00 184.34 ? 138 TYR B O   1 
ATOM 4055 C CB  . TYR B 1 140 ? 19.367  34.891  2.962   1.00 182.71 ? 138 TYR B CB  1 
ATOM 4056 C CG  . TYR B 1 140 ? 17.991  34.686  2.377   1.00 176.26 ? 138 TYR B CG  1 
ATOM 4057 C CD1 . TYR B 1 140 ? 17.490  33.412  2.149   1.00 181.04 ? 138 TYR B CD1 1 
ATOM 4058 C CD2 . TYR B 1 140 ? 17.213  35.772  2.002   1.00 178.98 ? 138 TYR B CD2 1 
ATOM 4059 C CE1 . TYR B 1 140 ? 16.240  33.230  1.589   1.00 174.61 ? 138 TYR B CE1 1 
ATOM 4060 C CE2 . TYR B 1 140 ? 15.969  35.600  1.444   1.00 173.85 ? 138 TYR B CE2 1 
ATOM 4061 C CZ  . TYR B 1 140 ? 15.486  34.330  1.240   1.00 165.82 ? 138 TYR B CZ  1 
ATOM 4062 O OH  . TYR B 1 140 ? 14.246  34.171  0.677   1.00 163.33 ? 138 TYR B OH  1 
ATOM 4063 N N   . GLN B 1 141 ? 21.837  34.944  4.782   1.00 195.79 ? 139 GLN B N   1 
ATOM 4064 C CA  . GLN B 1 141 ? 23.269  35.141  4.955   1.00 202.92 ? 139 GLN B CA  1 
ATOM 4065 C C   . GLN B 1 141 ? 23.879  33.891  5.566   1.00 200.63 ? 139 GLN B C   1 
ATOM 4066 O O   . GLN B 1 141 ? 24.929  33.422  5.127   1.00 201.69 ? 139 GLN B O   1 
ATOM 4067 C CB  . GLN B 1 141 ? 23.549  36.363  5.831   1.00 212.90 ? 139 GLN B CB  1 
ATOM 4068 N N   . LYS B 1 142 ? 23.216  33.367  6.593   1.00 197.97 ? 140 LYS B N   1 
ATOM 4069 C CA  . LYS B 1 142 ? 23.663  32.148  7.250   1.00 195.63 ? 140 LYS B CA  1 
ATOM 4070 C C   . LYS B 1 142 ? 23.727  30.986  6.261   1.00 187.51 ? 140 LYS B C   1 
ATOM 4071 O O   . LYS B 1 142 ? 24.687  30.215  6.261   1.00 188.07 ? 140 LYS B O   1 
ATOM 4072 C CB  . LYS B 1 142 ? 22.738  31.799  8.416   1.00 193.45 ? 140 LYS B CB  1 
ATOM 4073 N N   . SER B 1 143 ? 22.690  30.856  5.436   1.00 194.78 ? 141 SER B N   1 
ATOM 4074 C CA  . SER B 1 143 ? 22.656  29.837  4.388   1.00 195.78 ? 141 SER B CA  1 
ATOM 4075 C C   . SER B 1 143 ? 23.870  29.932  3.467   1.00 176.42 ? 141 SER B C   1 
ATOM 4076 O O   . SER B 1 143 ? 24.504  28.925  3.151   1.00 173.92 ? 141 SER B O   1 
ATOM 4077 C CB  . SER B 1 143 ? 21.367  29.953  3.570   1.00 166.85 ? 141 SER B CB  1 
ATOM 4078 N N   . LEU B 1 144 ? 24.179  31.154  3.043   1.00 182.47 ? 142 LEU B N   1 
ATOM 4079 C CA  . LEU B 1 144 ? 25.276  31.408  2.113   1.00 186.47 ? 142 LEU B CA  1 
ATOM 4080 C C   . LEU B 1 144 ? 26.634  31.101  2.729   1.00 192.54 ? 142 LEU B C   1 
ATOM 4081 O O   . LEU B 1 144 ? 27.527  30.580  2.063   1.00 193.00 ? 142 LEU B O   1 
ATOM 4082 C CB  . LEU B 1 144 ? 25.243  32.859  1.634   1.00 192.28 ? 142 LEU B CB  1 
ATOM 4083 N N   . SER B 1 145 ? 26.782  31.429  4.008   1.00 197.74 ? 143 SER B N   1 
ATOM 4084 C CA  . SER B 1 145 ? 28.021  31.158  4.724   1.00 227.98 ? 143 SER B CA  1 
ATOM 4085 C C   . SER B 1 145 ? 28.210  29.658  4.914   1.00 231.57 ? 143 SER B C   1 
ATOM 4086 O O   . SER B 1 145 ? 29.333  29.157  4.872   1.00 230.58 ? 143 SER B O   1 
ATOM 4087 C CB  . SER B 1 145 ? 28.036  31.867  6.078   1.00 211.53 ? 143 SER B CB  1 
ATOM 4088 O OG  . SER B 1 145 ? 27.161  31.232  6.992   1.00 214.66 ? 143 SER B OG  1 
ATOM 4089 N N   . LEU B 1 146 ? 27.111  28.947  5.142   1.00 190.73 ? 144 LEU B N   1 
ATOM 4090 C CA  . LEU B 1 146 ? 27.151  27.492  5.238   1.00 197.07 ? 144 LEU B CA  1 
ATOM 4091 C C   . LEU B 1 146 ? 27.437  26.846  3.885   1.00 200.07 ? 144 LEU B C   1 
ATOM 4092 O O   . LEU B 1 146 ? 28.043  25.777  3.815   1.00 202.14 ? 144 LEU B O   1 
ATOM 4093 C CB  . LEU B 1 146 ? 25.837  26.953  5.808   1.00 177.57 ? 144 LEU B CB  1 
ATOM 4094 N N   . ASN B 1 147 ? 26.981  27.490  2.815   1.00 147.29 ? 145 ASN B N   1 
ATOM 4095 C CA  . ASN B 1 147 ? 27.087  26.924  1.476   1.00 143.34 ? 145 ASN B CA  1 
ATOM 4096 C C   . ASN B 1 147 ? 27.072  28.020  0.413   1.00 143.21 ? 145 ASN B C   1 
ATOM 4097 O O   . ASN B 1 147 ? 26.006  28.421  -0.053  1.00 151.27 ? 145 ASN B O   1 
ATOM 4098 C CB  . ASN B 1 147 ? 25.948  25.930  1.232   1.00 148.94 ? 145 ASN B CB  1 
ATOM 4099 C CG  . ASN B 1 147 ? 26.066  25.203  -0.100  1.00 156.44 ? 145 ASN B CG  1 
ATOM 4100 O OD1 . ASN B 1 147 ? 26.918  25.519  -0.931  1.00 148.81 ? 145 ASN B OD1 1 
ATOM 4101 N ND2 . ASN B 1 147 ? 25.194  24.225  -0.310  1.00 119.18 ? 145 ASN B ND2 1 
ATOM 4102 N N   . PRO B 1 148 ? 28.258  28.506  0.021   1.00 142.87 ? 146 PRO B N   1 
ATOM 4103 C CA  . PRO B 1 148 ? 28.359  29.627  -0.916  1.00 145.49 ? 146 PRO B CA  1 
ATOM 4104 C C   . PRO B 1 148 ? 28.252  29.198  -2.380  1.00 139.65 ? 146 PRO B C   1 
ATOM 4105 O O   . PRO B 1 148 ? 28.467  30.014  -3.277  1.00 140.74 ? 146 PRO B O   1 
ATOM 4106 C CB  . PRO B 1 148 ? 29.741  30.194  -0.605  1.00 158.28 ? 146 PRO B CB  1 
ATOM 4107 C CG  . PRO B 1 148 ? 30.543  28.976  -0.262  1.00 164.10 ? 146 PRO B CG  1 
ATOM 4108 C CD  . PRO B 1 148 ? 29.588  28.036  0.454   1.00 146.85 ? 146 PRO B CD  1 
ATOM 4109 N N   . PHE B 1 149 ? 27.912  27.934  -2.612  1.00 132.99 ? 147 PHE B N   1 
ATOM 4110 C CA  . PHE B 1 149 ? 27.599  27.457  -3.954  1.00 138.86 ? 147 PHE B CA  1 
ATOM 4111 C C   . PHE B 1 149 ? 26.158  27.795  -4.335  1.00 148.02 ? 147 PHE B C   1 
ATOM 4112 O O   . PHE B 1 149 ? 25.806  27.824  -5.514  1.00 150.09 ? 147 PHE B O   1 
ATOM 4113 C CB  . PHE B 1 149 ? 27.833  25.949  -4.057  1.00 123.16 ? 147 PHE B CB  1 
ATOM 4114 N N   . LEU B 1 150 ? 25.331  28.052  -3.326  1.00 148.59 ? 148 LEU B N   1 
ATOM 4115 C CA  . LEU B 1 150 ? 23.949  28.474  -3.538  1.00 147.95 ? 148 LEU B CA  1 
ATOM 4116 C C   . LEU B 1 150 ? 23.921  29.915  -4.033  1.00 139.53 ? 148 LEU B C   1 
ATOM 4117 O O   . LEU B 1 150 ? 24.475  30.807  -3.391  1.00 138.96 ? 148 LEU B O   1 
ATOM 4118 C CB  . LEU B 1 150 ? 23.133  28.331  -2.253  1.00 121.07 ? 148 LEU B CB  1 
ATOM 4119 N N   . TRP B 1 151 ? 23.286  30.146  -5.177  1.00 128.45 ? 149 TRP B N   1 
ATOM 4120 C CA  . TRP B 1 151 ? 23.148  31.504  -5.691  1.00 130.67 ? 149 TRP B CA  1 
ATOM 4121 C C   . TRP B 1 151 ? 21.865  32.190  -5.223  1.00 130.07 ? 149 TRP B C   1 
ATOM 4122 O O   . TRP B 1 151 ? 21.846  33.406  -5.033  1.00 133.78 ? 149 TRP B O   1 
ATOM 4123 C CB  . TRP B 1 151 ? 23.219  31.504  -7.220  1.00 131.79 ? 149 TRP B CB  1 
ATOM 4124 C CG  . TRP B 1 151 ? 22.773  32.793  -7.834  1.00 150.83 ? 149 TRP B CG  1 
ATOM 4125 C CD1 . TRP B 1 151 ? 21.517  33.117  -8.258  1.00 157.79 ? 149 TRP B CD1 1 
ATOM 4126 C CD2 . TRP B 1 151 ? 23.584  33.952  -8.057  1.00 158.22 ? 149 TRP B CD2 1 
ATOM 4127 N NE1 . TRP B 1 151 ? 21.502  34.400  -8.750  1.00 156.72 ? 149 TRP B NE1 1 
ATOM 4128 C CE2 . TRP B 1 151 ? 22.758  34.935  -8.636  1.00 158.71 ? 149 TRP B CE2 1 
ATOM 4129 C CE3 . TRP B 1 151 ? 24.931  34.250  -7.830  1.00 160.39 ? 149 TRP B CE3 1 
ATOM 4130 C CZ2 . TRP B 1 151 ? 23.236  36.195  -8.991  1.00 162.60 ? 149 TRP B CZ2 1 
ATOM 4131 C CZ3 . TRP B 1 151 ? 25.403  35.500  -8.183  1.00 161.02 ? 149 TRP B CZ3 1 
ATOM 4132 C CH2 . TRP B 1 151 ? 24.558  36.457  -8.757  1.00 162.67 ? 149 TRP B CH2 1 
ATOM 4133 N N   . SER B 1 152 ? 20.796  31.420  -5.042  1.00 124.74 ? 150 SER B N   1 
ATOM 4134 C CA  . SER B 1 152 ? 19.470  31.998  -4.823  1.00 126.70 ? 150 SER B CA  1 
ATOM 4135 C C   . SER B 1 152 ? 19.332  32.854  -3.542  1.00 135.30 ? 150 SER B C   1 
ATOM 4136 O O   . SER B 1 152 ? 18.627  33.864  -3.569  1.00 135.34 ? 150 SER B O   1 
ATOM 4137 C CB  . SER B 1 152 ? 18.413  30.884  -4.824  1.00 119.05 ? 150 SER B CB  1 
ATOM 4138 O OG  . SER B 1 152 ? 18.335  30.220  -3.576  1.00 143.41 ? 150 SER B OG  1 
ATOM 4139 N N   . PRO B 1 153 ? 19.990  32.471  -2.424  1.00 145.45 ? 151 PRO B N   1 
ATOM 4140 C CA  . PRO B 1 153 ? 19.864  33.352  -1.253  1.00 152.83 ? 151 PRO B CA  1 
ATOM 4141 C C   . PRO B 1 153 ? 20.469  34.739  -1.476  1.00 146.51 ? 151 PRO B C   1 
ATOM 4142 O O   . PRO B 1 153 ? 19.876  35.744  -1.083  1.00 154.40 ? 151 PRO B O   1 
ATOM 4143 C CB  . PRO B 1 153 ? 20.632  32.597  -0.160  1.00 164.39 ? 151 PRO B CB  1 
ATOM 4144 C CG  . PRO B 1 153 ? 20.650  31.184  -0.613  1.00 160.38 ? 151 PRO B CG  1 
ATOM 4145 C CD  . PRO B 1 153 ? 20.781  31.271  -2.095  1.00 152.35 ? 151 PRO B CD  1 
ATOM 4146 N N   . PHE B 1 154 ? 21.635  34.780  -2.111  1.00 138.92 ? 152 PHE B N   1 
ATOM 4147 C CA  . PHE B 1 154 ? 22.287  36.034  -2.478  1.00 147.44 ? 152 PHE B CA  1 
ATOM 4148 C C   . PHE B 1 154 ? 21.457  36.814  -3.491  1.00 147.88 ? 152 PHE B C   1 
ATOM 4149 O O   . PHE B 1 154 ? 21.393  38.043  -3.432  1.00 154.37 ? 152 PHE B O   1 
ATOM 4150 C CB  . PHE B 1 154 ? 23.688  35.763  -3.030  1.00 158.46 ? 152 PHE B CB  1 
ATOM 4151 C CG  . PHE B 1 154 ? 24.374  36.980  -3.595  1.00 159.55 ? 152 PHE B CG  1 
ATOM 4152 C CD1 . PHE B 1 154 ? 25.182  37.767  -2.791  1.00 161.99 ? 152 PHE B CD1 1 
ATOM 4153 C CD2 . PHE B 1 154 ? 24.243  37.316  -4.934  1.00 158.76 ? 152 PHE B CD2 1 
ATOM 4154 C CE1 . PHE B 1 154 ? 25.823  38.880  -3.303  1.00 169.38 ? 152 PHE B CE1 1 
ATOM 4155 C CE2 . PHE B 1 154 ? 24.879  38.428  -5.450  1.00 163.61 ? 152 PHE B CE2 1 
ATOM 4156 C CZ  . PHE B 1 154 ? 25.672  39.210  -4.634  1.00 168.89 ? 152 PHE B CZ  1 
ATOM 4157 N N   . GLU B 1 155 ? 20.842  36.098  -4.427  1.00 141.88 ? 153 GLU B N   1 
ATOM 4158 C CA  . GLU B 1 155 ? 19.950  36.713  -5.404  1.00 141.21 ? 153 GLU B CA  1 
ATOM 4159 C C   . GLU B 1 155 ? 18.850  37.465  -4.667  1.00 141.26 ? 153 GLU B C   1 
ATOM 4160 O O   . GLU B 1 155 ? 18.534  38.608  -4.996  1.00 153.30 ? 153 GLU B O   1 
ATOM 4161 C CB  . GLU B 1 155 ? 19.350  35.658  -6.337  1.00 150.41 ? 153 GLU B CB  1 
ATOM 4162 C CG  . GLU B 1 155 ? 18.763  36.221  -7.622  1.00 154.34 ? 153 GLU B CG  1 
ATOM 4163 C CD  . GLU B 1 155 ? 18.104  35.156  -8.477  1.00 153.89 ? 153 GLU B CD  1 
ATOM 4164 O OE1 . GLU B 1 155 ? 17.393  34.299  -7.912  1.00 165.62 ? 153 GLU B OE1 1 
ATOM 4165 O OE2 . GLU B 1 155 ? 18.286  35.182  -9.713  1.00 136.71 ? 153 GLU B OE2 1 
ATOM 4166 N N   . SER B 1 156 ? 18.269  36.804  -3.673  1.00 132.36 ? 154 SER B N   1 
ATOM 4167 C CA  . SER B 1 156 ? 17.193  37.376  -2.875  1.00 138.86 ? 154 SER B CA  1 
ATOM 4168 C C   . SER B 1 156 ? 17.663  38.601  -2.085  1.00 145.64 ? 154 SER B C   1 
ATOM 4169 O O   . SER B 1 156 ? 16.992  39.634  -2.084  1.00 146.67 ? 154 SER B O   1 
ATOM 4170 C CB  . SER B 1 156 ? 16.618  36.323  -1.926  1.00 147.78 ? 154 SER B CB  1 
ATOM 4171 O OG  . SER B 1 156 ? 16.279  35.138  -2.626  1.00 157.77 ? 154 SER B OG  1 
ATOM 4172 N N   . LEU B 1 157 ? 18.803  38.473  -1.405  1.00 151.05 ? 155 LEU B N   1 
ATOM 4173 C CA  . LEU B 1 157 ? 19.420  39.596  -0.689  1.00 156.81 ? 155 LEU B CA  1 
ATOM 4174 C C   . LEU B 1 157 ? 19.545  40.871  -1.505  1.00 157.42 ? 155 LEU B C   1 
ATOM 4175 O O   . LEU B 1 157 ? 19.265  41.961  -1.008  1.00 165.20 ? 155 LEU B O   1 
ATOM 4176 C CB  . LEU B 1 157 ? 20.821  39.214  -0.197  1.00 157.32 ? 155 LEU B CB  1 
ATOM 4177 C CG  . LEU B 1 157 ? 21.027  38.694  1.224   1.00 160.07 ? 155 LEU B CG  1 
ATOM 4178 C CD1 . LEU B 1 157 ? 19.764  38.066  1.751   1.00 153.83 ? 155 LEU B CD1 1 
ATOM 4179 C CD2 . LEU B 1 157 ? 22.192  37.713  1.274   1.00 162.93 ? 155 LEU B CD2 1 
ATOM 4180 N N   . CYS B 1 158 ? 19.964  40.736  -2.756  1.00 151.84 ? 156 CYS B N   1 
ATOM 4181 C CA  . CYS B 1 158 ? 20.105  41.899  -3.616  1.00 152.54 ? 156 CYS B CA  1 
ATOM 4182 C C   . CYS B 1 158 ? 18.742  42.512  -3.917  1.00 151.00 ? 156 CYS B C   1 
ATOM 4183 O O   . CYS B 1 158 ? 18.570  43.729  -3.841  1.00 162.56 ? 156 CYS B O   1 
ATOM 4184 C CB  . CYS B 1 158 ? 20.827  41.517  -4.907  1.00 151.10 ? 156 CYS B CB  1 
ATOM 4185 S SG  . CYS B 1 158 ? 22.527  40.958  -4.649  1.00 152.74 ? 156 CYS B SG  1 
ATOM 4186 N N   . GLU B 1 159 ? 17.776  41.663  -4.252  1.00 143.53 ? 157 GLU B N   1 
ATOM 4187 C CA  . GLU B 1 159 ? 16.442  42.124  -4.625  1.00 141.70 ? 157 GLU B CA  1 
ATOM 4188 C C   . GLU B 1 159 ? 15.656  42.738  -3.469  1.00 143.46 ? 157 GLU B C   1 
ATOM 4189 O O   . GLU B 1 159 ? 14.894  43.686  -3.667  1.00 144.47 ? 157 GLU B O   1 
ATOM 4190 C CB  . GLU B 1 159 ? 15.618  40.994  -5.248  1.00 141.96 ? 157 GLU B CB  1 
ATOM 4191 C CG  . GLU B 1 159 ? 16.133  40.515  -6.596  1.00 147.26 ? 157 GLU B CG  1 
ATOM 4192 C CD  . GLU B 1 159 ? 15.491  39.214  -7.036  1.00 158.81 ? 157 GLU B CD  1 
ATOM 4193 O OE1 . GLU B 1 159 ? 14.260  39.217  -7.244  1.00 165.88 ? 157 GLU B OE1 1 
ATOM 4194 O OE2 . GLU B 1 159 ? 16.204  38.200  -7.187  1.00 160.67 ? 157 GLU B OE2 1 
ATOM 4195 N N   . ILE B 1 160 ? 15.840  42.209  -2.263  1.00 140.17 ? 158 ILE B N   1 
ATOM 4196 C CA  . ILE B 1 160 ? 15.166  42.778  -1.102  1.00 141.63 ? 158 ILE B CA  1 
ATOM 4197 C C   . ILE B 1 160 ? 15.946  43.916  -0.458  1.00 154.67 ? 158 ILE B C   1 
ATOM 4198 O O   . ILE B 1 160 ? 15.737  44.243  0.710   1.00 161.52 ? 158 ILE B O   1 
ATOM 4199 C CB  . ILE B 1 160 ? 14.908  41.699  -0.033  1.00 137.37 ? 158 ILE B CB  1 
ATOM 4200 N N   . GLY B 1 161 ? 16.838  44.522  -1.231  1.00 162.50 ? 159 GLY B N   1 
ATOM 4201 C CA  . GLY B 1 161 ? 17.422  45.799  -0.872  1.00 179.63 ? 159 GLY B CA  1 
ATOM 4202 C C   . GLY B 1 161 ? 18.667  45.784  -0.010  1.00 193.89 ? 159 GLY B C   1 
ATOM 4203 O O   . GLY B 1 161 ? 19.275  46.832  0.203   1.00 201.29 ? 159 GLY B O   1 
ATOM 4204 N N   . GLU B 1 162 ? 19.069  44.616  0.478   1.00 189.11 ? 160 GLU B N   1 
ATOM 4205 C CA  . GLU B 1 162 ? 20.295  44.562  1.260   1.00 176.54 ? 160 GLU B CA  1 
ATOM 4206 C C   . GLU B 1 162 ? 21.485  44.442  0.325   1.00 176.25 ? 160 GLU B C   1 
ATOM 4207 O O   . GLU B 1 162 ? 21.338  44.056  -0.834  1.00 178.63 ? 160 GLU B O   1 
ATOM 4208 C CB  . GLU B 1 162 ? 20.265  43.392  2.246   1.00 166.97 ? 160 GLU B CB  1 
ATOM 4209 N N   . LYS B 1 163 ? 22.664  44.775  0.835   1.00 179.82 ? 161 LYS B N   1 
ATOM 4210 C CA  . LYS B 1 163 ? 23.848  44.887  -0.005  1.00 174.74 ? 161 LYS B CA  1 
ATOM 4211 C C   . LYS B 1 163 ? 25.005  44.067  0.544   1.00 176.74 ? 161 LYS B C   1 
ATOM 4212 O O   . LYS B 1 163 ? 25.933  44.627  1.128   1.00 191.65 ? 161 LYS B O   1 
ATOM 4213 C CB  . LYS B 1 163 ? 24.264  46.351  -0.150  1.00 173.81 ? 161 LYS B CB  1 
ATOM 4214 N N   . PRO B 1 164 ? 24.971  42.742  0.359   1.00 166.46 ? 162 PRO B N   1 
ATOM 4215 C CA  . PRO B 1 164 ? 26.137  42.008  0.848   1.00 168.32 ? 162 PRO B CA  1 
ATOM 4216 C C   . PRO B 1 164 ? 27.346  42.230  -0.055  1.00 169.60 ? 162 PRO B C   1 
ATOM 4217 O O   . PRO B 1 164 ? 27.190  42.678  -1.182  1.00 170.98 ? 162 PRO B O   1 
ATOM 4218 C CB  . PRO B 1 164 ? 25.664  40.555  0.814   1.00 165.20 ? 162 PRO B CB  1 
ATOM 4219 C CG  . PRO B 1 164 ? 24.701  40.520  -0.330  1.00 161.10 ? 162 PRO B CG  1 
ATOM 4220 C CD  . PRO B 1 164 ? 24.010  41.868  -0.337  1.00 162.46 ? 162 PRO B CD  1 
ATOM 4221 N N   . ASP B 1 165 ? 28.534  41.914  0.442   1.00 172.89 ? 163 ASP B N   1 
ATOM 4222 C CA  . ASP B 1 165 ? 29.772  42.133  -0.298  1.00 174.50 ? 163 ASP B CA  1 
ATOM 4223 C C   . ASP B 1 165 ? 30.132  40.816  -0.965  1.00 172.64 ? 163 ASP B C   1 
ATOM 4224 O O   . ASP B 1 165 ? 30.501  39.867  -0.279  1.00 174.01 ? 163 ASP B O   1 
ATOM 4225 C CB  . ASP B 1 165 ? 30.886  42.627  0.622   1.00 180.86 ? 163 ASP B CB  1 
ATOM 4226 C CG  . ASP B 1 165 ? 32.207  42.789  -0.098  1.00 184.30 ? 163 ASP B CG  1 
ATOM 4227 O OD1 . ASP B 1 165 ? 32.200  43.227  -1.268  1.00 179.69 ? 163 ASP B OD1 1 
ATOM 4228 O OD2 . ASP B 1 165 ? 33.252  42.476  0.507   1.00 191.02 ? 163 ASP B OD2 1 
ATOM 4229 N N   . PRO B 1 166 ? 30.074  40.771  -2.308  1.00 173.31 ? 164 PRO B N   1 
ATOM 4230 C CA  . PRO B 1 166 ? 30.481  39.551  -3.018  1.00 179.60 ? 164 PRO B CA  1 
ATOM 4231 C C   . PRO B 1 166 ? 31.857  39.015  -2.638  1.00 189.09 ? 164 PRO B C   1 
ATOM 4232 O O   . PRO B 1 166 ? 31.948  37.812  -2.388  1.00 182.54 ? 164 PRO B O   1 
ATOM 4233 C CB  . PRO B 1 166 ? 30.474  39.993  -4.485  1.00 177.93 ? 164 PRO B CB  1 
ATOM 4234 N N   . ASP B 1 167 ? 32.889  39.851  -2.616  1.00 201.08 ? 165 ASP B N   1 
ATOM 4235 C CA  . ASP B 1 167 ? 34.244  39.372  -2.356  1.00 200.22 ? 165 ASP B CA  1 
ATOM 4236 C C   . ASP B 1 167 ? 34.307  38.576  -1.046  1.00 205.44 ? 165 ASP B C   1 
ATOM 4237 O O   . ASP B 1 167 ? 35.013  37.573  -0.940  1.00 209.70 ? 165 ASP B O   1 
ATOM 4238 C CB  . ASP B 1 167 ? 35.229  40.541  -2.314  1.00 191.27 ? 165 ASP B CB  1 
ATOM 4239 N N   . GLN B 1 168 ? 33.552  39.049  -0.057  1.00 201.28 ? 166 GLN B N   1 
ATOM 4240 C CA  . GLN B 1 168 ? 33.502  38.462  1.283   1.00 194.40 ? 166 GLN B CA  1 
ATOM 4241 C C   . GLN B 1 168 ? 32.400  37.419  1.504   1.00 189.60 ? 166 GLN B C   1 
ATOM 4242 O O   . GLN B 1 168 ? 32.606  36.433  2.209   1.00 188.66 ? 166 GLN B O   1 
ATOM 4243 C CB  . GLN B 1 168 ? 33.353  39.574  2.325   1.00 193.19 ? 166 GLN B CB  1 
ATOM 4244 N N   . THR B 1 169 ? 31.232  37.645  0.909   1.00 187.73 ? 167 THR B N   1 
ATOM 4245 C CA  . THR B 1 169 ? 30.080  36.755  1.085   1.00 188.56 ? 167 THR B CA  1 
ATOM 4246 C C   . THR B 1 169 ? 30.286  35.382  0.447   1.00 190.48 ? 167 THR B C   1 
ATOM 4247 O O   . THR B 1 169 ? 29.884  34.370  1.022   1.00 190.02 ? 167 THR B O   1 
ATOM 4248 C CB  . THR B 1 169 ? 28.747  37.360  0.547   1.00 173.36 ? 167 THR B CB  1 
ATOM 4249 O OG1 . THR B 1 169 ? 27.640  36.585  1.025   1.00 177.46 ? 167 THR B OG1 1 
ATOM 4250 C CG2 . THR B 1 169 ? 28.705  37.420  -0.969  1.00 169.10 ? 167 THR B CG2 1 
ATOM 4251 N N   . PHE B 1 170 ? 30.910  35.334  -0.727  1.00 200.14 ? 168 PHE B N   1 
ATOM 4252 C CA  . PHE B 1 170 ? 31.179  34.054  -1.366  1.00 197.70 ? 168 PHE B CA  1 
ATOM 4253 C C   . PHE B 1 170 ? 32.598  33.555  -1.174  1.00 203.76 ? 168 PHE B C   1 
ATOM 4254 O O   . PHE B 1 170 ? 33.056  32.672  -1.913  1.00 209.90 ? 168 PHE B O   1 
ATOM 4255 C CB  . PHE B 1 170 ? 30.913  34.167  -2.867  1.00 191.02 ? 168 PHE B CB  1 
ATOM 4256 C CG  . PHE B 1 170 ? 29.477  34.384  -3.210  1.00 185.52 ? 168 PHE B CG  1 
ATOM 4257 C CD1 . PHE B 1 170 ? 28.516  33.457  -2.848  1.00 186.83 ? 168 PHE B CD1 1 
ATOM 4258 C CD2 . PHE B 1 170 ? 29.089  35.515  -3.905  1.00 183.37 ? 168 PHE B CD2 1 
ATOM 4259 C CE1 . PHE B 1 170 ? 27.191  33.661  -3.169  1.00 187.25 ? 168 PHE B CE1 1 
ATOM 4260 C CE2 . PHE B 1 170 ? 27.768  35.723  -4.228  1.00 178.15 ? 168 PHE B CE2 1 
ATOM 4261 C CZ  . PHE B 1 170 ? 26.820  34.794  -3.862  1.00 179.90 ? 168 PHE B CZ  1 
ATOM 4262 N N   . LYS B 1 171 ? 33.289  34.086  -0.174  1.00 202.54 ? 169 LYS B N   1 
ATOM 4263 C CA  . LYS B 1 171 ? 34.598  33.554  0.182   1.00 195.86 ? 169 LYS B CA  1 
ATOM 4264 C C   . LYS B 1 171 ? 34.323  32.231  0.922   1.00 188.95 ? 169 LYS B C   1 
ATOM 4265 O O   . LYS B 1 171 ? 33.416  32.161  1.760   1.00 194.95 ? 169 LYS B O   1 
ATOM 4266 C CB  . LYS B 1 171 ? 35.396  34.549  1.021   1.00 197.06 ? 169 LYS B CB  1 
ATOM 4267 N N   . PHE B 1 172 ? 35.170  31.247  0.640   1.00 180.96 ? 170 PHE B N   1 
ATOM 4268 C CA  . PHE B 1 172 ? 35.086  29.890  1.098   1.00 185.16 ? 170 PHE B CA  1 
ATOM 4269 C C   . PHE B 1 172 ? 35.509  29.597  2.546   1.00 201.34 ? 170 PHE B C   1 
ATOM 4270 O O   . PHE B 1 172 ? 36.707  29.666  2.882   1.00 214.35 ? 170 PHE B O   1 
ATOM 4271 C CB  . PHE B 1 172 ? 35.910  28.984  0.163   1.00 179.22 ? 170 PHE B CB  1 
ATOM 4272 N N   . THR B 1 173 ? 34.530  29.366  3.433   1.00 192.31 ? 171 THR B N   1 
ATOM 4273 C CA  . THR B 1 173 ? 34.810  29.077  4.853   1.00 178.63 ? 171 THR B CA  1 
ATOM 4274 C C   . THR B 1 173 ? 33.608  28.379  5.498   1.00 174.26 ? 171 THR B C   1 
ATOM 4275 O O   . THR B 1 173 ? 33.685  27.199  5.856   1.00 173.22 ? 171 THR B O   1 
ATOM 4276 C CB  . THR B 1 173 ? 35.182  30.347  5.660   1.00 177.96 ? 171 THR B CB  1 
ATOM 4277 N N   . ALA B 1 195 ? 37.836  24.967  -6.215  1.00 206.71 ? 465 ALA B N   1 
ATOM 4278 C CA  . ALA B 1 195 ? 36.840  25.670  -5.415  1.00 203.78 ? 465 ALA B CA  1 
ATOM 4279 C C   . ALA B 1 195 ? 36.983  27.182  -5.579  1.00 193.16 ? 465 ALA B C   1 
ATOM 4280 O O   . ALA B 1 195 ? 36.007  27.883  -5.848  1.00 178.90 ? 465 ALA B O   1 
ATOM 4281 C CB  . ALA B 1 195 ? 36.972  25.275  -3.951  1.00 216.92 ? 465 ALA B CB  1 
ATOM 4282 N N   . GLU B 1 196 ? 38.209  27.668  -5.406  1.00 196.41 ? 466 GLU B N   1 
ATOM 4283 C CA  . GLU B 1 196 ? 38.554  29.084  -5.541  1.00 189.61 ? 466 GLU B CA  1 
ATOM 4284 C C   . GLU B 1 196 ? 38.112  29.667  -6.884  1.00 183.45 ? 466 GLU B C   1 
ATOM 4285 O O   . GLU B 1 196 ? 37.791  30.850  -6.987  1.00 180.62 ? 466 GLU B O   1 
ATOM 4286 C CB  . GLU B 1 196 ? 40.057  29.291  -5.352  1.00 188.55 ? 466 GLU B CB  1 
ATOM 4287 N N   . GLY B 1 197 ? 38.102  28.820  -7.908  1.00 182.01 ? 467 GLY B N   1 
ATOM 4288 C CA  . GLY B 1 197 ? 37.637  29.189  -9.232  1.00 180.57 ? 467 GLY B CA  1 
ATOM 4289 C C   . GLY B 1 197 ? 36.150  29.449  -9.374  1.00 170.69 ? 467 GLY B C   1 
ATOM 4290 O O   . GLY B 1 197 ? 35.757  30.376  -10.084 1.00 169.23 ? 467 GLY B O   1 
ATOM 4291 N N   . LEU B 1 198 ? 35.317  28.653  -8.714  1.00 163.03 ? 468 LEU B N   1 
ATOM 4292 C CA  . LEU B 1 198 ? 33.886  28.903  -8.780  1.00 158.04 ? 468 LEU B CA  1 
ATOM 4293 C C   . LEU B 1 198 ? 33.589  30.197  -8.035  1.00 150.24 ? 468 LEU B C   1 
ATOM 4294 O O   . LEU B 1 198 ? 32.940  31.090  -8.581  1.00 142.04 ? 468 LEU B O   1 
ATOM 4295 C CB  . LEU B 1 198 ? 33.093  27.740  -8.180  1.00 158.13 ? 468 LEU B CB  1 
ATOM 4296 N N   . MET B 1 199 ? 34.040  30.284  -6.785  1.00 156.71 ? 469 MET B N   1 
ATOM 4297 C CA  . MET B 1 199 ? 33.761  31.451  -5.952  1.00 167.65 ? 469 MET B CA  1 
ATOM 4298 C C   . MET B 1 199 ? 34.189  32.757  -6.625  1.00 172.62 ? 469 MET B C   1 
ATOM 4299 O O   . MET B 1 199 ? 33.444  33.737  -6.628  1.00 182.11 ? 469 MET B O   1 
ATOM 4300 C CB  . MET B 1 199 ? 34.453  31.312  -4.594  1.00 178.77 ? 469 MET B CB  1 
ATOM 4301 C CG  . MET B 1 199 ? 33.987  30.116  -3.777  1.00 153.21 ? 469 MET B CG  1 
ATOM 4302 N N   . SER B 1 200 ? 35.391  32.757  -7.196  1.00 165.86 ? 470 SER B N   1 
ATOM 4303 C CA  . SER B 1 200 ? 35.926  33.929  -7.885  1.00 160.67 ? 470 SER B CA  1 
ATOM 4304 C C   . SER B 1 200 ? 35.062  34.337  -9.073  1.00 156.32 ? 470 SER B C   1 
ATOM 4305 O O   . SER B 1 200 ? 34.920  35.522  -9.376  1.00 162.76 ? 470 SER B O   1 
ATOM 4306 C CB  . SER B 1 200 ? 37.362  33.665  -8.339  1.00 161.40 ? 470 SER B CB  1 
ATOM 4307 O OG  . SER B 1 200 ? 37.399  32.663  -9.338  1.00 159.87 ? 470 SER B OG  1 
ATOM 4308 N N   . LEU B 1 201 ? 34.483  33.346  -9.741  1.00 147.34 ? 471 LEU B N   1 
ATOM 4309 C CA  . LEU B 1 201 ? 33.510  33.615  -10.789 1.00 144.33 ? 471 LEU B CA  1 
ATOM 4310 C C   . LEU B 1 201 ? 32.216  34.133  -10.170 1.00 141.24 ? 471 LEU B C   1 
ATOM 4311 O O   . LEU B 1 201 ? 31.682  35.154  -10.599 1.00 139.96 ? 471 LEU B O   1 
ATOM 4312 C CB  . LEU B 1 201 ? 33.248  32.357  -11.619 1.00 144.41 ? 471 LEU B CB  1 
ATOM 4313 N N   . LEU B 1 202 ? 31.714  33.411  -9.172  1.00 148.25 ? 472 LEU B N   1 
ATOM 4314 C CA  . LEU B 1 202 ? 30.478  33.774  -8.484  1.00 150.91 ? 472 LEU B CA  1 
ATOM 4315 C C   . LEU B 1 202 ? 30.518  35.191  -7.908  1.00 152.08 ? 472 LEU B C   1 
ATOM 4316 O O   . LEU B 1 202 ? 29.555  35.950  -8.016  1.00 162.89 ? 472 LEU B O   1 
ATOM 4317 C CB  . LEU B 1 202 ? 30.195  32.777  -7.358  1.00 160.79 ? 472 LEU B CB  1 
ATOM 4318 C CG  . LEU B 1 202 ? 29.816  31.339  -7.718  1.00 151.45 ? 472 LEU B CG  1 
ATOM 4319 C CD1 . LEU B 1 202 ? 29.431  30.581  -6.460  1.00 155.11 ? 472 LEU B CD1 1 
ATOM 4320 C CD2 . LEU B 1 202 ? 28.675  31.302  -8.726  1.00 140.77 ? 472 LEU B CD2 1 
ATOM 4321 N N   . ARG B 1 203 ? 31.654  35.532  -7.305  1.00 147.92 ? 473 ARG B N   1 
ATOM 4322 C CA  . ARG B 1 203 ? 31.897  36.859  -6.745  1.00 148.50 ? 473 ARG B CA  1 
ATOM 4323 C C   . ARG B 1 203 ? 31.788  38.003  -7.749  1.00 148.43 ? 473 ARG B C   1 
ATOM 4324 O O   . ARG B 1 203 ? 31.162  39.025  -7.468  1.00 155.85 ? 473 ARG B O   1 
ATOM 4325 C CB  . ARG B 1 203 ? 33.281  36.898  -6.090  1.00 152.56 ? 473 ARG B CB  1 
ATOM 4326 N N   . GLU B 1 204 ? 32.380  37.821  -8.923  1.00 140.98 ? 474 GLU B N   1 
ATOM 4327 C CA  . GLU B 1 204 ? 32.337  38.836  -9.969  1.00 140.99 ? 474 GLU B CA  1 
ATOM 4328 C C   . GLU B 1 204 ? 30.933  38.980  -10.542 1.00 140.43 ? 474 GLU B C   1 
ATOM 4329 O O   . GLU B 1 204 ? 30.464  40.090  -10.796 1.00 137.11 ? 474 GLU B O   1 
ATOM 4330 C CB  . GLU B 1 204 ? 33.327  38.495  -11.085 1.00 142.55 ? 474 GLU B CB  1 
ATOM 4331 N N   . MET B 1 205 ? 30.272  37.848  -10.741 1.00 152.04 ? 475 MET B N   1 
ATOM 4332 C CA  . MET B 1 205 ? 28.913  37.819  -11.264 1.00 155.12 ? 475 MET B CA  1 
ATOM 4333 C C   . MET B 1 205 ? 27.935  38.383  -10.236 1.00 154.70 ? 475 MET B C   1 
ATOM 4334 O O   . MET B 1 205 ? 26.998  39.106  -10.578 1.00 151.31 ? 475 MET B O   1 
ATOM 4335 C CB  . MET B 1 205 ? 28.530  36.390  -11.640 1.00 156.42 ? 475 MET B CB  1 
ATOM 4336 C CG  . MET B 1 205 ? 29.251  35.878  -12.873 1.00 159.46 ? 475 MET B CG  1 
ATOM 4337 S SD  . MET B 1 205 ? 28.881  34.152  -13.226 1.00 141.89 ? 475 MET B SD  1 
ATOM 4338 C CE  . MET B 1 205 ? 27.251  34.315  -13.941 1.00 140.15 ? 475 MET B CE  1 
ATOM 4339 N N   . GLY B 1 206 ? 28.174  38.042  -8.975  1.00 157.37 ? 476 GLY B N   1 
ATOM 4340 C CA  . GLY B 1 206 ? 27.390  38.533  -7.855  1.00 158.82 ? 476 GLY B CA  1 
ATOM 4341 C C   . GLY B 1 206 ? 27.511  40.034  -7.683  1.00 167.33 ? 476 GLY B C   1 
ATOM 4342 O O   . GLY B 1 206 ? 26.517  40.728  -7.466  1.00 164.99 ? 476 GLY B O   1 
ATOM 4343 N N   . LYS B 1 207 ? 28.739  40.531  -7.775  1.00 177.72 ? 477 LYS B N   1 
ATOM 4344 C CA  . LYS B 1 207 ? 29.006  41.963  -7.724  1.00 176.47 ? 477 LYS B CA  1 
ATOM 4345 C C   . LYS B 1 207 ? 28.260  42.676  -8.849  1.00 155.45 ? 477 LYS B C   1 
ATOM 4346 O O   . LYS B 1 207 ? 27.821  43.814  -8.690  1.00 160.74 ? 477 LYS B O   1 
ATOM 4347 C CB  . LYS B 1 207 ? 30.508  42.240  -7.817  1.00 184.22 ? 477 LYS B CB  1 
ATOM 4348 N N   . GLY B 1 208 ? 28.129  42.005  -9.987  1.00 136.03 ? 478 GLY B N   1 
ATOM 4349 C CA  . GLY B 1 208 ? 27.431  42.574  -11.122 1.00 139.43 ? 478 GLY B CA  1 
ATOM 4350 C C   . GLY B 1 208 ? 25.932  42.644  -10.880 1.00 143.11 ? 478 GLY B C   1 
ATOM 4351 O O   . GLY B 1 208 ? 25.317  43.686  -11.109 1.00 146.32 ? 478 GLY B O   1 
ATOM 4352 N N   . TYR B 1 209 ? 25.339  41.542  -10.427 1.00 142.43 ? 479 TYR B N   1 
ATOM 4353 C CA  . TYR B 1 209 ? 23.899  41.510  -10.177 1.00 141.63 ? 479 TYR B CA  1 
ATOM 4354 C C   . TYR B 1 209 ? 23.479  42.518  -9.111  1.00 143.45 ? 479 TYR B C   1 
ATOM 4355 O O   . TYR B 1 209 ? 22.438  43.163  -9.238  1.00 147.07 ? 479 TYR B O   1 
ATOM 4356 C CB  . TYR B 1 209 ? 23.460  40.106  -9.751  1.00 137.57 ? 479 TYR B CB  1 
ATOM 4357 C CG  . TYR B 1 209 ? 21.958  39.925  -9.690  1.00 136.65 ? 479 TYR B CG  1 
ATOM 4358 C CD1 . TYR B 1 209 ? 21.330  39.579  -8.500  1.00 148.44 ? 479 TYR B CD1 1 
ATOM 4359 C CD2 . TYR B 1 209 ? 21.169  40.095  -10.820 1.00 139.27 ? 479 TYR B CD2 1 
ATOM 4360 C CE1 . TYR B 1 209 ? 19.959  39.412  -8.436  1.00 154.10 ? 479 TYR B CE1 1 
ATOM 4361 C CE2 . TYR B 1 209 ? 19.796  39.929  -10.766 1.00 141.83 ? 479 TYR B CE2 1 
ATOM 4362 C CZ  . TYR B 1 209 ? 19.197  39.587  -9.572  1.00 151.97 ? 479 TYR B CZ  1 
ATOM 4363 O OH  . TYR B 1 209 ? 17.832  39.421  -9.513  1.00 155.46 ? 479 TYR B OH  1 
ATOM 4364 N N   . LEU B 1 210 ? 24.285  42.642  -8.061  1.00 152.46 ? 480 LEU B N   1 
ATOM 4365 C CA  . LEU B 1 210 ? 24.057  43.642  -7.019  1.00 153.58 ? 480 LEU B CA  1 
ATOM 4366 C C   . LEU B 1 210 ? 23.968  45.051  -7.588  1.00 149.36 ? 480 LEU B C   1 
ATOM 4367 O O   . LEU B 1 210 ? 23.101  45.837  -7.202  1.00 151.99 ? 480 LEU B O   1 
ATOM 4368 C CB  . LEU B 1 210 ? 25.173  43.580  -5.978  1.00 162.59 ? 480 LEU B CB  1 
ATOM 4369 C CG  . LEU B 1 210 ? 24.970  44.154  -4.572  1.00 178.38 ? 480 LEU B CG  1 
ATOM 4370 C CD1 . LEU B 1 210 ? 26.159  43.745  -3.759  1.00 185.85 ? 480 LEU B CD1 1 
ATOM 4371 C CD2 . LEU B 1 210 ? 24.824  45.672  -4.529  1.00 186.52 ? 480 LEU B CD2 1 
ATOM 4372 N N   . ALA B 1 211 ? 24.870  45.354  -8.516  1.00 141.23 ? 481 ALA B N   1 
ATOM 4373 C CA  . ALA B 1 211 ? 24.906  46.658  -9.160  1.00 147.38 ? 481 ALA B CA  1 
ATOM 4374 C C   . ALA B 1 211 ? 23.596  46.891  -9.888  1.00 147.78 ? 481 ALA B C   1 
ATOM 4375 O O   . ALA B 1 211 ? 22.987  47.954  -9.762  1.00 150.42 ? 481 ALA B O   1 
ATOM 4376 C CB  . ALA B 1 211 ? 26.083  46.756  -10.105 1.00 154.91 ? 481 ALA B CB  1 
ATOM 4377 N N   . LEU B 1 212 ? 23.180  45.897  -10.665 1.00 150.76 ? 482 LEU B N   1 
ATOM 4378 C CA  . LEU B 1 212 ? 21.940  45.980  -11.417 1.00 152.02 ? 482 LEU B CA  1 
ATOM 4379 C C   . LEU B 1 212 ? 20.800  46.220  -10.434 1.00 166.35 ? 482 LEU B C   1 
ATOM 4380 O O   . LEU B 1 212 ? 19.913  47.037  -10.680 1.00 176.15 ? 482 LEU B O   1 
ATOM 4381 C CB  . LEU B 1 212 ? 21.703  44.711  -12.236 1.00 145.41 ? 482 LEU B CB  1 
ATOM 4382 N N   . CYS B 1 213 ? 20.819  45.485  -9.327  1.00 169.35 ? 483 CYS B N   1 
ATOM 4383 C CA  . CYS B 1 213 ? 19.803  45.635  -8.292  1.00 160.95 ? 483 CYS B CA  1 
ATOM 4384 C C   . CYS B 1 213 ? 19.862  46.997  -7.598  1.00 162.81 ? 483 CYS B C   1 
ATOM 4385 O O   . CYS B 1 213 ? 18.825  47.572  -7.273  1.00 167.41 ? 483 CYS B O   1 
ATOM 4386 C CB  . CYS B 1 213 ? 19.921  44.510  -7.266  1.00 156.25 ? 483 CYS B CB  1 
ATOM 4387 S SG  . CYS B 1 213 ? 19.470  42.879  -7.902  1.00 148.90 ? 483 CYS B SG  1 
ATOM 4388 N N   . SER B 1 214 ? 21.067  47.505  -7.345  1.00 170.75 ? 484 SER B N   1 
ATOM 4389 C CA  . SER B 1 214 ? 21.225  48.840  -6.762  1.00 180.58 ? 484 SER B CA  1 
ATOM 4390 C C   . SER B 1 214 ? 21.063  49.939  -7.812  1.00 182.49 ? 484 SER B C   1 
ATOM 4391 O O   . SER B 1 214 ? 21.244  51.125  -7.533  1.00 188.33 ? 484 SER B O   1 
ATOM 4392 C CB  . SER B 1 214 ? 22.571  48.962  -6.054  1.00 195.19 ? 484 SER B CB  1 
ATOM 4393 O OG  . SER B 1 214 ? 22.629  48.126  -4.911  1.00 202.45 ? 484 SER B OG  1 
ATOM 4394 N N   . TYR B 1 215 ? 20.767  49.499  -9.035  1.00 178.21 ? 485 TYR B N   1 
ATOM 4395 C CA  . TYR B 1 215 ? 20.446  50.344  -10.189 1.00 186.26 ? 485 TYR B CA  1 
ATOM 4396 C C   . TYR B 1 215 ? 21.549  51.280  -10.708 1.00 200.43 ? 485 TYR B C   1 
ATOM 4397 O O   . TYR B 1 215 ? 21.250  52.285  -11.358 1.00 203.58 ? 485 TYR B O   1 
ATOM 4398 C CB  . TYR B 1 215 ? 19.171  51.129  -9.936  1.00 193.05 ? 485 TYR B CB  1 
ATOM 4399 C CG  . TYR B 1 215 ? 17.925  50.280  -10.041 1.00 195.44 ? 485 TYR B CG  1 
ATOM 4400 C CD1 . TYR B 1 215 ? 17.392  49.961  -11.285 1.00 195.37 ? 485 TYR B CD1 1 
ATOM 4401 C CD2 . TYR B 1 215 ? 17.296  49.778  -8.912  1.00 203.68 ? 485 TYR B CD2 1 
ATOM 4402 C CE1 . TYR B 1 215 ? 16.258  49.180  -11.398 1.00 199.20 ? 485 TYR B CE1 1 
ATOM 4403 C CE2 . TYR B 1 215 ? 16.161  48.994  -9.015  1.00 206.60 ? 485 TYR B CE2 1 
ATOM 4404 C CZ  . TYR B 1 215 ? 15.647  48.698  -10.261 1.00 205.69 ? 485 TYR B CZ  1 
ATOM 4405 O OH  . TYR B 1 215 ? 14.517  47.919  -10.370 1.00 207.10 ? 485 TYR B OH  1 
ATOM 4406 N N   . ASN B 1 216 ? 22.799  50.985  -10.379 1.00 200.90 ? 486 ASN B N   1 
ATOM 4407 C CA  . ASN B 1 216 ? 23.955  51.581  -11.050 1.00 189.37 ? 486 ASN B CA  1 
ATOM 4408 C C   . ASN B 1 216 ? 24.323  50.583  -12.140 1.00 184.82 ? 486 ASN B C   1 
ATOM 4409 O O   . ASN B 1 216 ? 25.201  49.739  -11.957 1.00 180.06 ? 486 ASN B O   1 
ATOM 4410 C CB  . ASN B 1 216 ? 25.116  51.930  -10.118 1.00 183.88 ? 486 ASN B CB  1 
ATOM 4411 C CG  . ASN B 1 216 ? 24.665  52.651  -8.862  1.00 182.73 ? 486 ASN B CG  1 
ATOM 4412 O OD1 . ASN B 1 216 ? 23.851  53.575  -8.927  1.00 186.88 ? 486 ASN B OD1 1 
ATOM 4413 N ND2 . ASN B 1 216 ? 25.230  52.275  -7.724  1.00 180.32 ? 486 ASN B ND2 1 
ATOM 4414 N N   . CYS B 1 217 ? 23.648  50.700  -13.274 1.00 182.85 ? 487 CYS B N   1 
ATOM 4415 C CA  . CYS B 1 217 ? 23.642  49.703  -14.341 1.00 173.46 ? 487 CYS B CA  1 
ATOM 4416 C C   . CYS B 1 217 ? 24.894  49.771  -15.203 1.00 177.78 ? 487 CYS B C   1 
ATOM 4417 O O   . CYS B 1 217 ? 25.433  48.735  -15.593 1.00 166.65 ? 487 CYS B O   1 
ATOM 4418 C CB  . CYS B 1 217 ? 22.394  49.861  -15.210 1.00 166.97 ? 487 CYS B CB  1 
ATOM 4419 N N   . LYS B 1 218 ? 25.341  50.981  -15.517 1.00 194.07 ? 488 LYS B N   1 
ATOM 4420 C CA  . LYS B 1 218 ? 26.579  51.160  -16.268 1.00 192.87 ? 488 LYS B CA  1 
ATOM 4421 C C   . LYS B 1 218 ? 27.734  50.462  -15.551 1.00 186.28 ? 488 LYS B C   1 
ATOM 4422 O O   . LYS B 1 218 ? 28.651  49.959  -16.199 1.00 193.69 ? 488 LYS B O   1 
ATOM 4423 C CB  . LYS B 1 218 ? 26.890  52.646  -16.452 1.00 194.17 ? 488 LYS B CB  1 
ATOM 4424 N N   . GLU B 1 219 ? 27.698  50.426  -14.224 1.00 174.24 ? 489 GLU B N   1 
ATOM 4425 C CA  . GLU B 1 219 ? 28.698  49.667  -13.487 1.00 166.97 ? 489 GLU B CA  1 
ATOM 4426 C C   . GLU B 1 219 ? 28.426  48.178  -13.724 1.00 160.26 ? 489 GLU B C   1 
ATOM 4427 O O   . GLU B 1 219 ? 29.336  47.421  -14.061 1.00 151.56 ? 489 GLU B O   1 
ATOM 4428 C CB  . GLU B 1 219 ? 28.662  50.000  -11.995 1.00 174.29 ? 489 GLU B CB  1 
ATOM 4429 N N   . ALA B 1 220 ? 27.173  47.770  -13.523 1.00 168.79 ? 490 ALA B N   1 
ATOM 4430 C CA  . ALA B 1 220 ? 26.752  46.373  -13.665 1.00 174.46 ? 490 ALA B CA  1 
ATOM 4431 C C   . ALA B 1 220 ? 27.137  45.769  -15.012 1.00 170.70 ? 490 ALA B C   1 
ATOM 4432 O O   . ALA B 1 220 ? 27.558  44.614  -15.092 1.00 170.55 ? 490 ALA B O   1 
ATOM 4433 C CB  . ALA B 1 220 ? 25.247  46.256  -13.467 1.00 182.63 ? 490 ALA B CB  1 
ATOM 4434 N N   . ILE B 1 221 ? 26.986  46.560  -16.068 1.00 165.39 ? 491 ILE B N   1 
ATOM 4435 C CA  . ILE B 1 221 ? 27.389  46.137  -17.401 1.00 160.45 ? 491 ILE B CA  1 
ATOM 4436 C C   . ILE B 1 221 ? 28.901  45.982  -17.480 1.00 160.18 ? 491 ILE B C   1 
ATOM 4437 O O   . ILE B 1 221 ? 29.405  44.976  -17.969 1.00 160.49 ? 491 ILE B O   1 
ATOM 4438 C CB  . ILE B 1 221 ? 26.920  47.136  -18.476 1.00 159.93 ? 491 ILE B CB  1 
ATOM 4439 N N   . ASN B 1 222 ? 29.611  46.991  -16.990 1.00 158.63 ? 492 ASN B N   1 
ATOM 4440 C CA  . ASN B 1 222 ? 31.068  47.019  -17.019 1.00 166.63 ? 492 ASN B CA  1 
ATOM 4441 C C   . ASN B 1 222 ? 31.702  45.847  -16.274 1.00 161.26 ? 492 ASN B C   1 
ATOM 4442 O O   . ASN B 1 222 ? 32.636  45.211  -16.766 1.00 161.23 ? 492 ASN B O   1 
ATOM 4443 C CB  . ASN B 1 222 ? 31.581  48.332  -16.429 1.00 177.69 ? 492 ASN B CB  1 
ATOM 4444 C CG  . ASN B 1 222 ? 31.443  49.495  -17.390 1.00 182.91 ? 492 ASN B CG  1 
ATOM 4445 O OD1 . ASN B 1 222 ? 31.170  49.308  -18.575 1.00 184.53 ? 492 ASN B OD1 1 
ATOM 4446 N ND2 . ASN B 1 222 ? 31.649  50.706  -16.885 1.00 186.08 ? 492 ASN B ND2 1 
ATOM 4447 N N   . ILE B 1 223 ? 31.178  45.561  -15.086 1.00 158.10 ? 493 ILE B N   1 
ATOM 4448 C CA  . ILE B 1 223 ? 31.818  44.621  -14.176 1.00 165.39 ? 493 ILE B CA  1 
ATOM 4449 C C   . ILE B 1 223 ? 31.555  43.166  -14.546 1.00 157.53 ? 493 ILE B C   1 
ATOM 4450 O O   . ILE B 1 223 ? 32.366  42.295  -14.233 1.00 153.54 ? 493 ILE B O   1 
ATOM 4451 C CB  . ILE B 1 223 ? 31.356  44.851  -12.723 1.00 148.83 ? 493 ILE B CB  1 
ATOM 4452 N N   . LEU B 1 224 ? 30.435  42.888  -15.205 1.00 158.72 ? 494 LEU B N   1 
ATOM 4453 C CA  . LEU B 1 224 ? 30.184  41.519  -15.640 1.00 156.39 ? 494 LEU B CA  1 
ATOM 4454 C C   . LEU B 1 224 ? 30.423  41.326  -17.135 1.00 167.24 ? 494 LEU B C   1 
ATOM 4455 O O   . LEU B 1 224 ? 30.259  40.221  -17.653 1.00 179.86 ? 494 LEU B O   1 
ATOM 4456 C CB  . LEU B 1 224 ? 28.755  41.102  -15.288 1.00 147.34 ? 494 LEU B CB  1 
ATOM 4457 N N   . SER B 1 225 ? 30.799  42.394  -17.832 1.00 166.19 ? 495 SER B N   1 
ATOM 4458 C CA  . SER B 1 225 ? 31.388  42.243  -19.157 1.00 169.62 ? 495 SER B CA  1 
ATOM 4459 C C   . SER B 1 225 ? 32.906  42.131  -19.066 1.00 170.89 ? 495 SER B C   1 
ATOM 4460 O O   . SER B 1 225 ? 33.594  42.066  -20.085 1.00 173.07 ? 495 SER B O   1 
ATOM 4461 C CB  . SER B 1 225 ? 30.992  43.413  -20.058 1.00 173.50 ? 495 SER B CB  1 
ATOM 4462 O OG  . SER B 1 225 ? 31.745  44.571  -19.743 1.00 185.76 ? 495 SER B OG  1 
ATOM 4463 N N   . HIS B 1 226 ? 33.423  42.110  -17.841 1.00 175.89 ? 496 HIS B N   1 
ATOM 4464 C CA  . HIS B 1 226 ? 34.811  41.734  -17.590 1.00 177.68 ? 496 HIS B CA  1 
ATOM 4465 C C   . HIS B 1 226 ? 34.944  40.235  -17.361 1.00 174.73 ? 496 HIS B C   1 
ATOM 4466 O O   . HIS B 1 226 ? 36.035  39.724  -17.105 1.00 178.60 ? 496 HIS B O   1 
ATOM 4467 C CB  . HIS B 1 226 ? 35.359  42.499  -16.384 1.00 175.88 ? 496 HIS B CB  1 
ATOM 4468 N N   . LEU B 1 227 ? 33.821  39.536  -17.478 1.00 164.09 ? 497 LEU B N   1 
ATOM 4469 C CA  . LEU B 1 227 ? 33.758  38.103  -17.219 1.00 152.33 ? 497 LEU B CA  1 
ATOM 4470 C C   . LEU B 1 227 ? 34.303  37.345  -18.415 1.00 160.15 ? 497 LEU B C   1 
ATOM 4471 O O   . LEU B 1 227 ? 34.289  37.868  -19.530 1.00 162.48 ? 497 LEU B O   1 
ATOM 4472 C CB  . LEU B 1 227 ? 32.325  37.667  -16.919 1.00 143.77 ? 497 LEU B CB  1 
ATOM 4473 N N   . PRO B 1 228 ? 34.823  36.129  -18.179 1.00 167.93 ? 498 PRO B N   1 
ATOM 4474 C CA  . PRO B 1 228 ? 35.331  35.429  -19.364 1.00 173.82 ? 498 PRO B CA  1 
ATOM 4475 C C   . PRO B 1 228 ? 34.242  35.208  -20.406 1.00 188.57 ? 498 PRO B C   1 
ATOM 4476 O O   . PRO B 1 228 ? 33.086  34.932  -20.060 1.00 184.70 ? 498 PRO B O   1 
ATOM 4477 C CB  . PRO B 1 228 ? 35.825  34.096  -18.802 1.00 163.11 ? 498 PRO B CB  1 
ATOM 4478 N N   . SER B 1 229 ? 34.623  35.341  -21.668 1.00 195.87 ? 499 SER B N   1 
ATOM 4479 C CA  . SER B 1 229 ? 33.668  35.427  -22.764 1.00 193.17 ? 499 SER B CA  1 
ATOM 4480 C C   . SER B 1 229 ? 32.742  34.200  -22.929 1.00 197.33 ? 499 SER B C   1 
ATOM 4481 O O   . SER B 1 229 ? 31.675  34.346  -23.501 1.00 196.68 ? 499 SER B O   1 
ATOM 4482 C CB  . SER B 1 229 ? 34.395  35.702  -24.078 1.00 187.56 ? 499 SER B CB  1 
ATOM 4483 O OG  . SER B 1 229 ? 35.499  34.842  -24.225 1.00 188.27 ? 499 SER B OG  1 
ATOM 4484 N N   . HIS B 1 230 ? 33.138  33.010  -22.436 1.00 196.86 ? 500 HIS B N   1 
ATOM 4485 C CA  . HIS B 1 230 ? 32.280  31.810  -22.493 1.00 197.40 ? 500 HIS B CA  1 
ATOM 4486 C C   . HIS B 1 230 ? 31.284  31.707  -21.332 1.00 192.27 ? 500 HIS B C   1 
ATOM 4487 O O   . HIS B 1 230 ? 30.558  30.744  -21.243 1.00 204.79 ? 500 HIS B O   1 
ATOM 4488 C CB  . HIS B 1 230 ? 33.067  30.488  -22.399 1.00 202.82 ? 500 HIS B CB  1 
ATOM 4489 C CG  . HIS B 1 230 ? 34.241  30.377  -23.297 1.00 224.83 ? 500 HIS B CG  1 
ATOM 4490 N ND1 . HIS B 1 230 ? 34.138  30.041  -24.629 1.00 241.06 ? 500 HIS B ND1 1 
ATOM 4491 C CD2 . HIS B 1 230 ? 35.562  30.528  -23.034 1.00 229.40 ? 500 HIS B CD2 1 
ATOM 4492 C CE1 . HIS B 1 230 ? 35.354  29.999  -25.146 1.00 243.27 ? 500 HIS B CE1 1 
ATOM 4493 N NE2 . HIS B 1 230 ? 36.234  30.297  -24.203 1.00 237.79 ? 500 HIS B NE2 1 
ATOM 4494 N N   . HIS B 1 231 ? 31.411  32.640  -20.389 1.00 179.52 ? 501 HIS B N   1 
ATOM 4495 C CA  . HIS B 1 231 ? 30.378  32.836  -19.385 1.00 164.83 ? 501 HIS B CA  1 
ATOM 4496 C C   . HIS B 1 231 ? 29.685  34.168  -19.629 1.00 160.00 ? 501 HIS B C   1 
ATOM 4497 O O   . HIS B 1 231 ? 28.656  34.477  -19.041 1.00 158.20 ? 501 HIS B O   1 
ATOM 4498 C CB  . HIS B 1 231 ? 31.012  32.798  -17.985 1.00 168.74 ? 501 HIS B CB  1 
ATOM 4499 C CG  . HIS B 1 231 ? 31.544  31.444  -17.618 1.00 169.58 ? 501 HIS B CG  1 
ATOM 4500 N ND1 . HIS B 1 231 ? 32.884  31.128  -17.748 1.00 172.31 ? 501 HIS B ND1 1 
ATOM 4501 C CD2 . HIS B 1 231 ? 30.938  30.335  -17.134 1.00 166.32 ? 501 HIS B CD2 1 
ATOM 4502 C CE1 . HIS B 1 231 ? 33.077  29.882  -17.358 1.00 170.86 ? 501 HIS B CE1 1 
ATOM 4503 N NE2 . HIS B 1 231 ? 31.914  29.379  -16.981 1.00 167.66 ? 501 HIS B NE2 1 
ATOM 4504 N N   . TYR B 1 232 ? 30.308  34.960  -20.480 1.00 166.35 ? 502 TYR B N   1 
ATOM 4505 C CA  . TYR B 1 232 ? 29.693  36.184  -20.947 1.00 168.23 ? 502 TYR B CA  1 
ATOM 4506 C C   . TYR B 1 232 ? 28.566  35.786  -21.895 1.00 172.19 ? 502 TYR B C   1 
ATOM 4507 O O   . TYR B 1 232 ? 27.462  36.323  -21.831 1.00 178.66 ? 502 TYR B O   1 
ATOM 4508 C CB  . TYR B 1 232 ? 30.713  37.078  -21.643 1.00 172.57 ? 502 TYR B CB  1 
ATOM 4509 C CG  . TYR B 1 232 ? 30.136  38.385  -22.113 1.00 174.93 ? 502 TYR B CG  1 
ATOM 4510 C CD1 . TYR B 1 232 ? 29.717  38.536  -23.427 1.00 178.10 ? 502 TYR B CD1 1 
ATOM 4511 C CD2 . TYR B 1 232 ? 29.999  39.464  -21.251 1.00 175.10 ? 502 TYR B CD2 1 
ATOM 4512 C CE1 . TYR B 1 232 ? 29.182  39.719  -23.870 1.00 180.73 ? 502 TYR B CE1 1 
ATOM 4513 C CE2 . TYR B 1 232 ? 29.464  40.654  -21.688 1.00 177.84 ? 502 TYR B CE2 1 
ATOM 4514 C CZ  . TYR B 1 232 ? 29.057  40.775  -22.999 1.00 179.52 ? 502 TYR B CZ  1 
ATOM 4515 O OH  . TYR B 1 232 ? 28.521  41.959  -23.444 1.00 181.87 ? 502 TYR B OH  1 
ATOM 4516 N N   . ASN B 1 233 ? 28.855  34.821  -22.761 1.00 171.95 ? 503 ASN B N   1 
ATOM 4517 C CA  . ASN B 1 233 ? 27.914  34.374  -23.785 1.00 173.86 ? 503 ASN B CA  1 
ATOM 4518 C C   . ASN B 1 233 ? 26.879  33.346  -23.325 1.00 177.60 ? 503 ASN B C   1 
ATOM 4519 O O   . ASN B 1 233 ? 26.159  32.784  -24.149 1.00 180.60 ? 503 ASN B O   1 
ATOM 4520 C CB  . ASN B 1 233 ? 28.681  33.810  -24.981 1.00 178.69 ? 503 ASN B CB  1 
ATOM 4521 N N   . THR B 1 234 ? 26.820  33.068  -22.028 1.00 178.69 ? 504 THR B N   1 
ATOM 4522 C CA  . THR B 1 234 ? 25.638  32.427  -21.458 1.00 171.45 ? 504 THR B CA  1 
ATOM 4523 C C   . THR B 1 234 ? 24.431  33.360  -21.484 1.00 168.70 ? 504 THR B C   1 
ATOM 4524 O O   . THR B 1 234 ? 24.577  34.583  -21.533 1.00 166.01 ? 504 THR B O   1 
ATOM 4525 C CB  . THR B 1 234 ? 25.867  31.965  -20.016 1.00 167.50 ? 504 THR B CB  1 
ATOM 4526 O OG1 . THR B 1 234 ? 24.793  31.109  -19.608 1.00 176.00 ? 504 THR B OG1 1 
ATOM 4527 C CG2 . THR B 1 234 ? 25.923  33.155  -19.092 1.00 160.46 ? 504 THR B CG2 1 
ATOM 4528 N N   . GLY B 1 235 ? 23.239  32.772  -21.467 1.00 167.67 ? 505 GLY B N   1 
ATOM 4529 C CA  . GLY B 1 235 ? 22.001  33.520  -21.581 1.00 167.83 ? 505 GLY B CA  1 
ATOM 4530 C C   . GLY B 1 235 ? 21.746  34.423  -20.389 1.00 167.03 ? 505 GLY B C   1 
ATOM 4531 O O   . GLY B 1 235 ? 21.325  35.569  -20.550 1.00 171.43 ? 505 GLY B O   1 
ATOM 4532 N N   . TRP B 1 236 ? 21.987  33.896  -19.191 1.00 162.90 ? 506 TRP B N   1 
ATOM 4533 C CA  . TRP B 1 236 ? 21.745  34.629  -17.949 1.00 161.64 ? 506 TRP B CA  1 
ATOM 4534 C C   . TRP B 1 236 ? 22.507  35.952  -17.886 1.00 157.88 ? 506 TRP B C   1 
ATOM 4535 O O   . TRP B 1 236 ? 21.925  36.993  -17.591 1.00 159.04 ? 506 TRP B O   1 
ATOM 4536 C CB  . TRP B 1 236 ? 22.117  33.763  -16.743 1.00 164.56 ? 506 TRP B CB  1 
ATOM 4537 C CG  . TRP B 1 236 ? 21.840  34.423  -15.426 1.00 165.50 ? 506 TRP B CG  1 
ATOM 4538 C CD1 . TRP B 1 236 ? 20.688  34.351  -14.699 1.00 173.17 ? 506 TRP B CD1 1 
ATOM 4539 C CD2 . TRP B 1 236 ? 22.732  35.263  -14.682 1.00 160.14 ? 506 TRP B CD2 1 
ATOM 4540 N NE1 . TRP B 1 236 ? 20.808  35.090  -13.547 1.00 180.12 ? 506 TRP B NE1 1 
ATOM 4541 C CE2 . TRP B 1 236 ? 22.053  35.660  -13.513 1.00 168.24 ? 506 TRP B CE2 1 
ATOM 4542 C CE3 . TRP B 1 236 ? 24.038  35.716  -14.889 1.00 152.49 ? 506 TRP B CE3 1 
ATOM 4543 C CZ2 . TRP B 1 236 ? 22.636  36.489  -12.556 1.00 160.79 ? 506 TRP B CZ2 1 
ATOM 4544 C CZ3 . TRP B 1 236 ? 24.613  36.539  -13.939 1.00 155.49 ? 506 TRP B CZ3 1 
ATOM 4545 C CH2 . TRP B 1 236 ? 23.914  36.916  -12.787 1.00 158.30 ? 506 TRP B CH2 1 
ATOM 4546 N N   . VAL B 1 237 ? 23.804  35.904  -18.172 1.00 147.37 ? 507 VAL B N   1 
ATOM 4547 C CA  . VAL B 1 237 ? 24.642  37.102  -18.176 1.00 143.56 ? 507 VAL B CA  1 
ATOM 4548 C C   . VAL B 1 237 ? 24.154  38.132  -19.186 1.00 149.00 ? 507 VAL B C   1 
ATOM 4549 O O   . VAL B 1 237 ? 23.951  39.295  -18.835 1.00 151.02 ? 507 VAL B O   1 
ATOM 4550 C CB  . VAL B 1 237 ? 26.118  36.766  -18.448 1.00 144.35 ? 507 VAL B CB  1 
ATOM 4551 C CG1 . VAL B 1 237 ? 26.907  38.023  -18.776 1.00 147.39 ? 507 VAL B CG1 1 
ATOM 4552 C CG2 . VAL B 1 237 ? 26.712  36.052  -17.246 1.00 145.14 ? 507 VAL B CG2 1 
ATOM 4553 N N   . LEU B 1 238 ? 23.986  37.712  -20.437 1.00 156.34 ? 508 LEU B N   1 
ATOM 4554 C CA  . LEU B 1 238 ? 23.461  38.601  -21.468 1.00 160.94 ? 508 LEU B CA  1 
ATOM 4555 C C   . LEU B 1 238 ? 22.139  39.216  -21.011 1.00 160.67 ? 508 LEU B C   1 
ATOM 4556 O O   . LEU B 1 238 ? 21.885  40.396  -21.249 1.00 165.03 ? 508 LEU B O   1 
ATOM 4557 C CB  . LEU B 1 238 ? 23.272  37.847  -22.786 1.00 155.37 ? 508 LEU B CB  1 
ATOM 4558 N N   . CYS B 1 239 ? 21.295  38.404  -20.380 1.00 162.33 ? 509 CYS B N   1 
ATOM 4559 C CA  . CYS B 1 239 ? 19.989  38.858  -19.916 1.00 162.28 ? 509 CYS B CA  1 
ATOM 4560 C C   . CYS B 1 239 ? 20.113  40.019  -18.931 1.00 165.03 ? 509 CYS B C   1 
ATOM 4561 O O   . CYS B 1 239 ? 19.389  41.010  -19.030 1.00 177.68 ? 509 CYS B O   1 
ATOM 4562 C CB  . CYS B 1 239 ? 19.218  37.709  -19.265 1.00 156.44 ? 509 CYS B CB  1 
ATOM 4563 S SG  . CYS B 1 239 ? 17.423  37.910  -19.291 1.00 213.13 ? 509 CYS B SG  1 
ATOM 4564 N N   . GLN B 1 240 ? 21.040  39.886  -17.983 1.00 160.89 ? 510 GLN B N   1 
ATOM 4565 C CA  . GLN B 1 240 ? 21.292  40.934  -16.997 1.00 157.47 ? 510 GLN B CA  1 
ATOM 4566 C C   . GLN B 1 240 ? 21.770  42.208  -17.676 1.00 160.79 ? 510 GLN B C   1 
ATOM 4567 O O   . GLN B 1 240 ? 21.393  43.315  -17.292 1.00 173.07 ? 510 GLN B O   1 
ATOM 4568 C CB  . GLN B 1 240 ? 22.338  40.479  -15.976 1.00 147.98 ? 510 GLN B CB  1 
ATOM 4569 C CG  . GLN B 1 240 ? 22.061  39.140  -15.306 1.00 142.62 ? 510 GLN B CG  1 
ATOM 4570 C CD  . GLN B 1 240 ? 20.605  38.936  -14.942 1.00 151.07 ? 510 GLN B CD  1 
ATOM 4571 O OE1 . GLN B 1 240 ? 19.976  39.800  -14.331 1.00 155.39 ? 510 GLN B OE1 1 
ATOM 4572 N NE2 . GLN B 1 240 ? 20.063  37.780  -15.309 1.00 158.62 ? 510 GLN B NE2 1 
ATOM 4573 N N   . ILE B 1 241 ? 22.613  42.031  -18.686 1.00 150.47 ? 511 ILE B N   1 
ATOM 4574 C CA  . ILE B 1 241 ? 23.111  43.137  -19.489 1.00 154.64 ? 511 ILE B CA  1 
ATOM 4575 C C   . ILE B 1 241 ? 21.939  43.777  -20.223 1.00 162.91 ? 511 ILE B C   1 
ATOM 4576 O O   . ILE B 1 241 ? 21.769  44.997  -20.205 1.00 163.51 ? 511 ILE B O   1 
ATOM 4577 C CB  . ILE B 1 241 ? 24.188  42.670  -20.478 1.00 155.66 ? 511 ILE B CB  1 
ATOM 4578 C CG1 . ILE B 1 241 ? 25.486  42.360  -19.731 1.00 151.68 ? 511 ILE B CG1 1 
ATOM 4579 C CG2 . ILE B 1 241 ? 24.418  43.713  -21.555 1.00 172.62 ? 511 ILE B CG2 1 
ATOM 4580 C CD1 . ILE B 1 241 ? 26.300  41.263  -20.363 1.00 151.22 ? 511 ILE B CD1 1 
ATOM 4581 N N   . GLY B 1 242 ? 21.148  42.936  -20.885 1.00 177.03 ? 512 GLY B N   1 
ATOM 4582 C CA  . GLY B 1 242 ? 19.938  43.366  -21.562 1.00 183.57 ? 512 GLY B CA  1 
ATOM 4583 C C   . GLY B 1 242 ? 19.019  44.081  -20.591 1.00 183.36 ? 512 GLY B C   1 
ATOM 4584 O O   . GLY B 1 242 ? 18.425  45.109  -20.917 1.00 188.81 ? 512 GLY B O   1 
ATOM 4585 N N   . ARG B 1 243 ? 18.900  43.513  -19.394 1.00 173.26 ? 513 ARG B N   1 
ATOM 4586 C CA  . ARG B 1 243 ? 18.132  44.112  -18.308 1.00 169.70 ? 513 ARG B CA  1 
ATOM 4587 C C   . ARG B 1 243 ? 18.641  45.514  -18.003 1.00 173.85 ? 513 ARG B C   1 
ATOM 4588 O O   . ARG B 1 243 ? 17.864  46.462  -17.885 1.00 180.83 ? 513 ARG B O   1 
ATOM 4589 C CB  . ARG B 1 243 ? 18.201  43.240  -17.052 1.00 163.51 ? 513 ARG B CB  1 
ATOM 4590 N N   . ALA B 1 244 ? 19.958  45.628  -17.887 1.00 175.20 ? 514 ALA B N   1 
ATOM 4591 C CA  . ALA B 1 244 ? 20.626  46.889  -17.595 1.00 180.06 ? 514 ALA B CA  1 
ATOM 4592 C C   . ALA B 1 244 ? 20.373  47.962  -18.655 1.00 181.14 ? 514 ALA B C   1 
ATOM 4593 O O   . ALA B 1 244 ? 19.964  49.074  -18.326 1.00 184.50 ? 514 ALA B O   1 
ATOM 4594 C CB  . ALA B 1 244 ? 22.123  46.659  -17.434 1.00 185.98 ? 514 ALA B CB  1 
ATOM 4595 N N   . TYR B 1 245 ? 20.621  47.631  -19.919 1.00 184.42 ? 515 TYR B N   1 
ATOM 4596 C CA  . TYR B 1 245 ? 20.333  48.544  -21.027 1.00 190.21 ? 515 TYR B CA  1 
ATOM 4597 C C   . TYR B 1 245 ? 18.904  49.093  -21.102 1.00 193.48 ? 515 TYR B C   1 
ATOM 4598 O O   . TYR B 1 245 ? 18.684  50.142  -21.706 1.00 199.58 ? 515 TYR B O   1 
ATOM 4599 C CB  . TYR B 1 245 ? 20.667  47.863  -22.356 1.00 193.31 ? 515 TYR B CB  1 
ATOM 4600 C CG  . TYR B 1 245 ? 22.135  47.920  -22.701 1.00 193.59 ? 515 TYR B CG  1 
ATOM 4601 C CD1 . TYR B 1 245 ? 22.774  49.140  -22.874 1.00 199.30 ? 515 TYR B CD1 1 
ATOM 4602 C CD2 . TYR B 1 245 ? 22.880  46.761  -22.870 1.00 189.14 ? 515 TYR B CD2 1 
ATOM 4603 C CE1 . TYR B 1 245 ? 24.115  49.207  -23.191 1.00 201.33 ? 515 TYR B CE1 1 
ATOM 4604 C CE2 . TYR B 1 245 ? 24.224  46.818  -23.191 1.00 189.62 ? 515 TYR B CE2 1 
ATOM 4605 C CZ  . TYR B 1 245 ? 24.835  48.044  -23.349 1.00 195.84 ? 515 TYR B CZ  1 
ATOM 4606 O OH  . TYR B 1 245 ? 26.172  48.111  -23.668 1.00 198.74 ? 515 TYR B OH  1 
ATOM 4607 N N   . PHE B 1 246 ? 17.936  48.408  -20.504 1.00 190.00 ? 516 PHE B N   1 
ATOM 4608 C CA  . PHE B 1 246 ? 16.577  48.936  -20.507 1.00 193.62 ? 516 PHE B CA  1 
ATOM 4609 C C   . PHE B 1 246 ? 16.507  50.014  -19.430 1.00 201.61 ? 516 PHE B C   1 
ATOM 4610 O O   . PHE B 1 246 ? 15.803  51.014  -19.564 1.00 214.00 ? 516 PHE B O   1 
ATOM 4611 C CB  . PHE B 1 246 ? 15.551  47.831  -20.251 1.00 185.95 ? 516 PHE B CB  1 
ATOM 4612 N N   . GLU B 1 247 ? 17.253  49.772  -18.358 1.00 199.49 ? 517 GLU B N   1 
ATOM 4613 C CA  . GLU B 1 247 ? 17.353  50.656  -17.198 1.00 201.62 ? 517 GLU B CA  1 
ATOM 4614 C C   . GLU B 1 247 ? 18.170  51.922  -17.474 1.00 212.11 ? 517 GLU B C   1 
ATOM 4615 O O   . GLU B 1 247 ? 17.905  52.982  -16.907 1.00 218.98 ? 517 GLU B O   1 
ATOM 4616 C CB  . GLU B 1 247 ? 17.956  49.902  -16.011 1.00 201.93 ? 517 GLU B CB  1 
ATOM 4617 N N   . LEU B 1 248 ? 19.165  51.791  -18.348 1.00 214.11 ? 518 LEU B N   1 
ATOM 4618 C CA  . LEU B 1 248 ? 19.791  52.930  -19.027 1.00 216.65 ? 518 LEU B CA  1 
ATOM 4619 C C   . LEU B 1 248 ? 18.976  53.553  -20.149 1.00 219.97 ? 518 LEU B C   1 
ATOM 4620 O O   . LEU B 1 248 ? 19.406  54.529  -20.764 1.00 223.23 ? 518 LEU B O   1 
ATOM 4621 C CB  . LEU B 1 248 ? 21.127  52.486  -19.628 1.00 209.60 ? 518 LEU B CB  1 
ATOM 4622 C CG  . LEU B 1 248 ? 22.048  51.578  -18.820 1.00 203.22 ? 518 LEU B CG  1 
ATOM 4623 C CD1 . LEU B 1 248 ? 23.186  51.079  -19.693 1.00 205.51 ? 518 LEU B CD1 1 
ATOM 4624 C CD2 . LEU B 1 248 ? 22.593  52.350  -17.643 1.00 204.49 ? 518 LEU B CD2 1 
ATOM 4625 N N   . SER B 1 249 ? 17.802  52.990  -20.401 1.00 215.40 ? 519 SER B N   1 
ATOM 4626 C CA  . SER B 1 249 ? 16.943  53.375  -21.517 1.00 215.68 ? 519 SER B CA  1 
ATOM 4627 C C   . SER B 1 249 ? 17.659  53.296  -22.864 1.00 215.71 ? 519 SER B C   1 
ATOM 4628 O O   . SER B 1 249 ? 17.255  53.943  -23.831 1.00 218.15 ? 519 SER B O   1 
ATOM 4629 C CB  . SER B 1 249 ? 16.399  54.792  -21.305 1.00 226.69 ? 519 SER B CB  1 
ATOM 4630 N N   . GLU B 1 250 ? 18.726  52.506  -22.920 1.00 212.93 ? 520 GLU B N   1 
ATOM 4631 C CA  . GLU B 1 250 ? 19.459  52.305  -24.159 1.00 211.70 ? 520 GLU B CA  1 
ATOM 4632 C C   . GLU B 1 250 ? 18.640  51.246  -24.875 1.00 211.89 ? 520 GLU B C   1 
ATOM 4633 O O   . GLU B 1 250 ? 19.004  50.071  -24.862 1.00 213.58 ? 520 GLU B O   1 
ATOM 4634 C CB  . GLU B 1 250 ? 20.899  51.858  -23.912 1.00 203.76 ? 520 GLU B CB  1 
ATOM 4635 N N   . TYR B 1 251 ? 17.537  51.646  -25.498 1.00 208.14 ? 521 TYR B N   1 
ATOM 4636 C CA  . TYR B 1 251 ? 16.612  50.657  -26.039 1.00 201.25 ? 521 TYR B CA  1 
ATOM 4637 C C   . TYR B 1 251 ? 17.116  49.880  -27.249 1.00 206.21 ? 521 TYR B C   1 
ATOM 4638 O O   . TYR B 1 251 ? 16.815  48.693  -27.382 1.00 203.68 ? 521 TYR B O   1 
ATOM 4639 C CB  . TYR B 1 251 ? 15.291  51.342  -26.402 1.00 198.14 ? 521 TYR B CB  1 
ATOM 4640 N N   . MET B 1 252 ? 17.877  50.521  -28.128 1.00 218.82 ? 522 MET B N   1 
ATOM 4641 C CA  . MET B 1 252 ? 18.308  49.835  -29.339 1.00 226.13 ? 522 MET B CA  1 
ATOM 4642 C C   . MET B 1 252 ? 19.460  48.870  -29.069 1.00 224.13 ? 522 MET B C   1 
ATOM 4643 O O   . MET B 1 252 ? 19.582  47.832  -29.719 1.00 229.64 ? 522 MET B O   1 
ATOM 4644 C CB  . MET B 1 252 ? 18.719  50.849  -30.407 1.00 229.65 ? 522 MET B CB  1 
ATOM 4645 N N   . GLN B 1 253 ? 20.296  49.220  -28.096 1.00 211.70 ? 523 GLN B N   1 
ATOM 4646 C CA  . GLN B 1 253 ? 21.343  48.332  -27.601 1.00 205.26 ? 523 GLN B CA  1 
ATOM 4647 C C   . GLN B 1 253 ? 20.792  47.164  -26.786 1.00 203.86 ? 523 GLN B C   1 
ATOM 4648 O O   . GLN B 1 253 ? 21.368  46.076  -26.766 1.00 198.92 ? 523 GLN B O   1 
ATOM 4649 C CB  . GLN B 1 253 ? 22.356  49.118  -26.771 1.00 204.66 ? 523 GLN B CB  1 
ATOM 4650 C CG  . GLN B 1 253 ? 23.620  48.336  -26.474 1.00 202.00 ? 523 GLN B CG  1 
ATOM 4651 C CD  . GLN B 1 253 ? 24.240  47.745  -27.728 1.00 201.70 ? 523 GLN B CD  1 
ATOM 4652 O OE1 . GLN B 1 253 ? 24.325  48.406  -28.763 1.00 203.16 ? 523 GLN B OE1 1 
ATOM 4653 N NE2 . GLN B 1 253 ? 24.673  46.493  -27.641 1.00 202.21 ? 523 GLN B NE2 1 
ATOM 4654 N N   . ALA B 1 254 ? 19.677  47.408  -26.106 1.00 210.04 ? 524 ALA B N   1 
ATOM 4655 C CA  . ALA B 1 254 ? 19.003  46.383  -25.318 1.00 211.05 ? 524 ALA B CA  1 
ATOM 4656 C C   . ALA B 1 254 ? 18.534  45.243  -26.209 1.00 216.44 ? 524 ALA B C   1 
ATOM 4657 O O   . ALA B 1 254 ? 18.829  44.077  -25.946 1.00 218.94 ? 524 ALA B O   1 
ATOM 4658 C CB  . ALA B 1 254 ? 17.830  46.979  -24.554 1.00 211.35 ? 524 ALA B CB  1 
ATOM 4659 N N   . GLU B 1 255 ? 17.799  45.587  -27.260 1.00 215.81 ? 525 GLU B N   1 
ATOM 4660 C CA  . GLU B 1 255 ? 17.268  44.586  -28.174 1.00 208.38 ? 525 GLU B CA  1 
ATOM 4661 C C   . GLU B 1 255 ? 18.381  43.855  -28.919 1.00 207.91 ? 525 GLU B C   1 
ATOM 4662 O O   . GLU B 1 255 ? 18.191  42.728  -29.364 1.00 208.84 ? 525 GLU B O   1 
ATOM 4663 C CB  . GLU B 1 255 ? 16.313  45.238  -29.177 1.00 212.87 ? 525 GLU B CB  1 
ATOM 4664 N N   . ARG B 1 256 ? 19.535  44.500  -29.058 1.00 200.47 ? 526 ARG B N   1 
ATOM 4665 C CA  . ARG B 1 256 ? 20.735  43.826  -29.548 1.00 196.74 ? 526 ARG B CA  1 
ATOM 4666 C C   . ARG B 1 256 ? 21.106  42.625  -28.678 1.00 193.99 ? 526 ARG B C   1 
ATOM 4667 O O   . ARG B 1 256 ? 21.293  41.515  -29.177 1.00 196.84 ? 526 ARG B O   1 
ATOM 4668 C CB  . ARG B 1 256 ? 21.910  44.804  -29.617 1.00 194.99 ? 526 ARG B CB  1 
ATOM 4669 N N   . ILE B 1 257 ? 21.202  42.861  -27.372 1.00 186.39 ? 527 ILE B N   1 
ATOM 4670 C CA  . ILE B 1 257 ? 21.622  41.838  -26.418 1.00 180.28 ? 527 ILE B CA  1 
ATOM 4671 C C   . ILE B 1 257 ? 20.591  40.729  -26.237 1.00 176.28 ? 527 ILE B C   1 
ATOM 4672 O O   . ILE B 1 257 ? 20.942  39.549  -26.186 1.00 174.34 ? 527 ILE B O   1 
ATOM 4673 C CB  . ILE B 1 257 ? 21.921  42.455  -25.039 1.00 173.32 ? 527 ILE B CB  1 
ATOM 4674 N N   . PHE B 1 258 ? 19.321  41.109  -26.135 1.00 175.24 ? 528 PHE B N   1 
ATOM 4675 C CA  . PHE B 1 258 ? 18.245  40.131  -26.023 1.00 171.21 ? 528 PHE B CA  1 
ATOM 4676 C C   . PHE B 1 258 ? 18.194  39.231  -27.249 1.00 179.16 ? 528 PHE B C   1 
ATOM 4677 O O   . PHE B 1 258 ? 18.232  38.008  -27.117 1.00 173.21 ? 528 PHE B O   1 
ATOM 4678 C CB  . PHE B 1 258 ? 16.901  40.826  -25.822 1.00 168.84 ? 528 PHE B CB  1 
ATOM 4679 C CG  . PHE B 1 258 ? 16.706  41.379  -24.441 1.00 168.10 ? 528 PHE B CG  1 
ATOM 4680 C CD1 . PHE B 1 258 ? 16.902  40.577  -23.330 1.00 172.02 ? 528 PHE B CD1 1 
ATOM 4681 C CD2 . PHE B 1 258 ? 16.322  42.695  -24.253 1.00 172.31 ? 528 PHE B CD2 1 
ATOM 4682 C CE1 . PHE B 1 258 ? 16.723  41.077  -22.058 1.00 172.61 ? 528 PHE B CE1 1 
ATOM 4683 C CE2 . PHE B 1 258 ? 16.140  43.201  -22.983 1.00 174.94 ? 528 PHE B CE2 1 
ATOM 4684 C CZ  . PHE B 1 258 ? 16.344  42.390  -21.885 1.00 173.95 ? 528 PHE B CZ  1 
ATOM 4685 N N   . SER B 1 259 ? 18.055  39.837  -28.427 1.00 195.27 ? 529 SER B N   1 
ATOM 4686 C CA  . SER B 1 259 ? 18.091  39.109  -29.697 1.00 203.20 ? 529 SER B CA  1 
ATOM 4687 C C   . SER B 1 259 ? 19.182  38.040  -29.727 1.00 212.53 ? 529 SER B C   1 
ATOM 4688 O O   . SER B 1 259 ? 18.973  36.943  -30.245 1.00 229.15 ? 529 SER B O   1 
ATOM 4689 C CB  . SER B 1 259 ? 18.290  40.076  -30.865 1.00 203.57 ? 529 SER B CB  1 
ATOM 4690 O OG  . SER B 1 259 ? 18.317  39.387  -32.102 1.00 204.97 ? 529 SER B OG  1 
ATOM 4691 N N   . GLU B 1 260 ? 20.345  38.365  -29.168 1.00 198.73 ? 530 GLU B N   1 
ATOM 4692 C CA  . GLU B 1 260 ? 21.424  37.392  -29.054 1.00 187.41 ? 530 GLU B CA  1 
ATOM 4693 C C   . GLU B 1 260 ? 21.065  36.313  -28.040 1.00 179.33 ? 530 GLU B C   1 
ATOM 4694 O O   . GLU B 1 260 ? 21.206  35.122  -28.314 1.00 182.99 ? 530 GLU B O   1 
ATOM 4695 C CB  . GLU B 1 260 ? 22.730  38.081  -28.653 1.00 179.30 ? 530 GLU B CB  1 
ATOM 4696 N N   . VAL B 1 261 ? 20.605  36.742  -26.868 1.00 179.01 ? 531 VAL B N   1 
ATOM 4697 C CA  . VAL B 1 261 ? 20.185  35.825  -25.811 1.00 171.92 ? 531 VAL B CA  1 
ATOM 4698 C C   . VAL B 1 261 ? 19.091  34.868  -26.281 1.00 172.40 ? 531 VAL B C   1 
ATOM 4699 O O   . VAL B 1 261 ? 19.010  33.729  -25.823 1.00 177.97 ? 531 VAL B O   1 
ATOM 4700 C CB  . VAL B 1 261 ? 19.677  36.589  -24.573 1.00 172.75 ? 531 VAL B CB  1 
ATOM 4701 N N   . ARG B 1 262 ? 18.257  35.343  -27.203 1.00 170.60 ? 532 ARG B N   1 
ATOM 4702 C CA  . ARG B 1 262 ? 17.277  34.497  -27.876 1.00 170.79 ? 532 ARG B CA  1 
ATOM 4703 C C   . ARG B 1 262 ? 17.952  33.427  -28.726 1.00 179.41 ? 532 ARG B C   1 
ATOM 4704 O O   . ARG B 1 262 ? 17.553  32.261  -28.701 1.00 186.44 ? 532 ARG B O   1 
ATOM 4705 C CB  . ARG B 1 262 ? 16.346  35.348  -28.742 1.00 168.28 ? 532 ARG B CB  1 
ATOM 4706 N N   . ARG B 1 263 ? 18.965  33.833  -29.485 1.00 178.52 ? 533 ARG B N   1 
ATOM 4707 C CA  . ARG B 1 263 ? 19.678  32.920  -30.371 1.00 181.55 ? 533 ARG B CA  1 
ATOM 4708 C C   . ARG B 1 263 ? 20.401  31.857  -29.553 1.00 181.12 ? 533 ARG B C   1 
ATOM 4709 O O   . ARG B 1 263 ? 20.316  30.668  -29.839 1.00 191.42 ? 533 ARG B O   1 
ATOM 4710 C CB  . ARG B 1 263 ? 20.666  33.682  -31.255 1.00 180.25 ? 533 ARG B CB  1 
ATOM 4711 N N   . ILE B 1 264 ? 21.105  32.308  -28.522 1.00 176.50 ? 534 ILE B N   1 
ATOM 4712 C CA  . ILE B 1 264 ? 21.783  31.416  -27.590 1.00 170.89 ? 534 ILE B CA  1 
ATOM 4713 C C   . ILE B 1 264 ? 20.818  30.485  -26.872 1.00 163.38 ? 534 ILE B C   1 
ATOM 4714 O O   . ILE B 1 264 ? 21.003  29.263  -26.853 1.00 165.30 ? 534 ILE B O   1 
ATOM 4715 C CB  . ILE B 1 264 ? 22.561  32.218  -26.533 1.00 168.02 ? 534 ILE B CB  1 
ATOM 4716 C CG1 . ILE B 1 264 ? 23.518  33.206  -27.206 1.00 173.61 ? 534 ILE B CG1 1 
ATOM 4717 C CG2 . ILE B 1 264 ? 23.334  31.297  -25.609 1.00 166.86 ? 534 ILE B CG2 1 
ATOM 4718 C CD1 . ILE B 1 264 ? 24.386  32.579  -28.282 1.00 185.24 ? 534 ILE B CD1 1 
ATOM 4719 N N   . GLU B 1 265 ? 19.803  31.074  -26.251 1.00 185.79 ? 535 GLU B N   1 
ATOM 4720 C CA  . GLU B 1 265 ? 18.977  30.391  -25.249 1.00 178.56 ? 535 GLU B CA  1 
ATOM 4721 C C   . GLU B 1 265 ? 17.465  30.545  -25.536 1.00 171.74 ? 535 GLU B C   1 
ATOM 4722 O O   . GLU B 1 265 ? 16.774  31.166  -24.741 1.00 173.79 ? 535 GLU B O   1 
ATOM 4723 C CB  . GLU B 1 265 ? 19.315  30.948  -23.856 1.00 178.55 ? 535 GLU B CB  1 
ATOM 4724 C CG  . GLU B 1 265 ? 19.163  29.980  -22.689 1.00 180.91 ? 535 GLU B CG  1 
ATOM 4725 C CD  . GLU B 1 265 ? 19.892  30.474  -21.441 1.00 177.29 ? 535 GLU B CD  1 
ATOM 4726 O OE1 . GLU B 1 265 ? 19.213  30.926  -20.487 1.00 176.61 ? 535 GLU B OE1 1 
ATOM 4727 O OE2 . GLU B 1 265 ? 21.141  30.434  -21.406 1.00 174.22 ? 535 GLU B OE2 1 
ATOM 4728 N N   . ASN B 1 266 ? 16.965  30.031  -26.664 1.00 176.20 ? 536 ASN B N   1 
ATOM 4729 C CA  . ASN B 1 266 ? 15.543  30.135  -27.046 1.00 181.67 ? 536 ASN B CA  1 
ATOM 4730 C C   . ASN B 1 266 ? 14.547  29.549  -26.041 1.00 190.57 ? 536 ASN B C   1 
ATOM 4731 O O   . ASN B 1 266 ? 13.325  29.705  -26.175 1.00 197.11 ? 536 ASN B O   1 
ATOM 4732 C CB  . ASN B 1 266 ? 15.271  29.366  -28.324 1.00 179.77 ? 536 ASN B CB  1 
ATOM 4733 C CG  . ASN B 1 266 ? 15.764  27.945  -28.236 1.00 180.62 ? 536 ASN B CG  1 
ATOM 4734 O OD1 . ASN B 1 266 ? 16.409  27.562  -27.268 1.00 188.70 ? 536 ASN B OD1 1 
ATOM 4735 N ND2 . ASN B 1 266 ? 15.378  27.124  -29.210 1.00 179.83 ? 536 ASN B ND2 1 
ATOM 4736 N N   . TYR B 1 267 ? 15.072  28.767  -25.108 1.00 191.04 ? 537 TYR B N   1 
ATOM 4737 C CA  . TYR B 1 267 ? 14.263  28.231  -24.037 1.00 193.93 ? 537 TYR B CA  1 
ATOM 4738 C C   . TYR B 1 267 ? 14.150  29.116  -22.816 1.00 193.28 ? 537 TYR B C   1 
ATOM 4739 O O   . TYR B 1 267 ? 13.369  28.834  -21.907 1.00 202.97 ? 537 TYR B O   1 
ATOM 4740 C CB  . TYR B 1 267 ? 14.801  26.854  -23.686 1.00 195.62 ? 537 TYR B CB  1 
ATOM 4741 C CG  . TYR B 1 267 ? 16.260  26.795  -23.287 1.00 191.50 ? 537 TYR B CG  1 
ATOM 4742 C CD1 . TYR B 1 267 ? 17.242  26.436  -24.205 1.00 187.66 ? 537 TYR B CD1 1 
ATOM 4743 C CD2 . TYR B 1 267 ? 16.645  27.047  -21.982 1.00 196.90 ? 537 TYR B CD2 1 
ATOM 4744 C CE1 . TYR B 1 267 ? 18.569  26.353  -23.835 1.00 186.70 ? 537 TYR B CE1 1 
ATOM 4745 C CE2 . TYR B 1 267 ? 17.963  26.966  -21.602 1.00 203.29 ? 537 TYR B CE2 1 
ATOM 4746 C CZ  . TYR B 1 267 ? 18.920  26.621  -22.522 1.00 197.36 ? 537 TYR B CZ  1 
ATOM 4747 O OH  . TYR B 1 267 ? 20.235  26.545  -22.132 1.00 205.54 ? 537 TYR B OH  1 
ATOM 4748 N N   . ARG B 1 268 ? 14.931  30.183  -22.790 1.00 183.80 ? 538 ARG B N   1 
ATOM 4749 C CA  . ARG B 1 268 ? 14.883  31.107  -21.671 1.00 179.03 ? 538 ARG B CA  1 
ATOM 4750 C C   . ARG B 1 268 ? 13.637  31.955  -21.819 1.00 178.15 ? 538 ARG B C   1 
ATOM 4751 O O   . ARG B 1 268 ? 13.406  32.532  -22.881 1.00 176.31 ? 538 ARG B O   1 
ATOM 4752 C CB  . ARG B 1 268 ? 16.123  31.984  -21.605 1.00 175.48 ? 538 ARG B CB  1 
ATOM 4753 C CG  . ARG B 1 268 ? 16.171  32.784  -20.336 1.00 176.18 ? 538 ARG B CG  1 
ATOM 4754 C CD  . ARG B 1 268 ? 17.351  33.713  -20.327 1.00 171.57 ? 538 ARG B CD  1 
ATOM 4755 N NE  . ARG B 1 268 ? 17.480  34.359  -19.029 1.00 181.57 ? 538 ARG B NE  1 
ATOM 4756 C CZ  . ARG B 1 268 ? 17.993  33.785  -17.949 1.00 197.98 ? 538 ARG B CZ  1 
ATOM 4757 N NH1 . ARG B 1 268 ? 18.429  32.535  -17.995 1.00 203.75 ? 538 ARG B NH1 1 
ATOM 4758 N NH2 . ARG B 1 268 ? 18.046  34.461  -16.810 1.00 200.10 ? 538 ARG B NH2 1 
ATOM 4759 N N   . VAL B 1 269 ? 12.828  32.017  -20.770 1.00 177.84 ? 539 VAL B N   1 
ATOM 4760 C CA  . VAL B 1 269 ? 11.746  32.990  -20.707 1.00 176.64 ? 539 VAL B CA  1 
ATOM 4761 C C   . VAL B 1 269 ? 12.097  34.047  -19.662 1.00 177.18 ? 539 VAL B C   1 
ATOM 4762 O O   . VAL B 1 269 ? 11.728  35.214  -19.807 1.00 175.24 ? 539 VAL B O   1 
ATOM 4763 C CB  . VAL B 1 269 ? 10.371  32.328  -20.383 1.00 201.99 ? 539 VAL B CB  1 
ATOM 4764 C CG1 . VAL B 1 269 ? 10.004  31.290  -21.441 1.00 202.36 ? 539 VAL B CG1 1 
ATOM 4765 C CG2 . VAL B 1 269 ? 10.359  31.706  -18.989 1.00 199.87 ? 539 VAL B CG2 1 
ATOM 4766 N N   . GLU B 1 270 ? 12.778  33.620  -18.599 1.00 182.29 ? 540 GLU B N   1 
ATOM 4767 C CA  . GLU B 1 270 ? 13.291  34.513  -17.564 1.00 181.46 ? 540 GLU B CA  1 
ATOM 4768 C C   . GLU B 1 270 ? 13.986  35.743  -18.142 1.00 178.62 ? 540 GLU B C   1 
ATOM 4769 O O   . GLU B 1 270 ? 15.000  35.627  -18.830 1.00 178.48 ? 540 GLU B O   1 
ATOM 4770 C CB  . GLU B 1 270 ? 14.257  33.762  -16.644 1.00 179.31 ? 540 GLU B CB  1 
ATOM 4771 N N   . GLY B 1 271 ? 13.438  36.917  -17.860 1.00 175.67 ? 541 GLY B N   1 
ATOM 4772 C CA  . GLY B 1 271 ? 14.057  38.166  -18.257 1.00 177.04 ? 541 GLY B CA  1 
ATOM 4773 C C   . GLY B 1 271 ? 13.687  38.618  -19.655 1.00 173.13 ? 541 GLY B C   1 
ATOM 4774 O O   . GLY B 1 271 ? 14.324  39.515  -20.211 1.00 174.22 ? 541 GLY B O   1 
ATOM 4775 N N   . MET B 1 272 ? 12.653  38.010  -20.227 1.00 166.11 ? 542 MET B N   1 
ATOM 4776 C CA  . MET B 1 272 ? 12.272  38.351  -21.588 1.00 162.62 ? 542 MET B CA  1 
ATOM 4777 C C   . MET B 1 272 ? 10.941  39.088  -21.595 1.00 165.18 ? 542 MET B C   1 
ATOM 4778 O O   . MET B 1 272 ? 10.502  39.569  -22.637 1.00 162.34 ? 542 MET B O   1 
ATOM 4779 C CB  . MET B 1 272 ? 12.178  37.089  -22.454 1.00 162.64 ? 542 MET B CB  1 
ATOM 4780 N N   . GLU B 1 273 ? 10.298  39.172  -20.432 1.00 178.26 ? 543 GLU B N   1 
ATOM 4781 C CA  . GLU B 1 273 ? 9.222   40.135  -20.219 1.00 177.78 ? 543 GLU B CA  1 
ATOM 4782 C C   . GLU B 1 273 ? 9.649   41.565  -20.554 1.00 179.35 ? 543 GLU B C   1 
ATOM 4783 O O   . GLU B 1 273 ? 8.876   42.340  -21.114 1.00 190.06 ? 543 GLU B O   1 
ATOM 4784 C CB  . GLU B 1 273 ? 8.691   40.055  -18.778 1.00 179.98 ? 543 GLU B CB  1 
ATOM 4785 C CG  . GLU B 1 273 ? 9.681   40.451  -17.694 1.00 184.52 ? 543 GLU B CG  1 
ATOM 4786 C CD  . GLU B 1 273 ? 10.570  39.305  -17.264 1.00 187.55 ? 543 GLU B CD  1 
ATOM 4787 O OE1 . GLU B 1 273 ? 11.022  38.544  -18.142 1.00 188.71 ? 543 GLU B OE1 1 
ATOM 4788 O OE2 . GLU B 1 273 ? 10.832  39.172  -16.049 1.00 187.15 ? 543 GLU B OE2 1 
ATOM 4789 N N   . ILE B 1 274 ? 10.888  41.905  -20.206 1.00 171.60 ? 544 ILE B N   1 
ATOM 4790 C CA  . ILE B 1 274 ? 11.387  43.267  -20.361 1.00 166.21 ? 544 ILE B CA  1 
ATOM 4791 C C   . ILE B 1 274 ? 11.965  43.462  -21.763 1.00 166.53 ? 544 ILE B C   1 
ATOM 4792 O O   . ILE B 1 274 ? 12.113  44.589  -22.234 1.00 169.32 ? 544 ILE B O   1 
ATOM 4793 C CB  . ILE B 1 274 ? 12.427  43.634  -19.276 1.00 166.46 ? 544 ILE B CB  1 
ATOM 4794 C CG1 . ILE B 1 274 ? 13.838  43.237  -19.694 1.00 163.73 ? 544 ILE B CG1 1 
ATOM 4795 C CG2 . ILE B 1 274 ? 12.048  43.026  -17.930 1.00 169.03 ? 544 ILE B CG2 1 
ATOM 4796 C CD1 . ILE B 1 274 ? 14.829  44.348  -19.489 1.00 165.65 ? 544 ILE B CD1 1 
ATOM 4797 N N   . TYR B 1 275 ? 12.297  42.353  -22.417 1.00 169.22 ? 545 TYR B N   1 
ATOM 4798 C CA  . TYR B 1 275 ? 12.599  42.365  -23.845 1.00 175.32 ? 545 TYR B CA  1 
ATOM 4799 C C   . TYR B 1 275 ? 11.352  42.788  -24.607 1.00 175.73 ? 545 TYR B C   1 
ATOM 4800 O O   . TYR B 1 275 ? 11.424  43.556  -25.566 1.00 176.78 ? 545 TYR B O   1 
ATOM 4801 C CB  . TYR B 1 275 ? 13.072  40.984  -24.308 1.00 178.46 ? 545 TYR B CB  1 
ATOM 4802 C CG  . TYR B 1 275 ? 13.455  40.892  -25.772 1.00 173.57 ? 545 TYR B CG  1 
ATOM 4803 C CD1 . TYR B 1 275 ? 13.815  42.021  -26.500 1.00 176.95 ? 545 TYR B CD1 1 
ATOM 4804 C CD2 . TYR B 1 275 ? 13.434  39.671  -26.431 1.00 178.39 ? 545 TYR B CD2 1 
ATOM 4805 C CE1 . TYR B 1 275 ? 14.151  41.931  -27.838 1.00 184.89 ? 545 TYR B CE1 1 
ATOM 4806 C CE2 . TYR B 1 275 ? 13.770  39.571  -27.766 1.00 184.38 ? 545 TYR B CE2 1 
ATOM 4807 C CZ  . TYR B 1 275 ? 14.127  40.703  -28.465 1.00 193.30 ? 545 TYR B CZ  1 
ATOM 4808 O OH  . TYR B 1 275 ? 14.465  40.603  -29.795 1.00 209.04 ? 545 TYR B OH  1 
ATOM 4809 N N   . SER B 1 276 ? 10.208  42.281  -24.167 1.00 181.58 ? 546 SER B N   1 
ATOM 4810 C CA  . SER B 1 276 ? 8.928   42.633  -24.760 1.00 189.61 ? 546 SER B CA  1 
ATOM 4811 C C   . SER B 1 276 ? 8.687   44.130  -24.586 1.00 186.86 ? 546 SER B C   1 
ATOM 4812 O O   . SER B 1 276 ? 8.243   44.812  -25.509 1.00 201.26 ? 546 SER B O   1 
ATOM 4813 C CB  . SER B 1 276 ? 7.799   41.821  -24.128 1.00 203.02 ? 546 SER B CB  1 
ATOM 4814 O OG  . SER B 1 276 ? 7.315   42.453  -22.957 1.00 208.41 ? 546 SER B OG  1 
ATOM 4815 N N   . THR B 1 277 ? 8.997   44.631  -23.394 1.00 175.69 ? 547 THR B N   1 
ATOM 4816 C CA  . THR B 1 277 ? 8.816   46.041  -23.067 1.00 170.76 ? 547 THR B CA  1 
ATOM 4817 C C   . THR B 1 277 ? 9.824   46.912  -23.821 1.00 171.02 ? 547 THR B C   1 
ATOM 4818 O O   . THR B 1 277 ? 9.562   48.084  -24.100 1.00 175.67 ? 547 THR B O   1 
ATOM 4819 C CB  . THR B 1 277 ? 8.965   46.275  -21.544 1.00 169.00 ? 547 THR B CB  1 
ATOM 4820 O OG1 . THR B 1 277 ? 8.023   45.460  -20.837 1.00 170.04 ? 547 THR B OG1 1 
ATOM 4821 C CG2 . THR B 1 277 ? 8.735   47.736  -21.181 1.00 173.42 ? 547 THR B CG2 1 
ATOM 4822 N N   . THR B 1 278 ? 10.955  46.321  -24.192 1.00 170.44 ? 548 THR B N   1 
ATOM 4823 C CA  . THR B 1 278 ? 11.915  46.989  -25.065 1.00 175.15 ? 548 THR B CA  1 
ATOM 4824 C C   . THR B 1 278 ? 11.314  47.143  -26.454 1.00 181.51 ? 548 THR B C   1 
ATOM 4825 O O   . THR B 1 278 ? 11.375  48.213  -27.060 1.00 179.67 ? 548 THR B O   1 
ATOM 4826 C CB  . THR B 1 278 ? 13.247  46.218  -25.160 1.00 173.30 ? 548 THR B CB  1 
ATOM 4827 O OG1 . THR B 1 278 ? 13.888  46.205  -23.878 1.00 173.92 ? 548 THR B OG1 1 
ATOM 4828 C CG2 . THR B 1 278 ? 14.173  46.873  -26.175 1.00 176.58 ? 548 THR B CG2 1 
ATOM 4829 N N   . LEU B 1 279 ? 10.727  46.061  -26.952 1.00 195.03 ? 549 LEU B N   1 
ATOM 4830 C CA  . LEU B 1 279 ? 10.110  46.068  -28.269 1.00 207.16 ? 549 LEU B CA  1 
ATOM 4831 C C   . LEU B 1 279 ? 8.813   46.874  -28.274 1.00 217.17 ? 549 LEU B C   1 
ATOM 4832 O O   . LEU B 1 279 ? 8.249   47.129  -29.336 1.00 229.77 ? 549 LEU B O   1 
ATOM 4833 C CB  . LEU B 1 279 ? 9.839   44.636  -28.738 1.00 208.07 ? 549 LEU B CB  1 
ATOM 4834 N N   . TRP B 1 280 ? 8.307   47.211  -27.089 1.00 210.73 ? 550 TRP B N   1 
ATOM 4835 C CA  . TRP B 1 280 ? 7.137   48.084  -26.974 1.00 206.97 ? 550 TRP B CA  1 
ATOM 4836 C C   . TRP B 1 280 ? 7.472   49.586  -26.980 1.00 194.63 ? 550 TRP B C   1 
ATOM 4837 O O   . TRP B 1 280 ? 6.755   50.376  -27.594 1.00 199.46 ? 550 TRP B O   1 
ATOM 4838 C CB  . TRP B 1 280 ? 6.337   47.734  -25.715 1.00 213.33 ? 550 TRP B CB  1 
ATOM 4839 C CG  . TRP B 1 280 ? 5.044   48.497  -25.597 1.00 216.43 ? 550 TRP B CG  1 
ATOM 4840 C CD1 . TRP B 1 280 ? 3.812   48.080  -26.013 1.00 221.28 ? 550 TRP B CD1 1 
ATOM 4841 C CD2 . TRP B 1 280 ? 4.850   49.789  -25.007 1.00 209.72 ? 550 TRP B CD2 1 
ATOM 4842 N NE1 . TRP B 1 280 ? 2.867   49.037  -25.735 1.00 219.95 ? 550 TRP B NE1 1 
ATOM 4843 C CE2 . TRP B 1 280 ? 3.477   50.095  -25.115 1.00 211.92 ? 550 TRP B CE2 1 
ATOM 4844 C CE3 . TRP B 1 280 ? 5.702   50.719  -24.403 1.00 203.44 ? 550 TRP B CE3 1 
ATOM 4845 C CZ2 . TRP B 1 280 ? 2.939   51.290  -24.643 1.00 205.85 ? 550 TRP B CZ2 1 
ATOM 4846 C CZ3 . TRP B 1 280 ? 5.165   51.905  -23.935 1.00 201.48 ? 550 TRP B CZ3 1 
ATOM 4847 C CH2 . TRP B 1 280 ? 3.797   52.179  -24.058 1.00 199.84 ? 550 TRP B CH2 1 
ATOM 4848 N N   . HIS B 1 281 ? 8.556   49.975  -26.308 1.00 186.75 ? 551 HIS B N   1 
ATOM 4849 C CA  . HIS B 1 281 ? 9.012   51.371  -26.316 1.00 188.57 ? 551 HIS B CA  1 
ATOM 4850 C C   . HIS B 1 281 ? 9.491   51.816  -27.694 1.00 198.16 ? 551 HIS B C   1 
ATOM 4851 O O   . HIS B 1 281 ? 8.993   52.798  -28.248 1.00 207.80 ? 551 HIS B O   1 
ATOM 4852 C CB  . HIS B 1 281 ? 10.131  51.572  -25.292 1.00 184.37 ? 551 HIS B CB  1 
ATOM 4853 N N   . LEU B 1 282 ? 10.463  51.092  -28.240 1.00 193.92 ? 552 LEU B N   1 
ATOM 4854 C CA  . LEU B 1 282 ? 10.648  51.048  -29.681 1.00 197.75 ? 552 LEU B CA  1 
ATOM 4855 C C   . LEU B 1 282 ? 9.326   50.511  -30.199 1.00 207.05 ? 552 LEU B C   1 
ATOM 4856 O O   . LEU B 1 282 ? 8.740   49.650  -29.563 1.00 214.60 ? 552 LEU B O   1 
ATOM 4857 C CB  . LEU B 1 282 ? 11.826  50.159  -30.078 1.00 192.75 ? 552 LEU B CB  1 
ATOM 4858 N N   . GLN B 1 283 ? 8.851   50.967  -31.348 1.00 202.80 ? 553 GLN B N   1 
ATOM 4859 C CA  . GLN B 1 283 ? 7.520   50.542  -31.769 1.00 205.50 ? 553 GLN B CA  1 
ATOM 4860 C C   . GLN B 1 283 ? 7.571   49.454  -32.831 1.00 214.98 ? 553 GLN B C   1 
ATOM 4861 O O   . GLN B 1 283 ? 7.303   49.692  -34.006 1.00 232.53 ? 553 GLN B O   1 
ATOM 4862 C CB  . GLN B 1 283 ? 6.718   51.738  -32.286 1.00 211.54 ? 553 GLN B CB  1 
ATOM 4863 N N   . LYS B 1 284 ? 7.926   48.252  -32.387 1.00 208.72 ? 554 LYS B N   1 
ATOM 4864 C CA  . LYS B 1 284 ? 8.163   47.121  -33.274 1.00 216.32 ? 554 LYS B CA  1 
ATOM 4865 C C   . LYS B 1 284 ? 7.126   46.013  -33.089 1.00 229.67 ? 554 LYS B C   1 
ATOM 4866 O O   . LYS B 1 284 ? 7.472   44.908  -32.670 1.00 232.24 ? 554 LYS B O   1 
ATOM 4867 C CB  . LYS B 1 284 ? 9.567   46.558  -33.053 1.00 210.12 ? 554 LYS B CB  1 
ATOM 4868 N N   . ASP B 1 285 ? 5.859   46.322  -33.358 1.00 240.62 ? 555 ASP B N   1 
ATOM 4869 C CA  . ASP B 1 285 ? 4.784   45.329  -33.285 1.00 250.48 ? 555 ASP B CA  1 
ATOM 4870 C C   . ASP B 1 285 ? 5.126   44.060  -34.071 1.00 252.68 ? 555 ASP B C   1 
ATOM 4871 O O   . ASP B 1 285 ? 4.744   42.957  -33.682 1.00 251.11 ? 555 ASP B O   1 
ATOM 4872 C CB  . ASP B 1 285 ? 3.472   45.925  -33.802 1.00 254.97 ? 555 ASP B CB  1 
ATOM 4873 N N   . VAL B 1 286 ? 5.828   44.240  -35.187 1.00 248.23 ? 556 VAL B N   1 
ATOM 4874 C CA  . VAL B 1 286 ? 6.359   43.140  -35.991 1.00 247.21 ? 556 VAL B CA  1 
ATOM 4875 C C   . VAL B 1 286 ? 7.138   42.109  -35.155 1.00 242.02 ? 556 VAL B C   1 
ATOM 4876 O O   . VAL B 1 286 ? 6.858   40.911  -35.219 1.00 247.68 ? 556 VAL B O   1 
ATOM 4877 C CB  . VAL B 1 286 ? 7.240   43.673  -37.159 1.00 218.50 ? 556 VAL B CB  1 
ATOM 4878 C CG1 . VAL B 1 286 ? 8.386   44.556  -36.662 1.00 216.73 ? 556 VAL B CG1 1 
ATOM 4879 C CG2 . VAL B 1 286 ? 7.736   42.524  -38.029 1.00 218.77 ? 556 VAL B CG2 1 
ATOM 4880 N N   . ALA B 1 287 ? 8.101   42.580  -34.367 1.00 228.45 ? 557 ALA B N   1 
ATOM 4881 C CA  . ALA B 1 287 ? 9.006   41.713  -33.621 1.00 213.55 ? 557 ALA B CA  1 
ATOM 4882 C C   . ALA B 1 287 ? 8.356   41.253  -32.325 1.00 209.31 ? 557 ALA B C   1 
ATOM 4883 O O   . ALA B 1 287 ? 8.570   40.126  -31.876 1.00 205.42 ? 557 ALA B O   1 
ATOM 4884 C CB  . ALA B 1 287 ? 10.314  42.434  -33.332 1.00 210.20 ? 557 ALA B CB  1 
ATOM 4885 N N   . LEU B 1 288 ? 7.557   42.133  -31.733 1.00 218.46 ? 558 LEU B N   1 
ATOM 4886 C CA  . LEU B 1 288 ? 6.815   41.805  -30.524 1.00 222.82 ? 558 LEU B CA  1 
ATOM 4887 C C   . LEU B 1 288 ? 5.783   40.718  -30.806 1.00 231.97 ? 558 LEU B C   1 
ATOM 4888 O O   . LEU B 1 288 ? 5.390   39.976  -29.906 1.00 235.10 ? 558 LEU B O   1 
ATOM 4889 C CB  . LEU B 1 288 ? 6.128   43.051  -29.961 1.00 217.02 ? 558 LEU B CB  1 
ATOM 4890 N N   . SER B 1 289 ? 5.348   40.626  -32.059 1.00 225.63 ? 559 SER B N   1 
ATOM 4891 C CA  . SER B 1 289 ? 4.470   39.541  -32.483 1.00 220.66 ? 559 SER B CA  1 
ATOM 4892 C C   . SER B 1 289 ? 5.216   38.209  -32.541 1.00 220.41 ? 559 SER B C   1 
ATOM 4893 O O   . SER B 1 289 ? 4.753   37.214  -31.981 1.00 232.14 ? 559 SER B O   1 
ATOM 4894 C CB  . SER B 1 289 ? 3.852   39.854  -33.847 1.00 224.17 ? 559 SER B CB  1 
ATOM 4895 N N   . VAL B 1 290 ? 6.348   38.189  -33.242 1.00 208.89 ? 560 VAL B N   1 
ATOM 4896 C CA  . VAL B 1 290 ? 7.227   37.019  -33.270 1.00 200.03 ? 560 VAL B CA  1 
ATOM 4897 C C   . VAL B 1 290 ? 7.527   36.523  -31.858 1.00 191.38 ? 560 VAL B C   1 
ATOM 4898 O O   . VAL B 1 290 ? 7.435   35.328  -31.569 1.00 187.24 ? 560 VAL B O   1 
ATOM 4899 C CB  . VAL B 1 290 ? 8.553   37.330  -33.997 1.00 196.92 ? 560 VAL B CB  1 
ATOM 4900 C CG1 . VAL B 1 290 ? 9.633   36.328  -33.608 1.00 197.02 ? 560 VAL B CG1 1 
ATOM 4901 C CG2 . VAL B 1 290 ? 8.343   37.336  -35.502 1.00 203.30 ? 560 VAL B CG2 1 
ATOM 4902 N N   . LEU B 1 291 ? 7.877   37.461  -30.985 1.00 189.51 ? 561 LEU B N   1 
ATOM 4903 C CA  . LEU B 1 291 ? 8.321   37.153  -29.632 1.00 184.67 ? 561 LEU B CA  1 
ATOM 4904 C C   . LEU B 1 291 ? 7.203   36.510  -28.819 1.00 190.18 ? 561 LEU B C   1 
ATOM 4905 O O   . LEU B 1 291 ? 7.392   35.467  -28.191 1.00 195.22 ? 561 LEU B O   1 
ATOM 4906 C CB  . LEU B 1 291 ? 8.824   38.415  -28.930 1.00 179.43 ? 561 LEU B CB  1 
ATOM 4907 N N   . SER B 1 292 ? 6.036   37.147  -28.840 1.00 189.96 ? 562 SER B N   1 
ATOM 4908 C CA  . SER B 1 292 ? 4.894   36.712  -28.045 1.00 190.42 ? 562 SER B CA  1 
ATOM 4909 C C   . SER B 1 292 ? 4.343   35.364  -28.494 1.00 198.54 ? 562 SER B C   1 
ATOM 4910 O O   . SER B 1 292 ? 4.045   34.513  -27.660 1.00 206.46 ? 562 SER B O   1 
ATOM 4911 C CB  . SER B 1 292 ? 3.786   37.767  -28.099 1.00 189.48 ? 562 SER B CB  1 
ATOM 4912 O OG  . SER B 1 292 ? 2.964   37.582  -29.238 1.00 195.42 ? 562 SER B OG  1 
ATOM 4913 N N   . LYS B 1 293 ? 4.193   35.180  -29.801 1.00 200.31 ? 563 LYS B N   1 
ATOM 4914 C CA  . LYS B 1 293 ? 3.757   33.899  -30.350 1.00 210.86 ? 563 LYS B CA  1 
ATOM 4915 C C   . LYS B 1 293 ? 4.643   32.763  -29.840 1.00 214.72 ? 563 LYS B C   1 
ATOM 4916 O O   . LYS B 1 293 ? 4.158   31.769  -29.298 1.00 220.07 ? 563 LYS B O   1 
ATOM 4917 C CB  . LYS B 1 293 ? 3.769   33.936  -31.880 1.00 210.54 ? 563 LYS B CB  1 
ATOM 4918 N N   . ASP B 1 294 ? 5.946   32.925  -30.042 1.00 204.22 ? 564 ASP B N   1 
ATOM 4919 C CA  . ASP B 1 294 ? 6.957   31.974  -29.590 1.00 196.63 ? 564 ASP B CA  1 
ATOM 4920 C C   . ASP B 1 294 ? 6.890   31.626  -28.100 1.00 185.68 ? 564 ASP B C   1 
ATOM 4921 O O   . ASP B 1 294 ? 6.823   30.453  -27.735 1.00 186.46 ? 564 ASP B O   1 
ATOM 4922 C CB  . ASP B 1 294 ? 8.348   32.514  -29.917 1.00 198.32 ? 564 ASP B CB  1 
ATOM 4923 C CG  . ASP B 1 294 ? 8.875   31.988  -31.233 1.00 207.63 ? 564 ASP B CG  1 
ATOM 4924 O OD1 . ASP B 1 294 ? 8.821   30.759  -31.451 1.00 215.20 ? 564 ASP B OD1 1 
ATOM 4925 O OD2 . ASP B 1 294 ? 9.343   32.806  -32.052 1.00 206.93 ? 564 ASP B OD2 1 
ATOM 4926 N N   . LEU B 1 295 ? 6.895   32.651  -27.250 1.00 177.18 ? 565 LEU B N   1 
ATOM 4927 C CA  . LEU B 1 295 ? 6.932   32.463  -25.799 1.00 172.50 ? 565 LEU B CA  1 
ATOM 4928 C C   . LEU B 1 295 ? 5.634   31.874  -25.265 1.00 179.74 ? 565 LEU B C   1 
ATOM 4929 O O   . LEU B 1 295 ? 5.655   31.038  -24.361 1.00 187.27 ? 565 LEU B O   1 
ATOM 4930 C CB  . LEU B 1 295 ? 7.227   33.790  -25.098 1.00 166.59 ? 565 LEU B CB  1 
ATOM 4931 N N   . THR B 1 296 ? 4.511   32.331  -25.810 1.00 177.83 ? 566 THR B N   1 
ATOM 4932 C CA  . THR B 1 296 ? 3.193   31.922  -25.337 1.00 181.36 ? 566 THR B CA  1 
ATOM 4933 C C   . THR B 1 296 ? 3.109   30.405  -25.414 1.00 185.01 ? 566 THR B C   1 
ATOM 4934 O O   . THR B 1 296 ? 2.832   29.736  -24.417 1.00 187.56 ? 566 THR B O   1 
ATOM 4935 C CB  . THR B 1 296 ? 2.051   32.560  -26.141 1.00 184.25 ? 566 THR B CB  1 
ATOM 4936 O OG1 . THR B 1 296 ? 2.449   32.708  -27.509 1.00 188.46 ? 566 THR B OG1 1 
ATOM 4937 C CG2 . THR B 1 296 ? 1.707   33.927  -25.567 1.00 176.10 ? 566 THR B CG2 1 
ATOM 4938 N N   . ASP B 1 297 ? 3.346   29.867  -26.605 1.00 185.64 ? 567 ASP B N   1 
ATOM 4939 C CA  . ASP B 1 297 ? 3.130   28.452  -26.853 1.00 190.25 ? 567 ASP B CA  1 
ATOM 4940 C C   . ASP B 1 297 ? 4.411   27.656  -26.621 1.00 190.28 ? 567 ASP B C   1 
ATOM 4941 O O   . ASP B 1 297 ? 4.487   26.476  -26.965 1.00 196.73 ? 567 ASP B O   1 
ATOM 4942 C CB  . ASP B 1 297 ? 2.627   28.231  -28.280 1.00 197.47 ? 567 ASP B CB  1 
ATOM 4943 N N   . MET B 1 298 ? 5.422   28.305  -26.049 1.00 181.29 ? 568 MET B N   1 
ATOM 4944 C CA  . MET B 1 298 ? 6.544   27.572  -25.476 1.00 180.19 ? 568 MET B CA  1 
ATOM 4945 C C   . MET B 1 298 ? 6.242   27.262  -24.011 1.00 185.11 ? 568 MET B C   1 
ATOM 4946 O O   . MET B 1 298 ? 6.523   26.167  -23.525 1.00 200.34 ? 568 MET B O   1 
ATOM 4947 C CB  . MET B 1 298 ? 7.844   28.370  -25.600 1.00 171.89 ? 568 MET B CB  1 
ATOM 4948 N N   . ASP B 1 299 ? 5.672   28.244  -23.316 1.00 181.66 ? 569 ASP B N   1 
ATOM 4949 C CA  . ASP B 1 299 ? 5.390   28.137  -21.885 1.00 180.56 ? 569 ASP B CA  1 
ATOM 4950 C C   . ASP B 1 299 ? 4.125   28.917  -21.511 1.00 187.34 ? 569 ASP B C   1 
ATOM 4951 O O   . ASP B 1 299 ? 4.215   30.086  -21.132 1.00 178.83 ? 569 ASP B O   1 
ATOM 4952 C CB  . ASP B 1 299 ? 6.582   28.634  -21.065 1.00 166.67 ? 569 ASP B CB  1 
ATOM 4953 N N   . LYS B 1 300 ? 2.955   28.293  -21.629 1.00 192.96 ? 570 LYS B N   1 
ATOM 4954 C CA  . LYS B 1 300 ? 1.707   28.939  -21.211 1.00 189.61 ? 570 LYS B CA  1 
ATOM 4955 C C   . LYS B 1 300 ? 1.651   29.309  -19.725 1.00 193.75 ? 570 LYS B C   1 
ATOM 4956 O O   . LYS B 1 300 ? 0.912   30.215  -19.337 1.00 192.31 ? 570 LYS B O   1 
ATOM 4957 C CB  . LYS B 1 300 ? 0.518   28.036  -21.546 1.00 186.32 ? 570 LYS B CB  1 
ATOM 4958 N N   . ASN B 1 301 ? 2.441   28.625  -18.903 1.00 195.26 ? 571 ASN B N   1 
ATOM 4959 C CA  . ASN B 1 301 ? 2.435   28.862  -17.458 1.00 189.32 ? 571 ASN B CA  1 
ATOM 4960 C C   . ASN B 1 301 ? 3.455   29.886  -16.994 1.00 191.16 ? 571 ASN B C   1 
ATOM 4961 O O   . ASN B 1 301 ? 3.600   30.120  -15.795 1.00 188.67 ? 571 ASN B O   1 
ATOM 4962 C CB  . ASN B 1 301 ? 2.633   27.561  -16.675 1.00 179.93 ? 571 ASN B CB  1 
ATOM 4963 C CG  . ASN B 1 301 ? 1.342   26.789  -16.496 1.00 182.20 ? 571 ASN B CG  1 
ATOM 4964 O OD1 . ASN B 1 301 ? 0.375   27.314  -15.944 1.00 185.04 ? 571 ASN B OD1 1 
ATOM 4965 N ND2 . ASN B 1 301 ? 1.324   25.537  -16.936 1.00 185.96 ? 571 ASN B ND2 1 
ATOM 4966 N N   . SER B 1 302 ? 4.145   30.517  -17.934 1.00 192.94 ? 572 SER B N   1 
ATOM 4967 C CA  . SER B 1 302 ? 5.066   31.575  -17.563 1.00 184.73 ? 572 SER B CA  1 
ATOM 4968 C C   . SER B 1 302 ? 4.344   32.898  -17.740 1.00 177.81 ? 572 SER B C   1 
ATOM 4969 O O   . SER B 1 302 ? 3.746   33.153  -18.786 1.00 171.51 ? 572 SER B O   1 
ATOM 4970 C CB  . SER B 1 302 ? 6.343   31.523  -18.404 1.00 177.47 ? 572 SER B CB  1 
ATOM 4971 O OG  . SER B 1 302 ? 6.241   32.357  -19.543 1.00 174.82 ? 572 SER B OG  1 
ATOM 4972 N N   . PRO B 1 303 ? 4.403   33.747  -16.706 1.00 173.48 ? 573 PRO B N   1 
ATOM 4973 C CA  . PRO B 1 303 ? 3.826   35.088  -16.790 1.00 166.84 ? 573 PRO B CA  1 
ATOM 4974 C C   . PRO B 1 303 ? 4.593   35.978  -17.751 1.00 160.72 ? 573 PRO B C   1 
ATOM 4975 O O   . PRO B 1 303 ? 3.993   36.863  -18.360 1.00 160.65 ? 573 PRO B O   1 
ATOM 4976 C CB  . PRO B 1 303 ? 3.939   35.605  -15.354 1.00 165.88 ? 573 PRO B CB  1 
ATOM 4977 N N   . GLU B 1 304 ? 5.899   35.763  -17.867 1.00 162.11 ? 574 GLU B N   1 
ATOM 4978 C CA  . GLU B 1 304 ? 6.695   36.501  -18.837 1.00 160.70 ? 574 GLU B CA  1 
ATOM 4979 C C   . GLU B 1 304 ? 6.110   36.384  -20.241 1.00 161.72 ? 574 GLU B C   1 
ATOM 4980 O O   . GLU B 1 304 ? 6.078   37.360  -20.990 1.00 162.32 ? 574 GLU B O   1 
ATOM 4981 C CB  . GLU B 1 304 ? 8.152   36.032  -18.824 1.00 164.23 ? 574 GLU B CB  1 
ATOM 4982 C CG  . GLU B 1 304 ? 8.558   35.225  -17.600 1.00 174.95 ? 574 GLU B CG  1 
ATOM 4983 C CD  . GLU B 1 304 ? 8.524   36.051  -16.327 1.00 183.52 ? 574 GLU B CD  1 
ATOM 4984 O OE1 . GLU B 1 304 ? 8.756   37.272  -16.402 1.00 182.41 ? 574 GLU B OE1 1 
ATOM 4985 O OE2 . GLU B 1 304 ? 8.301   35.471  -15.245 1.00 190.11 ? 574 GLU B OE2 1 
ATOM 4986 N N   . ALA B 1 305 ? 5.647   35.188  -20.593 1.00 171.42 ? 575 ALA B N   1 
ATOM 4987 C CA  . ALA B 1 305 ? 5.032   34.969  -21.897 1.00 184.74 ? 575 ALA B CA  1 
ATOM 4988 C C   . ALA B 1 305 ? 3.719   35.731  -22.060 1.00 181.38 ? 575 ALA B C   1 
ATOM 4989 O O   . ALA B 1 305 ? 3.397   36.192  -23.154 1.00 179.93 ? 575 ALA B O   1 
ATOM 4990 C CB  . ALA B 1 305 ? 4.802   33.481  -22.126 1.00 196.71 ? 575 ALA B CB  1 
ATOM 4991 N N   . TRP B 1 306 ? 2.959   35.858  -20.976 1.00 177.26 ? 576 TRP B N   1 
ATOM 4992 C CA  . TRP B 1 306 ? 1.687   36.569  -21.039 1.00 179.16 ? 576 TRP B CA  1 
ATOM 4993 C C   . TRP B 1 306 ? 1.873   38.079  -20.945 1.00 178.87 ? 576 TRP B C   1 
ATOM 4994 O O   . TRP B 1 306 ? 1.109   38.845  -21.534 1.00 181.09 ? 576 TRP B O   1 
ATOM 4995 C CB  . TRP B 1 306 ? 0.750   36.080  -19.935 1.00 180.53 ? 576 TRP B CB  1 
ATOM 4996 C CG  . TRP B 1 306 ? 0.339   34.655  -20.123 1.00 192.03 ? 576 TRP B CG  1 
ATOM 4997 C CD1 . TRP B 1 306 ? 0.634   33.602  -19.306 1.00 196.67 ? 576 TRP B CD1 1 
ATOM 4998 C CD2 . TRP B 1 306 ? -0.408  34.116  -21.220 1.00 198.36 ? 576 TRP B CD2 1 
ATOM 4999 N NE1 . TRP B 1 306 ? 0.100   32.444  -19.816 1.00 202.46 ? 576 TRP B NE1 1 
ATOM 5000 C CE2 . TRP B 1 306 ? -0.543  32.732  -20.992 1.00 206.51 ? 576 TRP B CE2 1 
ATOM 5001 C CE3 . TRP B 1 306 ? -0.982  34.670  -22.368 1.00 193.08 ? 576 TRP B CE3 1 
ATOM 5002 C CZ2 . TRP B 1 306 ? -1.230  31.895  -21.869 1.00 210.58 ? 576 TRP B CZ2 1 
ATOM 5003 C CZ3 . TRP B 1 306 ? -1.663  33.838  -23.237 1.00 198.40 ? 576 TRP B CZ3 1 
ATOM 5004 C CH2 . TRP B 1 306 ? -1.781  32.466  -22.983 1.00 207.91 ? 576 TRP B CH2 1 
ATOM 5005 N N   . CYS B 1 307 ? 2.891   38.499  -20.201 1.00 185.19 ? 577 CYS B N   1 
ATOM 5006 C CA  . CYS B 1 307 ? 3.341   39.884  -20.235 1.00 185.29 ? 577 CYS B CA  1 
ATOM 5007 C C   . CYS B 1 307 ? 3.805   40.261  -21.635 1.00 187.70 ? 577 CYS B C   1 
ATOM 5008 O O   . CYS B 1 307 ? 3.598   41.386  -22.090 1.00 187.94 ? 577 CYS B O   1 
ATOM 5009 C CB  . CYS B 1 307 ? 4.468   40.108  -19.224 1.00 183.41 ? 577 CYS B CB  1 
ATOM 5010 N N   . ALA B 1 308 ? 4.430   39.305  -22.314 1.00 192.05 ? 578 ALA B N   1 
ATOM 5011 C CA  . ALA B 1 308 ? 4.898   39.508  -23.678 1.00 197.08 ? 578 ALA B CA  1 
ATOM 5012 C C   . ALA B 1 308 ? 3.727   39.721  -24.630 1.00 200.41 ? 578 ALA B C   1 
ATOM 5013 O O   . ALA B 1 308 ? 3.712   40.676  -25.406 1.00 200.99 ? 578 ALA B O   1 
ATOM 5014 C CB  . ALA B 1 308 ? 5.744   38.326  -24.130 1.00 200.52 ? 578 ALA B CB  1 
ATOM 5015 N N   . ALA B 1 309 ? 2.752   38.820  -24.571 1.00 206.24 ? 579 ALA B N   1 
ATOM 5016 C CA  . ALA B 1 309 ? 1.546   38.942  -25.382 1.00 217.48 ? 579 ALA B CA  1 
ATOM 5017 C C   . ALA B 1 309 ? 0.709   40.151  -24.974 1.00 215.24 ? 579 ALA B C   1 
ATOM 5018 O O   . ALA B 1 309 ? 0.050   40.769  -25.810 1.00 215.99 ? 579 ALA B O   1 
ATOM 5019 C CB  . ALA B 1 309 ? 0.718   37.670  -25.287 1.00 228.72 ? 579 ALA B CB  1 
ATOM 5020 N N   . GLY B 1 310 ? 0.734   40.478  -23.685 1.00 210.74 ? 580 GLY B N   1 
ATOM 5021 C CA  . GLY B 1 310 ? 0.045   41.651  -23.177 1.00 210.75 ? 580 GLY B CA  1 
ATOM 5022 C C   . GLY B 1 310 ? 0.521   42.967  -23.763 1.00 211.35 ? 580 GLY B C   1 
ATOM 5023 O O   . GLY B 1 310 ? -0.287  43.813  -24.147 1.00 217.84 ? 580 GLY B O   1 
ATOM 5024 N N   . ASN B 1 311 ? 1.838   43.137  -23.834 1.00 200.42 ? 581 ASN B N   1 
ATOM 5025 C CA  . ASN B 1 311 ? 2.432   44.288  -24.506 1.00 191.39 ? 581 ASN B CA  1 
ATOM 5026 C C   . ASN B 1 311 ? 2.107   44.327  -25.996 1.00 193.34 ? 581 ASN B C   1 
ATOM 5027 O O   . ASN B 1 311 ? 1.781   45.381  -26.540 1.00 186.78 ? 581 ASN B O   1 
ATOM 5028 C CB  . ASN B 1 311 ? 3.949   44.292  -24.305 1.00 184.74 ? 581 ASN B CB  1 
ATOM 5029 N N   . CYS B 1 312 ? 2.235   43.175  -26.648 1.00 199.90 ? 582 CYS B N   1 
ATOM 5030 C CA  . CYS B 1 312 ? 2.005   43.040  -28.086 1.00 207.06 ? 582 CYS B CA  1 
ATOM 5031 C C   . CYS B 1 312 ? 0.675   43.648  -28.535 1.00 214.20 ? 582 CYS B C   1 
ATOM 5032 O O   . CYS B 1 312 ? 0.625   44.430  -29.484 1.00 221.26 ? 582 CYS B O   1 
ATOM 5033 C CB  . CYS B 1 312 ? 2.065   41.566  -28.493 1.00 207.47 ? 582 CYS B CB  1 
ATOM 5034 S SG  . CYS B 1 312 ? 1.908   41.279  -30.272 1.00 254.01 ? 582 CYS B SG  1 
ATOM 5035 N N   . PHE B 1 313 ? -0.396  43.280  -27.837 1.00 217.92 ? 583 PHE B N   1 
ATOM 5036 C CA  . PHE B 1 313 ? -1.750  43.703  -28.189 1.00 226.58 ? 583 PHE B CA  1 
ATOM 5037 C C   . PHE B 1 313 ? -2.040  45.130  -27.729 1.00 221.92 ? 583 PHE B C   1 
ATOM 5038 O O   . PHE B 1 313 ? -2.985  45.764  -28.198 1.00 226.77 ? 583 PHE B O   1 
ATOM 5039 C CB  . PHE B 1 313 ? -2.779  42.742  -27.592 1.00 228.75 ? 583 PHE B CB  1 
ATOM 5040 N N   . SER B 1 314 ? -1.218  45.625  -26.812 1.00 209.73 ? 584 SER B N   1 
ATOM 5041 C CA  . SER B 1 314 ? -1.277  47.017  -26.383 1.00 206.31 ? 584 SER B CA  1 
ATOM 5042 C C   . SER B 1 314 ? -0.876  47.923  -27.540 1.00 216.10 ? 584 SER B C   1 
ATOM 5043 O O   . SER B 1 314 ? -1.536  48.925  -27.820 1.00 223.94 ? 584 SER B O   1 
ATOM 5044 C CB  . SER B 1 314 ? -0.369  47.255  -25.175 1.00 195.44 ? 584 SER B CB  1 
ATOM 5045 O OG  . SER B 1 314 ? -0.290  48.633  -24.855 1.00 190.98 ? 584 SER B OG  1 
ATOM 5046 N N   . LEU B 1 315 ? 0.223   47.564  -28.192 1.00 217.60 ? 585 LEU B N   1 
ATOM 5047 C CA  . LEU B 1 315 ? 0.687   48.234  -29.403 1.00 224.05 ? 585 LEU B CA  1 
ATOM 5048 C C   . LEU B 1 315 ? -0.373  48.236  -30.509 1.00 231.13 ? 585 LEU B C   1 
ATOM 5049 O O   . LEU B 1 315 ? -0.610  49.261  -31.147 1.00 229.70 ? 585 LEU B O   1 
ATOM 5050 C CB  . LEU B 1 315 ? 1.968   47.569  -29.907 1.00 220.49 ? 585 LEU B CB  1 
ATOM 5051 C CG  . LEU B 1 315 ? 3.267   48.302  -29.567 1.00 216.07 ? 585 LEU B CG  1 
ATOM 5052 C CD1 . LEU B 1 315 ? 4.455   47.620  -30.224 1.00 218.22 ? 585 LEU B CD1 1 
ATOM 5053 C CD2 . LEU B 1 315 ? 3.186   49.766  -29.969 1.00 213.63 ? 585 LEU B CD2 1 
ATOM 5054 N N   . GLN B 1 316 ? -1.002  47.086  -30.734 1.00 240.24 ? 586 GLN B N   1 
ATOM 5055 C CA  . GLN B 1 316 ? -2.046  46.947  -31.753 1.00 249.44 ? 586 GLN B CA  1 
ATOM 5056 C C   . GLN B 1 316 ? -3.318  47.738  -31.416 1.00 251.07 ? 586 GLN B C   1 
ATOM 5057 O O   . GLN B 1 316 ? -4.304  47.686  -32.153 1.00 256.19 ? 586 GLN B O   1 
ATOM 5058 C CB  . GLN B 1 316 ? -2.390  45.469  -31.957 1.00 255.48 ? 586 GLN B CB  1 
ATOM 5059 N N   . ARG B 1 317 ? -3.287  48.434  -30.280 1.00 242.09 ? 587 ARG B N   1 
ATOM 5060 C CA  . ARG B 1 317 ? -4.386  49.262  -29.781 1.00 238.57 ? 587 ARG B CA  1 
ATOM 5061 C C   . ARG B 1 317 ? -5.635  48.445  -29.480 1.00 243.42 ? 587 ARG B C   1 
ATOM 5062 O O   . ARG B 1 317 ? -6.759  48.864  -29.765 1.00 252.56 ? 587 ARG B O   1 
ATOM 5063 C CB  . ARG B 1 317 ? -4.720  50.382  -30.774 1.00 242.66 ? 587 ARG B CB  1 
ATOM 5064 N N   . GLU B 1 318 ? -5.416  47.265  -28.911 1.00 237.25 ? 588 GLU B N   1 
ATOM 5065 C CA  . GLU B 1 318 ? -6.492  46.464  -28.356 1.00 236.99 ? 588 GLU B CA  1 
ATOM 5066 C C   . GLU B 1 318 ? -6.322  46.439  -26.840 1.00 231.75 ? 588 GLU B C   1 
ATOM 5067 O O   . GLU B 1 318 ? -5.694  45.526  -26.299 1.00 230.67 ? 588 GLU B O   1 
ATOM 5068 C CB  . GLU B 1 318 ? -6.477  45.049  -28.935 1.00 239.01 ? 588 GLU B CB  1 
ATOM 5069 N N   . HIS B 1 319 ? -6.897  47.433  -26.161 1.00 231.32 ? 589 HIS B N   1 
ATOM 5070 C CA  . HIS B 1 319 ? -6.726  47.599  -24.709 1.00 234.17 ? 589 HIS B CA  1 
ATOM 5071 C C   . HIS B 1 319 ? -7.356  46.431  -23.945 1.00 242.84 ? 589 HIS B C   1 
ATOM 5072 O O   . HIS B 1 319 ? -6.784  45.919  -22.994 1.00 235.90 ? 589 HIS B O   1 
ATOM 5073 C CB  . HIS B 1 319 ? -7.314  48.921  -24.254 1.00 231.74 ? 589 HIS B CB  1 
ATOM 5074 N N   . ASP B 1 320 ? -8.519  45.992  -24.413 1.00 251.76 ? 590 ASP B N   1 
ATOM 5075 C CA  . ASP B 1 320 ? -9.266  44.874  -23.871 1.00 254.60 ? 590 ASP B CA  1 
ATOM 5076 C C   . ASP B 1 320 ? -8.524  43.568  -24.002 1.00 253.89 ? 590 ASP B C   1 
ATOM 5077 O O   . ASP B 1 320 ? -8.472  42.786  -23.052 1.00 254.05 ? 590 ASP B O   1 
ATOM 5078 C CB  . ASP B 1 320 ? -10.643 44.838  -24.547 1.00 259.40 ? 590 ASP B CB  1 
ATOM 5079 C CG  . ASP B 1 320 ? -11.571 45.907  -24.027 1.00 259.65 ? 590 ASP B CG  1 
ATOM 5080 O OD1 . ASP B 1 320 ? -11.093 46.950  -23.580 1.00 255.73 ? 590 ASP B OD1 1 
ATOM 5081 O OD2 . ASP B 1 320 ? -12.764 45.845  -24.409 1.00 267.10 ? 590 ASP B OD2 1 
ATOM 5082 N N   . ILE B 1 321 ? -7.898  43.369  -25.145 1.00 250.04 ? 591 ILE B N   1 
ATOM 5083 C CA  . ILE B 1 321 ? -7.148  42.150  -25.384 1.00 237.89 ? 591 ILE B CA  1 
ATOM 5084 C C   . ILE B 1 321 ? -5.859  42.193  -24.565 1.00 218.13 ? 591 ILE B C   1 
ATOM 5085 O O   . ILE B 1 321 ? -5.355  41.165  -24.118 1.00 211.75 ? 591 ILE B O   1 
ATOM 5086 C CB  . ILE B 1 321 ? -6.823  41.959  -26.873 1.00 238.27 ? 591 ILE B CB  1 
ATOM 5087 N N   . ALA B 1 322 ? -5.333  43.401  -24.388 1.00 211.71 ? 592 ALA B N   1 
ATOM 5088 C CA  . ALA B 1 322 ? -4.133  43.634  -23.589 1.00 207.12 ? 592 ALA B CA  1 
ATOM 5089 C C   . ALA B 1 322 ? -4.328  43.268  -22.115 1.00 217.71 ? 592 ALA B C   1 
ATOM 5090 O O   . ALA B 1 322 ? -3.538  42.513  -21.548 1.00 222.14 ? 592 ALA B O   1 
ATOM 5091 C CB  . ALA B 1 322 ? -3.693  45.084  -23.715 1.00 201.55 ? 592 ALA B CB  1 
ATOM 5092 N N   . ILE B 1 323 ? -5.378  43.810  -21.500 1.00 218.47 ? 593 ILE B N   1 
ATOM 5093 C CA  . ILE B 1 323 ? -5.683  43.527  -20.096 1.00 217.72 ? 593 ILE B CA  1 
ATOM 5094 C C   . ILE B 1 323 ? -6.078  42.069  -19.867 1.00 211.40 ? 593 ILE B C   1 
ATOM 5095 O O   . ILE B 1 323 ? -5.863  41.528  -18.781 1.00 201.99 ? 593 ILE B O   1 
ATOM 5096 C CB  . ILE B 1 323 ? -6.799  44.474  -19.564 1.00 229.11 ? 593 ILE B CB  1 
ATOM 5097 C CG1 . ILE B 1 323 ? -8.154  44.199  -20.229 1.00 232.32 ? 593 ILE B CG1 1 
ATOM 5098 C CG2 . ILE B 1 323 ? -6.418  45.922  -19.806 1.00 225.30 ? 593 ILE B CG2 1 
ATOM 5099 C CD1 . ILE B 1 323 ? -9.075  43.256  -19.461 1.00 233.06 ? 593 ILE B CD1 1 
ATOM 5100 N N   . LYS B 1 324 ? -6.664  41.448  -20.885 1.00 219.14 ? 594 LYS B N   1 
ATOM 5101 C CA  . LYS B 1 324 ? -7.006  40.031  -20.845 1.00 223.44 ? 594 LYS B CA  1 
ATOM 5102 C C   . LYS B 1 324 ? -5.755  39.225  -20.520 1.00 222.16 ? 594 LYS B C   1 
ATOM 5103 O O   . LYS B 1 324 ? -5.766  38.339  -19.665 1.00 229.40 ? 594 LYS B O   1 
ATOM 5104 C CB  . LYS B 1 324 ? -7.614  39.576  -22.172 1.00 225.36 ? 594 LYS B CB  1 
ATOM 5105 N N   . PHE B 1 325 ? -4.675  39.556  -21.218 1.00 207.02 ? 595 PHE B N   1 
ATOM 5106 C CA  . PHE B 1 325 ? -3.404  38.856  -21.093 1.00 196.81 ? 595 PHE B CA  1 
ATOM 5107 C C   . PHE B 1 325 ? -2.666  39.175  -19.794 1.00 187.61 ? 595 PHE B C   1 
ATOM 5108 O O   . PHE B 1 325 ? -2.175  38.264  -19.127 1.00 184.34 ? 595 PHE B O   1 
ATOM 5109 C CB  . PHE B 1 325 ? -2.504  39.188  -22.286 1.00 198.71 ? 595 PHE B CB  1 
ATOM 5110 N N   . PHE B 1 326 ? -2.566  40.455  -19.444 1.00 191.89 ? 596 PHE B N   1 
ATOM 5111 C CA  . PHE B 1 326 ? -1.939  40.837  -18.179 1.00 195.79 ? 596 PHE B CA  1 
ATOM 5112 C C   . PHE B 1 326 ? -2.550  40.151  -16.952 1.00 198.74 ? 596 PHE B C   1 
ATOM 5113 O O   . PHE B 1 326 ? -1.825  39.800  -16.021 1.00 195.27 ? 596 PHE B O   1 
ATOM 5114 C CB  . PHE B 1 326 ? -2.012  42.356  -18.001 1.00 195.28 ? 596 PHE B CB  1 
ATOM 5115 N N   . GLN B 1 327 ? -3.866  39.957  -16.940 1.00 199.09 ? 597 GLN B N   1 
ATOM 5116 C CA  . GLN B 1 327 ? -4.497  39.234  -15.835 1.00 199.25 ? 597 GLN B CA  1 
ATOM 5117 C C   . GLN B 1 327 ? -4.120  37.760  -15.834 1.00 192.90 ? 597 GLN B C   1 
ATOM 5118 O O   . GLN B 1 327 ? -3.951  37.158  -14.773 1.00 191.45 ? 597 GLN B O   1 
ATOM 5119 C CB  . GLN B 1 327 ? -6.020  39.376  -15.840 1.00 211.21 ? 597 GLN B CB  1 
ATOM 5120 C CG  . GLN B 1 327 ? -6.515  40.720  -15.340 1.00 218.15 ? 597 GLN B CG  1 
ATOM 5121 C CD  . GLN B 1 327 ? -7.996  40.922  -15.577 1.00 226.35 ? 597 GLN B CD  1 
ATOM 5122 O OE1 . GLN B 1 327 ? -8.625  40.176  -16.327 1.00 228.15 ? 597 GLN B OE1 1 
ATOM 5123 N NE2 . GLN B 1 327 ? -8.570  41.917  -14.910 1.00 230.18 ? 597 GLN B NE2 1 
ATOM 5124 N N   . ARG B 1 328 ? -3.985  37.183  -17.024 1.00 188.40 ? 598 ARG B N   1 
ATOM 5125 C CA  . ARG B 1 328 ? -3.524  35.806  -17.137 1.00 187.77 ? 598 ARG B CA  1 
ATOM 5126 C C   . ARG B 1 328 ? -2.097  35.661  -16.630 1.00 189.42 ? 598 ARG B C   1 
ATOM 5127 O O   . ARG B 1 328 ? -1.753  34.636  -16.039 1.00 197.38 ? 598 ARG B O   1 
ATOM 5128 C CB  . ARG B 1 328 ? -3.618  35.328  -18.587 1.00 183.19 ? 598 ARG B CB  1 
ATOM 5129 N N   . ALA B 1 329 ? -1.263  36.668  -16.876 1.00 177.88 ? 599 ALA B N   1 
ATOM 5130 C CA  . ALA B 1 329 ? 0.096   36.645  -16.352 1.00 170.72 ? 599 ALA B CA  1 
ATOM 5131 C C   . ALA B 1 329 ? 0.004   36.580  -14.833 1.00 178.52 ? 599 ALA B C   1 
ATOM 5132 O O   . ALA B 1 329 ? 0.656   35.761  -14.183 1.00 184.08 ? 599 ALA B O   1 
ATOM 5133 C CB  . ALA B 1 329 ? 0.875   37.867  -16.799 1.00 167.76 ? 599 ALA B CB  1 
ATOM 5134 N N   . ILE B 1 330 ? -0.828  37.464  -14.288 1.00 178.57 ? 600 ILE B N   1 
ATOM 5135 C CA  . ILE B 1 330 ? -1.153  37.488  -12.867 1.00 172.21 ? 600 ILE B CA  1 
ATOM 5136 C C   . ILE B 1 330 ? -1.805  36.182  -12.428 1.00 175.81 ? 600 ILE B C   1 
ATOM 5137 O O   . ILE B 1 330 ? -1.535  35.678  -11.340 1.00 178.91 ? 600 ILE B O   1 
ATOM 5138 C CB  . ILE B 1 330 ? -2.088  38.661  -12.523 1.00 172.21 ? 600 ILE B CB  1 
ATOM 5139 N N   . GLN B 1 331 ? -2.674  35.649  -13.281 1.00 175.52 ? 601 GLN B N   1 
ATOM 5140 C CA  . GLN B 1 331 ? -3.359  34.392  -13.003 1.00 176.03 ? 601 GLN B CA  1 
ATOM 5141 C C   . GLN B 1 331 ? -2.345  33.268  -12.849 1.00 179.54 ? 601 GLN B C   1 
ATOM 5142 O O   . GLN B 1 331 ? -2.471  32.420  -11.967 1.00 189.60 ? 601 GLN B O   1 
ATOM 5143 C CB  . GLN B 1 331 ? -4.361  34.057  -14.109 1.00 176.62 ? 601 GLN B CB  1 
ATOM 5144 N N   . VAL B 1 332 ? -1.339  33.268  -13.718 1.00 180.08 ? 602 VAL B N   1 
ATOM 5145 C CA  . VAL B 1 332 ? -0.346  32.205  -13.726 1.00 179.12 ? 602 VAL B CA  1 
ATOM 5146 C C   . VAL B 1 332 ? 0.632   32.376  -12.568 1.00 179.13 ? 602 VAL B C   1 
ATOM 5147 O O   . VAL B 1 332 ? 1.102   31.394  -11.994 1.00 187.36 ? 602 VAL B O   1 
ATOM 5148 C CB  . VAL B 1 332 ? 0.436   32.172  -15.053 1.00 180.08 ? 602 VAL B CB  1 
ATOM 5149 N N   . ASP B 1 333 ? 0.938   33.624  -12.227 1.00 172.03 ? 603 ASP B N   1 
ATOM 5150 C CA  . ASP B 1 333 ? 1.780   33.911  -11.069 1.00 167.24 ? 603 ASP B CA  1 
ATOM 5151 C C   . ASP B 1 333 ? 1.336   35.177  -10.339 1.00 168.68 ? 603 ASP B C   1 
ATOM 5152 O O   . ASP B 1 333 ? 1.768   36.275  -10.684 1.00 167.46 ? 603 ASP B O   1 
ATOM 5153 C CB  . ASP B 1 333 ? 3.244   34.042  -11.495 1.00 165.42 ? 603 ASP B CB  1 
ATOM 5154 N N   . PRO B 1 334 ? 0.453   35.030  -9.338  1.00 179.45 ? 604 PRO B N   1 
ATOM 5155 C CA  . PRO B 1 334 ? -0.010  36.202  -8.584  1.00 182.55 ? 604 PRO B CA  1 
ATOM 5156 C C   . PRO B 1 334 ? 1.100   36.906  -7.802  1.00 189.37 ? 604 PRO B C   1 
ATOM 5157 O O   . PRO B 1 334 ? 0.892   38.022  -7.325  1.00 186.55 ? 604 PRO B O   1 
ATOM 5158 C CB  . PRO B 1 334 ? -1.050  35.612  -7.629  1.00 186.97 ? 604 PRO B CB  1 
ATOM 5159 N N   . ASN B 1 335 ? 2.261   36.267  -7.680  1.00 197.25 ? 605 ASN B N   1 
ATOM 5160 C CA  . ASN B 1 335 ? 3.418   36.914  -7.078  1.00 192.57 ? 605 ASN B CA  1 
ATOM 5161 C C   . ASN B 1 335 ? 4.424   37.356  -8.131  1.00 187.35 ? 605 ASN B C   1 
ATOM 5162 O O   . ASN B 1 335 ? 5.635   37.233  -7.948  1.00 188.66 ? 605 ASN B O   1 
ATOM 5163 C CB  . ASN B 1 335 ? 4.088   35.981  -6.068  1.00 192.49 ? 605 ASN B CB  1 
ATOM 5164 N N   . TYR B 1 336 ? 3.902   37.885  -9.232  1.00 185.92 ? 606 TYR B N   1 
ATOM 5165 C CA  . TYR B 1 336 ? 4.719   38.368  -10.335 1.00 184.56 ? 606 TYR B CA  1 
ATOM 5166 C C   . TYR B 1 336 ? 4.361   39.833  -10.517 1.00 190.11 ? 606 TYR B C   1 
ATOM 5167 O O   . TYR B 1 336 ? 3.481   40.175  -11.306 1.00 192.72 ? 606 TYR B O   1 
ATOM 5168 C CB  . TYR B 1 336 ? 4.472   37.569  -11.615 1.00 181.17 ? 606 TYR B CB  1 
ATOM 5169 N N   . ALA B 1 337 ? 5.053   40.685  -9.769  1.00 189.95 ? 607 ALA B N   1 
ATOM 5170 C CA  . ALA B 1 337 ? 4.739   42.108  -9.673  1.00 189.87 ? 607 ALA B CA  1 
ATOM 5171 C C   . ALA B 1 337 ? 4.633   42.838  -11.008 1.00 189.38 ? 607 ALA B C   1 
ATOM 5172 O O   . ALA B 1 337 ? 3.764   43.690  -11.185 1.00 188.30 ? 607 ALA B O   1 
ATOM 5173 C CB  . ALA B 1 337 ? 5.772   42.791  -8.806  1.00 187.78 ? 607 ALA B CB  1 
ATOM 5174 N N   . TYR B 1 338 ? 5.524   42.511  -11.938 1.00 189.02 ? 608 TYR B N   1 
ATOM 5175 C CA  . TYR B 1 338 ? 5.633   43.253  -13.190 1.00 191.79 ? 608 TYR B CA  1 
ATOM 5176 C C   . TYR B 1 338 ? 4.376   43.196  -14.060 1.00 195.42 ? 608 TYR B C   1 
ATOM 5177 O O   . TYR B 1 338 ? 4.131   44.094  -14.865 1.00 192.31 ? 608 TYR B O   1 
ATOM 5178 C CB  . TYR B 1 338 ? 6.829   42.741  -13.993 1.00 192.42 ? 608 TYR B CB  1 
ATOM 5179 C CG  . TYR B 1 338 ? 7.199   43.635  -15.150 1.00 192.24 ? 608 TYR B CG  1 
ATOM 5180 C CD1 . TYR B 1 338 ? 7.402   44.995  -14.962 1.00 192.24 ? 608 TYR B CD1 1 
ATOM 5181 C CD2 . TYR B 1 338 ? 7.345   43.120  -16.431 1.00 192.56 ? 608 TYR B CD2 1 
ATOM 5182 C CE1 . TYR B 1 338 ? 7.739   45.818  -16.016 1.00 195.67 ? 608 TYR B CE1 1 
ATOM 5183 C CE2 . TYR B 1 338 ? 7.685   43.936  -17.492 1.00 192.39 ? 608 TYR B CE2 1 
ATOM 5184 C CZ  . TYR B 1 338 ? 7.879   45.284  -17.279 1.00 190.33 ? 608 TYR B CZ  1 
ATOM 5185 O OH  . TYR B 1 338 ? 8.215   46.102  -18.332 1.00 179.78 ? 608 TYR B OH  1 
ATOM 5186 N N   . ALA B 1 339 ? 3.579   42.150  -13.886 1.00 201.92 ? 609 ALA B N   1 
ATOM 5187 C CA  . ALA B 1 339 ? 2.304   42.031  -14.586 1.00 207.97 ? 609 ALA B CA  1 
ATOM 5188 C C   . ALA B 1 339 ? 1.256   42.987  -14.026 1.00 211.28 ? 609 ALA B C   1 
ATOM 5189 O O   . ALA B 1 339 ? 0.406   43.491  -14.760 1.00 211.85 ? 609 ALA B O   1 
ATOM 5190 C CB  . ALA B 1 339 ? 1.798   40.600  -14.518 1.00 213.32 ? 609 ALA B CB  1 
ATOM 5191 N N   . TYR B 1 340 ? 1.320   43.226  -12.722 1.00 212.66 ? 610 TYR B N   1 
ATOM 5192 C CA  . TYR B 1 340 ? 0.429   44.177  -12.074 1.00 208.00 ? 610 TYR B CA  1 
ATOM 5193 C C   . TYR B 1 340 ? 0.668   45.603  -12.575 1.00 200.19 ? 610 TYR B C   1 
ATOM 5194 O O   . TYR B 1 340 ? -0.279  46.344  -12.836 1.00 203.80 ? 610 TYR B O   1 
ATOM 5195 C CB  . TYR B 1 340 ? 0.617   44.109  -10.555 1.00 211.51 ? 610 TYR B CB  1 
ATOM 5196 C CG  . TYR B 1 340 ? 0.075   42.840  -9.929  1.00 212.53 ? 610 TYR B CG  1 
ATOM 5197 C CD1 . TYR B 1 340 ? -1.090  42.247  -10.400 1.00 214.17 ? 610 TYR B CD1 1 
ATOM 5198 C CD2 . TYR B 1 340 ? 0.749   42.218  -8.884  1.00 213.43 ? 610 TYR B CD2 1 
ATOM 5199 C CE1 . TYR B 1 340 ? -1.578  41.080  -9.835  1.00 220.80 ? 610 TYR B CE1 1 
ATOM 5200 C CE2 . TYR B 1 340 ? 0.269   41.052  -8.314  1.00 218.99 ? 610 TYR B CE2 1 
ATOM 5201 C CZ  . TYR B 1 340 ? -0.894  40.487  -8.793  1.00 225.36 ? 610 TYR B CZ  1 
ATOM 5202 O OH  . TYR B 1 340 ? -1.374  39.327  -8.227  1.00 233.15 ? 610 TYR B OH  1 
ATOM 5203 N N   . THR B 1 341 ? 1.936   45.981  -12.705 1.00 195.21 ? 611 THR B N   1 
ATOM 5204 C CA  . THR B 1 341 ? 2.301   47.316  -13.178 1.00 186.05 ? 611 THR B CA  1 
ATOM 5205 C C   . THR B 1 341 ? 1.988   47.567  -14.655 1.00 180.64 ? 611 THR B C   1 
ATOM 5206 O O   . THR B 1 341 ? 1.668   48.690  -15.047 1.00 175.45 ? 611 THR B O   1 
ATOM 5207 C CB  . THR B 1 341 ? 3.800   47.581  -12.963 1.00 187.84 ? 611 THR B CB  1 
ATOM 5208 O OG1 . THR B 1 341 ? 4.558   46.436  -13.374 1.00 184.01 ? 611 THR B OG1 1 
ATOM 5209 C CG2 . THR B 1 341 ? 4.080   47.892  -11.500 1.00 195.12 ? 611 THR B CG2 1 
ATOM 5210 N N   . LEU B 1 342 ? 2.081   46.520  -15.470 1.00 182.95 ? 612 LEU B N   1 
ATOM 5211 C CA  . LEU B 1 342 ? 1.759   46.626  -16.892 1.00 183.19 ? 612 LEU B CA  1 
ATOM 5212 C C   . LEU B 1 342 ? 0.259   46.727  -17.129 1.00 186.90 ? 612 LEU B C   1 
ATOM 5213 O O   . LEU B 1 342 ? -0.188  47.399  -18.059 1.00 189.85 ? 612 LEU B O   1 
ATOM 5214 C CB  . LEU B 1 342 ? 2.330   45.436  -17.659 1.00 190.45 ? 612 LEU B CB  1 
ATOM 5215 C CG  . LEU B 1 342 ? 3.827   45.523  -17.958 1.00 189.85 ? 612 LEU B CG  1 
ATOM 5216 C CD1 . LEU B 1 342 ? 4.344   44.184  -18.454 1.00 193.30 ? 612 LEU B CD1 1 
ATOM 5217 C CD2 . LEU B 1 342 ? 4.119   46.630  -18.961 1.00 185.76 ? 612 LEU B CD2 1 
ATOM 5218 N N   . LEU B 1 343 ? -0.511  46.054  -16.282 1.00 188.91 ? 613 LEU B N   1 
ATOM 5219 C CA  . LEU B 1 343 ? -1.958  46.201  -16.288 1.00 192.15 ? 613 LEU B CA  1 
ATOM 5220 C C   . LEU B 1 343 ? -2.283  47.642  -15.937 1.00 198.51 ? 613 LEU B C   1 
ATOM 5221 O O   . LEU B 1 343 ? -3.127  48.275  -16.573 1.00 207.51 ? 613 LEU B O   1 
ATOM 5222 C CB  . LEU B 1 343 ? -2.618  45.236  -15.302 1.00 190.82 ? 613 LEU B CB  1 
ATOM 5223 N N   . GLY B 1 344 ? -1.610  48.141  -14.903 1.00 194.44 ? 614 GLY B N   1 
ATOM 5224 C CA  . GLY B 1 344 ? -1.764  49.511  -14.455 1.00 192.18 ? 614 GLY B CA  1 
ATOM 5225 C C   . GLY B 1 344 ? -1.613  50.511  -15.585 1.00 190.80 ? 614 GLY B C   1 
ATOM 5226 O O   . GLY B 1 344 ? -2.521  51.301  -15.833 1.00 195.77 ? 614 GLY B O   1 
ATOM 5227 N N   . HIS B 1 345 ? -0.465  50.487  -16.260 1.00 183.21 ? 615 HIS B N   1 
ATOM 5228 C CA  . HIS B 1 345 ? -0.227  51.387  -17.385 1.00 186.26 ? 615 HIS B CA  1 
ATOM 5229 C C   . HIS B 1 345 ? -1.309  51.237  -18.453 1.00 187.71 ? 615 HIS B C   1 
ATOM 5230 O O   . HIS B 1 345 ? -1.742  52.217  -19.053 1.00 188.04 ? 615 HIS B O   1 
ATOM 5231 C CB  . HIS B 1 345 ? 1.153   51.130  -17.996 1.00 185.99 ? 615 HIS B CB  1 
ATOM 5232 N N   . GLU B 1 346 ? -1.721  50.001  -18.711 1.00 195.65 ? 616 GLU B N   1 
ATOM 5233 C CA  . GLU B 1 346 ? -2.760  49.745  -19.701 1.00 210.87 ? 616 GLU B CA  1 
ATOM 5234 C C   . GLU B 1 346 ? -4.117  50.293  -19.260 1.00 216.64 ? 616 GLU B C   1 
ATOM 5235 O O   . GLU B 1 346 ? -4.957  50.643  -20.090 1.00 212.03 ? 616 GLU B O   1 
ATOM 5236 C CB  . GLU B 1 346 ? -2.872  48.246  -19.981 1.00 214.06 ? 616 GLU B CB  1 
ATOM 5237 N N   . PHE B 1 347 ? -4.318  50.375  -17.947 1.00 221.12 ? 617 PHE B N   1 
ATOM 5238 C CA  . PHE B 1 347 ? -5.512  51.002  -17.387 1.00 221.03 ? 617 PHE B CA  1 
ATOM 5239 C C   . PHE B 1 347 ? -5.485  52.525  -17.433 1.00 220.35 ? 617 PHE B C   1 
ATOM 5240 O O   . PHE B 1 347 ? -6.522  53.155  -17.642 1.00 223.75 ? 617 PHE B O   1 
ATOM 5241 C CB  . PHE B 1 347 ? -5.716  50.539  -15.943 1.00 218.03 ? 617 PHE B CB  1 
ATOM 5242 N N   . VAL B 1 348 ? -4.313  53.119  -17.234 1.00 215.11 ? 618 VAL B N   1 
ATOM 5243 C CA  . VAL B 1 348 ? -4.216  54.574  -17.270 1.00 219.55 ? 618 VAL B CA  1 
ATOM 5244 C C   . VAL B 1 348 ? -4.508  55.035  -18.697 1.00 231.58 ? 618 VAL B C   1 
ATOM 5245 O O   . VAL B 1 348 ? -5.161  56.060  -18.892 1.00 234.03 ? 618 VAL B O   1 
ATOM 5246 C CB  . VAL B 1 348 ? -2.846  55.114  -16.744 1.00 220.65 ? 618 VAL B CB  1 
ATOM 5247 C CG1 . VAL B 1 348 ? -2.478  54.446  -15.426 1.00 215.70 ? 618 VAL B CG1 1 
ATOM 5248 C CG2 . VAL B 1 348 ? -1.724  54.975  -17.763 1.00 217.64 ? 618 VAL B CG2 1 
ATOM 5249 N N   . LEU B 1 349 ? -3.994  54.306  -19.688 1.00 238.29 ? 619 LEU B N   1 
ATOM 5250 C CA  . LEU B 1 349 ? -4.291  54.607  -21.083 1.00 241.58 ? 619 LEU B CA  1 
ATOM 5251 C C   . LEU B 1 349 ? -5.799  54.684  -21.324 1.00 244.00 ? 619 LEU B C   1 
ATOM 5252 O O   . LEU B 1 349 ? -6.275  55.566  -22.038 1.00 239.17 ? 619 LEU B O   1 
ATOM 5253 C CB  . LEU B 1 349 ? -3.666  53.553  -22.001 1.00 232.44 ? 619 LEU B CB  1 
ATOM 5254 N N   . THR B 1 350 ? -6.544  53.751  -20.739 1.00 248.05 ? 620 THR B N   1 
ATOM 5255 C CA  . THR B 1 350 ? -8.001  53.761  -20.847 1.00 251.35 ? 620 THR B CA  1 
ATOM 5256 C C   . THR B 1 350 ? -8.646  54.641  -19.776 1.00 244.42 ? 620 THR B C   1 
ATOM 5257 O O   . THR B 1 350 ? -9.852  54.548  -19.544 1.00 249.67 ? 620 THR B O   1 
ATOM 5258 C CB  . THR B 1 350 ? -8.596  52.346  -20.766 1.00 254.04 ? 620 THR B CB  1 
ATOM 5259 O OG1 . THR B 1 350 ? -8.037  51.646  -19.649 1.00 250.55 ? 620 THR B OG1 1 
ATOM 5260 C CG2 . THR B 1 350 ? -8.304  51.583  -22.047 1.00 255.80 ? 620 THR B CG2 1 
ATOM 5261 N N   . GLU B 1 351 ? -7.844  55.502  -19.153 1.00 241.86 ? 621 GLU B N   1 
ATOM 5262 C CA  . GLU B 1 351 ? -8.298  56.383  -18.073 1.00 235.84 ? 621 GLU B CA  1 
ATOM 5263 C C   . GLU B 1 351 ? -9.239  55.713  -17.067 1.00 234.58 ? 621 GLU B C   1 
ATOM 5264 O O   . GLU B 1 351 ? -10.276 56.270  -16.707 1.00 237.54 ? 621 GLU B O   1 
ATOM 5265 C CB  . GLU B 1 351 ? -8.982  57.616  -18.666 1.00 245.35 ? 621 GLU B CB  1 
ATOM 5266 N N   . GLU B 1 352 ? -8.861  54.523  -16.610 1.00 235.60 ? 622 GLU B N   1 
ATOM 5267 C CA  . GLU B 1 352 ? -9.601  53.836  -15.557 1.00 238.75 ? 622 GLU B CA  1 
ATOM 5268 C C   . GLU B 1 352 ? -8.761  53.779  -14.290 1.00 230.25 ? 622 GLU B C   1 
ATOM 5269 O O   . GLU B 1 352 ? -8.276  52.720  -13.892 1.00 225.25 ? 622 GLU B O   1 
ATOM 5270 C CB  . GLU B 1 352 ? -9.990  52.424  -15.998 1.00 240.77 ? 622 GLU B CB  1 
ATOM 5271 N N   . LEU B 1 353 ? -8.601  54.939  -13.662 1.00 228.73 ? 623 LEU B N   1 
ATOM 5272 C CA  . LEU B 1 353 ? -7.549  55.150  -12.678 1.00 223.13 ? 623 LEU B CA  1 
ATOM 5273 C C   . LEU B 1 353 ? -7.829  54.444  -11.356 1.00 220.81 ? 623 LEU B C   1 
ATOM 5274 O O   . LEU B 1 353 ? -6.894  54.067  -10.652 1.00 214.21 ? 623 LEU B O   1 
ATOM 5275 C CB  . LEU B 1 353 ? -7.344  56.647  -12.434 1.00 227.17 ? 623 LEU B CB  1 
ATOM 5276 N N   . ASP B 1 354 ? -9.103  54.276  -11.006 1.00 230.65 ? 624 ASP B N   1 
ATOM 5277 C CA  . ASP B 1 354 ? -9.436  53.514  -9.807  1.00 233.95 ? 624 ASP B CA  1 
ATOM 5278 C C   . ASP B 1 354 ? -8.898  52.095  -9.929  1.00 242.82 ? 624 ASP B C   1 
ATOM 5279 O O   . ASP B 1 354 ? -8.371  51.536  -8.967  1.00 244.27 ? 624 ASP B O   1 
ATOM 5280 C CB  . ASP B 1 354 ? -10.948 53.492  -9.577  1.00 234.11 ? 624 ASP B CB  1 
ATOM 5281 N N   . LYS B 1 355 ? -9.043  51.514  -11.114 1.00 250.31 ? 625 LYS B N   1 
ATOM 5282 C CA  . LYS B 1 355 ? -8.529  50.175  -11.366 1.00 254.05 ? 625 LYS B CA  1 
ATOM 5283 C C   . LYS B 1 355 ? -7.005  50.193  -11.464 1.00 246.35 ? 625 LYS B C   1 
ATOM 5284 O O   . LYS B 1 355 ? -6.331  49.265  -11.019 1.00 249.10 ? 625 LYS B O   1 
ATOM 5285 C CB  . LYS B 1 355 ? -9.148  49.573  -12.629 1.00 257.05 ? 625 LYS B CB  1 
ATOM 5286 C CG  . LYS B 1 355 ? -10.659 49.419  -12.552 1.00 257.71 ? 625 LYS B CG  1 
ATOM 5287 C CD  . LYS B 1 355 ? -11.199 48.612  -13.721 1.00 261.08 ? 625 LYS B CD  1 
ATOM 5288 C CE  . LYS B 1 355 ? -12.668 48.271  -13.517 1.00 267.13 ? 625 LYS B CE  1 
ATOM 5289 N NZ  . LYS B 1 355 ? -13.226 47.476  -14.647 1.00 271.25 ? 625 LYS B NZ  1 
ATOM 5290 N N   . ALA B 1 356 ? -6.472  51.264  -12.050 1.00 232.85 ? 626 ALA B N   1 
ATOM 5291 C CA  . ALA B 1 356 ? -5.029  51.432  -12.192 1.00 219.18 ? 626 ALA B CA  1 
ATOM 5292 C C   . ALA B 1 356 ? -4.300  51.602  -10.861 1.00 211.31 ? 626 ALA B C   1 
ATOM 5293 O O   . ALA B 1 356 ? -3.209  51.062  -10.679 1.00 205.09 ? 626 ALA B O   1 
ATOM 5294 C CB  . ALA B 1 356 ? -4.735  52.622  -13.098 1.00 223.58 ? 626 ALA B CB  1 
ATOM 5295 N N   . LEU B 1 357 ? -4.896  52.348  -9.937  1.00 214.12 ? 627 LEU B N   1 
ATOM 5296 C CA  . LEU B 1 357 ? -4.319  52.508  -8.604  1.00 214.94 ? 627 LEU B CA  1 
ATOM 5297 C C   . LEU B 1 357 ? -4.249  51.186  -7.852  1.00 219.29 ? 627 LEU B C   1 
ATOM 5298 O O   . LEU B 1 357 ? -3.286  50.925  -7.138  1.00 211.46 ? 627 LEU B O   1 
ATOM 5299 C CB  . LEU B 1 357 ? -5.101  53.535  -7.778  1.00 218.91 ? 627 LEU B CB  1 
ATOM 5300 C CG  . LEU B 1 357 ? -4.535  54.960  -7.779  1.00 216.57 ? 627 LEU B CG  1 
ATOM 5301 C CD1 . LEU B 1 357 ? -5.291  55.884  -8.718  1.00 218.02 ? 627 LEU B CD1 1 
ATOM 5302 C CD2 . LEU B 1 357 ? -4.508  55.529  -6.366  1.00 222.65 ? 627 LEU B CD2 1 
ATOM 5303 N N   . ALA B 1 358 ? -5.264  50.349  -8.046  1.00 231.97 ? 628 ALA B N   1 
ATOM 5304 C CA  . ALA B 1 358 ? -5.342  49.039  -7.405  1.00 234.79 ? 628 ALA B CA  1 
ATOM 5305 C C   . ALA B 1 358 ? -4.219  48.113  -7.853  1.00 239.66 ? 628 ALA B C   1 
ATOM 5306 O O   . ALA B 1 358 ? -3.571  47.475  -7.023  1.00 241.41 ? 628 ALA B O   1 
ATOM 5307 C CB  . ALA B 1 358 ? -6.692  48.399  -7.686  1.00 237.59 ? 628 ALA B CB  1 
ATOM 5308 N N   . CYS B 1 359 ? -3.990  48.048  -9.160  1.00 235.46 ? 629 CYS B N   1 
ATOM 5309 C CA  . CYS B 1 359 ? -2.902  47.247  -9.709  1.00 218.42 ? 629 CYS B CA  1 
ATOM 5310 C C   . CYS B 1 359 ? -1.576  47.702  -9.114  1.00 212.71 ? 629 CYS B C   1 
ATOM 5311 O O   . CYS B 1 359 ? -0.810  46.882  -8.606  1.00 211.86 ? 629 CYS B O   1 
ATOM 5312 C CB  . CYS B 1 359 ? -2.868  47.340  -11.235 1.00 210.15 ? 629 CYS B CB  1 
ATOM 5313 S SG  . CYS B 1 359 ? -4.400  46.833  -12.050 1.00 268.92 ? 629 CYS B SG  1 
ATOM 5314 N N   . PHE B 1 360 ? -1.300  49.001  -9.197  1.00 206.81 ? 630 PHE B N   1 
ATOM 5315 C CA  . PHE B 1 360 ? -0.050  49.541  -8.679  1.00 200.23 ? 630 PHE B CA  1 
ATOM 5316 C C   . PHE B 1 360 ? 0.006   49.258  -7.180  1.00 207.40 ? 630 PHE B C   1 
ATOM 5317 O O   . PHE B 1 360 ? 1.049   48.878  -6.647  1.00 204.17 ? 630 PHE B O   1 
ATOM 5318 C CB  . PHE B 1 360 ? 0.048   51.044  -8.943  1.00 197.90 ? 630 PHE B CB  1 
ATOM 5319 C CG  . PHE B 1 360 ? 0.180   51.399  -10.397 1.00 197.85 ? 630 PHE B CG  1 
ATOM 5320 C CD1 . PHE B 1 360 ? 0.914   50.603  -11.260 1.00 191.54 ? 630 PHE B CD1 1 
ATOM 5321 C CD2 . PHE B 1 360 ? -0.440  52.532  -10.902 1.00 203.73 ? 630 PHE B CD2 1 
ATOM 5322 C CE1 . PHE B 1 360 ? 1.030   50.931  -12.600 1.00 192.09 ? 630 PHE B CE1 1 
ATOM 5323 C CE2 . PHE B 1 360 ? -0.328  52.865  -12.240 1.00 202.20 ? 630 PHE B CE2 1 
ATOM 5324 C CZ  . PHE B 1 360 ? 0.408   52.064  -13.089 1.00 196.10 ? 630 PHE B CZ  1 
ATOM 5325 N N   . ARG B 1 361 ? -1.119  49.475  -6.502  1.00 213.66 ? 631 ARG B N   1 
ATOM 5326 C CA  . ARG B 1 361 ? -1.215  49.203  -5.072  1.00 216.67 ? 631 ARG B CA  1 
ATOM 5327 C C   . ARG B 1 361 ? -0.952  47.726  -4.818  1.00 214.23 ? 631 ARG B C   1 
ATOM 5328 O O   . ARG B 1 361 ? -0.273  47.356  -3.865  1.00 218.59 ? 631 ARG B O   1 
ATOM 5329 C CB  . ARG B 1 361 ? -2.583  49.602  -4.516  1.00 225.86 ? 631 ARG B CB  1 
ATOM 5330 N N   . ASN B 1 362 ? -1.542  46.875  -5.650  1.00 212.94 ? 632 ASN B N   1 
ATOM 5331 C CA  . ASN B 1 362 ? -1.279  45.448  -5.560  1.00 210.77 ? 632 ASN B CA  1 
ATOM 5332 C C   . ASN B 1 362 ? 0.191   45.151  -5.843  1.00 208.06 ? 632 ASN B C   1 
ATOM 5333 O O   . ASN B 1 362 ? 0.823   44.352  -5.152  1.00 217.05 ? 632 ASN B O   1 
ATOM 5334 C CB  . ASN B 1 362 ? -2.171  44.682  -6.537  1.00 212.23 ? 632 ASN B CB  1 
ATOM 5335 C CG  . ASN B 1 362 ? -3.456  44.197  -5.895  1.00 218.92 ? 632 ASN B CG  1 
ATOM 5336 O OD1 . ASN B 1 362 ? -3.444  43.318  -5.034  1.00 222.19 ? 632 ASN B OD1 1 
ATOM 5337 N ND2 . ASN B 1 362 ? -4.577  44.773  -6.315  1.00 219.93 ? 632 ASN B ND2 1 
ATOM 5338 N N   . ALA B 1 363 ? 0.716   45.798  -6.881  1.00 199.75 ? 633 ALA B N   1 
ATOM 5339 C CA  . ALA B 1 363 ? 2.124   45.696  -7.263  1.00 190.65 ? 633 ALA B CA  1 
ATOM 5340 C C   . ALA B 1 363 ? 3.137   45.943  -6.138  1.00 193.85 ? 633 ALA B C   1 
ATOM 5341 O O   . ALA B 1 363 ? 4.115   45.207  -6.017  1.00 193.56 ? 633 ALA B O   1 
ATOM 5342 C CB  . ALA B 1 363 ? 2.409   46.643  -8.422  1.00 185.70 ? 633 ALA B CB  1 
ATOM 5343 N N   . ILE B 1 364 ? 2.908   46.966  -5.316  1.00 197.12 ? 634 ILE B N   1 
ATOM 5344 C CA  . ILE B 1 364 ? 3.848   47.276  -4.234  1.00 201.19 ? 634 ILE B CA  1 
ATOM 5345 C C   . ILE B 1 364 ? 3.799   46.283  -3.064  1.00 209.26 ? 634 ILE B C   1 
ATOM 5346 O O   . ILE B 1 364 ? 4.839   45.961  -2.498  1.00 208.56 ? 634 ILE B O   1 
ATOM 5347 C CB  . ILE B 1 364 ? 3.659   48.718  -3.705  1.00 203.74 ? 634 ILE B CB  1 
ATOM 5348 C CG1 . ILE B 1 364 ? 2.184   49.060  -3.524  1.00 207.79 ? 634 ILE B CG1 1 
ATOM 5349 C CG2 . ILE B 1 364 ? 4.304   49.714  -4.656  1.00 200.47 ? 634 ILE B CG2 1 
ATOM 5350 C CD1 . ILE B 1 364 ? 1.726   49.041  -2.083  1.00 214.40 ? 634 ILE B CD1 1 
ATOM 5351 N N   . ARG B 1 365 ? 2.605   45.835  -2.679  1.00 219.10 ? 635 ARG B N   1 
ATOM 5352 C CA  . ARG B 1 365 ? 2.447   44.778  -1.669  1.00 221.66 ? 635 ARG B CA  1 
ATOM 5353 C C   . ARG B 1 365 ? 3.343   43.601  -2.074  1.00 216.69 ? 635 ARG B C   1 
ATOM 5354 O O   . ARG B 1 365 ? 4.111   43.051  -1.276  1.00 228.07 ? 635 ARG B O   1 
ATOM 5355 C CB  . ARG B 1 365 ? 0.984   44.347  -1.543  1.00 223.64 ? 635 ARG B CB  1 
ATOM 5356 N N   . VAL B 1 366 ? 3.225   43.293  -3.358  1.00 208.39 ? 636 VAL B N   1 
ATOM 5357 C CA  . VAL B 1 366 ? 3.857   42.217  -4.103  1.00 208.85 ? 636 VAL B CA  1 
ATOM 5358 C C   . VAL B 1 366 ? 5.342   42.506  -4.217  1.00 208.33 ? 636 VAL B C   1 
ATOM 5359 O O   . VAL B 1 366 ? 6.174   41.643  -3.986  1.00 206.49 ? 636 VAL B O   1 
ATOM 5360 C CB  . VAL B 1 366 ? 3.221   42.035  -5.520  1.00 210.15 ? 636 VAL B CB  1 
ATOM 5361 N N   . ASN B 1 367 ? 5.667   43.742  -4.566  1.00 208.81 ? 637 ASN B N   1 
ATOM 5362 C CA  . ASN B 1 367 ? 7.046   44.136  -4.659  1.00 207.90 ? 637 ASN B CA  1 
ATOM 5363 C C   . ASN B 1 367 ? 7.407   45.384  -3.911  1.00 215.00 ? 637 ASN B C   1 
ATOM 5364 O O   . ASN B 1 367 ? 7.040   46.492  -4.284  1.00 211.84 ? 637 ASN B O   1 
ATOM 5365 C CB  . ASN B 1 367 ? 7.381   44.316  -6.121  1.00 208.46 ? 637 ASN B CB  1 
ATOM 5366 N N   . PRO B 1 368 ? 8.056   45.145  -2.762  1.00 231.89 ? 638 PRO B N   1 
ATOM 5367 C CA  . PRO B 1 368 ? 8.524   46.149  -1.830  1.00 236.16 ? 638 PRO B CA  1 
ATOM 5368 C C   . PRO B 1 368 ? 9.519   47.117  -2.460  1.00 234.08 ? 638 PRO B C   1 
ATOM 5369 O O   . PRO B 1 368 ? 9.273   48.313  -2.373  1.00 239.76 ? 638 PRO B O   1 
ATOM 5370 C CB  . PRO B 1 368 ? 9.211   45.294  -0.757  1.00 238.61 ? 638 PRO B CB  1 
ATOM 5371 N N   . ARG B 1 369 ? 10.585  46.615  -3.078  1.00 230.14 ? 639 ARG B N   1 
ATOM 5372 C CA  . ARG B 1 369 ? 11.602  47.418  -3.787  1.00 223.70 ? 639 ARG B CA  1 
ATOM 5373 C C   . ARG B 1 369 ? 11.383  47.701  -5.296  1.00 226.33 ? 639 ARG B C   1 
ATOM 5374 O O   . ARG B 1 369 ? 12.358  47.841  -6.034  1.00 225.89 ? 639 ARG B O   1 
ATOM 5375 C CB  . ARG B 1 369 ? 12.971  46.758  -3.603  1.00 216.77 ? 639 ARG B CB  1 
ATOM 5376 N N   . HIS B 1 370 ? 10.134  47.814  -5.741  1.00 229.60 ? 640 HIS B N   1 
ATOM 5377 C CA  . HIS B 1 370 ? 9.759   48.045  -7.157  1.00 225.71 ? 640 HIS B CA  1 
ATOM 5378 C C   . HIS B 1 370 ? 9.375   49.457  -7.614  1.00 233.05 ? 640 HIS B C   1 
ATOM 5379 O O   . HIS B 1 370 ? 8.212   49.840  -7.501  1.00 249.04 ? 640 HIS B O   1 
ATOM 5380 C CB  . HIS B 1 370 ? 8.608   47.122  -7.542  1.00 222.91 ? 640 HIS B CB  1 
ATOM 5381 N N   . TYR B 1 371 ? 10.342  50.221  -8.123  1.00 219.38 ? 641 TYR B N   1 
ATOM 5382 C CA  . TYR B 1 371 ? 10.121  51.615  -8.520  1.00 208.84 ? 641 TYR B CA  1 
ATOM 5383 C C   . TYR B 1 371 ? 8.912   51.785  -9.447  1.00 195.53 ? 641 TYR B C   1 
ATOM 5384 O O   . TYR B 1 371 ? 8.201   52.784  -9.342  1.00 191.76 ? 641 TYR B O   1 
ATOM 5385 C CB  . TYR B 1 371 ? 11.373  52.167  -9.246  1.00 197.17 ? 641 TYR B CB  1 
ATOM 5386 C CG  . TYR B 1 371 ? 11.541  51.732  -10.711 1.00 188.20 ? 641 TYR B CG  1 
ATOM 5387 C CD1 . TYR B 1 371 ? 10.838  52.368  -11.740 1.00 187.75 ? 641 TYR B CD1 1 
ATOM 5388 C CD2 . TYR B 1 371 ? 12.355  50.660  -11.056 1.00 187.08 ? 641 TYR B CD2 1 
ATOM 5389 C CE1 . TYR B 1 371 ? 10.966  51.969  -13.060 1.00 188.52 ? 641 TYR B CE1 1 
ATOM 5390 C CE2 . TYR B 1 371 ? 12.488  50.255  -12.382 1.00 187.33 ? 641 TYR B CE2 1 
ATOM 5391 C CZ  . TYR B 1 371 ? 11.791  50.914  -13.376 1.00 187.33 ? 641 TYR B CZ  1 
ATOM 5392 O OH  . TYR B 1 371 ? 11.918  50.516  -14.689 1.00 186.58 ? 641 TYR B OH  1 
ATOM 5393 N N   . ASN B 1 372 ? 8.702   50.837  -10.363 1.00 196.24 ? 642 ASN B N   1 
ATOM 5394 C CA  . ASN B 1 372 ? 7.658   50.954  -11.387 1.00 193.03 ? 642 ASN B CA  1 
ATOM 5395 C C   . ASN B 1 372 ? 6.289   51.402  -10.877 1.00 196.65 ? 642 ASN B C   1 
ATOM 5396 O O   . ASN B 1 372 ? 5.652   52.267  -11.479 1.00 192.18 ? 642 ASN B O   1 
ATOM 5397 C CB  . ASN B 1 372 ? 7.503   49.618  -12.118 1.00 187.84 ? 642 ASN B CB  1 
ATOM 5398 N N   . ALA B 1 373 ? 5.835   50.816  -9.775  1.00 214.82 ? 643 ALA B N   1 
ATOM 5399 C CA  . ALA B 1 373 ? 4.487   51.084  -9.288  1.00 223.41 ? 643 ALA B CA  1 
ATOM 5400 C C   . ALA B 1 373 ? 4.455   52.412  -8.549  1.00 227.37 ? 643 ALA B C   1 
ATOM 5401 O O   . ALA B 1 373 ? 3.579   53.249  -8.777  1.00 234.47 ? 643 ALA B O   1 
ATOM 5402 C CB  . ALA B 1 373 ? 4.007   49.960  -8.388  1.00 228.23 ? 643 ALA B CB  1 
ATOM 5403 N N   . TRP B 1 374 ? 5.410   52.563  -7.635  1.00 224.62 ? 644 TRP B N   1 
ATOM 5404 C CA  . TRP B 1 374 ? 5.621   53.786  -6.871  1.00 222.47 ? 644 TRP B CA  1 
ATOM 5405 C C   . TRP B 1 374 ? 5.557   55.013  -7.777  1.00 218.83 ? 644 TRP B C   1 
ATOM 5406 O O   . TRP B 1 374 ? 4.821   55.962  -7.507  1.00 224.28 ? 644 TRP B O   1 
ATOM 5407 C CB  . TRP B 1 374 ? 6.965   53.715  -6.147  1.00 225.30 ? 644 TRP B CB  1 
ATOM 5408 C CG  . TRP B 1 374 ? 6.907   52.896  -4.890  1.00 227.39 ? 644 TRP B CG  1 
ATOM 5409 C CD1 . TRP B 1 374 ? 7.534   51.704  -4.669  1.00 223.01 ? 644 TRP B CD1 1 
ATOM 5410 C CD2 . TRP B 1 374 ? 6.176   53.192  -3.693  1.00 235.41 ? 644 TRP B CD2 1 
ATOM 5411 N NE1 . TRP B 1 374 ? 7.244   51.242  -3.409  1.00 224.76 ? 644 TRP B NE1 1 
ATOM 5412 C CE2 . TRP B 1 374 ? 6.414   52.137  -2.789  1.00 234.43 ? 644 TRP B CE2 1 
ATOM 5413 C CE3 . TRP B 1 374 ? 5.348   54.247  -3.296  1.00 242.37 ? 644 TRP B CE3 1 
ATOM 5414 C CZ2 . TRP B 1 374 ? 5.854   52.106  -1.513  1.00 241.99 ? 644 TRP B CZ2 1 
ATOM 5415 C CZ3 . TRP B 1 374 ? 4.793   54.214  -2.028  1.00 245.46 ? 644 TRP B CZ3 1 
ATOM 5416 C CH2 . TRP B 1 374 ? 5.049   53.150  -1.152  1.00 245.39 ? 644 TRP B CH2 1 
ATOM 5417 N N   . TYR B 1 375 ? 6.341   54.985  -8.851  1.00 207.46 ? 645 TYR B N   1 
ATOM 5418 C CA  . TYR B 1 375 ? 6.345   56.073  -9.820  1.00 204.68 ? 645 TYR B CA  1 
ATOM 5419 C C   . TYR B 1 375 ? 5.038   56.095  -10.601 1.00 204.70 ? 645 TYR B C   1 
ATOM 5420 O O   . TYR B 1 375 ? 4.460   57.158  -10.828 1.00 206.65 ? 645 TYR B O   1 
ATOM 5421 C CB  . TYR B 1 375 ? 7.529   55.941  -10.780 1.00 203.40 ? 645 TYR B CB  1 
ATOM 5422 N N   . GLY B 1 376 ? 4.599   54.914  -11.031 1.00 209.77 ? 646 GLY B N   1 
ATOM 5423 C CA  . GLY B 1 376 ? 3.317   54.750  -11.695 1.00 216.00 ? 646 GLY B CA  1 
ATOM 5424 C C   . GLY B 1 376 ? 2.172   55.425  -10.967 1.00 224.53 ? 646 GLY B C   1 
ATOM 5425 O O   . GLY B 1 376 ? 1.361   56.125  -11.573 1.00 221.13 ? 646 GLY B O   1 
ATOM 5426 N N   . LEU B 1 377 ? 2.109   55.206  -9.657  1.00 230.62 ? 647 LEU B N   1 
ATOM 5427 C CA  . LEU B 1 377 ? 1.145   55.895  -8.810  1.00 232.29 ? 647 LEU B CA  1 
ATOM 5428 C C   . LEU B 1 377 ? 1.404   57.394  -8.801  1.00 232.22 ? 647 LEU B C   1 
ATOM 5429 O O   . LEU B 1 377 ? 0.484   58.188  -8.990  1.00 239.57 ? 647 LEU B O   1 
ATOM 5430 C CB  . LEU B 1 377 ? 1.190   55.343  -7.384  1.00 229.68 ? 647 LEU B CB  1 
ATOM 5431 N N   . GLY B 1 378 ? 2.653   57.769  -8.531  1.00 224.23 ? 648 GLY B N   1 
ATOM 5432 C CA  . GLY B 1 378 ? 3.078   59.156  -8.584  1.00 220.40 ? 648 GLY B CA  1 
ATOM 5433 C C   . GLY B 1 378 ? 2.543   59.933  -9.772  1.00 219.10 ? 648 GLY B C   1 
ATOM 5434 O O   . GLY B 1 378 ? 1.997   61.025  -9.612  1.00 219.20 ? 648 GLY B O   1 
ATOM 5435 N N   . MET B 1 379 ? 2.710   59.373  -10.968 1.00 214.20 ? 649 MET B N   1 
ATOM 5436 C CA  . MET B 1 379 ? 2.248   60.033  -12.183 1.00 207.24 ? 649 MET B CA  1 
ATOM 5437 C C   . MET B 1 379 ? 0.732   60.202  -12.184 1.00 208.17 ? 649 MET B C   1 
ATOM 5438 O O   . MET B 1 379 ? 0.206   61.164  -12.744 1.00 210.53 ? 649 MET B O   1 
ATOM 5439 C CB  . MET B 1 379 ? 2.688   59.246  -13.419 1.00 198.89 ? 649 MET B CB  1 
ATOM 5440 N N   . ILE B 1 380 ? 0.037   59.260  -11.553 1.00 212.83 ? 650 ILE B N   1 
ATOM 5441 C CA  . ILE B 1 380 ? -1.413  59.334  -11.424 1.00 219.81 ? 650 ILE B CA  1 
ATOM 5442 C C   . ILE B 1 380 ? -1.813  60.455  -10.473 1.00 226.91 ? 650 ILE B C   1 
ATOM 5443 O O   . ILE B 1 380 ? -2.699  61.255  -10.769 1.00 232.00 ? 650 ILE B O   1 
ATOM 5444 C CB  . ILE B 1 380 ? -2.010  58.003  -10.926 1.00 215.52 ? 650 ILE B CB  1 
ATOM 5445 N N   . TYR B 1 381 ? -1.145  60.495  -9.324  1.00 227.21 ? 651 TYR B N   1 
ATOM 5446 C CA  . TYR B 1 381 ? -1.386  61.515  -8.310  1.00 231.82 ? 651 TYR B CA  1 
ATOM 5447 C C   . TYR B 1 381 ? -0.970  62.904  -8.785  1.00 234.97 ? 651 TYR B C   1 
ATOM 5448 O O   . TYR B 1 381 ? -1.497  63.914  -8.320  1.00 242.01 ? 651 TYR B O   1 
ATOM 5449 C CB  . TYR B 1 381 ? -0.649  61.162  -7.016  1.00 234.20 ? 651 TYR B CB  1 
ATOM 5450 N N   . TYR B 1 382 ? -0.022  62.943  -9.716  1.00 233.29 ? 652 TYR B N   1 
ATOM 5451 C CA  . TYR B 1 382 ? 0.406   64.194  -10.334 1.00 240.32 ? 652 TYR B CA  1 
ATOM 5452 C C   . TYR B 1 382 ? -0.628  64.728  -11.318 1.00 247.11 ? 652 TYR B C   1 
ATOM 5453 O O   . TYR B 1 382 ? -0.835  65.937  -11.422 1.00 244.99 ? 652 TYR B O   1 
ATOM 5454 C CB  . TYR B 1 382 ? 1.747   64.001  -11.045 1.00 238.71 ? 652 TYR B CB  1 
ATOM 5455 N N   . LYS B 1 383 ? -1.278  63.819  -12.036 1.00 249.07 ? 653 LYS B N   1 
ATOM 5456 C CA  . LYS B 1 383 ? -2.352  64.187  -12.949 1.00 252.20 ? 653 LYS B CA  1 
ATOM 5457 C C   . LYS B 1 383 ? -3.622  64.543  -12.185 1.00 255.76 ? 653 LYS B C   1 
ATOM 5458 O O   . LYS B 1 383 ? -4.497  65.236  -12.705 1.00 256.07 ? 653 LYS B O   1 
ATOM 5459 C CB  . LYS B 1 383 ? -2.632  63.050  -13.934 1.00 247.03 ? 653 LYS B CB  1 
ATOM 5460 N N   . GLN B 1 384 ? -3.714  64.071  -10.946 1.00 255.78 ? 654 GLN B N   1 
ATOM 5461 C CA  . GLN B 1 384 ? -4.816  64.440  -10.065 1.00 263.92 ? 654 GLN B CA  1 
ATOM 5462 C C   . GLN B 1 384 ? -4.506  65.701  -9.259  1.00 268.19 ? 654 GLN B C   1 
ATOM 5463 O O   . GLN B 1 384 ? -5.256  66.060  -8.351  1.00 275.04 ? 654 GLN B O   1 
ATOM 5464 C CB  . GLN B 1 384 ? -5.154  63.284  -9.122  1.00 262.73 ? 654 GLN B CB  1 
ATOM 5465 N N   . GLU B 1 385 ? -3.389  66.349  -9.587  1.00 260.70 ? 655 GLU B N   1 
ATOM 5466 C CA  . GLU B 1 385 ? -2.938  67.568  -8.910  1.00 259.87 ? 655 GLU B CA  1 
ATOM 5467 C C   . GLU B 1 385 ? -2.714  67.402  -7.407  1.00 260.49 ? 655 GLU B C   1 
ATOM 5468 O O   . GLU B 1 385 ? -2.725  68.382  -6.661  1.00 263.15 ? 655 GLU B O   1 
ATOM 5469 C CB  . GLU B 1 385 ? -3.934  68.708  -9.155  1.00 269.34 ? 655 GLU B CB  1 
ATOM 5470 N N   . LYS B 1 386 ? -2.510  66.165  -6.967  1.00 260.12 ? 656 LYS B N   1 
ATOM 5471 C CA  . LYS B 1 386 ? -2.303  65.890  -5.551  1.00 260.90 ? 656 LYS B CA  1 
ATOM 5472 C C   . LYS B 1 386 ? -0.812  65.746  -5.286  1.00 254.40 ? 656 LYS B C   1 
ATOM 5473 O O   . LYS B 1 386 ? -0.328  64.665  -4.948  1.00 251.55 ? 656 LYS B O   1 
ATOM 5474 C CB  . LYS B 1 386 ? -3.051  64.625  -5.127  1.00 258.25 ? 656 LYS B CB  1 
ATOM 5475 N N   . PHE B 1 387 ? -0.093  66.856  -5.432  1.00 254.18 ? 657 PHE B N   1 
ATOM 5476 C CA  . PHE B 1 387 ? 1.360   66.822  -5.488  1.00 246.44 ? 657 PHE B CA  1 
ATOM 5477 C C   . PHE B 1 387 ? 1.971   66.435  -4.149  1.00 245.50 ? 657 PHE B C   1 
ATOM 5478 O O   . PHE B 1 387 ? 3.087   65.918  -4.095  1.00 241.54 ? 657 PHE B O   1 
ATOM 5479 C CB  . PHE B 1 387 ? 1.895   68.187  -5.928  1.00 255.37 ? 657 PHE B CB  1 
ATOM 5480 N N   . SER B 1 388 ? 1.234   66.681  -3.070  1.00 256.00 ? 658 SER B N   1 
ATOM 5481 C CA  . SER B 1 388 ? 1.684   66.274  -1.746  1.00 262.77 ? 658 SER B CA  1 
ATOM 5482 C C   . SER B 1 388 ? 1.869   64.764  -1.697  1.00 259.37 ? 658 SER B C   1 
ATOM 5483 O O   . SER B 1 388 ? 2.859   64.269  -1.159  1.00 256.77 ? 658 SER B O   1 
ATOM 5484 C CB  . SER B 1 388 ? 0.704   66.731  -0.666  1.00 268.96 ? 658 SER B CB  1 
ATOM 5485 O OG  . SER B 1 388 ? 0.502   68.132  -0.724  1.00 274.12 ? 658 SER B OG  1 
ATOM 5486 N N   . LEU B 1 389 ? 0.905   64.036  -2.252  1.00 259.18 ? 659 LEU B N   1 
ATOM 5487 C CA  . LEU B 1 389 ? 1.031   62.590  -2.351  1.00 252.09 ? 659 LEU B CA  1 
ATOM 5488 C C   . LEU B 1 389 ? 2.110   62.218  -3.361  1.00 246.95 ? 659 LEU B C   1 
ATOM 5489 O O   . LEU B 1 389 ? 3.037   61.477  -3.036  1.00 241.18 ? 659 LEU B O   1 
ATOM 5490 C CB  . LEU B 1 389 ? -0.306  61.958  -2.742  1.00 248.75 ? 659 LEU B CB  1 
ATOM 5491 N N   . ALA B 1 390 ? 1.950   62.709  -4.591  1.00 246.60 ? 660 ALA B N   1 
ATOM 5492 C CA  . ALA B 1 390 ? 2.867   62.420  -5.698  1.00 242.77 ? 660 ALA B CA  1 
ATOM 5493 C C   . ALA B 1 390 ? 4.342   62.471  -5.297  1.00 234.84 ? 660 ALA B C   1 
ATOM 5494 O O   . ALA B 1 390 ? 5.127   61.600  -5.674  1.00 236.37 ? 660 ALA B O   1 
ATOM 5495 C CB  . ALA B 1 390 ? 2.607   63.379  -6.850  1.00 249.40 ? 660 ALA B CB  1 
ATOM 5496 N N   . GLU B 1 391 ? 4.699   63.501  -4.530  1.00 230.24 ? 661 GLU B N   1 
ATOM 5497 C CA  . GLU B 1 391 ? 6.044   63.656  -3.974  1.00 229.22 ? 661 GLU B CA  1 
ATOM 5498 C C   . GLU B 1 391 ? 6.487   62.391  -3.256  1.00 236.24 ? 661 GLU B C   1 
ATOM 5499 O O   . GLU B 1 391 ? 7.470   61.755  -3.640  1.00 223.17 ? 661 GLU B O   1 
ATOM 5500 C CB  . GLU B 1 391 ? 6.095   64.851  -3.021  1.00 239.35 ? 661 GLU B CB  1 
ATOM 5501 N N   . MET B 1 392 ? 5.755   62.056  -2.196  1.00 259.52 ? 662 MET B N   1 
ATOM 5502 C CA  . MET B 1 392 ? 6.086   60.956  -1.295  1.00 262.12 ? 662 MET B CA  1 
ATOM 5503 C C   . MET B 1 392 ? 6.298   59.667  -2.082  1.00 261.48 ? 662 MET B C   1 
ATOM 5504 O O   . MET B 1 392 ? 7.136   58.835  -1.736  1.00 264.59 ? 662 MET B O   1 
ATOM 5505 C CB  . MET B 1 392 ? 4.985   60.767  -0.249  1.00 269.50 ? 662 MET B CB  1 
ATOM 5506 N N   . HIS B 1 393 ? 5.515   59.525  -3.147  1.00 255.07 ? 663 HIS B N   1 
ATOM 5507 C CA  . HIS B 1 393 ? 5.585   58.386  -4.055  1.00 243.09 ? 663 HIS B CA  1 
ATOM 5508 C C   . HIS B 1 393 ? 6.823   58.419  -4.950  1.00 238.56 ? 663 HIS B C   1 
ATOM 5509 O O   . HIS B 1 393 ? 7.580   57.450  -4.996  1.00 236.10 ? 663 HIS B O   1 
ATOM 5510 C CB  . HIS B 1 393 ? 4.326   58.328  -4.922  1.00 241.27 ? 663 HIS B CB  1 
ATOM 5511 N N   . PHE B 1 394 ? 7.025   59.530  -5.655  1.00 235.65 ? 664 PHE B N   1 
ATOM 5512 C CA  . PHE B 1 394 ? 8.223   59.709  -6.477  1.00 224.06 ? 664 PHE B CA  1 
ATOM 5513 C C   . PHE B 1 394 ? 9.524   59.492  -5.719  1.00 216.41 ? 664 PHE B C   1 
ATOM 5514 O O   . PHE B 1 394 ? 10.456  58.911  -6.261  1.00 214.37 ? 664 PHE B O   1 
ATOM 5515 C CB  . PHE B 1 394 ? 8.256   61.112  -7.094  1.00 230.85 ? 664 PHE B CB  1 
ATOM 5516 C CG  . PHE B 1 394 ? 7.193   61.354  -8.120  1.00 231.81 ? 664 PHE B CG  1 
ATOM 5517 C CD1 . PHE B 1 394 ? 6.868   60.371  -9.037  1.00 225.04 ? 664 PHE B CD1 1 
ATOM 5518 C CD2 . PHE B 1 394 ? 6.543   62.575  -8.193  1.00 238.13 ? 664 PHE B CD2 1 
ATOM 5519 C CE1 . PHE B 1 394 ? 5.902   60.591  -9.995  1.00 226.77 ? 664 PHE B CE1 1 
ATOM 5520 C CE2 . PHE B 1 394 ? 5.572   62.801  -9.147  1.00 238.22 ? 664 PHE B CE2 1 
ATOM 5521 C CZ  . PHE B 1 394 ? 5.252   61.807  -10.051 1.00 233.07 ? 664 PHE B CZ  1 
ATOM 5522 N N   . GLN B 1 395 ? 9.570   59.920  -4.464  1.00 214.36 ? 665 GLN B N   1 
ATOM 5523 C CA  . GLN B 1 395 ? 10.735  59.687  -3.619  1.00 219.75 ? 665 GLN B CA  1 
ATOM 5524 C C   . GLN B 1 395 ? 11.017  58.184  -3.522  1.00 223.84 ? 665 GLN B C   1 
ATOM 5525 O O   . GLN B 1 395 ? 12.151  57.745  -3.717  1.00 221.98 ? 665 GLN B O   1 
ATOM 5526 C CB  . GLN B 1 395 ? 10.507  60.278  -2.223  1.00 221.71 ? 665 GLN B CB  1 
ATOM 5527 C CG  . GLN B 1 395 ? 11.689  60.178  -1.257  1.00 220.57 ? 665 GLN B CG  1 
ATOM 5528 C CD  . GLN B 1 395 ? 12.923  60.936  -1.730  1.00 220.59 ? 665 GLN B CD  1 
ATOM 5529 O OE1 . GLN B 1 395 ? 12.828  61.871  -2.527  1.00 223.56 ? 665 GLN B OE1 1 
ATOM 5530 N NE2 . GLN B 1 395 ? 14.088  60.540  -1.229  1.00 217.94 ? 665 GLN B NE2 1 
ATOM 5531 N N   . LYS B 1 396 ? 9.979   57.404  -3.223  1.00 233.15 ? 666 LYS B N   1 
ATOM 5532 C CA  . LYS B 1 396 ? 10.113  55.958  -3.042  1.00 234.20 ? 666 LYS B CA  1 
ATOM 5533 C C   . LYS B 1 396 ? 10.577  55.248  -4.313  1.00 236.27 ? 666 LYS B C   1 
ATOM 5534 O O   . LYS B 1 396 ? 11.359  54.297  -4.253  1.00 241.84 ? 666 LYS B O   1 
ATOM 5535 C CB  . LYS B 1 396 ? 8.784   55.358  -2.578  1.00 239.57 ? 666 LYS B CB  1 
ATOM 5536 N N   . ALA B 1 397 ? 10.096  55.712  -5.460  1.00 231.87 ? 667 ALA B N   1 
ATOM 5537 C CA  . ALA B 1 397 ? 10.514  55.143  -6.732  1.00 219.30 ? 667 ALA B CA  1 
ATOM 5538 C C   . ALA B 1 397 ? 11.953  55.546  -7.003  1.00 213.23 ? 667 ALA B C   1 
ATOM 5539 O O   . ALA B 1 397 ? 12.796  54.713  -7.340  1.00 220.03 ? 667 ALA B O   1 
ATOM 5540 C CB  . ALA B 1 397 ? 9.604   55.605  -7.855  1.00 220.47 ? 667 ALA B CB  1 
ATOM 5541 N N   . LEU B 1 398 ? 12.218  56.839  -6.842  1.00 207.48 ? 668 LEU B N   1 
ATOM 5542 C CA  . LEU B 1 398 ? 13.536  57.414  -7.077  1.00 204.70 ? 668 LEU B CA  1 
ATOM 5543 C C   . LEU B 1 398 ? 14.570  57.008  -6.021  1.00 208.58 ? 668 LEU B C   1 
ATOM 5544 O O   . LEU B 1 398 ? 15.769  57.079  -6.283  1.00 209.35 ? 668 LEU B O   1 
ATOM 5545 C CB  . LEU B 1 398 ? 13.435  58.938  -7.155  1.00 205.94 ? 668 LEU B CB  1 
ATOM 5546 C CG  . LEU B 1 398 ? 12.638  59.416  -8.374  1.00 204.32 ? 668 LEU B CG  1 
ATOM 5547 C CD1 . LEU B 1 398 ? 12.115  60.836  -8.179  1.00 205.18 ? 668 LEU B CD1 1 
ATOM 5548 C CD2 . LEU B 1 398 ? 13.435  59.290  -9.656  1.00 205.80 ? 668 LEU B CD2 1 
ATOM 5549 N N   . ASP B 1 399 ? 14.120  56.586  -4.838  1.00 217.45 ? 669 ASP B N   1 
ATOM 5550 C CA  . ASP B 1 399 ? 15.037  55.950  -3.886  1.00 221.37 ? 669 ASP B CA  1 
ATOM 5551 C C   . ASP B 1 399 ? 15.550  54.628  -4.434  1.00 217.92 ? 669 ASP B C   1 
ATOM 5552 O O   . ASP B 1 399 ? 16.742  54.342  -4.343  1.00 222.66 ? 669 ASP B O   1 
ATOM 5553 C CB  . ASP B 1 399 ? 14.378  55.722  -2.516  1.00 227.96 ? 669 ASP B CB  1 
ATOM 5554 C CG  . ASP B 1 399 ? 14.426  56.952  -1.629  1.00 241.97 ? 669 ASP B CG  1 
ATOM 5555 O OD1 . ASP B 1 399 ? 15.386  57.739  -1.768  1.00 245.15 ? 669 ASP B OD1 1 
ATOM 5556 O OD2 . ASP B 1 399 ? 13.516  57.134  -0.792  1.00 249.47 ? 669 ASP B OD2 1 
ATOM 5557 N N   . ILE B 1 400 ? 14.655  53.822  -4.995  1.00 210.26 ? 670 ILE B N   1 
ATOM 5558 C CA  . ILE B 1 400 ? 15.041  52.525  -5.543  1.00 203.53 ? 670 ILE B CA  1 
ATOM 5559 C C   . ILE B 1 400 ? 15.895  52.699  -6.799  1.00 196.98 ? 670 ILE B C   1 
ATOM 5560 O O   . ILE B 1 400 ? 16.985  52.135  -6.911  1.00 194.95 ? 670 ILE B O   1 
ATOM 5561 C CB  . ILE B 1 400 ? 13.808  51.662  -5.876  1.00 203.07 ? 670 ILE B CB  1 
ATOM 5562 N N   . ASN B 1 401 ? 15.382  53.477  -7.746  1.00 199.31 ? 671 ASN B N   1 
ATOM 5563 C CA  . ASN B 1 401 ? 16.057  53.712  -9.015  1.00 198.66 ? 671 ASN B CA  1 
ATOM 5564 C C   . ASN B 1 401 ? 15.946  55.196  -9.356  1.00 204.28 ? 671 ASN B C   1 
ATOM 5565 O O   . ASN B 1 401 ? 14.847  55.698  -9.594  1.00 209.65 ? 671 ASN B O   1 
ATOM 5566 C CB  . ASN B 1 401 ? 15.452  52.836  -10.111 1.00 190.43 ? 671 ASN B CB  1 
ATOM 5567 C CG  . ASN B 1 401 ? 15.987  53.165  -11.487 1.00 187.82 ? 671 ASN B CG  1 
ATOM 5568 O OD1 . ASN B 1 401 ? 17.188  53.362  -11.672 1.00 187.19 ? 671 ASN B OD1 1 
ATOM 5569 N ND2 . ASN B 1 401 ? 15.093  53.219  -12.466 1.00 190.01 ? 671 ASN B ND2 1 
ATOM 5570 N N   . PRO B 1 402 ? 17.086  55.906  -9.375  1.00 204.19 ? 672 PRO B N   1 
ATOM 5571 C CA  . PRO B 1 402 ? 17.085  57.351  -9.636  1.00 207.79 ? 672 PRO B CA  1 
ATOM 5572 C C   . PRO B 1 402 ? 16.583  57.784  -11.012 1.00 203.59 ? 672 PRO B C   1 
ATOM 5573 O O   . PRO B 1 402 ? 16.063  58.889  -11.135 1.00 198.77 ? 672 PRO B O   1 
ATOM 5574 C CB  . PRO B 1 402 ? 18.561  57.721  -9.485  1.00 213.29 ? 672 PRO B CB  1 
ATOM 5575 C CG  . PRO B 1 402 ? 19.281  56.500  -9.929  1.00 210.67 ? 672 PRO B CG  1 
ATOM 5576 C CD  . PRO B 1 402 ? 18.451  55.350  -9.403  1.00 204.09 ? 672 PRO B CD  1 
ATOM 5577 N N   . GLN B 1 403 ? 16.784  56.964  -12.036 1.00 202.76 ? 673 GLN B N   1 
ATOM 5578 C CA  . GLN B 1 403 ? 16.450  57.373  -13.396 1.00 208.38 ? 673 GLN B CA  1 
ATOM 5579 C C   . GLN B 1 403 ? 15.029  57.020  -13.831 1.00 212.58 ? 673 GLN B C   1 
ATOM 5580 O O   . GLN B 1 403 ? 14.753  56.978  -15.029 1.00 214.13 ? 673 GLN B O   1 
ATOM 5581 C CB  . GLN B 1 403 ? 17.448  56.773  -14.387 1.00 210.14 ? 673 GLN B CB  1 
ATOM 5582 N N   . SER B 1 404 ? 14.131  56.752  -12.886 1.00 221.84 ? 674 SER B N   1 
ATOM 5583 C CA  . SER B 1 404 ? 12.888  56.062  -13.231 1.00 223.31 ? 674 SER B CA  1 
ATOM 5584 C C   . SER B 1 404 ? 11.989  56.943  -14.093 1.00 226.36 ? 674 SER B C   1 
ATOM 5585 O O   . SER B 1 404 ? 11.142  56.445  -14.837 1.00 236.09 ? 674 SER B O   1 
ATOM 5586 C CB  . SER B 1 404 ? 12.141  55.626  -11.970 1.00 227.57 ? 674 SER B CB  1 
ATOM 5587 O OG  . SER B 1 404 ? 13.040  55.319  -10.919 1.00 229.49 ? 674 SER B OG  1 
ATOM 5588 N N   . SER B 1 405 ? 12.176  58.253  -13.979 1.00 219.85 ? 675 SER B N   1 
ATOM 5589 C CA  . SER B 1 405 ? 11.383  59.217  -14.726 1.00 205.68 ? 675 SER B CA  1 
ATOM 5590 C C   . SER B 1 405 ? 11.492  59.003  -16.237 1.00 201.70 ? 675 SER B C   1 
ATOM 5591 O O   . SER B 1 405 ? 10.483  58.930  -16.930 1.00 204.67 ? 675 SER B O   1 
ATOM 5592 C CB  . SER B 1 405 ? 11.815  60.636  -14.359 1.00 204.12 ? 675 SER B CB  1 
ATOM 5593 O OG  . SER B 1 405 ? 11.568  60.891  -12.988 1.00 199.27 ? 675 SER B OG  1 
ATOM 5594 N N   . VAL B 1 406 ? 12.721  58.839  -16.725 1.00 197.81 ? 676 VAL B N   1 
ATOM 5595 C CA  . VAL B 1 406 ? 12.988  58.728  -18.162 1.00 199.15 ? 676 VAL B CA  1 
ATOM 5596 C C   . VAL B 1 406 ? 12.193  57.600  -18.815 1.00 203.13 ? 676 VAL B C   1 
ATOM 5597 O O   . VAL B 1 406 ? 11.634  57.768  -19.900 1.00 207.21 ? 676 VAL B O   1 
ATOM 5598 C CB  . VAL B 1 406 ? 14.495  58.508  -18.435 1.00 193.04 ? 676 VAL B CB  1 
ATOM 5599 C CG1 . VAL B 1 406 ? 14.733  58.115  -19.887 1.00 194.10 ? 676 VAL B CG1 1 
ATOM 5600 C CG2 . VAL B 1 406 ? 15.289  59.757  -18.081 1.00 193.84 ? 676 VAL B CG2 1 
ATOM 5601 N N   . LEU B 1 407 ? 12.109  56.465  -18.132 1.00 204.29 ? 677 LEU B N   1 
ATOM 5602 C CA  . LEU B 1 407 ? 11.383  55.315  -18.652 1.00 200.95 ? 677 LEU B CA  1 
ATOM 5603 C C   . LEU B 1 407 ? 9.886   55.566  -18.526 1.00 200.53 ? 677 LEU B C   1 
ATOM 5604 O O   . LEU B 1 407 ? 9.129   55.348  -19.472 1.00 198.97 ? 677 LEU B O   1 
ATOM 5605 C CB  . LEU B 1 407 ? 11.781  54.034  -17.916 1.00 200.46 ? 677 LEU B CB  1 
ATOM 5606 N N   . LEU B 1 408 ? 9.463   56.019  -17.349 1.00 197.11 ? 678 LEU B N   1 
ATOM 5607 C CA  . LEU B 1 408 ? 8.045   56.182  -17.056 1.00 184.59 ? 678 LEU B CA  1 
ATOM 5608 C C   . LEU B 1 408 ? 7.445   57.351  -17.837 1.00 190.26 ? 678 LEU B C   1 
ATOM 5609 O O   . LEU B 1 408 ? 6.280   57.307  -18.232 1.00 195.71 ? 678 LEU B O   1 
ATOM 5610 C CB  . LEU B 1 408 ? 7.835   56.391  -15.555 1.00 176.50 ? 678 LEU B CB  1 
ATOM 5611 N N   . CYS B 1 409 ? 8.240   58.395  -18.054 1.00 191.75 ? 679 CYS B N   1 
ATOM 5612 C CA  . CYS B 1 409 ? 7.825   59.522  -18.889 1.00 189.80 ? 679 CYS B CA  1 
ATOM 5613 C C   . CYS B 1 409 ? 7.771   59.135  -20.365 1.00 191.08 ? 679 CYS B C   1 
ATOM 5614 O O   . CYS B 1 409 ? 6.947   59.655  -21.116 1.00 192.64 ? 679 CYS B O   1 
ATOM 5615 C CB  . CYS B 1 409 ? 8.745   60.731  -18.696 1.00 189.29 ? 679 CYS B CB  1 
ATOM 5616 S SG  . CYS B 1 409 ? 8.777   61.400  -17.014 1.00 235.79 ? 679 CYS B SG  1 
ATOM 5617 N N   . HIS B 1 410 ? 8.651   58.226  -20.777 1.00 197.67 ? 680 HIS B N   1 
ATOM 5618 C CA  . HIS B 1 410 ? 8.607   57.694  -22.137 1.00 204.04 ? 680 HIS B CA  1 
ATOM 5619 C C   . HIS B 1 410 ? 7.310   56.940  -22.393 1.00 209.46 ? 680 HIS B C   1 
ATOM 5620 O O   . HIS B 1 410 ? 6.743   57.044  -23.482 1.00 219.98 ? 680 HIS B O   1 
ATOM 5621 C CB  . HIS B 1 410 ? 9.803   56.767  -22.386 1.00 206.01 ? 680 HIS B CB  1 
ATOM 5622 C CG  . HIS B 1 410 ? 10.051  56.461  -23.833 1.00 212.92 ? 680 HIS B CG  1 
ATOM 5623 N ND1 . HIS B 1 410 ? 9.043   56.121  -24.709 1.00 217.06 ? 680 HIS B ND1 1 
ATOM 5624 C CD2 . HIS B 1 410 ? 11.198  56.434  -24.552 1.00 213.18 ? 680 HIS B CD2 1 
ATOM 5625 C CE1 . HIS B 1 410 ? 9.557   55.903  -25.906 1.00 217.56 ? 680 HIS B CE1 1 
ATOM 5626 N NE2 . HIS B 1 410 ? 10.863  56.086  -25.839 1.00 216.15 ? 680 HIS B NE2 1 
ATOM 5627 N N   . ILE B 1 411 ? 6.866   56.164  -21.407 1.00 197.67 ? 681 ILE B N   1 
ATOM 5628 C CA  . ILE B 1 411 ? 5.621   55.408  -21.519 1.00 192.59 ? 681 ILE B CA  1 
ATOM 5629 C C   . ILE B 1 411 ? 4.479   56.290  -22.018 1.00 195.77 ? 681 ILE B C   1 
ATOM 5630 O O   . ILE B 1 411 ? 3.743   55.918  -22.932 1.00 192.02 ? 681 ILE B O   1 
ATOM 5631 C CB  . ILE B 1 411 ? 5.219   54.780  -20.172 1.00 196.44 ? 681 ILE B CB  1 
ATOM 5632 N N   . GLY B 1 412 ? 4.345   57.462  -21.402 1.00 205.11 ? 682 GLY B N   1 
ATOM 5633 C CA  . GLY B 1 412 ? 3.311   58.413  -21.763 1.00 218.47 ? 682 GLY B CA  1 
ATOM 5634 C C   . GLY B 1 412 ? 3.407   58.949  -23.178 1.00 229.11 ? 682 GLY B C   1 
ATOM 5635 O O   . GLY B 1 412 ? 2.386   59.216  -23.815 1.00 238.10 ? 682 GLY B O   1 
ATOM 5636 N N   . VAL B 1 413 ? 4.630   59.105  -23.678 1.00 222.69 ? 683 VAL B N   1 
ATOM 5637 C CA  . VAL B 1 413 ? 4.817   59.634  -25.021 1.00 217.27 ? 683 VAL B CA  1 
ATOM 5638 C C   . VAL B 1 413 ? 4.511   58.576  -26.069 1.00 214.60 ? 683 VAL B C   1 
ATOM 5639 O O   . VAL B 1 413 ? 4.097   58.895  -27.184 1.00 214.52 ? 683 VAL B O   1 
ATOM 5640 C CB  . VAL B 1 413 ? 6.256   60.146  -25.231 1.00 214.01 ? 683 VAL B CB  1 
ATOM 5641 N N   . VAL B 1 414 ? 4.707   57.314  -25.705 1.00 211.74 ? 684 VAL B N   1 
ATOM 5642 C CA  . VAL B 1 414 ? 4.353   56.219  -26.593 1.00 208.93 ? 684 VAL B CA  1 
ATOM 5643 C C   . VAL B 1 414 ? 2.846   55.991  -26.570 1.00 211.71 ? 684 VAL B C   1 
ATOM 5644 O O   . VAL B 1 414 ? 2.204   55.899  -27.617 1.00 208.50 ? 684 VAL B O   1 
ATOM 5645 C CB  . VAL B 1 414 ? 5.078   54.918  -26.205 1.00 202.88 ? 684 VAL B CB  1 
ATOM 5646 N N   . GLN B 1 415 ? 2.302   55.881  -25.360 1.00 218.51 ? 685 GLN B N   1 
ATOM 5647 C CA  . GLN B 1 415 ? 0.861   55.813  -25.127 1.00 225.10 ? 685 GLN B CA  1 
ATOM 5648 C C   . GLN B 1 415 ? 0.046   56.843  -25.906 1.00 233.17 ? 685 GLN B C   1 
ATOM 5649 O O   . GLN B 1 415 ? -1.040  56.544  -26.402 1.00 239.52 ? 685 GLN B O   1 
ATOM 5650 C CB  . GLN B 1 415 ? 0.570   55.969  -23.631 1.00 223.96 ? 685 GLN B CB  1 
ATOM 5651 N N   . HIS B 1 416 ? 0.583   58.055  -26.007 1.00 232.05 ? 686 HIS B N   1 
ATOM 5652 C CA  . HIS B 1 416 ? -0.070  59.142  -26.731 1.00 239.46 ? 686 HIS B CA  1 
ATOM 5653 C C   . HIS B 1 416 ? -0.128  58.949  -28.244 1.00 252.30 ? 686 HIS B C   1 
ATOM 5654 O O   . HIS B 1 416 ? -1.123  59.292  -28.882 1.00 264.09 ? 686 HIS B O   1 
ATOM 5655 C CB  . HIS B 1 416 ? 0.635   60.464  -26.420 1.00 233.17 ? 686 HIS B CB  1 
ATOM 5656 N N   . ALA B 1 417 ? 0.931   58.382  -28.811 1.00 253.39 ? 687 ALA B N   1 
ATOM 5657 C CA  . ALA B 1 417 ? 0.925   57.999  -30.217 1.00 252.45 ? 687 ALA B CA  1 
ATOM 5658 C C   . ALA B 1 417 ? -0.049  56.857  -30.478 1.00 250.88 ? 687 ALA B C   1 
ATOM 5659 O O   . ALA B 1 417 ? -0.776  56.867  -31.472 1.00 253.01 ? 687 ALA B O   1 
ATOM 5660 C CB  . ALA B 1 417 ? 2.327   57.613  -30.666 1.00 239.60 ? 687 ALA B CB  1 
ATOM 5661 N N   . THR B 1 427 ? -2.159  75.978  -15.296 1.00 314.01 ? 697 THR B N   1 
ATOM 5662 C CA  . THR B 1 427 ? -1.487  75.091  -14.356 1.00 313.99 ? 697 THR B CA  1 
ATOM 5663 C C   . THR B 1 427 ? -0.010  75.456  -14.208 1.00 308.52 ? 697 THR B C   1 
ATOM 5664 O O   . THR B 1 427 ? 0.597   75.218  -13.164 1.00 298.70 ? 697 THR B O   1 
ATOM 5665 C CB  . THR B 1 427 ? -1.601  73.625  -14.816 1.00 300.12 ? 697 THR B CB  1 
ATOM 5666 N N   . LEU B 1 428 ? 0.543   76.052  -15.261 1.00 313.63 ? 698 LEU B N   1 
ATOM 5667 C CA  . LEU B 1 428 ? 1.947   76.471  -15.335 1.00 315.27 ? 698 LEU B CA  1 
ATOM 5668 C C   . LEU B 1 428 ? 2.455   77.200  -14.086 1.00 325.31 ? 698 LEU B C   1 
ATOM 5669 O O   . LEU B 1 428 ? 3.619   77.068  -13.705 1.00 321.53 ? 698 LEU B O   1 
ATOM 5670 C CB  . LEU B 1 428 ? 2.168   77.352  -16.566 1.00 320.90 ? 698 LEU B CB  1 
ATOM 5671 N N   . ASN B 1 429 ? 1.564   77.953  -13.449 1.00 336.68 ? 699 ASN B N   1 
ATOM 5672 C CA  . ASN B 1 429 ? 1.855   78.587  -12.167 1.00 339.35 ? 699 ASN B CA  1 
ATOM 5673 C C   . ASN B 1 429 ? 1.635   77.656  -10.983 1.00 331.08 ? 699 ASN B C   1 
ATOM 5674 O O   . ASN B 1 429 ? 2.401   77.702  -10.020 1.00 332.70 ? 699 ASN B O   1 
ATOM 5675 C CB  . ASN B 1 429 ? 1.003   79.848  -12.000 1.00 340.61 ? 699 ASN B CB  1 
ATOM 5676 N N   . LYS B 1 430 ? 0.573   76.855  -11.038 1.00 319.96 ? 700 LYS B N   1 
ATOM 5677 C CA  . LYS B 1 430 ? 0.200   75.947  -9.951  1.00 310.80 ? 700 LYS B CA  1 
ATOM 5678 C C   . LYS B 1 430 ? 1.432   75.211  -9.422  1.00 303.53 ? 700 LYS B C   1 
ATOM 5679 O O   . LYS B 1 430 ? 1.853   75.425  -8.284  1.00 304.31 ? 700 LYS B O   1 
ATOM 5680 C CB  . LYS B 1 430 ? -0.862  74.947  -10.413 1.00 308.86 ? 700 LYS B CB  1 
ATOM 5681 N N   . ALA B 1 431 ? 1.991   74.333  -10.250 1.00 298.99 ? 701 ALA B N   1 
ATOM 5682 C CA  . ALA B 1 431 ? 3.091   73.458  -9.848  1.00 288.89 ? 701 ALA B CA  1 
ATOM 5683 C C   . ALA B 1 431 ? 4.372   74.224  -9.506  1.00 292.86 ? 701 ALA B C   1 
ATOM 5684 O O   . ALA B 1 431 ? 5.250   73.696  -8.827  1.00 288.96 ? 701 ALA B O   1 
ATOM 5685 C CB  . ALA B 1 431 ? 3.374   72.447  -10.949 1.00 281.31 ? 701 ALA B CB  1 
ATOM 5686 N N   . ILE B 1 432 ? 4.462   75.470  -9.957  1.00 302.34 ? 702 ILE B N   1 
ATOM 5687 C CA  . ILE B 1 432 ? 5.584   76.341  -9.616  1.00 309.89 ? 702 ILE B CA  1 
ATOM 5688 C C   . ILE B 1 432 ? 5.530   76.751  -8.148  1.00 321.07 ? 702 ILE B C   1 
ATOM 5689 O O   . ILE B 1 432 ? 6.556   76.828  -7.472  1.00 322.72 ? 702 ILE B O   1 
ATOM 5690 C CB  . ILE B 1 432 ? 5.612   77.605  -10.494 1.00 323.61 ? 702 ILE B CB  1 
ATOM 5691 N N   . VAL B 1 433 ? 4.322   77.014  -7.664  1.00 335.96 ? 703 VAL B N   1 
ATOM 5692 C CA  . VAL B 1 433 ? 4.106   77.354  -6.265  1.00 349.13 ? 703 VAL B CA  1 
ATOM 5693 C C   . VAL B 1 433 ? 4.325   76.137  -5.372  1.00 338.39 ? 703 VAL B C   1 
ATOM 5694 O O   . VAL B 1 433 ? 4.983   76.233  -4.335  1.00 339.85 ? 703 VAL B O   1 
ATOM 5695 C CB  . VAL B 1 433 ? 2.688   77.901  -6.028  1.00 362.80 ? 703 VAL B CB  1 
ATOM 5696 N N   . ILE B 1 434 ? 3.759   75.001  -5.767  1.00 328.46 ? 704 ILE B N   1 
ATOM 5697 C CA  . ILE B 1 434 ? 4.084   73.740  -5.125  1.00 312.51 ? 704 ILE B CA  1 
ATOM 5698 C C   . ILE B 1 434 ? 5.585   73.427  -5.145  1.00 304.75 ? 704 ILE B C   1 
ATOM 5699 O O   . ILE B 1 434 ? 6.121   72.901  -4.171  1.00 301.26 ? 704 ILE B O   1 
ATOM 5700 C CB  . ILE B 1 434 ? 3.335   72.571  -5.799  1.00 308.27 ? 704 ILE B CB  1 
ATOM 5701 N N   . ASP B 1 435 ? 6.251   73.744  -6.260  1.00 304.23 ? 705 ASP B N   1 
ATOM 5702 C CA  . ASP B 1 435 ? 7.699   73.535  -6.416  1.00 294.93 ? 705 ASP B CA  1 
ATOM 5703 C C   . ASP B 1 435 ? 8.565   74.133  -5.313  1.00 292.57 ? 705 ASP B C   1 
ATOM 5704 O O   . ASP B 1 435 ? 9.731   73.737  -5.161  1.00 286.98 ? 705 ASP B O   1 
ATOM 5705 C CB  . ASP B 1 435 ? 8.166   74.109  -7.753  1.00 294.57 ? 705 ASP B CB  1 
ATOM 5706 N N   . PRO B 1 436 ? 8.012   75.076  -4.544  1.00 293.31 ? 706 PRO B N   1 
ATOM 5707 C CA  . PRO B 1 436 ? 8.718   75.504  -3.328  1.00 295.45 ? 706 PRO B CA  1 
ATOM 5708 C C   . PRO B 1 436 ? 8.799   74.365  -2.307  1.00 291.58 ? 706 PRO B C   1 
ATOM 5709 O O   . PRO B 1 436 ? 9.876   73.824  -2.066  1.00 286.12 ? 706 PRO B O   1 
ATOM 5710 C CB  . PRO B 1 436 ? 7.844   76.648  -2.824  1.00 310.32 ? 706 PRO B CB  1 
ATOM 5711 N N   . LYS B 1 437 ? 7.635   73.923  -1.844  1.00 297.84 ? 707 LYS B N   1 
ATOM 5712 C CA  . LYS B 1 437 ? 7.582   72.858  -0.831  1.00 297.30 ? 707 LYS B CA  1 
ATOM 5713 C C   . LYS B 1 437 ? 7.802   71.475  -1.439  1.00 288.62 ? 707 LYS B C   1 
ATOM 5714 O O   . LYS B 1 437 ? 8.345   70.598  -0.789  1.00 280.54 ? 707 LYS B O   1 
ATOM 5715 C CB  . LYS B 1 437 ? 6.245   72.900  -0.089  1.00 302.91 ? 707 LYS B CB  1 
ATOM 5716 N N   . ASN B 1 438 ? 7.361   71.316  -2.695  1.00 286.92 ? 708 ASN B N   1 
ATOM 5717 C CA  . ASN B 1 438 ? 7.301   70.024  -3.387  1.00 271.70 ? 708 ASN B CA  1 
ATOM 5718 C C   . ASN B 1 438 ? 8.204   69.828  -4.628  1.00 260.29 ? 708 ASN B C   1 
ATOM 5719 O O   . ASN B 1 438 ? 7.704   69.844  -5.752  1.00 261.75 ? 708 ASN B O   1 
ATOM 5720 C CB  . ASN B 1 438 ? 5.854   69.733  -3.804  1.00 278.15 ? 708 ASN B CB  1 
ATOM 5721 N N   . PRO B 1 439 ? 9.517   69.646  -4.432  1.00 249.89 ? 709 PRO B N   1 
ATOM 5722 C CA  . PRO B 1 439 ? 10.491  69.563  -5.529  1.00 239.57 ? 709 PRO B CA  1 
ATOM 5723 C C   . PRO B 1 439 ? 10.313  68.409  -6.527  1.00 230.46 ? 709 PRO B C   1 
ATOM 5724 O O   . PRO B 1 439 ? 10.461  68.634  -7.729  1.00 230.68 ? 709 PRO B O   1 
ATOM 5725 C CB  . PRO B 1 439 ? 11.826  69.381  -4.796  1.00 232.99 ? 709 PRO B CB  1 
ATOM 5726 C CG  . PRO B 1 439 ? 11.460  68.847  -3.453  1.00 236.22 ? 709 PRO B CG  1 
ATOM 5727 C CD  . PRO B 1 439 ? 10.145  69.464  -3.116  1.00 246.69 ? 709 PRO B CD  1 
ATOM 5728 N N   . LEU B 1 440 ? 10.012  67.205  -6.049  1.00 225.82 ? 710 LEU B N   1 
ATOM 5729 C CA  . LEU B 1 440 ? 9.878   66.051  -6.943  1.00 226.12 ? 710 LEU B CA  1 
ATOM 5730 C C   . LEU B 1 440 ? 8.796   66.179  -8.017  1.00 235.58 ? 710 LEU B C   1 
ATOM 5731 O O   . LEU B 1 440 ? 8.982   65.720  -9.144  1.00 228.20 ? 710 LEU B O   1 
ATOM 5732 C CB  . LEU B 1 440 ? 9.607   64.790  -6.116  1.00 215.37 ? 710 LEU B CB  1 
ATOM 5733 N N   . CYS B 1 441 ? 7.666   66.782  -7.668  1.00 248.81 ? 711 CYS B N   1 
ATOM 5734 C CA  . CYS B 1 441 ? 6.608   67.037  -8.640  1.00 259.50 ? 711 CYS B CA  1 
ATOM 5735 C C   . CYS B 1 441 ? 7.043   67.950  -9.788  1.00 263.72 ? 711 CYS B C   1 
ATOM 5736 O O   . CYS B 1 441 ? 6.609   67.784  -10.929 1.00 268.99 ? 711 CYS B O   1 
ATOM 5737 C CB  . CYS B 1 441 ? 5.394   67.622  -7.927  1.00 270.91 ? 711 CYS B CB  1 
ATOM 5738 S SG  . CYS B 1 441 ? 4.882   66.612  -6.525  1.00 299.87 ? 711 CYS B SG  1 
ATOM 5739 N N   . LYS B 1 442 ? 7.902   68.914  -9.470  1.00 256.02 ? 712 LYS B N   1 
ATOM 5740 C CA  . LYS B 1 442 ? 8.520   69.786  -10.466 1.00 245.04 ? 712 LYS B CA  1 
ATOM 5741 C C   . LYS B 1 442 ? 9.494   69.082  -11.408 1.00 228.83 ? 712 LYS B C   1 
ATOM 5742 O O   . LYS B 1 442 ? 9.469   69.305  -12.619 1.00 231.68 ? 712 LYS B O   1 
ATOM 5743 C CB  . LYS B 1 442 ? 9.245   70.936  -9.763  1.00 253.35 ? 712 LYS B CB  1 
ATOM 5744 N N   . PHE B 1 443 ? 10.344  68.232  -10.842 1.00 213.34 ? 713 PHE B N   1 
ATOM 5745 C CA  . PHE B 1 443 ? 11.271  67.415  -11.621 1.00 204.56 ? 713 PHE B CA  1 
ATOM 5746 C C   . PHE B 1 443 ? 10.565  66.535  -12.646 1.00 212.76 ? 713 PHE B C   1 
ATOM 5747 O O   . PHE B 1 443 ? 11.003  66.436  -13.794 1.00 207.26 ? 713 PHE B O   1 
ATOM 5748 C CB  . PHE B 1 443 ? 12.118  66.545  -10.691 1.00 189.17 ? 713 PHE B CB  1 
ATOM 5749 N N   . HIS B 1 444 ? 9.476   65.899  -12.229 1.00 230.98 ? 714 HIS B N   1 
ATOM 5750 C CA  . HIS B 1 444 ? 8.720   65.026  -13.117 1.00 238.08 ? 714 HIS B CA  1 
ATOM 5751 C C   . HIS B 1 444 ? 8.089   65.824  -14.251 1.00 250.87 ? 714 HIS B C   1 
ATOM 5752 O O   . HIS B 1 444 ? 7.976   65.334  -15.375 1.00 248.41 ? 714 HIS B O   1 
ATOM 5753 C CB  . HIS B 1 444 ? 7.642   64.269  -12.338 1.00 230.19 ? 714 HIS B CB  1 
ATOM 5754 N N   . ARG B 1 445 ? 7.671   67.050  -13.952 1.00 259.71 ? 715 ARG B N   1 
ATOM 5755 C CA  . ARG B 1 445 ? 7.101   67.919  -14.972 1.00 263.76 ? 715 ARG B CA  1 
ATOM 5756 C C   . ARG B 1 445 ? 8.144   68.283  -16.025 1.00 257.72 ? 715 ARG B C   1 
ATOM 5757 O O   . ARG B 1 445 ? 7.838   68.356  -17.215 1.00 256.82 ? 715 ARG B O   1 
ATOM 5758 C CB  . ARG B 1 445 ? 6.530   69.189  -14.337 1.00 275.59 ? 715 ARG B CB  1 
ATOM 5759 N N   . ALA B 1 446 ? 9.378   68.509  -15.582 1.00 247.04 ? 716 ALA B N   1 
ATOM 5760 C CA  . ALA B 1 446 ? 10.480  68.765  -16.502 1.00 235.22 ? 716 ALA B CA  1 
ATOM 5761 C C   . ALA B 1 446 ? 10.857  67.509  -17.277 1.00 226.03 ? 716 ALA B C   1 
ATOM 5762 O O   . ALA B 1 446 ? 11.218  67.577  -18.452 1.00 225.58 ? 716 ALA B O   1 
ATOM 5763 C CB  . ALA B 1 446 ? 11.685  69.301  -15.745 1.00 239.90 ? 716 ALA B CB  1 
ATOM 5764 N N   . SER B 1 447 ? 10.771  66.364  -16.609 1.00 222.75 ? 717 SER B N   1 
ATOM 5765 C CA  . SER B 1 447 ? 11.075  65.084  -17.237 1.00 225.38 ? 717 SER B CA  1 
ATOM 5766 C C   . SER B 1 447 ? 10.091  64.742  -18.351 1.00 226.82 ? 717 SER B C   1 
ATOM 5767 O O   . SER B 1 447 ? 10.491  64.283  -19.421 1.00 220.90 ? 717 SER B O   1 
ATOM 5768 C CB  . SER B 1 447 ? 11.091  63.967  -16.190 1.00 230.50 ? 717 SER B CB  1 
ATOM 5769 O OG  . SER B 1 447 ? 12.140  64.155  -15.255 1.00 232.29 ? 717 SER B OG  1 
ATOM 5770 N N   . VAL B 1 448 ? 8.805   64.959  -18.094 1.00 240.69 ? 718 VAL B N   1 
ATOM 5771 C CA  . VAL B 1 448 ? 7.778   64.708  -19.099 1.00 247.31 ? 718 VAL B CA  1 
ATOM 5772 C C   . VAL B 1 448 ? 7.870   65.659  -20.291 1.00 254.86 ? 718 VAL B C   1 
ATOM 5773 O O   . VAL B 1 448 ? 7.478   65.308  -21.404 1.00 259.02 ? 718 VAL B O   1 
ATOM 5774 C CB  . VAL B 1 448 ? 6.366   64.818  -18.489 1.00 252.84 ? 718 VAL B CB  1 
ATOM 5775 N N   . LEU B 1 449 ? 8.383   66.862  -20.052 1.00 249.17 ? 719 LEU B N   1 
ATOM 5776 C CA  . LEU B 1 449 ? 8.651   67.815  -21.125 1.00 246.28 ? 719 LEU B CA  1 
ATOM 5777 C C   . LEU B 1 449 ? 9.860   67.420  -21.970 1.00 237.36 ? 719 LEU B C   1 
ATOM 5778 O O   . LEU B 1 449 ? 9.865   67.582  -23.190 1.00 234.75 ? 719 LEU B O   1 
ATOM 5779 C CB  . LEU B 1 449 ? 8.863   69.216  -20.546 1.00 250.24 ? 719 LEU B CB  1 
ATOM 5780 N N   . PHE B 1 450 ? 10.875  66.886  -21.298 1.00 233.84 ? 720 PHE B N   1 
ATOM 5781 C CA  . PHE B 1 450 ? 12.071  66.348  -21.941 1.00 232.39 ? 720 PHE B CA  1 
ATOM 5782 C C   . PHE B 1 450 ? 11.733  65.084  -22.731 1.00 241.47 ? 720 PHE B C   1 
ATOM 5783 O O   . PHE B 1 450 ? 12.355  64.794  -23.753 1.00 243.29 ? 720 PHE B O   1 
ATOM 5784 C CB  . PHE B 1 450 ? 13.170  66.082  -20.909 1.00 223.48 ? 720 PHE B CB  1 
ATOM 5785 C CG  . PHE B 1 450 ? 14.306  65.251  -21.430 1.00 213.79 ? 720 PHE B CG  1 
ATOM 5786 C CD1 . PHE B 1 450 ? 15.163  65.768  -22.389 1.00 207.67 ? 720 PHE B CD1 1 
ATOM 5787 C CD2 . PHE B 1 450 ? 14.546  63.978  -20.943 1.00 212.20 ? 720 PHE B CD2 1 
ATOM 5788 C CE1 . PHE B 1 450 ? 16.220  65.024  -22.874 1.00 198.81 ? 720 PHE B CE1 1 
ATOM 5789 C CE2 . PHE B 1 450 ? 15.606  63.227  -21.422 1.00 203.86 ? 720 PHE B CE2 1 
ATOM 5790 C CZ  . PHE B 1 450 ? 16.444  63.752  -22.389 1.00 199.64 ? 720 PHE B CZ  1 
ATOM 5791 N N   . ALA B 1 451 ? 10.772  64.318  -22.223 1.00 253.14 ? 721 ALA B N   1 
ATOM 5792 C CA  . ALA B 1 451 ? 10.330  63.078  -22.856 1.00 241.85 ? 721 ALA B CA  1 
ATOM 5793 C C   . ALA B 1 451 ? 9.600   63.385  -24.163 1.00 241.53 ? 721 ALA B C   1 
ATOM 5794 O O   . ALA B 1 451 ? 9.746   62.667  -25.152 1.00 247.49 ? 721 ALA B O   1 
ATOM 5795 C CB  . ALA B 1 451 ? 9.434   62.289  -21.918 1.00 250.43 ? 721 ALA B CB  1 
ATOM 5796 N N   . ASN B 1 452 ? 8.811   64.455  -24.153 1.00 244.69 ? 722 ASN B N   1 
ATOM 5797 C CA  . ASN B 1 452 ? 8.370   65.096  -25.388 1.00 226.48 ? 722 ASN B CA  1 
ATOM 5798 C C   . ASN B 1 452 ? 9.541   65.865  -25.992 1.00 225.83 ? 722 ASN B C   1 
ATOM 5799 O O   . ASN B 1 452 ? 10.599  65.954  -25.376 1.00 222.49 ? 722 ASN B O   1 
ATOM 5800 C CB  . ASN B 1 452 ? 7.183   66.024  -25.128 1.00 232.89 ? 722 ASN B CB  1 
ATOM 5801 N N   . GLU B 1 453 ? 9.375   66.437  -27.180 1.00 237.33 ? 723 GLU B N   1 
ATOM 5802 C CA  . GLU B 1 453 ? 10.531  67.024  -27.853 1.00 248.65 ? 723 GLU B CA  1 
ATOM 5803 C C   . GLU B 1 453 ? 10.864  68.430  -27.357 1.00 265.10 ? 723 GLU B C   1 
ATOM 5804 O O   . GLU B 1 453 ? 11.702  69.122  -27.937 1.00 269.06 ? 723 GLU B O   1 
ATOM 5805 C CB  . GLU B 1 453 ? 10.296  67.054  -29.365 1.00 252.70 ? 723 GLU B CB  1 
ATOM 5806 N N   . LYS B 1 454 ? 10.198  68.843  -26.284 1.00 274.21 ? 724 LYS B N   1 
ATOM 5807 C CA  . LYS B 1 454 ? 10.200  70.235  -25.849 1.00 284.09 ? 724 LYS B CA  1 
ATOM 5808 C C   . LYS B 1 454 ? 11.459  70.494  -25.020 1.00 278.63 ? 724 LYS B C   1 
ATOM 5809 O O   . LYS B 1 454 ? 11.372  70.668  -23.804 1.00 284.41 ? 724 LYS B O   1 
ATOM 5810 C CB  . LYS B 1 454 ? 8.942   70.557  -25.043 1.00 289.29 ? 724 LYS B CB  1 
ATOM 5811 N N   . TYR B 1 455 ? 12.622  70.530  -25.664 1.00 249.46 ? 725 TYR B N   1 
ATOM 5812 C CA  . TYR B 1 455 ? 13.888  70.568  -24.928 1.00 238.45 ? 725 TYR B CA  1 
ATOM 5813 C C   . TYR B 1 455 ? 14.224  71.924  -24.307 1.00 239.27 ? 725 TYR B C   1 
ATOM 5814 O O   . TYR B 1 455 ? 14.742  71.988  -23.192 1.00 240.19 ? 725 TYR B O   1 
ATOM 5815 C CB  . TYR B 1 455 ? 15.045  70.158  -25.844 1.00 230.11 ? 725 TYR B CB  1 
ATOM 5816 C CG  . TYR B 1 455 ? 14.921  68.784  -26.465 1.00 218.41 ? 725 TYR B CG  1 
ATOM 5817 C CD1 . TYR B 1 455 ? 14.670  67.662  -25.685 1.00 209.75 ? 725 TYR B CD1 1 
ATOM 5818 C CD2 . TYR B 1 455 ? 15.083  68.608  -27.833 1.00 214.90 ? 725 TYR B CD2 1 
ATOM 5819 C CE1 . TYR B 1 455 ? 14.566  66.406  -26.256 1.00 196.65 ? 725 TYR B CE1 1 
ATOM 5820 C CE2 . TYR B 1 455 ? 14.983  67.358  -28.410 1.00 200.12 ? 725 TYR B CE2 1 
ATOM 5821 C CZ  . TYR B 1 455 ? 14.724  66.261  -27.619 1.00 190.10 ? 725 TYR B CZ  1 
ATOM 5822 O OH  . TYR B 1 455 ? 14.624  65.016  -28.195 1.00 184.60 ? 725 TYR B OH  1 
ATOM 5823 N N   . LYS B 1 456 ? 13.928  73.001  -25.026 1.00 236.38 ? 726 LYS B N   1 
ATOM 5824 C CA  . LYS B 1 456 ? 14.170  74.358  -24.536 1.00 242.84 ? 726 LYS B CA  1 
ATOM 5825 C C   . LYS B 1 456 ? 13.380  74.697  -23.273 1.00 240.97 ? 726 LYS B C   1 
ATOM 5826 O O   . LYS B 1 456 ? 13.947  75.130  -22.269 1.00 238.77 ? 726 LYS B O   1 
ATOM 5827 C CB  . LYS B 1 456 ? 13.847  75.377  -25.630 1.00 254.73 ? 726 LYS B CB  1 
ATOM 5828 N N   . SER B 1 457 ? 12.068  74.502  -23.344 1.00 240.68 ? 727 SER B N   1 
ATOM 5829 C CA  . SER B 1 457 ? 11.153  74.767  -22.236 1.00 248.39 ? 727 SER B CA  1 
ATOM 5830 C C   . SER B 1 457 ? 11.509  74.014  -20.955 1.00 252.92 ? 727 SER B C   1 
ATOM 5831 O O   . SER B 1 457 ? 11.222  74.482  -19.853 1.00 256.73 ? 727 SER B O   1 
ATOM 5832 C CB  . SER B 1 457 ? 9.720   74.425  -22.647 1.00 250.10 ? 727 SER B CB  1 
ATOM 5833 O OG  . SER B 1 457 ? 9.272   75.279  -23.685 1.00 243.33 ? 727 SER B OG  1 
ATOM 5834 N N   . ALA B 1 458 ? 12.138  72.854  -21.102 1.00 261.24 ? 728 ALA B N   1 
ATOM 5835 C CA  . ALA B 1 458 ? 12.501  72.029  -19.956 1.00 267.52 ? 728 ALA B CA  1 
ATOM 5836 C C   . ALA B 1 458 ? 13.715  72.576  -19.209 1.00 271.21 ? 728 ALA B C   1 
ATOM 5837 O O   . ALA B 1 458 ? 13.810  72.426  -17.993 1.00 274.16 ? 728 ALA B O   1 
ATOM 5838 C CB  . ALA B 1 458 ? 12.757  70.597  -20.399 1.00 259.06 ? 728 ALA B CB  1 
ATOM 5839 N N   . LEU B 1 459 ? 14.640  73.207  -19.925 1.00 268.77 ? 729 LEU B N   1 
ATOM 5840 C CA  . LEU B 1 459 ? 15.822  73.776  -19.285 1.00 252.61 ? 729 LEU B CA  1 
ATOM 5841 C C   . LEU B 1 459 ? 15.441  74.984  -18.434 1.00 258.53 ? 729 LEU B C   1 
ATOM 5842 O O   . LEU B 1 459 ? 15.845  75.085  -17.275 1.00 262.90 ? 729 LEU B O   1 
ATOM 5843 C CB  . LEU B 1 459 ? 16.867  74.174  -20.330 1.00 257.05 ? 729 LEU B CB  1 
ATOM 5844 N N   . GLN B 1 460 ? 14.688  75.906  -19.029 1.00 262.56 ? 730 GLN B N   1 
ATOM 5845 C CA  . GLN B 1 460 ? 14.086  77.027  -18.306 1.00 268.63 ? 730 GLN B CA  1 
ATOM 5846 C C   . GLN B 1 460 ? 13.443  76.612  -16.982 1.00 268.90 ? 730 GLN B C   1 
ATOM 5847 O O   . GLN B 1 460 ? 13.717  77.200  -15.935 1.00 277.32 ? 730 GLN B O   1 
ATOM 5848 C CB  . GLN B 1 460 ? 13.043  77.719  -19.187 1.00 267.99 ? 730 GLN B CB  1 
ATOM 5849 N N   . GLU B 1 461 ? 12.588  75.595  -17.039 1.00 263.86 ? 731 GLU B N   1 
ATOM 5850 C CA  . GLU B 1 461 ? 11.889  75.096  -15.858 1.00 270.50 ? 731 GLU B CA  1 
ATOM 5851 C C   . GLU B 1 461 ? 12.818  74.368  -14.890 1.00 273.42 ? 731 GLU B C   1 
ATOM 5852 O O   . GLU B 1 461 ? 12.622  74.416  -13.675 1.00 277.21 ? 731 GLU B O   1 
ATOM 5853 C CB  . GLU B 1 461 ? 10.747  74.166  -16.271 1.00 257.03 ? 731 GLU B CB  1 
ATOM 5854 N N   . LEU B 1 462 ? 13.832  73.703  -15.433 1.00 265.74 ? 732 LEU B N   1 
ATOM 5855 C CA  . LEU B 1 462 ? 14.801  72.988  -14.610 1.00 257.85 ? 732 LEU B CA  1 
ATOM 5856 C C   . LEU B 1 462 ? 15.778  73.944  -13.939 1.00 269.02 ? 732 LEU B C   1 
ATOM 5857 O O   . LEU B 1 462 ? 16.352  73.620  -12.903 1.00 276.47 ? 732 LEU B O   1 
ATOM 5858 C CB  . LEU B 1 462 ? 15.568  71.963  -15.448 1.00 245.06 ? 732 LEU B CB  1 
ATOM 5859 N N   . GLU B 1 463 ? 15.960  75.120  -14.528 1.00 268.50 ? 733 GLU B N   1 
ATOM 5860 C CA  . GLU B 1 463 ? 16.776  76.161  -13.915 1.00 268.14 ? 733 GLU B CA  1 
ATOM 5861 C C   . GLU B 1 463 ? 16.076  76.734  -12.686 1.00 269.09 ? 733 GLU B C   1 
ATOM 5862 O O   . GLU B 1 463 ? 16.666  76.822  -11.609 1.00 275.50 ? 733 GLU B O   1 
ATOM 5863 C CB  . GLU B 1 463 ? 17.079  77.274  -14.921 1.00 274.11 ? 733 GLU B CB  1 
ATOM 5864 N N   . GLU B 1 464 ? 14.823  77.140  -12.867 1.00 273.71 ? 734 GLU B N   1 
ATOM 5865 C CA  . GLU B 1 464 ? 13.971  77.598  -11.771 1.00 292.89 ? 734 GLU B CA  1 
ATOM 5866 C C   . GLU B 1 464 ? 13.931  76.624  -10.590 1.00 292.58 ? 734 GLU B C   1 
ATOM 5867 O O   . GLU B 1 464 ? 14.002  77.037  -9.432  1.00 298.17 ? 734 GLU B O   1 
ATOM 5868 C CB  . GLU B 1 464 ? 12.551  77.843  -12.285 1.00 276.90 ? 734 GLU B CB  1 
ATOM 5869 N N   . LEU B 1 465 ? 13.815  75.335  -10.892 1.00 285.74 ? 735 LEU B N   1 
ATOM 5870 C CA  . LEU B 1 465 ? 13.798  74.285  -9.874  1.00 287.05 ? 735 LEU B CA  1 
ATOM 5871 C C   . LEU B 1 465 ? 15.186  74.088  -9.262  1.00 290.68 ? 735 LEU B C   1 
ATOM 5872 O O   . LEU B 1 465 ? 15.318  73.762  -8.082  1.00 296.16 ? 735 LEU B O   1 
ATOM 5873 C CB  . LEU B 1 465 ? 13.285  72.971  -10.465 1.00 281.29 ? 735 LEU B CB  1 
ATOM 5874 N N   . LYS B 1 466 ? 16.211  74.288  -10.088 1.00 284.60 ? 736 LYS B N   1 
ATOM 5875 C CA  . LYS B 1 466 ? 17.619  74.183  -9.693  1.00 279.12 ? 736 LYS B CA  1 
ATOM 5876 C C   . LYS B 1 466 ? 17.991  75.174  -8.601  1.00 284.87 ? 736 LYS B C   1 
ATOM 5877 O O   . LYS B 1 466 ? 18.892  74.926  -7.805  1.00 287.15 ? 736 LYS B O   1 
ATOM 5878 C CB  . LYS B 1 466 ? 18.537  74.396  -10.897 1.00 275.72 ? 736 LYS B CB  1 
ATOM 5879 N N   . GLN B 1 467 ? 17.325  76.319  -8.594  1.00 293.19 ? 737 GLN B N   1 
ATOM 5880 C CA  . GLN B 1 467 ? 17.540  77.291  -7.539  1.00 305.19 ? 737 GLN B CA  1 
ATOM 5881 C C   . GLN B 1 467 ? 16.947  76.747  -6.245  1.00 305.46 ? 737 GLN B C   1 
ATOM 5882 O O   . GLN B 1 467 ? 17.543  76.887  -5.178  1.00 311.85 ? 737 GLN B O   1 
ATOM 5883 C CB  . GLN B 1 467 ? 16.914  78.638  -7.904  1.00 314.91 ? 737 GLN B CB  1 
ATOM 5884 N N   . ILE B 1 468 ? 15.774  76.127  -6.340  1.00 298.20 ? 738 ILE B N   1 
ATOM 5885 C CA  . ILE B 1 468 ? 15.083  75.625  -5.157  1.00 299.45 ? 738 ILE B CA  1 
ATOM 5886 C C   . ILE B 1 468 ? 15.879  74.494  -4.493  1.00 305.78 ? 738 ILE B C   1 
ATOM 5887 O O   . ILE B 1 468 ? 15.957  74.430  -3.266  1.00 309.18 ? 738 ILE B O   1 
ATOM 5888 C CB  . ILE B 1 468 ? 13.666  75.128  -5.500  1.00 288.54 ? 738 ILE B CB  1 
ATOM 5889 N N   . VAL B 1 469 ? 16.466  73.605  -5.292  1.00 316.91 ? 739 VAL B N   1 
ATOM 5890 C CA  . VAL B 1 469 ? 17.457  72.674  -4.758  1.00 320.78 ? 739 VAL B CA  1 
ATOM 5891 C C   . VAL B 1 469 ? 18.842  73.011  -5.287  1.00 322.90 ? 739 VAL B C   1 
ATOM 5892 O O   . VAL B 1 469 ? 19.130  72.758  -6.452  1.00 318.07 ? 739 VAL B O   1 
ATOM 5893 C CB  . VAL B 1 469 ? 17.133  71.216  -5.140  1.00 320.57 ? 739 VAL B CB  1 
ATOM 5894 N N   . PRO B 1 470 ? 19.722  73.534  -4.419  1.00 328.52 ? 740 PRO B N   1 
ATOM 5895 C CA  . PRO B 1 470 ? 21.085  73.822  -4.879  1.00 317.22 ? 740 PRO B CA  1 
ATOM 5896 C C   . PRO B 1 470 ? 21.795  72.564  -5.362  1.00 296.72 ? 740 PRO B C   1 
ATOM 5897 O O   . PRO B 1 470 ? 22.420  72.547  -6.423  1.00 291.38 ? 740 PRO B O   1 
ATOM 5898 C CB  . PRO B 1 470 ? 21.764  74.409  -3.640  1.00 348.92 ? 740 PRO B CB  1 
ATOM 5899 N N   . LYS B 1 471 ? 21.699  71.521  -4.548  1.00 297.27 ? 741 LYS B N   1 
ATOM 5900 C CA  . LYS B 1 471 ? 22.528  70.340  -4.702  1.00 294.69 ? 741 LYS B CA  1 
ATOM 5901 C C   . LYS B 1 471 ? 21.719  69.056  -4.781  1.00 291.29 ? 741 LYS B C   1 
ATOM 5902 O O   . LYS B 1 471 ? 21.266  68.524  -3.767  1.00 299.43 ? 741 LYS B O   1 
ATOM 5903 C CB  . LYS B 1 471 ? 23.531  70.243  -3.556  1.00 303.05 ? 741 LYS B CB  1 
ATOM 5904 N N   . GLU B 1 472 ? 21.525  68.574  -5.999  1.00 285.14 ? 742 GLU B N   1 
ATOM 5905 C CA  . GLU B 1 472 ? 20.872  67.297  -6.204  1.00 275.89 ? 742 GLU B CA  1 
ATOM 5906 C C   . GLU B 1 472 ? 21.468  66.708  -7.466  1.00 270.63 ? 742 GLU B C   1 
ATOM 5907 O O   . GLU B 1 472 ? 21.314  67.258  -8.558  1.00 266.52 ? 742 GLU B O   1 
ATOM 5908 C CB  . GLU B 1 472 ? 19.352  67.450  -6.318  1.00 273.69 ? 742 GLU B CB  1 
ATOM 5909 N N   . SER B 1 473 ? 22.165  65.588  -7.286  1.00 273.37 ? 743 SER B N   1 
ATOM 5910 C CA  . SER B 1 473 ? 22.862  64.886  -8.361  1.00 271.42 ? 743 SER B CA  1 
ATOM 5911 C C   . SER B 1 473 ? 21.920  64.650  -9.530  1.00 273.56 ? 743 SER B C   1 
ATOM 5912 O O   . SER B 1 473 ? 22.290  64.820  -10.690 1.00 270.79 ? 743 SER B O   1 
ATOM 5913 C CB  . SER B 1 473 ? 23.433  63.562  -7.852  1.00 268.03 ? 743 SER B CB  1 
ATOM 5914 N N   . LEU B 1 474 ? 20.703  64.244  -9.188  1.00 279.28 ? 744 LEU B N   1 
ATOM 5915 C CA  . LEU B 1 474 ? 19.636  63.946  -10.137 1.00 276.22 ? 744 LEU B CA  1 
ATOM 5916 C C   . LEU B 1 474 ? 19.498  65.062  -11.168 1.00 273.33 ? 744 LEU B C   1 
ATOM 5917 O O   . LEU B 1 474 ? 19.456  64.817  -12.373 1.00 266.89 ? 744 LEU B O   1 
ATOM 5918 C CB  . LEU B 1 474 ? 18.310  63.732  -9.406  1.00 278.40 ? 744 LEU B CB  1 
ATOM 5919 N N   . VAL B 1 475 ? 19.437  66.291  -10.667 1.00 278.05 ? 745 VAL B N   1 
ATOM 5920 C CA  . VAL B 1 475 ? 19.206  67.481  -11.478 1.00 263.49 ? 745 VAL B CA  1 
ATOM 5921 C C   . VAL B 1 475 ? 20.334  67.775  -12.465 1.00 252.19 ? 745 VAL B C   1 
ATOM 5922 O O   . VAL B 1 475 ? 20.074  68.225  -13.580 1.00 245.86 ? 745 VAL B O   1 
ATOM 5923 C CB  . VAL B 1 475 ? 19.005  68.722  -10.588 1.00 275.71 ? 745 VAL B CB  1 
ATOM 5924 N N   . TYR B 1 476 ? 21.578  67.522  -12.075 1.00 250.30 ? 746 TYR B N   1 
ATOM 5925 C CA  . TYR B 1 476 ? 22.698  67.792  -12.970 1.00 246.45 ? 746 TYR B CA  1 
ATOM 5926 C C   . TYR B 1 476 ? 22.749  66.709  -14.042 1.00 239.69 ? 746 TYR B C   1 
ATOM 5927 O O   . TYR B 1 476 ? 23.185  66.956  -15.166 1.00 238.18 ? 746 TYR B O   1 
ATOM 5928 C CB  . TYR B 1 476 ? 24.018  67.852  -12.201 1.00 251.69 ? 746 TYR B CB  1 
ATOM 5929 N N   . PHE B 1 477 ? 22.301  65.510  -13.686 1.00 240.96 ? 747 PHE B N   1 
ATOM 5930 C CA  . PHE B 1 477 ? 22.176  64.419  -14.645 1.00 232.47 ? 747 PHE B CA  1 
ATOM 5931 C C   . PHE B 1 477 ? 21.224  64.831  -15.767 1.00 228.17 ? 747 PHE B C   1 
ATOM 5932 O O   . PHE B 1 477 ? 21.566  64.747  -16.947 1.00 226.02 ? 747 PHE B O   1 
ATOM 5933 C CB  . PHE B 1 477 ? 21.681  63.143  -13.962 1.00 228.11 ? 747 PHE B CB  1 
ATOM 5934 N N   . LEU B 1 478 ? 20.026  65.271  -15.387 1.00 228.14 ? 748 LEU B N   1 
ATOM 5935 C CA  . LEU B 1 478 ? 18.983  65.630  -16.346 1.00 225.55 ? 748 LEU B CA  1 
ATOM 5936 C C   . LEU B 1 478 ? 19.380  66.811  -17.234 1.00 225.83 ? 748 LEU B C   1 
ATOM 5937 O O   . LEU B 1 478 ? 18.779  67.033  -18.284 1.00 224.35 ? 748 LEU B O   1 
ATOM 5938 C CB  . LEU B 1 478 ? 17.680  65.954  -15.611 1.00 229.47 ? 748 LEU B CB  1 
ATOM 5939 N N   . ILE B 1 479 ? 20.387  67.568  -16.808 1.00 225.07 ? 749 ILE B N   1 
ATOM 5940 C CA  . ILE B 1 479 ? 20.931  68.648  -17.623 1.00 222.64 ? 749 ILE B CA  1 
ATOM 5941 C C   . ILE B 1 479 ? 21.788  68.060  -18.740 1.00 214.08 ? 749 ILE B C   1 
ATOM 5942 O O   . ILE B 1 479 ? 21.638  68.416  -19.909 1.00 210.49 ? 749 ILE B O   1 
ATOM 5943 C CB  . ILE B 1 479 ? 21.769  69.632  -16.788 1.00 228.23 ? 749 ILE B CB  1 
ATOM 5944 N N   . GLY B 1 480 ? 22.688  67.157  -18.358 1.00 216.35 ? 750 GLY B N   1 
ATOM 5945 C CA  . GLY B 1 480 ? 23.508  66.410  -19.296 1.00 219.21 ? 750 GLY B CA  1 
ATOM 5946 C C   . GLY B 1 480 ? 22.661  65.619  -20.276 1.00 219.75 ? 750 GLY B C   1 
ATOM 5947 O O   . GLY B 1 480 ? 22.990  65.507  -21.456 1.00 214.59 ? 750 GLY B O   1 
ATOM 5948 N N   . LYS B 1 481 ? 21.573  65.056  -19.761 1.00 222.98 ? 751 LYS B N   1 
ATOM 5949 C CA  . LYS B 1 481 ? 20.596  64.305  -20.548 1.00 219.28 ? 751 LYS B CA  1 
ATOM 5950 C C   . LYS B 1 481 ? 20.053  65.133  -21.717 1.00 220.07 ? 751 LYS B C   1 
ATOM 5951 O O   . LYS B 1 481 ? 19.921  64.644  -22.838 1.00 216.70 ? 751 LYS B O   1 
ATOM 5952 C CB  . LYS B 1 481 ? 19.445  63.834  -19.656 1.00 220.04 ? 751 LYS B CB  1 
ATOM 5953 N N   . VAL B 1 482 ? 19.735  66.388  -21.421 1.00 220.04 ? 752 VAL B N   1 
ATOM 5954 C CA  . VAL B 1 482 ? 19.159  67.357  -22.356 1.00 210.73 ? 752 VAL B CA  1 
ATOM 5955 C C   . VAL B 1 482 ? 20.190  68.003  -23.288 1.00 204.54 ? 752 VAL B C   1 
ATOM 5956 O O   . VAL B 1 482 ? 19.870  68.404  -24.406 1.00 199.32 ? 752 VAL B O   1 
ATOM 5957 C CB  . VAL B 1 482 ? 18.420  68.479  -21.603 1.00 221.42 ? 752 VAL B CB  1 
ATOM 5958 N N   . TYR B 1 483 ? 21.427  68.084  -22.815 1.00 202.32 ? 753 TYR B N   1 
ATOM 5959 C CA  . TYR B 1 483 ? 22.567  68.582  -23.588 1.00 206.92 ? 753 TYR B CA  1 
ATOM 5960 C C   . TYR B 1 483 ? 22.995  67.679  -24.755 1.00 212.55 ? 753 TYR B C   1 
ATOM 5961 O O   . TYR B 1 483 ? 23.586  68.156  -25.724 1.00 212.78 ? 753 TYR B O   1 
ATOM 5962 C CB  . TYR B 1 483 ? 23.749  68.822  -22.660 1.00 213.62 ? 753 TYR B CB  1 
ATOM 5963 N N   . LYS B 1 484 ? 22.721  66.385  -24.652 1.00 220.62 ? 754 LYS B N   1 
ATOM 5964 C CA  . LYS B 1 484 ? 22.984  65.443  -25.740 1.00 219.28 ? 754 LYS B CA  1 
ATOM 5965 C C   . LYS B 1 484 ? 22.146  65.904  -26.930 1.00 214.37 ? 754 LYS B C   1 
ATOM 5966 O O   . LYS B 1 484 ? 22.630  65.960  -28.064 1.00 207.45 ? 754 LYS B O   1 
ATOM 5967 C CB  . LYS B 1 484 ? 22.638  64.007  -25.348 1.00 210.76 ? 754 LYS B CB  1 
ATOM 5968 N N   . LYS B 1 485 ? 20.893  66.257  -26.653 1.00 213.10 ? 755 LYS B N   1 
ATOM 5969 C CA  . LYS B 1 485 ? 19.944  66.702  -27.667 1.00 209.33 ? 755 LYS B CA  1 
ATOM 5970 C C   . LYS B 1 485 ? 20.383  68.079  -28.115 1.00 207.03 ? 755 LYS B C   1 
ATOM 5971 O O   . LYS B 1 485 ? 19.885  68.622  -29.128 1.00 208.96 ? 755 LYS B O   1 
ATOM 5972 C CB  . LYS B 1 485 ? 18.523  66.735  -27.106 1.00 208.22 ? 755 LYS B CB  1 
ATOM 5973 N N   . LEU B 1 486 ? 21.290  68.665  -27.327 1.00 201.11 ? 756 LEU B N   1 
ATOM 5974 C CA  . LEU B 1 486 ? 21.633  70.032  -27.603 1.00 204.07 ? 756 LEU B CA  1 
ATOM 5975 C C   . LEU B 1 486 ? 22.855  70.064  -28.501 1.00 210.35 ? 756 LEU B C   1 
ATOM 5976 O O   . LEU B 1 486 ? 22.887  70.848  -29.419 1.00 214.58 ? 756 LEU B O   1 
ATOM 5977 C CB  . LEU B 1 486 ? 21.944  70.775  -26.290 1.00 206.45 ? 756 LEU B CB  1 
ATOM 5978 N N   . GLY B 1 487 ? 23.950  69.366  -28.237 1.00 217.01 ? 757 GLY B N   1 
ATOM 5979 C CA  . GLY B 1 487 ? 24.957  69.520  -29.301 1.00 225.52 ? 757 GLY B CA  1 
ATOM 5980 C C   . GLY B 1 487 ? 26.340  69.537  -28.636 1.00 225.08 ? 757 GLY B C   1 
ATOM 5981 O O   . GLY B 1 487 ? 27.375  68.985  -29.053 1.00 225.36 ? 757 GLY B O   1 
ATOM 5982 N N   . GLN B 1 488 ? 26.203  70.313  -27.549 1.00 223.22 ? 758 GLN B N   1 
ATOM 5983 C CA  . GLN B 1 488 ? 27.178  70.911  -26.627 1.00 225.40 ? 758 GLN B CA  1 
ATOM 5984 C C   . GLN B 1 488 ? 27.875  69.939  -25.670 1.00 224.67 ? 758 GLN B C   1 
ATOM 5985 O O   . GLN B 1 488 ? 27.339  69.663  -24.620 1.00 224.76 ? 758 GLN B O   1 
ATOM 5986 C CB  . GLN B 1 488 ? 26.478  72.001  -25.815 1.00 226.99 ? 758 GLN B CB  1 
ATOM 5987 N N   . THR B 1 489 ? 29.063  69.451  -26.050 1.00 218.56 ? 759 THR B N   1 
ATOM 5988 C CA  . THR B 1 489 ? 29.805  68.597  -25.123 1.00 205.60 ? 759 THR B CA  1 
ATOM 5989 C C   . THR B 1 489 ? 30.011  69.298  -23.779 1.00 206.52 ? 759 THR B C   1 
ATOM 5990 O O   . THR B 1 489 ? 29.819  68.663  -22.744 1.00 198.74 ? 759 THR B O   1 
ATOM 5991 C CB  . THR B 1 489 ? 31.182  68.154  -25.672 1.00 200.52 ? 759 THR B CB  1 
ATOM 5992 N N   . HIS B 1 490 ? 30.429  70.556  -23.777 1.00 210.04 ? 760 HIS B N   1 
ATOM 5993 C CA  . HIS B 1 490 ? 30.557  71.285  -22.514 1.00 220.58 ? 760 HIS B CA  1 
ATOM 5994 C C   . HIS B 1 490 ? 29.344  71.096  -21.584 1.00 214.97 ? 760 HIS B C   1 
ATOM 5995 O O   . HIS B 1 490 ? 29.521  70.692  -20.435 1.00 215.44 ? 760 HIS B O   1 
ATOM 5996 C CB  . HIS B 1 490 ? 30.762  72.781  -22.770 1.00 229.12 ? 760 HIS B CB  1 
ATOM 5997 N N   . LEU B 1 491 ? 28.129  71.409  -22.030 1.00 213.24 ? 761 LEU B N   1 
ATOM 5998 C CA  . LEU B 1 491 ? 27.005  71.280  -21.108 1.00 235.92 ? 761 LEU B CA  1 
ATOM 5999 C C   . LEU B 1 491 ? 26.752  69.852  -20.606 1.00 234.73 ? 761 LEU B C   1 
ATOM 6000 O O   . LEU B 1 491 ? 26.562  69.656  -19.405 1.00 235.10 ? 761 LEU B O   1 
ATOM 6001 C CB  . LEU B 1 491 ? 25.723  71.797  -21.774 1.00 217.36 ? 761 LEU B CB  1 
ATOM 6002 N N   . ALA B 1 492 ? 26.720  68.859  -21.495 1.00 230.37 ? 762 ALA B N   1 
ATOM 6003 C CA  . ALA B 1 492 ? 26.520  67.489  -21.015 1.00 226.45 ? 762 ALA B CA  1 
ATOM 6004 C C   . ALA B 1 492 ? 27.597  66.916  -20.093 1.00 234.02 ? 762 ALA B C   1 
ATOM 6005 O O   . ALA B 1 492 ? 27.303  66.462  -18.986 1.00 229.14 ? 762 ALA B O   1 
ATOM 6006 C CB  . ALA B 1 492 ? 26.356  66.558  -22.213 1.00 219.04 ? 762 ALA B CB  1 
ATOM 6007 N N   . LEU B 1 493 ? 28.841  66.931  -20.576 1.00 241.82 ? 763 LEU B N   1 
ATOM 6008 C CA  . LEU B 1 493 ? 29.995  66.436  -19.821 1.00 236.40 ? 763 LEU B CA  1 
ATOM 6009 C C   . LEU B 1 493 ? 30.183  67.018  -18.428 1.00 228.41 ? 763 LEU B C   1 
ATOM 6010 O O   . LEU B 1 493 ? 30.407  66.296  -17.454 1.00 226.39 ? 763 LEU B O   1 
ATOM 6011 C CB  . LEU B 1 493 ? 31.273  66.664  -20.632 1.00 229.09 ? 763 LEU B CB  1 
ATOM 6012 N N   . MET B 1 494 ? 30.091  68.344  -18.365 1.00 221.17 ? 764 MET B N   1 
ATOM 6013 C CA  . MET B 1 494 ? 30.222  69.098  -17.126 1.00 227.58 ? 764 MET B CA  1 
ATOM 6014 C C   . MET B 1 494 ? 29.236  68.634  -16.082 1.00 220.83 ? 764 MET B C   1 
ATOM 6015 O O   . MET B 1 494 ? 29.607  68.197  -14.992 1.00 217.35 ? 764 MET B O   1 
ATOM 6016 C CB  . MET B 1 494 ? 30.047  70.596  -17.380 1.00 224.93 ? 764 MET B CB  1 
ATOM 6017 N N   . ASN B 1 495 ? 27.962  68.745  -16.443 1.00 217.52 ? 765 ASN B N   1 
ATOM 6018 C CA  . ASN B 1 495 ? 26.883  68.431  -15.530 1.00 227.12 ? 765 ASN B CA  1 
ATOM 6019 C C   . ASN B 1 495 ? 26.920  66.986  -15.066 1.00 234.94 ? 765 ASN B C   1 
ATOM 6020 O O   . ASN B 1 495 ? 26.712  66.716  -13.884 1.00 232.09 ? 765 ASN B O   1 
ATOM 6021 C CB  . ASN B 1 495 ? 25.540  68.734  -16.196 1.00 224.29 ? 765 ASN B CB  1 
ATOM 6022 N N   . PHE B 1 496 ? 27.150  66.055  -15.990 1.00 241.89 ? 766 PHE B N   1 
ATOM 6023 C CA  . PHE B 1 496 ? 27.289  64.660  -15.595 1.00 239.63 ? 766 PHE B CA  1 
ATOM 6024 C C   . PHE B 1 496 ? 28.400  64.500  -14.562 1.00 240.25 ? 766 PHE B C   1 
ATOM 6025 O O   . PHE B 1 496 ? 28.217  63.850  -13.531 1.00 238.33 ? 766 PHE B O   1 
ATOM 6026 C CB  . PHE B 1 496 ? 27.573  63.779  -16.813 1.00 235.60 ? 766 PHE B CB  1 
ATOM 6027 N N   . SER B 1 497 ? 29.551  65.106  -14.851 1.00 238.90 ? 767 SER B N   1 
ATOM 6028 C CA  . SER B 1 497 ? 30.691  65.064  -13.942 1.00 240.14 ? 767 SER B CA  1 
ATOM 6029 C C   . SER B 1 497 ? 30.393  65.705  -12.595 1.00 251.41 ? 767 SER B C   1 
ATOM 6030 O O   . SER B 1 497 ? 30.926  65.288  -11.567 1.00 257.04 ? 767 SER B O   1 
ATOM 6031 C CB  . SER B 1 497 ? 31.902  65.748  -14.580 1.00 237.73 ? 767 SER B CB  1 
ATOM 6032 N N   . TRP B 1 498 ? 29.543  66.727  -12.606 1.00 255.44 ? 768 TRP B N   1 
ATOM 6033 C CA  . TRP B 1 498 ? 29.133  67.355  -11.363 1.00 261.30 ? 768 TRP B CA  1 
ATOM 6034 C C   . TRP B 1 498 ? 28.315  66.357  -10.559 1.00 259.90 ? 768 TRP B C   1 
ATOM 6035 O O   . TRP B 1 498 ? 28.602  66.086  -9.394  1.00 261.98 ? 768 TRP B O   1 
ATOM 6036 C CB  . TRP B 1 498 ? 28.336  68.635  -11.632 1.00 259.58 ? 768 TRP B CB  1 
ATOM 6037 N N   . ALA B 1 499 ? 27.273  65.837  -11.204 1.00 251.93 ? 769 ALA B N   1 
ATOM 6038 C CA  . ALA B 1 499 ? 26.351  64.885  -10.591 1.00 248.56 ? 769 ALA B CA  1 
ATOM 6039 C C   . ALA B 1 499 ? 26.997  63.625  -10.020 1.00 253.48 ? 769 ALA B C   1 
ATOM 6040 O O   . ALA B 1 499 ? 26.561  63.107  -8.991  1.00 256.06 ? 769 ALA B O   1 
ATOM 6041 C CB  . ALA B 1 499 ? 25.294  64.485  -11.610 1.00 240.03 ? 769 ALA B CB  1 
ATOM 6042 N N   . MET B 1 500 ? 28.038  63.140  -10.691 1.00 257.87 ? 770 MET B N   1 
ATOM 6043 C CA  . MET B 1 500 ? 28.790  61.983  -10.212 1.00 258.77 ? 770 MET B CA  1 
ATOM 6044 C C   . MET B 1 500 ? 29.550  62.214  -8.910  1.00 263.03 ? 770 MET B C   1 
ATOM 6045 O O   . MET B 1 500 ? 29.425  61.437  -7.964  1.00 262.13 ? 770 MET B O   1 
ATOM 6046 C CB  . MET B 1 500 ? 29.765  61.523  -11.299 1.00 242.46 ? 770 MET B CB  1 
ATOM 6047 N N   . ASP B 1 501 ? 30.338  63.283  -8.875  1.00 258.57 ? 771 ASP B N   1 
ATOM 6048 C CA  . ASP B 1 501 ? 31.097  63.665  -7.688  1.00 261.86 ? 771 ASP B CA  1 
ATOM 6049 C C   . ASP B 1 501 ? 30.234  63.845  -6.437  1.00 273.17 ? 771 ASP B C   1 
ATOM 6050 O O   . ASP B 1 501 ? 30.628  63.448  -5.340  1.00 287.95 ? 771 ASP B O   1 
ATOM 6051 C CB  . ASP B 1 501 ? 31.887  64.947  -7.962  1.00 269.53 ? 771 ASP B CB  1 
ATOM 6052 N N   . LEU B 1 502 ? 29.059  64.445  -6.613  1.00 277.53 ? 772 LEU B N   1 
ATOM 6053 C CA  . LEU B 1 502 ? 28.177  64.774  -5.494  1.00 295.49 ? 772 LEU B CA  1 
ATOM 6054 C C   . LEU B 1 502 ? 27.591  63.575  -4.742  1.00 292.31 ? 772 LEU B C   1 
ATOM 6055 O O   . LEU B 1 502 ? 27.193  63.704  -3.582  1.00 300.50 ? 772 LEU B O   1 
ATOM 6056 C CB  . LEU B 1 502 ? 27.028  65.648  -6.001  1.00 299.56 ? 772 LEU B CB  1 
ATOM 6057 N N   . ASP B 1 503 ? 27.563  62.413  -5.384  1.00 272.81 ? 773 ASP B N   1 
ATOM 6058 C CA  . ASP B 1 503 ? 26.807  61.276  -4.863  1.00 257.33 ? 773 ASP B CA  1 
ATOM 6059 C C   . ASP B 1 503 ? 27.666  60.017  -4.827  1.00 253.47 ? 773 ASP B C   1 
ATOM 6060 O O   . ASP B 1 503 ? 27.239  58.956  -5.285  1.00 234.54 ? 773 ASP B O   1 
ATOM 6061 C CB  . ASP B 1 503 ? 25.549  61.032  -5.700  1.00 239.84 ? 773 ASP B CB  1 
ATOM 6062 N N   . PRO B 1 504 ? 28.884  60.129  -4.278  1.00 268.68 ? 774 PRO B N   1 
ATOM 6063 C CA  . PRO B 1 504 ? 29.772  58.971  -4.126  1.00 270.74 ? 774 PRO B CA  1 
ATOM 6064 C C   . PRO B 1 504 ? 29.457  58.132  -2.889  1.00 273.76 ? 774 PRO B C   1 
ATOM 6065 O O   . PRO B 1 504 ? 28.377  58.270  -2.316  1.00 268.65 ? 774 PRO B O   1 
ATOM 6066 C CB  . PRO B 1 504 ? 31.157  59.609  -4.009  1.00 273.74 ? 774 PRO B CB  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLN A 7   ? 1.4202 3.4300 2.5451 -0.1071 -0.5753 -0.6150 5   GLN A N   
2    C CA  . GLN A 7   ? 1.2248 3.1627 2.2949 -0.0781 -0.5162 -0.5696 5   GLN A CA  
3    C C   . GLN A 7   ? 1.3679 3.1594 2.2287 -0.0175 -0.5410 -0.5353 5   GLN A C   
4    O O   . GLN A 7   ? 1.4282 3.0786 2.1709 -0.0469 -0.5131 -0.5197 5   GLN A O   
5    C CB  . GLN A 7   ? 1.1522 3.2049 2.3421 -0.0318 -0.4893 -0.5545 5   GLN A CB  
6    N N   . GLU A 8   ? 1.4761 3.3035 2.3006 0.0678  -0.5886 -0.5220 6   GLU A N   
7    C CA  . GLU A 8   ? 1.6339 3.3591 2.2737 0.1299  -0.6415 -0.5013 6   GLU A CA  
8    C C   . GLU A 8   ? 1.5992 3.2361 2.1060 0.0930  -0.6766 -0.5208 6   GLU A C   
9    O O   . GLU A 8   ? 1.5687 3.0491 1.9132 0.0935  -0.6504 -0.4900 6   GLU A O   
10   C CB  . GLU A 8   ? 1.6983 3.5361 2.3773 0.2166  -0.7166 -0.5074 6   GLU A CB  
11   N N   . PRO A 9   ? 1.5889 3.3212 2.1727 0.0457  -0.7220 -0.5761 7   PRO A N   
12   C CA  . PRO A 9   ? 1.6917 3.3153 2.1204 0.0162  -0.7437 -0.5923 7   PRO A CA  
13   C C   . PRO A 9   ? 1.5907 3.1201 2.0119 -0.0583 -0.6690 -0.5953 7   PRO A C   
14   O O   . PRO A 9   ? 1.7286 3.1487 2.0125 -0.0775 -0.6661 -0.6013 7   PRO A O   
15   C CB  . PRO A 9   ? 1.5535 3.2421 2.0309 -0.0030 -0.8008 -0.6294 7   PRO A CB  
16   C CG  . PRO A 9   ? 1.4759 3.2952 2.1716 -0.0403 -0.7739 -0.6478 7   PRO A CG  
17   C CD  . PRO A 9   ? 1.5805 3.4524 2.3450 0.0105  -0.7379 -0.6128 7   PRO A CD  
18   N N   . VAL A 10  ? 1.3783 2.9554 1.9475 -0.1012 -0.6130 -0.5960 8   VAL A N   
19   C CA  . VAL A 10  ? 1.2559 2.7400 1.8232 -0.1649 -0.5464 -0.5946 8   VAL A CA  
20   C C   . VAL A 10  ? 1.2683 2.6006 1.6848 -0.1372 -0.5036 -0.5423 8   VAL A C   
21   O O   . VAL A 10  ? 1.2884 2.5220 1.6020 -0.1597 -0.4911 -0.5489 8   VAL A O   
22   C CB  . VAL A 10  ? 1.1677 2.7107 1.8977 -0.2057 -0.4912 -0.5891 8   VAL A CB  
23   N N   . GLN A 11  ? 1.4001 2.7171 1.8016 -0.0876 -0.4829 -0.4943 9   GLN A N   
24   C CA  . GLN A 11  ? 1.4694 2.6486 1.7406 -0.0660 -0.4430 -0.4448 9   GLN A CA  
25   C C   . GLN A 11  ? 1.5416 2.6402 1.6351 -0.0192 -0.4831 -0.4307 9   GLN A C   
26   O O   . GLN A 11  ? 1.5980 2.5803 1.5768 -0.0053 -0.4528 -0.3915 9   GLN A O   
27   C CB  . GLN A 11  ? 1.4360 2.6187 1.7517 -0.0364 -0.4035 -0.4035 9   GLN A CB  
28   N N   . ALA A 12  ? 1.6379 2.8016 1.7115 0.0114  -0.5532 -0.4563 10  ALA A N   
29   C CA  . ALA A 12  ? 1.7332 2.8079 1.6233 0.0395  -0.5910 -0.4487 10  ALA A CA  
30   C C   . ALA A 12  ? 1.6771 2.6805 1.4971 -0.0217 -0.5663 -0.4762 10  ALA A C   
31   O O   . ALA A 12  ? 1.6580 2.5405 1.3383 -0.0249 -0.5363 -0.4523 10  ALA A O   
32   C CB  . ALA A 12  ? 1.8342 2.9980 1.7163 0.0869  -0.6817 -0.4717 10  ALA A CB  
33   N N   . ALA A 13  ? 1.6999 2.7832 1.6317 -0.0722 -0.5735 -0.5286 11  ALA A N   
34   C CA  . ALA A 13  ? 1.8610 2.9005 1.7669 -0.1321 -0.5510 -0.5704 11  ALA A CA  
35   C C   . ALA A 13  ? 1.5609 2.5072 1.4683 -0.1692 -0.4690 -0.5515 11  ALA A C   
36   O O   . ALA A 13  ? 1.6313 2.5101 1.4666 -0.1984 -0.4448 -0.5732 11  ALA A O   
37   C CB  . ALA A 13  ? 1.9567 3.1069 2.0046 -0.1759 -0.5796 -0.6303 11  ALA A CB  
38   N N   . ILE A 14  ? 1.4301 2.3832 1.4274 -0.1661 -0.4300 -0.5146 12  ILE A N   
39   C CA  . ILE A 14  ? 1.4646 2.3399 1.4713 -0.1922 -0.3640 -0.4896 12  ILE A CA  
40   C C   . ILE A 14  ? 1.5725 2.3445 1.4222 -0.1709 -0.3483 -0.4579 12  ILE A C   
41   O O   . ILE A 14  ? 1.6302 2.3387 1.4290 -0.1991 -0.3145 -0.4695 12  ILE A O   
42   C CB  . ILE A 14  ? 1.4389 2.3391 1.5517 -0.1885 -0.3336 -0.4526 12  ILE A CB  
43   C CG1 . ILE A 14  ? 1.3747 2.3554 1.6427 -0.2293 -0.3292 -0.4838 12  ILE A CG1 
44   C CG2 . ILE A 14  ? 1.3362 2.1434 1.4210 -0.2032 -0.2793 -0.4184 12  ILE A CG2 
45   C CD1 . ILE A 14  ? 1.2038 2.2184 1.5714 -0.2299 -0.2997 -0.4524 12  ILE A CD1 
46   N N   . TRP A 15  ? 1.6187 2.3726 1.3881 -0.1215 -0.3727 -0.4215 13  TRP A N   
47   C CA  . TRP A 15  ? 1.6979 2.3420 1.3144 -0.1045 -0.3550 -0.3847 13  TRP A CA  
48   C C   . TRP A 15  ? 1.8009 2.3991 1.2911 -0.1186 -0.3644 -0.4116 13  TRP A C   
49   O O   . TRP A 15  ? 1.9178 2.4266 1.3071 -0.1334 -0.3255 -0.3947 13  TRP A O   
50   C CB  . TRP A 15  ? 1.7518 2.3726 1.2970 -0.0441 -0.3848 -0.3428 13  TRP A CB  
51   C CG  . TRP A 15  ? 1.7115 2.3047 1.3002 -0.0346 -0.3489 -0.3025 13  TRP A CG  
52   C CD1 . TRP A 15  ? 1.6336 2.2451 1.3334 -0.0701 -0.3062 -0.3009 13  TRP A CD1 
53   C CD2 . TRP A 15  ? 1.8262 2.3539 1.3319 0.0137  -0.3535 -0.2583 13  TRP A CD2 
54   N NE1 . TRP A 15  ? 1.6870 2.2549 1.3758 -0.0491 -0.2855 -0.2602 13  TRP A NE1 
55   C CE2 . TRP A 15  ? 1.8151 2.3300 1.3879 0.0017  -0.3119 -0.2359 13  TRP A CE2 
56   C CE3 . TRP A 15  ? 2.0390 2.5080 1.4127 0.0678  -0.3908 -0.2354 13  TRP A CE3 
57   C CZ2 . TRP A 15  ? 1.9109 2.3582 1.4240 0.0389  -0.3038 -0.1972 13  TRP A CZ2 
58   C CZ3 . TRP A 15  ? 2.1726 2.5698 1.4926 0.1076  -0.3818 -0.1946 13  TRP A CZ3 
59   C CH2 . TRP A 15  ? 2.0895 2.4773 1.4795 0.0916  -0.3373 -0.1786 13  TRP A CH2 
60   N N   . GLN A 16  ? 1.9253 2.5853 1.4188 -0.1178 -0.4138 -0.4552 14  GLN A N   
61   C CA  . GLN A 16  ? 2.1096 2.7230 1.4737 -0.1355 -0.4204 -0.4872 14  GLN A CA  
62   C C   . GLN A 16  ? 2.1261 2.7110 1.5333 -0.1897 -0.3550 -0.5158 14  GLN A C   
63   O O   . GLN A 16  ? 2.3816 2.8890 1.6737 -0.2055 -0.3176 -0.5166 14  GLN A O   
64   C CB  . GLN A 16  ? 2.1401 2.8329 1.5121 -0.1291 -0.4921 -0.5353 14  GLN A CB  
65   N N   . ALA A 17  ? 1.8266 2.4726 1.3989 -0.2169 -0.3395 -0.5395 15  ALA A N   
66   C CA  . ALA A 17  ? 1.6277 2.2458 1.2596 -0.2590 -0.2804 -0.5635 15  ALA A CA  
67   C C   . ALA A 17  ? 1.5814 2.1303 1.1845 -0.2600 -0.2233 -0.5183 15  ALA A C   
68   O O   . ALA A 17  ? 1.6043 2.1108 1.1815 -0.2840 -0.1761 -0.5359 15  ALA A O   
69   C CB  . ALA A 17  ? 1.4827 2.1637 1.2918 -0.2827 -0.2777 -0.5838 15  ALA A CB  
70   N N   . LEU A 18  ? 1.7211 2.2627 1.3336 -0.2350 -0.2269 -0.4642 16  LEU A N   
71   C CA  . LEU A 18  ? 1.7072 2.1868 1.2976 -0.2402 -0.1806 -0.4222 16  LEU A CA  
72   C C   . LEU A 18  ? 1.8086 2.2096 1.2359 -0.2402 -0.1616 -0.4079 16  LEU A C   
73   O O   . LEU A 18  ? 1.8400 2.2013 1.2588 -0.2654 -0.1108 -0.4010 16  LEU A O   
74   C CB  . LEU A 18  ? 1.6603 2.1432 1.2876 -0.2144 -0.1920 -0.3726 16  LEU A CB  
75   C CG  . LEU A 18  ? 1.5567 2.0964 1.3395 -0.2230 -0.1888 -0.3719 16  LEU A CG  
76   C CD1 . LEU A 18  ? 1.5997 2.1464 1.3898 -0.1901 -0.2048 -0.3303 16  LEU A CD1 
77   C CD2 . LEU A 18  ? 1.5008 2.0150 1.3524 -0.2543 -0.1434 -0.3683 16  LEU A CD2 
78   N N   . ASN A 19  ? 1.9073 2.2859 1.2061 -0.2127 -0.2024 -0.4021 17  ASN A N   
79   C CA  . ASN A 19  ? 2.0338 2.3225 1.1564 -0.2156 -0.1836 -0.3848 17  ASN A CA  
80   C C   . ASN A 19  ? 2.1702 2.4485 1.2407 -0.2496 -0.1512 -0.4337 17  ASN A C   
81   O O   . ASN A 19  ? 2.4132 2.6191 1.3526 -0.2662 -0.1132 -0.4245 17  ASN A O   
82   C CB  . ASN A 19  ? 2.1478 2.4009 1.1349 -0.1695 -0.2420 -0.3585 17  ASN A CB  
83   C CG  . ASN A 19  ? 2.3333 2.5922 1.3675 -0.1292 -0.2688 -0.3144 17  ASN A CG  
84   O OD1 . ASN A 19  ? 2.3748 2.6882 1.5559 -0.1347 -0.2565 -0.3126 17  ASN A OD1 
85   N ND2 . ASN A 19  ? 2.5520 2.7442 1.4513 -0.0867 -0.3033 -0.2779 17  ASN A ND2 
86   N N   . HIS A 20  ? 2.0260 2.3717 1.1953 -0.2621 -0.1623 -0.4873 18  HIS A N   
87   C CA  . HIS A 20  ? 1.9520 2.2895 1.0999 -0.2951 -0.1218 -0.5420 18  HIS A CA  
88   C C   . HIS A 20  ? 1.8346 2.1971 1.1375 -0.3213 -0.0646 -0.5575 18  HIS A C   
89   O O   . HIS A 20  ? 1.8616 2.2220 1.1773 -0.3444 -0.0238 -0.6064 18  HIS A O   
90   C CB  . HIS A 20  ? 1.9742 2.3537 1.1133 -0.2943 -0.1719 -0.5990 18  HIS A CB  
91   C CG  . HIS A 20  ? 2.0916 2.4425 1.0586 -0.2688 -0.2297 -0.5915 18  HIS A CG  
92   N ND1 . HIS A 20  ? 2.0797 2.4759 1.0624 -0.2312 -0.3060 -0.5714 18  HIS A ND1 
93   C CD2 . HIS A 20  ? 2.2619 2.5413 1.0333 -0.2728 -0.2232 -0.5994 18  HIS A CD2 
94   C CE1 . HIS A 20  ? 2.2357 2.5900 1.0435 -0.2087 -0.3515 -0.5665 18  HIS A CE1 
95   N NE2 . HIS A 20  ? 2.3535 2.6299 1.0208 -0.2352 -0.3025 -0.5815 18  HIS A NE2 
96   N N   . TYR A 21  ? 1.7416 2.1248 1.1578 -0.3137 -0.0647 -0.5170 19  TYR A N   
97   C CA  . TYR A 21  ? 1.6502 2.0536 1.2124 -0.3313 -0.0219 -0.5202 19  TYR A CA  
98   C C   . TYR A 21  ? 1.5962 2.0414 1.2791 -0.3419 -0.0251 -0.5726 19  TYR A C   
99   O O   . TYR A 21  ? 1.5761 2.0227 1.3474 -0.3557 0.0171  -0.5942 19  TYR A O   
100  C CB  . TYR A 21  ? 1.6993 2.0679 1.2239 -0.3529 0.0439  -0.5215 19  TYR A CB  
101  C CG  . TYR A 21  ? 1.7853 2.0951 1.1622 -0.3529 0.0525  -0.4774 19  TYR A CG  
102  C CD1 . TYR A 21  ? 1.7597 2.0499 1.1392 -0.3412 0.0346  -0.4197 19  TYR A CD1 
103  C CD2 . TYR A 21  ? 1.9938 2.2556 1.2172 -0.3664 0.0805  -0.4934 19  TYR A CD2 
104  C CE1 . TYR A 21  ? 1.8514 2.0713 1.0909 -0.3432 0.0427  -0.3795 19  TYR A CE1 
105  C CE2 . TYR A 21  ? 2.1343 2.3259 1.2124 -0.3701 0.0905  -0.4488 19  TYR A CE2 
106  C CZ  . TYR A 21  ? 1.9798 2.1483 1.0695 -0.3585 0.0705  -0.3921 19  TYR A CZ  
107  O OH  . TYR A 21  ? 2.0692 2.1519 1.0094 -0.3641 0.0809  -0.3482 19  TYR A OH  
108  N N   . ALA A 22  ? 1.6035 2.0818 1.2935 -0.3352 -0.0766 -0.5938 20  ALA A N   
109  C CA  . ALA A 22  ? 1.6113 2.1229 1.4209 -0.3509 -0.0848 -0.6388 20  ALA A CA  
110  C C   . ALA A 22  ? 1.5068 2.0473 1.4493 -0.3468 -0.0956 -0.6002 20  ALA A C   
111  O O   . ALA A 22  ? 1.4345 2.0187 1.4189 -0.3434 -0.1370 -0.5972 20  ALA A O   
112  C CB  . ALA A 22  ? 1.8049 2.3447 1.5669 -0.3544 -0.1358 -0.6838 20  ALA A CB  
113  N N   . TYR A 23  ? 1.5104 2.0298 1.5182 -0.3480 -0.0582 -0.5712 21  TYR A N   
114  C CA  . TYR A 23  ? 1.4171 1.9490 1.5152 -0.3419 -0.0670 -0.5235 21  TYR A CA  
115  C C   . TYR A 23  ? 1.3642 1.9190 1.5792 -0.3569 -0.0803 -0.5422 21  TYR A C   
116  O O   . TYR A 23  ? 1.3653 1.9495 1.6185 -0.3537 -0.1036 -0.5147 21  TYR A O   
117  C CB  . TYR A 23  ? 1.3956 1.8984 1.5294 -0.3409 -0.0309 -0.4907 21  TYR A CB  
118  C CG  . TYR A 23  ? 1.4603 1.9388 1.4883 -0.3346 -0.0157 -0.4632 21  TYR A CG  
119  C CD1 . TYR A 23  ? 1.6973 2.1594 1.7166 -0.3452 0.0280  -0.4758 21  TYR A CD1 
120  C CD2 . TYR A 23  ? 1.5078 1.9776 1.4490 -0.3187 -0.0421 -0.4251 21  TYR A CD2 
121  C CE1 . TYR A 23  ? 1.7977 2.2339 1.7210 -0.3488 0.0465  -0.4496 21  TYR A CE1 
122  C CE2 . TYR A 23  ? 1.6498 2.0798 1.4862 -0.3171 -0.0275 -0.3981 21  TYR A CE2 
123  C CZ  . TYR A 23  ? 1.7157 2.1281 1.5420 -0.3365 0.0176  -0.4096 21  TYR A CZ  
124  O OH  . TYR A 23  ? 1.6701 2.0393 1.3922 -0.3439 0.0367  -0.3822 21  TYR A OH  
125  N N   . ARG A 24  ? 1.4334 1.9699 1.7041 -0.3744 -0.0614 -0.5889 22  ARG A N   
126  C CA  . ARG A 24  ? 1.4037 1.9448 1.7781 -0.3951 -0.0714 -0.6075 22  ARG A CA  
127  C C   . ARG A 24  ? 1.4859 2.0809 1.8570 -0.4084 -0.1132 -0.6290 22  ARG A C   
128  O O   . ARG A 24  ? 1.5066 2.1243 1.9614 -0.4249 -0.1243 -0.6181 22  ARG A O   
129  C CB  . ARG A 24  ? 1.6668 2.1643 2.0866 -0.4087 -0.0442 -0.6613 22  ARG A CB  
130  C CG  . ARG A 24  ? 1.8613 2.3407 2.3832 -0.4342 -0.0509 -0.6782 22  ARG A CG  
131  C CD  . ARG A 24  ? 2.0341 2.4473 2.6136 -0.4349 -0.0179 -0.7115 22  ARG A CD  
132  N NE  . ARG A 24  ? 2.0101 2.3987 2.6329 -0.4092 0.0036  -0.6604 22  ARG A NE  
133  C CZ  . ARG A 24  ? 1.9652 2.2985 2.6627 -0.3985 0.0264  -0.6674 22  ARG A CZ  
134  N NH1 . ARG A 24  ? 2.0231 2.3074 2.7559 -0.4115 0.0367  -0.7250 22  ARG A NH1 
135  N NH2 . ARG A 24  ? 1.8208 2.1448 2.5576 -0.3733 0.0351  -0.6178 22  ARG A NH2 
136  N N   . ASP A 25  ? 1.5787 2.1966 1.8529 -0.4020 -0.1368 -0.6583 23  ASP A N   
137  C CA  . ASP A 25  ? 1.5479 2.2309 1.8199 -0.4090 -0.1865 -0.6802 23  ASP A CA  
138  C C   . ASP A 25  ? 1.4210 2.1545 1.7016 -0.3842 -0.2087 -0.6246 23  ASP A C   
139  O O   . ASP A 25  ? 1.3678 2.1649 1.7272 -0.3952 -0.2331 -0.6269 23  ASP A O   
140  C CB  . ASP A 25  ? 1.6580 2.3429 1.8066 -0.4037 -0.2120 -0.7242 23  ASP A CB  
141  N N   . ALA A 26  ? 1.3532 2.0574 1.5552 -0.3527 -0.1966 -0.5776 24  ALA A N   
142  C CA  . ALA A 26  ? 1.2879 2.0210 1.4830 -0.3232 -0.2116 -0.5254 24  ALA A CA  
143  C C   . ALA A 26  ? 1.2137 1.9559 1.5195 -0.3346 -0.1905 -0.4928 24  ALA A C   
144  O O   . ALA A 26  ? 1.2085 2.0108 1.5691 -0.3301 -0.2069 -0.4815 24  ALA A O   
145  C CB  . ALA A 26  ? 1.3757 2.0529 1.4554 -0.2946 -0.1981 -0.4855 24  ALA A CB  
146  N N   . VAL A 27  ? 1.2318 1.9149 1.5673 -0.3477 -0.1536 -0.4775 25  VAL A N   
147  C CA  . VAL A 27  ? 1.1689 1.8389 1.5875 -0.3591 -0.1332 -0.4420 25  VAL A CA  
148  C C   . VAL A 27  ? 1.1194 1.8322 1.6407 -0.3913 -0.1386 -0.4646 25  VAL A C   
149  O O   . VAL A 27  ? 1.1105 1.8455 1.6809 -0.3957 -0.1310 -0.4330 25  VAL A O   
150  C CB  . VAL A 27  ? 1.1660 1.7658 1.6048 -0.3669 -0.1023 -0.4314 25  VAL A CB  
151  C CG1 . VAL A 27  ? 1.1367 1.7120 1.6582 -0.3832 -0.0878 -0.4014 25  VAL A CG1 
152  C CG2 . VAL A 27  ? 1.2028 1.7694 1.5619 -0.3427 -0.0926 -0.3982 25  VAL A CG2 
153  N N   . PHE A 28  ? 1.1867 1.9093 1.7346 -0.4171 -0.1493 -0.5214 26  PHE A N   
154  C CA  . PHE A 28  ? 1.1270 1.8873 1.7734 -0.4575 -0.1555 -0.5503 26  PHE A CA  
155  C C   . PHE A 28  ? 1.1173 1.9797 1.7932 -0.4523 -0.1826 -0.5466 26  PHE A C   
156  O O   . PHE A 28  ? 1.2180 2.1132 1.9758 -0.4730 -0.1684 -0.5274 26  PHE A O   
157  C CB  . PHE A 28  ? 1.1795 1.9268 1.8324 -0.4861 -0.1673 -0.6199 26  PHE A CB  
158  C CG  . PHE A 28  ? 1.1826 1.9289 1.9405 -0.5381 -0.1619 -0.6481 26  PHE A CG  
159  C CD1 . PHE A 28  ? 1.2075 2.0398 2.0187 -0.5688 -0.1940 -0.6869 26  PHE A CD1 
160  C CD2 . PHE A 28  ? 1.1946 1.8520 2.0000 -0.5573 -0.1269 -0.6349 26  PHE A CD2 
161  C CE1 . PHE A 28  ? 1.3571 2.1765 2.2586 -0.6204 -0.1843 -0.7069 26  PHE A CE1 
162  C CE2 . PHE A 28  ? 1.2394 1.8771 2.1314 -0.6090 -0.1191 -0.6577 26  PHE A CE2 
163  C CZ  . PHE A 28  ? 1.2913 2.0088 2.2305 -0.6441 -0.1451 -0.6939 26  PHE A CZ  
164  N N   . LEU A 29  ? 1.0910 2.0023 1.6988 -0.4229 -0.2202 -0.5640 27  LEU A N   
165  C CA  . LEU A 29  ? 1.0830 2.0994 1.7202 -0.4049 -0.2536 -0.5625 27  LEU A CA  
166  C C   . LEU A 29  ? 1.0402 2.0634 1.6889 -0.3772 -0.2281 -0.5024 27  LEU A C   
167  O O   . LEU A 29  ? 1.0772 2.1778 1.8157 -0.3862 -0.2241 -0.4970 27  LEU A O   
168  C CB  . LEU A 29  ? 1.1330 2.1744 1.6668 -0.3658 -0.3015 -0.5807 27  LEU A CB  
169  C CG  . LEU A 29  ? 1.2105 2.2765 1.7208 -0.3866 -0.3439 -0.6463 27  LEU A CG  
170  C CD1 . LEU A 29  ? 1.2744 2.3150 1.6339 -0.3425 -0.3766 -0.6448 27  LEU A CD1 
171  C CD2 . LEU A 29  ? 1.2193 2.4086 1.8424 -0.4088 -0.3851 -0.6821 27  LEU A CD2 
172  N N   . ALA A 30  ? 1.0617 2.0052 1.6191 -0.3465 -0.2087 -0.4606 28  ALA A N   
173  C CA  . ALA A 30  ? 1.0668 1.9962 1.6129 -0.3210 -0.1841 -0.4059 28  ALA A CA  
174  C C   . ALA A 30  ? 1.0750 2.0037 1.7148 -0.3574 -0.1465 -0.3874 28  ALA A C   
175  O O   . ALA A 30  ? 1.1192 2.0951 1.7950 -0.3477 -0.1322 -0.3648 28  ALA A O   
176  C CB  . ALA A 30  ? 1.2056 2.0380 1.6449 -0.2976 -0.1695 -0.3709 28  ALA A CB  
177  N N   . GLU A 31  ? 1.0972 1.9657 1.7699 -0.3970 -0.1278 -0.3961 29  GLU A N   
178  C CA  . GLU A 31  ? 1.1040 1.9524 1.8525 -0.4357 -0.0933 -0.3762 29  GLU A CA  
179  C C   . GLU A 31  ? 1.0843 2.0343 1.9367 -0.4668 -0.0927 -0.4003 29  GLU A C   
180  O O   . GLU A 31  ? 1.1033 2.0694 1.9991 -0.4817 -0.0598 -0.3709 29  GLU A O   
181  C CB  . GLU A 31  ? 1.1469 1.9082 1.9155 -0.4688 -0.0807 -0.3879 29  GLU A CB  
182  C CG  . GLU A 31  ? 1.3486 2.0144 2.0500 -0.4451 -0.0695 -0.3516 29  GLU A CG  
183  C CD  . GLU A 31  ? 1.4594 2.0456 2.1948 -0.4686 -0.0590 -0.3657 29  GLU A CD  
184  O OE1 . GLU A 31  ? 1.4624 2.0536 2.2622 -0.5056 -0.0585 -0.4048 29  GLU A OE1 
185  O OE2 . GLU A 31  ? 1.4428 1.9613 2.1449 -0.4493 -0.0526 -0.3393 29  GLU A OE2 
186  N N   . ARG A 32  ? 1.0081 2.0291 1.8999 -0.4797 -0.1282 -0.4554 30  ARG A N   
187  C CA  . ARG A 32  ? 0.9929 2.1256 2.0013 -0.5156 -0.1327 -0.4850 30  ARG A CA  
188  C C   . ARG A 32  ? 1.0107 2.2522 2.0356 -0.4722 -0.1425 -0.4711 30  ARG A C   
189  O O   . ARG A 32  ? 1.1324 2.4611 2.2579 -0.4944 -0.1210 -0.4708 30  ARG A O   
190  C CB  . ARG A 32  ? 1.0331 2.2112 2.0804 -0.5465 -0.1754 -0.5534 30  ARG A CB  
191  C CG  . ARG A 32  ? 1.4072 2.4741 2.4086 -0.5690 -0.1750 -0.5791 30  ARG A CG  
192  C CD  . ARG A 32  ? 1.4259 2.4259 2.4991 -0.6302 -0.1395 -0.5821 30  ARG A CD  
193  N NE  . ARG A 32  ? 1.4550 2.4104 2.5394 -0.6327 -0.0921 -0.5205 30  ARG A NE  
194  C CZ  . ARG A 32  ? 1.4970 2.3412 2.5092 -0.6071 -0.0708 -0.4777 30  ARG A CZ  
195  N NH1 . ARG A 32  ? 1.4174 2.1992 2.3629 -0.5818 -0.0866 -0.4947 30  ARG A NH1 
196  N NH2 . ARG A 32  ? 1.5653 2.3634 2.5723 -0.6081 -0.0339 -0.4199 30  ARG A NH2 
197  N N   . LEU A 33  ? 1.0925 2.3253 2.0187 -0.4099 -0.1717 -0.4601 31  LEU A N   
198  C CA  . LEU A 33  ? 1.1434 2.4644 2.0727 -0.3561 -0.1864 -0.4481 31  LEU A CA  
199  C C   . LEU A 33  ? 1.2896 2.5891 2.2233 -0.3463 -0.1310 -0.3987 31  LEU A C   
200  O O   . LEU A 33  ? 1.1544 2.5547 2.1776 -0.3443 -0.1130 -0.3999 31  LEU A O   
201  C CB  . LEU A 33  ? 1.1720 2.4541 1.9720 -0.2935 -0.2270 -0.4415 31  LEU A CB  
202  C CG  . LEU A 33  ? 1.2310 2.5746 2.0121 -0.2253 -0.2441 -0.4236 31  LEU A CG  
203  C CD1 . LEU A 33  ? 1.2931 2.7993 2.2032 -0.2226 -0.2779 -0.4626 31  LEU A CD1 
204  C CD2 . LEU A 33  ? 1.3337 2.6050 1.9663 -0.1713 -0.2806 -0.4116 31  LEU A CD2 
205  N N   . TYR A 34  ? 1.4597 2.6323 2.2966 -0.3402 -0.1042 -0.3576 32  TYR A N   
206  C CA  . TYR A 34  ? 1.4067 2.5393 2.2243 -0.3348 -0.0541 -0.3108 32  TYR A CA  
207  C C   . TYR A 34  ? 1.3713 2.5387 2.2944 -0.3932 -0.0082 -0.3089 32  TYR A C   
208  O O   . TYR A 34  ? 1.4192 2.6161 2.3612 -0.3875 0.0334  -0.2853 32  TYR A O   
209  C CB  . TYR A 34  ? 1.3635 2.3542 2.0668 -0.3286 -0.0424 -0.2717 32  TYR A CB  
210  C CG  . TYR A 34  ? 1.4528 2.3957 2.1153 -0.3210 0.0015  -0.2251 32  TYR A CG  
211  C CD1 . TYR A 34  ? 1.5418 2.5132 2.1636 -0.2709 0.0089  -0.2118 32  TYR A CD1 
212  C CD2 . TYR A 34  ? 1.6294 2.4915 2.2860 -0.3616 0.0345  -0.1952 32  TYR A CD2 
213  C CE1 . TYR A 34  ? 1.6757 2.5984 2.2485 -0.2649 0.0515  -0.1746 32  TYR A CE1 
214  C CE2 . TYR A 34  ? 1.7734 2.5858 2.3751 -0.3562 0.0723  -0.1531 32  TYR A CE2 
215  C CZ  . TYR A 34  ? 1.8005 2.6445 2.3586 -0.3095 0.0823  -0.1452 32  TYR A CZ  
216  O OH  . TYR A 34  ? 1.9158 2.7052 2.4071 -0.3040 0.1223  -0.1085 32  TYR A OH  
217  N N   . ALA A 35  ? 1.2020 2.3574 2.1865 -0.4509 -0.0114 -0.3342 33  ALA A N   
218  C CA  . ALA A 35  ? 1.0600 2.2319 2.1387 -0.5154 0.0336  -0.3315 33  ALA A CA  
219  C C   . ALA A 35  ? 1.0667 2.4019 2.2753 -0.5294 0.0393  -0.3634 33  ALA A C   
220  O O   . ALA A 35  ? 1.2883 2.6583 2.5606 -0.5639 0.0933  -0.3474 33  ALA A O   
221  C CB  . ALA A 35  ? 1.0145 2.1166 2.1204 -0.5718 0.0259  -0.3535 33  ALA A CB  
222  N N   . GLU A 36  ? 1.0520 2.4903 2.3004 -0.5033 -0.0163 -0.4087 34  GLU A N   
223  C CA  . GLU A 36  ? 1.1982 2.8113 2.5859 -0.5108 -0.0228 -0.4441 34  GLU A CA  
224  C C   . GLU A 36  ? 1.3393 3.0061 2.7135 -0.4476 0.0045  -0.4144 34  GLU A C   
225  O O   . GLU A 36  ? 1.3351 3.0663 2.7899 -0.4700 0.0618  -0.4038 34  GLU A O   
226  C CB  . GLU A 36  ? 1.1363 2.8367 2.5571 -0.4963 -0.1012 -0.5001 34  GLU A CB  
227  C CG  . GLU A 36  ? 1.1637 3.0076 2.7083 -0.4970 -0.1206 -0.5277 34  GLU A CG  
228  C CD  . GLU A 36  ? 1.1653 3.1405 2.7570 -0.4287 -0.1219 -0.5225 34  GLU A CD  
229  O OE1 . GLU A 36  ? 1.1908 3.1333 2.6834 -0.3600 -0.1388 -0.5039 34  GLU A OE1 
230  O OE2 . GLU A 36  ? 1.1484 3.2326 2.8583 -0.4370 -0.1043 -0.5298 34  GLU A OE2 
231  N N   . VAL A 37  ? 1.3622 2.9958 2.6295 -0.3698 -0.0329 -0.4025 35  VAL A N   
232  C CA  . VAL A 37  ? 1.4430 3.0968 2.6721 -0.3013 -0.0100 -0.3750 35  VAL A CA  
233  C C   . VAL A 37  ? 1.5955 3.0787 2.6612 -0.2788 0.0160  -0.3236 35  VAL A C   
234  O O   . VAL A 37  ? 1.6010 2.9820 2.5596 -0.2652 -0.0196 -0.3158 35  VAL A O   
235  C CB  . VAL A 37  ? 1.2906 3.0344 2.5214 -0.2235 -0.0743 -0.3991 35  VAL A CB  
236  C CG1 . VAL A 37  ? 1.2717 2.9189 2.3747 -0.1989 -0.1369 -0.4017 35  VAL A CG1 
237  C CG2 . VAL A 37  ? 1.2328 2.9914 2.4313 -0.1494 -0.0462 -0.3741 35  VAL A CG2 
238  N N   . HIS A 38  ? 1.6883 3.1431 2.7357 -0.2794 0.0797  -0.2906 36  HIS A N   
239  C CA  . HIS A 38  ? 1.7002 2.9946 2.5995 -0.2713 0.1036  -0.2433 36  HIS A CA  
240  C C   . HIS A 38  ? 1.7242 2.9678 2.5056 -0.1925 0.0870  -0.2266 36  HIS A C   
241  O O   . HIS A 38  ? 1.7460 2.8860 2.4214 -0.1813 0.1186  -0.1907 36  HIS A O   
242  C CB  . HIS A 38  ? 1.7443 3.0100 2.6524 -0.3138 0.1785  -0.2135 36  HIS A CB  
243  C CG  . HIS A 38  ? 1.8096 3.0702 2.7954 -0.3970 0.1989  -0.2171 36  HIS A CG  
244  N ND1 . HIS A 38  ? 1.8932 3.2837 3.0326 -0.4386 0.1962  -0.2583 36  HIS A ND1 
245  C CD2 . HIS A 38  ? 1.8186 2.9533 2.7485 -0.4459 0.2191  -0.1849 36  HIS A CD2 
246  C CE1 . HIS A 38  ? 1.9298 3.2644 3.0989 -0.5130 0.2185  -0.2516 36  HIS A CE1 
247  N NE2 . HIS A 38  ? 1.9057 3.0829 2.9480 -0.5150 0.2322  -0.2056 36  HIS A NE2 
248  N N   . SER A 39  ? 1.7524 3.0613 2.5457 -0.1395 0.0354  -0.2525 37  SER A N   
249  C CA  . SER A 39  ? 1.7382 3.0026 2.4286 -0.0609 0.0202  -0.2391 37  SER A CA  
250  C C   . SER A 39  ? 1.7043 2.7983 2.2299 -0.0567 0.0141  -0.2045 37  SER A C   
251  O O   . SER A 39  ? 1.6381 2.6646 2.1357 -0.1033 0.0029  -0.1977 37  SER A O   
252  C CB  . SER A 39  ? 1.7821 3.1291 2.5020 -0.0084 -0.0449 -0.2694 37  SER A CB  
253  O OG  . SER A 39  ? 1.8056 3.1214 2.4989 -0.0370 -0.0946 -0.2831 37  SER A OG  
254  N N   . GLU A 40  ? 1.8440 2.8711 2.2668 -0.0005 0.0214  -0.1857 38  GLU A N   
255  C CA  . GLU A 40  ? 1.9486 2.8214 2.2178 0.0043  0.0112  -0.1567 38  GLU A CA  
256  C C   . GLU A 40  ? 1.9621 2.8006 2.1781 0.0158  -0.0462 -0.1649 38  GLU A C   
257  O O   . GLU A 40  ? 1.9996 2.7300 2.1210 -0.0039 -0.0557 -0.1467 38  GLU A O   
258  C CB  . GLU A 40  ? 2.1038 2.9097 2.2750 0.0600  0.0341  -0.1402 38  GLU A CB  
259  N N   . GLU A 41  ? 1.9078 2.8425 2.1852 0.0460  -0.0843 -0.1930 39  GLU A N   
260  C CA  . GLU A 41  ? 1.8257 2.7267 2.0369 0.0604  -0.1378 -0.2010 39  GLU A CA  
261  C C   . GLU A 41  ? 1.6936 2.6123 1.9530 -0.0030 -0.1503 -0.2193 39  GLU A C   
262  O O   . GLU A 41  ? 1.7971 2.6384 1.9745 -0.0171 -0.1689 -0.2156 39  GLU A O   
263  C CB  . GLU A 41  ? 1.8707 2.8600 2.1132 0.1238  -0.1818 -0.2222 39  GLU A CB  
264  N N   . ALA A 42  ? 1.4772 2.4953 1.8702 -0.0425 -0.1359 -0.2413 40  ALA A N   
265  C CA  . ALA A 42  ? 1.3608 2.3873 1.8049 -0.1035 -0.1431 -0.2623 40  ALA A CA  
266  C C   . ALA A 42  ? 1.4671 2.3831 1.8623 -0.1438 -0.1096 -0.2339 40  ALA A C   
267  O O   . ALA A 42  ? 1.5828 2.4518 1.9589 -0.1744 -0.1201 -0.2420 40  ALA A O   
268  C CB  . ALA A 42  ? 1.2421 2.3938 1.8405 -0.1394 -0.1348 -0.2928 40  ALA A CB  
269  N N   . LEU A 43  ? 1.4390 2.3165 1.8145 -0.1409 -0.0699 -0.2023 41  LEU A N   
270  C CA  . LEU A 43  ? 1.4167 2.1878 1.7353 -0.1711 -0.0462 -0.1705 41  LEU A CA  
271  C C   . LEU A 43  ? 1.4244 2.1032 1.6314 -0.1564 -0.0698 -0.1590 41  LEU A C   
272  O O   . LEU A 43  ? 1.3787 2.0078 1.5776 -0.1881 -0.0733 -0.1566 41  LEU A O   
273  C CB  . LEU A 43  ? 1.4539 2.1941 1.7419 -0.1625 -0.0051 -0.1396 41  LEU A CB  
274  N N   . PHE A 44  ? 1.5672 2.2233 1.6921 -0.1076 -0.0834 -0.1525 42  PHE A N   
275  C CA  . PHE A 44  ? 1.5817 2.1492 1.5939 -0.0955 -0.1027 -0.1414 42  PHE A CA  
276  C C   . PHE A 44  ? 1.5375 2.1194 1.5610 -0.1161 -0.1271 -0.1664 42  PHE A C   
277  O O   . PHE A 44  ? 1.5004 2.0199 1.4830 -0.1411 -0.1246 -0.1597 42  PHE A O   
278  C CB  . PHE A 44  ? 1.6680 2.2103 1.5953 -0.0364 -0.1160 -0.1342 42  PHE A CB  
279  C CG  . PHE A 44  ? 1.7160 2.1703 1.5256 -0.0264 -0.1375 -0.1256 42  PHE A CG  
280  C CD1 . PHE A 44  ? 1.6919 2.0463 1.4259 -0.0530 -0.1250 -0.1030 42  PHE A CD1 
281  C CD2 . PHE A 44  ? 1.7370 2.2079 1.5087 0.0074  -0.1710 -0.1394 42  PHE A CD2 
282  C CE1 . PHE A 44  ? 1.6863 1.9616 1.3164 -0.0523 -0.1376 -0.0953 42  PHE A CE1 
283  C CE2 . PHE A 44  ? 1.8440 2.2226 1.4943 0.0116  -0.1845 -0.1279 42  PHE A CE2 
284  C CZ  . PHE A 44  ? 1.7926 2.0743 1.3753 -0.0212 -0.1637 -0.1062 42  PHE A CZ  
285  N N   . LEU A 45  ? 1.6859 2.3542 1.7657 -0.1057 -0.1503 -0.1980 43  LEU A N   
286  C CA  . LEU A 45  ? 1.7914 2.4731 1.8700 -0.1241 -0.1738 -0.2279 43  LEU A CA  
287  C C   . LEU A 45  ? 1.7778 2.4449 1.9155 -0.1773 -0.1541 -0.2384 43  LEU A C   
288  O O   . LEU A 45  ? 1.9084 2.5306 2.0034 -0.1930 -0.1547 -0.2466 43  LEU A O   
289  C CB  . LEU A 45  ? 1.6619 2.4490 1.8038 -0.1088 -0.2071 -0.2636 43  LEU A CB  
290  N N   . LEU A 46  ? 1.4292 2.1315 1.6645 -0.2036 -0.1339 -0.2380 44  LEU A N   
291  C CA  . LEU A 46  ? 1.2343 1.9068 1.5237 -0.2476 -0.1158 -0.2417 44  LEU A CA  
292  C C   . LEU A 46  ? 1.2082 1.7912 1.4355 -0.2513 -0.1030 -0.2108 44  LEU A C   
293  O O   . LEU A 46  ? 1.3013 1.8557 1.5315 -0.2688 -0.1020 -0.2239 44  LEU A O   
294  C CB  . LEU A 46  ? 1.1577 1.8625 1.5417 -0.2742 -0.0932 -0.2355 44  LEU A CB  
295  C CG  . LEU A 46  ? 1.1239 1.7835 1.5615 -0.3156 -0.0769 -0.2348 44  LEU A CG  
296  C CD1 . LEU A 46  ? 1.0873 1.7487 1.5463 -0.3313 -0.0920 -0.2778 44  LEU A CD1 
297  C CD2 . LEU A 46  ? 1.1856 1.8747 1.7093 -0.3469 -0.0541 -0.2306 44  LEU A CD2 
298  N N   . ALA A 47  ? 1.2460 1.7891 1.4215 -0.2351 -0.0930 -0.1734 45  ALA A N   
299  C CA  . ALA A 47  ? 1.2742 1.7385 1.3905 -0.2405 -0.0878 -0.1443 45  ALA A CA  
300  C C   . ALA A 47  ? 1.3219 1.7587 1.3708 -0.2344 -0.0989 -0.1550 45  ALA A C   
301  O O   . ALA A 47  ? 1.3718 1.7737 1.4189 -0.2532 -0.0943 -0.1514 45  ALA A O   
302  C CB  . ALA A 47  ? 1.5219 1.9454 1.5745 -0.2224 -0.0793 -0.1096 45  ALA A CB  
303  N N   . THR A 48  ? 1.4313 1.8857 1.4260 -0.2072 -0.1129 -0.1671 46  THR A N   
304  C CA  . THR A 48  ? 1.4569 1.8800 1.3711 -0.2026 -0.1210 -0.1766 46  THR A CA  
305  C C   . THR A 48  ? 1.4163 1.8629 1.3828 -0.2315 -0.1151 -0.2097 46  THR A C   
306  O O   . THR A 48  ? 1.5799 1.9906 1.5186 -0.2485 -0.1018 -0.2103 46  THR A O   
307  C CB  . THR A 48  ? 1.5005 1.9403 1.3503 -0.1641 -0.1445 -0.1847 46  THR A CB  
308  O OG1 . THR A 48  ? 1.5505 1.9610 1.3523 -0.1306 -0.1459 -0.1565 46  THR A OG1 
309  C CG2 . THR A 48  ? 1.5803 1.9715 1.3272 -0.1636 -0.1501 -0.1899 46  THR A CG2 
310  N N   . CYS A 49  ? 1.2920 1.8003 1.3373 -0.2384 -0.1223 -0.2405 47  CYS A N   
311  C CA  . CYS A 49  ? 1.2433 1.7684 1.3363 -0.2634 -0.1163 -0.2796 47  CYS A CA  
312  C C   . CYS A 49  ? 1.2054 1.6985 1.3554 -0.2866 -0.0930 -0.2716 47  CYS A C   
313  O O   . CYS A 49  ? 1.2211 1.6990 1.3648 -0.2978 -0.0788 -0.2909 47  CYS A O   
314  C CB  . CYS A 49  ? 1.2024 1.7925 1.3772 -0.2729 -0.1298 -0.3139 47  CYS A CB  
315  S SG  . CYS A 49  ? 1.7902 2.4419 1.9213 -0.2442 -0.1689 -0.3348 47  CYS A SG  
316  N N   . TYR A 50  ? 1.1683 1.6525 1.3734 -0.2918 -0.0887 -0.2438 48  TYR A N   
317  C CA  . TYR A 50  ? 1.1278 1.5781 1.3825 -0.3062 -0.0767 -0.2290 48  TYR A CA  
318  C C   . TYR A 50  ? 1.1447 1.5622 1.3450 -0.3050 -0.0712 -0.2132 48  TYR A C   
319  O O   . TYR A 50  ? 1.1448 1.5578 1.3912 -0.3154 -0.0602 -0.2237 48  TYR A O   
320  C CB  . TYR A 50  ? 1.1262 1.5581 1.4144 -0.3093 -0.0775 -0.1923 48  TYR A CB  
321  C CG  . TYR A 50  ? 1.1085 1.5653 1.4728 -0.3239 -0.0736 -0.2067 48  TYR A CG  
322  C CD1 . TYR A 50  ? 1.1315 1.5865 1.5057 -0.3277 -0.0681 -0.1781 48  TYR A CD1 
323  C CD2 . TYR A 50  ? 1.2258 1.7021 1.6490 -0.3384 -0.0713 -0.2509 48  TYR A CD2 
324  C CE1 . TYR A 50  ? 1.1219 1.5984 1.5688 -0.3499 -0.0588 -0.1905 48  TYR A CE1 
325  C CE2 . TYR A 50  ? 1.2934 1.7848 1.7869 -0.3597 -0.0674 -0.2660 48  TYR A CE2 
326  C CZ  . TYR A 50  ? 1.1349 1.6282 1.6435 -0.3677 -0.0604 -0.2343 48  TYR A CZ  
327  O OH  . TYR A 50  ? 1.0869 1.5946 1.6682 -0.3974 -0.0511 -0.2488 48  TYR A OH  
328  N N   . TYR A 51  ? 1.2145 1.6091 1.3226 -0.2928 -0.0774 -0.1898 49  TYR A N   
329  C CA  . TYR A 51  ? 1.2723 1.6299 1.3248 -0.3003 -0.0713 -0.1739 49  TYR A CA  
330  C C   . TYR A 51  ? 1.4180 1.7812 1.4404 -0.3104 -0.0540 -0.2025 49  TYR A C   
331  O O   . TYR A 51  ? 1.5426 1.9008 1.5846 -0.3284 -0.0383 -0.2030 49  TYR A O   
332  C CB  . TYR A 51  ? 1.3014 1.6149 1.2511 -0.2857 -0.0811 -0.1430 49  TYR A CB  
333  C CG  . TYR A 51  ? 1.3459 1.6110 1.2378 -0.3022 -0.0762 -0.1246 49  TYR A CG  
334  C CD1 . TYR A 51  ? 1.4083 1.6466 1.2165 -0.3075 -0.0652 -0.1316 49  TYR A CD1 
335  C CD2 . TYR A 51  ? 1.3675 1.6129 1.2876 -0.3171 -0.0835 -0.1011 49  TYR A CD2 
336  C CE1 . TYR A 51  ? 1.4490 1.6428 1.2093 -0.3319 -0.0563 -0.1162 49  TYR A CE1 
337  C CE2 . TYR A 51  ? 1.3790 1.5886 1.2569 -0.3394 -0.0820 -0.0886 49  TYR A CE2 
338  C CZ  . TYR A 51  ? 1.4203 1.6053 1.2230 -0.3495 -0.0655 -0.0970 49  TYR A CZ  
339  O OH  . TYR A 51  ? 1.5073 1.6554 1.2717 -0.3805 -0.0598 -0.0854 49  TYR A OH  
340  N N   . ARG A 52  ? 1.4649 1.8421 1.4395 -0.2998 -0.0568 -0.2271 50  ARG A N   
341  C CA  . ARG A 52  ? 1.5153 1.8876 1.4354 -0.3101 -0.0376 -0.2536 50  ARG A CA  
342  C C   . ARG A 52  ? 1.5017 1.9100 1.5093 -0.3243 -0.0169 -0.2960 50  ARG A C   
343  O O   . ARG A 52  ? 1.7361 2.1423 1.7209 -0.3385 0.0122  -0.3187 50  ARG A O   
344  C CB  . ARG A 52  ? 1.5741 1.9380 1.3910 -0.2901 -0.0556 -0.2616 50  ARG A CB  
345  C CG  . ARG A 52  ? 1.6316 1.9457 1.3541 -0.2698 -0.0717 -0.2208 50  ARG A CG  
346  C CD  . ARG A 52  ? 1.8550 2.1546 1.4712 -0.2423 -0.0944 -0.2252 50  ARG A CD  
347  N NE  . ARG A 52  ? 2.1648 2.4212 1.6816 -0.2590 -0.0741 -0.2338 50  ARG A NE  
348  C CZ  . ARG A 52  ? 2.3677 2.6159 1.7936 -0.2462 -0.0883 -0.2515 50  ARG A CZ  
349  N NH1 . ARG A 52  ? 2.3661 2.6574 1.8013 -0.2145 -0.1297 -0.2648 50  ARG A NH1 
350  N NH2 . ARG A 52  ? 2.4833 2.6822 1.8076 -0.2669 -0.0612 -0.2558 50  ARG A NH2 
351  N N   . SER A 53  ? 1.2916 1.7266 1.3961 -0.3213 -0.0277 -0.3071 51  SER A N   
352  C CA  . SER A 53  ? 1.2479 1.7020 1.4467 -0.3306 -0.0098 -0.3448 51  SER A CA  
353  C C   . SER A 53  ? 1.2586 1.7103 1.5284 -0.3370 0.0092  -0.3328 51  SER A C   
354  O O   . SER A 53  ? 1.2167 1.6813 1.5714 -0.3378 0.0270  -0.3627 51  SER A O   
355  C CB  . SER A 53  ? 1.3427 1.8098 1.6196 -0.3292 -0.0275 -0.3533 51  SER A CB  
356  O OG  . SER A 53  ? 1.4931 1.9451 1.8247 -0.3270 -0.0370 -0.3119 51  SER A OG  
357  N N   . GLY A 54  ? 1.3752 1.8104 1.6122 -0.3400 0.0031  -0.2914 52  GLY A N   
358  C CA  . GLY A 54  ? 1.4090 1.8538 1.7128 -0.3485 0.0137  -0.2797 52  GLY A CA  
359  C C   . GLY A 54  ? 1.3032 1.7427 1.6912 -0.3401 -0.0128 -0.2501 52  GLY A C   
360  O O   . GLY A 54  ? 1.3882 1.8452 1.8565 -0.3410 -0.0125 -0.2454 52  GLY A O   
361  N N   . LYS A 55  ? 1.1697 1.5872 1.5396 -0.3315 -0.0358 -0.2299 53  LYS A N   
362  C CA  . LYS A 55  ? 1.1486 1.5468 1.5764 -0.3253 -0.0587 -0.1984 53  LYS A CA  
363  C C   . LYS A 55  ? 1.3901 1.7561 1.7374 -0.3250 -0.0789 -0.1554 53  LYS A C   
364  O O   . LYS A 55  ? 1.3162 1.6712 1.6465 -0.3203 -0.0839 -0.1461 53  LYS A O   
365  C CB  . LYS A 55  ? 1.0830 1.4764 1.5750 -0.3203 -0.0575 -0.2171 53  LYS A CB  
366  N N   . ALA A 56  ? 1.5879 1.9397 1.8878 -0.3323 -0.0871 -0.1328 54  ALA A N   
367  C CA  . ALA A 56  ? 1.5691 1.8787 1.7827 -0.3314 -0.1044 -0.0959 54  ALA A CA  
368  C C   . ALA A 56  ? 1.3428 1.6258 1.5761 -0.3253 -0.1226 -0.0661 54  ALA A C   
369  O O   . ALA A 56  ? 1.3993 1.6591 1.5725 -0.3189 -0.1218 -0.0497 54  ALA A O   
370  C CB  . ALA A 56  ? 1.7852 2.0778 1.9601 -0.3475 -0.1135 -0.0807 54  ALA A CB  
371  N N   . TYR A 57  ? 1.3173 1.6017 1.6319 -0.3255 -0.1374 -0.0582 55  TYR A N   
372  C CA  . TYR A 57  ? 1.3617 1.6057 1.6834 -0.3212 -0.1571 -0.0237 55  TYR A CA  
373  C C   . TYR A 57  ? 1.3629 1.5969 1.6738 -0.3198 -0.1381 -0.0247 55  TYR A C   
374  O O   . TYR A 57  ? 1.4632 1.6577 1.7265 -0.3216 -0.1416 0.0071  55  TYR A O   
375  C CB  . TYR A 57  ? 1.3724 1.6197 1.7962 -0.3136 -0.1761 -0.0209 55  TYR A CB  
376  C CG  . TYR A 57  ? 1.4022 1.6663 1.9159 -0.3058 -0.1561 -0.0534 55  TYR A CG  
377  C CD1 . TYR A 57  ? 1.3435 1.5695 1.8677 -0.3063 -0.1503 -0.0442 55  TYR A CD1 
378  C CD2 . TYR A 57  ? 1.5248 1.8372 2.1085 -0.3016 -0.1390 -0.0955 55  TYR A CD2 
379  C CE1 . TYR A 57  ? 1.3315 1.5608 1.9326 -0.3035 -0.1332 -0.0775 55  TYR A CE1 
380  C CE2 . TYR A 57  ? 1.5344 1.8519 2.1905 -0.2941 -0.1197 -0.1307 55  TYR A CE2 
381  C CZ  . TYR A 57  ? 1.4336 1.7062 2.0979 -0.2954 -0.1195 -0.1223 55  TYR A CZ  
382  O OH  . TYR A 57  ? 1.5176 1.7838 2.2491 -0.2922 -0.1013 -0.1609 55  TYR A OH  
383  N N   . LYS A 58  ? 1.3026 1.5749 1.6563 -0.3200 -0.1165 -0.0635 56  LYS A N   
384  C CA  . LYS A 58  ? 1.3093 1.5888 1.6719 -0.3248 -0.1000 -0.0723 56  LYS A CA  
385  C C   . LYS A 58  ? 1.3299 1.6177 1.6092 -0.3201 -0.0927 -0.0624 56  LYS A C   
386  O O   . LYS A 58  ? 1.4238 1.7005 1.6876 -0.3238 -0.0830 -0.0434 56  LYS A O   
387  C CB  . LYS A 58  ? 1.2392 1.5596 1.6622 -0.3283 -0.0857 -0.1225 56  LYS A CB  
388  N N   . ALA A 59  ? 1.2692 1.5734 1.4945 -0.3109 -0.0939 -0.0756 57  ALA A N   
389  C CA  . ALA A 59  ? 1.3170 1.6196 1.4592 -0.2972 -0.0898 -0.0669 57  ALA A CA  
390  C C   . ALA A 59  ? 1.4888 1.7383 1.5670 -0.2957 -0.0939 -0.0266 57  ALA A C   
391  O O   . ALA A 59  ? 1.5708 1.8193 1.6092 -0.2851 -0.0807 -0.0174 57  ALA A O   
392  C CB  . ALA A 59  ? 1.4146 1.7182 1.4961 -0.2884 -0.0931 -0.0816 57  ALA A CB  
393  N N   . TYR A 60  ? 1.6440 1.8535 1.7129 -0.3054 -0.1125 -0.0055 58  TYR A N   
394  C CA  . TYR A 60  ? 1.7310 1.8818 1.7281 -0.3073 -0.1229 0.0313  58  TYR A CA  
395  C C   . TYR A 60  ? 1.7749 1.9091 1.7782 -0.3110 -0.1085 0.0525  58  TYR A C   
396  O O   . TYR A 60  ? 1.9292 2.0393 1.8593 -0.3047 -0.0927 0.0670  58  TYR A O   
397  C CB  . TYR A 60  ? 1.6708 1.7942 1.6770 -0.3191 -0.1552 0.0475  58  TYR A CB  
398  C CG  . TYR A 60  ? 1.6389 1.6965 1.5630 -0.3237 -0.1752 0.0847  58  TYR A CG  
399  C CD1 . TYR A 60  ? 1.7182 1.7335 1.5381 -0.3256 -0.1839 0.0909  58  TYR A CD1 
400  C CD2 . TYR A 60  ? 1.7328 1.7588 1.6713 -0.3274 -0.1867 0.1134  58  TYR A CD2 
401  C CE1 . TYR A 60  ? 1.9015 1.8505 1.6327 -0.3318 -0.2040 0.1202  58  TYR A CE1 
402  C CE2 . TYR A 60  ? 1.9058 1.8643 1.7501 -0.3322 -0.2075 0.1479  58  TYR A CE2 
403  C CZ  . TYR A 60  ? 1.9555 1.8787 1.6962 -0.3348 -0.2165 0.1488  58  TYR A CZ  
404  O OH  . TYR A 60  ? 2.0184 1.8686 1.6525 -0.3415 -0.2387 0.1785  58  TYR A OH  
405  N N   . ARG A 61  ? 1.6730 1.8143 1.7595 -0.3216 -0.1089 0.0534  59  ARG A N   
406  C CA  . ARG A 61  ? 1.7470 1.8567 1.8311 -0.3328 -0.0925 0.0793  59  ARG A CA  
407  C C   . ARG A 61  ? 1.7539 1.9124 1.8524 -0.3341 -0.0545 0.0607  59  ARG A C   
408  O O   . ARG A 61  ? 1.8556 1.9951 1.9131 -0.3406 -0.0290 0.0816  59  ARG A O   
409  C CB  . ARG A 61  ? 1.7339 1.8212 1.8981 -0.3438 -0.1031 0.0871  59  ARG A CB  
410  C CG  . ARG A 61  ? 1.6985 1.7815 1.9101 -0.3347 -0.1392 0.0833  59  ARG A CG  
411  C CD  . ARG A 61  ? 1.8012 1.8341 2.0664 -0.3370 -0.1531 0.1052  59  ARG A CD  
412  N NE  . ARG A 61  ? 1.9982 2.0078 2.2782 -0.3225 -0.1980 0.1241  59  ARG A NE  
413  C CZ  . ARG A 61  ? 2.1927 2.1452 2.3980 -0.3205 -0.2303 0.1682  59  ARG A CZ  
414  N NH1 . ARG A 61  ? 2.2907 2.1950 2.3893 -0.3327 -0.2151 0.1976  59  ARG A NH1 
415  N NH2 . ARG A 61  ? 2.2393 2.1868 2.4770 -0.3060 -0.2782 0.1807  59  ARG A NH2 
416  N N   . LEU A 62  ? 1.7215 1.9471 1.8799 -0.3286 -0.0507 0.0201  60  LEU A N   
417  C CA  . LEU A 62  ? 1.6976 1.9880 1.8865 -0.3273 -0.0246 -0.0029 60  LEU A CA  
418  C C   . LEU A 62  ? 1.8125 2.1054 1.9194 -0.3046 -0.0101 0.0070  60  LEU A C   
419  O O   . LEU A 62  ? 2.0345 2.3404 2.1396 -0.3091 0.0209  0.0169  60  LEU A O   
420  C CB  . LEU A 62  ? 1.5373 1.8927 1.7839 -0.3214 -0.0350 -0.0486 60  LEU A CB  
421  N N   . LEU A 63  ? 1.6995 1.9756 1.7384 -0.2810 -0.0282 0.0032  61  LEU A N   
422  C CA  . LEU A 63  ? 1.6872 1.9501 1.6412 -0.2534 -0.0157 0.0093  61  LEU A CA  
423  C C   . LEU A 63  ? 1.9047 2.1007 1.7824 -0.2602 0.0009  0.0438  61  LEU A C   
424  O O   . LEU A 63  ? 1.9835 2.1877 1.8272 -0.2452 0.0325  0.0462  61  LEU A O   
425  C CB  . LEU A 63  ? 1.5930 1.8230 1.4755 -0.2338 -0.0398 0.0028  61  LEU A CB  
426  N N   . LYS A 64  ? 1.8775 2.0094 1.7275 -0.2806 -0.0214 0.0689  62  LYS A N   
427  C CA  . LYS A 64  ? 1.9420 1.9959 1.7011 -0.2900 -0.0173 0.1044  62  LYS A CA  
428  C C   . LYS A 64  ? 1.9770 2.0306 1.7486 -0.3069 0.0220  0.1227  62  LYS A C   
429  O O   . LYS A 64  ? 2.0718 2.0820 1.7525 -0.3043 0.0484  0.1405  62  LYS A O   
430  C CB  . LYS A 64  ? 1.9023 1.9003 1.6473 -0.3065 -0.0616 0.1262  62  LYS A CB  
431  N N   . GLY A 65  ? 1.9733 2.0688 1.8511 -0.3273 0.0301  0.1167  63  GLY A N   
432  C CA  . GLY A 65  ? 2.2182 2.2971 2.1071 -0.3547 0.0670  0.1395  63  GLY A CA  
433  C C   . GLY A 65  ? 2.3419 2.4719 2.2318 -0.3537 0.1247  0.1304  63  GLY A C   
434  O O   . GLY A 65  ? 2.5544 2.6417 2.3932 -0.3742 0.1624  0.1588  63  GLY A O   
435  N N   . HIS A 66  ? 2.1811 2.4022 2.1270 -0.3291 0.1329  0.0922  64  HIS A N   
436  C CA  . HIS A 66  ? 2.2401 2.5192 2.1879 -0.3154 0.1844  0.0805  64  HIS A CA  
437  C C   . HIS A 66  ? 2.1667 2.4624 2.0693 -0.2643 0.1658  0.0578  64  HIS A C   
438  O O   . HIS A 66  ? 2.1508 2.5103 2.1174 -0.2444 0.1391  0.0279  64  HIS A O   
439  C CB  . HIS A 66  ? 2.2425 2.6313 2.3304 -0.3382 0.2160  0.0557  64  HIS A CB  
440  C CG  . HIS A 66  ? 2.0718 2.5446 2.2622 -0.3271 0.1788  0.0155  64  HIS A CG  
441  N ND1 . HIS A 66  ? 2.0373 2.4813 2.2562 -0.3419 0.1357  0.0108  64  HIS A ND1 
442  C CD2 . HIS A 66  ? 2.0315 2.6144 2.2959 -0.2999 0.1766  -0.0227 64  HIS A CD2 
443  C CE1 . HIS A 66  ? 2.0602 2.5870 2.3549 -0.3287 0.1123  -0.0293 64  HIS A CE1 
444  N NE2 . HIS A 66  ? 2.0498 2.6609 2.3715 -0.3028 0.1317  -0.0485 64  HIS A NE2 
445  N N   . SER A 67  ? 2.3288 2.5541 2.1079 -0.2442 0.1803  0.0730  65  SER A N   
446  C CA  . SER A 67  ? 2.4047 2.5868 2.0977 -0.2039 0.1527  0.0629  65  SER A CA  
447  C C   . SER A 67  ? 2.2376 2.4950 1.9677 -0.1544 0.1635  0.0296  65  SER A C   
448  O O   . SER A 67  ? 2.2962 2.6080 2.0511 -0.1351 0.2109  0.0188  65  SER A O   
449  C CB  . SER A 67  ? 2.6773 2.7476 2.2167 -0.2017 0.1645  0.0865  65  SER A CB  
450  O OG  . SER A 67  ? 2.8009 2.7923 2.2572 -0.1958 0.1148  0.0903  65  SER A OG  
451  N N   . CYS A 68  ? 2.0800 2.3408 1.8144 -0.1328 0.1197  0.0140  66  CYS A N   
452  C CA  . CYS A 68  ? 2.0678 2.3790 1.8166 -0.0790 0.1170  -0.0125 66  CYS A CA  
453  C C   . CYS A 68  ? 2.0710 2.2710 1.6788 -0.0472 0.1019  -0.0067 66  CYS A C   
454  O O   . CYS A 68  ? 2.0414 2.1533 1.5752 -0.0725 0.0728  0.0090  66  CYS A O   
455  C CB  . CYS A 68  ? 2.1212 2.5083 1.9628 -0.0777 0.0789  -0.0340 66  CYS A CB  
456  S SG  . CYS A 68  ? 2.8151 3.3131 2.7269 -0.0158 0.0760  -0.0672 66  CYS A SG  
457  N N   . THR A 69  ? 2.2411 2.4475 1.8188 0.0085  0.1218  -0.0217 67  THR A N   
458  C CA  . THR A 69  ? 2.2866 2.3743 1.7227 0.0425  0.1152  -0.0195 67  THR A CA  
459  C C   . THR A 69  ? 2.2845 2.3642 1.7048 0.0911  0.0822  -0.0333 67  THR A C   
460  O O   . THR A 69  ? 2.5267 2.4975 1.8278 0.1214  0.0761  -0.0322 67  THR A O   
461  C CB  . THR A 69  ? 2.4616 2.5250 1.8405 0.0765  0.1691  -0.0253 67  THR A CB  
462  N N   . THR A 70  ? 2.1382 2.3229 1.6682 0.0979  0.0598  -0.0462 68  THR A N   
463  C CA  . THR A 70  ? 2.1307 2.3091 1.6391 0.1469  0.0252  -0.0563 68  THR A CA  
464  C C   . THR A 70  ? 2.1180 2.1824 1.5236 0.1202  -0.0097 -0.0415 68  THR A C   
465  O O   . THR A 70  ? 2.1328 2.1829 1.5477 0.0603  -0.0176 -0.0309 68  THR A O   
466  C CB  . THR A 70  ? 2.1627 2.4846 1.8083 0.1551  0.0040  -0.0757 68  THR A CB  
467  O OG1 . THR A 70  ? 2.0764 2.4260 1.7755 0.0905  -0.0116 -0.0728 68  THR A OG1 
468  C CG2 . THR A 70  ? 2.2138 2.6633 1.9786 0.1760  0.0401  -0.0933 68  THR A CG2 
469  N N   . PRO A 71  ? 2.1393 2.1203 1.4483 0.1653  -0.0287 -0.0404 69  PRO A N   
470  C CA  . PRO A 71  ? 2.1641 2.0264 1.3643 0.1386  -0.0543 -0.0260 69  PRO A CA  
471  C C   . PRO A 71  ? 2.1884 2.1030 1.4472 0.0891  -0.0779 -0.0256 69  PRO A C   
472  O O   . PRO A 71  ? 2.1880 2.0393 1.4028 0.0375  -0.0841 -0.0145 69  PRO A O   
473  C CB  . PRO A 71  ? 2.2808 2.0747 1.3960 0.2075  -0.0703 -0.0268 69  PRO A CB  
474  C CG  . PRO A 71  ? 2.3805 2.2146 1.5261 0.2709  -0.0440 -0.0402 69  PRO A CG  
475  C CD  . PRO A 71  ? 2.2492 2.2414 1.5485 0.2473  -0.0246 -0.0524 69  PRO A CD  
476  N N   . GLN A 72  ? 2.2603 2.2928 1.6209 0.1046  -0.0904 -0.0413 70  GLN A N   
477  C CA  . GLN A 72  ? 2.2129 2.2966 1.6275 0.0622  -0.1093 -0.0479 70  GLN A CA  
478  C C   . GLN A 72  ? 2.1110 2.2303 1.6014 -0.0007 -0.0943 -0.0465 70  GLN A C   
479  O O   . GLN A 72  ? 2.2291 2.3326 1.7209 -0.0439 -0.1026 -0.0451 70  GLN A O   
480  C CB  . GLN A 72  ? 2.3732 2.5756 1.8772 0.0936  -0.1294 -0.0702 70  GLN A CB  
481  C CG  . GLN A 72  ? 2.6250 2.8490 2.1211 0.1700  -0.1365 -0.0755 70  GLN A CG  
482  C CD  . GLN A 72  ? 2.6646 3.0464 2.3110 0.1857  -0.1342 -0.0999 70  GLN A CD  
483  O OE1 . GLN A 72  ? 2.5846 3.0398 2.3306 0.1357  -0.1165 -0.1088 70  GLN A OE1 
484  N NE2 . GLN A 72  ? 2.7593 3.1935 2.4265 0.2552  -0.1533 -0.1108 70  GLN A NE2 
485  N N   . CYS A 73  ? 1.9269 2.0909 1.4779 -0.0038 -0.0702 -0.0460 71  CYS A N   
486  C CA  . CYS A 73  ? 1.8429 2.0167 1.4455 -0.0574 -0.0579 -0.0373 71  CYS A CA  
487  C C   . CYS A 73  ? 1.8328 1.8969 1.3409 -0.0842 -0.0583 -0.0155 71  CYS A C   
488  O O   . CYS A 73  ? 1.7883 1.8427 1.3198 -0.1283 -0.0682 -0.0085 71  CYS A O   
489  C CB  . CYS A 73  ? 1.9001 2.1430 1.5800 -0.0556 -0.0284 -0.0394 71  CYS A CB  
490  S SG  . CYS A 73  ? 2.0822 2.4745 1.9133 -0.0528 -0.0304 -0.0685 71  CYS A SG  
491  N N   . LYS A 74  ? 1.8076 1.7910 1.2128 -0.0559 -0.0495 -0.0079 72  LYS A N   
492  C CA  . LYS A 74  ? 1.8249 1.6983 1.1295 -0.0827 -0.0542 0.0084  72  LYS A CA  
493  C C   . LYS A 74  ? 1.7762 1.5977 1.0426 -0.1156 -0.0789 0.0121  72  LYS A C   
494  O O   . LYS A 74  ? 1.7426 1.5344 1.0040 -0.1607 -0.0903 0.0221  72  LYS A O   
495  C CB  . LYS A 74  ? 1.9176 1.7043 1.1092 -0.0414 -0.0387 0.0087  72  LYS A CB  
496  N N   . TYR A 75  ? 1.8803 1.6914 1.1184 -0.0934 -0.0872 0.0046  73  TYR A N   
497  C CA  . TYR A 75  ? 1.8914 1.6597 1.0954 -0.1292 -0.1009 0.0075  73  TYR A CA  
498  C C   . TYR A 75  ? 1.8410 1.6913 1.1560 -0.1739 -0.1050 0.0020  73  TYR A C   
499  O O   . TYR A 75  ? 1.9857 1.8124 1.3029 -0.2189 -0.1114 0.0077  73  TYR A O   
500  C CB  . TYR A 75  ? 1.8381 1.5845 0.9894 -0.0974 -0.1072 0.0029  73  TYR A CB  
501  C CG  . TYR A 75  ? 1.8291 1.5288 0.9392 -0.1423 -0.1109 0.0070  73  TYR A CG  
502  C CD1 . TYR A 75  ? 1.9785 1.5668 0.9935 -0.1740 -0.1101 0.0195  73  TYR A CD1 
503  C CD2 . TYR A 75  ? 1.7871 1.5546 0.9542 -0.1584 -0.1116 -0.0046 73  TYR A CD2 
504  C CE1 . TYR A 75  ? 1.9660 1.5188 0.9522 -0.2223 -0.1065 0.0226  73  TYR A CE1 
505  C CE2 . TYR A 75  ? 1.8949 1.6237 1.0248 -0.2024 -0.1048 -0.0023 73  TYR A CE2 
506  C CZ  . TYR A 75  ? 1.8150 1.4407 0.8597 -0.2356 -0.1006 0.0124  73  TYR A CZ  
507  O OH  . TYR A 75  ? 1.8503 1.4451 0.8668 -0.2859 -0.0874 0.0140  73  TYR A OH  
508  N N   . LEU A 76  ? 1.6128 1.5618 1.0254 -0.1597 -0.1018 -0.0118 74  LEU A N   
509  C CA  . LEU A 76  ? 1.5538 1.5769 1.0729 -0.1930 -0.1033 -0.0227 74  LEU A CA  
510  C C   . LEU A 76  ? 1.5346 1.5627 1.1061 -0.2238 -0.1048 -0.0102 74  LEU A C   
511  O O   . LEU A 76  ? 1.5260 1.5656 1.1442 -0.2577 -0.1117 -0.0109 74  LEU A O   
512  C CB  . LEU A 76  ? 1.5339 1.6501 1.1367 -0.1716 -0.1014 -0.0433 74  LEU A CB  
513  C CG  . LEU A 76  ? 1.4607 1.6460 1.1729 -0.2018 -0.1006 -0.0604 74  LEU A CG  
514  C CD1 . LEU A 76  ? 1.4573 1.6282 1.1521 -0.2251 -0.1016 -0.0708 74  LEU A CD1 
515  C CD2 . LEU A 76  ? 1.5013 1.7704 1.2877 -0.1845 -0.1011 -0.0836 74  LEU A CD2 
516  N N   . LEU A 77  ? 1.6101 1.6304 1.1730 -0.2100 -0.0977 0.0014  75  LEU A N   
517  C CA  . LEU A 77  ? 1.6244 1.6326 1.2115 -0.2362 -0.1031 0.0190  75  LEU A CA  
518  C C   . LEU A 77  ? 1.6244 1.5629 1.1491 -0.2645 -0.1236 0.0316  75  LEU A C   
519  O O   . LEU A 77  ? 1.6012 1.5530 1.1792 -0.2930 -0.1412 0.0393  75  LEU A O   
520  C CB  . LEU A 77  ? 1.6207 1.6157 1.1770 -0.2175 -0.0850 0.0308  75  LEU A CB  
521  N N   . ALA A 78  ? 1.6798 1.5442 1.0966 -0.2567 -0.1240 0.0323  76  ALA A N   
522  C CA  . ALA A 78  ? 1.7186 1.5163 1.0766 -0.2917 -0.1440 0.0396  76  ALA A CA  
523  C C   . ALA A 78  ? 1.7534 1.5927 1.1806 -0.3254 -0.1514 0.0304  76  ALA A C   
524  O O   . ALA A 78  ? 1.7581 1.6007 1.2179 -0.3617 -0.1720 0.0354  76  ALA A O   
525  C CB  . ALA A 78  ? 1.7418 1.4382 0.9644 -0.2770 -0.1386 0.0394  76  ALA A CB  
526  N N   . LYS A 79  ? 1.7969 1.6716 1.2468 -0.3126 -0.1345 0.0154  77  LYS A N   
527  C CA  . LYS A 79  ? 1.7430 1.6595 1.2525 -0.3425 -0.1298 0.0026  77  LYS A CA  
528  C C   . LYS A 79  ? 1.6928 1.6948 1.3391 -0.3577 -0.1357 -0.0043 77  LYS A C   
529  O O   . LYS A 79  ? 1.8628 1.8901 1.5638 -0.3903 -0.1397 -0.0094 77  LYS A O   
530  C CB  . LYS A 79  ? 1.7319 1.6606 1.2168 -0.3211 -0.1110 -0.0122 77  LYS A CB  
531  C CG  . LYS A 79  ? 1.7614 1.7023 1.2578 -0.3547 -0.0961 -0.0243 77  LYS A CG  
532  C CD  . LYS A 79  ? 2.0576 1.9275 1.4315 -0.3441 -0.0842 -0.0220 77  LYS A CD  
533  C CE  . LYS A 79  ? 2.3077 2.1111 1.6195 -0.3926 -0.0734 -0.0143 77  LYS A CE  
534  N NZ  . LYS A 79  ? 2.2027 2.0806 1.6167 -0.4375 -0.0563 -0.0298 77  LYS A NZ  
535  N N   . CYS A 80  ? 1.5018 1.5470 1.2074 -0.3341 -0.1349 -0.0051 78  CYS A N   
536  C CA  . CYS A 80  ? 1.4285 1.5337 1.2545 -0.3432 -0.1424 -0.0085 78  CYS A CA  
537  C C   . CYS A 80  ? 1.4617 1.5461 1.3005 -0.3637 -0.1719 0.0124  78  CYS A C   
538  O O   . CYS A 80  ? 1.4249 1.5527 1.3578 -0.3781 -0.1845 0.0083  78  CYS A O   
539  C CB  . CYS A 80  ? 1.4122 1.5452 1.2798 -0.3198 -0.1352 -0.0085 78  CYS A CB  
540  S SG  . CYS A 80  ? 1.3830 1.5633 1.2645 -0.2977 -0.1124 -0.0385 78  CYS A SG  
541  N N   . CYS A 81  ? 1.6288 1.6460 1.3691 -0.3620 -0.1845 0.0325  79  CYS A N   
542  C CA  . CYS A 81  ? 1.6434 1.6257 1.3622 -0.3820 -0.2199 0.0527  79  CYS A CA  
543  C C   . CYS A 81  ? 1.6195 1.6112 1.3591 -0.4179 -0.2359 0.0442  79  CYS A C   
544  O O   . CYS A 81  ? 1.6374 1.6652 1.4542 -0.4352 -0.2668 0.0490  79  CYS A O   
545  C CB  . CYS A 81  ? 1.7288 1.6274 1.3157 -0.3723 -0.2221 0.0688  79  CYS A CB  
546  S SG  . CYS A 81  ? 2.6920 2.5988 2.2823 -0.3392 -0.1996 0.0806  79  CYS A SG  
547  N N   . VAL A 82  ? 1.5269 1.4847 1.1976 -0.4291 -0.2151 0.0325  80  VAL A N   
548  C CA  . VAL A 82  ? 1.5267 1.4876 1.2082 -0.4721 -0.2199 0.0235  80  VAL A CA  
549  C C   . VAL A 82  ? 1.4948 1.5587 1.3254 -0.4825 -0.2108 0.0064  80  VAL A C   
550  O O   . VAL A 82  ? 1.5773 1.6842 1.4834 -0.5138 -0.2312 0.0031  80  VAL A O   
551  C CB  . VAL A 82  ? 1.6545 1.5484 1.2267 -0.4795 -0.1904 0.0165  80  VAL A CB  
552  C CG1 . VAL A 82  ? 1.6618 1.5628 1.2535 -0.5330 -0.1848 0.0067  80  VAL A CG1 
553  C CG2 . VAL A 82  ? 1.8106 1.5953 1.2377 -0.4650 -0.1988 0.0295  80  VAL A CG2 
554  N N   . ASP A 83  ? 1.5372 1.6434 1.4128 -0.4559 -0.1805 -0.0079 81  ASP A N   
555  C CA  . ASP A 83  ? 1.5406 1.7372 1.5519 -0.4583 -0.1656 -0.0297 81  ASP A CA  
556  C C   . ASP A 83  ? 1.4978 1.7431 1.6242 -0.4528 -0.2019 -0.0212 81  ASP A C   
557  O O   . ASP A 83  ? 1.5840 1.9003 1.8262 -0.4658 -0.2033 -0.0358 81  ASP A O   
558  C CB  . ASP A 83  ? 1.6334 1.8520 1.6572 -0.4276 -0.1350 -0.0474 81  ASP A CB  
559  C CG  . ASP A 83  ? 1.8081 1.9968 1.7400 -0.4319 -0.1019 -0.0600 81  ASP A CG  
560  O OD1 . ASP A 83  ? 1.8970 2.0944 1.8275 -0.4636 -0.0808 -0.0710 81  ASP A OD1 
561  O OD2 . ASP A 83  ? 1.8252 1.9823 1.6861 -0.4039 -0.0973 -0.0579 81  ASP A OD2 
562  N N   . LEU A 84  ? 1.3818 1.5870 1.4733 -0.4311 -0.2296 0.0032  82  LEU A N   
563  C CA  . LEU A 84  ? 1.3452 1.5701 1.5140 -0.4202 -0.2709 0.0209  82  LEU A CA  
564  C C   . LEU A 84  ? 1.4688 1.6669 1.6027 -0.4429 -0.3222 0.0421  82  LEU A C   
565  O O   . LEU A 84  ? 1.3699 1.5632 1.5316 -0.4308 -0.3659 0.0645  82  LEU A O   
566  C CB  . LEU A 84  ? 1.3141 1.5039 1.4579 -0.3892 -0.2690 0.0378  82  LEU A CB  
567  C CG  . LEU A 84  ? 1.2627 1.4872 1.4555 -0.3718 -0.2260 0.0116  82  LEU A CG  
568  C CD1 . LEU A 84  ? 1.2991 1.4865 1.4438 -0.3525 -0.2140 0.0240  82  LEU A CD1 
569  C CD2 . LEU A 84  ? 1.5131 1.8012 1.8502 -0.3627 -0.2263 -0.0069 82  LEU A CD2 
570  N N   . SER A 85  ? 1.6447 1.8182 1.7113 -0.4774 -0.3194 0.0351  83  SER A N   
571  C CA  . SER A 85  ? 1.7186 1.8537 1.7288 -0.5070 -0.3678 0.0494  83  SER A CA  
572  C C   . SER A 85  ? 1.7989 1.8499 1.6952 -0.4911 -0.4008 0.0786  83  SER A C   
573  O O   . SER A 85  ? 2.1446 2.1880 2.0401 -0.5012 -0.4572 0.0948  83  SER A O   
574  C CB  . SER A 85  ? 1.7447 1.9698 1.9004 -0.5225 -0.4097 0.0448  83  SER A CB  
575  O OG  . SER A 85  ? 1.7636 2.0459 1.9812 -0.5627 -0.3873 0.0186  83  SER A OG  
576  N N   . LYS A 86  ? 1.6538 1.6459 1.4546 -0.4659 -0.3658 0.0844  84  LYS A N   
577  C CA  . LYS A 86  ? 1.8517 1.7576 1.5253 -0.4553 -0.3827 0.1080  84  LYS A CA  
578  C C   . LYS A 86  ? 1.9898 1.8096 1.5182 -0.4720 -0.3708 0.1000  84  LYS A C   
579  O O   . LYS A 86  ? 1.9872 1.7497 1.4190 -0.4481 -0.3376 0.1017  84  LYS A O   
580  C CB  . LYS A 86  ? 1.7107 1.6102 1.3785 -0.4179 -0.3490 0.1187  84  LYS A CB  
581  N N   . LEU A 87  ? 1.9801 1.7924 1.5013 -0.5133 -0.3971 0.0894  85  LEU A N   
582  C CA  . LEU A 87  ? 2.0146 1.7408 1.4117 -0.5357 -0.3817 0.0768  85  LEU A CA  
583  C C   . LEU A 87  ? 2.2644 1.8724 1.4917 -0.5265 -0.3896 0.0854  85  LEU A C   
584  O O   . LEU A 87  ? 2.4498 1.9797 1.5696 -0.5138 -0.3551 0.0766  85  LEU A O   
585  C CB  . LEU A 87  ? 1.9347 1.6819 1.3734 -0.5931 -0.4111 0.0633  85  LEU A CB  
586  N N   . ALA A 88  ? 2.2761 1.8674 1.4749 -0.5292 -0.4345 0.1022  86  ALA A N   
587  C CA  . ALA A 88  ? 2.4966 1.9747 1.5261 -0.5219 -0.4408 0.1089  86  ALA A CA  
588  C C   . ALA A 88  ? 2.5390 1.9919 1.5167 -0.4716 -0.3829 0.1144  86  ALA A C   
589  O O   . ALA A 88  ? 2.5928 1.9542 1.4365 -0.4567 -0.3557 0.1060  86  ALA A O   
590  C CB  . ALA A 88  ? 2.6799 2.1510 1.6903 -0.5346 -0.5036 0.1294  86  ALA A CB  
591  N N   . GLU A 89  ? 2.4409 1.9791 1.5339 -0.4461 -0.3639 0.1256  87  GLU A N   
592  C CA  . GLU A 89  ? 2.3367 1.8826 1.4224 -0.4041 -0.3097 0.1286  87  GLU A CA  
593  C C   . GLU A 89  ? 2.1079 1.6531 1.1872 -0.3864 -0.2675 0.1056  87  GLU A C   
594  O O   . GLU A 89  ? 2.1492 1.6425 1.1398 -0.3566 -0.2319 0.0992  87  GLU A O   
595  C CB  . GLU A 89  ? 2.3426 1.9774 1.5632 -0.3915 -0.3065 0.1430  87  GLU A CB  
596  C CG  . GLU A 89  ? 2.4070 2.0657 1.6436 -0.3575 -0.2526 0.1442  87  GLU A CG  
597  C CD  . GLU A 89  ? 2.3889 2.1105 1.7041 -0.3409 -0.2190 0.1201  87  GLU A CD  
598  O OE1 . GLU A 89  ? 2.2382 1.9711 1.5762 -0.3555 -0.2310 0.1047  87  GLU A OE1 
599  O OE2 . GLU A 89  ? 2.5223 2.2826 1.8745 -0.3161 -0.1814 0.1166  87  GLU A OE2 
600  N N   . GLY A 90  ? 1.8239 1.4278 0.9978 -0.4018 -0.2708 0.0937  88  GLY A N   
601  C CA  . GLY A 90  ? 1.8390 1.4371 1.0014 -0.3890 -0.2382 0.0760  88  GLY A CA  
602  C C   . GLY A 90  ? 2.0349 1.5166 1.0447 -0.3812 -0.2274 0.0687  88  GLY A C   
603  O O   . GLY A 90  ? 2.1591 1.6190 1.1291 -0.3429 -0.1939 0.0608  88  GLY A O   
604  N N   . GLU A 91  ? 2.1390 1.5438 1.0641 -0.4160 -0.2592 0.0692  89  GLU A N   
605  C CA  . GLU A 91  ? 2.4259 1.7005 1.1921 -0.4100 -0.2504 0.0592  89  GLU A CA  
606  C C   . GLU A 91  ? 2.4628 1.7053 1.1584 -0.3558 -0.2158 0.0604  89  GLU A C   
607  O O   . GLU A 91  ? 2.3173 1.5117 0.9525 -0.3152 -0.1818 0.0496  89  GLU A O   
608  C CB  . GLU A 91  ? 2.6662 1.8677 1.3543 -0.4614 -0.2967 0.0568  89  GLU A CB  
609  C CG  . GLU A 91  ? 2.9624 2.0125 1.4703 -0.4556 -0.2882 0.0424  89  GLU A CG  
610  C CD  . GLU A 91  ? 3.2442 2.2221 1.6690 -0.5107 -0.3401 0.0362  89  GLU A CD  
611  O OE1 . GLU A 91  ? 3.4673 2.3091 1.7369 -0.5143 -0.3373 0.0195  89  GLU A OE1 
612  O OE2 . GLU A 91  ? 3.2165 2.2725 1.7313 -0.5484 -0.3866 0.0462  89  GLU A OE2 
613  N N   . GLN A 92  ? 2.5145 1.7831 1.2180 -0.3547 -0.2238 0.0743  90  GLN A N   
614  C CA  . GLN A 92  ? 2.4292 1.6722 1.0661 -0.3125 -0.1847 0.0759  90  GLN A CA  
615  C C   . GLN A 92  ? 2.3866 1.6966 1.0915 -0.2603 -0.1348 0.0696  90  GLN A C   
616  O O   . GLN A 92  ? 2.6035 1.8763 1.2391 -0.2190 -0.0954 0.0602  90  GLN A O   
617  C CB  . GLN A 92  ? 2.2410 1.5123 0.8920 -0.3268 -0.1998 0.0986  90  GLN A CB  
618  C CG  . GLN A 92  ? 2.3306 1.5226 0.8811 -0.3682 -0.2515 0.1047  90  GLN A CG  
619  C CD  . GLN A 92  ? 2.5072 1.7495 1.1162 -0.3881 -0.2883 0.1334  90  GLN A CD  
620  O OE1 . GLN A 92  ? 2.3136 1.6445 1.0423 -0.3738 -0.2720 0.1480  90  GLN A OE1 
621  N NE2 . GLN A 92  ? 3.0719 2.2508 1.5912 -0.4205 -0.3418 0.1416  90  GLN A NE2 
622  N N   . ILE A 93  ? 2.0402 1.4531 0.8823 -0.2606 -0.1364 0.0717  91  ILE A N   
623  C CA  . ILE A 93  ? 1.9167 1.3963 0.8219 -0.2135 -0.0982 0.0624  91  ILE A CA  
624  C C   . ILE A 93  ? 1.9948 1.4013 0.8160 -0.1816 -0.0868 0.0464  91  ILE A C   
625  O O   . ILE A 93  ? 2.0850 1.4787 0.8699 -0.1307 -0.0538 0.0363  91  ILE A O   
626  C CB  . ILE A 93  ? 1.8747 1.4690 0.9293 -0.2212 -0.1044 0.0627  91  ILE A CB  
627  C CG1 . ILE A 93  ? 1.8123 1.4628 0.9503 -0.2522 -0.1205 0.0794  91  ILE A CG1 
628  C CG2 . ILE A 93  ? 2.0256 1.6922 1.1406 -0.1745 -0.0708 0.0510  91  ILE A CG2 
629  C CD1 . ILE A 93  ? 1.8417 1.6003 1.1243 -0.2520 -0.1165 0.0743  91  ILE A CD1 
630  N N   . LEU A 94  ? 2.0973 1.4542 0.8896 -0.2113 -0.1127 0.0443  92  LEU A N   
631  C CA  . LEU A 94  ? 2.3972 1.6690 1.1032 -0.1840 -0.1041 0.0340  92  LEU A CA  
632  C C   . LEU A 94  ? 2.7615 1.8922 1.3119 -0.1736 -0.0980 0.0255  92  LEU A C   
633  O O   . LEU A 94  ? 3.0216 2.1062 1.5118 -0.1154 -0.0702 0.0150  92  LEU A O   
634  C CB  . LEU A 94  ? 2.4168 1.6709 1.1330 -0.2275 -0.1265 0.0361  92  LEU A CB  
635  C CG  . LEU A 94  ? 2.2207 1.5935 1.0699 -0.2408 -0.1298 0.0387  92  LEU A CG  
636  C CD1 . LEU A 94  ? 2.2358 1.5743 1.0736 -0.2938 -0.1443 0.0396  92  LEU A CD1 
637  C CD2 . LEU A 94  ? 2.1716 1.5929 1.0513 -0.1826 -0.1100 0.0332  92  LEU A CD2 
638  N N   . SER A 95  ? 2.1466 2.0036 1.4593 -0.0816 0.2602  -0.1006 93  SER A N   
639  C CA  . SER A 95  ? 2.1494 1.9910 1.4135 -0.0388 0.2707  -0.1107 93  SER A CA  
640  C C   . SER A 95  ? 2.1817 2.0302 1.4023 -0.0334 0.3266  -0.0989 93  SER A C   
641  O O   . SER A 95  ? 2.1320 2.0129 1.3538 -0.0009 0.3512  -0.1073 93  SER A O   
642  C CB  . SER A 95  ? 2.3188 2.0672 1.5018 -0.0177 0.2308  -0.1197 93  SER A CB  
643  O OG  . SER A 95  ? 2.5383 2.2589 1.6636 0.0203  0.2365  -0.1343 93  SER A OG  
644  N N   . GLY A 96  ? 2.3635 2.1770 1.5418 -0.0623 0.3505  -0.0782 94  GLY A N   
645  C CA  . GLY A 96  ? 2.7104 2.5148 1.8284 -0.0537 0.4054  -0.0644 94  GLY A CA  
646  C C   . GLY A 96  ? 2.8705 2.5775 1.8720 -0.0158 0.3803  -0.0755 94  GLY A C   
647  O O   . GLY A 96  ? 2.9513 2.6370 1.8835 0.0171  0.4073  -0.0808 94  GLY A O   
648  N N   . GLY A 97  ? 2.8211 2.4731 1.8049 -0.0194 0.3255  -0.0813 95  GLY A N   
649  C CA  . GLY A 97  ? 2.6895 2.2811 1.6090 0.0147  0.2821  -0.1016 95  GLY A CA  
650  C C   . GLY A 97  ? 2.7746 2.2873 1.5627 0.0386  0.2906  -0.0997 95  GLY A C   
651  O O   . GLY A 97  ? 2.8812 2.3756 1.6165 0.0714  0.2965  -0.1188 95  GLY A O   
652  N N   . VAL A 98  ? 2.8633 2.3227 1.5913 0.0234  0.2922  -0.0759 96  VAL A N   
653  C CA  . VAL A 98  ? 3.0110 2.3833 1.6085 0.0468  0.2751  -0.0736 96  VAL A CA  
654  C C   . VAL A 98  ? 2.9400 2.2809 1.4443 0.0515  0.3350  -0.0515 96  VAL A C   
655  O O   . VAL A 98  ? 3.0942 2.3721 1.4782 0.0805  0.3334  -0.0558 96  VAL A O   
656  C CB  . VAL A 98  ? 3.0808 2.4058 1.6640 0.0366  0.2263  -0.0600 96  VAL A CB  
657  N N   . PHE A 99  ? 2.7852 2.1703 1.3423 0.0215  0.3895  -0.0276 97  PHE A N   
658  C CA  . PHE A 99  ? 2.9996 2.3589 1.4747 0.0225  0.4535  -0.0022 97  PHE A CA  
659  C C   . PHE A 99  ? 3.1309 2.5315 1.5953 0.0519  0.4982  -0.0182 97  PHE A C   
660  O O   . PHE A 99  ? 2.9817 2.3234 1.3294 0.0905  0.4984  -0.0307 97  PHE A O   
661  C CB  . PHE A 99  ? 2.9024 2.2947 1.4434 -0.0265 0.4982  0.0300  97  PHE A CB  
662  N N   . ASN A 100 ? 3.1779 2.6795 1.7621 0.0346  0.5356  -0.0177 98  ASN A N   
663  C CA  . ASN A 100 ? 2.9437 2.5079 1.5592 0.0663  0.5699  -0.0365 98  ASN A CA  
664  C C   . ASN A 100 ? 2.6182 2.1835 1.2623 0.0949  0.5133  -0.0746 98  ASN A C   
665  O O   . ASN A 100 ? 2.5333 2.0700 1.1957 0.0831  0.4497  -0.0844 98  ASN A O   
666  C CB  . ASN A 100 ? 2.8937 2.5790 1.6453 0.0366  0.6195  -0.0207 98  ASN A CB  
667  N N   . LYS A 101 ? 2.4796 2.0786 1.1321 0.1328  0.5401  -0.0940 99  LYS A N   
668  C CA  . LYS A 101 ? 2.4270 2.0249 1.1113 0.1592  0.4942  -0.1281 99  LYS A CA  
669  C C   . LYS A 101 ? 2.5190 2.1866 1.3410 0.1279  0.4559  -0.1268 99  LYS A C   
670  O O   . LYS A 101 ? 2.6476 2.4080 1.5746 0.1014  0.4836  -0.1087 99  LYS A O   
671  C CB  . LYS A 101 ? 2.4642 2.0941 1.1483 0.2061  0.5400  -0.1441 99  LYS A CB  
672  N N   . GLN A 102 ? 2.6011 2.2216 1.4168 0.1312  0.3913  -0.1474 100 GLN A N   
673  C CA  . GLN A 102 ? 2.3927 2.0600 1.3172 0.1139  0.3487  -0.1532 100 GLN A CA  
674  C C   . GLN A 102 ? 2.2931 2.0467 1.3149 0.1323  0.3684  -0.1604 100 GLN A C   
675  O O   . GLN A 102 ? 2.4201 2.1560 1.4133 0.1737  0.3778  -0.1798 100 GLN A O   
676  C CB  . GLN A 102 ? 2.3398 1.9331 1.2234 0.1214  0.2830  -0.1747 100 GLN A CB  
677  N N   . LYS A 103 ? 2.1688 2.0123 1.3012 0.1024  0.3737  -0.1447 101 LYS A N   
678  C CA  . LYS A 103 ? 2.1148 2.0598 1.3480 0.1175  0.3954  -0.1445 101 LYS A CA  
679  C C   . LYS A 103 ? 2.0973 2.0204 1.3539 0.1368  0.3458  -0.1641 101 LYS A C   
680  O O   . LYS A 103 ? 2.1770 2.0543 1.4267 0.1160  0.2974  -0.1685 101 LYS A O   
681  C CB  . LYS A 103 ? 2.0044 2.0503 1.3431 0.0732  0.4083  -0.1233 101 LYS A CB  
682  N N   . SER A 104 ? 2.0658 2.0221 1.3514 0.1787  0.3617  -0.1736 102 SER A N   
683  C CA  . SER A 104 ? 2.0345 1.9728 1.3471 0.1995  0.3229  -0.1883 102 SER A CA  
684  C C   . SER A 104 ? 1.9467 1.9673 1.3688 0.1781  0.2979  -0.1771 102 SER A C   
685  O O   . SER A 104 ? 1.9414 2.0557 1.4366 0.1541  0.3153  -0.1603 102 SER A O   
686  C CB  . SER A 104 ? 2.2247 2.1577 1.5200 0.2577  0.3528  -0.2007 102 SER A CB  
687  O OG  . SER A 104 ? 2.2570 2.2002 1.6050 0.2781  0.3260  -0.2061 102 SER A OG  
688  N N   . HIS A 105 ? 1.8065 1.7859 1.2338 0.1845  0.2553  -0.1872 103 HIS A N   
689  C CA  . HIS A 105 ? 1.7506 1.7934 1.2655 0.1763  0.2303  -0.1791 103 HIS A CA  
690  C C   . HIS A 105 ? 1.7827 1.9329 1.3751 0.2033  0.2593  -0.1685 103 HIS A C   
691  O O   . HIS A 105 ? 1.7791 2.0164 1.4514 0.1825  0.2485  -0.1563 103 HIS A O   
692  C CB  . HIS A 105 ? 1.7179 1.6908 1.2149 0.1914  0.1921  -0.1906 103 HIS A CB  
693  N N   . ASP A 106 ? 1.8893 2.0362 1.4586 0.2512  0.2948  -0.1736 104 ASP A N   
694  C CA  . ASP A 106 ? 1.9030 2.1646 1.5544 0.2819  0.3239  -0.1603 104 ASP A CA  
695  C C   . ASP A 106 ? 1.8757 2.2391 1.5817 0.2463  0.3537  -0.1441 104 ASP A C   
696  O O   . ASP A 106 ? 1.8353 2.3194 1.6396 0.2391  0.3551  -0.1296 104 ASP A O   
697  C CB  . ASP A 106 ? 2.1608 2.3907 1.7706 0.3474  0.3615  -0.1689 104 ASP A CB  
698  C CG  . ASP A 106 ? 2.2251 2.3516 1.7856 0.3808  0.3346  -0.1846 104 ASP A CG  
699  O OD1 . ASP A 106 ? 2.0086 2.1453 1.6130 0.3726  0.2968  -0.1788 104 ASP A OD1 
700  O OD2 . ASP A 106 ? 2.5214 2.5524 1.9952 0.4144  0.3527  -0.2030 104 ASP A OD2 
701  N N   . ASP A 107 ? 1.9989 2.3137 1.6402 0.2228  0.3766  -0.1455 105 ASP A N   
702  C CA  . ASP A 107 ? 1.9929 2.3848 1.6779 0.1776  0.4034  -0.1284 105 ASP A CA  
703  C C   . ASP A 107 ? 1.9820 2.4065 1.7225 0.1192  0.3628  -0.1224 105 ASP A C   
704  O O   . ASP A 107 ? 2.0161 2.5517 1.8471 0.0908  0.3696  -0.1096 105 ASP A O   
705  C CB  . ASP A 107 ? 1.9719 2.2816 1.5579 0.1643  0.4323  -0.1291 105 ASP A CB  
706  C CG  . ASP A 107 ? 2.1073 2.3984 1.6374 0.2184  0.4837  -0.1337 105 ASP A CG  
707  O OD1 . ASP A 107 ? 2.1768 2.5717 1.7773 0.2461  0.5242  -0.1229 105 ASP A OD1 
708  O OD2 . ASP A 107 ? 2.2282 2.4020 1.6422 0.2348  0.4828  -0.1487 105 ASP A OD2 
709  N N   . ILE A 108 ? 1.8859 2.2119 1.5698 0.1015  0.3208  -0.1327 106 ILE A N   
710  C CA  . ILE A 108 ? 1.7065 2.0387 1.4231 0.0527  0.2823  -0.1302 106 ILE A CA  
711  C C   . ILE A 108 ? 1.6841 2.1159 1.4964 0.0521  0.2598  -0.1268 106 ILE A C   
712  O O   . ILE A 108 ? 1.6772 2.1720 1.5450 0.0074  0.2510  -0.1207 106 ILE A O   
713  C CB  . ILE A 108 ? 1.6529 1.8696 1.2994 0.0501  0.2416  -0.1416 106 ILE A CB  
714  C CG1 . ILE A 108 ? 1.7005 1.8314 1.2611 0.0314  0.2527  -0.1406 106 ILE A CG1 
715  C CG2 . ILE A 108 ? 1.6150 1.8452 1.3032 0.0189  0.2012  -0.1411 106 ILE A CG2 
716  C CD1 . ILE A 108 ? 1.7636 1.7888 1.2538 0.0397  0.2158  -0.1518 106 ILE A CD1 
717  N N   . VAL A 109 ? 1.7253 2.1655 1.5506 0.1020  0.2498  -0.1308 107 VAL A N   
718  C CA  . VAL A 109 ? 1.6754 2.2096 1.5830 0.1126  0.2284  -0.1248 107 VAL A CA  
719  C C   . VAL A 109 ? 1.6678 2.3421 1.6643 0.1051  0.2560  -0.1118 107 VAL A C   
720  O O   . VAL A 109 ? 1.6836 2.4459 1.7510 0.0754  0.2338  -0.1068 107 VAL A O   
721  C CB  . VAL A 109 ? 1.7579 2.2629 1.6532 0.1744  0.2195  -0.1278 107 VAL A CB  
722  C CG1 . VAL A 109 ? 1.7908 2.4046 1.7702 0.1947  0.2032  -0.1164 107 VAL A CG1 
723  C CG2 . VAL A 109 ? 1.8429 2.2277 1.6714 0.1711  0.1859  -0.1385 107 VAL A CG2 
724  N N   . THR A 110 ? 1.8270 2.5234 1.8188 0.1308  0.3047  -0.1069 108 THR A N   
725  C CA  . THR A 110 ? 1.9451 2.7838 2.0290 0.1249  0.3386  -0.0918 108 THR A CA  
726  C C   . THR A 110 ? 1.9891 2.8692 2.1087 0.0465  0.3364  -0.0865 108 THR A C   
727  O O   . THR A 110 ? 1.9505 2.9571 2.1681 0.0186  0.3292  -0.0780 108 THR A O   
728  C CB  . THR A 110 ? 2.0250 2.8662 2.0838 0.1670  0.3998  -0.0869 108 THR A CB  
729  O OG1 . THR A 110 ? 2.1122 2.9112 2.1378 0.2412  0.4027  -0.0936 108 THR A OG1 
730  C CG2 . THR A 110 ? 2.0083 3.0121 2.1767 0.1586  0.4379  -0.0678 108 THR A CG2 
731  N N   . GLU A 111 ? 2.0529 2.8230 2.0906 0.0111  0.3408  -0.0916 109 GLU A N   
732  C CA  . GLU A 111 ? 2.0560 2.8373 2.1096 -0.0621 0.3447  -0.0860 109 GLU A CA  
733  C C   . GLU A 111 ? 1.9060 2.7096 2.0002 -0.1012 0.2907  -0.0938 109 GLU A C   
734  O O   . GLU A 111 ? 1.8995 2.8036 2.0749 -0.1462 0.2862  -0.0892 109 GLU A O   
735  C CB  . GLU A 111 ? 2.2568 2.9018 2.2014 -0.0805 0.3592  -0.0874 109 GLU A CB  
736  C CG  . GLU A 111 ? 2.3410 3.0008 2.2957 -0.1428 0.3921  -0.0734 109 GLU A CG  
737  C CD  . GLU A 111 ? 2.3785 2.8964 2.2214 -0.1617 0.3970  -0.0723 109 GLU A CD  
738  O OE1 . GLU A 111 ? 2.4287 2.8485 2.1868 -0.1215 0.3820  -0.0819 109 GLU A OE1 
739  O OE2 . GLU A 111 ? 2.3517 2.8567 2.1918 -0.2172 0.4158  -0.0606 109 GLU A OE2 
740  N N   . PHE A 112 ? 1.8671 2.5780 1.9040 -0.0858 0.2505  -0.1062 110 PHE A N   
741  C CA  . PHE A 112 ? 1.9326 2.6376 1.9827 -0.1225 0.2038  -0.1149 110 PHE A CA  
742  C C   . PHE A 112 ? 1.9843 2.7820 2.1009 -0.0954 0.1714  -0.1159 110 PHE A C   
743  O O   . PHE A 112 ? 1.9772 2.8296 2.1371 -0.1323 0.1406  -0.1204 110 PHE A O   
744  C CB  . PHE A 112 ? 1.8892 2.4544 1.8482 -0.1191 0.1792  -0.1247 110 PHE A CB  
745  C CG  . PHE A 112 ? 1.8830 2.3513 1.7697 -0.1438 0.2020  -0.1221 110 PHE A CG  
746  C CD1 . PHE A 112 ? 1.8864 2.3827 1.7892 -0.1877 0.2352  -0.1125 110 PHE A CD1 
747  C CD2 . PHE A 112 ? 1.9934 2.3452 1.7975 -0.1236 0.1898  -0.1271 110 PHE A CD2 
748  C CE1 . PHE A 112 ? 1.9423 2.3427 1.7702 -0.2069 0.2568  -0.1064 110 PHE A CE1 
749  C CE2 . PHE A 112 ? 2.0555 2.3206 1.7898 -0.1419 0.2066  -0.1224 110 PHE A CE2 
750  C CZ  . PHE A 112 ? 2.0401 2.3251 1.7814 -0.1814 0.2408  -0.1112 110 PHE A CZ  
751  N N   . GLY A 113 ? 2.0025 2.8150 2.1227 -0.0302 0.1785  -0.1117 111 GLY A N   
752  C CA  . GLY A 113 ? 1.9564 2.8638 2.1407 0.0035  0.1537  -0.1069 111 GLY A CA  
753  C C   . GLY A 113 ? 1.8623 2.7036 2.0068 0.0026  0.1070  -0.1154 111 GLY A C   
754  O O   . GLY A 113 ? 1.8347 2.5734 1.9141 0.0338  0.1020  -0.1189 111 GLY A O   
755  N N   . ASP A 114 ? 1.8433 2.7453 2.0267 -0.0352 0.0734  -0.1191 112 ASP A N   
756  C CA  . ASP A 114 ? 1.8221 2.6723 1.9680 -0.0378 0.0312  -0.1266 112 ASP A CA  
757  C C   . ASP A 114 ? 1.7558 2.4763 1.8237 -0.0724 0.0282  -0.1382 112 ASP A C   
758  O O   . ASP A 114 ? 1.7793 2.4303 1.8011 -0.0615 0.0048  -0.1423 112 ASP A O   
759  C CB  . ASP A 114 ? 1.9216 2.8759 2.1241 -0.0684 -0.0053 -0.1298 112 ASP A CB  
760  C CG  . ASP A 114 ? 2.1084 3.0871 2.3325 -0.1452 -0.0041 -0.1407 112 ASP A CG  
761  O OD1 . ASP A 114 ? 2.2012 3.0815 2.3717 -0.1785 0.0142  -0.1475 112 ASP A OD1 
762  O OD2 . ASP A 114 ? 2.1729 3.2694 2.4680 -0.1738 -0.0240 -0.1420 112 ASP A OD2 
763  N N   . SER A 115 ? 1.7010 2.3900 1.7544 -0.1106 0.0547  -0.1407 113 SER A N   
764  C CA  . SER A 115 ? 1.6246 2.1912 1.6039 -0.1369 0.0543  -0.1483 113 SER A CA  
765  C C   . SER A 115 ? 1.5639 2.0380 1.4843 -0.0981 0.0703  -0.1452 113 SER A C   
766  O O   . SER A 115 ? 1.5061 1.8829 1.3676 -0.1075 0.0639  -0.1494 113 SER A O   
767  C CB  . SER A 115 ? 1.5534 2.1155 1.5343 -0.1960 0.0746  -0.1499 113 SER A CB  
768  O OG  . SER A 115 ? 1.5634 2.2163 1.6050 -0.2399 0.0592  -0.1549 113 SER A OG  
769  N N   . ALA A 116 ? 1.5767 2.0821 1.5129 -0.0535 0.0893  -0.1386 114 ALA A N   
770  C CA  . ALA A 116 ? 1.5899 2.0092 1.4679 -0.0182 0.1033  -0.1392 114 ALA A CA  
771  C C   . ALA A 116 ? 1.5959 1.9236 1.4253 -0.0106 0.0749  -0.1442 114 ALA A C   
772  O O   . ALA A 116 ? 1.8649 2.1059 1.6382 -0.0121 0.0772  -0.1474 114 ALA A O   
773  C CB  . ALA A 116 ? 1.5992 2.0606 1.5000 0.0357  0.1200  -0.1344 114 ALA A CB  
774  N N   . CYS A 117 ? 1.4791 1.8320 1.3318 -0.0016 0.0483  -0.1432 115 CYS A N   
775  C CA  . CYS A 117 ? 1.4859 1.7649 1.3024 0.0061  0.0256  -0.1447 115 CYS A CA  
776  C C   . CYS A 117 ? 1.4705 1.6814 1.2471 -0.0296 0.0181  -0.1499 115 CYS A C   
777  O O   . CYS A 117 ? 1.5012 1.6394 1.2419 -0.0196 0.0107  -0.1498 115 CYS A O   
778  C CB  . CYS A 117 ? 1.4925 1.8192 1.3383 0.0201  0.0026  -0.1400 115 CYS A CB  
779  S SG  . CYS A 117 ? 2.6149 3.0213 2.4957 -0.0224 -0.0149 -0.1453 115 CYS A SG  
780  N N   . PHE A 118 ? 1.6250 1.8575 1.4092 -0.0705 0.0198  -0.1538 116 PHE A N   
781  C CA  . PHE A 118 ? 1.6474 1.8063 1.3886 -0.0992 0.0151  -0.1577 116 PHE A CA  
782  C C   . PHE A 118 ? 1.6373 1.7355 1.3373 -0.1053 0.0345  -0.1546 116 PHE A C   
783  O O   . PHE A 118 ? 1.6781 1.7017 1.3356 -0.1049 0.0283  -0.1534 116 PHE A O   
784  C CB  . PHE A 118 ? 1.7209 1.9079 1.4752 -0.1435 0.0101  -0.1649 116 PHE A CB  
785  C CG  . PHE A 118 ? 1.6052 1.8535 1.3909 -0.1417 -0.0134 -0.1698 116 PHE A CG  
786  C CD1 . PHE A 118 ? 1.6197 1.8277 1.3771 -0.1333 -0.0332 -0.1736 116 PHE A CD1 
787  C CD2 . PHE A 118 ? 1.5518 1.9029 1.3947 -0.1461 -0.0151 -0.1692 116 PHE A CD2 
788  C CE1 . PHE A 118 ? 1.6126 1.8740 1.3874 -0.1296 -0.0554 -0.1774 116 PHE A CE1 
789  C CE2 . PHE A 118 ? 1.5241 1.9360 1.3919 -0.1424 -0.0415 -0.1726 116 PHE A CE2 
790  C CZ  . PHE A 118 ? 1.5724 1.9354 1.4005 -0.1343 -0.0623 -0.1771 116 PHE A CZ  
791  N N   . THR A 119 ? 1.6347 1.7701 1.3475 -0.1090 0.0588  -0.1515 117 THR A N   
792  C CA  . THR A 119 ? 1.6752 1.7576 1.3414 -0.1110 0.0806  -0.1468 117 THR A CA  
793  C C   . THR A 119 ? 1.7656 1.7958 1.3931 -0.0728 0.0757  -0.1476 117 THR A C   
794  O O   . THR A 119 ? 2.0026 1.9646 1.5757 -0.0733 0.0773  -0.1451 117 THR A O   
795  C CB  . THR A 119 ? 1.7221 1.8655 1.4141 -0.1243 0.1131  -0.1419 117 THR A CB  
796  O OG1 . THR A 119 ? 1.9393 2.1048 1.6335 -0.0835 0.1275  -0.1415 117 THR A OG1 
797  C CG2 . THR A 119 ? 1.6758 1.9105 1.4365 -0.1505 0.1080  -0.1440 117 THR A CG2 
798  N N   . LEU A 120 ? 1.6982 1.7564 1.3509 -0.0405 0.0675  -0.1509 118 LEU A N   
799  C CA  . LEU A 120 ? 1.6918 1.6942 1.3090 -0.0098 0.0591  -0.1548 118 LEU A CA  
800  C C   . LEU A 120 ? 1.8326 1.7828 1.4353 -0.0160 0.0314  -0.1541 118 LEU A C   
801  O O   . LEU A 120 ? 2.1110 2.0013 1.6734 -0.0100 0.0209  -0.1554 118 LEU A O   
802  C CB  . LEU A 120 ? 1.6914 1.7273 1.3373 0.0255  0.0604  -0.1573 118 LEU A CB  
803  C CG  . LEU A 120 ? 1.7391 1.8138 1.3888 0.0446  0.0922  -0.1581 118 LEU A CG  
804  C CD1 . LEU A 120 ? 1.8281 1.9585 1.5237 0.0792  0.0950  -0.1561 118 LEU A CD1 
805  C CD2 . LEU A 120 ? 1.8387 1.8418 1.4200 0.0601  0.1031  -0.1659 118 LEU A CD2 
806  N N   . SER A 121 ? 1.6092 1.5867 1.2452 -0.0262 0.0190  -0.1520 119 SER A N   
807  C CA  . SER A 121 ? 1.5829 1.5175 1.2074 -0.0324 0.0000  -0.1495 119 SER A CA  
808  C C   . SER A 121 ? 1.6140 1.4983 1.1969 -0.0517 0.0041  -0.1468 119 SER A C   
809  O O   . SER A 121 ? 1.7094 1.5445 1.2679 -0.0442 -0.0091 -0.1434 119 SER A O   
810  C CB  . SER A 121 ? 1.6135 1.5833 1.2674 -0.0418 -0.0082 -0.1493 119 SER A CB  
811  O OG  . SER A 121 ? 1.7654 1.7651 1.4473 -0.0177 -0.0163 -0.1469 119 SER A OG  
812  N N   . LEU A 122 ? 1.5434 1.4420 1.1205 -0.0765 0.0226  -0.1464 120 LEU A N   
813  C CA  . LEU A 122 ? 1.5630 1.4056 1.0945 -0.0948 0.0308  -0.1404 120 LEU A CA  
814  C C   . LEU A 122 ? 1.6079 1.4081 1.0925 -0.0778 0.0336  -0.1363 120 LEU A C   
815  O O   . LEU A 122 ? 1.6593 1.4040 1.1072 -0.0708 0.0204  -0.1304 120 LEU A O   
816  C CB  . LEU A 122 ? 1.5982 1.4640 1.1359 -0.1305 0.0537  -0.1395 120 LEU A CB  
817  C CG  . LEU A 122 ? 1.6785 1.4743 1.1671 -0.1538 0.0637  -0.1315 120 LEU A CG  
818  C CD1 . LEU A 122 ? 1.6717 1.4193 1.1473 -0.1500 0.0442  -0.1327 120 LEU A CD1 
819  C CD2 . LEU A 122 ? 1.7254 1.5438 1.2261 -0.1969 0.0878  -0.1307 120 LEU A CD2 
820  N N   . LEU A 123 ? 1.7040 1.5326 1.1883 -0.0684 0.0501  -0.1395 121 LEU A N   
821  C CA  . LEU A 123 ? 1.7399 1.5285 1.1716 -0.0487 0.0518  -0.1404 121 LEU A CA  
822  C C   . LEU A 123 ? 1.7434 1.4978 1.1655 -0.0270 0.0192  -0.1458 121 LEU A C   
823  O O   . LEU A 123 ? 2.0308 1.7351 1.4018 -0.0194 0.0063  -0.1442 121 LEU A O   
824  C CB  . LEU A 123 ? 1.7434 1.5723 1.1817 -0.0353 0.0772  -0.1461 121 LEU A CB  
825  C CG  . LEU A 123 ? 2.1328 1.9564 1.5301 -0.0438 0.1131  -0.1389 121 LEU A CG  
826  C CD1 . LEU A 123 ? 2.4027 2.2596 1.8010 -0.0180 0.1376  -0.1461 121 LEU A CD1 
827  C CD2 . LEU A 123 ? 2.3625 2.1060 1.6781 -0.0423 0.1063  -0.1323 121 LEU A CD2 
828  N N   . GLY A 124 ? 1.6938 1.4773 1.1655 -0.0185 0.0050  -0.1508 122 GLY A N   
829  C CA  . GLY A 124 ? 1.8588 1.6165 1.3358 -0.0057 -0.0242 -0.1532 122 GLY A CA  
830  C C   . GLY A 124 ? 1.8717 1.5954 1.3341 -0.0118 -0.0429 -0.1439 122 GLY A C   
831  O O   . GLY A 124 ? 1.9722 1.6621 1.4063 -0.0038 -0.0637 -0.1442 122 GLY A O   
832  N N   . HIS A 125 ? 1.6886 1.4217 1.1694 -0.0243 -0.0365 -0.1364 123 HIS A N   
833  C CA  . HIS A 125 ? 1.7117 1.4130 1.1823 -0.0243 -0.0488 -0.1259 123 HIS A CA  
834  C C   . HIS A 125 ? 1.7762 1.4296 1.1876 -0.0209 -0.0530 -0.1181 123 HIS A C   
835  O O   . HIS A 125 ? 1.7795 1.4126 1.1836 -0.0078 -0.0766 -0.1112 123 HIS A O   
836  C CB  . HIS A 125 ? 1.8000 1.5063 1.2830 -0.0397 -0.0344 -0.1231 123 HIS A CB  
837  C CG  . HIS A 125 ? 1.8104 1.4735 1.2735 -0.0356 -0.0395 -0.1124 123 HIS A CG  
838  N ND1 . HIS A 125 ? 1.8215 1.4690 1.2857 -0.0148 -0.0607 -0.1035 123 HIS A ND1 
839  C CD2 . HIS A 125 ? 1.8099 1.4412 1.2525 -0.0480 -0.0258 -0.1090 123 HIS A CD2 
840  C CE1 . HIS A 125 ? 1.8640 1.4753 1.3104 -0.0088 -0.0579 -0.0930 123 HIS A CE1 
841  N NE2 . HIS A 125 ? 1.8675 1.4604 1.2953 -0.0287 -0.0359 -0.0971 123 HIS A NE2 
842  N N   . VAL A 126 ? 1.8929 1.5327 1.2638 -0.0318 -0.0299 -0.1171 124 VAL A N   
843  C CA  . VAL A 126 ? 1.9836 1.5723 1.2861 -0.0274 -0.0294 -0.1064 124 VAL A CA  
844  C C   . VAL A 126 ? 2.0488 1.6239 1.3171 -0.0091 -0.0519 -0.1128 124 VAL A C   
845  O O   . VAL A 126 ? 2.2076 1.7478 1.4362 0.0032  -0.0742 -0.1038 124 VAL A O   
846  C CB  . VAL A 126 ? 2.0477 1.6248 1.3144 -0.0467 0.0077  -0.1009 124 VAL A CB  
847  C CG1 . VAL A 126 ? 2.0716 1.6266 1.3418 -0.0676 0.0226  -0.0909 124 VAL A CG1 
848  C CG2 . VAL A 126 ? 2.2072 1.8392 1.5074 -0.0546 0.0288  -0.1134 124 VAL A CG2 
849  N N   . TYR A 127 ? 1.9708 1.5703 1.2501 -0.0059 -0.0475 -0.1287 125 TYR A N   
850  C CA  . TYR A 127 ? 1.9328 1.5106 1.1755 0.0089  -0.0708 -0.1406 125 TYR A CA  
851  C C   . TYR A 127 ? 1.9672 1.5437 1.2383 0.0146  -0.1135 -0.1398 125 TYR A C   
852  O O   . TYR A 127 ? 2.1307 1.6793 1.3588 0.0228  -0.1427 -0.1411 125 TYR A O   
853  C CB  . TYR A 127 ? 1.8760 1.4746 1.1349 0.0144  -0.0586 -0.1591 125 TYR A CB  
854  C CG  . TYR A 127 ? 1.8901 1.4905 1.1102 0.0168  -0.0191 -0.1617 125 TYR A CG  
855  C CD1 . TYR A 127 ? 2.1372 1.6956 1.2745 0.0213  -0.0086 -0.1573 125 TYR A CD1 
856  C CD2 . TYR A 127 ? 1.8665 1.5144 1.1326 0.0180  0.0084  -0.1669 125 TYR A CD2 
857  C CE1 . TYR A 127 ? 2.2798 1.8442 1.3840 0.0245  0.0337  -0.1573 125 TYR A CE1 
858  C CE2 . TYR A 127 ? 2.1469 1.8090 1.3886 0.0224  0.0475  -0.1673 125 TYR A CE2 
859  C CZ  . TYR A 127 ? 2.2481 1.8685 1.4099 0.0247  0.0625  -0.1625 125 TYR A CZ  
860  O OH  . TYR A 127 ? 2.2327 1.8714 1.3726 0.0298  0.1075  -0.1603 125 TYR A OH  
861  N N   . CYS A 128 ? 1.9719 1.5830 1.3156 0.0102  -0.1172 -0.1367 126 CYS A N   
862  C CA  . CYS A 128 ? 2.0220 1.6443 1.4074 0.0143  -0.1512 -0.1325 126 CYS A CA  
863  C C   . CYS A 128 ? 2.1079 1.7148 1.4762 0.0228  -0.1654 -0.1139 126 CYS A C   
864  O O   . CYS A 128 ? 2.2974 1.9032 1.6640 0.0307  -0.2006 -0.1106 126 CYS A O   
865  C CB  . CYS A 128 ? 2.0050 1.6665 1.4660 0.0101  -0.1433 -0.1308 126 CYS A CB  
866  S SG  . CYS A 128 ? 2.8621 2.5399 2.3481 0.0077  -0.1316 -0.1477 126 CYS A SG  
867  N N   . LYS A 129 ? 2.0515 1.6455 1.4070 0.0212  -0.1394 -0.1015 127 LYS A N   
868  C CA  . LYS A 129 ? 2.1091 1.6770 1.4424 0.0343  -0.1471 -0.0816 127 LYS A CA  
869  C C   . LYS A 129 ? 2.3186 1.8418 1.5687 0.0434  -0.1561 -0.0742 127 LYS A C   
870  O O   . LYS A 129 ? 2.6121 2.1106 1.8356 0.0608  -0.1696 -0.0554 127 LYS A O   
871  C CB  . LYS A 129 ? 1.9843 1.5366 1.3207 0.0273  -0.1145 -0.0732 127 LYS A CB  
872  N N   . THR A 130 ? 2.3322 1.8434 1.5369 0.0358  -0.1471 -0.0876 128 THR A N   
873  C CA  . THR A 130 ? 2.1425 1.6106 1.2583 0.0465  -0.1575 -0.0829 128 THR A CA  
874  C C   . THR A 130 ? 2.1057 1.5788 1.2037 0.0508  -0.1930 -0.1026 128 THR A C   
875  O O   . THR A 130 ? 2.0755 1.5150 1.0953 0.0543  -0.1887 -0.1108 128 THR A O   
876  C CB  . THR A 130 ? 2.1039 1.5410 1.1590 0.0365  -0.1124 -0.0805 128 THR A CB  
877  O OG1 . THR A 130 ? 2.0475 1.5173 1.1346 0.0237  -0.0904 -0.1007 128 THR A OG1 
878  C CG2 . THR A 130 ? 2.1281 1.5457 1.1876 0.0266  -0.0809 -0.0610 128 THR A CG2 
879  N N   . ASP A 131 ? 2.1988 1.7100 1.3663 0.0487  -0.2257 -0.1109 129 ASP A N   
880  C CA  . ASP A 131 ? 2.1978 1.7088 1.3510 0.0491  -0.2710 -0.1275 129 ASP A CA  
881  C C   . ASP A 131 ? 2.1459 1.6362 1.2649 0.0406  -0.2603 -0.1556 129 ASP A C   
882  O O   . ASP A 131 ? 2.1489 1.6065 1.2005 0.0436  -0.2863 -0.1714 129 ASP A O   
883  C CB  . ASP A 131 ? 2.2935 1.7754 1.3707 0.0656  -0.3048 -0.1165 129 ASP A CB  
884  C CG  . ASP A 131 ? 2.5256 2.0345 1.6305 0.0640  -0.3661 -0.1250 129 ASP A CG  
885  O OD1 . ASP A 131 ? 2.5176 2.0659 1.7067 0.0476  -0.3778 -0.1366 129 ASP A OD1 
886  O OD2 . ASP A 131 ? 2.8153 2.3072 1.8579 0.0776  -0.4032 -0.1190 129 ASP A OD2 
887  N N   . ARG A 132 ? 2.0794 1.5864 1.2399 0.0329  -0.2227 -0.1622 130 ARG A N   
888  C CA  . ARG A 132 ? 2.1977 1.6852 1.3292 0.0321  -0.2068 -0.1864 130 ARG A CA  
889  C C   . ARG A 132 ? 2.1330 1.6539 1.3476 0.0243  -0.1951 -0.1935 130 ARG A C   
890  O O   . ARG A 132 ? 2.1330 1.6647 1.3575 0.0273  -0.1574 -0.1967 130 ARG A O   
891  C CB  . ARG A 132 ? 2.2055 1.6733 1.2745 0.0396  -0.1603 -0.1835 130 ARG A CB  
892  N N   . LEU A 133 ? 1.9928 1.5345 1.2695 0.0150  -0.2277 -0.1929 131 LEU A N   
893  C CA  . LEU A 133 ? 1.9323 1.5020 1.2869 0.0076  -0.2193 -0.1945 131 LEU A CA  
894  C C   . LEU A 133 ? 1.9311 1.4728 1.2618 0.0123  -0.2005 -0.2154 131 LEU A C   
895  O O   . LEU A 133 ? 1.9399 1.5030 1.3156 0.0155  -0.1754 -0.2125 131 LEU A O   
896  C CB  . LEU A 133 ? 1.8484 1.4364 1.2615 -0.0057 -0.2589 -0.1922 131 LEU A CB  
897  N N   . ALA A 134 ? 1.9027 1.3935 1.1574 0.0160  -0.2139 -0.2363 132 ALA A N   
898  C CA  . ALA A 134 ? 1.9795 1.4307 1.1937 0.0276  -0.1926 -0.2581 132 ALA A CA  
899  C C   . ALA A 134 ? 2.0518 1.5319 1.2730 0.0444  -0.1412 -0.2489 132 ALA A C   
900  O O   . ALA A 134 ? 1.9766 1.4720 1.2396 0.0525  -0.1202 -0.2494 132 ALA A O   
901  C CB  . ALA A 134 ? 2.1418 1.5295 1.2524 0.0331  -0.2098 -0.2814 132 ALA A CB  
902  N N   . LYS A 135 ? 2.2347 1.7235 1.4156 0.0490  -0.1219 -0.2388 133 LYS A N   
903  C CA  . LYS A 135 ? 2.2057 1.7297 1.3965 0.0589  -0.0741 -0.2295 133 LYS A CA  
904  C C   . LYS A 135 ? 1.9991 1.5847 1.2795 0.0490  -0.0647 -0.2115 133 LYS A C   
905  O O   . LYS A 135 ? 1.9755 1.5991 1.2918 0.0570  -0.0359 -0.2090 133 LYS A O   
906  C CB  . LYS A 135 ? 2.3303 1.8443 1.4573 0.0593  -0.0555 -0.2199 133 LYS A CB  
907  N N   . GLY A 136 ? 1.7334 1.3298 1.0467 0.0343  -0.0899 -0.1990 134 GLY A N   
908  C CA  . GLY A 136 ? 1.6885 1.3325 1.0737 0.0258  -0.0836 -0.1839 134 GLY A CA  
909  C C   . GLY A 136 ? 1.6821 1.3469 1.1247 0.0303  -0.0848 -0.1864 134 GLY A C   
910  O O   . GLY A 136 ? 1.6864 1.3936 1.1720 0.0309  -0.0668 -0.1781 134 GLY A O   
911  N N   . SER A 137 ? 1.6822 1.3139 1.1220 0.0320  -0.1070 -0.1974 135 SER A N   
912  C CA  . SER A 137 ? 1.6598 1.2968 1.1448 0.0370  -0.1053 -0.1976 135 SER A CA  
913  C C   . SER A 137 ? 1.6493 1.2905 1.1234 0.0587  -0.0753 -0.2042 135 SER A C   
914  O O   . SER A 137 ? 1.6431 1.3166 1.1609 0.0681  -0.0621 -0.1947 135 SER A O   
915  C CB  . SER A 137 ? 1.7367 1.3282 1.2183 0.0278  -0.1357 -0.2086 135 SER A CB  
916  O OG  . SER A 137 ? 1.7832 1.3893 1.2953 0.0098  -0.1635 -0.1984 135 SER A OG  
917  N N   . GLU A 138 ? 1.7421 1.3520 1.1556 0.0704  -0.0642 -0.2192 136 GLU A N   
918  C CA  . GLU A 138 ? 1.8301 1.4497 1.2330 0.0969  -0.0310 -0.2244 136 GLU A CA  
919  C C   . GLU A 138 ? 1.8063 1.5049 1.2573 0.0983  -0.0061 -0.2075 136 GLU A C   
920  O O   . GLU A 138 ? 1.9115 1.6452 1.3947 0.1188  0.0125  -0.2031 136 GLU A O   
921  C CB  . GLU A 138 ? 1.9258 1.5018 1.2486 0.1095  -0.0180 -0.2418 136 GLU A CB  
922  N N   . CYS A 139 ? 1.7126 1.4367 1.1667 0.0765  -0.0077 -0.1980 137 CYS A N   
923  C CA  . CYS A 139 ? 1.6744 1.4673 1.1711 0.0682  0.0113  -0.1849 137 CYS A CA  
924  C C   . CYS A 139 ? 1.6249 1.4551 1.1820 0.0661  0.0004  -0.1749 137 CYS A C   
925  O O   . CYS A 139 ? 1.6205 1.5062 1.2150 0.0759  0.0144  -0.1695 137 CYS A O   
926  C CB  . CYS A 139 ? 1.6771 1.4669 1.1529 0.0428  0.0109  -0.1779 137 CYS A CB  
927  S SG  . CYS A 139 ? 1.8007 1.5707 1.2095 0.0446  0.0391  -0.1812 137 CYS A SG  
928  N N   . TYR A 140 ? 1.6652 1.4688 1.2311 0.0549  -0.0243 -0.1712 138 TYR A N   
929  C CA  . TYR A 140 ? 1.6450 1.4746 1.2576 0.0546  -0.0323 -0.1603 138 TYR A CA  
930  C C   . TYR A 140 ? 1.7513 1.5889 1.3827 0.0799  -0.0253 -0.1589 138 TYR A C   
931  O O   . TYR A 140 ? 2.0294 1.9145 1.6935 0.0880  -0.0197 -0.1493 138 TYR A O   
932  C CB  . TYR A 140 ? 1.6260 1.4234 1.2455 0.0430  -0.0552 -0.1556 138 TYR A CB  
933  C CG  . TYR A 140 ? 1.5892 1.3858 1.2003 0.0250  -0.0619 -0.1509 138 TYR A CG  
934  C CD1 . TYR A 140 ? 1.5603 1.3880 1.1758 0.0150  -0.0493 -0.1467 138 TYR A CD1 
935  C CD2 . TYR A 140 ? 1.6620 1.4254 1.2612 0.0183  -0.0822 -0.1503 138 TYR A CD2 
936  C CE1 . TYR A 140 ? 1.5722 1.3849 1.1730 0.0011  -0.0527 -0.1421 138 TYR A CE1 
937  C CE2 . TYR A 140 ? 1.6856 1.4450 1.2753 0.0091  -0.0870 -0.1431 138 TYR A CE2 
938  C CZ  . TYR A 140 ? 1.6050 1.3826 1.1920 0.0017  -0.0702 -0.1389 138 TYR A CZ  
939  O OH  . TYR A 140 ? 1.6243 1.3839 1.1949 -0.0049 -0.0725 -0.1315 138 TYR A OH  
940  N N   . GLN A 141 ? 1.6411 1.4267 1.2460 0.0932  -0.0272 -0.1689 139 GLN A N   
941  C CA  . GLN A 141 ? 1.6774 1.4516 1.2895 0.1216  -0.0178 -0.1677 139 GLN A CA  
942  C C   . GLN A 141 ? 1.6685 1.5021 1.2944 0.1455  0.0062  -0.1646 139 GLN A C   
943  O O   . GLN A 141 ? 1.7284 1.5984 1.3865 0.1652  0.0106  -0.1520 139 GLN A O   
944  C CB  . GLN A 141 ? 1.7339 1.4286 1.3012 0.1294  -0.0221 -0.1844 139 GLN A CB  
945  N N   . LYS A 142 ? 1.7206 1.5678 1.3232 0.1451  0.0222  -0.1739 140 LYS A N   
946  C CA  . LYS A 142 ? 1.7326 1.6503 1.3595 0.1650  0.0475  -0.1695 140 LYS A CA  
947  C C   . LYS A 142 ? 1.7720 1.7733 1.4534 0.1497  0.0421  -0.1556 140 LYS A C   
948  O O   . LYS A 142 ? 1.8931 1.9600 1.6131 0.1714  0.0507  -0.1469 140 LYS A O   
949  C CB  . LYS A 142 ? 1.7986 1.7175 1.3912 0.1602  0.0692  -0.1790 140 LYS A CB  
950  N N   . SER A 143 ? 1.7211 1.7187 1.4024 0.1140  0.0266  -0.1543 141 SER A N   
951  C CA  . SER A 143 ? 1.5986 1.6578 1.3178 0.0952  0.0182  -0.1459 141 SER A CA  
952  C C   . SER A 143 ? 1.6038 1.6831 1.3494 0.1157  0.0061  -0.1349 141 SER A C   
953  O O   . SER A 143 ? 1.6703 1.8216 1.4502 0.1218  0.0049  -0.1282 141 SER A O   
954  C CB  . SER A 143 ? 1.5708 1.5986 1.2727 0.0599  0.0053  -0.1475 141 SER A CB  
955  O OG  . SER A 143 ? 1.5277 1.5997 1.2549 0.0428  -0.0036 -0.1430 141 SER A OG  
956  N N   . LEU A 144 ? 1.6022 1.6189 1.3315 0.1250  -0.0037 -0.1318 142 LEU A N   
957  C CA  . LEU A 144 ? 1.6202 1.6406 1.3648 0.1450  -0.0115 -0.1175 142 LEU A CA  
958  C C   . LEU A 144 ? 1.7197 1.7697 1.4781 0.1860  -0.0002 -0.1105 142 LEU A C   
959  O O   . LEU A 144 ? 1.7737 1.8619 1.5510 0.2057  -0.0058 -0.0958 142 LEU A O   
960  C CB  . LEU A 144 ? 1.6052 1.5490 1.3330 0.1421  -0.0192 -0.1141 142 LEU A CB  
961  N N   . SER A 145 ? 1.8491 1.8785 1.5926 0.2029  0.0164  -0.1204 143 SER A N   
962  C CA  . SER A 145 ? 1.8742 1.9346 1.6309 0.2478  0.0327  -0.1145 143 SER A CA  
963  C C   . SER A 145 ? 1.8322 2.0081 1.6376 0.2502  0.0336  -0.1069 143 SER A C   
964  O O   . SER A 145 ? 1.9359 2.1627 1.7687 0.2852  0.0325  -0.0923 143 SER A O   
965  C CB  . SER A 145 ? 2.0837 2.0984 1.8072 0.2639  0.0545  -0.1300 143 SER A CB  
966  O OG  . SER A 145 ? 2.2992 2.2178 1.9766 0.2430  0.0458  -0.1434 143 SER A OG  
967  N N   . LEU A 146 ? 1.7254 1.9420 1.5416 0.2116  0.0342  -0.1160 144 LEU A N   
968  C CA  . LEU A 146 ? 1.6655 1.9935 1.5326 0.2021  0.0338  -0.1117 144 LEU A CA  
969  C C   . LEU A 146 ? 1.8152 2.1810 1.6995 0.1854  0.0054  -0.1044 144 LEU A C   
970  O O   . LEU A 146 ? 1.9767 2.4364 1.9040 0.1915  -0.0041 -0.0973 144 LEU A O   
971  C CB  . LEU A 146 ? 1.5397 1.8857 1.4074 0.1619  0.0473  -0.1231 144 LEU A CB  
972  N N   . ASN A 147 ? 1.7318 2.0272 1.5814 0.1656  -0.0085 -0.1062 145 ASN A N   
973  C CA  . ASN A 147 ? 1.5460 1.8635 1.3971 0.1498  -0.0316 -0.1016 145 ASN A CA  
974  C C   . ASN A 147 ? 1.5571 1.7912 1.3724 0.1556  -0.0374 -0.0947 145 ASN A C   
975  O O   . ASN A 147 ? 1.7267 1.8991 1.5186 0.1318  -0.0352 -0.1023 145 ASN A O   
976  C CB  . ASN A 147 ? 1.4895 1.8294 1.3426 0.0991  -0.0379 -0.1153 145 ASN A CB  
977  C CG  . ASN A 147 ? 1.4813 1.8362 1.3248 0.0818  -0.0613 -0.1156 145 ASN A CG  
978  O OD1 . ASN A 147 ? 1.6042 1.9522 1.4359 0.1075  -0.0723 -0.1037 145 ASN A OD1 
979  N ND2 . ASN A 147 ? 1.6113 1.9794 1.4525 0.0378  -0.0673 -0.1294 145 ASN A ND2 
980  N N   . PRO A 148 ? 1.7353 1.9713 1.5488 0.1884  -0.0439 -0.0776 146 PRO A N   
981  C CA  . PRO A 148 ? 1.7532 1.9144 1.5383 0.1943  -0.0442 -0.0664 146 PRO A CA  
982  C C   . PRO A 148 ? 1.7145 1.8764 1.4826 0.1716  -0.0566 -0.0651 146 PRO A C   
983  O O   . PRO A 148 ? 1.7289 1.8339 1.4779 0.1710  -0.0526 -0.0558 146 PRO A O   
984  C CB  . PRO A 148 ? 1.8741 2.0358 1.6598 0.2421  -0.0414 -0.0452 146 PRO A CB  
985  C CG  . PRO A 148 ? 1.9921 2.2526 1.8079 0.2602  -0.0501 -0.0432 146 PRO A CG  
986  C CD  . PRO A 148 ? 1.8537 2.1648 1.6933 0.2239  -0.0499 -0.0646 146 PRO A CD  
987  N N   . PHE A 149 ? 1.5728 1.7964 1.3471 0.1523  -0.0702 -0.0749 147 PHE A N   
988  C CA  . PHE A 149 ? 1.5360 1.7513 1.2825 0.1315  -0.0809 -0.0784 147 PHE A CA  
989  C C   . PHE A 149 ? 1.5564 1.7190 1.2882 0.0974  -0.0734 -0.0924 147 PHE A C   
990  O O   . PHE A 149 ? 1.6811 1.8201 1.3850 0.0844  -0.0763 -0.0954 147 PHE A O   
991  C CB  . PHE A 149 ? 1.5050 1.7982 1.2578 0.1184  -0.1020 -0.0880 147 PHE A CB  
992  C CG  . PHE A 149 ? 1.5342 1.8910 1.3006 0.1552  -0.1156 -0.0720 147 PHE A CG  
993  C CD1 . PHE A 149 ? 1.7485 2.0961 1.4791 0.1790  -0.1258 -0.0561 147 PHE A CD1 
994  C CD2 . PHE A 149 ? 1.5499 1.9784 1.3633 0.1693  -0.1169 -0.0708 147 PHE A CD2 
995  C CE1 . PHE A 149 ? 1.9804 2.3858 1.7184 0.2174  -0.1407 -0.0383 147 PHE A CE1 
996  C CE2 . PHE A 149 ? 1.7045 2.1976 1.5339 0.2092  -0.1308 -0.0534 147 PHE A CE2 
997  C CZ  . PHE A 149 ? 1.9330 2.4131 1.7229 0.2337  -0.1448 -0.0368 147 PHE A CZ  
998  N N   . LEU A 150 ? 1.4939 1.6357 1.2391 0.0872  -0.0630 -0.1001 148 LEU A N   
999  C CA  . LEU A 150 ? 1.4641 1.5586 1.1945 0.0596  -0.0578 -0.1106 148 LEU A CA  
1000 C C   . LEU A 150 ? 1.5259 1.5599 1.2489 0.0691  -0.0517 -0.0999 148 LEU A C   
1001 O O   . LEU A 150 ? 1.5907 1.5999 1.3236 0.0811  -0.0469 -0.0955 148 LEU A O   
1002 C CB  . LEU A 150 ? 1.3823 1.4812 1.1227 0.0451  -0.0503 -0.1216 148 LEU A CB  
1003 N N   . TRP A 151 ? 1.5450 1.5556 1.2508 0.0630  -0.0511 -0.0967 149 TRP A N   
1004 C CA  . TRP A 151 ? 1.5925 1.5591 1.3030 0.0687  -0.0438 -0.0847 149 TRP A CA  
1005 C C   . TRP A 151 ? 1.5762 1.5115 1.2915 0.0526  -0.0441 -0.0924 149 TRP A C   
1006 O O   . TRP A 151 ? 1.7457 1.6554 1.4777 0.0556  -0.0439 -0.0850 149 TRP A O   
1007 C CB  . TRP A 151 ? 1.6081 1.5667 1.2995 0.0735  -0.0380 -0.0763 149 TRP A CB  
1008 C CG  . TRP A 151 ? 1.7590 1.6853 1.4648 0.0768  -0.0271 -0.0626 149 TRP A CG  
1009 C CD1 . TRP A 151 ? 2.0278 1.9341 1.7325 0.0684  -0.0223 -0.0653 149 TRP A CD1 
1010 C CD2 . TRP A 151 ? 1.7133 1.6266 1.4432 0.0887  -0.0191 -0.0424 149 TRP A CD2 
1011 N NE1 . TRP A 151 ? 2.0002 1.8948 1.7346 0.0748  -0.0129 -0.0476 149 TRP A NE1 
1012 C CE2 . TRP A 151 ? 1.7710 1.6678 1.5216 0.0833  -0.0106 -0.0338 149 TRP A CE2 
1013 C CE3 . TRP A 151 ? 1.7435 1.6556 1.4801 0.1038  -0.0171 -0.0293 149 TRP A CE3 
1014 C CZ2 . TRP A 151 ? 1.7926 1.6781 1.5768 0.0856  -0.0009 -0.0134 149 TRP A CZ2 
1015 C CZ3 . TRP A 151 ? 1.8058 1.6917 1.5657 0.1067  -0.0061 -0.0094 149 TRP A CZ3 
1016 C CH2 . TRP A 151 ? 1.8147 1.6907 1.6014 0.0944  0.0016  -0.0020 149 TRP A CH2 
1017 N N   . SER A 152 ? 1.5567 1.4928 1.2560 0.0344  -0.0461 -0.1063 150 SER A N   
1018 C CA  . SER A 152 ? 1.6037 1.5062 1.2969 0.0227  -0.0469 -0.1103 150 SER A CA  
1019 C C   . SER A 152 ? 1.5794 1.4690 1.2817 0.0245  -0.0517 -0.1120 150 SER A C   
1020 O O   . SER A 152 ? 1.6111 1.4748 1.3198 0.0242  -0.0579 -0.1078 150 SER A O   
1021 C CB  . SER A 152 ? 1.8456 1.7423 1.5123 0.0026  -0.0449 -0.1227 150 SER A CB  
1022 O OG  . SER A 152 ? 2.0113 1.9186 1.6625 -0.0019 -0.0434 -0.1270 150 SER A OG  
1023 N N   . PRO A 153 ? 1.5181 1.4272 1.2196 0.0271  -0.0495 -0.1190 151 PRO A N   
1024 C CA  . PRO A 153 ? 1.5227 1.4092 1.2200 0.0320  -0.0520 -0.1236 151 PRO A CA  
1025 C C   . PRO A 153 ? 1.5529 1.4139 1.2673 0.0417  -0.0588 -0.1155 151 PRO A C   
1026 O O   . PRO A 153 ? 1.7431 1.5724 1.4538 0.0358  -0.0692 -0.1187 151 PRO A O   
1027 C CB  . PRO A 153 ? 1.5373 1.4564 1.2361 0.0421  -0.0425 -0.1291 151 PRO A CB  
1028 C CG  . PRO A 153 ? 1.5654 1.5292 1.2697 0.0310  -0.0388 -0.1302 151 PRO A CG  
1029 C CD  . PRO A 153 ? 1.5681 1.5236 1.2733 0.0276  -0.0449 -0.1232 151 PRO A CD  
1030 N N   . PHE A 154 ? 1.6092 1.4836 1.3406 0.0546  -0.0538 -0.1042 152 PHE A N   
1031 C CA  . PHE A 154 ? 1.6739 1.5215 1.4238 0.0604  -0.0554 -0.0929 152 PHE A CA  
1032 C C   . PHE A 154 ? 1.7006 1.5374 1.4683 0.0462  -0.0620 -0.0861 152 PHE A C   
1033 O O   . PHE A 154 ? 1.6571 1.4690 1.4407 0.0377  -0.0717 -0.0853 152 PHE A O   
1034 C CB  . PHE A 154 ? 1.7383 1.6010 1.4962 0.0784  -0.0454 -0.0768 152 PHE A CB  
1035 C CG  . PHE A 154 ? 1.8841 1.7142 1.6609 0.0805  -0.0418 -0.0606 152 PHE A CG  
1036 C CD1 . PHE A 154 ? 1.9871 1.7803 1.7615 0.0898  -0.0405 -0.0602 152 PHE A CD1 
1037 C CD2 . PHE A 154 ? 1.9765 1.8096 1.7732 0.0731  -0.0367 -0.0451 152 PHE A CD2 
1038 C CE1 . PHE A 154 ? 2.0630 1.8185 1.8548 0.0858  -0.0358 -0.0447 152 PHE A CE1 
1039 C CE2 . PHE A 154 ? 2.0267 1.8340 1.8476 0.0702  -0.0299 -0.0275 152 PHE A CE2 
1040 C CZ  . PHE A 154 ? 2.0481 1.8144 1.8668 0.0736  -0.0304 -0.0274 152 PHE A CZ  
1041 N N   . GLU A 155 ? 1.8474 1.7034 1.6131 0.0440  -0.0571 -0.0819 153 GLU A N   
1042 C CA  . GLU A 155 ? 1.9058 1.7591 1.6920 0.0386  -0.0588 -0.0724 153 GLU A CA  
1043 C C   . GLU A 155 ? 2.0251 1.8639 1.8101 0.0278  -0.0756 -0.0808 153 GLU A C   
1044 O O   . GLU A 155 ? 2.1847 2.0246 2.0009 0.0234  -0.0845 -0.0721 153 GLU A O   
1045 C CB  . GLU A 155 ? 1.9554 1.8214 1.7255 0.0435  -0.0471 -0.0699 153 GLU A CB  
1046 C CG  . GLU A 155 ? 2.0387 1.9030 1.8271 0.0460  -0.0437 -0.0595 153 GLU A CG  
1047 C CD  . GLU A 155 ? 2.0212 1.8883 1.7896 0.0573  -0.0256 -0.0550 153 GLU A CD  
1048 O OE1 . GLU A 155 ? 1.9309 1.8040 1.6740 0.0609  -0.0191 -0.0584 153 GLU A OE1 
1049 O OE2 . GLU A 155 ? 2.0623 1.9248 1.8371 0.0650  -0.0185 -0.0485 153 GLU A OE2 
1050 N N   . SER A 156 ? 1.8678 1.6971 1.6178 0.0238  -0.0801 -0.0956 154 SER A N   
1051 C CA  . SER A 156 ? 1.6555 1.4649 1.3901 0.0166  -0.0970 -0.1031 154 SER A CA  
1052 C C   . SER A 156 ? 1.5990 1.3892 1.3419 0.0112  -0.1142 -0.1090 154 SER A C   
1053 O O   . SER A 156 ? 1.6336 1.4175 1.3875 0.0040  -0.1349 -0.1081 154 SER A O   
1054 C CB  . SER A 156 ? 1.7504 1.5510 1.4396 0.0135  -0.0914 -0.1151 154 SER A CB  
1055 O OG  . SER A 156 ? 1.7737 1.5844 1.4526 0.0117  -0.0775 -0.1127 154 SER A OG  
1056 N N   . LEU A 157 ? 1.5778 1.3574 1.3138 0.0155  -0.1070 -0.1155 155 LEU A N   
1057 C CA  . LEU A 157 ? 1.6003 1.3460 1.3344 0.0104  -0.1203 -0.1245 155 LEU A CA  
1058 C C   . LEU A 157 ? 1.7995 1.5438 1.5818 -0.0031 -0.1330 -0.1135 155 LEU A C   
1059 O O   . LEU A 157 ? 1.9576 1.6792 1.7413 -0.0182 -0.1567 -0.1227 155 LEU A O   
1060 C CB  . LEU A 157 ? 1.6203 1.3521 1.3399 0.0249  -0.1038 -0.1293 155 LEU A CB  
1061 C CG  . LEU A 157 ? 1.6031 1.3320 1.2783 0.0366  -0.0937 -0.1443 155 LEU A CG  
1062 C CD1 . LEU A 157 ? 1.6291 1.3645 1.3050 0.0585  -0.0743 -0.1423 155 LEU A CD1 
1063 C CD2 . LEU A 157 ? 1.6845 1.3683 1.3179 0.0312  -0.1087 -0.1633 155 LEU A CD2 
1064 N N   . CYS A 158 ? 1.8246 1.5946 1.6454 0.0006  -0.1172 -0.0938 156 CYS A N   
1065 C CA  . CYS A 158 ? 1.8287 1.6087 1.7048 -0.0134 -0.1223 -0.0781 156 CYS A CA  
1066 C C   . CYS A 158 ? 1.8007 1.6072 1.7036 -0.0234 -0.1434 -0.0756 156 CYS A C   
1067 O O   . CYS A 158 ? 1.7931 1.6003 1.7312 -0.0432 -0.1654 -0.0756 156 CYS A O   
1068 C CB  . CYS A 158 ? 1.8071 1.6110 1.7090 -0.0022 -0.0948 -0.0551 156 CYS A CB  
1069 S SG  . CYS A 158 ? 2.1587 1.9386 2.0311 0.0157  -0.0732 -0.0517 156 CYS A SG  
1070 N N   . GLU A 159 ? 1.8297 1.6561 1.7149 -0.0100 -0.1386 -0.0736 157 GLU A N   
1071 C CA  . GLU A 159 ? 1.8141 1.6654 1.7212 -0.0102 -0.1561 -0.0672 157 GLU A CA  
1072 C C   . GLU A 159 ? 1.8275 1.6605 1.7112 -0.0216 -0.1916 -0.0831 157 GLU A C   
1073 O O   . GLU A 159 ? 1.8176 1.6767 1.7357 -0.0271 -0.2165 -0.0765 157 GLU A O   
1074 C CB  . GLU A 159 ? 1.8253 1.6832 1.7039 0.0092  -0.1397 -0.0627 157 GLU A CB  
1075 C CG  . GLU A 159 ? 1.9073 1.7867 1.8097 0.0221  -0.1100 -0.0462 157 GLU A CG  
1076 C CD  . GLU A 159 ? 1.9271 1.7924 1.7806 0.0359  -0.0923 -0.0508 157 GLU A CD  
1077 O OE1 . GLU A 159 ? 1.8901 1.7661 1.7515 0.0496  -0.0714 -0.0397 157 GLU A OE1 
1078 O OE2 . GLU A 159 ? 1.9700 1.8110 1.7753 0.0317  -0.0977 -0.0659 157 GLU A OE2 
1079 N N   . ILE A 160 ? 1.7913 1.5832 1.6156 -0.0229 -0.1942 -0.1033 158 ILE A N   
1080 C CA  . ILE A 160 ? 1.8008 1.5659 1.5856 -0.0314 -0.2259 -0.1207 158 ILE A CA  
1081 C C   . ILE A 160 ? 2.0006 1.7574 1.8186 -0.0556 -0.2543 -0.1281 158 ILE A C   
1082 O O   . ILE A 160 ? 2.1260 1.8853 1.9413 -0.0670 -0.2913 -0.1352 158 ILE A O   
1083 C CB  . ILE A 160 ? 1.7240 1.4456 1.4336 -0.0237 -0.2140 -0.1403 158 ILE A CB  
1084 C CG1 . ILE A 160 ? 1.6784 1.4087 1.3556 -0.0084 -0.1911 -0.1344 158 ILE A CG1 
1085 C CG2 . ILE A 160 ? 1.7748 1.4583 1.4321 -0.0314 -0.2444 -0.1608 158 ILE A CG2 
1086 C CD1 . ILE A 160 ? 1.6594 1.3686 1.2883 -0.0013 -0.1677 -0.1472 158 ILE A CD1 
1087 N N   . GLY A 161 ? 2.0900 1.8362 1.9392 -0.0648 -0.2384 -0.1251 159 GLY A N   
1088 C CA  . GLY A 161 ? 2.2478 1.9680 2.1191 -0.0927 -0.2613 -0.1352 159 GLY A CA  
1089 C C   . GLY A 161 ? 2.3084 1.9609 2.1296 -0.0908 -0.2473 -0.1532 159 GLY A C   
1090 O O   . GLY A 161 ? 2.4806 2.0939 2.3138 -0.1131 -0.2577 -0.1614 159 GLY A O   
1091 N N   . GLU A 162 ? 2.1231 1.7612 1.8897 -0.0638 -0.2228 -0.1589 160 GLU A N   
1092 C CA  . GLU A 162 ? 2.0463 1.6341 1.7748 -0.0507 -0.2008 -0.1694 160 GLU A CA  
1093 C C   . GLU A 162 ? 1.9367 1.5292 1.7140 -0.0501 -0.1775 -0.1480 160 GLU A C   
1094 O O   . GLU A 162 ? 1.9502 1.5941 1.7768 -0.0490 -0.1659 -0.1243 160 GLU A O   
1095 C CB  . GLU A 162 ? 1.9797 1.5750 1.6583 -0.0218 -0.1773 -0.1743 160 GLU A CB  
1096 N N   . LYS A 163 ? 1.9011 1.4331 1.6572 -0.0477 -0.1685 -0.1557 161 LYS A N   
1097 C CA  . LYS A 163 ? 1.9268 1.4505 1.7158 -0.0427 -0.1438 -0.1329 161 LYS A CA  
1098 C C   . LYS A 163 ? 2.0017 1.4992 1.7481 -0.0057 -0.1163 -0.1333 161 LYS A C   
1099 O O   . LYS A 163 ? 2.3369 1.7637 2.0520 0.0005  -0.1112 -0.1434 161 LYS A O   
1100 C CB  . LYS A 163 ? 1.9263 1.3963 1.7401 -0.0760 -0.1567 -0.1342 161 LYS A CB  
1101 N N   . PRO A 164 ? 1.9191 1.4738 1.6649 0.0194  -0.0992 -0.1224 162 PRO A N   
1102 C CA  . PRO A 164 ? 1.9674 1.5161 1.6854 0.0559  -0.0757 -0.1193 162 PRO A CA  
1103 C C   . PRO A 164 ? 2.1055 1.6342 1.8426 0.0673  -0.0578 -0.0937 162 PRO A C   
1104 O O   . PRO A 164 ? 2.1644 1.7029 1.9409 0.0475  -0.0575 -0.0744 162 PRO A O   
1105 C CB  . PRO A 164 ? 1.7775 1.4014 1.4991 0.0686  -0.0689 -0.1148 162 PRO A CB  
1106 N N   . ASP A 165 ? 2.1933 1.6944 1.9014 0.1019  -0.0409 -0.0916 163 ASP A N   
1107 C CA  . ASP A 165 ? 2.3205 1.7856 2.0320 0.1198  -0.0229 -0.0663 163 ASP A CA  
1108 C C   . ASP A 165 ? 2.2601 1.7917 1.9812 0.1499  -0.0089 -0.0414 163 ASP A C   
1109 O O   . ASP A 165 ? 2.3006 1.8584 2.0030 0.1855  -0.0019 -0.0436 163 ASP A O   
1110 C CB  . ASP A 165 ? 2.3601 1.7425 2.0279 0.1457  -0.0131 -0.0773 163 ASP A CB  
1111 N N   . PRO A 166 ? 2.0566 1.6198 1.8066 0.1358  -0.0056 -0.0185 164 PRO A N   
1112 C CA  . PRO A 166 ? 2.0636 1.6890 1.8145 0.1590  0.0031  0.0021  164 PRO A CA  
1113 C C   . PRO A 166 ? 2.2800 1.8991 2.0045 0.2053  0.0143  0.0160  164 PRO A C   
1114 O O   . PRO A 166 ? 2.4759 2.1609 2.1952 0.2282  0.0112  0.0167  164 PRO A O   
1115 C CB  . PRO A 166 ? 2.0577 1.6756 1.8318 0.1409  0.0136  0.0286  164 PRO A CB  
1116 C CG  . PRO A 166 ? 2.0368 1.6335 1.8417 0.0991  0.0024  0.0154  164 PRO A CG  
1117 C CD  . PRO A 166 ? 2.0477 1.5905 1.8317 0.0961  -0.0098 -0.0114 164 PRO A CD  
1118 N N   . ASP A 167 ? 2.2758 1.8159 1.9844 0.2186  0.0260  0.0271  165 ASP A N   
1119 C CA  . ASP A 167 ? 2.3375 1.8632 2.0194 0.2695  0.0383  0.0454  165 ASP A CA  
1120 C C   . ASP A 167 ? 2.3092 1.8645 1.9798 0.2996  0.0344  0.0233  165 ASP A C   
1121 O O   . ASP A 167 ? 2.3813 1.9757 2.0443 0.3447  0.0386  0.0368  165 ASP A O   
1122 C CB  . ASP A 167 ? 2.5710 1.9868 2.2333 0.2752  0.0547  0.0624  165 ASP A CB  
1123 C CG  . ASP A 167 ? 2.6766 2.0699 2.3520 0.2525  0.0665  0.0939  165 ASP A CG  
1124 O OD1 . ASP A 167 ? 2.6164 2.0755 2.3165 0.2302  0.0616  0.0979  165 ASP A OD1 
1125 O OD2 . ASP A 167 ? 2.7913 2.0967 2.4499 0.2578  0.0840  0.1156  165 ASP A OD2 
1126 N N   . GLN A 168 ? 2.2233 1.7648 1.8933 0.2765  0.0267  -0.0089 166 GLN A N   
1127 C CA  . GLN A 168 ? 2.2511 1.8256 1.9111 0.3023  0.0283  -0.0296 166 GLN A CA  
1128 C C   . GLN A 168 ? 2.2135 1.8896 1.8972 0.2857  0.0169  -0.0418 166 GLN A C   
1129 O O   . GLN A 168 ? 2.3634 2.1029 2.0538 0.3119  0.0207  -0.0456 166 GLN A O   
1130 C CB  . GLN A 168 ? 2.2795 1.7710 1.9097 0.2916  0.0300  -0.0583 166 GLN A CB  
1131 N N   . THR A 169 ? 2.0315 1.7230 1.7305 0.2426  0.0044  -0.0463 167 THR A N   
1132 C CA  . THR A 169 ? 1.9721 1.7436 1.6874 0.2234  -0.0053 -0.0567 167 THR A CA  
1133 C C   . THR A 169 ? 2.0413 1.8939 1.7710 0.2399  -0.0077 -0.0414 167 THR A C   
1134 O O   . THR A 169 ? 2.0914 2.0116 1.8319 0.2424  -0.0106 -0.0513 167 THR A O   
1135 C CB  . THR A 169 ? 1.8140 1.5755 1.5398 0.1800  -0.0166 -0.0616 167 THR A CB  
1136 N N   . PHE A 170 ? 2.0527 1.8990 1.7804 0.2495  -0.0068 -0.0171 168 PHE A N   
1137 C CA  . PHE A 170 ? 1.8875 1.8056 1.6179 0.2668  -0.0135 -0.0035 168 PHE A CA  
1138 C C   . PHE A 170 ? 1.9262 1.8483 1.6481 0.3170  -0.0082 0.0183  168 PHE A C   
1139 O O   . PHE A 170 ? 1.9562 1.8378 1.6599 0.3342  -0.0017 0.0440  168 PHE A O   
1140 C CB  . PHE A 170 ? 1.7623 1.6775 1.4852 0.2478  -0.0159 0.0096  168 PHE A CB  
1141 N N   . LYS A 171 ? 1.9822 1.9561 1.7179 0.3430  -0.0090 0.0110  169 LYS A N   
1142 C CA  . LYS A 171 ? 2.0985 2.0959 1.8320 0.3976  -0.0068 0.0336  169 LYS A CA  
1143 C C   . LYS A 171 ? 2.2688 2.3703 2.0359 0.4176  -0.0136 0.0254  169 LYS A C   
1144 O O   . LYS A 171 ? 2.2160 2.3205 1.9967 0.4219  -0.0011 0.0085  169 LYS A O   
1145 C CB  . LYS A 171 ? 2.0364 1.9346 1.7471 0.4284  0.0136  0.0427  169 LYS A CB  
1146 N N   . PHE A 172 ? 2.2990 2.4879 2.0789 0.4286  -0.0333 0.0377  170 PHE A N   
1147 C CA  . PHE A 172 ? 2.1056 2.4144 1.9299 0.4396  -0.0452 0.0317  170 PHE A CA  
1148 C C   . PHE A 172 ? 2.1980 2.5229 2.0429 0.4958  -0.0279 0.0404  170 PHE A C   
1149 O O   . PHE A 172 ? 2.2051 2.4936 2.0301 0.5479  -0.0222 0.0658  170 PHE A O   
1150 C CB  . PHE A 172 ? 1.8565 2.2470 1.6829 0.4467  -0.0749 0.0462  170 PHE A CB  
1151 N N   . THR A 173 ? 2.2400 2.6178 2.1219 0.4889  -0.0167 0.0217  171 THR A N   
1152 C CA  . THR A 173 ? 2.3184 2.7001 2.2146 0.5442  0.0078  0.0271  171 THR A CA  
1153 C C   . THR A 173 ? 2.3139 2.8348 2.2772 0.5480  0.0083  0.0211  171 THR A C   
1154 O O   . THR A 173 ? 2.2705 2.7947 2.2474 0.5566  0.0358  0.0082  171 THR A O   
1155 C CB  . THR A 173 ? 2.2855 2.5477 2.1423 0.5379  0.0367  0.0082  171 THR A CB  
1166 N N   . ALA A 194 ? 2.5686 3.0206 4.1134 -0.0458 0.3144  0.2102  464 ALA A N   
1167 C CA  . ALA A 194 ? 2.1267 2.4991 3.5222 -0.0660 0.3076  0.1874  464 ALA A CA  
1168 C C   . ALA A 194 ? 1.9125 2.1778 3.1805 -0.0381 0.3661  0.1846  464 ALA A C   
1169 O O   . ALA A 194 ? 1.9053 2.1180 3.0456 -0.0350 0.3449  0.1736  464 ALA A O   
1170 C CB  . ALA A 194 ? 2.0227 2.4060 3.4520 -0.1180 0.3109  0.1637  464 ALA A CB  
1171 N N   . ALA A 195 ? 1.7453 1.9831 3.0472 -0.0196 0.4390  0.1930  465 ALA A N   
1172 C CA  . ALA A 195 ? 1.6761 1.8178 2.8551 0.0075  0.4927  0.1924  465 ALA A CA  
1173 C C   . ALA A 195 ? 1.5967 1.7121 2.6785 0.0368  0.4633  0.1954  465 ALA A C   
1174 O O   . ALA A 195 ? 1.6057 1.6640 2.5593 0.0389  0.4563  0.1830  465 ALA A O   
1175 C CB  . ALA A 195 ? 1.7686 1.8953 3.0067 0.0244  0.5726  0.2033  465 ALA A CB  
1176 N N   . GLU A 196 ? 1.4899 1.6436 2.6347 0.0604  0.4523  0.2118  466 GLU A N   
1177 C CA  . GLU A 196 ? 1.3918 1.5150 2.4531 0.0855  0.4313  0.2157  466 GLU A CA  
1178 C C   . GLU A 196 ? 1.4476 1.5455 2.3861 0.0681  0.3824  0.1986  466 GLU A C   
1179 O O   . GLU A 196 ? 1.3690 1.4110 2.1926 0.0798  0.3929  0.1887  466 GLU A O   
1180 C CB  . GLU A 196 ? 1.3262 1.5093 2.4852 0.1028  0.3958  0.2382  466 GLU A CB  
1181 N N   . GLY A 197 ? 1.6129 1.7578 2.5821 0.0376  0.3300  0.1926  467 GLY A N   
1182 C CA  . GLY A 197 ? 1.6453 1.7751 2.5152 0.0169  0.2855  0.1734  467 GLY A CA  
1183 C C   . GLY A 197 ? 1.7984 1.8670 2.5740 0.0136  0.3166  0.1528  467 GLY A C   
1184 O O   . GLY A 197 ? 1.9635 1.9976 2.6323 0.0205  0.3069  0.1400  467 GLY A O   
1185 N N   . LEU A 198 ? 1.7389 1.7945 2.5551 0.0035  0.3544  0.1506  468 LEU A N   
1186 C CA  . LEU A 198 ? 1.5807 1.5699 2.3075 0.0064  0.3859  0.1379  468 LEU A CA  
1187 C C   . LEU A 198 ? 1.6850 1.6208 2.3240 0.0408  0.4245  0.1429  468 LEU A C   
1188 O O   . LEU A 198 ? 1.8369 1.7319 2.3736 0.0511  0.4240  0.1316  468 LEU A O   
1189 C CB  . LEU A 198 ? 1.3804 1.3549 2.1687 -0.0118 0.4271  0.1395  468 LEU A CB  
1190 N N   . MET A 199 ? 1.6398 1.5791 2.3204 0.0586  0.4574  0.1580  469 MET A N   
1191 C CA  . MET A 199 ? 1.6189 1.5055 2.2149 0.0857  0.4986  0.1595  469 MET A CA  
1192 C C   . MET A 199 ? 1.5614 1.4452 2.0694 0.0940  0.4627  0.1474  469 MET A C   
1193 O O   . MET A 199 ? 1.5693 1.4133 1.9763 0.1077  0.4782  0.1384  469 MET A O   
1194 C CB  . MET A 199 ? 1.6223 1.5102 2.2889 0.1003  0.5484  0.1743  469 MET A CB  
1195 N N   . SER A 200 ? 1.5364 1.4644 2.0811 0.0831  0.4137  0.1473  470 SER A N   
1196 C CA  . SER A 200 ? 1.6495 1.5753 2.1156 0.0833  0.3803  0.1354  470 SER A CA  
1197 C C   . SER A 200 ? 1.6236 1.5375 1.9971 0.0766  0.3610  0.1133  470 SER A C   
1198 O O   . SER A 200 ? 1.6497 1.5452 1.9372 0.0847  0.3632  0.0997  470 SER A O   
1199 C CB  . SER A 200 ? 1.9406 1.9111 2.4599 0.0698  0.3303  0.1439  470 SER A CB  
1200 O OG  . SER A 200 ? 2.0911 2.0490 2.5358 0.0690  0.3096  0.1356  470 SER A OG  
1201 N N   . LEU A 201 ? 1.6675 1.5947 2.0635 0.0612  0.3427  0.1077  471 LEU A N   
1202 C CA  . LEU A 201 ? 1.6491 1.5636 1.9703 0.0601  0.3289  0.0872  471 LEU A CA  
1203 C C   . LEU A 201 ? 1.8464 1.7156 2.1041 0.0868  0.3700  0.0897  471 LEU A C   
1204 O O   . LEU A 201 ? 2.0796 1.9432 2.2562 0.0995  0.3637  0.0762  471 LEU A O   
1205 C CB  . LEU A 201 ? 1.4582 1.3803 1.8195 0.0391  0.3133  0.0804  471 LEU A CB  
1206 N N   . LEU A 202 ? 1.8411 1.6820 2.1377 0.0931  0.4117  0.1072  472 LEU A N   
1207 C CA  . LEU A 202 ? 1.6286 1.4176 1.8634 0.1165  0.4558  0.1160  472 LEU A CA  
1208 C C   . LEU A 202 ? 1.5609 1.3405 1.7238 0.1330  0.4675  0.1118  472 LEU A C   
1209 O O   . LEU A 202 ? 1.5380 1.2901 1.6130 0.1517  0.4783  0.1095  472 LEU A O   
1210 C CB  . LEU A 202 ? 1.4255 1.1885 1.7252 0.1131  0.5051  0.1361  472 LEU A CB  
1211 N N   . ARG A 203 ? 1.6316 1.4329 1.8299 0.1257  0.4639  0.1108  473 ARG A N   
1212 C CA  . ARG A 203 ? 1.6458 1.4326 1.7774 0.1343  0.4772  0.1015  473 ARG A CA  
1213 C C   . ARG A 203 ? 1.6664 1.4723 1.7142 0.1324  0.4404  0.0781  473 ARG A C   
1214 O O   . ARG A 203 ? 1.7482 1.5376 1.7118 0.1438  0.4521  0.0688  473 ARG A O   
1215 C CB  . ARG A 203 ? 1.6768 1.4759 1.8702 0.1275  0.4795  0.1061  473 ARG A CB  
1216 C CG  . ARG A 203 ? 1.8158 1.5967 2.0836 0.1366  0.5294  0.1249  473 ARG A CG  
1217 C CD  . ARG A 203 ? 1.9665 1.7506 2.2756 0.1391  0.5327  0.1279  473 ARG A CD  
1218 N NE  . ARG A 203 ? 2.0701 1.8899 2.5098 0.1402  0.5289  0.1491  473 ARG A NE  
1219 C CZ  . ARG A 203 ? 2.1936 2.0075 2.7117 0.1532  0.5782  0.1630  473 ARG A CZ  
1220 N NH1 . ARG A 203 ? 2.2733 2.0363 2.7401 0.1642  0.6390  0.1573  473 ARG A NH1 
1221 N NH2 . ARG A 203 ? 2.2156 2.0785 2.8633 0.1545  0.5670  0.1814  473 ARG A NH2 
1222 N N   . GLU A 204 ? 1.5915 1.4361 1.6614 0.1161  0.3963  0.0673  474 GLU A N   
1223 C CA  . GLU A 204 ? 1.6045 1.4758 1.6073 0.1104  0.3650  0.0419  474 GLU A CA  
1224 C C   . GLU A 204 ? 1.7055 1.5791 1.6626 0.1285  0.3586  0.0359  474 GLU A C   
1225 O O   . GLU A 204 ? 1.8204 1.7122 1.7110 0.1362  0.3475  0.0182  474 GLU A O   
1226 C CB  . GLU A 204 ? 1.5193 1.4263 1.5538 0.0862  0.3251  0.0327  474 GLU A CB  
1227 N N   . MET A 205 ? 1.5966 1.4516 1.5932 0.1357  0.3663  0.0512  475 MET A N   
1228 C CA  . MET A 205 ? 1.5434 1.3810 1.4997 0.1594  0.3686  0.0535  475 MET A CA  
1229 C C   . MET A 205 ? 1.5667 1.3675 1.4547 0.1850  0.3995  0.0669  475 MET A C   
1230 O O   . MET A 205 ? 1.7349 1.5419 1.5570 0.2080  0.3875  0.0621  475 MET A O   
1231 C CB  . MET A 205 ? 1.4789 1.2905 1.4935 0.1550  0.3773  0.0665  475 MET A CB  
1232 N N   . GLY A 206 ? 1.5879 1.3530 1.4917 0.1819  0.4392  0.0839  476 GLY A N   
1233 C CA  . GLY A 206 ? 1.6296 1.3534 1.4585 0.2009  0.4736  0.0956  476 GLY A CA  
1234 C C   . GLY A 206 ? 1.6564 1.4085 1.4068 0.2025  0.4553  0.0734  476 GLY A C   
1235 O O   . GLY A 206 ? 1.7377 1.4863 1.4056 0.2236  0.4493  0.0739  476 GLY A O   
1236 N N   . LYS A 207 ? 1.6215 1.4012 1.3981 0.1790  0.4458  0.0545  477 LYS A N   
1237 C CA  . LYS A 207 ? 1.6444 1.4538 1.3583 0.1688  0.4290  0.0267  477 LYS A CA  
1238 C C   . LYS A 207 ? 1.6794 1.5420 1.3546 0.1784  0.3852  0.0095  477 LYS A C   
1239 O O   . LYS A 207 ? 1.8008 1.6865 1.4035 0.1820  0.3747  -0.0072 477 LYS A O   
1240 C CB  . LYS A 207 ? 1.5888 1.4124 1.3485 0.1404  0.4234  0.0124  477 LYS A CB  
1241 N N   . GLY A 208 ? 1.7505 1.6357 1.4774 0.1821  0.3605  0.0115  478 GLY A N   
1242 C CA  . GLY A 208 ? 1.7761 1.7129 1.4831 0.1958  0.3238  -0.0049 478 GLY A CA  
1243 C C   . GLY A 208 ? 1.7318 1.6548 1.3922 0.2371  0.3224  0.0126  478 GLY A C   
1244 O O   . GLY A 208 ? 1.6405 1.6136 1.2604 0.2540  0.2946  -0.0019 478 GLY A O   
1245 N N   . TYR A 209 ? 1.8056 1.6626 1.4723 0.2539  0.3519  0.0446  479 TYR A N   
1246 C CA  . TYR A 209 ? 1.8485 1.6764 1.4613 0.2958  0.3535  0.0677  479 TYR A CA  
1247 C C   . TYR A 209 ? 2.2345 2.0538 1.7512 0.3108  0.3604  0.0752  479 TYR A C   
1248 O O   . TYR A 209 ? 2.5738 2.4101 2.0319 0.3456  0.3376  0.0827  479 TYR A O   
1249 C CB  . TYR A 209 ? 1.8332 1.5826 1.4748 0.3041  0.3890  0.0997  479 TYR A CB  
1250 C CG  . TYR A 209 ? 1.9760 1.6843 1.5626 0.3494  0.3898  0.1262  479 TYR A CG  
1251 C CD1 . TYR A 209 ? 2.1125 1.8506 1.7096 0.3766  0.3574  0.1184  479 TYR A CD1 
1252 C CD2 . TYR A 209 ? 1.9671 1.6029 1.4863 0.3674  0.4254  0.1603  479 TYR A CD2 
1253 C CE1 . TYR A 209 ? 2.2126 1.9070 1.7596 0.4252  0.3581  0.1468  479 TYR A CE1 
1254 C CE2 . TYR A 209 ? 1.9799 1.5681 1.4386 0.4120  0.4258  0.1905  479 TYR A CE2 
1255 C CZ  . TYR A 209 ? 2.0793 1.6964 1.5542 0.4433  0.3906  0.1851  479 TYR A CZ  
1256 O OH  . TYR A 209 ? 2.1119 1.6756 1.5279 0.4945  0.3909  0.2193  479 TYR A OH  
1257 N N   . LEU A 210 ? 2.2157 2.0087 1.7149 0.2859  0.3914  0.0729  480 LEU A N   
1258 C CA  . LEU A 210 ? 2.0855 1.8768 1.4871 0.2884  0.3969  0.0684  480 LEU A CA  
1259 C C   . LEU A 210 ? 2.0618 1.9429 1.4405 0.2815  0.3485  0.0324  480 LEU A C   
1260 O O   . LEU A 210 ? 2.1357 2.0462 1.4371 0.3016  0.3250  0.0310  480 LEU A O   
1261 C CB  . LEU A 210 ? 1.9581 1.7041 1.3569 0.2588  0.4443  0.0646  480 LEU A CB  
1262 C CG  . LEU A 210 ? 2.1113 1.8448 1.4042 0.2514  0.4592  0.0525  480 LEU A CG  
1263 C CD1 . LEU A 210 ? 2.4294 2.1503 1.6195 0.2863  0.4464  0.0747  480 LEU A CD1 
1264 C CD2 . LEU A 210 ? 2.2451 1.9088 1.5426 0.2330  0.5226  0.0586  480 LEU A CD2 
1265 N N   . ALA A 211 ? 1.9887 1.9154 1.4354 0.2514  0.3336  0.0039  481 ALA A N   
1266 C CA  . ALA A 211 ? 1.9769 1.9908 1.4174 0.2351  0.2942  -0.0347 481 ALA A CA  
1267 C C   . ALA A 211 ? 1.9192 1.9960 1.3587 0.2716  0.2522  -0.0350 481 ALA A C   
1268 O O   . ALA A 211 ? 1.9248 2.0849 1.3485 0.2661  0.2184  -0.0648 481 ALA A O   
1269 C CB  . ALA A 211 ? 2.0220 2.0567 1.5350 0.1972  0.2921  -0.0578 481 ALA A CB  
1270 N N   . LEU A 212 ? 1.9352 1.9742 1.4011 0.3070  0.2562  -0.0043 482 LEU A N   
1271 C CA  . LEU A 212 ? 1.9373 2.0204 1.4030 0.3519  0.2225  0.0014  482 LEU A CA  
1272 C C   . LEU A 212 ? 2.2818 2.3424 1.6569 0.3941  0.2171  0.0318  482 LEU A C   
1273 O O   . LEU A 212 ? 2.6182 2.7495 1.9652 0.4239  0.1772  0.0260  482 LEU A O   
1274 C CB  . LEU A 212 ? 1.7300 1.7725 1.2619 0.3694  0.2323  0.0177  482 LEU A CB  
1275 N N   . CYS A 213 ? 2.2194 2.1840 1.5491 0.3964  0.2576  0.0648  483 CYS A N   
1276 C CA  . CYS A 213 ? 2.2817 2.2036 1.5101 0.4338  0.2601  0.1001  483 CYS A CA  
1277 C C   . CYS A 213 ? 2.3580 2.3382 1.5005 0.4234  0.2348  0.0796  483 CYS A C   
1278 O O   . CYS A 213 ? 2.5242 2.5391 1.6014 0.4620  0.1991  0.0937  483 CYS A O   
1279 C CB  . CYS A 213 ? 2.3022 2.1067 1.5031 0.4280  0.3187  0.1349  483 CYS A CB  
1280 S SG  . CYS A 213 ? 3.4835 3.2089 2.5714 0.4845  0.3269  0.1920  483 CYS A SG  
1281 N N   . SER A 214 ? 2.2101 2.1962 1.3493 0.3715  0.2541  0.0474  484 SER A N   
1282 C CA  . SER A 214 ? 2.1699 2.2340 1.2558 0.3467  0.2244  0.0092  484 SER A CA  
1283 C C   . SER A 214 ? 2.0832 2.2508 1.2566 0.3328  0.1862  -0.0291 484 SER A C   
1284 O O   . SER A 214 ? 2.0921 2.2495 1.3478 0.3075  0.2034  -0.0419 484 SER A O   
1285 C CB  . SER A 214 ? 2.0941 2.1108 1.1409 0.2960  0.2672  -0.0127 484 SER A CB  
1286 O OG  . SER A 214 ? 2.0313 2.0038 1.1659 0.2694  0.3045  -0.0165 484 SER A OG  
1287 N N   . TYR A 215 ? 2.1613 2.4323 1.3172 0.3481  0.1346  -0.0476 485 TYR A N   
1288 C CA  . TYR A 215 ? 2.1204 2.4879 1.3672 0.3575  0.0989  -0.0704 485 TYR A CA  
1289 C C   . TYR A 215 ? 2.0407 2.4671 1.3444 0.2970  0.1001  -0.1232 485 TYR A C   
1290 O O   . TYR A 215 ? 2.0089 2.5483 1.3400 0.2864  0.0639  -0.1596 485 TYR A O   
1291 C CB  . TYR A 215 ? 2.2974 2.7642 1.5199 0.4034  0.0427  -0.0681 485 TYR A CB  
1292 C CG  . TYR A 215 ? 2.3388 2.7533 1.5480 0.4764  0.0375  -0.0128 485 TYR A CG  
1293 C CD1 . TYR A 215 ? 2.2642 2.5431 1.4352 0.4887  0.0832  0.0313  485 TYR A CD1 
1294 C CD2 . TYR A 215 ? 2.4251 2.9229 1.6668 0.5329  -0.0087 -0.0052 485 TYR A CD2 
1295 C CE1 . TYR A 215 ? 2.3185 2.5358 1.4726 0.5509  0.0845  0.0819  485 TYR A CE1 
1296 C CE2 . TYR A 215 ? 2.4579 2.8931 1.6842 0.6022  -0.0094 0.0477  485 TYR A CE2 
1297 C CZ  . TYR A 215 ? 2.3684 2.6579 1.5462 0.6088  0.0384  0.0913  485 TYR A CZ  
1298 O OH  . TYR A 215 ? 2.3895 2.6030 1.5459 0.6736  0.0436  0.1445  485 TYR A OH  
1299 N N   . ASN A 216 ? 1.9769 2.3254 1.2990 0.2580  0.1433  -0.1254 486 ASN A N   
1300 C CA  . ASN A 216 ? 1.9075 2.2848 1.2797 0.2029  0.1512  -0.1656 486 ASN A CA  
1301 C C   . ASN A 216 ? 1.9577 2.3531 1.4221 0.2120  0.1458  -0.1647 486 ASN A C   
1302 O O   . ASN A 216 ? 1.9192 2.2522 1.4237 0.1931  0.1730  -0.1559 486 ASN A O   
1303 C CB  . ASN A 216 ? 1.8829 2.1655 1.2349 0.1645  0.1984  -0.1634 486 ASN A CB  
1304 C CG  . ASN A 216 ? 2.1170 2.3598 1.3711 0.1592  0.2149  -0.1613 486 ASN A CG  
1305 O OD1 . ASN A 216 ? 2.3542 2.6601 1.5484 0.1612  0.1849  -0.1789 486 ASN A OD1 
1306 N ND2 . ASN A 216 ? 2.1609 2.3024 1.3989 0.1513  0.2630  -0.1415 486 ASN A ND2 
1307 N N   . CYS A 217 ? 2.1808 2.6640 1.6775 0.2424  0.1101  -0.1743 487 CYS A N   
1308 C CA  . CYS A 217 ? 2.1828 2.6791 1.7568 0.2623  0.1064  -0.1718 487 CYS A CA  
1309 C C   . CYS A 217 ? 1.9270 2.4343 1.5530 0.2092  0.1195  -0.2031 487 CYS A C   
1310 O O   . CYS A 217 ? 1.8837 2.3442 1.5533 0.2091  0.1344  -0.1918 487 CYS A O   
1311 C CB  . CYS A 217 ? 2.4003 3.0003 2.0003 0.3064  0.0673  -0.1819 487 CYS A CB  
1312 S SG  . CYS A 217 ? 3.0323 3.6185 2.5678 0.3804  0.0444  -0.1363 487 CYS A SG  
1313 N N   . LYS A 218 ? 1.7860 2.3518 1.4012 0.1614  0.1144  -0.2426 488 LYS A N   
1314 C CA  . LYS A 218 ? 1.6954 2.2602 1.3437 0.1074  0.1299  -0.2691 488 LYS A CA  
1315 C C   . LYS A 218 ? 1.7402 2.1920 1.3770 0.0862  0.1622  -0.2436 488 LYS A C   
1316 O O   . LYS A 218 ? 1.7699 2.1922 1.4437 0.0669  0.1725  -0.2415 488 LYS A O   
1317 C CB  . LYS A 218 ? 1.6692 2.3085 1.2994 0.0568  0.1232  -0.3159 488 LYS A CB  
1318 N N   . GLU A 219 ? 1.7412 2.1334 1.3270 0.0899  0.1782  -0.2247 489 GLU A N   
1319 C CA  . GLU A 219 ? 1.5885 1.8803 1.1745 0.0773  0.2109  -0.1988 489 GLU A CA  
1320 C C   . GLU A 219 ? 1.6209 1.8649 1.2534 0.1088  0.2160  -0.1631 489 GLU A C   
1321 O O   . GLU A 219 ? 1.5941 1.7994 1.2650 0.0896  0.2271  -0.1543 489 GLU A O   
1322 C CB  . GLU A 219 ? 1.6124 1.8519 1.1351 0.0798  0.2326  -0.1879 489 GLU A CB  
1323 N N   . ALA A 220 ? 1.7107 1.9590 1.3382 0.1557  0.2062  -0.1432 490 ALA A N   
1324 C CA  . ALA A 220 ? 1.7072 1.9003 1.3720 0.1833  0.2163  -0.1107 490 ALA A CA  
1325 C C   . ALA A 220 ? 1.7521 1.9640 1.4771 0.1700  0.2065  -0.1230 490 ALA A C   
1326 O O   . ALA A 220 ? 1.8745 2.0340 1.6353 0.1632  0.2193  -0.1050 490 ALA A O   
1327 C CB  . ALA A 220 ? 1.9539 2.1447 1.5926 0.2366  0.2080  -0.0887 490 ALA A CB  
1328 N N   . ILE A 221 ? 1.7246 2.0151 1.4607 0.1636  0.1847  -0.1560 491 ILE A N   
1329 C CA  . ILE A 221 ? 1.6684 1.9779 1.4500 0.1450  0.1794  -0.1738 491 ILE A CA  
1330 C C   . ILE A 221 ? 1.6692 1.9522 1.4542 0.0932  0.1889  -0.1792 491 ILE A C   
1331 O O   . ILE A 221 ? 1.6757 1.9269 1.4894 0.0781  0.1912  -0.1720 491 ILE A O   
1332 C CB  . ILE A 221 ? 1.7373 2.1429 1.5335 0.1487  0.1602  -0.2111 491 ILE A CB  
1333 C CG1 . ILE A 221 ? 1.9157 2.3494 1.7133 0.2092  0.1471  -0.2007 491 ILE A CG1 
1334 C CG2 . ILE A 221 ? 1.6721 2.0877 1.5067 0.1265  0.1621  -0.2312 491 ILE A CG2 
1335 C CD1 . ILE A 221 ? 1.9374 2.4847 1.7497 0.2193  0.1245  -0.2355 491 ILE A CD1 
1336 N N   . ASN A 222 ? 1.5545 1.8470 1.3058 0.0664  0.1937  -0.1912 492 ASN A N   
1337 C CA  . ASN A 222 ? 1.5469 1.8032 1.2943 0.0220  0.2052  -0.1921 492 ASN A CA  
1338 C C   . ASN A 222 ? 1.6704 1.8478 1.4393 0.0287  0.2193  -0.1537 492 ASN A C   
1339 O O   . ASN A 222 ? 1.7358 1.8886 1.5261 0.0047  0.2179  -0.1461 492 ASN A O   
1340 C CB  . ASN A 222 ? 1.4836 1.7492 1.1860 -0.0047 0.2145  -0.2116 492 ASN A CB  
1341 N N   . ILE A 223 ? 1.7894 1.9306 1.5527 0.0600  0.2329  -0.1292 493 ILE A N   
1342 C CA  . ILE A 223 ? 1.8462 1.9227 1.6417 0.0655  0.2505  -0.0952 493 ILE A CA  
1343 C C   . ILE A 223 ? 2.0544 2.1264 1.8988 0.0728  0.2392  -0.0839 493 ILE A C   
1344 O O   . ILE A 223 ? 2.1615 2.2129 2.0436 0.0542  0.2362  -0.0715 493 ILE A O   
1345 C CB  . ILE A 223 ? 1.8841 1.9193 1.6590 0.0939  0.2758  -0.0731 493 ILE A CB  
1346 C CG1 . ILE A 223 ? 2.1639 2.2116 1.8736 0.0894  0.2835  -0.0918 493 ILE A CG1 
1347 C CG2 . ILE A 223 ? 1.8262 1.8044 1.6392 0.0892  0.3010  -0.0459 493 ILE A CG2 
1348 C CD1 . ILE A 223 ? 2.3029 2.3458 1.9985 0.0504  0.2905  -0.1112 493 ILE A CD1 
1349 N N   . LEU A 224 ? 2.0754 2.1658 1.9173 0.1004  0.2320  -0.0884 494 LEU A N   
1350 C CA  . LEU A 224 ? 1.9324 2.0080 1.8139 0.1076  0.2272  -0.0817 494 LEU A CA  
1351 C C   . LEU A 224 ? 1.7578 1.8603 1.6577 0.0745  0.2084  -0.1033 494 LEU A C   
1352 O O   . LEU A 224 ? 1.7368 1.8157 1.6708 0.0602  0.2047  -0.0946 494 LEU A O   
1353 C CB  . LEU A 224 ? 1.9189 2.0023 1.7871 0.1482  0.2263  -0.0835 494 LEU A CB  
1354 N N   . SER A 225 ? 1.6941 1.8478 1.5688 0.0589  0.1973  -0.1332 495 SER A N   
1355 C CA  . SER A 225 ? 1.7434 1.9197 1.6223 0.0241  0.1844  -0.1553 495 SER A CA  
1356 C C   . SER A 225 ? 1.6863 1.8312 1.5696 -0.0110 0.1799  -0.1387 495 SER A C   
1357 O O   . SER A 225 ? 1.7647 1.9052 1.6565 -0.0356 0.1672  -0.1419 495 SER A O   
1358 C CB  . SER A 225 ? 1.9576 2.1980 1.8102 0.0112  0.1800  -0.1917 495 SER A CB  
1359 O OG  . SER A 225 ? 2.0381 2.3196 1.8957 0.0490  0.1788  -0.2056 495 SER A OG  
1360 N N   . HIS A 226 ? 1.5733 1.6944 1.4479 -0.0118 0.1903  -0.1207 496 HIS A N   
1361 C CA  . HIS A 226 ? 1.5300 1.6168 1.4167 -0.0342 0.1871  -0.0980 496 HIS A CA  
1362 C C   . HIS A 226 ? 1.6258 1.6848 1.5670 -0.0253 0.1824  -0.0688 496 HIS A C   
1363 O O   . HIS A 226 ? 1.7818 1.8257 1.7442 -0.0422 0.1704  -0.0494 496 HIS A O   
1364 C CB  . HIS A 226 ? 1.4877 1.5496 1.3543 -0.0330 0.2064  -0.0889 496 HIS A CB  
1365 N N   . LEU A 227 ? 1.6515 1.7044 1.6164 0.0009  0.1917  -0.0646 497 LEU A N   
1366 C CA  . LEU A 227 ? 1.6825 1.7131 1.7036 0.0035  0.1910  -0.0423 497 LEU A CA  
1367 C C   . LEU A 227 ? 1.7866 1.8311 1.8202 -0.0266 0.1634  -0.0527 497 LEU A C   
1368 O O   . LEU A 227 ? 1.8508 1.9164 1.8481 -0.0392 0.1536  -0.0810 497 LEU A O   
1369 C CB  . LEU A 227 ? 1.4838 1.4945 1.5150 0.0343  0.2120  -0.0380 497 LEU A CB  
1370 N N   . PRO A 228 ? 1.5529 1.5902 1.6383 -0.0399 0.1511  -0.0316 498 PRO A N   
1371 C CA  . PRO A 228 ? 1.5282 1.5808 1.6169 -0.0741 0.1194  -0.0409 498 PRO A CA  
1372 C C   . PRO A 228 ? 1.5770 1.6279 1.6519 -0.0797 0.1216  -0.0715 498 PRO A C   
1373 O O   . PRO A 228 ? 1.5632 1.5934 1.6561 -0.0555 0.1451  -0.0724 498 PRO A O   
1374 C CB  . PRO A 228 ? 1.5244 1.5782 1.6858 -0.0803 0.1076  -0.0111 498 PRO A CB  
1375 C CG  . PRO A 228 ? 1.5097 1.5441 1.7122 -0.0485 0.1422  0.0083  498 PRO A CG  
1376 C CD  . PRO A 228 ? 1.4997 1.5199 1.6459 -0.0241 0.1676  -0.0010 498 PRO A CD  
1377 N N   . SER A 229 ? 1.7252 1.7906 1.7632 -0.1108 0.1008  -0.0956 499 SER A N   
1378 C CA  . SER A 229 ? 1.8670 1.9291 1.8799 -0.1138 0.1099  -0.1323 499 SER A CA  
1379 C C   . SER A 229 ? 2.0908 2.1237 2.1420 -0.1111 0.1207  -0.1377 499 SER A C   
1380 O O   . SER A 229 ? 2.2824 2.2972 2.3215 -0.0920 0.1424  -0.1599 499 SER A O   
1381 C CB  . SER A 229 ? 1.8037 1.8825 1.7673 -0.1554 0.0881  -0.1570 499 SER A CB  
1382 O OG  . SER A 229 ? 1.7622 1.8429 1.7386 -0.1884 0.0557  -0.1390 499 SER A OG  
1383 N N   . HIS A 230 ? 2.1596 2.1874 2.2603 -0.1292 0.1076  -0.1175 500 HIS A N   
1384 C CA  . HIS A 230 ? 2.1908 2.1869 2.3337 -0.1316 0.1234  -0.1214 500 HIS A CA  
1385 C C   . HIS A 230 ? 2.1893 2.1514 2.3484 -0.0861 0.1621  -0.1051 500 HIS A C   
1386 O O   . HIS A 230 ? 2.3295 2.2494 2.4886 -0.0743 0.1870  -0.1170 500 HIS A O   
1387 C CB  . HIS A 230 ? 2.1987 2.2120 2.4004 -0.1658 0.0986  -0.1055 500 HIS A CB  
1388 C CG  . HIS A 230 ? 2.6584 2.6852 2.8373 -0.2152 0.0667  -0.1331 500 HIS A CG  
1389 N ND1 . HIS A 230 ? 2.8589 2.8811 2.9646 -0.2281 0.0638  -0.1673 500 HIS A ND1 
1390 C CD2 . HIS A 230 ? 2.7803 2.8269 2.9972 -0.2572 0.0377  -0.1346 500 HIS A CD2 
1391 C CE1 . HIS A 230 ? 2.8518 2.8826 2.9410 -0.2767 0.0359  -0.1885 500 HIS A CE1 
1392 N NE2 . HIS A 230 ? 2.8244 2.8725 2.9796 -0.2958 0.0162  -0.1691 500 HIS A NE2 
1393 N N   . HIS A 231 ? 2.0746 2.0479 2.2398 -0.0610 0.1688  -0.0775 501 HIS A N   
1394 C CA  . HIS A 231 ? 1.7679 1.7089 1.9342 -0.0197 0.2039  -0.0597 501 HIS A CA  
1395 C C   . HIS A 231 ? 1.6568 1.6056 1.7635 0.0116  0.2099  -0.0732 501 HIS A C   
1396 O O   . HIS A 231 ? 1.6114 1.5407 1.7013 0.0486  0.2322  -0.0596 501 HIS A O   
1397 C CB  . HIS A 231 ? 1.5661 1.5121 1.7680 -0.0103 0.2136  -0.0261 501 HIS A CB  
1398 C CG  . HIS A 231 ? 1.5104 1.4592 1.7887 -0.0345 0.2122  -0.0102 501 HIS A CG  
1399 N ND1 . HIS A 231 ? 1.5144 1.4262 1.8317 -0.0298 0.2449  0.0004  501 HIS A ND1 
1400 C CD2 . HIS A 231 ? 1.5013 1.4898 1.8279 -0.0635 0.1818  -0.0023 501 HIS A CD2 
1401 C CE1 . HIS A 231 ? 1.5115 1.4479 1.9061 -0.0582 0.2358  0.0102  501 HIS A CE1 
1402 N NE2 . HIS A 231 ? 1.4955 1.4820 1.8987 -0.0763 0.1945  0.0099  501 HIS A NE2 
1403 N N   . TYR A 232 ? 1.6530 1.6351 1.7271 -0.0052 0.1891  -0.1004 502 TYR A N   
1404 C CA  . TYR A 232 ? 1.6208 1.6236 1.6514 0.0207  0.1942  -0.1201 502 TYR A CA  
1405 C C   . TYR A 232 ? 1.6333 1.6119 1.6591 0.0379  0.2079  -0.1426 502 TYR A C   
1406 O O   . TYR A 232 ? 1.6317 1.6076 1.6417 0.0803  0.2217  -0.1433 502 TYR A O   
1407 C CB  . TYR A 232 ? 1.5403 1.5903 1.5401 -0.0069 0.1734  -0.1408 502 TYR A CB  
1408 C CG  . TYR A 232 ? 1.5658 1.6525 1.5331 0.0138  0.1789  -0.1667 502 TYR A CG  
1409 C CD1 . TYR A 232 ? 1.4936 1.6013 1.4459 0.0415  0.1849  -0.1577 502 TYR A CD1 
1410 C CD2 . TYR A 232 ? 1.7891 1.8941 1.7435 0.0046  0.1790  -0.2029 502 TYR A CD2 
1411 C CE1 . TYR A 232 ? 1.4669 1.6232 1.3994 0.0591  0.1856  -0.1831 502 TYR A CE1 
1412 C CE2 . TYR A 232 ? 1.8055 1.9567 1.7451 0.0253  0.1850  -0.2281 502 TYR A CE2 
1413 C CZ  . TYR A 232 ? 1.6284 1.8103 1.5609 0.0525  0.1856  -0.2175 502 TYR A CZ  
1414 O OH  . TYR A 232 ? 1.6125 1.8551 1.5397 0.0716  0.1872  -0.2443 502 TYR A OH  
1415 N N   . ASN A 233 ? 1.5937 1.5529 1.6321 0.0055  0.2035  -0.1606 503 ASN A N   
1416 C CA  . ASN A 233 ? 1.6540 1.5829 1.6845 0.0158  0.2201  -0.1892 503 ASN A CA  
1417 C C   . ASN A 233 ? 1.6907 1.5504 1.7390 0.0466  0.2496  -0.1733 503 ASN A C   
1418 O O   . ASN A 233 ? 1.7585 1.5860 1.7959 0.0741  0.2691  -0.1905 503 ASN A O   
1419 C CB  . ASN A 233 ? 1.8808 1.8080 1.9068 -0.0371 0.2069  -0.2197 503 ASN A CB  
1420 C CG  . ASN A 233 ? 1.7830 1.7653 1.7726 -0.0634 0.1866  -0.2428 503 ASN A CG  
1421 O OD1 . ASN A 233 ? 1.6392 1.6447 1.6059 -0.0465 0.1973  -0.2698 503 ASN A OD1 
1422 N ND2 . ASN A 233 ? 1.7552 1.7586 1.7409 -0.1051 0.1584  -0.2317 503 ASN A ND2 
1423 N N   . THR A 234 ? 1.6539 1.4866 1.7304 0.0418  0.2564  -0.1405 504 THR A N   
1424 C CA  . THR A 234 ? 1.8084 1.5734 1.8913 0.0752  0.2894  -0.1157 504 THR A CA  
1425 C C   . THR A 234 ? 1.9914 1.7463 2.0370 0.1370  0.3024  -0.1084 504 THR A C   
1426 O O   . THR A 234 ? 1.9365 1.7494 1.9598 0.1574  0.2858  -0.1087 504 THR A O   
1427 C CB  . THR A 234 ? 1.8009 1.5594 1.9113 0.0706  0.2973  -0.0782 504 THR A CB  
1428 O OG1 . THR A 234 ? 1.9218 1.6077 2.0262 0.1017  0.3343  -0.0533 504 THR A OG1 
1429 C CG2 . THR A 234 ? 1.7628 1.5755 1.8534 0.0872  0.2820  -0.0639 504 THR A CG2 
1430 N N   . GLY A 235 ? 1.7657 1.6408 1.4482 0.0238  0.0214  -0.0196 505 GLY A N   
1431 C CA  . GLY A 235 ? 1.7735 1.6525 1.4697 0.0303  0.0255  -0.0382 505 GLY A CA  
1432 C C   . GLY A 235 ? 1.7676 1.6410 1.4726 0.0420  0.0296  -0.0294 505 GLY A C   
1433 O O   . GLY A 235 ? 1.8683 1.7426 1.5796 0.0443  0.0329  -0.0433 505 GLY A O   
1434 N N   . TRP A 236 ? 1.6597 1.5287 1.3627 0.0524  0.0290  -0.0057 506 TRP A N   
1435 C CA  . TRP A 236 ? 1.6553 1.5180 1.3527 0.0724  0.0331  -0.0009 506 TRP A CA  
1436 C C   . TRP A 236 ? 1.6396 1.4799 1.3157 0.0694  0.0349  -0.0147 506 TRP A C   
1437 O O   . TRP A 236 ? 1.6620 1.4923 1.3353 0.0756  0.0312  -0.0286 506 TRP A O   
1438 C CB  . TRP A 236 ? 1.6582 1.5272 1.3542 0.0922  0.0357  0.0300  506 TRP A CB  
1439 C CG  . TRP A 236 ? 1.6483 1.5123 1.3256 0.1227  0.0408  0.0315  506 TRP A CG  
1440 C CD1 . TRP A 236 ? 1.6156 1.5001 1.3027 0.1425  0.0415  0.0382  506 TRP A CD1 
1441 C CD2 . TRP A 236 ? 1.6450 1.4793 1.2865 0.1400  0.0424  0.0243  506 TRP A CD2 
1442 N NE1 . TRP A 236 ? 1.5643 1.4355 1.2152 0.1744  0.0454  0.0337  506 TRP A NE1 
1443 C CE2 . TRP A 236 ? 1.5952 1.4300 1.2166 0.1743  0.0437  0.0223  506 TRP A CE2 
1444 C CE3 . TRP A 236 ? 1.8223 1.6282 1.4475 0.1311  0.0395  0.0200  506 TRP A CE3 
1445 C CZ2 . TRP A 236 ? 1.6446 1.4445 1.2224 0.2035  0.0397  0.0098  506 TRP A CZ2 
1446 C CZ3 . TRP A 236 ? 1.8033 1.5740 1.3958 0.1561  0.0338  0.0108  506 TRP A CZ3 
1447 C CH2 . TRP A 236 ? 1.6858 1.4496 1.2510 0.1937  0.0327  0.0026  506 TRP A CH2 
1448 N N   . VAL A 237 ? 1.5562 1.3880 1.2217 0.0581  0.0360  -0.0075 507 VAL A N   
1449 C CA  . VAL A 237 ? 1.5442 1.3533 1.2004 0.0521  0.0306  -0.0127 507 VAL A CA  
1450 C C   . VAL A 237 ? 1.6311 1.4492 1.3029 0.0362  0.0284  -0.0274 507 VAL A C   
1451 O O   . VAL A 237 ? 1.7129 1.5110 1.3857 0.0395  0.0173  -0.0361 507 VAL A O   
1452 C CB  . VAL A 237 ? 1.5176 1.3253 1.1707 0.0382  0.0313  0.0038  507 VAL A CB  
1453 C CG1 . VAL A 237 ? 1.5692 1.3601 1.2288 0.0247  0.0205  0.0038  507 VAL A CG1 
1454 C CG2 . VAL A 237 ? 1.5042 1.2995 1.1453 0.0575  0.0326  0.0213  507 VAL A CG2 
1455 N N   . LEU A 238 ? 1.6952 1.5432 1.3773 0.0214  0.0372  -0.0290 508 LEU A N   
1456 C CA  . LEU A 238 ? 1.7954 1.6642 1.4955 0.0104  0.0405  -0.0371 508 LEU A CA  
1457 C C   . LEU A 238 ? 2.0729 1.9368 1.7862 0.0190  0.0359  -0.0515 508 LEU A C   
1458 O O   . LEU A 238 ? 2.2450 2.1126 1.9767 0.0111  0.0313  -0.0522 508 LEU A O   
1459 C CB  . LEU A 238 ? 1.7110 1.6134 1.4086 0.0062  0.0526  -0.0419 508 LEU A CB  
1460 C CG  . LEU A 238 ? 1.6953 1.6098 1.3746 -0.0015 0.0569  -0.0289 508 LEU A CG  
1461 C CD1 . LEU A 238 ? 1.6848 1.6320 1.3522 0.0012  0.0667  -0.0403 508 LEU A CD1 
1462 C CD2 . LEU A 238 ? 1.8584 1.7756 1.5466 -0.0155 0.0553  -0.0063 508 LEU A CD2 
1463 N N   . CYS A 239 ? 1.9356 1.7957 1.6455 0.0339  0.0352  -0.0571 509 CYS A N   
1464 C CA  . CYS A 239 ? 1.7279 1.5857 1.4495 0.0441  0.0298  -0.0661 509 CYS A CA  
1465 C C   . CYS A 239 ? 1.7583 1.5866 1.4667 0.0518  0.0165  -0.0675 509 CYS A C   
1466 O O   . CYS A 239 ? 1.8470 1.6727 1.5680 0.0493  0.0081  -0.0752 509 CYS A O   
1467 C CB  . CYS A 239 ? 1.7255 1.5915 1.4514 0.0586  0.0296  -0.0604 509 CYS A CB  
1468 S SG  . CYS A 239 ? 3.0946 2.9837 2.8528 0.0538  0.0289  -0.0714 509 CYS A SG  
1469 N N   . GLN A 240 ? 1.6477 1.4505 1.3291 0.0630  0.0116  -0.0609 510 GLN A N   
1470 C CA  . GLN A 240 ? 1.6754 1.4377 1.3331 0.0765  -0.0074 -0.0679 510 GLN A CA  
1471 C C   . GLN A 240 ? 1.6973 1.4429 1.3732 0.0527  -0.0246 -0.0685 510 GLN A C   
1472 O O   . GLN A 240 ? 1.8545 1.5747 1.5307 0.0530  -0.0467 -0.0773 510 GLN A O   
1473 C CB  . GLN A 240 ? 1.6824 1.4202 1.3068 0.0990  -0.0082 -0.0614 510 GLN A CB  
1474 C CG  . GLN A 240 ? 1.6713 1.4360 1.2881 0.1218  0.0095  -0.0473 510 GLN A CG  
1475 C CD  . GLN A 240 ? 1.8693 1.6606 1.4953 0.1348  0.0136  -0.0477 510 GLN A CD  
1476 O OE1 . GLN A 240 ? 2.1234 1.9506 1.7764 0.1303  0.0240  -0.0332 510 GLN A OE1 
1477 N NE2 . GLN A 240 ? 1.8495 1.6214 1.4548 0.1508  0.0007  -0.0624 510 GLN A NE2 
1478 N N   . ILE A 241 ? 1.5935 1.3574 1.2877 0.0316  -0.0166 -0.0545 511 ILE A N   
1479 C CA  . ILE A 241 ? 1.5799 1.3466 1.3054 0.0063  -0.0296 -0.0415 511 ILE A CA  
1480 C C   . ILE A 241 ? 1.5762 1.3719 1.3341 -0.0045 -0.0273 -0.0427 511 ILE A C   
1481 O O   . ILE A 241 ? 1.6720 1.4573 1.4571 -0.0189 -0.0493 -0.0335 511 ILE A O   
1482 C CB  . ILE A 241 ? 1.5426 1.3414 1.2808 -0.0105 -0.0147 -0.0208 511 ILE A CB  
1483 C CG1 . ILE A 241 ? 1.6325 1.3981 1.3486 -0.0039 -0.0233 -0.0144 511 ILE A CG1 
1484 C CG2 . ILE A 241 ? 1.5236 1.3496 1.3056 -0.0358 -0.0216 0.0030  511 ILE A CG2 
1485 C CD1 . ILE A 241 ? 1.7188 1.5182 1.4395 -0.0169 -0.0064 0.0053  511 ILE A CD1 
1486 N N   . GLY A 242 ? 1.5954 1.4255 1.3553 0.0023  -0.0042 -0.0517 512 GLY A N   
1487 C CA  . GLY A 242 ? 1.5666 1.4232 1.3567 -0.0023 -0.0003 -0.0549 512 GLY A CA  
1488 C C   . GLY A 242 ? 1.5636 1.3883 1.3530 0.0032  -0.0239 -0.0639 512 GLY A C   
1489 O O   . GLY A 242 ? 1.5645 1.3954 1.3866 -0.0103 -0.0366 -0.0558 512 GLY A O   
1490 N N   . ARG A 243 ? 1.7032 1.4982 1.4552 0.0249  -0.0301 -0.0772 513 ARG A N   
1491 C CA  . ARG A 243 ? 1.7384 1.5001 1.4739 0.0372  -0.0545 -0.0880 513 ARG A CA  
1492 C C   . ARG A 243 ? 1.7704 1.4857 1.5043 0.0264  -0.0900 -0.0854 513 ARG A C   
1493 O O   . ARG A 243 ? 2.0309 1.7264 1.7757 0.0202  -0.1170 -0.0879 513 ARG A O   
1494 C CB  . ARG A 243 ? 1.5775 1.3250 1.2669 0.0699  -0.0506 -0.0972 513 ARG A CB  
1495 N N   . ALA A 244 ? 1.5988 1.2952 1.3237 0.0225  -0.0943 -0.0780 514 ALA A N   
1496 C CA  . ALA A 244 ? 1.6179 1.2671 1.3515 0.0092  -0.1340 -0.0710 514 ALA A CA  
1497 C C   . ALA A 244 ? 1.7071 1.3813 1.5053 -0.0253 -0.1477 -0.0456 514 ALA A C   
1498 O O   . ALA A 244 ? 1.6708 1.3090 1.4817 -0.0333 -0.1875 -0.0456 514 ALA A O   
1499 C CB  . ALA A 244 ? 1.6180 1.2539 1.3420 0.0086  -0.1318 -0.0617 514 ALA A CB  
1500 N N   . TYR A 245 ? 1.8935 1.6306 1.7317 -0.0433 -0.1171 -0.0214 515 TYR A N   
1501 C CA  . TYR A 245 ? 1.8553 1.6347 1.7597 -0.0706 -0.1219 0.0113  515 TYR A CA  
1502 C C   . TYR A 245 ? 1.8473 1.6350 1.7706 -0.0708 -0.1278 0.0050  515 TYR A C   
1503 O O   . TYR A 245 ? 1.8322 1.6271 1.8077 -0.0922 -0.1527 0.0309  515 TYR A O   
1504 C CB  . TYR A 245 ? 1.8219 1.6781 1.7504 -0.0766 -0.0784 0.0327  515 TYR A CB  
1505 C CG  . TYR A 245 ? 1.8069 1.6731 1.7448 -0.0889 -0.0791 0.0587  515 TYR A CG  
1506 C CD1 . TYR A 245 ? 1.9212 1.7845 1.9122 -0.1146 -0.1125 0.0979  515 TYR A CD1 
1507 C CD2 . TYR A 245 ? 1.8249 1.7055 1.7255 -0.0771 -0.0502 0.0492  515 TYR A CD2 
1508 C CE1 . TYR A 245 ? 2.1072 1.9846 2.1145 -0.1274 -0.1148 0.1273  515 TYR A CE1 
1509 C CE2 . TYR A 245 ? 1.9734 1.8668 1.8843 -0.0893 -0.0511 0.0758  515 TYR A CE2 
1510 C CZ  . TYR A 245 ? 2.1523 2.0459 2.1170 -0.1140 -0.0821 0.1152  515 TYR A CZ  
1511 O OH  . TYR A 245 ? 2.2995 2.2105 2.2817 -0.1276 -0.0846 0.1469  515 TYR A OH  
1512 N N   . PHE A 246 ? 1.7254 1.5156 1.6131 -0.0483 -0.1068 -0.0240 516 PHE A N   
1513 C CA  . PHE A 246 ? 1.7203 1.5203 1.6247 -0.0466 -0.1107 -0.0305 516 PHE A CA  
1514 C C   . PHE A 246 ? 1.7606 1.4994 1.6521 -0.0479 -0.1605 -0.0385 516 PHE A C   
1515 O O   . PHE A 246 ? 1.7492 1.4952 1.6805 -0.0628 -0.1797 -0.0255 516 PHE A O   
1516 C CB  . PHE A 246 ? 1.7133 1.5304 1.5881 -0.0229 -0.0812 -0.0547 516 PHE A CB  
1517 C CG  . PHE A 246 ? 1.6916 1.5139 1.5812 -0.0198 -0.0893 -0.0608 516 PHE A CG  
1518 C CD1 . PHE A 246 ? 1.8918 1.6792 1.7385 -0.0001 -0.1060 -0.0799 516 PHE A CD1 
1519 C CD2 . PHE A 246 ? 1.6617 1.5282 1.6091 -0.0343 -0.0804 -0.0439 516 PHE A CD2 
1520 C CE1 . PHE A 246 ? 2.1024 1.8986 1.9640 0.0016  -0.1150 -0.0820 516 PHE A CE1 
1521 C CE2 . PHE A 246 ? 1.7910 1.6629 1.7573 -0.0333 -0.0896 -0.0467 516 PHE A CE2 
1522 C CZ  . PHE A 246 ? 1.9972 1.8333 1.9209 -0.0173 -0.1082 -0.0656 516 PHE A CZ  
1523 N N   . GLU A 247 ? 1.8549 1.5326 1.6877 -0.0290 -0.1828 -0.0604 517 GLU A N   
1524 C CA  . GLU A 247 ? 2.0405 1.6495 1.8407 -0.0201 -0.2337 -0.0774 517 GLU A CA  
1525 C C   . GLU A 247 ? 2.1521 1.7277 1.9997 -0.0514 -0.2845 -0.0533 517 GLU A C   
1526 O O   . GLU A 247 ? 2.3037 1.8449 2.1619 -0.0604 -0.3288 -0.0531 517 GLU A O   
1527 C CB  . GLU A 247 ? 1.9535 1.5083 1.6733 0.0170  -0.2415 -0.1077 517 GLU A CB  
1528 C CG  . GLU A 247 ? 1.9437 1.5276 1.6184 0.0512  -0.2036 -0.1250 517 GLU A CG  
1529 C CD  . GLU A 247 ? 1.9213 1.5202 1.5960 0.0574  -0.2085 -0.1309 517 GLU A CD  
1530 O OE1 . GLU A 247 ? 2.0329 1.5857 1.6957 0.0555  -0.2539 -0.1393 517 GLU A OE1 
1531 O OE2 . GLU A 247 ? 1.8526 1.5067 1.5399 0.0641  -0.1713 -0.1265 517 GLU A OE2 
1532 N N   . LEU A 248 ? 1.9226 1.5103 1.8030 -0.0692 -0.2812 -0.0288 518 LEU A N   
1533 C CA  . LEU A 248 ? 1.8569 1.4382 1.8083 -0.1056 -0.3229 0.0114  518 LEU A CA  
1534 C C   . LEU A 248 ? 1.9203 1.5682 1.9488 -0.1317 -0.3132 0.0483  518 LEU A C   
1535 O O   . LEU A 248 ? 1.8868 1.5226 1.9767 -0.1606 -0.3601 0.0826  518 LEU A O   
1536 C CB  . LEU A 248 ? 1.7787 1.3835 1.7568 -0.1186 -0.3093 0.0386  518 LEU A CB  
1537 C CG  . LEU A 248 ? 1.7981 1.3336 1.7136 -0.0963 -0.3263 0.0099  518 LEU A CG  
1538 C CD1 . LEU A 248 ? 1.8918 1.4696 1.8311 -0.1070 -0.2974 0.0366  518 LEU A CD1 
1539 C CD2 . LEU A 248 ? 1.7852 1.2235 1.6973 -0.1009 -0.4059 0.0028  518 LEU A CD2 
1540 N N   . SER A 249 ? 1.9551 1.6737 1.9851 -0.1206 -0.2542 0.0444  519 SER A N   
1541 C CA  . SER A 249 ? 1.8695 1.6583 1.9642 -0.1344 -0.2331 0.0729  519 SER A CA  
1542 C C   . SER A 249 ? 1.8647 1.7280 2.0271 -0.1534 -0.2093 0.1235  519 SER A C   
1543 O O   . SER A 249 ? 1.8326 1.7536 2.0679 -0.1702 -0.2058 0.1655  519 SER A O   
1544 C CB  . SER A 249 ? 1.8305 1.5866 1.9587 -0.1519 -0.2854 0.0846  519 SER A CB  
1545 O OG  . SER A 249 ? 1.8363 1.5855 2.0334 -0.1850 -0.3311 0.1323  519 SER A OG  
1546 N N   . GLU A 250 ? 1.8968 1.7636 2.0349 -0.1483 -0.1919 0.1227  520 GLU A N   
1547 C CA  . GLU A 250 ? 1.8131 1.7641 1.9929 -0.1544 -0.1528 0.1623  520 GLU A CA  
1548 C C   . GLU A 250 ? 1.7484 1.7522 1.8950 -0.1269 -0.0920 0.1359  520 GLU A C   
1549 O O   . GLU A 250 ? 1.7188 1.7176 1.8114 -0.1095 -0.0662 0.1091  520 GLU A O   
1550 C CB  . GLU A 250 ? 1.7717 1.7041 1.9378 -0.1606 -0.1618 0.1726  520 GLU A CB  
1551 N N   . TYR A 251 ? 1.8656 1.9164 2.0480 -0.1230 -0.0741 0.1446  521 TYR A N   
1552 C CA  . TYR A 251 ? 1.8676 1.9517 2.0207 -0.0950 -0.0284 0.1129  521 TYR A CA  
1553 C C   . TYR A 251 ? 1.8669 2.0130 2.0067 -0.0782 0.0172  0.1190  521 TYR A C   
1554 O O   . TYR A 251 ? 2.0381 2.1763 2.1245 -0.0555 0.0415  0.0802  521 TYR A O   
1555 C CB  . TYR A 251 ? 1.9605 2.0826 2.1644 -0.0941 -0.0223 0.1256  521 TYR A CB  
1556 C CG  . TYR A 251 ? 2.1131 2.1803 2.3277 -0.1083 -0.0660 0.1182  521 TYR A CG  
1557 C CD1 . TYR A 251 ? 2.1953 2.1849 2.3482 -0.1027 -0.0922 0.0777  521 TYR A CD1 
1558 C CD2 . TYR A 251 ? 2.1225 2.2208 2.4076 -0.1237 -0.0801 0.1539  521 TYR A CD2 
1559 C CE1 . TYR A 251 ? 2.1988 2.1407 2.3513 -0.1104 -0.1325 0.0693  521 TYR A CE1 
1560 C CE2 . TYR A 251 ? 2.1021 2.1490 2.3930 -0.1367 -0.1237 0.1468  521 TYR A CE2 
1561 C CZ  . TYR A 251 ? 2.0968 2.0645 2.3169 -0.1288 -0.1501 0.1023  521 TYR A CZ  
1562 O OH  . TYR A 251 ? 2.0510 1.9692 2.2666 -0.1368 -0.1941 0.0934  521 TYR A OH  
1563 N N   . MET A 252 ? 1.8265 2.0360 2.0160 -0.0887 0.0255  0.1709  522 MET A N   
1564 C CA  . MET A 252 ? 1.8268 2.1042 1.9996 -0.0687 0.0690  0.1809  522 MET A CA  
1565 C C   . MET A 252 ? 1.9384 2.1838 2.0587 -0.0705 0.0665  0.1667  522 MET A C   
1566 O O   . MET A 252 ? 2.0168 2.2839 2.0886 -0.0475 0.0979  0.1449  522 MET A O   
1567 C CB  . MET A 252 ? 1.7147 2.0851 1.9625 -0.0766 0.0811  0.2513  522 MET A CB  
1568 N N   . GLN A 253 ? 1.8781 2.0684 2.0073 -0.0963 0.0259  0.1782  523 GLN A N   
1569 C CA  . GLN A 253 ? 1.7432 1.8959 1.8252 -0.0974 0.0209  0.1638  523 GLN A CA  
1570 C C   . GLN A 253 ? 1.7299 1.8246 1.7403 -0.0768 0.0273  0.1035  523 GLN A C   
1571 O O   . GLN A 253 ? 1.6525 1.7391 1.6168 -0.0671 0.0410  0.0868  523 GLN A O   
1572 C CB  . GLN A 253 ? 1.6340 1.7337 1.7448 -0.1257 -0.0290 0.1878  523 GLN A CB  
1573 N N   . ALA A 254 ? 1.7747 1.8339 1.7816 -0.0714 0.0154  0.0770  524 ALA A N   
1574 C CA  . ALA A 254 ? 1.7900 1.8101 1.7440 -0.0512 0.0225  0.0299  524 ALA A CA  
1575 C C   . ALA A 254 ? 1.7677 1.8289 1.7022 -0.0288 0.0589  0.0106  524 ALA A C   
1576 O O   . ALA A 254 ? 1.7594 1.8039 1.6498 -0.0169 0.0675  -0.0122 524 ALA A O   
1577 C CB  . ALA A 254 ? 1.8347 1.8169 1.7967 -0.0513 -0.0006 0.0143  524 ALA A CB  
1578 N N   . GLU A 255 ? 1.7085 1.8204 1.6767 -0.0214 0.0766  0.0198  525 GLU A N   
1579 C CA  . GLU A 255 ? 1.7058 1.8485 1.6523 0.0057  0.1057  -0.0043 525 GLU A CA  
1580 C C   . GLU A 255 ? 1.6878 1.8579 1.5960 0.0174  0.1259  -0.0038 525 GLU A C   
1581 O O   . GLU A 255 ? 1.8399 2.0083 1.7099 0.0405  0.1380  -0.0350 525 GLU A O   
1582 C CB  . GLU A 255 ? 1.5514 1.7495 1.5435 0.0163  0.1229  0.0103  525 GLU A CB  
1583 N N   . ARG A 256 ? 1.7322 1.9249 1.6518 0.0011  0.1246  0.0325  526 ARG A N   
1584 C CA  . ARG A 256 ? 1.9177 2.1369 1.7995 0.0093  0.1409  0.0373  526 ARG A CA  
1585 C C   . ARG A 256 ? 1.8961 2.0577 1.7233 0.0116  0.1301  0.0039  526 ARG A C   
1586 O O   . ARG A 256 ? 1.8562 2.0269 1.6397 0.0308  0.1427  -0.0167 526 ARG A O   
1587 C CB  . ARG A 256 ? 1.9731 2.2264 1.8902 -0.0140 0.1356  0.0903  526 ARG A CB  
1588 N N   . ILE A 257 ? 1.7793 1.8824 1.6081 -0.0053 0.1049  -0.0001 527 ILE A N   
1589 C CA  . ILE A 257 ? 1.7589 1.8165 1.5454 -0.0028 0.0959  -0.0209 527 ILE A CA  
1590 C C   . ILE A 257 ? 1.7051 1.7281 1.4776 0.0114  0.0896  -0.0553 527 ILE A C   
1591 O O   . ILE A 257 ? 1.7035 1.6965 1.4489 0.0152  0.0820  -0.0674 527 ILE A O   
1592 C CB  . ILE A 257 ? 1.7254 1.7437 1.5154 -0.0210 0.0748  -0.0038 527 ILE A CB  
1593 C CG1 . ILE A 257 ? 1.6413 1.6368 1.4670 -0.0326 0.0537  0.0061  527 ILE A CG1 
1594 C CG2 . ILE A 257 ? 1.9235 1.9739 1.7189 -0.0338 0.0796  0.0290  527 ILE A CG2 
1595 C CD1 . ILE A 257 ? 1.6753 1.6365 1.4950 -0.0220 0.0445  -0.0204 527 ILE A CD1 
1596 N N   . PHE A 258 ? 1.7017 1.7329 1.5004 0.0178  0.0910  -0.0646 528 PHE A N   
1597 C CA  . PHE A 258 ? 1.7004 1.7098 1.4960 0.0315  0.0849  -0.0922 528 PHE A CA  
1598 C C   . PHE A 258 ? 1.7023 1.7316 1.4811 0.0522  0.0960  -0.1138 528 PHE A C   
1599 O O   . PHE A 258 ? 1.7104 1.7136 1.4762 0.0619  0.0839  -0.1354 528 PHE A O   
1600 C CB  . PHE A 258 ? 1.7822 1.7888 1.6149 0.0294  0.0779  -0.0925 528 PHE A CB  
1601 C CG  . PHE A 258 ? 1.8102 1.7778 1.6419 0.0215  0.0583  -0.0887 528 PHE A CG  
1602 C CD1 . PHE A 258 ? 1.7236 1.6840 1.5779 0.0110  0.0460  -0.0770 528 PHE A CD1 
1603 C CD2 . PHE A 258 ? 1.8619 1.8017 1.6687 0.0278  0.0502  -0.0951 528 PHE A CD2 
1604 C CE1 . PHE A 258 ? 1.7073 1.6290 1.5475 0.0117  0.0263  -0.0788 528 PHE A CE1 
1605 C CE2 . PHE A 258 ? 1.8144 1.7260 1.6133 0.0296  0.0363  -0.0908 528 PHE A CE2 
1606 C CZ  . PHE A 258 ? 1.6895 1.5899 1.4992 0.0240  0.0244  -0.0862 528 PHE A CZ  
1607 N N   . SER A 259 ? 1.8691 1.9458 1.6496 0.0613  0.1166  -0.1059 529 SER A N   
1608 C CA  . SER A 259 ? 2.0355 2.1323 1.7831 0.0889  0.1283  -0.1285 529 SER A CA  
1609 C C   . SER A 259 ? 2.0298 2.1054 1.7295 0.0870  0.1195  -0.1343 529 SER A C   
1610 O O   . SER A 259 ? 2.3572 2.4160 2.0204 0.1064  0.1111  -0.1629 529 SER A O   
1611 C CB  . SER A 259 ? 2.2813 2.4467 2.0376 0.1037  0.1573  -0.1094 529 SER A CB  
1612 O OG  . SER A 259 ? 2.3495 2.5360 2.1589 0.1015  0.1629  -0.0966 529 SER A OG  
1613 N N   . GLU A 260 ? 1.6903 1.7626 1.3925 0.0634  0.1173  -0.1064 530 GLU A N   
1614 C CA  . GLU A 260 ? 1.6462 1.7016 1.3121 0.0563  0.1092  -0.1026 530 GLU A CA  
1615 C C   . GLU A 260 ? 1.7120 1.7136 1.3695 0.0528  0.0844  -0.1178 530 GLU A C   
1616 O O   . GLU A 260 ? 1.8407 1.8269 1.4652 0.0608  0.0727  -0.1326 530 GLU A O   
1617 C CB  . GLU A 260 ? 1.6048 1.6706 1.2871 0.0325  0.1117  -0.0654 530 GLU A CB  
1618 C CG  . GLU A 260 ? 1.5947 1.6501 1.2475 0.0229  0.1057  -0.0537 530 GLU A CG  
1619 C CD  . GLU A 260 ? 1.6173 1.7086 1.2281 0.0374  0.1172  -0.0576 530 GLU A CD  
1620 O OE1 . GLU A 260 ? 1.6433 1.7800 1.2490 0.0569  0.1359  -0.0618 530 GLU A OE1 
1621 O OE2 . GLU A 260 ? 1.6607 1.7374 1.2413 0.0322  0.1076  -0.0550 530 GLU A OE2 
1622 N N   . VAL A 261 ? 1.5918 1.5680 1.2796 0.0424  0.0745  -0.1108 531 VAL A N   
1623 C CA  . VAL A 261 ? 1.5748 1.5140 1.2656 0.0414  0.0538  -0.1140 531 VAL A CA  
1624 C C   . VAL A 261 ? 1.5960 1.5223 1.2866 0.0561  0.0383  -0.1401 531 VAL A C   
1625 O O   . VAL A 261 ? 1.5957 1.4963 1.2841 0.0552  0.0158  -0.1403 531 VAL A O   
1626 C CB  . VAL A 261 ? 1.5609 1.4857 1.2807 0.0365  0.0492  -0.1022 531 VAL A CB  
1627 C CG1 . VAL A 261 ? 1.6615 1.5981 1.4094 0.0415  0.0533  -0.1128 531 VAL A CG1 
1628 C CG2 . VAL A 261 ? 1.5892 1.4921 1.3173 0.0396  0.0317  -0.0953 531 VAL A CG2 
1629 N N   . ARG A 262 ? 1.6976 1.6412 1.3938 0.0704  0.0474  -0.1599 532 ARG A N   
1630 C CA  . ARG A 262 ? 1.7559 1.6813 1.4496 0.0888  0.0293  -0.1899 532 ARG A CA  
1631 C C   . ARG A 262 ? 1.9965 1.9122 1.6380 0.1033  0.0194  -0.2108 532 ARG A C   
1632 O O   . ARG A 262 ? 2.2681 2.1451 1.9054 0.1082  -0.0139 -0.2270 532 ARG A O   
1633 C CB  . ARG A 262 ? 1.6863 1.6334 1.4026 0.1049  0.0430  -0.2054 532 ARG A CB  
1634 C CG  . ARG A 262 ? 1.6520 1.5950 1.4212 0.0944  0.0381  -0.1938 532 ARG A CG  
1635 C CD  . ARG A 262 ? 1.6284 1.5597 1.4267 0.1108  0.0230  -0.2172 532 ARG A CD  
1636 N NE  . ARG A 262 ? 1.6440 1.5347 1.4421 0.1141  -0.0130 -0.2296 532 ARG A NE  
1637 C CZ  . ARG A 262 ? 1.6893 1.5560 1.4945 0.1338  -0.0362 -0.2593 532 ARG A CZ  
1638 N NH1 . ARG A 262 ? 1.6967 1.5801 1.5061 0.1563  -0.0212 -0.2814 532 ARG A NH1 
1639 N NH2 . ARG A 262 ? 1.7155 1.5404 1.5277 0.1319  -0.0778 -0.2648 532 ARG A NH2 
1640 N N   . ARG A 263 ? 1.8372 1.7879 1.4404 0.1111  0.0435  -0.2085 533 ARG A N   
1641 C CA  . ARG A 263 ? 1.8848 1.8260 1.4285 0.1293  0.0317  -0.2308 533 ARG A CA  
1642 C C   . ARG A 263 ? 1.8992 1.8112 1.4302 0.1071  0.0086  -0.2137 533 ARG A C   
1643 O O   . ARG A 263 ? 2.1374 2.0212 1.6276 0.1165  -0.0180 -0.2328 533 ARG A O   
1644 C CB  . ARG A 263 ? 1.9548 1.9516 1.4555 0.1476  0.0643  -0.2276 533 ARG A CB  
1645 C CG  . ARG A 263 ? 1.8577 1.8940 1.3644 0.1236  0.0868  -0.1846 533 ARG A CG  
1646 C CD  . ARG A 263 ? 1.9037 1.9857 1.3508 0.1485  0.1044  -0.1876 533 ARG A CD  
1647 N NE  . ARG A 263 ? 2.0324 2.1177 1.4504 0.1313  0.0989  -0.1659 533 ARG A NE  
1648 C CZ  . ARG A 263 ? 2.0483 2.1621 1.4941 0.1030  0.1124  -0.1217 533 ARG A CZ  
1649 N NH1 . ARG A 263 ? 2.0584 2.1956 1.5608 0.0872  0.1289  -0.0944 533 ARG A NH1 
1650 N NH2 . ARG A 263 ? 2.0263 2.1410 1.4438 0.0904  0.1048  -0.1048 533 ARG A NH2 
1651 N N   . ILE A 264 ? 1.6916 1.6084 1.2555 0.0802  0.0164  -0.1780 534 ILE A N   
1652 C CA  . ILE A 264 ? 1.7503 1.6462 1.3078 0.0615  -0.0013 -0.1560 534 ILE A CA  
1653 C C   . ILE A 264 ? 1.8835 1.7399 1.4768 0.0531  -0.0348 -0.1493 534 ILE A C   
1654 O O   . ILE A 264 ? 1.9992 1.8333 1.5847 0.0441  -0.0604 -0.1378 534 ILE A O   
1655 C CB  . ILE A 264 ? 1.6651 1.5844 1.2377 0.0417  0.0220  -0.1192 534 ILE A CB  
1656 C CG1 . ILE A 264 ? 1.6826 1.5882 1.2432 0.0265  0.0086  -0.0955 534 ILE A CG1 
1657 C CG2 . ILE A 264 ? 1.6409 1.5544 1.2598 0.0349  0.0271  -0.1062 534 ILE A CG2 
1658 C CD1 . ILE A 264 ? 1.8782 1.7916 1.3873 0.0312  0.0024  -0.1042 534 ILE A CD1 
1659 N N   . GLU A 265 ? 1.8294 1.6821 1.4668 0.0551  -0.0362 -0.1499 535 GLU A N   
1660 C CA  . GLU A 265 ? 1.8764 1.7042 1.5568 0.0482  -0.0674 -0.1338 535 GLU A CA  
1661 C C   . GLU A 265 ? 2.0063 1.8100 1.7055 0.0614  -0.0960 -0.1625 535 GLU A C   
1662 O O   . GLU A 265 ? 2.3616 2.1309 2.0675 0.0603  -0.1381 -0.1662 535 GLU A O   
1663 C CB  . GLU A 265 ? 1.8053 1.6506 1.5256 0.0406  -0.0512 -0.1017 535 GLU A CB  
1664 C CG  . GLU A 265 ? 1.8556 1.7119 1.5603 0.0309  -0.0335 -0.0734 535 GLU A CG  
1665 C CD  . GLU A 265 ? 1.8806 1.7409 1.6199 0.0294  -0.0374 -0.0356 535 GLU A CD  
1666 O OE1 . GLU A 265 ? 1.7683 1.6216 1.5225 0.0238  -0.0592 -0.0110 535 GLU A OE1 
1667 O OE2 . GLU A 265 ? 1.9958 1.8684 1.7464 0.0361  -0.0199 -0.0282 535 GLU A OE2 
1668 N N   . ASN A 266 ? 1.7832 1.6024 1.4948 0.0731  -0.0769 -0.1808 536 ASN A N   
1669 C CA  . ASN A 266 ? 1.8731 1.6715 1.6015 0.0902  -0.0993 -0.2124 536 ASN A CA  
1670 C C   . ASN A 266 ? 2.0553 1.8337 1.8496 0.0809  -0.1362 -0.1928 536 ASN A C   
1671 O O   . ASN A 266 ? 2.2309 1.9901 2.0534 0.0922  -0.1597 -0.2135 536 ASN A O   
1672 C CB  . ASN A 266 ? 1.8292 1.5977 1.5030 0.1104  -0.1216 -0.2521 536 ASN A CB  
1673 N N   . TYR A 267 ? 1.9744 1.7600 1.7958 0.0625  -0.1430 -0.1496 537 TYR A N   
1674 C CA  . TYR A 267 ? 1.9073 1.6935 1.7997 0.0536  -0.1715 -0.1148 537 TYR A CA  
1675 C C   . TYR A 267 ? 1.9326 1.7618 1.8504 0.0502  -0.1380 -0.0807 537 TYR A C   
1676 O O   . TYR A 267 ? 2.0565 1.9031 2.0306 0.0461  -0.1520 -0.0424 537 TYR A O   
1677 C CB  . TYR A 267 ? 1.7801 1.5467 1.6907 0.0400  -0.2111 -0.0837 537 TYR A CB  
1678 C CG  . TYR A 267 ? 1.7624 1.5476 1.6413 0.0312  -0.1866 -0.0569 537 TYR A CG  
1679 C CD1 . TYR A 267 ? 1.7484 1.5729 1.6479 0.0289  -0.1573 -0.0153 537 TYR A CD1 
1680 C CD2 . TYR A 267 ? 1.8158 1.5782 1.6413 0.0284  -0.1946 -0.0738 537 TYR A CD2 
1681 C CE1 . TYR A 267 ? 1.7683 1.6054 1.6401 0.0246  -0.1369 0.0069  537 TYR A CE1 
1682 C CE2 . TYR A 267 ? 1.8925 1.6719 1.6947 0.0195  -0.1738 -0.0474 537 TYR A CE2 
1683 C CZ  . TYR A 267 ? 1.8088 1.6236 1.6367 0.0177  -0.1454 -0.0074 537 TYR A CZ  
1684 O OH  . TYR A 267 ? 1.8852 1.7130 1.6916 0.0123  -0.1263 0.0173  537 TYR A OH  
1685 N N   . ARG A 268 ? 1.8497 1.6969 1.7261 0.0538  -0.0969 -0.0931 538 ARG A N   
1686 C CA  . ARG A 268 ? 1.8518 1.7286 1.7366 0.0542  -0.0696 -0.0688 538 ARG A CA  
1687 C C   . ARG A 268 ? 1.8655 1.7555 1.7724 0.0602  -0.0595 -0.0824 538 ARG A C   
1688 O O   . ARG A 268 ? 2.1932 2.0800 2.0830 0.0643  -0.0480 -0.1142 538 ARG A O   
1689 C CB  . ARG A 268 ? 1.8156 1.6974 1.6507 0.0522  -0.0402 -0.0696 538 ARG A CB  
1690 C CG  . ARG A 268 ? 1.7925 1.6918 1.6275 0.0573  -0.0195 -0.0525 538 ARG A CG  
1691 C CD  . ARG A 268 ? 1.7766 1.6724 1.5729 0.0561  -0.0026 -0.0434 538 ARG A CD  
1692 N NE  . ARG A 268 ? 1.8886 1.7906 1.6783 0.0671  0.0093  -0.0316 538 ARG A NE  
1693 C CZ  . ARG A 268 ? 2.1040 2.0125 1.8888 0.0800  0.0120  -0.0036 538 ARG A CZ  
1694 N NH1 . ARG A 268 ? 2.1893 2.1037 1.9856 0.0785  0.0043  0.0219  538 ARG A NH1 
1695 N NH2 . ARG A 268 ? 2.0904 1.9999 1.8579 0.0972  0.0206  -0.0001 538 ARG A NH2 
1696 N N   . VAL A 269 ? 1.5436 1.4546 1.4903 0.0624  -0.0633 -0.0534 539 VAL A N   
1697 C CA  . VAL A 269 ? 1.5169 1.4437 1.4862 0.0666  -0.0554 -0.0598 539 VAL A CA  
1698 C C   . VAL A 269 ? 1.5761 1.5206 1.5216 0.0718  -0.0322 -0.0460 539 VAL A C   
1699 O O   . VAL A 269 ? 1.7272 1.6807 1.6791 0.0738  -0.0248 -0.0540 539 VAL A O   
1700 C CB  . VAL A 269 ? 1.5206 1.4603 1.5573 0.0668  -0.0826 -0.0373 539 VAL A CB  
1701 C CG1 . VAL A 269 ? 1.7251 1.6346 1.7869 0.0631  -0.1172 -0.0524 539 VAL A CG1 
1702 C CG2 . VAL A 269 ? 1.5081 1.4793 1.5677 0.0705  -0.0853 0.0143  539 VAL A CG2 
1703 N N   . GLU A 270 ? 1.6300 1.5754 1.5462 0.0759  -0.0238 -0.0267 540 GLU A N   
1704 C CA  . GLU A 270 ? 1.6290 1.5875 1.5226 0.0897  -0.0099 -0.0107 540 GLU A CA  
1705 C C   . GLU A 270 ? 1.6008 1.5413 1.4569 0.0875  0.0029  -0.0380 540 GLU A C   
1706 O O   . GLU A 270 ? 1.6380 1.5829 1.4849 0.0973  0.0045  -0.0367 540 GLU A O   
1707 C CB  . GLU A 270 ? 1.7418 1.7041 1.6136 0.0997  -0.0044 0.0161  540 GLU A CB  
1708 N N   . GLY A 271 ? 1.4973 1.4198 1.3339 0.0750  0.0087  -0.0590 541 GLY A N   
1709 C CA  . GLY A 271 ? 1.5098 1.4208 1.3258 0.0690  0.0162  -0.0752 541 GLY A CA  
1710 C C   . GLY A 271 ? 1.5426 1.4640 1.3876 0.0612  0.0165  -0.0911 541 GLY A C   
1711 O O   . GLY A 271 ? 1.4551 1.3740 1.2986 0.0551  0.0185  -0.0965 541 GLY A O   
1712 N N   . MET A 272 ? 1.5866 1.5180 1.4619 0.0622  0.0110  -0.0966 542 MET A N   
1713 C CA  . MET A 272 ? 1.5007 1.4419 1.4011 0.0603  0.0138  -0.1148 542 MET A CA  
1714 C C   . MET A 272 ? 1.4949 1.4472 1.4248 0.0602  0.0094  -0.1090 542 MET A C   
1715 O O   . MET A 272 ? 1.5182 1.4822 1.4728 0.0580  0.0134  -0.1180 542 MET A O   
1716 C CB  . MET A 272 ? 1.3997 1.3372 1.3199 0.0663  0.0018  -0.1267 542 MET A CB  
1717 N N   . GLU A 273 ? 1.5700 1.5225 1.4959 0.0655  0.0017  -0.0910 543 GLU A N   
1718 C CA  . GLU A 273 ? 1.5751 1.5348 1.5089 0.0678  -0.0038 -0.0833 543 GLU A CA  
1719 C C   . GLU A 273 ? 1.6203 1.5717 1.5468 0.0578  -0.0022 -0.0925 543 GLU A C   
1720 O O   . GLU A 273 ? 1.7126 1.6767 1.6729 0.0526  -0.0060 -0.0933 543 GLU A O   
1721 C CB  . GLU A 273 ? 1.6786 1.6339 1.5760 0.0822  -0.0061 -0.0665 543 GLU A CB  
1722 C CG  . GLU A 273 ? 1.8644 1.8183 1.7410 0.0931  -0.0136 -0.0616 543 GLU A CG  
1723 C CD  . GLU A 273 ? 1.8569 1.8092 1.6885 0.1178  -0.0118 -0.0471 543 GLU A CD  
1724 O OE1 . GLU A 273 ? 1.9462 1.9253 1.7944 0.1283  -0.0072 -0.0235 543 GLU A OE1 
1725 O OE2 . GLU A 273 ? 1.6662 1.5901 1.4480 0.1286  -0.0173 -0.0575 543 GLU A OE2 
1726 N N   . ILE A 274 ? 1.6922 1.6230 1.5819 0.0537  0.0003  -0.0950 544 ILE A N   
1727 C CA  . ILE A 274 ? 1.7910 1.7100 1.6794 0.0419  -0.0076 -0.0954 544 ILE A CA  
1728 C C   . ILE A 274 ? 1.8566 1.7945 1.7715 0.0284  0.0049  -0.0956 544 ILE A C   
1729 O O   . ILE A 274 ? 2.2073 2.1541 2.1497 0.0169  -0.0003 -0.0879 544 ILE A O   
1730 C CB  . ILE A 274 ? 2.0214 1.9037 1.8620 0.0458  -0.0204 -0.0947 544 ILE A CB  
1731 C CG1 . ILE A 274 ? 2.1955 2.0701 2.0179 0.0406  -0.0103 -0.0936 544 ILE A CG1 
1732 C CG2 . ILE A 274 ? 2.0940 1.9668 1.9010 0.0694  -0.0273 -0.0931 544 ILE A CG2 
1733 C CD1 . ILE A 274 ? 2.2389 2.0987 2.0665 0.0233  -0.0215 -0.0875 544 ILE A CD1 
1734 N N   . TYR A 275 ? 1.5112 1.4599 1.4188 0.0326  0.0208  -0.1015 545 TYR A N   
1735 C CA  . TYR A 275 ? 1.5046 1.4818 1.4295 0.0313  0.0382  -0.1041 545 TYR A CA  
1736 C C   . TYR A 275 ? 1.4985 1.5012 1.4671 0.0365  0.0428  -0.1086 545 TYR A C   
1737 O O   . TYR A 275 ? 1.5275 1.5605 1.5195 0.0357  0.0557  -0.1015 545 TYR A O   
1738 C CB  . TYR A 275 ? 1.5951 1.5707 1.4927 0.0408  0.0475  -0.1155 545 TYR A CB  
1739 C CG  . TYR A 275 ? 1.6800 1.6844 1.5775 0.0493  0.0658  -0.1235 545 TYR A CG  
1740 C CD1 . TYR A 275 ? 1.5674 1.6062 1.4831 0.0454  0.0801  -0.1086 545 TYR A CD1 
1741 C CD2 . TYR A 275 ? 1.8887 1.8873 1.7663 0.0639  0.0665  -0.1432 545 TYR A CD2 
1742 C CE1 . TYR A 275 ? 1.5721 1.6476 1.4817 0.0612  0.1013  -0.1128 545 TYR A CE1 
1743 C CE2 . TYR A 275 ? 1.9372 1.9601 1.8009 0.0798  0.0823  -0.1552 545 TYR A CE2 
1744 C CZ  . TYR A 275 ? 1.7805 1.8461 1.6576 0.0811  0.1032  -0.1398 545 TYR A CZ  
1745 O OH  . TYR A 275 ? 1.9890 2.0892 1.8471 0.1046  0.1233  -0.1487 545 TYR A OH  
1746 N N   . SER A 276 ? 1.4555 1.4516 1.4404 0.0432  0.0325  -0.1155 546 SER A N   
1747 C CA  . SER A 276 ? 1.4317 1.4485 1.4634 0.0484  0.0334  -0.1191 546 SER A CA  
1748 C C   . SER A 276 ? 1.4763 1.5073 1.5361 0.0351  0.0306  -0.1015 546 SER A C   
1749 O O   . SER A 276 ? 1.5766 1.6379 1.6727 0.0374  0.0423  -0.0965 546 SER A O   
1750 C CB  . SER A 276 ? 1.4551 1.4635 1.5069 0.0537  0.0172  -0.1208 546 SER A CB  
1751 O OG  . SER A 276 ? 1.6346 1.6397 1.6903 0.0458  0.0039  -0.1053 546 SER A OG  
1752 N N   . THR A 277 ? 1.5174 1.5256 1.5594 0.0238  0.0127  -0.0912 547 THR A N   
1753 C CA  . THR A 277 ? 1.4234 1.4328 1.4884 0.0084  -0.0017 -0.0742 547 THR A CA  
1754 C C   . THR A 277 ? 1.4478 1.4691 1.5221 -0.0049 0.0027  -0.0565 547 THR A C   
1755 O O   . THR A 277 ? 1.4608 1.4995 1.5778 -0.0182 -0.0055 -0.0352 547 THR A O   
1756 C CB  . THR A 277 ? 1.4306 1.4032 1.4615 0.0065  -0.0287 -0.0740 547 THR A CB  
1757 O OG1 . THR A 277 ? 1.6018 1.5838 1.6621 0.0058  -0.0416 -0.0690 547 THR A OG1 
1758 C CG2 . THR A 277 ? 1.4660 1.4097 1.4783 -0.0074 -0.0494 -0.0648 547 THR A CG2 
1759 N N   . THR A 278 ? 1.4664 1.4836 1.5087 -0.0028 0.0139  -0.0589 548 THR A N   
1760 C CA  . THR A 278 ? 1.4676 1.5094 1.5288 -0.0149 0.0201  -0.0340 548 THR A CA  
1761 C C   . THR A 278 ? 1.6206 1.7219 1.7242 -0.0045 0.0482  -0.0238 548 THR A C   
1762 O O   . THR A 278 ? 1.5952 1.7317 1.7477 -0.0154 0.0482  0.0084  548 THR A O   
1763 C CB  . THR A 278 ? 1.4802 1.5122 1.5009 -0.0144 0.0275  -0.0349 548 THR A CB  
1764 O OG1 . THR A 278 ? 1.5442 1.6137 1.5577 0.0027  0.0588  -0.0432 548 THR A OG1 
1765 C CG2 . THR A 278 ? 1.4881 1.4698 1.4573 -0.0087 0.0141  -0.0559 548 THR A CG2 
1766 N N   . LEU A 279 ? 1.7838 1.8955 1.8694 0.0191  0.0694  -0.0497 549 LEU A N   
1767 C CA  . LEU A 279 ? 1.7633 1.9242 1.8783 0.0401  0.0953  -0.0501 549 LEU A CA  
1768 C C   . LEU A 279 ? 1.6921 1.8697 1.8657 0.0352  0.0882  -0.0364 549 LEU A C   
1769 O O   . LEU A 279 ? 1.8142 2.0426 2.0283 0.0479  0.1085  -0.0205 549 LEU A O   
1770 C CB  . LEU A 279 ? 1.8067 1.9540 1.8883 0.0671  0.1048  -0.0887 549 LEU A CB  
1771 C CG  . LEU A 279 ? 1.9031 2.0444 1.9293 0.0770  0.1150  -0.1014 549 LEU A CG  
1772 C CD1 . LEU A 279 ? 1.9484 2.0598 1.9455 0.0983  0.1091  -0.1397 549 LEU A CD1 
1773 C CD2 . LEU A 279 ? 1.9874 2.1869 2.0144 0.0905  0.1436  -0.0821 549 LEU A CD2 
1774 N N   . TRP A 280 ? 1.6219 1.7608 1.7987 0.0198  0.0605  -0.0408 550 TRP A N   
1775 C CA  . TRP A 280 ? 1.6577 1.8084 1.8883 0.0106  0.0480  -0.0252 550 TRP A CA  
1776 C C   . TRP A 280 ? 1.6265 1.8009 1.9009 -0.0120 0.0376  0.0170  550 TRP A C   
1777 O O   . TRP A 280 ? 1.7504 1.9687 2.0841 -0.0110 0.0463  0.0408  550 TRP A O   
1778 C CB  . TRP A 280 ? 1.7949 1.9014 2.0086 0.0019  0.0194  -0.0378 550 TRP A CB  
1779 C CG  . TRP A 280 ? 1.8093 1.9281 2.0742 -0.0059 0.0056  -0.0243 550 TRP A CG  
1780 C CD1 . TRP A 280 ? 1.9743 2.1142 2.2785 0.0074  0.0143  -0.0313 550 TRP A CD1 
1781 C CD2 . TRP A 280 ? 1.6196 1.7278 1.9049 -0.0294 -0.0239 -0.0003 550 TRP A CD2 
1782 N NE1 . TRP A 280 ? 1.9289 2.0780 2.2790 -0.0073 -0.0041 -0.0107 550 TRP A NE1 
1783 C CE2 . TRP A 280 ? 1.7270 1.8559 2.0640 -0.0302 -0.0288 0.0081  550 TRP A CE2 
1784 C CE3 . TRP A 280 ? 1.5783 1.6561 1.8439 -0.0496 -0.0520 0.0141  550 TRP A CE3 
1785 C CZ2 . TRP A 280 ? 1.7672 1.8903 2.1336 -0.0516 -0.0597 0.0315  550 TRP A CZ2 
1786 C CZ3 . TRP A 280 ? 1.5662 1.6313 1.8590 -0.0695 -0.0870 0.0341  550 TRP A CZ3 
1787 C CH2 . TRP A 280 ? 1.7409 1.8301 2.0822 -0.0710 -0.0900 0.0432  550 TRP A CH2 
1788 N N   . HIS A 281 ? 1.6605 1.8052 1.9111 -0.0321 0.0156  0.0290  551 HIS A N   
1789 C CA  . HIS A 281 ? 1.6576 1.8166 1.9556 -0.0579 -0.0055 0.0733  551 HIS A CA  
1790 C C   . HIS A 281 ? 1.6619 1.8937 2.0050 -0.0532 0.0246  0.1115  551 HIS A C   
1791 O O   . HIS A 281 ? 1.7121 1.9863 2.1248 -0.0667 0.0188  0.1570  551 HIS A O   
1792 C CB  . HIS A 281 ? 1.6881 1.7883 1.9471 -0.0771 -0.0420 0.0730  551 HIS A CB  
1793 C CG  . HIS A 281 ? 1.7431 1.7780 1.9615 -0.0800 -0.0774 0.0465  551 HIS A CG  
1794 N ND1 . HIS A 281 ? 1.9197 1.9414 2.1681 -0.0938 -0.1094 0.0579  551 HIS A ND1 
1795 C CD2 . HIS A 281 ? 1.7739 1.7584 1.9224 -0.0677 -0.0854 0.0127  551 HIS A CD2 
1796 C CE1 . HIS A 281 ? 1.9477 1.9140 2.1396 -0.0871 -0.1348 0.0293  551 HIS A CE1 
1797 N NE2 . HIS A 281 ? 1.8765 1.8224 2.0090 -0.0698 -0.1190 0.0032  551 HIS A NE2 
1798 N N   . LEU A 282 ? 1.6313 1.8819 1.9350 -0.0321 0.0564  0.0962  552 LEU A N   
1799 C CA  . LEU A 282 ? 1.6145 1.9431 1.9450 -0.0162 0.0929  0.1278  552 LEU A CA  
1800 C C   . LEU A 282 ? 1.5572 1.9442 1.9214 0.0148  0.1270  0.1281  552 LEU A C   
1801 O O   . LEU A 282 ? 1.5347 1.9997 1.9336 0.0319  0.1578  0.1645  552 LEU A O   
1802 C CB  . LEU A 282 ? 1.6410 1.9662 1.9072 0.0000  0.1132  0.1058  552 LEU A CB  
1803 C CG  . LEU A 282 ? 1.6073 1.8835 1.8508 -0.0293 0.0813  0.1143  552 LEU A CG  
1804 C CD1 . LEU A 282 ? 1.6631 1.9357 1.8462 -0.0159 0.0997  0.0953  552 LEU A CD1 
1805 C CD2 . LEU A 282 ? 1.5664 1.8794 1.8803 -0.0572 0.0629  0.1783  552 LEU A CD2 
1806 N N   . GLN A 283 ? 1.5287 1.8805 1.8836 0.0248  0.1211  0.0898  553 GLN A N   
1807 C CA  . GLN A 283 ? 1.4813 1.8735 1.8698 0.0549  0.1460  0.0831  553 GLN A CA  
1808 C C   . GLN A 283 ? 1.5816 2.0098 1.9301 0.1003  0.1864  0.0605  553 GLN A C   
1809 O O   . GLN A 283 ? 1.6463 2.1463 2.0265 0.1293  0.2190  0.0839  553 GLN A O   
1810 C CB  . GLN A 283 ? 1.4043 1.8584 1.8806 0.0438  0.1481  0.1414  553 GLN A CB  
1811 C CG  . GLN A 283 ? 1.3889 1.8079 1.9034 -0.0034 0.1009  0.1712  553 GLN A CG  
1812 C CD  . GLN A 283 ? 1.3539 1.8261 1.9611 -0.0136 0.0974  0.2231  553 GLN A CD  
1813 O OE1 . GLN A 283 ? 1.3159 1.8445 1.9582 0.0175  0.1315  0.2289  553 GLN A OE1 
1814 N NE2 . GLN A 283 ? 1.4469 1.8983 2.0945 -0.0558 0.0528  0.2613  553 GLN A NE2 
1815 N N   . LYS A 284 ? 1.6008 1.9802 1.8774 0.1088  0.1827  0.0163  554 LYS A N   
1816 C CA  . LYS A 284 ? 1.6209 2.0188 1.8473 0.1527  0.2114  -0.0142 554 LYS A CA  
1817 C C   . LYS A 284 ? 1.7355 2.0850 1.9446 0.1751  0.2007  -0.0672 554 LYS A C   
1818 O O   . LYS A 284 ? 1.7986 2.0856 1.9665 0.1665  0.1776  -0.1010 554 LYS A O   
1819 C CB  . LYS A 284 ? 1.6116 1.9907 1.7741 0.1465  0.2108  -0.0224 554 LYS A CB  
1820 N N   . ASP A 285 ? 1.8211 2.2042 2.0689 0.2050  0.2166  -0.0690 555 ASP A N   
1821 C CA  . ASP A 285 ? 1.8818 2.2237 2.1314 0.2277  0.2029  -0.1135 555 ASP A CA  
1822 C C   . ASP A 285 ? 1.9206 2.2140 2.0965 0.2555  0.1948  -0.1671 555 ASP A C   
1823 O O   . ASP A 285 ? 2.1000 2.3303 2.2642 0.2380  0.1619  -0.1917 555 ASP A O   
1824 C CB  . ASP A 285 ? 2.0208 2.4142 2.3225 0.2636  0.2262  -0.1050 555 ASP A CB  
1825 C CG  . ASP A 285 ? 2.2453 2.7099 2.5231 0.3123  0.2702  -0.0953 555 ASP A CG  
1826 O OD1 . ASP A 285 ? 2.2873 2.7730 2.5198 0.3095  0.2835  -0.0824 555 ASP A OD1 
1827 O OD2 . ASP A 285 ? 2.3971 2.9002 2.7006 0.3564  0.2923  -0.0990 555 ASP A OD2 
1828 N N   . VAL A 286 ? 1.8291 2.1537 1.9550 0.2964  0.2217  -0.1800 556 VAL A N   
1829 C CA  . VAL A 286 ? 1.9994 2.2741 2.0528 0.3282  0.2086  -0.2346 556 VAL A CA  
1830 C C   . VAL A 286 ? 2.0895 2.3074 2.1033 0.2917  0.1799  -0.2432 556 VAL A C   
1831 O O   . VAL A 286 ? 2.2763 2.4303 2.2678 0.2955  0.1474  -0.2808 556 VAL A O   
1832 C CB  . VAL A 286 ? 1.9633 2.2884 1.9567 0.3836  0.2446  -0.2454 556 VAL A CB  
1833 C CG1 . VAL A 286 ? 1.8972 2.2727 1.8664 0.3636  0.2674  -0.2036 556 VAL A CG1 
1834 C CG2 . VAL A 286 ? 2.0984 2.3612 2.0178 0.4256  0.2223  -0.3114 556 VAL A CG2 
1835 N N   . ALA A 287 ? 1.8631 2.1040 1.8755 0.2564  0.1886  -0.2047 557 ALA A N   
1836 C CA  . ALA A 287 ? 1.6869 1.8829 1.6610 0.2260  0.1672  -0.2078 557 ALA A CA  
1837 C C   . ALA A 287 ? 1.7562 1.8961 1.7587 0.1949  0.1317  -0.2128 557 ALA A C   
1838 O O   . ALA A 287 ? 1.9990 2.0903 1.9719 0.1878  0.1073  -0.2317 557 ALA A O   
1839 C CB  . ALA A 287 ? 1.6560 1.8902 1.6302 0.1986  0.1831  -0.1637 557 ALA A CB  
1840 N N   . LEU A 288 ? 1.6273 1.7799 1.6895 0.1767  0.1286  -0.1902 558 LEU A N   
1841 C CA  . LEU A 288 ? 1.6607 1.7732 1.7507 0.1514  0.0983  -0.1889 558 LEU A CA  
1842 C C   . LEU A 288 ? 1.6381 1.7191 1.7446 0.1724  0.0772  -0.2207 558 LEU A C   
1843 O O   . LEU A 288 ? 1.7917 1.8335 1.9014 0.1598  0.0482  -0.2263 558 LEU A O   
1844 C CB  . LEU A 288 ? 1.7174 1.8533 1.8604 0.1270  0.0983  -0.1551 558 LEU A CB  
1845 C CG  . LEU A 288 ? 1.7944 1.9009 1.9613 0.1024  0.0702  -0.1467 558 LEU A CG  
1846 C CD1 . LEU A 288 ? 1.8605 1.9347 1.9815 0.0866  0.0576  -0.1455 558 LEU A CD1 
1847 C CD2 . LEU A 288 ? 1.7241 1.8544 1.9329 0.0818  0.0693  -0.1151 558 LEU A CD2 
1848 N N   . SER A 289 ? 1.6119 1.7126 1.7342 0.2060  0.0900  -0.2375 559 SER A N   
1849 C CA  . SER A 289 ? 1.6234 1.6860 1.7544 0.2335  0.0657  -0.2749 559 SER A CA  
1850 C C   . SER A 289 ? 1.6719 1.6840 1.7462 0.2421  0.0414  -0.3053 559 SER A C   
1851 O O   . SER A 289 ? 1.8862 1.8515 1.9800 0.2342  0.0021  -0.3160 559 SER A O   
1852 C CB  . SER A 289 ? 1.6567 1.7489 1.7950 0.2795  0.0884  -0.2933 559 SER A CB  
1853 O OG  . SER A 289 ? 1.7760 1.8190 1.9061 0.3134  0.0600  -0.3389 559 SER A OG  
1854 N N   . VAL A 290 ? 1.5531 1.5792 1.5624 0.2573  0.0628  -0.3138 560 VAL A N   
1855 C CA  . VAL A 290 ? 1.6146 1.5960 1.5638 0.2645  0.0404  -0.3401 560 VAL A CA  
1856 C C   . VAL A 290 ? 1.7513 1.7038 1.7078 0.2221  0.0157  -0.3176 560 VAL A C   
1857 O O   . VAL A 290 ? 1.8483 1.7512 1.7977 0.2203  -0.0224 -0.3330 560 VAL A O   
1858 C CB  . VAL A 290 ? 1.6029 1.6185 1.4817 0.2866  0.0731  -0.3448 560 VAL A CB  
1859 C CG1 . VAL A 290 ? 1.6184 1.5924 1.4378 0.2803  0.0500  -0.3594 560 VAL A CG1 
1860 C CG2 . VAL A 290 ? 1.6419 1.6800 1.4958 0.3437  0.0924  -0.3757 560 VAL A CG2 
1861 N N   . LEU A 291 ? 1.7087 1.6914 1.6823 0.1904  0.0342  -0.2794 561 LEU A N   
1862 C CA  . LEU A 291 ? 1.5436 1.5058 1.5205 0.1577  0.0163  -0.2563 561 LEU A CA  
1863 C C   . LEU A 291 ? 1.5594 1.4976 1.5919 0.1477  -0.0171 -0.2499 561 LEU A C   
1864 O O   . LEU A 291 ? 1.5487 1.4564 1.5825 0.1392  -0.0464 -0.2463 561 LEU A O   
1865 C CB  . LEU A 291 ? 1.4075 1.4011 1.3872 0.1328  0.0393  -0.2222 561 LEU A CB  
1866 N N   . SER A 292 ? 1.5331 1.4906 1.6177 0.1480  -0.0137 -0.2426 562 SER A N   
1867 C CA  . SER A 292 ? 1.4965 1.4415 1.6427 0.1389  -0.0445 -0.2306 562 SER A CA  
1868 C C   . SER A 292 ? 1.7128 1.6134 1.8710 0.1540  -0.0839 -0.2550 562 SER A C   
1869 O O   . SER A 292 ? 1.7326 1.6161 1.9258 0.1390  -0.1174 -0.2353 562 SER A O   
1870 C CB  . SER A 292 ? 1.4615 1.4345 1.6606 0.1415  -0.0345 -0.2238 562 SER A CB  
1871 O OG  . SER A 292 ? 1.5306 1.5034 1.7290 0.1730  -0.0258 -0.2552 562 SER A OG  
1872 N N   . LYS A 293 ? 1.8086 1.6920 1.9388 0.1860  -0.0824 -0.2955 563 LYS A N   
1873 C CA  . LYS A 293 ? 1.6271 1.4549 1.7566 0.2051  -0.1273 -0.3274 563 LYS A CA  
1874 C C   . LYS A 293 ? 1.6046 1.4026 1.7025 0.1886  -0.1522 -0.3190 563 LYS A C   
1875 O O   . LYS A 293 ? 1.6271 1.3946 1.7694 0.1746  -0.1983 -0.3044 563 LYS A O   
1876 C CB  . LYS A 293 ? 1.5123 1.3278 1.5924 0.2513  -0.1161 -0.3774 563 LYS A CB  
1877 N N   . ASP A 294 ? 1.6333 1.4454 1.6621 0.1890  -0.1225 -0.3221 564 ASP A N   
1878 C CA  . ASP A 294 ? 1.7105 1.4980 1.7044 0.1748  -0.1418 -0.3137 564 ASP A CA  
1879 C C   . ASP A 294 ? 1.7957 1.5939 1.8373 0.1401  -0.1552 -0.2635 564 ASP A C   
1880 O O   . ASP A 294 ? 2.0444 1.8152 2.0940 0.1287  -0.1907 -0.2497 564 ASP A O   
1881 C CB  . ASP A 294 ? 1.7008 1.5138 1.6203 0.1791  -0.1009 -0.3184 564 ASP A CB  
1882 C CG  . ASP A 294 ? 1.8243 1.6255 1.6819 0.2189  -0.0950 -0.3651 564 ASP A CG  
1883 O OD1 . ASP A 294 ? 1.8102 1.6185 1.6031 0.2242  -0.0798 -0.3707 564 ASP A OD1 
1884 O OD2 . ASP A 294 ? 2.0348 1.8224 1.9071 0.2481  -0.1050 -0.3953 564 ASP A OD2 
1885 N N   . LEU A 295 ? 1.5002 1.3407 1.5724 0.1261  -0.1278 -0.2340 565 LEU A N   
1886 C CA  . LEU A 295 ? 1.4927 1.3528 1.6020 0.1025  -0.1345 -0.1862 565 LEU A CA  
1887 C C   . LEU A 295 ? 1.6261 1.4823 1.8167 0.0959  -0.1748 -0.1621 565 LEU A C   
1888 O O   . LEU A 295 ? 1.7156 1.5752 1.9366 0.0824  -0.1985 -0.1243 565 LEU A O   
1889 C CB  . LEU A 295 ? 1.4760 1.3777 1.5764 0.0941  -0.0949 -0.1670 565 LEU A CB  
1890 C CG  . LEU A 295 ? 1.4443 1.3541 1.4783 0.0933  -0.0607 -0.1748 565 LEU A CG  
1891 C CD1 . LEU A 295 ? 1.4904 1.4298 1.5239 0.0840  -0.0351 -0.1558 565 LEU A CD1 
1892 C CD2 . LEU A 295 ? 1.4593 1.3545 1.4612 0.0860  -0.0690 -0.1618 565 LEU A CD2 
1893 N N   . THR A 296 ? 1.6384 1.4929 1.8705 0.1058  -0.1829 -0.1782 566 THR A N   
1894 C CA  . THR A 296 ? 1.7602 1.6095 2.0783 0.0994  -0.2263 -0.1549 566 THR A CA  
1895 C C   . THR A 296 ? 1.8394 1.6340 2.1719 0.1022  -0.2813 -0.1665 566 THR A C   
1896 O O   . THR A 296 ? 2.0043 1.7985 2.4053 0.0865  -0.3233 -0.1255 566 THR A O   
1897 C CB  . THR A 296 ? 1.7939 1.6488 2.1547 0.1110  -0.2247 -0.1727 566 THR A CB  
1898 O OG1 . THR A 296 ? 1.9820 1.8047 2.2971 0.1387  -0.2170 -0.2288 566 THR A OG1 
1899 C CG2 . THR A 296 ? 1.6145 1.5231 1.9763 0.1021  -0.1824 -0.1502 566 THR A CG2 
1900 N N   . ASP A 297 ? 1.6178 1.3685 1.8863 0.1232  -0.2837 -0.2193 567 ASP A N   
1901 C CA  . ASP A 297 ? 1.6554 1.3426 1.9204 0.1290  -0.3408 -0.2395 567 ASP A CA  
1902 C C   . ASP A 297 ? 1.6476 1.3379 1.9181 0.1038  -0.3598 -0.1950 567 ASP A C   
1903 O O   . ASP A 297 ? 1.7648 1.4143 2.0780 0.0952  -0.4213 -0.1823 567 ASP A O   
1904 C CB  . ASP A 297 ? 1.9090 1.5574 2.0826 0.1619  -0.3309 -0.3051 567 ASP A CB  
1905 C CG  . ASP A 297 ? 2.1479 1.7812 2.3244 0.1959  -0.3284 -0.3511 567 ASP A CG  
1906 O OD1 . ASP A 297 ? 2.0033 1.6583 2.2536 0.1894  -0.3298 -0.3314 567 ASP A OD1 
1907 O OD2 . ASP A 297 ? 2.4210 2.0247 2.5249 0.2319  -0.3236 -0.4052 567 ASP A OD2 
1908 N N   . MET A 298 ? 1.5271 1.2644 1.7604 0.0922  -0.3110 -0.1684 568 MET A N   
1909 C CA  . MET A 298 ? 1.5387 1.2821 1.7709 0.0736  -0.3229 -0.1275 568 MET A CA  
1910 C C   . MET A 298 ? 1.6632 1.4555 1.9785 0.0546  -0.3315 -0.0565 568 MET A C   
1911 O O   . MET A 298 ? 1.7663 1.5524 2.1371 0.0405  -0.3766 -0.0146 568 MET A O   
1912 C CB  . MET A 298 ? 1.5226 1.2881 1.6715 0.0747  -0.2696 -0.1347 568 MET A CB  
1913 N N   . ASP A 299 ? 1.6192 1.4635 1.9441 0.0557  -0.2903 -0.0391 569 ASP A N   
1914 C CA  . ASP A 299 ? 1.6085 1.5123 1.9869 0.0452  -0.2846 0.0293  569 ASP A CA  
1915 C C   . ASP A 299 ? 1.5356 1.4795 1.9524 0.0485  -0.2676 0.0404  569 ASP A C   
1916 O O   . ASP A 299 ? 1.4940 1.4656 1.8643 0.0549  -0.2218 0.0322  569 ASP A O   
1917 C CB  . ASP A 299 ? 1.7455 1.6798 2.0660 0.0461  -0.2435 0.0504  569 ASP A CB  
1918 C CG  . ASP A 299 ? 1.9958 1.9918 2.3692 0.0434  -0.2433 0.1252  569 ASP A CG  
1919 O OD1 . ASP A 299 ? 2.0598 2.0639 2.4519 0.0374  -0.2604 0.1655  569 ASP A OD1 
1920 O OD2 . ASP A 299 ? 2.1456 2.1869 2.5446 0.0491  -0.2269 0.1478  569 ASP A OD2 
1921 N N   . LYS A 300 ? 1.6204 1.5645 2.1247 0.0429  -0.3093 0.0604  570 LYS A N   
1922 C CA  . LYS A 300 ? 1.5502 1.5342 2.1012 0.0440  -0.2991 0.0758  570 LYS A CA  
1923 C C   . LYS A 300 ? 1.5661 1.6269 2.1499 0.0408  -0.2835 0.1469  570 LYS A C   
1924 O O   . LYS A 300 ? 1.6477 1.7505 2.2626 0.0426  -0.2724 0.1661  570 LYS A O   
1925 C CB  . LYS A 300 ? 1.5144 1.4696 2.1525 0.0401  -0.3527 0.0723  570 LYS A CB  
1926 N N   . ASN A 301 ? 1.4623 1.5451 2.0379 0.0395  -0.2821 0.1877  571 ASN A N   
1927 C CA  . ASN A 301 ? 1.3162 1.4761 1.8973 0.0479  -0.2553 0.2493  571 ASN A CA  
1928 C C   . ASN A 301 ? 1.3690 1.5293 1.8431 0.0630  -0.2041 0.2239  571 ASN A C   
1929 O O   . ASN A 301 ? 1.4775 1.6748 1.9331 0.0734  -0.1877 0.2641  571 ASN A O   
1930 C CB  . ASN A 301 ? 1.1014 1.3016 1.7601 0.0410  -0.2876 0.3269  571 ASN A CB  
1931 N N   . SER A 302 ? 1.4841 1.6042 1.8933 0.0652  -0.1809 0.1598  572 SER A N   
1932 C CA  . SER A 302 ? 1.5368 1.6488 1.8515 0.0763  -0.1393 0.1316  572 SER A CA  
1933 C C   . SER A 302 ? 1.4951 1.6080 1.7835 0.0799  -0.1189 0.1014  572 SER A C   
1934 O O   . SER A 302 ? 1.4725 1.5598 1.7807 0.0721  -0.1277 0.0677  572 SER A O   
1935 C CB  . SER A 302 ? 1.7481 1.8050 2.0083 0.0711  -0.1358 0.0868  572 SER A CB  
1936 O OG  . SER A 302 ? 1.9530 2.0126 2.2149 0.0698  -0.1455 0.1175  572 SER A OG  
1937 N N   . PRO A 303 ? 1.9099 1.5143 1.8409 -0.0758 -0.1157 0.0701  573 PRO A N   
1938 C CA  . PRO A 303 ? 1.9284 1.5566 1.8417 -0.0954 -0.1033 0.0807  573 PRO A CA  
1939 C C   . PRO A 303 ? 1.9167 1.5134 1.7673 -0.1080 -0.0954 0.0577  573 PRO A C   
1940 O O   . PRO A 303 ? 2.0256 1.6510 1.8831 -0.1234 -0.0859 0.0594  573 PRO A O   
1941 C CB  . PRO A 303 ? 1.9000 1.5382 1.7739 -0.0998 -0.1000 0.0941  573 PRO A CB  
1942 C CG  . PRO A 303 ? 1.9503 1.5484 1.7870 -0.0828 -0.1090 0.0778  573 PRO A CG  
1943 C CD  . PRO A 303 ? 1.9645 1.5589 1.8588 -0.0676 -0.1189 0.0719  573 PRO A CD  
1944 N N   . GLU A 304 ? 1.7662 1.3095 1.5573 -0.1023 -0.1002 0.0384  574 GLU A N   
1945 C CA  . GLU A 304 ? 1.6686 1.1826 1.3946 -0.1179 -0.0935 0.0224  574 GLU A CA  
1946 C C   . GLU A 304 ? 1.5848 1.1361 1.3531 -0.1182 -0.0871 0.0081  574 GLU A C   
1947 O O   . GLU A 304 ? 1.6340 1.2077 1.3803 -0.1398 -0.0736 0.0050  574 GLU A O   
1948 C CB  . GLU A 304 ? 1.8953 1.3457 1.5577 -0.1065 -0.1052 0.0077  574 GLU A CB  
1949 C CG  . GLU A 304 ? 2.0595 1.4654 1.6666 -0.1040 -0.1145 0.0134  574 GLU A CG  
1950 C CD  . GLU A 304 ? 2.0968 1.5165 1.7507 -0.0759 -0.1260 0.0142  574 GLU A CD  
1951 O OE1 . GLU A 304 ? 1.9423 1.4084 1.6772 -0.0666 -0.1253 0.0195  574 GLU A OE1 
1952 O OE2 . GLU A 304 ? 2.1818 1.5686 1.7946 -0.0638 -0.1372 0.0093  574 GLU A OE2 
1953 N N   . ALA A 305 ? 1.4979 1.0591 1.3291 -0.0939 -0.0983 -0.0041 575 ALA A N   
1954 C CA  . ALA A 305 ? 1.4875 1.0847 1.3669 -0.0859 -0.0976 -0.0265 575 ALA A CA  
1955 C C   . ALA A 305 ? 1.5015 1.1549 1.4384 -0.0939 -0.0905 -0.0163 575 ALA A C   
1956 O O   . ALA A 305 ? 1.5662 1.2577 1.5091 -0.0987 -0.0813 -0.0349 575 ALA A O   
1957 C CB  . ALA A 305 ? 1.6500 1.2409 1.5958 -0.0573 -0.1174 -0.0421 575 ALA A CB  
1958 N N   . TRP A 306 ? 1.5665 1.2311 1.5448 -0.0943 -0.0955 0.0135  576 TRP A N   
1959 C CA  . TRP A 306 ? 1.5804 1.2956 1.6157 -0.0992 -0.0941 0.0305  576 TRP A CA  
1960 C C   . TRP A 306 ? 1.6264 1.3629 1.6075 -0.1264 -0.0767 0.0385  576 TRP A C   
1961 O O   . TRP A 306 ? 1.6588 1.4450 1.6756 -0.1317 -0.0729 0.0401  576 TRP A O   
1962 C CB  . TRP A 306 ? 1.5513 1.2731 1.6459 -0.0915 -0.1074 0.0646  576 TRP A CB  
1963 C CG  . TRP A 306 ? 1.7865 1.4971 1.9585 -0.0694 -0.1282 0.0591  576 TRP A CG  
1964 C CD1 . TRP A 306 ? 1.8697 1.5520 2.0542 -0.0608 -0.1393 0.0643  576 TRP A CD1 
1965 C CD2 . TRP A 306 ? 1.9040 1.6329 2.1591 -0.0532 -0.1440 0.0464  576 TRP A CD2 
1966 N NE1 . TRP A 306 ? 1.9124 1.5905 2.1815 -0.0442 -0.1610 0.0564  576 TRP A NE1 
1967 C CE2 . TRP A 306 ? 1.9594 1.6614 2.2730 -0.0376 -0.1659 0.0445  576 TRP A CE2 
1968 C CE3 . TRP A 306 ? 1.8772 1.6440 2.1661 -0.0486 -0.1442 0.0329  576 TRP A CE3 
1969 C CZ2 . TRP A 306 ? 2.0108 1.7131 2.4146 -0.0180 -0.1906 0.0293  576 TRP A CZ2 
1970 C CZ3 . TRP A 306 ? 1.9467 1.7181 2.3246 -0.0246 -0.1682 0.0157  576 TRP A CZ3 
1971 C CH2 . TRP A 306 ? 2.0387 1.7733 2.4728 -0.0097 -0.1924 0.0139  576 TRP A CH2 
1972 N N   . CYS A 307 ? 1.6725 1.3699 1.5707 -0.1427 -0.0695 0.0420  577 CYS A N   
1973 C CA  . CYS A 307 ? 1.6314 1.3384 1.4737 -0.1727 -0.0561 0.0455  577 CYS A CA  
1974 C C   . CYS A 307 ? 1.6731 1.4004 1.4974 -0.1854 -0.0440 0.0220  577 CYS A C   
1975 O O   . CYS A 307 ? 1.7309 1.5094 1.5662 -0.2033 -0.0335 0.0203  577 CYS A O   
1976 C CB  . CYS A 307 ? 1.6557 1.3038 1.4150 -0.1849 -0.0574 0.0509  577 CYS A CB  
1977 S SG  . CYS A 307 ? 2.4966 2.1501 2.2669 -0.1763 -0.0660 0.0741  577 CYS A SG  
1978 N N   . ALA A 308 ? 1.6886 1.3850 1.4880 -0.1749 -0.0461 0.0028  578 ALA A N   
1979 C CA  . ALA A 308 ? 1.6303 1.3550 1.4092 -0.1839 -0.0341 -0.0217 578 ALA A CA  
1980 C C   . ALA A 308 ? 1.6500 1.4522 1.5124 -0.1683 -0.0320 -0.0415 578 ALA A C   
1981 O O   . ALA A 308 ? 1.6614 1.5213 1.5193 -0.1872 -0.0165 -0.0521 578 ALA A O   
1982 C CB  . ALA A 308 ? 1.5581 1.2385 1.3003 -0.1681 -0.0413 -0.0387 578 ALA A CB  
1983 N N   . ALA A 309 ? 1.8631 1.6669 1.8045 -0.1338 -0.0500 -0.0475 579 ALA A N   
1984 C CA  . ALA A 309 ? 1.9478 1.8134 1.9786 -0.1125 -0.0566 -0.0664 579 ALA A CA  
1985 C C   . ALA A 309 ? 1.7698 1.6874 1.8236 -0.1291 -0.0493 -0.0491 579 ALA A C   
1986 O O   . ALA A 309 ? 1.8198 1.8050 1.9128 -0.1247 -0.0446 -0.0711 579 ALA A O   
1987 C CB  . ALA A 309 ? 2.1357 1.9770 2.2483 -0.0789 -0.0832 -0.0640 579 ALA A CB  
1988 N N   . GLY A 310 ? 1.6987 1.5906 1.7304 -0.1451 -0.0501 -0.0130 580 GLY A N   
1989 C CA  . GLY A 310 ? 1.7590 1.6974 1.8063 -0.1613 -0.0458 0.0052  580 GLY A CA  
1990 C C   . GLY A 310 ? 1.7804 1.7692 1.7888 -0.1925 -0.0251 -0.0092 580 GLY A C   
1991 O O   . GLY A 310 ? 1.8864 1.9471 1.9474 -0.1883 -0.0238 -0.0215 580 GLY A O   
1992 N N   . ASN A 311 ? 1.7171 1.6692 1.6369 -0.2240 -0.0110 -0.0075 581 ASN A N   
1993 C CA  . ASN A 311 ? 1.7469 1.7402 1.6225 -0.2639 0.0086  -0.0143 581 ASN A CA  
1994 C C   . ASN A 311 ? 1.7820 1.8251 1.6541 -0.2658 0.0234  -0.0459 581 ASN A C   
1995 O O   . ASN A 311 ? 1.8518 1.9448 1.6938 -0.3011 0.0420  -0.0516 581 ASN A O   
1996 C CB  . ASN A 311 ? 1.7696 1.6926 1.5495 -0.3005 0.0128  0.0046  581 ASN A CB  
1997 C CG  . ASN A 311 ? 1.9197 1.7603 1.6492 -0.2876 0.0056  0.0048  581 ASN A CG  
1998 O OD1 . ASN A 311 ? 2.1219 1.9560 1.8914 -0.2514 -0.0033 -0.0068 581 ASN A OD1 
1999 N ND2 . ASN A 311 ? 1.9192 1.6949 1.5635 -0.3165 0.0061  0.0169  581 ASN A ND2 
2000 N N   . CYS A 312 ? 1.8827 1.9202 1.7917 -0.2274 0.0140  -0.0677 582 CYS A N   
2001 C CA  . CYS A 312 ? 2.0385 2.1454 1.9692 -0.2152 0.0238  -0.1070 582 CYS A CA  
2002 C C   . CYS A 312 ? 1.9179 2.1239 1.9342 -0.2019 0.0238  -0.1260 582 CYS A C   
2003 O O   . CYS A 312 ? 1.9354 2.2268 1.9563 -0.2104 0.0407  -0.1545 582 CYS A O   
2004 C CB  . CYS A 312 ? 2.0794 2.1569 2.0349 -0.1739 0.0088  -0.1317 582 CYS A CB  
2005 S SG  . CYS A 312 ? 2.1133 2.2898 2.0933 -0.1546 0.0201  -0.1899 582 CYS A SG  
2006 N N   . PHE A 313 ? 1.8480 2.0467 1.9291 -0.1819 0.0043  -0.1087 583 PHE A N   
2007 C CA  . PHE A 313 ? 1.8735 2.1548 2.0391 -0.1632 -0.0033 -0.1230 583 PHE A CA  
2008 C C   . PHE A 313 ? 1.8971 2.2219 2.0476 -0.1999 0.0076  -0.1015 583 PHE A C   
2009 O O   . PHE A 313 ? 1.9397 2.3281 2.1562 -0.1862 -0.0016 -0.1063 583 PHE A O   
2010 C CB  . PHE A 313 ? 2.0470 2.3000 2.2965 -0.1228 -0.0356 -0.1083 583 PHE A CB  
2011 C CG  . PHE A 313 ? 2.1002 2.3371 2.4117 -0.0773 -0.0569 -0.1370 583 PHE A CG  
2012 C CD1 . PHE A 313 ? 2.1069 2.4034 2.5119 -0.0379 -0.0758 -0.1711 583 PHE A CD1 
2013 C CD2 . PHE A 313 ? 2.0599 2.2144 2.3458 -0.0702 -0.0649 -0.1282 583 PHE A CD2 
2014 C CE1 . PHE A 313 ? 2.1114 2.3773 2.5793 0.0053  -0.1029 -0.1963 583 PHE A CE1 
2015 C CE2 . PHE A 313 ? 2.1026 2.2324 2.4510 -0.0295 -0.0898 -0.1528 583 PHE A CE2 
2016 C CZ  . PHE A 313 ? 2.1540 2.3362 2.5950 0.0082  -0.1101 -0.1877 583 PHE A CZ  
2017 N N   . SER A 314 ? 1.8151 2.0914 1.8809 -0.2428 0.0208  -0.0754 584 SER A N   
2018 C CA  . SER A 314 ? 1.8282 2.1342 1.8629 -0.2866 0.0316  -0.0581 584 SER A CA  
2019 C C   . SER A 314 ? 1.8962 2.2674 1.8937 -0.3242 0.0586  -0.0795 584 SER A C   
2020 O O   . SER A 314 ? 1.9087 2.3558 1.9173 -0.3535 0.0693  -0.0828 584 SER A O   
2021 C CB  . SER A 314 ? 1.7995 2.0113 1.7641 -0.3104 0.0267  -0.0230 584 SER A CB  
2022 O OG  . SER A 314 ? 1.9711 2.1355 1.8495 -0.3464 0.0409  -0.0203 584 SER A OG  
2023 N N   . LEU A 315 ? 1.9861 2.3243 1.9343 -0.3262 0.0684  -0.0897 585 LEU A N   
2024 C CA  . LEU A 315 ? 2.0197 2.4248 1.9335 -0.3549 0.0936  -0.1100 585 LEU A CA  
2025 C C   . LEU A 315 ? 2.0077 2.5456 2.0127 -0.3274 0.0979  -0.1510 585 LEU A C   
2026 O O   . LEU A 315 ? 2.0075 2.6399 2.0219 -0.3599 0.1150  -0.1582 585 LEU A O   
2027 C CB  . LEU A 315 ? 2.1826 2.5362 2.0438 -0.3438 0.0966  -0.1187 585 LEU A CB  
2028 N N   . GLN A 316 ? 2.1038 2.6512 2.1769 -0.2685 0.0809  -0.1808 586 GLN A N   
2029 C CA  . GLN A 316 ? 2.1434 2.7973 2.3172 -0.2313 0.0728  -0.2179 586 GLN A CA  
2030 C C   . GLN A 316 ? 2.1814 2.8608 2.4148 -0.2280 0.0568  -0.1996 586 GLN A C   
2031 O O   . GLN A 316 ? 2.1149 2.8871 2.4305 -0.1986 0.0482  -0.2296 586 GLN A O   
2032 C CB  . GLN A 316 ? 2.0378 2.6698 2.2758 -0.1662 0.0480  -0.2501 586 GLN A CB  
2033 N N   . ARG A 317 ? 2.2733 2.8754 2.4609 -0.2578 0.0523  -0.1534 587 ARG A N   
2034 C CA  . ARG A 317 ? 2.4145 3.0484 2.6312 -0.2707 0.0434  -0.1330 587 ARG A CA  
2035 C C   . ARG A 317 ? 2.4313 3.0856 2.7436 -0.2182 0.0125  -0.1355 587 ARG A C   
2036 O O   . ARG A 317 ? 2.3943 3.1184 2.7526 -0.2184 0.0046  -0.1346 587 ARG A O   
2037 C CB  . ARG A 317 ? 2.3375 3.0880 2.5557 -0.3099 0.0665  -0.1520 587 ARG A CB  
2038 N N   . GLU A 318 ? 2.3554 2.9358 2.6921 -0.1777 -0.0087 -0.1297 588 GLU A N   
2039 C CA  . GLU A 318 ? 2.1200 2.7009 2.5441 -0.1307 -0.0427 -0.1230 588 GLU A CA  
2040 C C   . GLU A 318 ? 1.9463 2.4278 2.3302 -0.1411 -0.0530 -0.0721 588 GLU A C   
2041 O O   . GLU A 318 ? 1.9743 2.3767 2.2960 -0.1546 -0.0439 -0.0602 588 GLU A O   
2042 C CB  . GLU A 318 ? 1.9741 2.5586 2.4690 -0.0773 -0.0619 -0.1603 588 GLU A CB  
2043 N N   . HIS A 319 ? 1.7609 2.2536 2.1750 -0.1365 -0.0713 -0.0418 589 HIS A N   
2044 C CA  . HIS A 319 ? 1.7673 2.1939 2.1331 -0.1547 -0.0751 0.0048  589 HIS A CA  
2045 C C   . HIS A 319 ? 1.8631 2.2345 2.2729 -0.1220 -0.1040 0.0383  589 HIS A C   
2046 O O   . HIS A 319 ? 2.0426 2.3518 2.4076 -0.1338 -0.1033 0.0710  589 HIS A O   
2047 C CB  . HIS A 319 ? 1.7892 2.2728 2.1420 -0.1811 -0.0732 0.0194  589 HIS A CB  
2048 N N   . ASP A 320 ? 1.7770 2.1737 2.2761 -0.0818 -0.1306 0.0298  590 ASP A N   
2049 C CA  . ASP A 320 ? 1.7771 2.1169 2.3284 -0.0523 -0.1622 0.0632  590 ASP A CA  
2050 C C   . ASP A 320 ? 1.7701 2.0290 2.2992 -0.0495 -0.1586 0.0613  590 ASP A C   
2051 O O   . ASP A 320 ? 1.8139 2.0172 2.3368 -0.0518 -0.1689 0.1026  590 ASP A O   
2052 C CB  . ASP A 320 ? 1.7545 2.1282 2.4096 -0.0076 -0.1961 0.0463  590 ASP A CB  
2053 C CG  . ASP A 320 ? 1.7394 2.1831 2.4272 -0.0037 -0.2110 0.0629  590 ASP A CG  
2054 O OD1 . ASP A 320 ? 1.8340 2.2772 2.4809 -0.0277 -0.2085 0.1077  590 ASP A OD1 
2055 O OD2 . ASP A 320 ? 1.6430 2.1458 2.3997 0.0268  -0.2278 0.0286  590 ASP A OD2 
2056 N N   . ILE A 321 ? 1.7658 2.0271 2.2830 -0.0451 -0.1437 0.0126  591 ILE A N   
2057 C CA  . ILE A 321 ? 1.7273 1.9197 2.2353 -0.0351 -0.1455 0.0019  591 ILE A CA  
2058 C C   . ILE A 321 ? 1.7582 1.8975 2.1720 -0.0685 -0.1221 0.0217  591 ILE A C   
2059 O O   . ILE A 321 ? 1.8641 1.9398 2.2741 -0.0636 -0.1309 0.0403  591 ILE A O   
2060 C CB  . ILE A 321 ? 1.6957 1.9177 2.2184 -0.0164 -0.1385 -0.0605 591 ILE A CB  
2061 N N   . ALA A 322 ? 1.6191 1.7863 1.9613 -0.1025 -0.0950 0.0171  592 ALA A N   
2062 C CA  . ALA A 322 ? 1.6169 1.7343 1.8668 -0.1341 -0.0761 0.0328  592 ALA A CA  
2063 C C   . ALA A 322 ? 1.6288 1.7129 1.8691 -0.1385 -0.0864 0.0792  592 ALA A C   
2064 O O   . ALA A 322 ? 1.6184 1.6453 1.8154 -0.1435 -0.0835 0.0912  592 ALA A O   
2065 C CB  . ALA A 322 ? 1.6259 1.7817 1.8134 -0.1714 -0.0515 0.0200  592 ALA A CB  
2066 N N   . ILE A 323 ? 1.6041 1.7321 1.8834 -0.1355 -0.0986 0.1041  593 ILE A N   
2067 C CA  . ILE A 323 ? 1.5793 1.6949 1.8538 -0.1384 -0.1088 0.1501  593 ILE A CA  
2068 C C   . ILE A 323 ? 1.6221 1.6865 1.9306 -0.1195 -0.1242 0.1715  593 ILE A C   
2069 O O   . ILE A 323 ? 1.8076 1.8416 2.0765 -0.1285 -0.1197 0.1932  593 ILE A O   
2070 C CB  . ILE A 323 ? 1.4826 1.6590 1.8069 -0.1317 -0.1255 0.1750  593 ILE A CB  
2071 N N   . LYS A 324 ? 1.5883 1.6471 1.9743 -0.0928 -0.1443 0.1625  594 LYS A N   
2072 C CA  . LYS A 324 ? 1.5107 1.5203 1.9421 -0.0770 -0.1633 0.1804  594 LYS A CA  
2073 C C   . LYS A 324 ? 1.5840 1.5411 1.9632 -0.0835 -0.1492 0.1634  594 LYS A C   
2074 O O   . LYS A 324 ? 1.6604 1.5886 2.0417 -0.0857 -0.1550 0.1919  594 LYS A O   
2075 C CB  . LYS A 324 ? 1.4288 1.4357 1.9512 -0.0457 -0.1900 0.1587  594 LYS A CB  
2076 N N   . PHE A 325 ? 1.6310 1.5805 1.9663 -0.0862 -0.1322 0.1182  595 PHE A N   
2077 C CA  . PHE A 325 ? 1.6187 1.5179 1.8955 -0.0917 -0.1207 0.1022  595 PHE A CA  
2078 C C   . PHE A 325 ? 1.6311 1.5127 1.8318 -0.1133 -0.1065 0.1241  595 PHE A C   
2079 O O   . PHE A 325 ? 1.7118 1.5551 1.8962 -0.1102 -0.1090 0.1316  595 PHE A O   
2080 C CB  . PHE A 325 ? 1.6603 1.5612 1.9003 -0.0924 -0.1064 0.0545  595 PHE A CB  
2081 C CG  . PHE A 325 ? 1.7205 1.6333 2.0322 -0.0638 -0.1223 0.0219  595 PHE A CG  
2082 C CD1 . PHE A 325 ? 1.8382 1.7263 2.2304 -0.0406 -0.1508 0.0345  595 PHE A CD1 
2083 C CD2 . PHE A 325 ? 1.6914 1.6404 1.9912 -0.0603 -0.1106 -0.0226 595 PHE A CD2 
2084 C CE1 . PHE A 325 ? 1.7630 1.6550 2.2267 -0.0109 -0.1715 -0.0005 595 PHE A CE1 
2085 C CE2 . PHE A 325 ? 1.6893 1.6543 2.0577 -0.0281 -0.1278 -0.0604 595 PHE A CE2 
2086 C CZ  . PHE A 325 ? 1.6327 1.5648 2.0845 -0.0014 -0.1603 -0.0519 595 PHE A CZ  
2087 N N   . PHE A 326 ? 1.5107 1.4224 1.6668 -0.1336 -0.0934 0.1291  596 PHE A N   
2088 C CA  . PHE A 326 ? 1.4792 1.3758 1.5626 -0.1518 -0.0831 0.1419  596 PHE A CA  
2089 C C   . PHE A 326 ? 1.4855 1.3897 1.6001 -0.1430 -0.0944 0.1797  596 PHE A C   
2090 O O   . PHE A 326 ? 1.4652 1.3493 1.5369 -0.1455 -0.0907 0.1862  596 PHE A O   
2091 C CB  . PHE A 326 ? 1.4908 1.4246 1.5366 -0.1748 -0.0729 0.1406  596 PHE A CB  
2092 C CG  . PHE A 326 ? 1.5113 1.4325 1.5036 -0.1949 -0.0579 0.1086  596 PHE A CG  
2093 C CD1 . PHE A 326 ? 1.6501 1.5101 1.5761 -0.2021 -0.0516 0.0936  596 PHE A CD1 
2094 C CD2 . PHE A 326 ? 1.5199 1.4942 1.5280 -0.2080 -0.0512 0.0958  596 PHE A CD2 
2095 C CE1 . PHE A 326 ? 1.7013 1.5486 1.5739 -0.2256 -0.0389 0.0720  596 PHE A CE1 
2096 C CE2 . PHE A 326 ? 1.5488 1.5201 1.5073 -0.2328 -0.0355 0.0711  596 PHE A CE2 
2097 C CZ  . PHE A 326 ? 1.6202 1.5256 1.5088 -0.2435 -0.0294 0.0621  596 PHE A CZ  
2098 N N   . GLN A 327 ? 1.5168 1.4542 1.7081 -0.1325 -0.1096 0.2051  597 GLN A N   
2099 C CA  . GLN A 327 ? 1.4888 1.4400 1.7192 -0.1281 -0.1219 0.2489  597 GLN A CA  
2100 C C   . GLN A 327 ? 1.6390 1.5494 1.8869 -0.1193 -0.1276 0.2497  597 GLN A C   
2101 O O   . GLN A 327 ? 1.7150 1.6351 1.9495 -0.1236 -0.1254 0.2739  597 GLN A O   
2102 C CB  . GLN A 327 ? 1.3387 1.3197 1.6533 -0.1184 -0.1430 0.2765  597 GLN A CB  
2103 N N   . ARG A 328 ? 1.6812 1.5548 1.9611 -0.1061 -0.1353 0.2207  598 ARG A N   
2104 C CA  . ARG A 328 ? 1.6067 1.4415 1.9041 -0.0975 -0.1428 0.2148  598 ARG A CA  
2105 C C   . ARG A 328 ? 1.4414 1.2549 1.6575 -0.1029 -0.1268 0.1995  598 ARG A C   
2106 O O   . ARG A 328 ? 1.4603 1.2670 1.6841 -0.1001 -0.1306 0.2111  598 ARG A O   
2107 C CB  . ARG A 328 ? 1.5340 1.3364 1.8686 -0.0804 -0.1540 0.1754  598 ARG A CB  
2108 N N   . ALA A 329 ? 1.4126 1.2172 1.5535 -0.1112 -0.1111 0.1742  599 ALA A N   
2109 C CA  . ALA A 329 ? 1.5735 1.3497 1.6336 -0.1151 -0.1010 0.1594  599 ALA A CA  
2110 C C   . ALA A 329 ? 1.6940 1.5049 1.7408 -0.1190 -0.0985 0.1872  599 ALA A C   
2111 O O   . ALA A 329 ? 1.7730 1.5693 1.7861 -0.1124 -0.0977 0.1802  599 ALA A O   
2112 C CB  . ALA A 329 ? 1.5303 1.2876 1.5180 -0.1290 -0.0886 0.1334  599 ALA A CB  
2113 N N   . ILE A 330 ? 1.5924 1.4559 1.6658 -0.1274 -0.0985 0.2168  600 ILE A N   
2114 C CA  . ILE A 330 ? 1.5893 1.5025 1.6523 -0.1309 -0.0958 0.2449  600 ILE A CA  
2115 C C   . ILE A 330 ? 1.6245 1.5636 1.7488 -0.1258 -0.1039 0.2784  600 ILE A C   
2116 O O   . ILE A 330 ? 1.7737 1.7424 1.8786 -0.1237 -0.0991 0.2863  600 ILE A O   
2117 C CB  . ILE A 330 ? 1.6518 1.6190 1.7209 -0.1420 -0.0950 0.2678  600 ILE A CB  
2118 C CG1 . ILE A 330 ? 1.5816 1.5299 1.5886 -0.1525 -0.0866 0.2342  600 ILE A CG1 
2119 C CG2 . ILE A 330 ? 1.8729 1.9046 1.9330 -0.1445 -0.0928 0.2992  600 ILE A CG2 
2120 C CD1 . ILE A 330 ? 1.6683 1.6603 1.6969 -0.1622 -0.0885 0.2458  600 ILE A CD1 
2121 N N   . GLN A 331 ? 1.5397 1.4697 1.7406 -0.1241 -0.1176 0.2959  601 GLN A N   
2122 C CA  . GLN A 331 ? 1.5999 1.5485 1.8669 -0.1254 -0.1287 0.3313  601 GLN A CA  
2123 C C   . GLN A 331 ? 1.6477 1.5666 1.9051 -0.1165 -0.1279 0.3061  601 GLN A C   
2124 O O   . GLN A 331 ? 1.7748 1.7327 2.0448 -0.1201 -0.1259 0.3274  601 GLN A O   
2125 C CB  . GLN A 331 ? 1.4954 1.4266 1.8504 -0.1245 -0.1503 0.3511  601 GLN A CB  
2126 N N   . VAL A 332 ? 1.4938 1.3517 1.7288 -0.1050 -0.1297 0.2608  602 VAL A N   
2127 C CA  . VAL A 332 ? 1.5989 1.4251 1.8208 -0.0935 -0.1323 0.2333  602 VAL A CA  
2128 C C   . VAL A 332 ? 1.7946 1.6265 1.9372 -0.0874 -0.1199 0.2143  602 VAL A C   
2129 O O   . VAL A 332 ? 2.0169 1.8412 2.1553 -0.0762 -0.1236 0.1992  602 VAL A O   
2130 C CB  . VAL A 332 ? 1.5823 1.3454 1.7975 -0.0816 -0.1395 0.1906  602 VAL A CB  
2131 C CG1 . VAL A 332 ? 1.5275 1.2852 1.8234 -0.0811 -0.1552 0.1986  602 VAL A CG1 
2132 C CG2 . VAL A 332 ? 1.6252 1.3594 1.7524 -0.0819 -0.1262 0.1595  602 VAL A CG2 
2133 N N   . ASP A 333 ? 1.6897 1.5351 1.7731 -0.0929 -0.1086 0.2121  603 ASP A N   
2134 C CA  . ASP A 333 ? 1.6203 1.4743 1.6353 -0.0849 -0.1018 0.1938  603 ASP A CA  
2135 C C   . ASP A 333 ? 1.5770 1.4677 1.5523 -0.0949 -0.0929 0.2025  603 ASP A C   
2136 O O   . ASP A 333 ? 1.5384 1.3914 1.4650 -0.1013 -0.0905 0.1822  603 ASP A O   
2137 C CB  . ASP A 333 ? 1.5837 1.3599 1.5342 -0.0726 -0.1059 0.1487  603 ASP A CB  
2138 C CG  . ASP A 333 ? 1.6087 1.3786 1.4903 -0.0591 -0.1062 0.1243  603 ASP A CG  
2139 O OD1 . ASP A 333 ? 1.7071 1.5384 1.5846 -0.0582 -0.1007 0.1355  603 ASP A OD1 
2140 O OD2 . ASP A 333 ? 1.5909 1.2937 1.4206 -0.0474 -0.1143 0.0923  603 ASP A OD2 
2141 N N   . PRO A 334 ? 1.7000 1.6704 1.6965 -0.0985 -0.0883 0.2335  604 PRO A N   
2142 C CA  . PRO A 334 ? 1.7410 1.7590 1.7028 -0.1063 -0.0819 0.2420  604 PRO A CA  
2143 C C   . PRO A 334 ? 1.6886 1.7013 1.5725 -0.0934 -0.0800 0.2026  604 PRO A C   
2144 O O   . PRO A 334 ? 1.7177 1.7666 1.5674 -0.0980 -0.0772 0.2006  604 PRO A O   
2145 C CB  . PRO A 334 ? 1.9030 2.0136 1.9192 -0.1142 -0.0793 0.2932  604 PRO A CB  
2146 C CG  . PRO A 334 ? 1.9090 2.0290 1.9634 -0.1068 -0.0811 0.2978  604 PRO A CG  
2147 C CD  . PRO A 334 ? 1.8033 1.8306 1.8585 -0.0977 -0.0894 0.2637  604 PRO A CD  
2148 N N   . ASN A 335 ? 1.7254 1.6919 1.5829 -0.0755 -0.0851 0.1695  605 ASN A N   
2149 C CA  . ASN A 335 ? 1.8243 1.7649 1.6083 -0.0594 -0.0904 0.1265  605 ASN A CA  
2150 C C   . ASN A 335 ? 1.9409 1.7738 1.6731 -0.0632 -0.0990 0.0963  605 ASN A C   
2151 O O   . ASN A 335 ? 1.9724 1.7503 1.6484 -0.0477 -0.1105 0.0602  605 ASN A O   
2152 C CB  . ASN A 335 ? 1.8215 1.7901 1.6079 -0.0328 -0.0941 0.1086  605 ASN A CB  
2153 N N   . TYR A 336 ? 2.0208 1.8269 1.7738 -0.0839 -0.0949 0.1123  606 TYR A N   
2154 C CA  . TYR A 336 ? 2.0668 1.7861 1.7745 -0.0941 -0.0993 0.0907  606 TYR A CA  
2155 C C   . TYR A 336 ? 1.9515 1.6761 1.6343 -0.1185 -0.0950 0.0924  606 TYR A C   
2156 O O   . TYR A 336 ? 1.9027 1.6609 1.6272 -0.1343 -0.0871 0.1141  606 TYR A O   
2157 C CB  . TYR A 336 ? 2.1613 1.8570 1.9135 -0.0965 -0.0978 0.1000  606 TYR A CB  
2158 C CG  . TYR A 336 ? 2.1555 1.7807 1.8673 -0.1093 -0.0988 0.0827  606 TYR A CG  
2159 C CD1 . TYR A 336 ? 2.0726 1.6232 1.7240 -0.1008 -0.1093 0.0579  606 TYR A CD1 
2160 C CD2 . TYR A 336 ? 2.1562 1.7953 1.8916 -0.1292 -0.0902 0.0923  606 TYR A CD2 
2161 C CE1 . TYR A 336 ? 2.0697 1.5631 1.6804 -0.1166 -0.1093 0.0483  606 TYR A CE1 
2162 C CE2 . TYR A 336 ? 2.1552 1.7465 1.8543 -0.1432 -0.0880 0.0774  606 TYR A CE2 
2163 C CZ  . TYR A 336 ? 2.0993 1.6187 1.7340 -0.1391 -0.0966 0.0580  606 TYR A CZ  
2164 O OH  . TYR A 336 ? 2.1117 1.5908 1.7063 -0.1573 -0.0934 0.0491  606 TYR A OH  
2165 N N   . ALA A 337 ? 1.8984 1.5893 1.5165 -0.1203 -0.1033 0.0669  607 ALA A N   
2166 C CA  . ALA A 337 ? 1.8911 1.5973 1.4863 -0.1433 -0.1022 0.0649  607 ALA A CA  
2167 C C   . ALA A 337 ? 1.7646 1.4503 1.3666 -0.1732 -0.0947 0.0735  607 ALA A C   
2168 O O   . ALA A 337 ? 1.7364 1.4791 1.3702 -0.1884 -0.0874 0.0896  607 ALA A O   
2169 C CB  . ALA A 337 ? 2.1065 1.7593 1.6305 -0.1400 -0.1187 0.0301  607 ALA A CB  
2170 N N   . TYR A 338 ? 1.8687 1.4789 1.4389 -0.1804 -0.0973 0.0618  608 TYR A N   
2171 C CA  . TYR A 338 ? 1.9634 1.5545 1.5247 -0.2115 -0.0897 0.0635  608 TYR A CA  
2172 C C   . TYR A 338 ? 1.9094 1.5716 1.5427 -0.2162 -0.0760 0.0834  608 TYR A C   
2173 O O   . TYR A 338 ? 1.9011 1.5895 1.5402 -0.2412 -0.0689 0.0850  608 TYR A O   
2174 C CB  . TYR A 338 ? 1.9494 1.4605 1.4687 -0.2140 -0.0937 0.0531  608 TYR A CB  
2175 C CG  . TYR A 338 ? 1.8731 1.3671 1.3678 -0.2511 -0.0854 0.0538  608 TYR A CG  
2176 C CD1 . TYR A 338 ? 1.9164 1.4222 1.3912 -0.2838 -0.0843 0.0531  608 TYR A CD1 
2177 C CD2 . TYR A 338 ? 1.7978 1.2699 1.2873 -0.2550 -0.0790 0.0535  608 TYR A CD2 
2178 C CE1 . TYR A 338 ? 1.9300 1.4314 1.3852 -0.3224 -0.0751 0.0553  608 TYR A CE1 
2179 C CE2 . TYR A 338 ? 1.9127 1.3837 1.3775 -0.2912 -0.0687 0.0548  608 TYR A CE2 
2180 C CZ  . TYR A 338 ? 2.0329 1.5204 1.4824 -0.3265 -0.0659 0.0572  608 TYR A CZ  
2181 O OH  . TYR A 338 ? 2.2281 1.7258 1.6568 -0.3670 -0.0541 0.0602  608 TYR A OH  
2182 N N   . ALA A 339 ? 1.7765 1.4686 1.4675 -0.1922 -0.0749 0.0972  609 ALA A N   
2183 C CA  . ALA A 339 ? 1.6960 1.4437 1.4610 -0.1913 -0.0688 0.1147  609 ALA A CA  
2184 C C   . ALA A 339 ? 1.7161 1.5325 1.5074 -0.2011 -0.0674 0.1317  609 ALA A C   
2185 O O   . ALA A 339 ? 1.6975 1.5510 1.5258 -0.2109 -0.0636 0.1363  609 ALA A O   
2186 C CB  . ALA A 339 ? 1.6707 1.4297 1.4939 -0.1661 -0.0737 0.1289  609 ALA A CB  
2187 N N   . TYR A 340 ? 1.7577 1.5979 1.5308 -0.1955 -0.0719 0.1385  610 TYR A N   
2188 C CA  . TYR A 340 ? 1.7781 1.6855 1.5638 -0.2041 -0.0727 0.1526  610 TYR A CA  
2189 C C   . TYR A 340 ? 1.8039 1.7020 1.5554 -0.2323 -0.0704 0.1331  610 TYR A C   
2190 O O   . TYR A 340 ? 1.7957 1.7456 1.5825 -0.2433 -0.0685 0.1421  610 TYR A O   
2191 C CB  . TYR A 340 ? 1.9160 1.8512 1.6733 -0.1924 -0.0776 0.1540  610 TYR A CB  
2192 C CG  . TYR A 340 ? 1.9114 1.8825 1.7091 -0.1703 -0.0779 0.1799  610 TYR A CG  
2193 C CD1 . TYR A 340 ? 2.0586 1.9931 1.8858 -0.1585 -0.0775 0.1835  610 TYR A CD1 
2194 C CD2 . TYR A 340 ? 1.7841 1.8317 1.5896 -0.1637 -0.0788 0.2010  610 TYR A CD2 
2195 C CE1 . TYR A 340 ? 2.0019 1.9728 1.8708 -0.1440 -0.0785 0.2086  610 TYR A CE1 
2196 C CE2 . TYR A 340 ? 1.8348 1.9245 1.6776 -0.1499 -0.0775 0.2294  610 TYR A CE2 
2197 C CZ  . TYR A 340 ? 1.9184 1.9681 1.7955 -0.1417 -0.0776 0.2337  610 TYR A CZ  
2198 O OH  . TYR A 340 ? 1.9271 2.0219 1.8464 -0.1333 -0.0770 0.2636  610 TYR A OH  
2199 N N   . THR A 341 ? 1.7770 1.6084 1.4616 -0.2444 -0.0730 0.1074  611 THR A N   
2200 C CA  . THR A 341 ? 1.7534 1.5640 1.3983 -0.2782 -0.0728 0.0901  611 THR A CA  
2201 C C   . THR A 341 ? 1.6997 1.5339 1.3772 -0.2983 -0.0611 0.0928  611 THR A C   
2202 O O   . THR A 341 ? 1.7171 1.6016 1.4098 -0.3196 -0.0587 0.0921  611 THR A O   
2203 C CB  . THR A 341 ? 1.7785 1.4932 1.3496 -0.2875 -0.0811 0.0681  611 THR A CB  
2204 O OG1 . THR A 341 ? 1.8550 1.5543 1.3940 -0.2681 -0.0951 0.0557  611 THR A OG1 
2205 C CG2 . THR A 341 ? 1.8078 1.4966 1.3416 -0.3304 -0.0817 0.0569  611 THR A CG2 
2206 N N   . LEU A 342 ? 1.7079 1.5128 1.3974 -0.2894 -0.0546 0.0921  612 LEU A N   
2207 C CA  . LEU A 342 ? 1.7514 1.5861 1.4728 -0.3019 -0.0429 0.0883  612 LEU A CA  
2208 C C   . LEU A 342 ? 1.8338 1.7548 1.6337 -0.2911 -0.0419 0.0994  612 LEU A C   
2209 O O   . LEU A 342 ? 1.9420 1.9085 1.7662 -0.3065 -0.0339 0.0905  612 LEU A O   
2210 C CB  . LEU A 342 ? 1.6301 1.4245 1.3542 -0.2851 -0.0395 0.0824  612 LEU A CB  
2211 C CG  . LEU A 342 ? 1.6554 1.3691 1.3041 -0.2994 -0.0394 0.0707  612 LEU A CG  
2212 C CD1 . LEU A 342 ? 1.6309 1.3043 1.2861 -0.2668 -0.0452 0.0690  612 LEU A CD1 
2213 C CD2 . LEU A 342 ? 1.7013 1.4282 1.3310 -0.3317 -0.0258 0.0617  612 LEU A CD2 
2214 N N   . LEU A 343 ? 1.7660 1.7130 1.6063 -0.2650 -0.0512 0.1199  613 LEU A N   
2215 C CA  . LEU A 343 ? 1.6220 1.6445 1.5322 -0.2545 -0.0566 0.1367  613 LEU A CA  
2216 C C   . LEU A 343 ? 1.6705 1.7444 1.5682 -0.2770 -0.0578 0.1347  613 LEU A C   
2217 O O   . LEU A 343 ? 1.6717 1.8029 1.6110 -0.2829 -0.0570 0.1307  613 LEU A O   
2218 C CB  . LEU A 343 ? 1.5987 1.6339 1.5479 -0.2271 -0.0679 0.1674  613 LEU A CB  
2219 N N   . GLY A 344 ? 1.7889 1.8466 1.6328 -0.2868 -0.0621 0.1335  614 GLY A N   
2220 C CA  . GLY A 344 ? 1.9261 2.0263 1.7517 -0.3097 -0.0663 0.1260  614 GLY A CA  
2221 C C   . GLY A 344 ? 1.9428 2.0597 1.7679 -0.3427 -0.0580 0.1061  614 GLY A C   
2222 O O   . GLY A 344 ? 2.0731 2.2637 1.9377 -0.3497 -0.0604 0.1069  614 GLY A O   
2223 N N   . HIS A 345 ? 1.7705 1.8240 1.5504 -0.3640 -0.0489 0.0900  615 HIS A N   
2224 C CA  . HIS A 345 ? 1.7968 1.8685 1.5713 -0.4014 -0.0376 0.0745  615 HIS A CA  
2225 C C   . HIS A 345 ? 1.7598 1.9153 1.6097 -0.3902 -0.0298 0.0735  615 HIS A C   
2226 O O   . HIS A 345 ? 1.8626 2.0849 1.7344 -0.4143 -0.0256 0.0635  615 HIS A O   
2227 C CB  . HIS A 345 ? 1.8440 1.8337 1.5614 -0.4194 -0.0292 0.0665  615 HIS A CB  
2228 C CG  . HIS A 345 ? 1.8693 1.7733 1.5114 -0.4361 -0.0412 0.0620  615 HIS A CG  
2229 N ND1 . HIS A 345 ? 1.8256 1.7027 1.4523 -0.4092 -0.0561 0.0640  615 HIS A ND1 
2230 C CD2 . HIS A 345 ? 1.8988 1.7380 1.4782 -0.4757 -0.0432 0.0550  615 HIS A CD2 
2231 C CE1 . HIS A 345 ? 1.8370 1.6356 1.3971 -0.4267 -0.0683 0.0523  615 HIS A CE1 
2232 N NE2 . HIS A 345 ? 1.8382 1.6053 1.3683 -0.4682 -0.0625 0.0491  615 HIS A NE2 
2233 N N   . GLU A 346 ? 1.6563 1.8084 1.5489 -0.3529 -0.0301 0.0807  616 GLU A N   
2234 C CA  . GLU A 346 ? 1.6552 1.8772 1.6247 -0.3327 -0.0286 0.0748  616 GLU A CA  
2235 C C   . GLU A 346 ? 1.6564 1.9557 1.6855 -0.3178 -0.0432 0.0871  616 GLU A C   
2236 O O   . GLU A 346 ? 1.6669 2.0402 1.7511 -0.3139 -0.0431 0.0745  616 GLU A O   
2237 C CB  . GLU A 346 ? 1.5404 1.7266 1.5419 -0.2949 -0.0320 0.0782  616 GLU A CB  
2238 N N   . PHE A 347 ? 1.6617 1.9491 1.6781 -0.3081 -0.0566 0.1108  617 PHE A N   
2239 C CA  . PHE A 347 ? 1.5726 1.9308 1.6326 -0.2956 -0.0730 0.1283  617 PHE A CA  
2240 C C   . PHE A 347 ? 1.5772 1.9886 1.6177 -0.3296 -0.0717 0.1119  617 PHE A C   
2241 O O   . PHE A 347 ? 1.6189 2.1077 1.7051 -0.3228 -0.0837 0.1162  617 PHE A O   
2242 C CB  . PHE A 347 ? 1.5288 1.8665 1.5743 -0.2769 -0.0856 0.1605  617 PHE A CB  
2243 N N   . VAL A 348 ? 1.6100 1.9769 1.5843 -0.3666 -0.0604 0.0936  618 VAL A N   
2244 C CA  . VAL A 348 ? 1.6129 2.0208 1.5688 -0.4075 -0.0594 0.0751  618 VAL A CA  
2245 C C   . VAL A 348 ? 1.6510 2.1379 1.6627 -0.4175 -0.0497 0.0584  618 VAL A C   
2246 O O   . VAL A 348 ? 1.7566 2.3250 1.7999 -0.4299 -0.0563 0.0503  618 VAL A O   
2247 C CB  . VAL A 348 ? 1.7276 2.0559 1.6036 -0.4479 -0.0524 0.0612  618 VAL A CB  
2248 C CG1 . VAL A 348 ? 1.7430 2.1129 1.6088 -0.4977 -0.0518 0.0426  618 VAL A CG1 
2249 C CG2 . VAL A 348 ? 1.9109 2.1746 1.7353 -0.4340 -0.0654 0.0689  618 VAL A CG2 
2250 N N   . LEU A 349 ? 1.6557 2.1263 1.6805 -0.4103 -0.0348 0.0499  619 LEU A N   
2251 C CA  . LEU A 349 ? 1.6580 2.2122 1.7333 -0.4180 -0.0229 0.0275  619 LEU A CA  
2252 C C   . LEU A 349 ? 1.6177 2.2531 1.7812 -0.3745 -0.0398 0.0294  619 LEU A C   
2253 O O   . LEU A 349 ? 1.6393 2.3706 1.8485 -0.3826 -0.0406 0.0122  619 LEU A O   
2254 C CB  . LEU A 349 ? 1.6684 2.1891 1.7321 -0.4158 -0.0041 0.0151  619 LEU A CB  
2255 N N   . THR A 350 ? 1.6373 2.2348 1.8273 -0.3291 -0.0556 0.0511  620 THR A N   
2256 C CA  . THR A 350 ? 1.6442 2.3011 1.9150 -0.2869 -0.0791 0.0616  620 THR A CA  
2257 C C   . THR A 350 ? 1.7568 2.4618 2.0294 -0.2918 -0.0975 0.0798  620 THR A C   
2258 O O   . THR A 350 ? 1.8045 2.5630 2.1398 -0.2595 -0.1206 0.0926  620 THR A O   
2259 C CB  . THR A 350 ? 1.6013 2.1963 1.8988 -0.2435 -0.0942 0.0873  620 THR A CB  
2260 N N   . GLU A 351 ? 1.8813 2.5631 2.0844 -0.3297 -0.0906 0.0805  621 GLU A N   
2261 C CA  . GLU A 351 ? 2.0369 2.7672 2.2311 -0.3390 -0.1073 0.0900  621 GLU A CA  
2262 C C   . GLU A 351 ? 2.0983 2.8132 2.2989 -0.3025 -0.1287 0.1303  621 GLU A C   
2263 O O   . GLU A 351 ? 2.0896 2.8702 2.3227 -0.2866 -0.1503 0.1462  621 GLU A O   
2264 C CB  . GLU A 351 ? 1.9169 2.7590 2.1727 -0.3416 -0.1155 0.0709  621 GLU A CB  
2265 N N   . GLU A 352 ? 2.0535 2.6863 2.2222 -0.2910 -0.1232 0.1485  622 GLU A N   
2266 C CA  . GLU A 352 ? 2.0297 2.6495 2.1983 -0.2636 -0.1395 0.1904  622 GLU A CA  
2267 C C   . GLU A 352 ? 1.9831 2.5721 2.0732 -0.2809 -0.1355 0.1933  622 GLU A C   
2268 O O   . GLU A 352 ? 2.0455 2.5850 2.1107 -0.2683 -0.1332 0.2138  622 GLU A O   
2269 C CB  . GLU A 352 ? 2.1340 2.6958 2.3344 -0.2355 -0.1394 0.2099  622 GLU A CB  
2270 N N   . LEU A 353 ? 1.8693 2.4917 1.9247 -0.3092 -0.1363 0.1688  623 LEU A N   
2271 C CA  . LEU A 353 ? 1.8858 2.4747 1.8650 -0.3289 -0.1345 0.1546  623 LEU A CA  
2272 C C   . LEU A 353 ? 1.9424 2.5234 1.8925 -0.3046 -0.1417 0.1831  623 LEU A C   
2273 O O   . LEU A 353 ? 1.9310 2.4583 1.8226 -0.3103 -0.1358 0.1694  623 LEU A O   
2274 C CB  . LEU A 353 ? 1.8952 2.5457 1.8618 -0.3551 -0.1452 0.1301  623 LEU A CB  
2275 N N   . ASP A 354 ? 1.9946 2.6319 1.9862 -0.2778 -0.1557 0.2233  624 ASP A N   
2276 C CA  . ASP A 354 ? 2.0844 2.7352 2.0516 -0.2586 -0.1615 0.2569  624 ASP A CA  
2277 C C   . ASP A 354 ? 2.1360 2.7177 2.1011 -0.2458 -0.1490 0.2740  624 ASP A C   
2278 O O   . ASP A 354 ? 2.2809 2.8486 2.1992 -0.2419 -0.1439 0.2752  624 ASP A O   
2279 C CB  . ASP A 354 ? 2.0119 2.7426 2.0250 -0.2380 -0.1824 0.3036  624 ASP A CB  
2280 N N   . LYS A 355 ? 1.9261 2.4710 1.9444 -0.2373 -0.1457 0.2831  625 LYS A N   
2281 C CA  . LYS A 355 ? 1.8416 2.3170 1.8618 -0.2276 -0.1349 0.2917  625 LYS A CA  
2282 C C   . LYS A 355 ? 1.8560 2.2630 1.8133 -0.2443 -0.1183 0.2494  625 LYS A C   
2283 O O   . LYS A 355 ? 1.9861 2.3559 1.9108 -0.2374 -0.1122 0.2517  625 LYS A O   
2284 C CB  . LYS A 355 ? 1.8522 2.3033 1.9434 -0.2146 -0.1382 0.2997  625 LYS A CB  
2285 N N   . ALA A 356 ? 1.7438 2.1373 1.6867 -0.2671 -0.1127 0.2125  626 ALA A N   
2286 C CA  . ALA A 356 ? 1.7893 2.1132 1.6711 -0.2885 -0.1016 0.1754  626 ALA A CA  
2287 C C   . ALA A 356 ? 1.8645 2.1731 1.6813 -0.2884 -0.1059 0.1636  626 ALA A C   
2288 O O   . ALA A 356 ? 1.9372 2.1763 1.7137 -0.2862 -0.1006 0.1490  626 ALA A O   
2289 C CB  . ALA A 356 ? 1.7513 2.0859 1.6292 -0.3205 -0.0985 0.1456  626 ALA A CB  
2290 N N   . LEU A 357 ? 1.7215 2.0983 1.5283 -0.2879 -0.1177 0.1663  627 LEU A N   
2291 C CA  . LEU A 357 ? 1.7573 2.1372 1.5061 -0.2820 -0.1242 0.1497  627 LEU A CA  
2292 C C   . LEU A 357 ? 1.9008 2.2623 1.6420 -0.2556 -0.1180 0.1684  627 LEU A C   
2293 O O   . LEU A 357 ? 1.9933 2.2967 1.6886 -0.2519 -0.1162 0.1414  627 LEU A O   
2294 C CB  . LEU A 357 ? 1.6044 2.0813 1.3533 -0.2788 -0.1382 0.1571  627 LEU A CB  
2295 N N   . ALA A 358 ? 2.0000 2.4129 1.7890 -0.2382 -0.1174 0.2152  628 ALA A N   
2296 C CA  . ALA A 358 ? 2.0621 2.4745 1.8561 -0.2177 -0.1115 0.2409  628 ALA A CA  
2297 C C   . ALA A 358 ? 2.1329 2.4518 1.9205 -0.2155 -0.1016 0.2228  628 ALA A C   
2298 O O   . ALA A 358 ? 2.2091 2.5099 1.9697 -0.2021 -0.0978 0.2147  628 ALA A O   
2299 C CB  . ALA A 358 ? 1.9221 2.3886 1.7800 -0.2077 -0.1156 0.2998  628 ALA A CB  
2300 N N   . CYS A 359 ? 1.9727 2.2407 1.7855 -0.2272 -0.0981 0.2150  629 CYS A N   
2301 C CA  . CYS A 359 ? 1.8741 2.0541 1.6740 -0.2280 -0.0902 0.1945  629 CYS A CA  
2302 C C   . CYS A 359 ? 1.9133 2.0351 1.6404 -0.2337 -0.0917 0.1532  629 CYS A C   
2303 O O   . CYS A 359 ? 1.9273 2.0042 1.6332 -0.2189 -0.0901 0.1447  629 CYS A O   
2304 C CB  . CYS A 359 ? 1.8668 2.0204 1.6967 -0.2431 -0.0860 0.1867  629 CYS A CB  
2305 S SG  . CYS A 359 ? 2.6133 2.7949 2.5346 -0.2262 -0.0883 0.2235  629 CYS A SG  
2306 N N   . PHE A 360 ? 1.8194 1.9400 1.5114 -0.2547 -0.0980 0.1268  630 PHE A N   
2307 C CA  . PHE A 360 ? 1.9769 2.0306 1.6021 -0.2622 -0.1060 0.0868  630 PHE A CA  
2308 C C   . PHE A 360 ? 1.9583 2.0384 1.5532 -0.2355 -0.1138 0.0753  630 PHE A C   
2309 O O   . PHE A 360 ? 2.0060 2.0233 1.5593 -0.2239 -0.1201 0.0481  630 PHE A O   
2310 C CB  . PHE A 360 ? 2.0975 2.1491 1.6998 -0.2950 -0.1145 0.0630  630 PHE A CB  
2311 C CG  . PHE A 360 ? 1.9862 2.0101 1.6077 -0.3251 -0.1054 0.0659  630 PHE A CG  
2312 C CD1 . PHE A 360 ? 1.9613 1.9013 1.5626 -0.3330 -0.0991 0.0601  630 PHE A CD1 
2313 C CD2 . PHE A 360 ? 1.8753 1.9663 1.5349 -0.3442 -0.1035 0.0733  630 PHE A CD2 
2314 C CE1 . PHE A 360 ? 2.0237 1.9532 1.6399 -0.3611 -0.0885 0.0622  630 PHE A CE1 
2315 C CE2 . PHE A 360 ? 1.8295 1.9117 1.5095 -0.3707 -0.0932 0.0724  630 PHE A CE2 
2316 C CZ  . PHE A 360 ? 1.8685 1.8728 1.5255 -0.3800 -0.0844 0.0670  630 PHE A CZ  
2317 N N   . ARG A 361 ? 1.9427 2.1209 1.5592 -0.2238 -0.1141 0.0966  631 ARG A N   
2318 C CA  . ARG A 361 ? 1.9990 2.2290 1.5899 -0.1978 -0.1183 0.0877  631 ARG A CA  
2319 C C   . ARG A 361 ? 2.0401 2.2586 1.6465 -0.1745 -0.1087 0.1037  631 ARG A C   
2320 O O   . ARG A 361 ? 2.1793 2.3873 1.7510 -0.1534 -0.1130 0.0751  631 ARG A O   
2321 C CB  . ARG A 361 ? 2.0508 2.3988 1.6615 -0.1941 -0.1195 0.1156  631 ARG A CB  
2322 N N   . ASN A 362 ? 1.9434 2.1672 1.6060 -0.1771 -0.0983 0.1466  632 ASN A N   
2323 C CA  . ASN A 362 ? 1.9557 2.1656 1.6428 -0.1602 -0.0906 0.1636  632 ASN A CA  
2324 C C   . ASN A 362 ? 2.0749 2.1815 1.7245 -0.1552 -0.0940 0.1239  632 ASN A C   
2325 O O   . ASN A 362 ? 2.2915 2.3897 1.9258 -0.1335 -0.0949 0.1091  632 ASN A O   
2326 C CB  . ASN A 362 ? 1.8719 2.0904 1.6293 -0.1666 -0.0848 0.2111  632 ASN A CB  
2327 C CG  . ASN A 362 ? 1.8327 2.1486 1.6313 -0.1613 -0.0832 0.2618  632 ASN A CG  
2328 O OD1 . ASN A 362 ? 1.8000 2.1571 1.5992 -0.1484 -0.0786 0.2732  632 ASN A OD1 
2329 N ND2 . ASN A 362 ? 1.8304 2.1873 1.6645 -0.1720 -0.0882 0.2942  632 ASN A ND2 
2330 N N   . ALA A 363 ? 1.8794 1.9135 1.5155 -0.1761 -0.0965 0.1087  633 ALA A N   
2331 C CA  . ALA A 363 ? 1.8971 1.8269 1.4895 -0.1778 -0.1028 0.0758  633 ALA A CA  
2332 C C   . ALA A 363 ? 1.9375 1.8473 1.4717 -0.1614 -0.1179 0.0348  633 ALA A C   
2333 O O   . ALA A 363 ? 1.9272 1.7730 1.4334 -0.1441 -0.1258 0.0122  633 ALA A O   
2334 C CB  . ALA A 363 ? 1.8952 1.7725 1.4761 -0.2102 -0.1029 0.0690  633 ALA A CB  
2335 N N   . ILE A 364 ? 2.0782 2.0441 1.5955 -0.1640 -0.1247 0.0219  634 ILE A N   
2336 C CA  . ILE A 364 ? 2.1908 2.1486 1.6571 -0.1442 -0.1424 -0.0239 634 ILE A CA  
2337 C C   . ILE A 364 ? 2.2448 2.2718 1.7218 -0.1066 -0.1374 -0.0239 634 ILE A C   
2338 O O   . ILE A 364 ? 2.2835 2.2813 1.7254 -0.0796 -0.1512 -0.0648 634 ILE A O   
2339 C CB  . ILE A 364 ? 1.9698 1.9812 1.4179 -0.1565 -0.1526 -0.0414 634 ILE A CB  
2340 C CG1 . ILE A 364 ? 1.9564 1.9011 1.3919 -0.1967 -0.1601 -0.0483 634 ILE A CG1 
2341 C CG2 . ILE A 364 ? 2.1775 2.1985 1.5792 -0.1282 -0.1726 -0.0937 634 ILE A CG2 
2342 C CD1 . ILE A 364 ? 1.9753 1.7888 1.3686 -0.2069 -0.1749 -0.0751 634 ILE A CD1 
2343 N N   . ARG A 365 ? 2.2411 2.3597 1.7691 -0.1051 -0.1193 0.0225  635 ARG A N   
2344 C CA  . ARG A 365 ? 2.1874 2.3821 1.7322 -0.0766 -0.1113 0.0304  635 ARG A CA  
2345 C C   . ARG A 365 ? 2.2491 2.3809 1.7989 -0.0582 -0.1119 0.0193  635 ARG A C   
2346 O O   . ARG A 365 ? 2.5232 2.6751 2.0528 -0.0278 -0.1180 -0.0136 635 ARG A O   
2347 C CB  . ARG A 365 ? 2.1416 2.4384 1.7440 -0.0862 -0.0942 0.0924  635 ARG A CB  
2348 C CG  . ARG A 365 ? 2.1879 2.5697 1.8110 -0.0641 -0.0842 0.1061  635 ARG A CG  
2349 C CD  . ARG A 365 ? 2.3725 2.8897 2.0208 -0.0700 -0.0735 0.1531  635 ARG A CD  
2350 N NE  . ARG A 365 ? 2.4977 3.0199 2.1975 -0.0966 -0.0693 0.2140  635 ARG A NE  
2351 C CZ  . ARG A 365 ? 2.6101 3.2242 2.3236 -0.1078 -0.0676 0.2562  635 ARG A CZ  
2352 N NH1 . ARG A 365 ? 2.5746 3.2887 2.2501 -0.0966 -0.0670 0.2432  635 ARG A NH1 
2353 N NH2 . ARG A 365 ? 2.6814 3.2881 2.4452 -0.1278 -0.0690 0.3088  635 ARG A NH2 
2354 N N   . VAL A 366 ? 2.0475 2.1100 1.6248 -0.0737 -0.1069 0.0427  636 VAL A N   
2355 C CA  . VAL A 366 ? 1.9213 1.9244 1.5024 -0.0563 -0.1098 0.0315  636 VAL A CA  
2356 C C   . VAL A 366 ? 1.9296 1.8308 1.4486 -0.0411 -0.1311 -0.0212 636 VAL A C   
2357 O O   . VAL A 366 ? 1.9131 1.8088 1.4214 -0.0099 -0.1396 -0.0477 636 VAL A O   
2358 C CB  . VAL A 366 ? 2.0500 2.0048 1.6740 -0.0757 -0.1016 0.0654  636 VAL A CB  
2359 C CG1 . VAL A 366 ? 1.8861 1.8239 1.5130 -0.1068 -0.0986 0.0807  636 VAL A CG1 
2360 C CG2 . VAL A 366 ? 2.2574 2.1093 1.8574 -0.0657 -0.1116 0.0407  636 VAL A CG2 
2361 N N   . ASN A 367 ? 2.0247 1.8469 1.5048 -0.0637 -0.1418 -0.0355 637 ASN A N   
2362 C CA  . ASN A 367 ? 2.1212 1.8395 1.5392 -0.0545 -0.1675 -0.0811 637 ASN A CA  
2363 C C   . ASN A 367 ? 2.2593 1.9629 1.6377 -0.0707 -0.1824 -0.1069 637 ASN A C   
2364 O O   . ASN A 367 ? 2.1919 1.8751 1.5709 -0.1083 -0.1777 -0.0894 637 ASN A O   
2365 C CB  . ASN A 367 ? 2.1875 1.7939 1.5903 -0.0708 -0.1720 -0.0729 637 ASN A CB  
2366 C CG  . ASN A 367 ? 2.2914 1.7863 1.6330 -0.0547 -0.2025 -0.1128 637 ASN A CG  
2367 O OD1 . ASN A 367 ? 2.2662 1.7587 1.5779 -0.0318 -0.2231 -0.1522 637 ASN A OD1 
2368 N ND2 . ASN A 367 ? 2.4031 1.8054 1.7256 -0.0645 -0.2082 -0.1038 637 ASN A ND2 
2369 N N   . PRO A 368 ? 2.3961 2.1151 1.7432 -0.0418 -0.2019 -0.1523 638 PRO A N   
2370 C CA  . PRO A 368 ? 2.3705 2.0654 1.6812 -0.0588 -0.2209 -0.1814 638 PRO A CA  
2371 C C   . PRO A 368 ? 2.3955 1.9421 1.6596 -0.0834 -0.2468 -0.1988 638 PRO A C   
2372 O O   . PRO A 368 ? 2.5428 2.0663 1.7867 -0.1117 -0.2596 -0.2117 638 PRO A O   
2373 C CB  . PRO A 368 ? 2.4339 2.1879 1.7254 -0.0143 -0.2376 -0.2324 638 PRO A CB  
2374 C CG  . PRO A 368 ? 2.4410 2.2565 1.7608 0.0237  -0.2239 -0.2260 638 PRO A CG  
2375 C CD  . PRO A 368 ? 2.4295 2.1802 1.7716 0.0071  -0.2113 -0.1858 638 PRO A CD  
2376 N N   . ARG A 369 ? 2.2159 1.6670 1.4632 -0.0761 -0.2555 -0.1965 639 ARG A N   
2377 C CA  . ARG A 369 ? 2.1206 1.4319 1.3216 -0.1062 -0.2790 -0.2010 639 ARG A CA  
2378 C C   . ARG A 369 ? 2.3169 1.5959 1.5278 -0.1545 -0.2581 -0.1537 639 ARG A C   
2379 O O   . ARG A 369 ? 2.6377 1.8066 1.8084 -0.1812 -0.2745 -0.1500 639 ARG A O   
2380 C CB  . ARG A 369 ? 1.9659 1.1790 1.1310 -0.0700 -0.3085 -0.2283 639 ARG A CB  
2381 N N   . HIS A 370 ? 2.3029 1.6786 1.5664 -0.1655 -0.2240 -0.1183 640 HIS A N   
2382 C CA  . HIS A 370 ? 2.2778 1.6431 1.5580 -0.2060 -0.2032 -0.0804 640 HIS A CA  
2383 C C   . HIS A 370 ? 2.3075 1.6831 1.5831 -0.2522 -0.2031 -0.0779 640 HIS A C   
2384 O O   . HIS A 370 ? 2.3147 1.7880 1.6315 -0.2593 -0.1865 -0.0660 640 HIS A O   
2385 C CB  . HIS A 370 ? 2.1995 1.6549 1.5430 -0.1954 -0.1728 -0.0476 640 HIS A CB  
2386 C CG  . HIS A 370 ? 2.2123 1.6529 1.5721 -0.2271 -0.1553 -0.0190 640 HIS A CG  
2387 N ND1 . HIS A 370 ? 2.3642 1.7163 1.6892 -0.2356 -0.1610 -0.0165 640 HIS A ND1 
2388 C CD2 . HIS A 370 ? 2.1148 1.6224 1.5205 -0.2498 -0.1339 0.0054  640 HIS A CD2 
2389 C CE1 . HIS A 370 ? 2.3839 1.7566 1.7320 -0.2626 -0.1413 0.0062  640 HIS A CE1 
2390 N NE2 . HIS A 370 ? 2.2583 1.7237 1.6580 -0.2701 -0.1253 0.0177  640 HIS A NE2 
2391 N N   . TYR A 371 ? 2.2455 1.5212 1.4725 -0.2850 -0.2235 -0.0868 641 TYR A N   
2392 C CA  . TYR A 371 ? 2.0959 1.3702 1.3140 -0.3319 -0.2304 -0.0910 641 TYR A CA  
2393 C C   . TYR A 371 ? 2.0585 1.4235 1.3246 -0.3663 -0.1997 -0.0611 641 TYR A C   
2394 O O   . TYR A 371 ? 2.0737 1.4902 1.3538 -0.3886 -0.2017 -0.0689 641 TYR A O   
2395 C CB  . TYR A 371 ? 2.1436 1.2835 1.3030 -0.3677 -0.2565 -0.0937 641 TYR A CB  
2396 C CG  . TYR A 371 ? 2.2778 1.3880 1.4307 -0.4061 -0.2373 -0.0557 641 TYR A CG  
2397 C CD1 . TYR A 371 ? 2.2092 1.3720 1.3848 -0.4576 -0.2159 -0.0339 641 TYR A CD1 
2398 C CD2 . TYR A 371 ? 2.4936 1.5382 1.6206 -0.3873 -0.2393 -0.0440 641 TYR A CD2 
2399 C CE1 . TYR A 371 ? 2.3722 1.5245 1.5418 -0.4899 -0.1964 -0.0035 641 TYR A CE1 
2400 C CE2 . TYR A 371 ? 2.6300 1.6595 1.7478 -0.4197 -0.2212 -0.0120 641 TYR A CE2 
2401 C CZ  . TYR A 371 ? 2.6504 1.7364 1.7889 -0.4708 -0.1989 0.0075  641 TYR A CZ  
2402 O OH  . TYR A 371 ? 2.8024 1.8874 1.9309 -0.5012 -0.1794 0.0354  641 TYR A OH  
2403 N N   . ASN A 372 ? 2.1063 1.4903 1.3977 -0.3696 -0.1747 -0.0318 642 ASN A N   
2404 C CA  . ASN A 372 ? 2.0999 1.5670 1.4395 -0.3977 -0.1483 -0.0084 642 ASN A CA  
2405 C C   . ASN A 372 ? 2.2252 1.8046 1.6151 -0.3861 -0.1409 -0.0084 642 ASN A C   
2406 O O   . ASN A 372 ? 2.3011 1.9367 1.7156 -0.4171 -0.1340 -0.0037 642 ASN A O   
2407 C CB  . ASN A 372 ? 2.0608 1.5427 1.4281 -0.3873 -0.1257 0.0147  642 ASN A CB  
2408 C CG  . ASN A 372 ? 2.3689 1.7499 1.6842 -0.3973 -0.1323 0.0180  642 ASN A CG  
2409 O OD1 . ASN A 372 ? 2.5804 1.8764 1.8480 -0.3815 -0.1557 0.0040  642 ASN A OD1 
2410 N ND2 . ASN A 372 ? 2.4409 1.8349 1.7640 -0.4231 -0.1134 0.0353  642 ASN A ND2 
2411 N N   . ALA A 373 ? 2.1992 1.8170 1.6047 -0.3412 -0.1427 -0.0119 643 ALA A N   
2412 C CA  . ALA A 373 ? 2.0506 1.7787 1.5011 -0.3258 -0.1360 -0.0038 643 ALA A CA  
2413 C C   . ALA A 373 ? 2.1465 1.8998 1.5762 -0.3378 -0.1540 -0.0295 643 ALA A C   
2414 O O   . ALA A 373 ? 2.2162 2.0537 1.6793 -0.3493 -0.1490 -0.0207 643 ALA A O   
2415 C CB  . ALA A 373 ? 2.0110 1.7754 1.4807 -0.2797 -0.1320 0.0044  643 ALA A CB  
2416 N N   . TRP A 374 ? 2.2883 1.9704 1.6651 -0.3316 -0.1783 -0.0637 644 TRP A N   
2417 C CA  . TRP A 374 ? 2.3868 2.0797 1.7407 -0.3438 -0.2010 -0.0966 644 TRP A CA  
2418 C C   . TRP A 374 ? 2.4159 2.1184 1.7825 -0.3975 -0.1991 -0.0898 644 TRP A C   
2419 O O   . TRP A 374 ? 2.6265 2.4175 2.0203 -0.4061 -0.1983 -0.0909 644 TRP A O   
2420 C CB  . TRP A 374 ? 2.3982 1.9835 1.6933 -0.3351 -0.2330 -0.1375 644 TRP A CB  
2421 C CG  . TRP A 374 ? 2.3143 1.9054 1.5959 -0.2793 -0.2405 -0.1581 644 TRP A CG  
2422 C CD1 . TRP A 374 ? 2.4330 1.9489 1.6935 -0.2537 -0.2454 -0.1614 644 TRP A CD1 
2423 C CD2 . TRP A 374 ? 2.1899 1.8759 1.4774 -0.2421 -0.2445 -0.1804 644 TRP A CD2 
2424 N NE1 . TRP A 374 ? 2.3539 1.9159 1.6120 -0.2025 -0.2513 -0.1860 644 TRP A NE1 
2425 C CE2 . TRP A 374 ? 2.2964 1.9655 1.5693 -0.1953 -0.2495 -0.1973 644 TRP A CE2 
2426 C CE3 . TRP A 374 ? 2.1724 1.9640 1.4754 -0.2433 -0.2443 -0.1874 644 TRP A CE3 
2427 C CZ2 . TRP A 374 ? 2.4551 2.2163 1.7293 -0.1519 -0.2515 -0.2210 644 TRP A CZ2 
2428 C CZ3 . TRP A 374 ? 2.2300 2.1084 1.5290 -0.2001 -0.2475 -0.2087 644 TRP A CZ3 
2429 C CH2 . TRP A 374 ? 2.3725 2.2385 1.6575 -0.1558 -0.2496 -0.2253 644 TRP A CH2 
2430 N N   . TYR A 375 ? 2.1556 1.7721 1.5015 -0.4341 -0.1991 -0.0821 645 TYR A N   
2431 C CA  . TYR A 375 ? 2.1044 1.7284 1.4605 -0.4914 -0.1959 -0.0749 645 TYR A CA  
2432 C C   . TYR A 375 ? 2.1189 1.8621 1.5393 -0.4959 -0.1683 -0.0487 645 TYR A C   
2433 O O   . TYR A 375 ? 2.1045 1.9093 1.5485 -0.5260 -0.1699 -0.0534 645 TYR A O   
2434 C CB  . TYR A 375 ? 2.0802 1.6015 1.4022 -0.5278 -0.1954 -0.0616 645 TYR A CB  
2435 C CG  . TYR A 375 ? 2.1142 1.6162 1.4274 -0.5945 -0.2034 -0.0625 645 TYR A CG  
2436 C CD1 . TYR A 375 ? 2.2419 1.6415 1.5064 -0.6217 -0.2386 -0.0849 645 TYR A CD1 
2437 C CD2 . TYR A 375 ? 2.0792 1.6680 1.4367 -0.6303 -0.1784 -0.0427 645 TYR A CD2 
2438 C CE1 . TYR A 375 ? 2.3021 1.6832 1.5620 -0.6891 -0.2478 -0.0826 645 TYR A CE1 
2439 C CE2 . TYR A 375 ? 2.1501 1.7334 1.5038 -0.6954 -0.1843 -0.0429 645 TYR A CE2 
2440 C CZ  . TYR A 375 ? 2.2454 1.7236 1.5501 -0.7277 -0.2187 -0.0604 645 TYR A CZ  
2441 O OH  . TYR A 375 ? 2.2085 1.6799 1.5127 -0.7989 -0.2262 -0.0572 645 TYR A OH  
2442 N N   . GLY A 376 ? 2.0582 1.8322 1.5097 -0.4649 -0.1464 -0.0235 646 GLY A N   
2443 C CA  . GLY A 376 ? 1.9942 1.8716 1.5104 -0.4621 -0.1256 -0.0004 646 GLY A CA  
2444 C C   . GLY A 376 ? 2.0170 1.9908 1.5623 -0.4457 -0.1333 -0.0034 646 GLY A C   
2445 O O   . GLY A 376 ? 1.9199 1.9758 1.5102 -0.4598 -0.1273 0.0052  646 GLY A O   
2446 N N   . LEU A 377 ? 2.0587 2.0303 1.5783 -0.4140 -0.1474 -0.0166 647 LEU A N   
2447 C CA  . LEU A 377 ? 1.9307 1.9964 1.4661 -0.3995 -0.1571 -0.0210 647 LEU A CA  
2448 C C   . LEU A 377 ? 1.9688 2.0388 1.4891 -0.4395 -0.1746 -0.0501 647 LEU A C   
2449 O O   . LEU A 377 ? 2.0018 2.1577 1.5587 -0.4530 -0.1747 -0.0448 647 LEU A O   
2450 C CB  . LEU A 377 ? 1.5464 1.6164 1.0517 -0.3580 -0.1672 -0.0334 647 LEU A CB  
2451 N N   . GLY A 378 ? 1.8221 1.7951 1.2903 -0.4580 -0.1928 -0.0811 648 GLY A N   
2452 C CA  . GLY A 378 ? 1.8826 1.8353 1.3332 -0.5019 -0.2144 -0.1108 648 GLY A CA  
2453 C C   . GLY A 378 ? 1.9437 1.9332 1.4318 -0.5523 -0.2020 -0.0957 648 GLY A C   
2454 O O   . GLY A 378 ? 2.0497 2.0805 1.5482 -0.5841 -0.2162 -0.1141 648 GLY A O   
2455 N N   . MET A 379 ? 1.9672 1.9486 1.4773 -0.5589 -0.1762 -0.0654 649 MET A N   
2456 C CA  . MET A 379 ? 2.0103 2.0376 1.5579 -0.6039 -0.1608 -0.0532 649 MET A CA  
2457 C C   . MET A 379 ? 2.0298 2.1910 1.6396 -0.5905 -0.1554 -0.0463 649 MET A C   
2458 O O   . MET A 379 ? 2.0341 2.2554 1.6709 -0.6277 -0.1589 -0.0557 649 MET A O   
2459 C CB  . MET A 379 ? 1.9515 1.9453 1.5051 -0.6063 -0.1350 -0.0279 649 MET A CB  
2460 N N   . ILE A 380 ? 1.9081 2.1153 1.5418 -0.5383 -0.1488 -0.0277 650 ILE A N   
2461 C CA  . ILE A 380 ? 1.7873 2.1133 1.4788 -0.5180 -0.1478 -0.0138 650 ILE A CA  
2462 C C   . ILE A 380 ? 1.8127 2.1963 1.4938 -0.5128 -0.1718 -0.0329 650 ILE A C   
2463 O O   . ILE A 380 ? 1.7828 2.2674 1.5077 -0.5067 -0.1765 -0.0256 650 ILE A O   
2464 C CB  . ILE A 380 ? 1.6678 2.0152 1.3885 -0.4671 -0.1363 0.0191  650 ILE A CB  
2465 N N   . TYR A 381 ? 1.9352 2.2572 1.5588 -0.5127 -0.1897 -0.0605 651 TYR A N   
2466 C CA  . TYR A 381 ? 1.9719 2.3450 1.5805 -0.5141 -0.2155 -0.0898 651 TYR A CA  
2467 C C   . TYR A 381 ? 2.1357 2.5111 1.7527 -0.5711 -0.2276 -0.1155 651 TYR A C   
2468 O O   . TYR A 381 ? 2.2068 2.6753 1.8535 -0.5807 -0.2393 -0.1250 651 TYR A O   
2469 C CB  . TYR A 381 ? 1.9937 2.3019 1.5404 -0.4921 -0.2340 -0.1201 651 TYR A CB  
2470 C CG  . TYR A 381 ? 1.9690 2.3121 1.5064 -0.4360 -0.2278 -0.1027 651 TYR A CG  
2471 C CD1 . TYR A 381 ? 1.9290 2.3897 1.4925 -0.4087 -0.2280 -0.0819 651 TYR A CD1 
2472 C CD2 . TYR A 381 ? 1.9967 2.2585 1.4985 -0.4121 -0.2234 -0.1059 651 TYR A CD2 
2473 C CE1 . TYR A 381 ? 1.9175 2.4157 1.4718 -0.3640 -0.2215 -0.0604 651 TYR A CE1 
2474 C CE2 . TYR A 381 ? 1.9682 2.2716 1.4650 -0.3652 -0.2164 -0.0898 651 TYR A CE2 
2475 C CZ  . TYR A 381 ? 1.9431 2.3657 1.4658 -0.3438 -0.2144 -0.0654 651 TYR A CZ  
2476 O OH  . TYR A 381 ? 1.9470 2.4167 1.4644 -0.3033 -0.2065 -0.0436 651 TYR A OH  
2477 N N   . TYR A 382 ? 2.1789 2.4518 1.7690 -0.6106 -0.2262 -0.1246 652 TYR A N   
2478 C CA  . TYR A 382 ? 2.2389 2.5024 1.8382 -0.6757 -0.2338 -0.1403 652 TYR A CA  
2479 C C   . TYR A 382 ? 2.2190 2.5980 1.8870 -0.6926 -0.2152 -0.1216 652 TYR A C   
2480 O O   . TYR A 382 ? 2.3706 2.8137 2.0655 -0.7289 -0.2275 -0.1396 652 TYR A O   
2481 C CB  . TYR A 382 ? 2.1045 2.2395 1.6649 -0.7130 -0.2295 -0.1361 652 TYR A CB  
2482 C CG  . TYR A 382 ? 2.1315 2.2621 1.7062 -0.7879 -0.2290 -0.1373 652 TYR A CG  
2483 C CD1 . TYR A 382 ? 2.1950 2.2474 1.7358 -0.8356 -0.2601 -0.1645 652 TYR A CD1 
2484 C CD2 . TYR A 382 ? 2.0913 2.2943 1.7138 -0.8121 -0.1988 -0.1120 652 TYR A CD2 
2485 C CE1 . TYR A 382 ? 2.2891 2.3384 1.8440 -0.9111 -0.2600 -0.1605 652 TYR A CE1 
2486 C CE2 . TYR A 382 ? 2.1628 2.3755 1.7988 -0.8841 -0.1957 -0.1117 652 TYR A CE2 
2487 C CZ  . TYR A 382 ? 2.3048 2.4401 1.9066 -0.9365 -0.2256 -0.1326 652 TYR A CZ  
2488 O OH  . TYR A 382 ? 2.4305 2.5777 2.0477 -1.0152 -0.2226 -0.1270 652 TYR A OH  
2489 N N   . LYS A 383 ? 1.8956 2.3007 1.5949 -0.6654 -0.1878 -0.0890 653 LYS A N   
2490 C CA  . LYS A 383 ? 1.8488 2.3613 1.6174 -0.6719 -0.1710 -0.0746 653 LYS A CA  
2491 C C   . LYS A 383 ? 2.0222 2.6502 1.8296 -0.6468 -0.1880 -0.0796 653 LYS A C   
2492 O O   . LYS A 383 ? 1.9285 2.6520 1.7886 -0.6672 -0.1883 -0.0851 653 LYS A O   
2493 C CB  . LYS A 383 ? 1.8073 2.3163 1.6007 -0.6370 -0.1446 -0.0442 653 LYS A CB  
2494 N N   . GLN A 384 ? 2.2296 2.8562 2.0107 -0.6019 -0.2023 -0.0770 654 GLN A N   
2495 C CA  . GLN A 384 ? 2.1257 2.8599 1.9318 -0.5770 -0.2214 -0.0785 654 GLN A CA  
2496 C C   . GLN A 384 ? 2.0518 2.7849 1.8205 -0.6015 -0.2504 -0.1201 654 GLN A C   
2497 O O   . GLN A 384 ? 2.0997 2.9197 1.8768 -0.5834 -0.2706 -0.1286 654 GLN A O   
2498 C CB  . GLN A 384 ? 2.0333 2.7851 1.8336 -0.5165 -0.2206 -0.0474 654 GLN A CB  
2499 N N   . GLU A 385 ? 1.9965 2.6260 1.7217 -0.6398 -0.2553 -0.1456 655 GLU A N   
2500 C CA  . GLU A 385 ? 2.0073 2.6200 1.7069 -0.6775 -0.2858 -0.1906 655 GLU A CA  
2501 C C   . GLU A 385 ? 2.1661 2.7660 1.8147 -0.6375 -0.3106 -0.2167 655 GLU A C   
2502 O O   . GLU A 385 ? 2.4062 3.0303 2.0416 -0.6513 -0.3411 -0.2575 655 GLU A O   
2503 C CB  . GLU A 385 ? 1.9353 2.6641 1.6894 -0.7081 -0.2968 -0.2034 655 GLU A CB  
2504 N N   . LYS A 386 ? 2.1202 2.6863 1.7413 -0.5884 -0.2979 -0.1961 656 LYS A N   
2505 C CA  . LYS A 386 ? 2.1971 2.7422 1.7640 -0.5509 -0.3174 -0.2240 656 LYS A CA  
2506 C C   . LYS A 386 ? 2.2938 2.6945 1.8107 -0.5658 -0.3268 -0.2515 656 LYS A C   
2507 O O   . LYS A 386 ? 2.4592 2.7908 1.9568 -0.5433 -0.3096 -0.2315 656 LYS A O   
2508 C CB  . LYS A 386 ? 2.1926 2.7893 1.7588 -0.4919 -0.2999 -0.1865 656 LYS A CB  
2509 N N   . PHE A 387 ? 2.1657 2.5195 1.6638 -0.6038 -0.3579 -0.2979 657 PHE A N   
2510 C CA  . PHE A 387 ? 2.1530 2.3579 1.6148 -0.6359 -0.3715 -0.3180 657 PHE A CA  
2511 C C   . PHE A 387 ? 2.2254 2.3519 1.6297 -0.5927 -0.3936 -0.3548 657 PHE A C   
2512 O O   . PHE A 387 ? 2.2566 2.2812 1.6340 -0.5820 -0.3858 -0.3433 657 PHE A O   
2513 C CB  . PHE A 387 ? 2.2521 2.4325 1.7246 -0.7022 -0.3996 -0.3492 657 PHE A CB  
2514 N N   . SER A 388 ? 2.2929 2.4714 1.6787 -0.5664 -0.4230 -0.4029 658 SER A N   
2515 C CA  . SER A 388 ? 2.4343 2.5478 1.7678 -0.5244 -0.4494 -0.4513 658 SER A CA  
2516 C C   . SER A 388 ? 2.3099 2.4293 1.6263 -0.4664 -0.4224 -0.4247 658 SER A C   
2517 O O   . SER A 388 ? 2.3633 2.4039 1.6400 -0.4352 -0.4383 -0.4568 658 SER A O   
2518 C CB  . SER A 388 ? 2.6806 2.8810 2.0006 -0.5007 -0.4822 -0.5087 658 SER A CB  
2519 O OG  . SER A 388 ? 2.7370 3.0819 2.0951 -0.5063 -0.4692 -0.4849 658 SER A OG  
2520 N N   . LEU A 389 ? 2.1820 2.3936 1.5316 -0.4514 -0.3844 -0.3678 659 LEU A N   
2521 C CA  . LEU A 389 ? 2.1754 2.3788 1.5173 -0.4083 -0.3575 -0.3352 659 LEU A CA  
2522 C C   . LEU A 389 ? 2.2247 2.3148 1.5732 -0.4355 -0.3393 -0.3020 659 LEU A C   
2523 O O   . LEU A 389 ? 2.3252 2.3364 1.6471 -0.4108 -0.3368 -0.3036 659 LEU A O   
2524 C CB  . LEU A 389 ? 2.0800 2.4212 1.4554 -0.3807 -0.3293 -0.2864 659 LEU A CB  
2525 N N   . ALA A 390 ? 2.0986 2.1914 1.4832 -0.4847 -0.3265 -0.2728 660 ALA A N   
2526 C CA  . ALA A 390 ? 2.0474 2.0438 1.4356 -0.5171 -0.3097 -0.2433 660 ALA A CA  
2527 C C   . ALA A 390 ? 2.2232 2.0701 1.5612 -0.5314 -0.3370 -0.2750 660 ALA A C   
2528 O O   . ALA A 390 ? 2.5010 2.2605 1.8215 -0.5277 -0.3264 -0.2550 660 ALA A O   
2529 C CB  . ALA A 390 ? 2.0149 2.0496 1.4463 -0.5729 -0.2980 -0.2213 660 ALA A CB  
2530 N N   . GLU A 391 ? 2.1783 1.9946 1.4947 -0.5477 -0.3758 -0.3251 661 GLU A N   
2531 C CA  . GLU A 391 ? 2.2469 1.9179 1.5156 -0.5535 -0.4128 -0.3633 661 GLU A CA  
2532 C C   . GLU A 391 ? 2.4496 2.0743 1.6856 -0.4913 -0.4124 -0.3721 661 GLU A C   
2533 O O   . GLU A 391 ? 2.5693 2.0753 1.7798 -0.4954 -0.4164 -0.3613 661 GLU A O   
2534 C CB  . GLU A 391 ? 2.2034 1.8725 1.4590 -0.5620 -0.4585 -0.4259 661 GLU A CB  
2535 N N   . MET A 392 ? 2.4917 2.2184 1.7285 -0.4347 -0.4084 -0.3914 662 MET A N   
2536 C CA  . MET A 392 ? 2.5357 2.2459 1.7455 -0.3723 -0.4096 -0.4088 662 MET A CA  
2537 C C   . MET A 392 ? 2.4758 2.1472 1.6937 -0.3651 -0.3766 -0.3565 662 MET A C   
2538 O O   . MET A 392 ? 2.6285 2.2099 1.8178 -0.3387 -0.3872 -0.3688 662 MET A O   
2539 C CB  . MET A 392 ? 2.5241 2.3845 1.7410 -0.3217 -0.4004 -0.4231 662 MET A CB  
2540 N N   . HIS A 393 ? 2.3213 2.0627 1.5804 -0.3867 -0.3396 -0.3014 663 HIS A N   
2541 C CA  . HIS A 393 ? 2.2502 1.9623 1.5233 -0.3843 -0.3086 -0.2527 663 HIS A CA  
2542 C C   . HIS A 393 ? 2.1838 1.7555 1.4323 -0.4249 -0.3187 -0.2455 663 HIS A C   
2543 O O   . HIS A 393 ? 2.1248 1.6176 1.3515 -0.4054 -0.3176 -0.2378 663 HIS A O   
2544 C CB  . HIS A 393 ? 2.1751 1.9939 1.5022 -0.3982 -0.2729 -0.2026 663 HIS A CB  
2545 C CG  . HIS A 393 ? 2.1808 2.1341 1.5320 -0.3598 -0.2621 -0.1952 663 HIS A CG  
2546 N ND1 . HIS A 393 ? 2.2307 2.2612 1.5773 -0.3554 -0.2805 -0.2255 663 HIS A ND1 
2547 C CD2 . HIS A 393 ? 2.1891 2.2138 1.5682 -0.3265 -0.2366 -0.1581 663 HIS A CD2 
2548 C CE1 . HIS A 393 ? 2.2333 2.3802 1.5997 -0.3209 -0.2654 -0.2039 663 HIS A CE1 
2549 N NE2 . HIS A 393 ? 2.2084 2.3512 1.5963 -0.3047 -0.2391 -0.1612 663 HIS A NE2 
2550 N N   . PHE A 394 ? 2.1818 1.7284 1.4341 -0.4833 -0.3291 -0.2458 664 PHE A N   
2551 C CA  . PHE A 394 ? 2.1974 1.6160 1.4232 -0.5319 -0.3407 -0.2343 664 PHE A CA  
2552 C C   . PHE A 394 ? 2.3053 1.5870 1.4773 -0.5119 -0.3815 -0.2704 664 PHE A C   
2553 O O   . PHE A 394 ? 2.5995 1.7744 1.7430 -0.5203 -0.3851 -0.2513 664 PHE A O   
2554 C CB  . PHE A 394 ? 2.2093 1.6347 1.4494 -0.6004 -0.3510 -0.2358 664 PHE A CB  
2555 C CG  . PHE A 394 ? 2.1607 1.6984 1.4533 -0.6297 -0.3125 -0.1968 664 PHE A CG  
2556 C CD1 . PHE A 394 ? 2.1187 1.7075 1.4366 -0.6051 -0.2742 -0.1581 664 PHE A CD1 
2557 C CD2 . PHE A 394 ? 2.1790 1.7726 1.4996 -0.6805 -0.3178 -0.2028 664 PHE A CD2 
2558 C CE1 . PHE A 394 ? 2.0992 1.7896 1.4689 -0.6266 -0.2435 -0.1285 664 PHE A CE1 
2559 C CE2 . PHE A 394 ? 2.1564 1.8593 1.5292 -0.7028 -0.2850 -0.1720 664 PHE A CE2 
2560 C CZ  . PHE A 394 ? 2.1113 1.8611 1.5085 -0.6738 -0.2485 -0.1360 664 PHE A CZ  
2561 N N   . GLN A 395 ? 2.3304 1.6187 1.4885 -0.4824 -0.4146 -0.3249 665 GLN A N   
2562 C CA  . GLN A 395 ? 2.5121 1.6780 1.6242 -0.4532 -0.4595 -0.3705 665 GLN A CA  
2563 C C   . GLN A 395 ? 2.7367 1.8821 1.8336 -0.3924 -0.4497 -0.3669 665 GLN A C   
2564 O O   . GLN A 395 ? 2.9474 1.9636 2.0105 -0.3899 -0.4708 -0.3657 665 GLN A O   
2565 C CB  . GLN A 395 ? 2.4715 1.6748 1.5778 -0.4267 -0.4951 -0.4374 665 GLN A CB  
2566 N N   . LYS A 396 ? 2.7239 1.9993 1.8469 -0.3448 -0.4200 -0.3638 666 LYS A N   
2567 C CA  . LYS A 396 ? 2.6653 1.9481 1.7843 -0.2881 -0.4067 -0.3594 666 LYS A CA  
2568 C C   . LYS A 396 ? 2.5383 1.7573 1.6580 -0.3074 -0.3838 -0.3065 666 LYS A C   
2569 O O   . LYS A 396 ? 2.6007 1.7510 1.6991 -0.2748 -0.3924 -0.3102 666 LYS A O   
2570 C CB  . LYS A 396 ? 2.5019 1.9494 1.6561 -0.2489 -0.3743 -0.3519 666 LYS A CB  
2571 N N   . ALA A 397 ? 2.4044 1.6531 1.5492 -0.3593 -0.3564 -0.2612 667 ALA A N   
2572 C CA  . ALA A 397 ? 2.3975 1.5982 1.5433 -0.3860 -0.3336 -0.2126 667 ALA A CA  
2573 C C   . ALA A 397 ? 2.3163 1.3590 1.4123 -0.4184 -0.3645 -0.2121 667 ALA A C   
2574 O O   . ALA A 397 ? 2.2988 1.2699 1.3719 -0.4030 -0.3650 -0.1961 667 ALA A O   
2575 C CB  . ALA A 397 ? 2.4266 1.7147 1.6153 -0.4307 -0.2991 -0.1737 667 ALA A CB  
2576 N N   . LEU A 398 ? 2.3594 1.3479 1.4390 -0.4650 -0.3927 -0.2278 668 LEU A N   
2577 C CA  . LEU A 398 ? 2.4146 1.2521 1.4487 -0.5099 -0.4242 -0.2179 668 LEU A CA  
2578 C C   . LEU A 398 ? 2.5583 1.2730 1.5479 -0.4643 -0.4716 -0.2563 668 LEU A C   
2579 O O   . LEU A 398 ? 2.8126 1.3886 1.7594 -0.4864 -0.4999 -0.2423 668 LEU A O   
2580 C CB  . LEU A 398 ? 2.4144 1.2354 1.4515 -0.5766 -0.4433 -0.2242 668 LEU A CB  
2581 N N   . ASP A 399 ? 2.5132 1.2846 1.5131 -0.3991 -0.4807 -0.3040 669 ASP A N   
2582 C CA  . ASP A 399 ? 2.6213 1.3048 1.5884 -0.3403 -0.5198 -0.3453 669 ASP A CA  
2583 C C   . ASP A 399 ? 2.6845 1.3532 1.6456 -0.3115 -0.4978 -0.3117 669 ASP A C   
2584 O O   . ASP A 399 ? 3.0028 1.5469 1.9250 -0.2941 -0.5311 -0.3174 669 ASP A O   
2585 C CB  . ASP A 399 ? 2.7134 1.4890 1.6964 -0.2770 -0.5295 -0.4065 669 ASP A CB  
2586 C CG  . ASP A 399 ? 3.0166 1.7627 1.9904 -0.2917 -0.5723 -0.4590 669 ASP A CG  
2587 O OD1 . ASP A 399 ? 3.1730 1.8176 2.1305 -0.3537 -0.5967 -0.4459 669 ASP A OD1 
2588 O OD2 . ASP A 399 ? 3.0788 1.9044 2.0612 -0.2420 -0.5831 -0.5144 669 ASP A OD2 
2589 N N   . ILE A 400 ? 2.4508 1.2439 1.4519 -0.3060 -0.4453 -0.2773 670 ILE A N   
2590 C CA  . ILE A 400 ? 2.3594 1.1478 1.3615 -0.2829 -0.4229 -0.2453 670 ILE A CA  
2591 C C   . ILE A 400 ? 2.5023 1.1901 1.4732 -0.3395 -0.4237 -0.1994 670 ILE A C   
2592 O O   . ILE A 400 ? 2.5529 1.1380 1.4862 -0.3262 -0.4441 -0.1913 670 ILE A O   
2593 C CB  . ILE A 400 ? 2.1232 1.0639 1.1807 -0.2678 -0.3704 -0.2190 670 ILE A CB  
2594 N N   . ASN A 401 ? 2.5870 1.3132 1.5735 -0.4021 -0.4011 -0.1686 671 ASN A N   
2595 C CA  . ASN A 401 ? 2.5939 1.2475 1.5519 -0.4615 -0.3966 -0.1226 671 ASN A CA  
2596 C C   . ASN A 401 ? 2.8164 1.4471 1.7690 -0.5343 -0.4073 -0.1144 671 ASN A C   
2597 O O   . ASN A 401 ? 2.7475 1.4891 1.7436 -0.5597 -0.3794 -0.1104 671 ASN A O   
2598 C CB  . ASN A 401 ? 2.3268 1.0765 1.3182 -0.4671 -0.3447 -0.0820 671 ASN A CB  
2599 N N   . PRO A 402 ? 2.5446 1.0303 1.4456 -0.5706 -0.4495 -0.1090 672 PRO A N   
2600 C CA  . PRO A 402 ? 2.9328 1.3927 1.8273 -0.6555 -0.4540 -0.0839 672 PRO A CA  
2601 C C   . PRO A 402 ? 3.0344 1.5299 1.9257 -0.7057 -0.4131 -0.0246 672 PRO A C   
2602 O O   . PRO A 402 ? 3.1154 1.5806 1.9819 -0.6805 -0.4040 -0.0026 672 PRO A O   
2603 C CB  . PRO A 402 ? 2.7502 1.0829 1.6159 -0.6500 -0.5038 -0.0884 672 PRO A CB  
2604 C CG  . PRO A 402 ? 2.7663 1.0333 1.6049 -0.5794 -0.5227 -0.0998 672 PRO A CG  
2605 C CD  . PRO A 402 ? 2.6476 0.9937 1.5005 -0.5320 -0.4972 -0.1261 672 PRO A CD  
2606 N N   . GLN A 403 ? 3.0459 1.6163 1.9649 -0.7711 -0.3890 -0.0041 673 GLN A N   
2607 C CA  . GLN A 403 ? 2.9123 1.5517 1.8387 -0.8181 -0.3448 0.0447  673 GLN A CA  
2608 C C   . GLN A 403 ? 2.6442 1.4265 1.6239 -0.7674 -0.2969 0.0404  673 GLN A C   
2609 O O   . GLN A 403 ? 2.6676 1.4921 1.6479 -0.7706 -0.2644 0.0700  673 GLN A O   
2610 C CB  . GLN A 403 ? 2.8635 1.4071 1.7321 -0.8318 -0.3531 0.0869  673 GLN A CB  
2611 N N   . SER A 404 ? 2.4040 1.2603 1.4281 -0.7213 -0.2952 0.0033  674 SER A N   
2612 C CA  . SER A 404 ? 2.4165 1.4140 1.5005 -0.6824 -0.2539 0.0018  674 SER A CA  
2613 C C   . SER A 404 ? 2.4524 1.5620 1.5800 -0.7337 -0.2199 0.0218  674 SER A C   
2614 O O   . SER A 404 ? 2.3079 1.5047 1.4694 -0.7222 -0.1835 0.0385  674 SER A O   
2615 C CB  . SER A 404 ? 2.4748 1.5235 1.5896 -0.6282 -0.2644 -0.0378 674 SER A CB  
2616 O OG  . SER A 404 ? 2.6268 1.5776 1.7021 -0.5830 -0.2994 -0.0640 674 SER A OG  
2617 N N   . SER A 405 ? 2.5902 1.6984 1.7201 -0.7886 -0.2349 0.0159  675 SER A N   
2618 C CA  . SER A 405 ? 2.5683 1.7948 1.7468 -0.8370 -0.2073 0.0267  675 SER A CA  
2619 C C   . SER A 405 ? 2.5522 1.8244 1.7327 -0.8696 -0.1709 0.0633  675 SER A C   
2620 O O   . SER A 405 ? 2.4212 1.8237 1.6577 -0.8692 -0.1373 0.0659  675 SER A O   
2621 C CB  . SER A 405 ? 2.4753 1.6638 1.6438 -0.9026 -0.2357 0.0184  675 SER A CB  
2622 O OG  . SER A 405 ? 2.4048 1.4959 1.5443 -0.8772 -0.2809 -0.0154 675 SER A OG  
2623 N N   . VAL A 406 ? 2.5573 1.7264 1.6767 -0.8943 -0.1796 0.0897  676 VAL A N   
2624 C CA  . VAL A 406 ? 2.5858 1.8008 1.6974 -0.9300 -0.1464 0.1242  676 VAL A CA  
2625 C C   . VAL A 406 ? 2.6008 1.9253 1.7597 -0.8745 -0.1089 0.1188  676 VAL A C   
2626 O O   . VAL A 406 ? 2.6023 2.0451 1.8024 -0.8962 -0.0754 0.1255  676 VAL A O   
2627 C CB  . VAL A 406 ? 2.9329 2.0096 1.9614 -0.9553 -0.1662 0.1561  676 VAL A CB  
2628 C CG1 . VAL A 406 ? 2.8665 1.8617 1.8644 -0.8817 -0.1812 0.1467  676 VAL A CG1 
2629 C CG2 . VAL A 406 ? 3.0565 2.1925 2.0708 -1.0105 -0.1330 0.1943  676 VAL A CG2 
2630 N N   . LEU A 407 ? 2.5682 1.8568 1.7254 -0.8036 -0.1163 0.1049  677 LEU A N   
2631 C CA  . LEU A 407 ? 2.4523 1.8251 1.6524 -0.7530 -0.0868 0.1018  677 LEU A CA  
2632 C C   . LEU A 407 ? 2.3880 1.8924 1.6703 -0.7319 -0.0689 0.0839  677 LEU A C   
2633 O O   . LEU A 407 ? 2.3128 1.9212 1.6414 -0.7315 -0.0398 0.0862  677 LEU A O   
2634 C CB  . LEU A 407 ? 2.4023 1.7001 1.5813 -0.6877 -0.1024 0.0932  677 LEU A CB  
2635 N N   . LEU A 408 ? 2.4389 1.9407 1.7383 -0.7121 -0.0887 0.0645  678 LEU A N   
2636 C CA  . LEU A 408 ? 2.5465 2.1650 1.9188 -0.6837 -0.0769 0.0512  678 LEU A CA  
2637 C C   . LEU A 408 ? 2.5410 2.2577 1.9532 -0.7334 -0.0643 0.0503  678 LEU A C   
2638 O O   . LEU A 408 ? 2.6244 2.4526 2.1024 -0.7131 -0.0497 0.0439  678 LEU A O   
2639 C CB  . LEU A 408 ? 2.6601 2.2545 2.0323 -0.6461 -0.1020 0.0315  678 LEU A CB  
2640 C CG  . LEU A 408 ? 2.6229 2.1717 1.9843 -0.5832 -0.1088 0.0280  678 LEU A CG  
2641 C CD1 . LEU A 408 ? 2.6045 2.0178 1.8935 -0.5842 -0.1355 0.0226  678 LEU A CD1 
2642 C CD2 . LEU A 408 ? 2.5791 2.1909 1.9787 -0.5408 -0.1152 0.0145  678 LEU A CD2 
2643 N N   . CYS A 409 ? 2.4213 2.0972 1.7963 -0.7992 -0.0721 0.0578  679 CYS A N   
2644 C CA  . CYS A 409 ? 2.2671 2.0429 1.6800 -0.8547 -0.0570 0.0592  679 CYS A CA  
2645 C C   . CYS A 409 ? 2.1781 2.0222 1.6029 -0.8755 -0.0228 0.0755  679 CYS A C   
2646 O O   . CYS A 409 ? 2.1669 2.1374 1.6482 -0.8935 -0.0015 0.0697  679 CYS A O   
2647 C CB  . CYS A 409 ? 2.2815 1.9913 1.6557 -0.9235 -0.0814 0.0615  679 CYS A CB  
2648 S SG  . CYS A 409 ? 3.5130 3.1586 2.8771 -0.9016 -0.1248 0.0307  679 CYS A SG  
2649 N N   . HIS A 410 ? 2.1214 1.8878 1.4930 -0.8707 -0.0190 0.0928  680 HIS A N   
2650 C CA  . HIS A 410 ? 2.1199 1.9552 1.4992 -0.8772 0.0132  0.1033  680 HIS A CA  
2651 C C   . HIS A 410 ? 2.0671 2.0074 1.5220 -0.8134 0.0310  0.0826  680 HIS A C   
2652 O O   . HIS A 410 ? 2.0625 2.1133 1.5583 -0.8180 0.0577  0.0768  680 HIS A O   
2653 C CB  . HIS A 410 ? 2.1673 1.8945 1.4719 -0.8744 0.0090  0.1239  680 HIS A CB  
2654 C CG  . HIS A 410 ? 2.2545 2.0459 1.5459 -0.9044 0.0393  0.1390  680 HIS A CG  
2655 N ND1 . HIS A 410 ? 2.2260 2.1578 1.5814 -0.8822 0.0701  0.1212  680 HIS A ND1 
2656 C CD2 . HIS A 410 ? 2.4602 2.1991 1.6804 -0.9540 0.0420  0.1695  680 HIS A CD2 
2657 C CE1 . HIS A 410 ? 2.3692 2.3409 1.6934 -0.9152 0.0928  0.1355  680 HIS A CE1 
2658 N NE2 . HIS A 410 ? 2.5320 2.3897 1.7719 -0.9613 0.0774  0.1684  680 HIS A NE2 
2659 N N   . ILE A 411 ? 1.8992 1.8036 1.3718 -0.7535 0.0144  0.0718  681 ILE A N   
2660 C CA  . ILE A 411 ? 1.8396 1.8238 1.3831 -0.6926 0.0240  0.0580  681 ILE A CA  
2661 C C   . ILE A 411 ? 1.9487 2.0687 1.5647 -0.7058 0.0360  0.0453  681 ILE A C   
2662 O O   . ILE A 411 ? 1.9313 2.1455 1.5996 -0.6880 0.0552  0.0350  681 ILE A O   
2663 C CB  . ILE A 411 ? 1.7438 1.6764 1.2947 -0.6384 0.0024  0.0543  681 ILE A CB  
2664 N N   . GLY A 412 ? 2.2359 2.3657 1.8560 -0.7341 0.0214  0.0421  682 GLY A N   
2665 C CA  . GLY A 412 ? 2.2798 2.5353 1.9660 -0.7493 0.0271  0.0291  682 GLY A CA  
2666 C C   . GLY A 412 ? 2.1742 2.5217 1.8776 -0.7966 0.0536  0.0269  682 GLY A C   
2667 O O   . GLY A 412 ? 2.1607 2.6362 1.9347 -0.7896 0.0653  0.0109  682 GLY A O   
2668 N N   . VAL A 413 ? 2.0323 2.3174 1.6701 -0.8442 0.0619  0.0437  683 VAL A N   
2669 C CA  . VAL A 413 ? 1.8855 2.2558 1.5256 -0.8941 0.0903  0.0472  683 VAL A CA  
2670 C C   . VAL A 413 ? 1.8215 2.2710 1.5032 -0.8429 0.1126  0.0314  683 VAL A C   
2671 O O   . VAL A 413 ? 1.7920 2.3810 1.5356 -0.8447 0.1322  0.0120  683 VAL A O   
2672 C CB  . VAL A 413 ? 1.9118 2.1830 1.4623 -0.9554 0.0904  0.0770  683 VAL A CB  
2673 C CG1 . VAL A 413 ? 1.9466 2.3141 1.4940 -0.9955 0.1245  0.0838  683 VAL A CG1 
2674 C CG2 . VAL A 413 ? 1.9360 2.1486 1.4582 -1.0176 0.0675  0.0884  683 VAL A CG2 
2675 N N   . VAL A 414 ? 1.9167 2.2782 1.5662 -0.7963 0.1073  0.0362  684 VAL A N   
2676 C CA  . VAL A 414 ? 1.8869 2.3023 1.5702 -0.7452 0.1229  0.0187  684 VAL A CA  
2677 C C   . VAL A 414 ? 1.8826 2.4040 1.6656 -0.6935 0.1207  -0.0087 684 VAL A C   
2678 O O   . VAL A 414 ? 1.8434 2.4654 1.6774 -0.6689 0.1368  -0.0329 684 VAL A O   
2679 C CB  . VAL A 414 ? 1.8150 2.1091 1.4555 -0.6994 0.1098  0.0270  684 VAL A CB  
2680 N N   . GLN A 415 ? 1.9107 2.4096 1.7203 -0.6749 0.0984  -0.0058 685 GLN A N   
2681 C CA  . GLN A 415 ? 1.8654 2.4532 1.7652 -0.6266 0.0901  -0.0244 685 GLN A CA  
2682 C C   . GLN A 415 ? 1.8421 2.5734 1.7965 -0.6580 0.1030  -0.0433 685 GLN A C   
2683 O O   . GLN A 415 ? 1.8262 2.6642 1.8495 -0.6262 0.1118  -0.0691 685 GLN A O   
2684 C CB  . GLN A 415 ? 1.9367 2.4660 1.8397 -0.6036 0.0626  -0.0113 685 GLN A CB  
2685 C CG  . GLN A 415 ? 1.9815 2.3946 1.8505 -0.5625 0.0488  0.0037  685 GLN A CG  
2686 C CD  . GLN A 415 ? 2.1087 2.4693 1.9622 -0.5541 0.0253  0.0172  685 GLN A CD  
2687 O OE1 . GLN A 415 ? 2.3148 2.6911 2.1548 -0.5913 0.0185  0.0165  685 GLN A OE1 
2688 N NE2 . GLN A 415 ? 2.0218 2.3266 1.8785 -0.5060 0.0125  0.0279  685 GLN A NE2 
2689 N N   . HIS A 416 ? 1.9351 2.6687 1.8614 -0.7196 0.1017  -0.0332 686 HIS A N   
2690 C CA  . HIS A 416 ? 2.1661 3.0357 2.1443 -0.7571 0.1110  -0.0495 686 HIS A CA  
2691 C C   . HIS A 416 ? 2.3070 3.2821 2.2938 -0.7919 0.1440  -0.0626 686 HIS A C   
2692 O O   . HIS A 416 ? 2.2698 3.3832 2.3129 -0.8153 0.1553  -0.0820 686 HIS A O   
2693 C CB  . HIS A 416 ? 2.2315 3.0619 2.1725 -0.8196 0.0977  -0.0348 686 HIS A CB  
2694 N N   . ALA A 417 ? 2.3404 3.2594 2.2718 -0.7944 0.1593  -0.0532 687 ALA A N   
2695 C CA  . ALA A 417 ? 2.3175 3.3456 2.2552 -0.8153 0.1918  -0.0682 687 ALA A CA  
2696 C C   . ALA A 417 ? 2.2253 3.3337 2.2332 -0.7380 0.1960  -0.1064 687 ALA A C   
2697 O O   . ALA A 417 ? 2.2595 3.5171 2.3188 -0.7381 0.2170  -0.1374 687 ALA A O   
2698 C CB  . ALA A 417 ? 2.4487 3.3840 2.2877 -0.8580 0.2044  -0.0387 687 ALA A CB  
2699 N N   . LEU A 418 ? 2.6196 4.0858 3.9394 0.2008  1.1448  -0.7775 688 LEU A N   
2700 C CA  . LEU A 418 ? 2.4960 3.8853 3.7774 0.3131  1.1438  -0.8266 688 LEU A CA  
2701 C C   . LEU A 418 ? 2.3940 3.7896 3.7874 0.3784  1.1039  -0.8061 688 LEU A C   
2702 O O   . LEU A 418 ? 2.3324 3.5871 3.7043 0.4422  1.0594  -0.8334 688 LEU A O   
2703 C CB  . LEU A 418 ? 2.3916 3.5570 3.5544 0.3186  1.1044  -0.8792 688 LEU A CB  
2704 N N   . THR A 427 ? 3.1382 3.8339 5.0407 -0.2273 -0.8548 -0.0047 697 THR A N   
2705 C CA  . THR A 427 ? 3.0786 3.6275 4.7721 -0.1316 -0.7679 -0.0634 697 THR A CA  
2706 C C   . THR A 427 ? 3.1313 3.5870 4.6739 -0.2342 -0.7789 -0.0487 697 THR A C   
2707 O O   . THR A 427 ? 3.2393 3.4497 4.5273 -0.1841 -0.8380 -0.0683 697 THR A O   
2708 C CB  . THR A 427 ? 2.9155 3.6512 4.7404 -0.0584 -0.5638 -0.1084 697 THR A CB  
2709 N N   . LEU A 428 ? 3.0747 3.7354 4.7754 -0.3718 -0.7185 -0.0092 698 LEU A N   
2710 C CA  . LEU A 428 ? 3.0742 3.6736 4.6615 -0.4881 -0.7373 0.0170  698 LEU A CA  
2711 C C   . LEU A 428 ? 3.2190 3.5797 4.6495 -0.5405 -0.9573 0.0557  698 LEU A C   
2712 O O   . LEU A 428 ? 3.3670 3.5400 4.5867 -0.5716 -1.0086 0.0532  698 LEU A O   
2713 C CB  . LEU A 428 ? 3.0568 3.9458 4.8673 -0.6224 -0.6454 0.0690  698 LEU A CB  
2714 N N   . ASN A 429 ? 3.2473 3.6038 4.7748 -0.5471 -1.0949 0.0904  699 ASN A N   
2715 C CA  . ASN A 429 ? 3.4558 3.5472 4.8136 -0.5751 -1.3252 0.1171  699 ASN A CA  
2716 C C   . ASN A 429 ? 3.5271 3.3371 4.6232 -0.3985 -1.3890 0.0523  699 ASN A C   
2717 O O   . ASN A 429 ? 3.7178 3.2469 4.5607 -0.3822 -1.5362 0.0477  699 ASN A O   
2718 C CB  . ASN A 429 ? 3.5395 3.7284 5.1067 -0.6613 -1.4669 0.1887  699 ASN A CB  
2719 N N   . LYS A 430 ? 3.4231 3.3108 4.5805 -0.2610 -1.2824 0.0077  700 LYS A N   
2720 C CA  . LYS A 430 ? 3.5180 3.1770 4.4458 -0.0775 -1.3171 -0.0431 700 LYS A CA  
2721 C C   . LYS A 430 ? 3.5650 3.0433 4.2313 -0.0388 -1.2778 -0.0679 700 LYS A C   
2722 O O   . LYS A 430 ? 3.7390 2.9426 4.1340 0.0513  -1.3953 -0.0810 700 LYS A O   
2723 C CB  . LYS A 430 ? 3.3328 3.1459 4.3986 0.0515  -1.1746 -0.0781 700 LYS A CB  
2724 N N   . ALA A 431 ? 3.5086 3.1484 4.2586 -0.1022 -1.1096 -0.0729 701 ALA A N   
2725 C CA  . ALA A 431 ? 3.5206 3.0343 4.0645 -0.0816 -1.0461 -0.0911 701 ALA A CA  
2726 C C   . ALA A 431 ? 3.6974 2.9984 4.0402 -0.1686 -1.2002 -0.0649 701 ALA A C   
2727 O O   . ALA A 431 ? 3.8134 2.8736 3.8856 -0.0829 -1.2522 -0.0802 701 ALA A O   
2728 C CB  . ALA A 431 ? 3.4031 3.1451 4.1012 -0.1517 -0.8513 -0.0997 701 ALA A CB  
2729 N N   . ILE A 432 ? 3.6690 3.0661 4.1514 -0.3361 -1.2739 -0.0182 702 ILE A N   
2730 C CA  . ILE A 432 ? 3.7833 2.9909 4.1099 -0.4392 -1.4382 0.0163  702 ILE A CA  
2731 C C   . ILE A 432 ? 3.9335 2.8332 4.0298 -0.3405 -1.6492 0.0054  702 ILE A C   
2732 O O   . ILE A 432 ? 4.1583 2.8008 3.9963 -0.3332 -1.7645 0.0032  702 ILE A O   
2733 C CB  . ILE A 432 ? 3.8347 3.2309 4.3996 -0.6358 -1.4901 0.0872  702 ILE A CB  
2734 N N   . VAL A 433 ? 3.9035 2.8260 4.0860 -0.2582 -1.7009 -0.0030 703 VAL A N   
2735 C CA  . VAL A 433 ? 4.2028 2.8381 4.1653 -0.1419 -1.8988 -0.0195 703 VAL A CA  
2736 C C   . VAL A 433 ? 4.2466 2.6820 3.9153 0.0485  -1.8471 -0.0676 703 VAL A C   
2737 O O   . VAL A 433 ? 4.5809 2.7193 3.9535 0.1188  -1.9927 -0.0783 703 VAL A O   
2738 C CB  . VAL A 433 ? 4.1778 2.9050 4.3102 -0.0864 -1.9450 -0.0188 703 VAL A CB  
2739 N N   . ILE A 434 ? 3.9065 2.5099 3.6642 0.1368  -1.6425 -0.0906 704 ILE A N   
2740 C CA  . ILE A 434 ? 3.9495 2.4235 3.4816 0.3055  -1.5599 -0.1162 704 ILE A CA  
2741 C C   . ILE A 434 ? 3.9781 2.3379 3.3313 0.2442  -1.5434 -0.1088 704 ILE A C   
2742 O O   . ILE A 434 ? 4.1688 2.2974 3.2344 0.3662  -1.5885 -0.1163 704 ILE A O   
2743 C CB  . ILE A 434 ? 3.8070 2.5118 3.5195 0.3812  -1.3437 -0.1301 704 ILE A CB  
2744 N N   . ASP A 435 ? 4.1392 2.6690 3.6623 0.0613  -1.4756 -0.0901 705 ASP A N   
2745 C CA  . ASP A 435 ? 4.1598 2.6115 3.5441 -0.0154 -1.4482 -0.0808 705 ASP A CA  
2746 C C   . ASP A 435 ? 4.3909 2.5382 3.5032 -0.0257 -1.6564 -0.0708 705 ASP A C   
2747 O O   . ASP A 435 ? 4.6361 2.6505 3.5551 -0.0315 -1.6486 -0.0688 705 ASP A O   
2748 C CB  . ASP A 435 ? 4.1346 2.8360 3.7641 -0.2131 -1.3543 -0.0569 705 ASP A CB  
2749 N N   . PRO A 436 ? 4.3731 2.4069 3.4748 -0.0349 -1.8500 -0.0632 706 PRO A N   
2750 C CA  . PRO A 436 ? 4.4292 2.1553 3.2855 -0.0149 -1.9992 -0.0529 706 PRO A CA  
2751 C C   . PRO A 436 ? 4.5210 2.0428 3.1013 0.1607  -1.9133 -0.0925 706 PRO A C   
2752 O O   . PRO A 436 ? 4.1934 1.5802 2.6334 0.1355  -1.8921 -0.0840 706 PRO A O   
2753 C CB  . PRO A 436 ? 4.5242 2.1763 3.4373 0.0193  -2.1219 -0.0525 706 PRO A CB  
2754 N N   . LYS A 437 ? 4.0712 1.6096 2.6081 0.3272  -1.8416 -0.1389 707 LYS A N   
2755 C CA  . LYS A 437 ? 4.2256 1.6790 2.5558 0.4681  -1.7177 -0.1957 707 LYS A CA  
2756 C C   . LYS A 437 ? 4.1743 1.7053 2.4667 0.4613  -1.5818 -0.1746 707 LYS A C   
2757 O O   . LYS A 437 ? 3.9993 1.4244 2.1252 0.4932  -1.5293 -0.2045 707 LYS A O   
2758 C CB  . LYS A 437 ? 4.0224 1.5901 2.3721 0.6154  -1.6326 -0.2308 707 LYS A CB  
2759 N N   . ASN A 438 ? 4.1427 1.8567 2.5961 0.4214  -1.5285 -0.1239 708 ASN A N   
2760 C CA  . ASN A 438 ? 3.9499 1.7337 2.3717 0.4411  -1.3787 -0.1038 708 ASN A CA  
2761 C C   . ASN A 438 ? 3.6651 1.6264 2.2754 0.2559  -1.3009 -0.0823 708 ASN A C   
2762 O O   . ASN A 438 ? 3.3920 1.5977 2.2841 0.1793  -1.2115 -0.0891 708 ASN A O   
2763 C CB  . ASN A 438 ? 3.6808 1.6289 2.1919 0.5832  -1.2131 -0.1095 708 ASN A CB  
2764 N N   . PRO A 439 ? 3.8076 1.6783 2.2826 0.1763  -1.3018 -0.0696 709 PRO A N   
2765 C CA  . PRO A 439 ? 3.7458 1.7610 2.3613 -0.0243 -1.2342 -0.0602 709 PRO A CA  
2766 C C   . PRO A 439 ? 3.4423 1.7314 2.2935 -0.0718 -1.0229 -0.0661 709 PRO A C   
2767 O O   . PRO A 439 ? 3.3641 1.8573 2.4413 -0.2183 -0.9732 -0.0661 709 PRO A O   
2768 C CB  . PRO A 439 ? 3.8457 1.6470 2.1884 -0.0232 -1.2788 -0.0461 709 PRO A CB  
2769 C CG  . PRO A 439 ? 3.9141 1.5813 2.0703 0.1901  -1.2423 -0.0492 709 PRO A CG  
2770 C CD  . PRO A 439 ? 3.9877 1.6536 2.1979 0.2948  -1.2988 -0.0774 709 PRO A CD  
2771 N N   . LEU A 440 ? 3.3210 1.6075 2.1116 0.0569  -0.9061 -0.0654 710 LEU A N   
2772 C CA  . LEU A 440 ? 3.1046 1.5963 2.0677 0.0171  -0.7214 -0.0706 710 LEU A CA  
2773 C C   . LEU A 440 ? 3.0342 1.7668 2.2824 0.0058  -0.6329 -0.0929 710 LEU A C   
2774 O O   . LEU A 440 ? 3.0009 1.9202 2.4210 -0.0845 -0.5120 -0.1058 710 LEU A O   
2775 C CB  . LEU A 440 ? 3.0579 1.4711 1.8860 0.1586  -0.6385 -0.0496 710 LEU A CB  
2776 C CG  . LEU A 440 ? 3.2912 1.4806 1.8356 0.1771  -0.7036 -0.0229 710 LEU A CG  
2777 C CD1 . LEU A 440 ? 3.4704 1.5793 1.8785 0.3519  -0.6412 0.0154  710 LEU A CD1 
2778 C CD2 . LEU A 440 ? 3.1140 1.3570 1.6862 0.0005  -0.6587 -0.0250 710 LEU A CD2 
2779 N N   . CYS A 441 ? 3.1572 1.8805 2.4450 0.1086  -0.6910 -0.0987 711 CYS A N   
2780 C CA  . CYS A 441 ? 3.1547 2.1012 2.7139 0.0942  -0.6245 -0.1188 711 CYS A CA  
2781 C C   . CYS A 441 ? 3.2577 2.3518 2.9841 -0.0895 -0.6429 -0.1206 711 CYS A C   
2782 O O   . CYS A 441 ? 3.2182 2.5347 3.1574 -0.1566 -0.5243 -0.1343 711 CYS A O   
2783 C CB  . CYS A 441 ? 3.3260 2.2140 2.8771 0.2271  -0.7103 -0.1205 711 CYS A CB  
2784 S SG  . CYS A 441 ? 3.9891 2.6530 3.2705 0.4533  -0.7382 -0.0976 711 CYS A SG  
2785 N N   . LYS A 442 ? 3.3285 2.2954 2.9553 -0.1629 -0.7982 -0.1011 712 LYS A N   
2786 C CA  . LYS A 442 ? 3.2445 2.3359 3.0150 -0.3446 -0.8371 -0.0798 712 LYS A CA  
2787 C C   . LYS A 442 ? 3.1363 2.3503 2.9538 -0.4595 -0.7123 -0.0766 712 LYS A C   
2788 O O   . LYS A 442 ? 3.0636 2.5106 3.0962 -0.5611 -0.6317 -0.0704 712 LYS A O   
2789 C CB  . LYS A 442 ? 3.4373 2.3200 3.0509 -0.3996 -1.0421 -0.0516 712 LYS A CB  
2790 N N   . PHE A 443 ? 3.1537 2.2052 2.7577 -0.4356 -0.7007 -0.0775 713 PHE A N   
2791 C CA  . PHE A 443 ? 3.0335 2.1580 2.6365 -0.5354 -0.5966 -0.0750 713 PHE A CA  
2792 C C   . PHE A 443 ? 2.9072 2.2624 2.7041 -0.5287 -0.4169 -0.1034 713 PHE A C   
2793 O O   . PHE A 443 ? 2.8409 2.3468 2.7340 -0.6405 -0.3353 -0.1019 713 PHE A O   
2794 C CB  . PHE A 443 ? 3.0121 1.9149 2.3501 -0.4765 -0.6081 -0.0711 713 PHE A CB  
2795 C CG  . PHE A 443 ? 2.8891 1.8427 2.2057 -0.5820 -0.5172 -0.0665 713 PHE A CG  
2796 C CD1 . PHE A 443 ? 2.9148 1.8340 2.1802 -0.7257 -0.5898 -0.0385 713 PHE A CD1 
2797 C CD2 . PHE A 443 ? 2.8112 1.8420 2.1608 -0.5391 -0.3675 -0.0867 713 PHE A CD2 
2798 C CE1 . PHE A 443 ? 2.9672 1.9357 2.2091 -0.8203 -0.5059 -0.0331 713 PHE A CE1 
2799 C CE2 . PHE A 443 ? 2.8068 1.8749 2.1278 -0.6338 -0.2910 -0.0848 713 PHE A CE2 
2800 C CZ  . PHE A 443 ? 2.9207 1.9612 2.1847 -0.7723 -0.3557 -0.0592 713 PHE A CZ  
2801 N N   . HIS A 444 ? 3.0278 2.4040 2.8744 -0.3917 -0.3599 -0.1280 714 HIS A N   
2802 C CA  . HIS A 444 ? 2.9138 2.4912 2.9469 -0.3739 -0.2078 -0.1591 714 HIS A CA  
2803 C C   . HIS A 444 ? 2.9094 2.7162 3.1768 -0.4606 -0.1888 -0.1601 714 HIS A C   
2804 O O   . HIS A 444 ? 2.9401 2.9236 3.3289 -0.5283 -0.0805 -0.1735 714 HIS A O   
2805 C CB  . HIS A 444 ? 2.8603 2.4064 2.9092 -0.2085 -0.1709 -0.1748 714 HIS A CB  
2806 C CG  . HIS A 444 ? 2.6507 2.3889 2.9003 -0.1824 -0.0359 -0.2088 714 HIS A CG  
2807 N ND1 . HIS A 444 ? 2.6210 2.4039 2.8784 -0.2037 0.0751  -0.2279 714 HIS A ND1 
2808 C CD2 . HIS A 444 ? 2.5951 2.4846 3.0407 -0.1368 -0.0018 -0.2292 714 HIS A CD2 
2809 C CE1 . HIS A 444 ? 2.5405 2.4810 2.9805 -0.1664 0.1665  -0.2617 714 HIS A CE1 
2810 N NE2 . HIS A 444 ? 2.5072 2.5204 3.0666 -0.1255 0.1263  -0.2625 714 HIS A NE2 
2811 N N   . ARG A 445 ? 3.0150 2.8178 3.3401 -0.4516 -0.2966 -0.1419 715 ARG A N   
2812 C CA  . ARG A 445 ? 2.9193 2.9413 3.4751 -0.5326 -0.2955 -0.1253 715 ARG A CA  
2813 C C   . ARG A 445 ? 2.7901 2.9362 3.4030 -0.6955 -0.2785 -0.0898 715 ARG A C   
2814 O O   . ARG A 445 ? 2.8310 3.2186 3.6494 -0.7542 -0.2063 -0.0773 715 ARG A O   
2815 C CB  . ARG A 445 ? 3.0803 3.0288 3.6507 -0.5139 -0.4509 -0.0989 715 ARG A CB  
2816 N N   . ALA A 446 ? 2.7065 2.6932 3.1362 -0.7617 -0.3426 -0.0684 716 ALA A N   
2817 C CA  . ALA A 446 ? 2.6159 2.7108 3.0827 -0.9126 -0.3210 -0.0301 716 ALA A CA  
2818 C C   . ALA A 446 ? 2.4201 2.6181 2.8908 -0.9098 -0.1518 -0.0673 716 ALA A C   
2819 O O   . ALA A 446 ? 2.4103 2.8307 3.0273 -0.9825 -0.0614 -0.0546 716 ALA A O   
2820 C CB  . ALA A 446 ? 2.7956 2.6719 3.0628 -0.9837 -0.4595 0.0060  716 ALA A CB  
2821 N N   . SER A 447 ? 2.4497 2.4830 2.7548 -0.8210 -0.1146 -0.1075 717 SER A N   
2822 C CA  . SER A 447 ? 2.2254 2.3151 2.5136 -0.8104 0.0269  -0.1448 717 SER A CA  
2823 C C   . SER A 447 ? 2.1977 2.5035 2.6873 -0.7589 0.1475  -0.1829 717 SER A C   
2824 O O   . SER A 447 ? 2.3266 2.7615 2.8651 -0.7886 0.2598  -0.2056 717 SER A O   
2825 C CB  . SER A 447 ? 2.2580 2.1321 2.3562 -0.7123 0.0299  -0.1669 717 SER A CB  
2826 N N   . VAL A 448 ? 2.1927 2.5275 2.7872 -0.6741 0.1199  -0.1919 718 VAL A N   
2827 C CA  . VAL A 448 ? 2.0782 2.6127 2.8696 -0.6182 0.2205  -0.2261 718 VAL A CA  
2828 C C   . VAL A 448 ? 2.1107 2.8943 3.0757 -0.7158 0.2586  -0.1960 718 VAL A C   
2829 O O   . VAL A 448 ? 2.2102 3.1758 3.2999 -0.6910 0.3748  -0.2262 718 VAL A O   
2830 C CB  . VAL A 448 ? 2.1297 2.6373 2.9956 -0.5082 0.1714  -0.2346 718 VAL A CB  
2831 N N   . LEU A 449 ? 2.1127 2.9035 3.0857 -0.8214 0.1558  -0.1306 719 LEU A N   
2832 C CA  . LEU A 449 ? 2.2432 3.2795 3.3853 -0.9264 0.1826  -0.0755 719 LEU A CA  
2833 C C   . LEU A 449 ? 2.2204 3.3435 3.3177 -1.0125 0.2674  -0.0635 719 LEU A C   
2834 O O   . LEU A 449 ? 2.1426 3.5090 3.3814 -1.0356 0.3680  -0.0494 719 LEU A O   
2835 C CB  . LEU A 449 ? 1.9503 2.9575 3.1320 -1.0160 0.0236  0.0039  719 LEU A CB  
2836 N N   . PHE A 450 ? 2.1881 3.1172 3.0843 -1.0520 0.2293  -0.0666 720 PHE A N   
2837 C CA  . PHE A 450 ? 2.1332 3.1215 2.9654 -1.1306 0.3049  -0.0580 720 PHE A CA  
2838 C C   . PHE A 450 ? 1.9818 3.0509 2.8174 -1.0504 0.4597  -0.1315 720 PHE A C   
2839 O O   . PHE A 450 ? 1.9156 3.1493 2.7875 -1.0928 0.5537  -0.1251 720 PHE A O   
2840 C CB  . PHE A 450 ? 1.9880 2.7322 2.5959 -1.1814 0.2257  -0.0484 720 PHE A CB  
2841 C CG  . PHE A 450 ? 1.9932 2.7738 2.5158 -1.2473 0.3096  -0.0505 720 PHE A CG  
2842 C CD1 . PHE A 450 ? 2.0285 2.9954 2.6372 -1.3653 0.3258  0.0167  720 PHE A CD1 
2843 C CD2 . PHE A 450 ? 2.0431 2.6786 2.4066 -1.1917 0.3689  -0.1107 720 PHE A CD2 
2844 C CE1 . PHE A 450 ? 2.1216 3.0968 2.6336 -1.3786 0.3919  0.0165  720 PHE A CE1 
2845 C CE2 . PHE A 450 ? 2.0821 2.7452 2.3625 -1.2523 0.4401  -0.1138 720 PHE A CE2 
2846 C CZ  . PHE A 450 ? 2.1583 2.9810 2.5023 -1.3264 0.4467  -0.0527 720 PHE A CZ  
2847 N N   . ALA A 451 ? 2.2153 3.1586 3.0053 -0.9310 0.4783  -0.1977 721 ALA A N   
2848 C CA  . ALA A 451 ? 2.3125 3.2982 3.1079 -0.8448 0.6016  -0.2709 721 ALA A CA  
2849 C C   . ALA A 451 ? 2.3877 3.6377 3.3780 -0.8133 0.6930  -0.2811 721 ALA A C   
2850 O O   . ALA A 451 ? 2.4514 3.8086 3.4438 -0.7963 0.8000  -0.3170 721 ALA A O   
2851 C CB  . ALA A 451 ? 2.3543 3.1585 3.0917 -0.7271 0.5828  -0.3192 721 ALA A CB  
2852 N N   . ASN A 452 ? 2.4312 3.7815 3.5768 -0.7988 0.6483  -0.2490 722 ASN A N   
2853 C CA  . ASN A 452 ? 2.7716 4.4020 4.1153 -0.7930 0.7215  -0.2288 722 ASN A CA  
2854 C C   . ASN A 452 ? 1.7432 3.5411 3.1229 -0.9173 0.7321  -0.1484 722 ASN A C   
2855 O O   . ASN A 452 ? 1.7895 3.4729 3.0590 -1.0147 0.6567  -0.1047 722 ASN A O   
2856 C CB  . ASN A 452 ? 1.6589 3.3485 3.1625 -0.7578 0.6571  -0.2020 722 ASN A CB  
2857 N N   . GLU A 453 ? 1.7441 3.8181 3.2791 -0.9109 0.8250  -0.1214 723 GLU A N   
2858 C CA  . GLU A 453 ? 1.8024 4.0507 3.3759 -1.0148 0.8444  -0.0307 723 GLU A CA  
2859 C C   . GLU A 453 ? 2.1187 4.4572 3.8392 -1.1199 0.7304  0.0867  723 GLU A C   
2860 O O   . GLU A 453 ? 2.1832 4.6819 4.0035 -1.1551 0.7395  0.1828  723 GLU A O   
2861 C CB  . GLU A 453 ? 1.8505 4.2903 3.4831 -0.9193 0.9691  -0.0272 723 GLU A CB  
2862 N N   . LYS A 454 ? 1.9765 4.1330 3.6778 -1.1288 0.6022  0.0814  724 LYS A N   
2863 C CA  . LYS A 454 ? 2.0750 4.2776 3.9117 -1.2131 0.4693  0.1804  724 LYS A CA  
2864 C C   . LYS A 454 ? 2.2385 4.2291 3.9285 -1.3261 0.3300  0.2244  724 LYS A C   
2865 O O   . LYS A 454 ? 2.1936 3.9351 3.7742 -1.3082 0.2074  0.1980  724 LYS A O   
2866 C CB  . LYS A 454 ? 1.9570 4.0856 3.8637 -1.1255 0.4074  0.1450  724 LYS A CB  
2867 N N   . TYR A 455 ? 2.3342 4.3863 3.9975 -1.4101 0.3457  0.2871  725 TYR A N   
2868 C CA  . TYR A 455 ? 2.5979 4.4112 4.0696 -1.4830 0.2432  0.3023  725 TYR A CA  
2869 C C   . TYR A 455 ? 2.1716 3.8869 3.6837 -1.5625 0.0569  0.3852  725 TYR A C   
2870 O O   . TYR A 455 ? 2.2312 3.6845 3.5773 -1.5897 -0.0696 0.3703  725 TYR A O   
2871 C CB  . TYR A 455 ? 2.1233 3.9908 3.5259 -1.4960 0.3271  0.3258  725 TYR A CB  
2872 C CG  . TYR A 455 ? 2.0940 3.9701 3.3887 -1.4122 0.4782  0.2323  725 TYR A CG  
2873 C CD1 . TYR A 455 ? 2.0007 3.7572 3.2109 -1.3483 0.5096  0.1278  725 TYR A CD1 
2874 C CD2 . TYR A 455 ? 2.1008 4.0940 3.3750 -1.3909 0.5837  0.2464  725 TYR A CD2 
2875 C CE1 . TYR A 455 ? 1.9524 3.6912 3.0627 -1.2651 0.6346  0.0389  725 TYR A CE1 
2876 C CE2 . TYR A 455 ? 2.0695 4.0437 3.2292 -1.3071 0.7028  0.1572  725 TYR A CE2 
2877 C CZ  . TYR A 455 ? 1.9918 3.8321 3.0703 -1.2449 0.7234  0.0531  725 TYR A CZ  
2878 O OH  . TYR A 455 ? 1.9795 3.7776 2.9453 -1.1589 0.8267  -0.0369 725 TYR A OH  
2879 N N   . LYS A 456 ? 2.3781 4.2919 4.0979 -1.5873 0.0397  0.4699  726 LYS A N   
2880 C CA  . LYS A 456 ? 2.6309 4.4722 4.4071 -1.6570 -0.1363 0.5531  726 LYS A CA  
2881 C C   . LYS A 456 ? 2.6811 4.3359 4.4252 -1.6396 -0.2772 0.5200  726 LYS A C   
2882 O O   . LYS A 456 ? 2.8051 4.2134 4.4135 -1.6734 -0.4395 0.5322  726 LYS A O   
2883 C CB  . LYS A 456 ? 2.3656 4.4835 4.3850 -1.6757 -0.1067 0.6494  726 LYS A CB  
2884 N N   . SER A 457 ? 2.5370 4.3067 4.3993 -1.5741 -0.2163 0.4779  727 SER A N   
2885 C CA  . SER A 457 ? 2.5539 4.1445 4.3823 -1.5196 -0.3348 0.4360  727 SER A CA  
2886 C C   . SER A 457 ? 2.5651 3.7939 4.0939 -1.4726 -0.4115 0.3574  727 SER A C   
2887 O O   . SER A 457 ? 2.7118 3.7145 4.1468 -1.4458 -0.5680 0.3480  727 SER A O   
2888 C CB  . SER A 457 ? 2.4109 4.1243 4.3365 -1.3793 -0.2041 0.3628  727 SER A CB  
2889 N N   . ALA A 458 ? 2.3977 3.5749 3.7735 -1.4561 -0.3018 0.3045  728 ALA A N   
2890 C CA  . ALA A 458 ? 2.4322 3.2930 3.5282 -1.4144 -0.3562 0.2428  728 ALA A CA  
2891 C C   . ALA A 458 ? 2.5374 3.2004 3.5147 -1.5213 -0.5439 0.3045  728 ALA A C   
2892 O O   . ALA A 458 ? 2.5987 2.9764 3.3801 -1.4642 -0.6620 0.2685  728 ALA A O   
2893 C CB  . ALA A 458 ? 2.4832 3.3627 3.4702 -1.3935 -0.1993 0.1892  728 ALA A CB  
2894 N N   . LEU A 459 ? 2.5036 3.2895 3.5641 -1.6128 -0.5535 0.3847  729 LEU A N   
2895 C CA  . LEU A 459 ? 2.6784 3.2594 3.5891 -1.6488 -0.6939 0.4274  729 LEU A CA  
2896 C C   . LEU A 459 ? 2.8991 3.3407 3.8194 -1.6470 -0.8876 0.4658  729 LEU A C   
2897 O O   . LEU A 459 ? 3.0870 3.2659 3.8106 -1.6333 -1.0232 0.4687  729 LEU A O   
2898 C CB  . LEU A 459 ? 2.7148 3.4722 3.7120 -1.7220 -0.6366 0.5031  729 LEU A CB  
2899 C CG  . LEU A 459 ? 2.7552 3.7563 4.0039 -1.7794 -0.6521 0.6027  729 LEU A CG  
2900 C CD1 . LEU A 459 ? 2.9679 3.8282 4.1848 -1.8318 -0.8407 0.6828  729 LEU A CD1 
2901 C CD2 . LEU A 459 ? 2.6964 3.9636 4.0610 -1.8081 -0.4921 0.6409  729 LEU A CD2 
2902 N N   . GLN A 460 ? 2.8623 3.4766 4.0037 -1.6507 -0.8991 0.4968  730 GLN A N   
2903 C CA  . GLN A 460 ? 2.9660 3.4387 4.1144 -1.6337 -1.0817 0.5228  730 GLN A CA  
2904 C C   . GLN A 460 ? 2.9504 3.1250 3.8804 -1.5349 -1.1711 0.4350  730 GLN A C   
2905 O O   . GLN A 460 ? 3.1324 3.0309 3.8692 -1.5016 -1.3272 0.4362  730 GLN A O   
2906 C CB  . GLN A 460 ? 2.8444 3.5801 4.2824 -1.6447 -1.0557 0.5676  730 GLN A CB  
2907 N N   . GLU A 461 ? 2.7861 3.0190 3.7456 -1.4782 -1.0701 0.3640  731 GLU A N   
2908 C CA  . GLU A 461 ? 2.8148 2.7825 3.5462 -1.3230 -1.0989 0.2724  731 GLU A CA  
2909 C C   . GLU A 461 ? 2.9067 2.6015 3.3408 -1.3107 -1.1410 0.2415  731 GLU A C   
2910 O O   . GLU A 461 ? 3.0257 2.4388 3.2355 -1.2103 -1.2503 0.2011  731 GLU A O   
2911 C CB  . GLU A 461 ? 2.6297 2.7367 3.4233 -1.1929 -0.9010 0.1990  731 GLU A CB  
2912 N N   . LEU A 462 ? 3.0093 2.7944 3.4366 -1.3999 -1.0475 0.2630  732 LEU A N   
2913 C CA  . LEU A 462 ? 2.9307 2.4967 3.0881 -1.3689 -1.0471 0.2383  732 LEU A CA  
2914 C C   . LEU A 462 ? 3.1518 2.4890 3.1432 -1.3533 -1.2139 0.2793  732 LEU A C   
2915 O O   . LEU A 462 ? 3.2544 2.3219 2.9944 -1.2567 -1.2825 0.2443  732 LEU A O   
2916 C CB  . LEU A 462 ? 2.8324 2.5773 3.0386 -1.4435 -0.8923 0.2552  732 LEU A CB  
2917 N N   . GLU A 463 ? 3.2354 2.6794 3.3632 -1.4405 -1.2749 0.3605  733 GLU A N   
2918 C CA  . GLU A 463 ? 3.4603 2.6902 3.4444 -1.4371 -1.4354 0.4108  733 GLU A CA  
2919 C C   . GLU A 463 ? 3.6038 2.5876 3.4601 -1.3318 -1.5873 0.3843  733 GLU A C   
2920 O O   . GLU A 463 ? 3.7757 2.4848 3.3948 -1.2600 -1.6890 0.3821  733 GLU A O   
2921 C CB  . GLU A 463 ? 3.5289 2.9320 3.7124 -1.5532 -1.4786 0.5125  733 GLU A CB  
2922 N N   . GLU A 464 ? 3.5658 2.6527 3.5830 -1.3155 -1.6002 0.3684  734 GLU A N   
2923 C CA  . GLU A 464 ? 3.7013 2.5720 3.6040 -1.1979 -1.7289 0.3312  734 GLU A CA  
2924 C C   . GLU A 464 ? 3.7526 2.3728 3.3650 -1.0536 -1.7178 0.2528  734 GLU A C   
2925 O O   . GLU A 464 ? 3.8635 2.2179 3.2756 -0.9384 -1.8375 0.2395  734 GLU A O   
2926 C CB  . GLU A 464 ? 3.5900 2.6551 3.7290 -1.1969 -1.7057 0.3140  734 GLU A CB  
2927 N N   . LEU A 465 ? 3.6419 2.3478 3.2332 -1.0541 -1.5672 0.2078  735 LEU A N   
2928 C CA  . LEU A 465 ? 3.6662 2.1615 2.9905 -0.9240 -1.5341 0.1487  735 LEU A CA  
2929 C C   . LEU A 465 ? 3.6349 1.9715 2.7537 -0.9201 -1.5450 0.1809  735 LEU A C   
2930 O O   . LEU A 465 ? 3.7438 1.8395 2.6168 -0.7898 -1.5824 0.1622  735 LEU A O   
2931 C CB  . LEU A 465 ? 3.3008 1.9415 2.6950 -0.9274 -1.3707 0.0924  735 LEU A CB  
2932 N N   . LYS A 466 ? 3.6068 2.0886 2.8335 -1.0536 -1.5051 0.2338  736 LYS A N   
2933 C CA  . LYS A 466 ? 3.7106 2.0638 2.7711 -1.0625 -1.5223 0.2714  736 LYS A CA  
2934 C C   . LYS A 466 ? 3.9678 2.0409 2.8556 -0.9867 -1.6928 0.3043  736 LYS A C   
2935 O O   . LYS A 466 ? 4.0746 1.9458 2.7508 -0.9208 -1.7149 0.3133  736 LYS A O   
2936 C CB  . LYS A 466 ? 3.6611 2.2297 2.8925 -1.2152 -1.4735 0.3306  736 LYS A CB  
2937 N N   . GLN A 467 ? 4.0717 2.1319 3.0607 -0.9960 -1.8099 0.3255  737 GLN A N   
2938 C CA  . GLN A 467 ? 4.4083 2.1858 3.2485 -0.9151 -1.9774 0.3492  737 GLN A CA  
2939 C C   . GLN A 467 ? 4.5162 2.0691 3.1554 -0.7300 -1.9902 0.2830  737 GLN A C   
2940 O O   . GLN A 467 ? 4.8228 2.0900 3.2555 -0.6277 -2.0678 0.2854  737 GLN A O   
2941 C CB  . GLN A 467 ? 4.4563 2.3102 3.4903 -0.9874 -2.0898 0.3941  737 GLN A CB  
2942 N N   . ILE A 468 ? 4.2735 1.9558 2.9831 -0.6840 -1.9068 0.2236  738 ILE A N   
2943 C CA  . ILE A 468 ? 4.3410 1.8541 2.8796 -0.5002 -1.8944 0.1609  738 ILE A CA  
2944 C C   . ILE A 468 ? 4.5213 1.9035 2.8504 -0.4035 -1.8012 0.1414  738 ILE A C   
2945 O O   . ILE A 468 ? 4.5971 1.7492 2.7492 -0.2448 -1.8145 0.1064  738 ILE A O   
2946 C CB  . ILE A 468 ? 4.0442 1.7541 2.7286 -0.4821 -1.8250 0.1075  738 ILE A CB  
2947 N N   . VAL A 469 ? 2.8511 2.3142 1.8653 -0.7802 -0.3202 0.1321  739 VAL A N   
2948 C CA  . VAL A 469 ? 2.7628 2.1285 1.7713 -0.7153 -0.2620 0.1201  739 VAL A CA  
2949 C C   . VAL A 469 ? 2.5995 1.9298 1.6241 -0.6918 -0.2374 0.1070  739 VAL A C   
2950 O O   . VAL A 469 ? 2.5568 1.9834 1.7079 -0.6442 -0.2496 0.1138  739 VAL A O   
2951 C CB  . VAL A 469 ? 2.6026 2.0486 1.7449 -0.6421 -0.2605 0.1362  739 VAL A CB  
2952 N N   . PRO A 470 ? 2.6404 1.8211 1.5250 -0.7226 -0.2025 0.0879  740 PRO A N   
2953 C CA  . PRO A 470 ? 2.6588 1.7825 1.5395 -0.6947 -0.1732 0.0784  740 PRO A CA  
2954 C C   . PRO A 470 ? 2.8347 1.8882 1.7296 -0.6097 -0.1217 0.0706  740 PRO A C   
2955 O O   . PRO A 470 ? 2.8103 1.7955 1.6854 -0.5745 -0.0914 0.0624  740 PRO A O   
2956 C CB  . PRO A 470 ? 2.8073 1.7900 1.5198 -0.7733 -0.1620 0.0631  740 PRO A CB  
2957 N N   . LYS A 471 ? 3.0785 2.1514 2.0080 -0.5770 -0.1112 0.0761  741 LYS A N   
2958 C CA  . LYS A 471 ? 3.2218 2.2484 2.1811 -0.4992 -0.0617 0.0726  741 LYS A CA  
2959 C C   . LYS A 471 ? 3.0784 2.2371 2.2197 -0.4337 -0.0817 0.0824  741 LYS A C   
2960 O O   . LYS A 471 ? 3.0093 2.1486 2.1921 -0.3718 -0.0560 0.0763  741 LYS A O   
2961 C CB  . LYS A 471 ? 3.2236 2.2090 2.1354 -0.4963 -0.0342 0.0773  741 LYS A CB  
2962 N N   . GLU A 472 ? 2.8969 2.1855 2.1416 -0.4451 -0.1297 0.0970  742 GLU A N   
2963 C CA  . GLU A 472 ? 2.5776 1.9808 1.9887 -0.3851 -0.1510 0.1045  742 GLU A CA  
2964 C C   . GLU A 472 ? 2.5379 1.9951 2.0146 -0.3550 -0.1735 0.0972  742 GLU A C   
2965 O O   . GLU A 472 ? 2.5093 2.0065 1.9691 -0.3924 -0.2029 0.0995  742 GLU A O   
2966 C CB  . GLU A 472 ? 2.3262 1.8325 1.8106 -0.4044 -0.1940 0.1228  742 GLU A CB  
2967 N N   . SER A 473 ? 2.5505 2.0140 2.1025 -0.2864 -0.1596 0.0899  743 SER A N   
2968 C CA  . SER A 473 ? 2.4858 2.0037 2.1035 -0.2454 -0.1834 0.0827  743 SER A CA  
2969 C C   . SER A 473 ? 2.2465 1.8918 1.9615 -0.2486 -0.2384 0.0890  743 SER A C   
2970 O O   . SER A 473 ? 2.2074 1.8950 1.9305 -0.2432 -0.2594 0.0866  743 SER A O   
2971 C CB  . SER A 473 ? 2.4874 2.0065 2.1847 -0.1691 -0.1687 0.0741  743 SER A CB  
2972 O OG  . SER A 473 ? 2.5918 2.0013 2.2079 -0.1562 -0.1141 0.0709  743 SER A OG  
2973 N N   . LEU A 474 ? 2.0507 1.7517 1.8346 -0.2533 -0.2577 0.0988  744 LEU A N   
2974 C CA  . LEU A 474 ? 1.8406 1.6524 1.7147 -0.2496 -0.3083 0.1060  744 LEU A CA  
2975 C C   . LEU A 474 ? 2.0139 1.8716 1.8435 -0.2921 -0.3314 0.1128  744 LEU A C   
2976 O O   . LEU A 474 ? 1.9943 1.9384 1.8895 -0.2674 -0.3646 0.1123  744 LEU A O   
2977 C CB  . LEU A 474 ? 1.6713 1.5052 1.5848 -0.2640 -0.3173 0.1222  744 LEU A CB  
2978 N N   . VAL A 475 ? 2.2300 2.0303 1.9475 -0.3562 -0.3134 0.1188  745 VAL A N   
2979 C CA  . VAL A 475 ? 2.2620 2.1091 1.9385 -0.4099 -0.3337 0.1278  745 VAL A CA  
2980 C C   . VAL A 475 ? 2.2362 2.0863 1.9022 -0.3956 -0.3258 0.1215  745 VAL A C   
2981 O O   . VAL A 475 ? 2.2446 2.1911 1.9521 -0.3998 -0.3511 0.1304  745 VAL A O   
2982 C CB  . VAL A 475 ? 2.2625 2.0312 1.8117 -0.4888 -0.3186 0.1315  745 VAL A CB  
2983 N N   . TYR A 476 ? 2.1946 1.9398 1.8023 -0.3747 -0.2879 0.1089  746 TYR A N   
2984 C CA  . TYR A 476 ? 2.3034 2.0301 1.8802 -0.3612 -0.2748 0.1066  746 TYR A CA  
2985 C C   . TYR A 476 ? 2.2183 2.0239 1.8978 -0.2811 -0.2960 0.1000  746 TYR A C   
2986 O O   . TYR A 476 ? 2.2656 2.1096 1.9453 -0.2679 -0.2999 0.1039  746 TYR A O   
2987 C CB  . TYR A 476 ? 2.4491 2.0244 1.9173 -0.3604 -0.2274 0.0973  746 TYR A CB  
2988 N N   . PHE A 477 ? 2.0899 1.9161 1.8523 -0.2298 -0.3091 0.0901  747 PHE A N   
2989 C CA  . PHE A 477 ? 2.0053 1.9015 1.8671 -0.1566 -0.3382 0.0786  747 PHE A CA  
2990 C C   . PHE A 477 ? 1.8637 1.8777 1.7895 -0.1548 -0.3779 0.0856  747 PHE A C   
2991 O O   . PHE A 477 ? 1.8509 1.9171 1.8170 -0.1037 -0.3970 0.0772  747 PHE A O   
2992 C CB  . PHE A 477 ? 1.9656 1.8536 1.9056 -0.1163 -0.3444 0.0678  747 PHE A CB  
2993 N N   . LEU A 478 ? 1.7859 1.8402 1.7145 -0.2060 -0.3901 0.1011  748 LEU A N   
2994 C CA  . LEU A 478 ? 1.6462 1.8163 1.6334 -0.2034 -0.4257 0.1119  748 LEU A CA  
2995 C C   . LEU A 478 ? 1.7391 1.9557 1.6842 -0.2312 -0.4175 0.1243  748 LEU A C   
2996 O O   . LEU A 478 ? 1.7692 2.0776 1.7638 -0.1952 -0.4362 0.1270  748 LEU A O   
2997 C CB  . LEU A 478 ? 1.5273 1.7268 1.5275 -0.2466 -0.4428 0.1283  748 LEU A CB  
2998 N N   . ILE A 479 ? 1.8659 2.0161 1.7174 -0.2960 -0.3876 0.1327  749 ILE A N   
2999 C CA  . ILE A 479 ? 2.0358 2.2139 1.8429 -0.3309 -0.3728 0.1469  749 ILE A CA  
3000 C C   . ILE A 479 ? 2.2526 2.4239 2.0642 -0.2631 -0.3603 0.1379  749 ILE A C   
3001 O O   . ILE A 479 ? 2.3710 2.6224 2.1979 -0.2537 -0.3606 0.1503  749 ILE A O   
3002 C CB  . ILE A 479 ? 2.0489 2.1210 1.7416 -0.4122 -0.3411 0.1526  749 ILE A CB  
3003 N N   . GLY A 480 ? 2.2326 2.3119 2.0288 -0.2145 -0.3485 0.1182  750 GLY A N   
3004 C CA  . GLY A 480 ? 2.1764 2.2443 1.9738 -0.1421 -0.3440 0.1071  750 GLY A CA  
3005 C C   . GLY A 480 ? 2.0452 2.2266 1.9276 -0.0810 -0.3792 0.1007  750 GLY A C   
3006 O O   . GLY A 480 ? 2.0864 2.3062 1.9538 -0.0500 -0.3732 0.1056  750 GLY A O   
3007 N N   . LYS A 481 ? 1.9211 2.1476 1.8854 -0.0611 -0.4134 0.0902  751 LYS A N   
3008 C CA  . LYS A 481 ? 1.7713 2.0897 1.8107 -0.0006 -0.4492 0.0807  751 LYS A CA  
3009 C C   . LYS A 481 ? 1.7950 2.2220 1.8420 -0.0222 -0.4492 0.1042  751 LYS A C   
3010 O O   . LYS A 481 ? 2.0453 2.5299 2.0988 0.0274  -0.4513 0.1028  751 LYS A O   
3011 C CB  . LYS A 481 ? 1.6672 1.9946 1.7864 0.0155  -0.4836 0.0685  751 LYS A CB  
3012 N N   . VAL A 482 ? 1.6352 2.0945 1.6813 -0.0940 -0.4473 0.1263  752 VAL A N   
3013 C CA  . VAL A 482 ? 1.5863 2.1675 1.6563 -0.1215 -0.4513 0.1524  752 VAL A CA  
3014 C C   . VAL A 482 ? 1.7040 2.3182 1.7294 -0.1349 -0.4183 0.1697  752 VAL A C   
3015 O O   . VAL A 482 ? 1.7783 2.5119 1.8424 -0.1201 -0.4200 0.1869  752 VAL A O   
3016 C CB  . VAL A 482 ? 1.4545 2.0521 1.5165 -0.2076 -0.4569 0.1729  752 VAL A CB  
3017 N N   . TYR A 483 ? 1.8034 2.3112 1.7465 -0.1603 -0.3851 0.1681  753 TYR A N   
3018 C CA  . TYR A 483 ? 1.8789 2.3943 1.7696 -0.1661 -0.3493 0.1857  753 TYR A CA  
3019 C C   . TYR A 483 ? 1.9581 2.4927 1.8558 -0.0674 -0.3498 0.1721  753 TYR A C   
3020 O O   . TYR A 483 ? 2.0068 2.6250 1.9058 -0.0507 -0.3326 0.1909  753 TYR A O   
3021 C CB  . TYR A 483 ? 1.9402 2.3147 1.7288 -0.2189 -0.3137 0.1888  753 TYR A CB  
3022 N N   . LYS A 484 ? 1.9303 2.3898 1.8311 -0.0032 -0.3694 0.1397  754 LYS A N   
3023 C CA  . LYS A 484 ? 1.8489 2.3127 1.7483 0.0926  -0.3800 0.1193  754 LYS A CA  
3024 C C   . LYS A 484 ? 1.7287 2.3189 1.6885 0.1420  -0.3994 0.1199  754 LYS A C   
3025 O O   . LYS A 484 ? 1.7209 2.3488 1.6525 0.1945  -0.3852 0.1232  754 LYS A O   
3026 C CB  . LYS A 484 ? 1.8250 2.2083 1.7450 0.1436  -0.4113 0.0824  754 LYS A CB  
3027 N N   . LYS A 485 ? 1.7145 2.3655 1.7502 0.1301  -0.4296 0.1181  755 LYS A N   
3028 C CA  . LYS A 485 ? 1.8071 2.5724 1.9013 0.1828  -0.4490 0.1187  755 LYS A CA  
3029 C C   . LYS A 485 ? 1.8914 2.7785 1.9920 0.1439  -0.4177 0.1596  755 LYS A C   
3030 O O   . LYS A 485 ? 1.9490 2.9423 2.0874 0.1964  -0.4207 0.1657  755 LYS A O   
3031 C CB  . LYS A 485 ? 1.6859 2.4666 1.8552 0.1854  -0.4914 0.1072  755 LYS A CB  
3032 N N   . LEU A 486 ? 1.8553 2.7267 1.9195 0.0521  -0.3875 0.1874  756 LEU A N   
3033 C CA  . LEU A 486 ? 1.9102 2.9012 1.9898 -0.0021 -0.3593 0.2290  756 LEU A CA  
3034 C C   . LEU A 486 ? 2.0483 3.0319 2.0615 0.0030  -0.3102 0.2479  756 LEU A C   
3035 O O   . LEU A 486 ? 2.0814 3.1754 2.1124 -0.0319 -0.2805 0.2850  756 LEU A O   
3036 C CB  . LEU A 486 ? 1.8698 2.8516 1.9481 -0.1164 -0.3598 0.2492  756 LEU A CB  
3037 N N   . GLY A 487 ? 2.1220 2.9812 2.0619 0.0484  -0.3017 0.2252  757 GLY A N   
3038 C CA  . GLY A 487 ? 2.1840 3.0161 2.0455 0.0616  -0.2553 0.2440  757 GLY A CA  
3039 C C   . GLY A 487 ? 2.2482 2.9473 2.0204 -0.0074 -0.2240 0.2564  757 GLY A C   
3040 O O   . GLY A 487 ? 2.3175 2.9336 2.0070 0.0307  -0.1983 0.2570  757 GLY A O   
3041 N N   . GLN A 488 ? 2.2283 2.8994 2.0074 -0.1050 -0.2266 0.2661  758 GLN A N   
3042 C CA  . GLN A 488 ? 2.2226 2.7532 1.9084 -0.1743 -0.1965 0.2760  758 GLN A CA  
3043 C C   . GLN A 488 ? 2.3114 2.6913 1.9405 -0.1173 -0.2067 0.2420  758 GLN A C   
3044 O O   . GLN A 488 ? 2.3076 2.6209 1.9461 -0.1367 -0.2292 0.2200  758 GLN A O   
3045 C CB  . GLN A 488 ? 2.0883 2.6167 1.7884 -0.2865 -0.2047 0.2863  758 GLN A CB  
3046 N N   . THR A 489 ? 2.3665 2.6995 1.9367 -0.0450 -0.1891 0.2401  759 THR A N   
3047 C CA  . THR A 489 ? 2.4334 2.6422 1.9564 0.0202  -0.2017 0.2102  759 THR A CA  
3048 C C   . THR A 489 ? 2.6712 2.7261 2.1085 -0.0353 -0.1749 0.2165  759 THR A C   
3049 O O   . THR A 489 ? 2.6699 2.6410 2.1050 -0.0120 -0.1928 0.1899  759 THR A O   
3050 C CB  . THR A 489 ? 2.4683 2.6693 1.9384 0.1139  -0.1923 0.2091  759 THR A CB  
3051 N N   . HIS A 490 ? 2.8860 2.9026 2.2532 -0.1083 -0.1302 0.2524  760 HIS A N   
3052 C CA  . HIS A 490 ? 2.9479 2.8013 2.2161 -0.1637 -0.1004 0.2598  760 HIS A CA  
3053 C C   . HIS A 490 ? 2.8448 2.6610 2.1349 -0.2332 -0.1174 0.2433  760 HIS A C   
3054 O O   . HIS A 490 ? 2.9139 2.5893 2.1384 -0.2380 -0.1069 0.2304  760 HIS A O   
3055 C CB  . HIS A 490 ? 2.9542 2.7766 2.1448 -0.2360 -0.0501 0.3039  760 HIS A CB  
3056 N N   . LEU A 491 ? 2.6596 2.6024 2.0372 -0.2812 -0.1425 0.2448  761 LEU A N   
3057 C CA  . LEU A 491 ? 2.5603 2.4807 1.9529 -0.3516 -0.1603 0.2331  761 LEU A CA  
3058 C C   . LEU A 491 ? 2.4613 2.3952 1.9224 -0.2914 -0.1984 0.1992  761 LEU A C   
3059 O O   . LEU A 491 ? 2.4969 2.3653 1.9437 -0.3269 -0.2046 0.1855  761 LEU A O   
3060 C CB  . LEU A 491 ? 2.4661 2.5209 1.9182 -0.4341 -0.1726 0.2550  761 LEU A CB  
3061 N N   . ALA A 492 ? 2.3506 2.3624 1.8799 -0.2009 -0.2222 0.1857  762 ALA A N   
3062 C CA  . ALA A 492 ? 2.3387 2.3516 1.9329 -0.1397 -0.2572 0.1540  762 ALA A CA  
3063 C C   . ALA A 492 ? 2.5331 2.4083 2.0702 -0.1012 -0.2429 0.1372  762 ALA A C   
3064 O O   . ALA A 492 ? 2.5712 2.3909 2.1153 -0.1167 -0.2465 0.1236  762 ALA A O   
3065 C CB  . ALA A 492 ? 2.2589 2.3793 1.9311 -0.0561 -0.2889 0.1416  762 ALA A CB  
3066 N N   . LEU A 493 ? 2.5939 2.4216 2.0772 -0.0443 -0.2269 0.1395  763 LEU A N   
3067 C CA  . LEU A 493 ? 2.6042 2.3035 2.0259 -0.0019 -0.2106 0.1291  763 LEU A CA  
3068 C C   . LEU A 493 ? 2.7207 2.2990 2.0696 -0.0702 -0.1784 0.1344  763 LEU A C   
3069 O O   . LEU A 493 ? 2.7723 2.2773 2.1173 -0.0429 -0.1753 0.1181  763 LEU A O   
3070 C CB  . LEU A 493 ? 2.5985 2.2496 1.9381 0.0460  -0.1876 0.1439  763 LEU A CB  
3071 N N   . MET A 494 ? 2.7478 2.3073 2.0383 -0.1587 -0.1541 0.1571  764 MET A N   
3072 C CA  . MET A 494 ? 2.7789 2.2164 1.9833 -0.2355 -0.1260 0.1603  764 MET A CA  
3073 C C   . MET A 494 ? 2.6615 2.0992 1.9114 -0.2485 -0.1436 0.1389  764 MET A C   
3074 O O   . MET A 494 ? 2.7218 2.0476 1.9240 -0.2288 -0.1243 0.1262  764 MET A O   
3075 C CB  . MET A 494 ? 2.8002 2.2576 1.9649 -0.3389 -0.1128 0.1856  764 MET A CB  
3076 N N   . ASN A 495 ? 2.4698 2.0345 1.8102 -0.2772 -0.1777 0.1376  765 ASN A N   
3077 C CA  . ASN A 495 ? 2.4091 1.9768 1.7836 -0.3003 -0.1926 0.1240  765 ASN A CA  
3078 C C   . ASN A 495 ? 2.4291 2.0027 1.8756 -0.2190 -0.2057 0.1034  765 ASN A C   
3079 O O   . ASN A 495 ? 2.4637 1.9985 1.9136 -0.2294 -0.2014 0.0941  765 ASN A O   
3080 C CB  . ASN A 495 ? 2.2510 1.9562 1.7016 -0.3476 -0.2278 0.1329  765 ASN A CB  
3081 N N   . PHE A 496 ? 2.4746 2.0961 1.9765 -0.1397 -0.2215 0.0966  766 PHE A N   
3082 C CA  . PHE A 496 ? 2.4487 2.0810 2.0276 -0.0678 -0.2386 0.0766  766 PHE A CA  
3083 C C   . PHE A 496 ? 2.6258 2.1343 2.1448 -0.0378 -0.2037 0.0704  766 PHE A C   
3084 O O   . PHE A 496 ? 2.6398 2.1417 2.2075 -0.0202 -0.2034 0.0600  766 PHE A O   
3085 C CB  . PHE A 496 ? 2.3142 2.0288 1.9616 0.0074  -0.2722 0.0671  766 PHE A CB  
3086 N N   . SER A 497 ? 2.7633 2.1755 2.1781 -0.0289 -0.1720 0.0794  767 SER A N   
3087 C CA  . SER A 497 ? 2.8689 2.1497 2.2085 0.0036  -0.1336 0.0768  767 SER A CA  
3088 C C   . SER A 497 ? 2.9420 2.1206 2.2049 -0.0565 -0.0977 0.0767  767 SER A C   
3089 O O   . SER A 497 ? 2.9556 2.0565 2.1959 -0.0199 -0.0702 0.0696  767 SER A O   
3090 C CB  . SER A 497 ? 3.0540 2.2455 2.2871 0.0267  -0.1082 0.0906  767 SER A CB  
3091 O OG  . SER A 497 ? 3.1774 2.3582 2.3424 -0.0473 -0.0975 0.1090  767 SER A OG  
3092 N N   . TRP A 498 ? 3.0396 2.2292 2.2684 -0.1447 -0.1008 0.0841  768 TRP A N   
3093 C CA  . TRP A 498 ? 3.2331 2.3459 2.3922 -0.2118 -0.0796 0.0810  768 TRP A CA  
3094 C C   . TRP A 498 ? 3.1442 2.3382 2.4095 -0.1908 -0.0985 0.0715  768 TRP A C   
3095 O O   . TRP A 498 ? 3.2723 2.4018 2.5200 -0.1677 -0.0711 0.0640  768 TRP A O   
3096 C CB  . TRP A 498 ? 3.3702 2.4990 2.4790 -0.3137 -0.0904 0.0924  768 TRP A CB  
3097 N N   . ALA A 499 ? 2.8618 2.2006 2.2425 -0.1902 -0.1436 0.0736  769 ALA A N   
3098 C CA  . ALA A 499 ? 2.7179 2.1370 2.2057 -0.1744 -0.1655 0.0685  769 ALA A CA  
3099 C C   . ALA A 499 ? 2.7721 2.1625 2.3062 -0.0990 -0.1473 0.0586  769 ALA A C   
3100 O O   . ALA A 499 ? 2.7709 2.1527 2.3317 -0.0992 -0.1328 0.0576  769 ALA A O   
3101 C CB  . ALA A 499 ? 2.5947 2.1584 2.2002 -0.1601 -0.2165 0.0699  769 ALA A CB  
3102 N N   . MET A 500 ? 2.8974 2.2759 2.4387 -0.0349 -0.1467 0.0539  770 MET A N   
3103 C CA  . MET A 500 ? 2.9842 2.3500 2.5776 0.0409  -0.1345 0.0460  770 MET A CA  
3104 C C   . MET A 500 ? 3.0553 2.2898 2.5489 0.0443  -0.0758 0.0480  770 MET A C   
3105 O O   . MET A 500 ? 3.0801 2.3208 2.6295 0.0817  -0.0572 0.0457  770 MET A O   
3106 C CB  . MET A 500 ? 3.0515 2.4347 2.6603 0.1083  -0.1535 0.0417  770 MET A CB  
3107 C CG  . MET A 500 ? 2.9391 2.4539 2.6671 0.1348  -0.2126 0.0324  770 MET A CG  
3108 N N   . ASP A 501 ? 3.0781 2.1927 2.4244 0.0075  -0.0453 0.0528  771 ASP A N   
3109 C CA  . ASP A 501 ? 3.1709 2.1357 2.3945 0.0091  0.0113  0.0520  771 ASP A CA  
3110 C C   . ASP A 501 ? 3.0904 2.0379 2.2982 -0.0373 0.0306  0.0495  771 ASP A C   
3111 O O   . ASP A 501 ? 3.1445 2.0058 2.2997 -0.0108 0.0773  0.0466  771 ASP A O   
3112 C CB  . ASP A 501 ? 3.3612 2.1944 2.4261 -0.0343 0.0330  0.0572  771 ASP A CB  
3113 N N   . LEU A 502 ? 3.0152 2.0417 2.2603 -0.1021 -0.0029 0.0523  772 LEU A N   
3114 C CA  . LEU A 502 ? 3.1385 2.1466 2.3548 -0.1483 0.0118  0.0525  772 LEU A CA  
3115 C C   . LEU A 502 ? 3.1614 2.2698 2.5201 -0.1025 0.0073  0.0561  772 LEU A C   
3116 O O   . LEU A 502 ? 3.2513 2.3447 2.5968 -0.1214 0.0296  0.0601  772 LEU A O   
3117 C CB  . LEU A 502 ? 3.1141 2.1675 2.3088 -0.2351 -0.0249 0.0572  772 LEU A CB  
3118 N N   . ASP A 503 ? 3.0992 2.3076 2.5904 -0.0447 -0.0228 0.0553  773 ASP A N   
3119 C CA  . ASP A 503 ? 3.0570 2.3752 2.7049 -0.0084 -0.0390 0.0586  773 ASP A CA  
3120 C C   . ASP A 503 ? 3.1002 2.3950 2.7835 0.0555  0.0052  0.0598  773 ASP A C   
3121 O O   . ASP A 503 ? 3.1973 2.4393 2.8443 0.1078  0.0247  0.0549  773 ASP A O   
3122 C CB  . ASP A 503 ? 2.9217 2.3568 2.6941 0.0206  -0.0989 0.0532  773 ASP A CB  
3123 N N   . PRO A 504 ? 3.0070 2.3454 2.7639 0.0541  0.0229  0.0697  774 PRO A N   
3124 C CA  . PRO A 504 ? 2.9823 2.3250 2.7976 0.1164  0.0668  0.0749  774 PRO A CA  
3125 C C   . PRO A 504 ? 2.8270 2.3116 2.8409 0.1404  0.0362  0.0819  774 PRO A C   
3126 O O   . PRO A 504 ? 2.7476 2.3071 2.8605 0.1757  -0.0117 0.0720  774 PRO A O   
3127 C CB  . PRO A 504 ? 3.0819 2.3313 2.7852 0.0885  0.1301  0.0837  774 PRO A CB  
3128 N N   . GLU B 8   ? 1.7809 1.9672 1.9235 0.3928  0.0214  -0.0257 6   GLU B N   
3129 C CA  . GLU B 8   ? 1.8531 2.1140 1.9892 0.3640  0.0018  -0.0574 6   GLU B CA  
3130 C C   . GLU B 8   ? 1.8366 2.0459 1.9855 0.3331  0.0075  -0.0915 6   GLU B C   
3131 O O   . GLU B 8   ? 1.8960 2.1134 2.0163 0.2853  -0.0092 -0.1216 6   GLU B O   
3132 C CB  . GLU B 8   ? 2.0272 2.3920 2.1817 0.4096  0.0029  -0.0432 6   GLU B CB  
3133 C CG  . GLU B 8   ? 2.1580 2.5514 2.3021 0.4666  0.0059  0.0027  6   GLU B CG  
3134 C CD  . GLU B 8   ? 2.1979 2.6842 2.3057 0.4523  -0.0236 -0.0018 6   GLU B CD  
3135 O OE1 . GLU B 8   ? 2.1533 2.6864 2.2527 0.3982  -0.0425 -0.0421 6   GLU B OE1 
3136 O OE2 . GLU B 8   ? 2.2825 2.7909 2.3665 0.4940  -0.0248 0.0339  6   GLU B OE2 
3137 N N   . PRO B 9   ? 1.8430 1.9960 2.0299 0.3598  0.0337  -0.0880 7   PRO B N   
3138 C CA  . PRO B 9   ? 1.9101 2.0193 2.1014 0.3280  0.0361  -0.1259 7   PRO B CA  
3139 C C   . PRO B 9   ? 1.8177 1.8551 1.9824 0.2862  0.0183  -0.1464 7   PRO B C   
3140 O O   . PRO B 9   ? 1.8690 1.8941 2.0032 0.2492  0.0035  -0.1766 7   PRO B O   
3141 C CB  . PRO B 9   ? 2.0569 2.1204 2.3003 0.3673  0.0714  -0.1200 7   PRO B CB  
3142 C CG  . PRO B 9   ? 2.0549 2.1635 2.3158 0.4244  0.0861  -0.0770 7   PRO B CG  
3143 C CD  . PRO B 9   ? 1.9443 2.0726 2.1679 0.4184  0.0652  -0.0539 7   PRO B CD  
3144 N N   . VAL B 10  ? 1.6288 1.6194 1.8034 0.2950  0.0213  -0.1300 8   VAL B N   
3145 C CA  . VAL B 10  ? 1.5324 1.4640 1.6924 0.2624  0.0026  -0.1506 8   VAL B CA  
3146 C C   . VAL B 10  ? 1.5599 1.5160 1.6633 0.2256  -0.0294 -0.1593 8   VAL B C   
3147 O O   . VAL B 10  ? 1.5675 1.4841 1.6427 0.1960  -0.0496 -0.1845 8   VAL B O   
3148 C CB  . VAL B 10  ? 1.5951 1.4830 1.7831 0.2788  0.0178  -0.1321 8   VAL B CB  
3149 C CG1 . VAL B 10  ? 1.7829 1.6219 1.9663 0.2481  -0.0039 -0.1585 8   VAL B CG1 
3150 C CG2 . VAL B 10  ? 1.6111 1.4569 1.8547 0.3109  0.0586  -0.1246 8   VAL B CG2 
3151 N N   . GLN B 11  ? 1.5975 1.6176 1.6824 0.2291  -0.0332 -0.1397 9   GLN B N   
3152 C CA  . GLN B 11  ? 1.6407 1.6839 1.6768 0.1910  -0.0559 -0.1511 9   GLN B CA  
3153 C C   . GLN B 11  ? 1.7317 1.7863 1.7357 0.1596  -0.0611 -0.1760 9   GLN B C   
3154 O O   . GLN B 11  ? 1.8196 1.8307 1.7787 0.1248  -0.0761 -0.1926 9   GLN B O   
3155 C CB  . GLN B 11  ? 1.5803 1.7046 1.6101 0.2012  -0.0565 -0.1326 9   GLN B CB  
3156 N N   . ALA B 12  ? 1.7547 1.8643 1.7801 0.1746  -0.0455 -0.1775 10  ALA B N   
3157 C CA  . ALA B 12  ? 1.7858 1.9119 1.7850 0.1454  -0.0413 -0.2026 10  ALA B CA  
3158 C C   . ALA B 12  ? 1.7704 1.8142 1.7468 0.1322  -0.0438 -0.2218 10  ALA B C   
3159 O O   . ALA B 12  ? 1.8012 1.8275 1.7266 0.0984  -0.0452 -0.2408 10  ALA B O   
3160 C CB  . ALA B 12  ? 1.8043 2.0149 1.8449 0.1709  -0.0220 -0.2024 10  ALA B CB  
3161 N N   . ALA B 13  ? 1.5976 1.5917 1.6094 0.1583  -0.0423 -0.2188 11  ALA B N   
3162 C CA  . ALA B 13  ? 1.6853 1.6107 1.6810 0.1489  -0.0503 -0.2432 11  ALA B CA  
3163 C C   . ALA B 13  ? 1.6281 1.4955 1.5712 0.1249  -0.0805 -0.2497 11  ALA B C   
3164 O O   . ALA B 13  ? 1.7263 1.5506 1.6196 0.1083  -0.0941 -0.2694 11  ALA B O   
3165 C CB  . ALA B 13  ? 1.7382 1.6349 1.7994 0.1807  -0.0359 -0.2458 11  ALA B CB  
3166 N N   . ILE B 14  ? 1.5143 1.3797 1.4651 0.1267  -0.0905 -0.2329 12  ILE B N   
3167 C CA  . ILE B 14  ? 1.4808 1.2948 1.3856 0.1074  -0.1173 -0.2373 12  ILE B CA  
3168 C C   . ILE B 14  ? 1.6846 1.4910 1.5108 0.0726  -0.1213 -0.2406 12  ILE B C   
3169 O O   . ILE B 14  ? 1.9014 1.6474 1.6693 0.0606  -0.1383 -0.2514 12  ILE B O   
3170 C CB  . ILE B 14  ? 1.4566 1.2780 1.3878 0.1142  -0.1204 -0.2207 12  ILE B CB  
3171 C CG1 . ILE B 14  ? 1.4047 1.2035 1.4018 0.1414  -0.1158 -0.2227 12  ILE B CG1 
3172 C CG2 . ILE B 14  ? 1.4504 1.2286 1.3287 0.0910  -0.1430 -0.2244 12  ILE B CG2 
3173 C CD1 . ILE B 14  ? 1.3925 1.2063 1.4203 0.1523  -0.1063 -0.2031 12  ILE B CD1 
3174 N N   . TRP B 15  ? 1.7344 1.6019 1.5579 0.0573  -0.1043 -0.2327 13  TRP B N   
3175 C CA  . TRP B 15  ? 1.8120 1.6750 1.5693 0.0170  -0.0974 -0.2400 13  TRP B CA  
3176 C C   . TRP B 15  ? 1.8835 1.7142 1.5898 0.0028  -0.0891 -0.2542 13  TRP B C   
3177 O O   . TRP B 15  ? 1.9544 1.7369 1.5843 -0.0291 -0.0855 -0.2582 13  TRP B O   
3178 C CB  . TRP B 15  ? 1.8179 1.7757 1.6007 0.0038  -0.0776 -0.2398 13  TRP B CB  
3179 C CG  . TRP B 15  ? 1.8219 1.8026 1.6180 0.0007  -0.0854 -0.2314 13  TRP B CG  
3180 C CD1 . TRP B 15  ? 1.9514 1.9956 1.8017 0.0297  -0.0863 -0.2180 13  TRP B CD1 
3181 C CD2 . TRP B 15  ? 1.7633 1.6980 1.5117 -0.0325 -0.0908 -0.2364 13  TRP B CD2 
3182 N NE1 . TRP B 15  ? 1.9583 2.0067 1.7970 0.0142  -0.0932 -0.2177 13  TRP B NE1 
3183 C CE2 . TRP B 15  ? 1.8518 1.8332 1.6333 -0.0248 -0.0952 -0.2308 13  TRP B CE2 
3184 C CE3 . TRP B 15  ? 1.7742 1.6262 1.4496 -0.0660 -0.0895 -0.2438 13  TRP B CE3 
3185 C CZ2 . TRP B 15  ? 1.8595 1.8122 1.6121 -0.0525 -0.0979 -0.2380 13  TRP B CZ2 
3186 C CZ3 . TRP B 15  ? 1.7710 1.5864 1.4174 -0.0906 -0.0907 -0.2466 13  TRP B CZ3 
3187 C CH2 . TRP B 15  ? 1.8624 1.7304 1.5515 -0.0853 -0.0947 -0.2465 13  TRP B CH2 
3188 N N   . GLN B 16  ? 1.7943 1.6449 1.5384 0.0262  -0.0821 -0.2621 14  GLN B N   
3189 C CA  . GLN B 16  ? 1.8289 1.6484 1.5237 0.0154  -0.0745 -0.2794 14  GLN B CA  
3190 C C   . GLN B 16  ? 1.8191 1.5482 1.4554 0.0199  -0.1051 -0.2833 14  GLN B C   
3191 O O   . GLN B 16  ? 2.0778 1.7523 1.6234 -0.0009 -0.1067 -0.2868 14  GLN B O   
3192 C CB  . GLN B 16  ? 1.8517 1.7154 1.6107 0.0415  -0.0579 -0.2913 14  GLN B CB  
3193 C CG  . GLN B 16  ? 2.1110 1.9791 1.8317 0.0246  -0.0356 -0.3128 14  GLN B CG  
3194 C CD  . GLN B 16  ? 2.2883 2.1875 2.0769 0.0539  -0.0197 -0.3282 14  GLN B CD  
3195 O OE1 . GLN B 16  ? 2.1763 2.0699 2.0283 0.0854  -0.0275 -0.3241 14  GLN B OE1 
3196 N NE2 . GLN B 16  ? 2.4509 2.3792 2.2286 0.0421  0.0082  -0.3481 14  GLN B NE2 
3197 N N   . ALA B 17  ? 1.8372 1.5520 1.5248 0.0489  -0.1281 -0.2835 15  ALA B N   
3198 C CA  . ALA B 17  ? 1.9133 1.5602 1.5645 0.0607  -0.1635 -0.2930 15  ALA B CA  
3199 C C   . ALA B 17  ? 1.7987 1.3853 1.3706 0.0451  -0.1809 -0.2779 15  ALA B C   
3200 O O   . ALA B 17  ? 1.8514 1.3738 1.3456 0.0482  -0.2038 -0.2817 15  ALA B O   
3201 C CB  . ALA B 17  ? 2.0145 1.6708 1.7542 0.0898  -0.1777 -0.3006 15  ALA B CB  
3202 N N   . LEU B 18  ? 1.7161 1.3224 1.3054 0.0308  -0.1695 -0.2613 16  LEU B N   
3203 C CA  . LEU B 18  ? 1.7539 1.3022 1.2738 0.0107  -0.1753 -0.2486 16  LEU B CA  
3204 C C   . LEU B 18  ? 1.8894 1.3934 1.3074 -0.0213 -0.1552 -0.2456 16  LEU B C   
3205 O O   . LEU B 18  ? 2.0748 1.4910 1.4041 -0.0227 -0.1689 -0.2373 16  LEU B O   
3206 C CB  . LEU B 18  ? 1.7892 1.3822 1.3534 -0.0043 -0.1600 -0.2394 16  LEU B CB  
3207 C CG  . LEU B 18  ? 1.6905 1.2652 1.2882 0.0093  -0.1794 -0.2342 16  LEU B CG  
3208 C CD1 . LEU B 18  ? 1.6751 1.2294 1.3163 0.0472  -0.2098 -0.2426 16  LEU B CD1 
3209 C CD2 . LEU B 18  ? 1.6070 1.2596 1.2667 0.0019  -0.1606 -0.2298 16  LEU B CD2 
3210 N N   . ASN B 19  ? 1.8568 1.4206 1.2873 -0.0451 -0.1201 -0.2522 17  ASN B N   
3211 C CA  . ASN B 19  ? 1.9539 1.4855 1.2975 -0.0830 -0.0890 -0.2536 17  ASN B CA  
3212 C C   . ASN B 19  ? 2.0275 1.4985 1.2887 -0.0742 -0.0961 -0.2578 17  ASN B C   
3213 O O   . ASN B 19  ? 2.1322 1.5565 1.3017 -0.1043 -0.0685 -0.2559 17  ASN B O   
3214 C CB  . ASN B 19  ? 1.9789 1.6105 1.3777 -0.1074 -0.0504 -0.2672 17  ASN B CB  
3215 C CG  . ASN B 19  ? 2.0708 1.7536 1.5104 -0.1314 -0.0361 -0.2670 17  ASN B CG  
3216 O OD1 . ASN B 19  ? 2.1810 1.8121 1.5630 -0.1661 -0.0216 -0.2647 17  ASN B OD1 
3217 N ND2 . ASN B 19  ? 2.0747 1.8587 1.6111 -0.1122 -0.0383 -0.2705 17  ASN B ND2 
3218 N N   . HIS B 20  ? 1.9828 1.4540 1.2739 -0.0347 -0.1307 -0.2663 18  HIS B N   
3219 C CA  . HIS B 20  ? 2.0343 1.4466 1.2408 -0.0202 -0.1491 -0.2735 18  HIS B CA  
3220 C C   . HIS B 20  ? 2.0332 1.3791 1.2072 0.0136  -0.1994 -0.2660 18  HIS B C   
3221 O O   . HIS B 20  ? 2.1791 1.4874 1.2946 0.0378  -0.2290 -0.2755 18  HIS B O   
3222 C CB  . HIS B 20  ? 1.9980 1.4715 1.2640 -0.0041 -0.1470 -0.3010 18  HIS B CB  
3223 C CG  . HIS B 20  ? 2.1627 1.6962 1.4499 -0.0320 -0.0985 -0.3107 18  HIS B CG  
3224 N ND1 . HIS B 20  ? 2.1821 1.7948 1.5617 -0.0411 -0.0739 -0.3080 18  HIS B ND1 
3225 C CD2 . HIS B 20  ? 2.3969 1.9270 1.6240 -0.0511 -0.0699 -0.3248 18  HIS B CD2 
3226 C CE1 . HIS B 20  ? 2.2924 1.9536 1.6772 -0.0620 -0.0347 -0.3219 18  HIS B CE1 
3227 N NE2 . HIS B 20  ? 2.4392 2.0499 1.7341 -0.0710 -0.0287 -0.3331 18  HIS B NE2 
3228 N N   . TYR B 21  ? 1.9543 1.2930 1.1685 0.0164  -0.2093 -0.2523 19  TYR B N   
3229 C CA  . TYR B 21  ? 1.9405 1.2226 1.1385 0.0491  -0.2543 -0.2461 19  TYR B CA  
3230 C C   . TYR B 21  ? 1.8904 1.2068 1.1515 0.0892  -0.2951 -0.2732 19  TYR B C   
3231 O O   . TYR B 21  ? 1.9986 1.2701 1.2150 0.1213  -0.3382 -0.2784 19  TYR B O   
3232 C CB  . TYR B 21  ? 2.0747 1.2470 1.1265 0.0491  -0.2608 -0.2247 19  TYR B CB  
3233 C CG  . TYR B 21  ? 2.1529 1.2939 1.1386 -0.0010 -0.2062 -0.2074 19  TYR B CG  
3234 C CD1 . TYR B 21  ? 2.3140 1.4511 1.3273 -0.0290 -0.1814 -0.1968 19  TYR B CD1 
3235 C CD2 . TYR B 21  ? 2.2380 1.3601 1.1396 -0.0241 -0.1756 -0.2081 19  TYR B CD2 
3236 C CE1 . TYR B 21  ? 2.3528 1.4710 1.3178 -0.0801 -0.1283 -0.1905 19  TYR B CE1 
3237 C CE2 . TYR B 21  ? 2.3142 1.4139 1.1659 -0.0751 -0.1196 -0.1990 19  TYR B CE2 
3238 C CZ  . TYR B 21  ? 2.3221 1.4216 1.2090 -0.1038 -0.0964 -0.1919 19  TYR B CZ  
3239 O OH  . TYR B 21  ? 2.3683 1.4529 1.2152 -0.1595 -0.0379 -0.1916 19  TYR B OH  
3240 N N   . ALA B 22  ? 1.8846 1.2819 1.2523 0.0883  -0.2797 -0.2922 20  ALA B N   
3241 C CA  . ALA B 22  ? 1.8926 1.3279 1.3465 0.1185  -0.3068 -0.3229 20  ALA B CA  
3242 C C   . ALA B 22  ? 1.7919 1.2522 1.3448 0.1280  -0.3110 -0.3202 20  ALA B C   
3243 O O   . ALA B 22  ? 1.6446 1.1600 1.2890 0.1235  -0.2846 -0.3228 20  ALA B O   
3244 C CB  . ALA B 22  ? 1.8365 1.3299 1.3452 0.1128  -0.2804 -0.3455 20  ALA B CB  
3245 N N   . TYR B 23  ? 1.7785 1.1937 1.3073 0.1437  -0.3425 -0.3137 21  TYR B N   
3246 C CA  . TYR B 23  ? 1.6108 1.0389 1.2145 0.1478  -0.3423 -0.3085 21  TYR B CA  
3247 C C   . TYR B 23  ? 1.5575 1.0357 1.2790 0.1679  -0.3511 -0.3400 21  TYR B C   
3248 O O   . TYR B 23  ? 1.4951 1.0082 1.2975 0.1622  -0.3267 -0.3359 21  TYR B O   
3249 C CB  . TYR B 23  ? 1.6667 1.0265 1.2095 0.1612  -0.3714 -0.2957 21  TYR B CB  
3250 C CG  . TYR B 23  ? 1.7649 1.0628 1.1950 0.1353  -0.3509 -0.2641 21  TYR B CG  
3251 C CD1 . TYR B 23  ? 1.8518 1.1713 1.2925 0.0981  -0.3081 -0.2477 21  TYR B CD1 
3252 C CD2 . TYR B 23  ? 2.0563 1.2751 1.3677 0.1478  -0.3720 -0.2527 21  TYR B CD2 
3253 C CE1 . TYR B 23  ? 2.0785 1.3451 1.4262 0.0675  -0.2829 -0.2269 21  TYR B CE1 
3254 C CE2 . TYR B 23  ? 2.2691 1.4201 1.4759 0.1194  -0.3432 -0.2242 21  TYR B CE2 
3255 C CZ  . TYR B 23  ? 2.2551 1.4317 1.4864 0.0760  -0.2966 -0.2145 21  TYR B CZ  
3256 O OH  . TYR B 23  ? 2.3280 1.4404 1.4650 0.0412  -0.2621 -0.1940 21  TYR B OH  
3257 N N   . ARG B 24  ? 1.7109 1.1925 1.4394 0.1904  -0.3837 -0.3736 22  ARG B N   
3258 C CA  . ARG B 24  ? 1.7088 1.2379 1.5547 0.2040  -0.3878 -0.4132 22  ARG B CA  
3259 C C   . ARG B 24  ? 1.5345 1.1062 1.4517 0.1870  -0.3386 -0.4146 22  ARG B C   
3260 O O   . ARG B 24  ? 1.4699 1.0689 1.4880 0.1889  -0.3183 -0.4272 22  ARG B O   
3261 C CB  . ARG B 24  ? 1.8822 1.4178 1.7176 0.2280  -0.4327 -0.4571 22  ARG B CB  
3262 N N   . ASP B 25  ? 1.5734 1.1471 1.4374 0.1723  -0.3164 -0.4011 23  ASP B N   
3263 C CA  . ASP B 25  ? 1.5590 1.1700 1.4855 0.1634  -0.2707 -0.4005 23  ASP B CA  
3264 C C   . ASP B 25  ? 1.5247 1.1522 1.4820 0.1553  -0.2371 -0.3627 23  ASP B C   
3265 O O   . ASP B 25  ? 1.4938 1.1480 1.5246 0.1594  -0.2026 -0.3594 23  ASP B O   
3266 C CB  . ASP B 25  ? 1.9867 1.6009 1.8496 0.1517  -0.2559 -0.3995 23  ASP B CB  
3267 C CG  . ASP B 25  ? 2.3221 1.9158 2.1204 0.1586  -0.2912 -0.4311 23  ASP B CG  
3268 O OD1 . ASP B 25  ? 2.3213 1.9350 2.1387 0.1583  -0.2798 -0.4623 23  ASP B OD1 
3269 O OD2 . ASP B 25  ? 2.4511 2.0072 2.1763 0.1669  -0.3300 -0.4251 23  ASP B OD2 
3270 N N   . ALA B 26  ? 1.4739 1.0822 1.3705 0.1452  -0.2468 -0.3352 24  ALA B N   
3271 C CA  . ALA B 26  ? 1.6324 1.2645 1.5402 0.1344  -0.2194 -0.3029 24  ALA B CA  
3272 C C   . ALA B 26  ? 1.5329 1.1673 1.5009 0.1428  -0.2184 -0.2993 24  ALA B C   
3273 O O   . ALA B 26  ? 1.4338 1.1002 1.4457 0.1444  -0.1886 -0.2815 24  ALA B O   
3274 C CB  . ALA B 26  ? 1.8372 1.4506 1.6536 0.1121  -0.2225 -0.2824 24  ALA B CB  
3275 N N   . VAL B 27  ? 1.4877 1.0892 1.4545 0.1508  -0.2505 -0.3159 25  VAL B N   
3276 C CA  . VAL B 27  ? 1.3623 0.9667 1.3923 0.1580  -0.2479 -0.3197 25  VAL B CA  
3277 C C   . VAL B 27  ? 1.3247 0.9549 1.4516 0.1676  -0.2201 -0.3355 25  VAL B C   
3278 O O   . VAL B 27  ? 1.4475 1.0898 1.6221 0.1682  -0.1931 -0.3240 25  VAL B O   
3279 C CB  . VAL B 27  ? 1.6915 1.2606 1.7129 0.1708  -0.2901 -0.3416 25  VAL B CB  
3280 C CG1 . VAL B 27  ? 1.7234 1.2484 1.6431 0.1624  -0.3092 -0.3206 25  VAL B CG1 
3281 C CG2 . VAL B 27  ? 1.8481 1.4179 1.8944 0.1889  -0.3195 -0.3811 25  VAL B CG2 
3282 N N   . PHE B 28  ? 1.2534 0.8875 1.4052 0.1738  -0.2229 -0.3630 26  PHE B N   
3283 C CA  . PHE B 28  ? 1.2001 0.8482 1.4448 0.1793  -0.1898 -0.3828 26  PHE B CA  
3284 C C   . PHE B 28  ? 1.2604 0.9225 1.5178 0.1798  -0.1403 -0.3459 26  PHE B C   
3285 O O   . PHE B 28  ? 1.4053 1.0658 1.7253 0.1851  -0.1042 -0.3404 26  PHE B O   
3286 C CB  . PHE B 28  ? 1.1949 0.8457 1.4569 0.1825  -0.2026 -0.4253 26  PHE B CB  
3287 C CG  . PHE B 28  ? 1.2991 0.9572 1.6694 0.1843  -0.1779 -0.4660 26  PHE B CG  
3288 C CD1 . PHE B 28  ? 1.4573 1.1240 1.8827 0.1880  -0.2064 -0.5146 26  PHE B CD1 
3289 C CD2 . PHE B 28  ? 1.1677 0.8234 1.5883 0.1832  -0.1235 -0.4578 26  PHE B CD2 
3290 C CE1 . PHE B 28  ? 1.4858 1.1633 2.0204 0.1831  -0.1778 -0.5600 26  PHE B CE1 
3291 C CE2 . PHE B 28  ? 1.3540 1.0054 1.8752 0.1800  -0.0913 -0.4971 26  PHE B CE2 
3292 C CZ  . PHE B 28  ? 1.4139 1.0785 1.9952 0.1763  -0.1169 -0.5511 26  PHE B CZ  
3293 N N   . LEU B 29  ? 1.2760 0.9520 1.4724 0.1764  -0.1372 -0.3208 27  LEU B N   
3294 C CA  . LEU B 29  ? 1.2978 0.9980 1.5001 0.1842  -0.0982 -0.2843 27  LEU B CA  
3295 C C   . LEU B 29  ? 1.3111 1.0242 1.5009 0.1838  -0.0915 -0.2527 27  LEU B C   
3296 O O   . LEU B 29  ? 1.3803 1.1042 1.5989 0.1981  -0.0573 -0.2275 27  LEU B O   
3297 C CB  . LEU B 29  ? 1.3467 1.0716 1.4926 0.1794  -0.0997 -0.2723 27  LEU B CB  
3298 C CG  . LEU B 29  ? 1.5324 1.2506 1.6795 0.1791  -0.1002 -0.3015 27  LEU B CG  
3299 C CD1 . LEU B 29  ? 1.6983 1.4471 1.7917 0.1723  -0.0943 -0.2871 27  LEU B CD1 
3300 C CD2 . LEU B 29  ? 1.5891 1.2976 1.8181 0.1954  -0.0639 -0.3148 27  LEU B CD2 
3301 N N   . ALA B 30  ? 1.2475 0.9553 1.3888 0.1689  -0.1227 -0.2543 28  ALA B N   
3302 C CA  . ALA B 30  ? 1.2718 0.9932 1.3964 0.1637  -0.1188 -0.2325 28  ALA B CA  
3303 C C   . ALA B 30  ? 1.2746 0.9787 1.4590 0.1713  -0.1034 -0.2396 28  ALA B C   
3304 O O   . ALA B 30  ? 1.2874 1.0082 1.4723 0.1747  -0.0814 -0.2162 28  ALA B O   
3305 C CB  . ALA B 30  ? 1.3661 1.0743 1.4256 0.1437  -0.1508 -0.2370 28  ALA B CB  
3306 N N   . GLU B 31  ? 1.3830 1.0592 1.6173 0.1734  -0.1142 -0.2750 29  GLU B N   
3307 C CA  . GLU B 31  ? 1.3285 0.9925 1.6338 0.1773  -0.0914 -0.2890 29  GLU B CA  
3308 C C   . GLU B 31  ? 1.5041 1.1676 1.8490 0.1889  -0.0385 -0.2684 29  GLU B C   
3309 O O   . GLU B 31  ? 1.8218 1.4824 2.1802 0.1930  -0.0051 -0.2478 29  GLU B O   
3310 C CB  . GLU B 31  ? 1.3279 0.9763 1.6903 0.1773  -0.1152 -0.3404 29  GLU B CB  
3311 C CG  . GLU B 31  ? 1.5824 1.2221 1.9180 0.1756  -0.1624 -0.3585 29  GLU B CG  
3312 C CD  . GLU B 31  ? 1.7529 1.3905 2.1412 0.1839  -0.1949 -0.4112 29  GLU B CD  
3313 O OE1 . GLU B 31  ? 1.8833 1.5303 2.3401 0.1846  -0.1762 -0.4403 29  GLU B OE1 
3314 O OE2 . GLU B 31  ? 1.6269 1.2543 1.9894 0.1916  -0.2388 -0.4256 29  GLU B OE2 
3315 N N   . ARG B 32  ? 1.3153 0.9758 1.6736 0.1957  -0.0285 -0.2736 30  ARG B N   
3316 C CA  . ARG B 32  ? 1.2125 0.8639 1.5967 0.2124  0.0228  -0.2480 30  ARG B CA  
3317 C C   . ARG B 32  ? 1.3065 0.9825 1.6379 0.2279  0.0397  -0.1936 30  ARG B C   
3318 O O   . ARG B 32  ? 1.4476 1.1078 1.7933 0.2416  0.0806  -0.1674 30  ARG B O   
3319 C CB  . ARG B 32  ? 1.1769 0.8259 1.5723 0.2165  0.0233  -0.2653 30  ARG B CB  
3320 C CG  . ARG B 32  ? 1.1518 0.7691 1.6315 0.2114  0.0465  -0.3117 30  ARG B CG  
3321 C CD  . ARG B 32  ? 1.2795 0.8954 1.8037 0.1946  0.0190  -0.3623 30  ARG B CD  
3322 N NE  . ARG B 32  ? 1.2818 0.8811 1.8425 0.1934  0.0546  -0.3492 30  ARG B NE  
3323 C CZ  . ARG B 32  ? 1.3587 0.9622 1.9526 0.1826  0.0401  -0.3763 30  ARG B CZ  
3324 N NH1 . ARG B 32  ? 1.1198 0.7434 1.7162 0.1766  -0.0152 -0.4177 30  ARG B NH1 
3325 N NH2 . ARG B 32  ? 1.5001 1.0862 2.1221 0.1808  0.0834  -0.3607 30  ARG B NH2 
3326 N N   . LEU B 33  ? 1.2659 0.9823 1.5355 0.2263  0.0107  -0.1786 31  LEU B N   
3327 C CA  . LEU B 33  ? 1.3351 1.0939 1.5586 0.2416  0.0200  -0.1354 31  LEU B CA  
3328 C C   . LEU B 33  ? 1.4507 1.2122 1.6603 0.2388  0.0276  -0.1209 31  LEU B C   
3329 O O   . LEU B 33  ? 1.7030 1.4790 1.8958 0.2617  0.0550  -0.0841 31  LEU B O   
3330 C CB  . LEU B 33  ? 1.3699 1.1782 1.5383 0.2294  -0.0141 -0.1357 31  LEU B CB  
3331 C CG  . LEU B 33  ? 1.4422 1.3151 1.5715 0.2450  -0.0093 -0.1010 31  LEU B CG  
3332 C CD1 . LEU B 33  ? 1.4574 1.3469 1.6047 0.2811  0.0168  -0.0771 31  LEU B CD1 
3333 C CD2 . LEU B 33  ? 1.4790 1.3995 1.5596 0.2179  -0.0415 -0.1136 31  LEU B CD2 
3334 N N   . TYR B 34  ? 1.3813 1.1279 1.5944 0.2143  0.0039  -0.1495 32  TYR B N   
3335 C CA  . TYR B 34  ? 1.4101 1.1595 1.6122 0.2086  0.0124  -0.1426 32  TYR B CA  
3336 C C   . TYR B 34  ? 1.4128 1.1227 1.6650 0.2181  0.0582  -0.1392 32  TYR B C   
3337 O O   . TYR B 34  ? 1.6688 1.3836 1.9009 0.2233  0.0821  -0.1178 32  TYR B O   
3338 C CB  . TYR B 34  ? 1.3637 1.1034 1.5600 0.1828  -0.0242 -0.1763 32  TYR B CB  
3339 C CG  . TYR B 34  ? 1.3644 1.1120 1.5458 0.1744  -0.0162 -0.1734 32  TYR B CG  
3340 C CD1 . TYR B 34  ? 1.4524 1.2468 1.5758 0.1738  -0.0150 -0.1489 32  TYR B CD1 
3341 C CD2 . TYR B 34  ? 1.4875 1.2028 1.7182 0.1674  -0.0078 -0.2001 32  TYR B CD2 
3342 C CE1 . TYR B 34  ? 1.5566 1.3602 1.6639 0.1646  -0.0058 -0.1509 32  TYR B CE1 
3343 C CE2 . TYR B 34  ? 1.5474 1.2693 1.7660 0.1590  0.0038  -0.2007 32  TYR B CE2 
3344 C CZ  . TYR B 34  ? 1.6872 1.4506 1.8405 0.1571  0.0053  -0.1756 32  TYR B CZ  
3345 O OH  . TYR B 34  ? 1.9254 1.6977 2.0634 0.1470  0.0181  -0.1808 32  TYR B OH  
3346 N N   . ALA B 35  ? 1.3543 1.0250 1.6713 0.2171  0.0723  -0.1652 33  ALA B N   
3347 C CA  . ALA B 35  ? 1.3326 0.9596 1.7072 0.2216  0.1258  -0.1672 33  ALA B CA  
3348 C C   . ALA B 35  ? 1.5839 1.1984 1.9314 0.2514  0.1720  -0.1153 33  ALA B C   
3349 O O   . ALA B 35  ? 1.7881 1.3744 2.1319 0.2615  0.2196  -0.0894 33  ALA B O   
3350 C CB  . ALA B 35  ? 1.3638 0.9616 1.8201 0.2100  0.1285  -0.2166 33  ALA B CB  
3351 N N   . GLU B 36  ? 1.5809 1.2158 1.9053 0.2680  0.1578  -0.0994 34  GLU B N   
3352 C CA  . GLU B 36  ? 1.7218 1.3461 2.0248 0.3048  0.1960  -0.0513 34  GLU B CA  
3353 C C   . GLU B 36  ? 1.7366 1.4015 1.9645 0.3253  0.1954  -0.0045 34  GLU B C   
3354 O O   . GLU B 36  ? 1.9842 1.6160 2.1946 0.3484  0.2417  0.0325  34  GLU B O   
3355 C CB  . GLU B 36  ? 1.9034 1.5542 2.2028 0.3156  0.1730  -0.0541 34  GLU B CB  
3356 C CG  . GLU B 36  ? 2.0758 1.7046 2.3746 0.3563  0.2144  -0.0147 34  GLU B CG  
3357 C CD  . GLU B 36  ? 2.2552 1.7993 2.6244 0.3528  0.2698  -0.0318 34  GLU B CD  
3358 O OE1 . GLU B 36  ? 2.3122 1.8438 2.7366 0.3197  0.2561  -0.0873 34  GLU B OE1 
3359 O OE2 . GLU B 36  ? 2.3714 1.8603 2.7412 0.3806  0.3277  0.0060  34  GLU B OE2 
3360 N N   . VAL B 37  ? 1.5820 1.3175 1.7628 0.3162  0.1456  -0.0081 35  VAL B N   
3361 C CA  . VAL B 37  ? 1.6854 1.4761 1.7984 0.3278  0.1364  0.0214  35  VAL B CA  
3362 C C   . VAL B 37  ? 1.7736 1.5770 1.8811 0.2878  0.1091  -0.0138 35  VAL B C   
3363 O O   . VAL B 37  ? 1.9688 1.7797 2.0915 0.2597  0.0725  -0.0502 35  VAL B O   
3364 C CB  . VAL B 37  ? 1.7345 1.6074 1.8029 0.3489  0.1060  0.0406  35  VAL B CB  
3365 C CG1 . VAL B 37  ? 1.8328 1.6987 1.8937 0.4026  0.1378  0.0874  35  VAL B CG1 
3366 C CG2 . VAL B 37  ? 1.7044 1.6021 1.7908 0.3208  0.0668  0.0032  35  VAL B CG2 
3367 N N   . HIS B 38  ? 1.6740 1.4802 1.7519 0.2872  0.1263  -0.0022 36  HIS B N   
3368 C CA  . HIS B 38  ? 1.6324 1.4524 1.7052 0.2514  0.1019  -0.0371 36  HIS B CA  
3369 C C   . HIS B 38  ? 1.6825 1.5816 1.6951 0.2430  0.0647  -0.0378 36  HIS B C   
3370 O O   . HIS B 38  ? 1.7080 1.6264 1.6972 0.2214  0.0560  -0.0553 36  HIS B O   
3371 C CB  . HIS B 38  ? 1.7075 1.4922 1.7845 0.2482  0.1419  -0.0347 36  HIS B CB  
3372 C CG  . HIS B 38  ? 1.7265 1.4376 1.8628 0.2557  0.1910  -0.0326 36  HIS B CG  
3373 N ND1 . HIS B 38  ? 1.6083 1.2795 1.8252 0.2328  0.1881  -0.0777 36  HIS B ND1 
3374 C CD2 . HIS B 38  ? 1.7958 1.4648 1.9226 0.2830  0.2470  0.0068  36  HIS B CD2 
3375 C CE1 . HIS B 38  ? 1.6758 1.2896 1.9394 0.2401  0.2417  -0.0726 36  HIS B CE1 
3376 N NE2 . HIS B 38  ? 1.7042 1.3072 1.9121 0.2697  0.2816  -0.0191 36  HIS B NE2 
3377 N N   . SER B 39  ? 1.7220 1.6683 1.7169 0.2584  0.0460  -0.0239 37  SER B N   
3378 C CA  . SER B 39  ? 1.8001 1.8328 1.7504 0.2494  0.0133  -0.0301 37  SER B CA  
3379 C C   . SER B 39  ? 1.8515 1.8839 1.7999 0.2015  -0.0154 -0.0739 37  SER B C   
3380 O O   . SER B 39  ? 1.8453 1.8170 1.8279 0.1819  -0.0232 -0.0977 37  SER B O   
3381 C CB  . SER B 39  ? 1.8142 1.8866 1.7695 0.2687  0.0011  -0.0189 37  SER B CB  
3382 O OG  . SER B 39  ? 1.8963 2.0596 1.8195 0.2553  -0.0275 -0.0326 37  SER B OG  
3383 N N   . GLU B 40  ? 1.9442 2.0436 1.8513 0.1847  -0.0303 -0.0859 38  GLU B N   
3384 C CA  . GLU B 40  ? 1.9158 2.0077 1.8164 0.1389  -0.0510 -0.1264 38  GLU B CA  
3385 C C   . GLU B 40  ? 1.9445 2.0408 1.8479 0.1192  -0.0724 -0.1423 38  GLU B C   
3386 O O   . GLU B 40  ? 2.1234 2.1777 2.0232 0.0855  -0.0849 -0.1700 38  GLU B O   
3387 C CB  . GLU B 40  ? 1.9429 2.1074 1.8013 0.1233  -0.0544 -0.1402 38  GLU B CB  
3388 C CG  . GLU B 40  ? 1.9767 2.1149 1.8288 0.0772  -0.0627 -0.1819 38  GLU B CG  
3389 C CD  . GLU B 40  ? 1.9599 2.1689 1.7746 0.0630  -0.0595 -0.1993 38  GLU B CD  
3390 O OE1 . GLU B 40  ? 1.8546 2.0277 1.6679 0.0400  -0.0513 -0.2241 38  GLU B OE1 
3391 O OE2 . GLU B 40  ? 2.0853 2.3908 1.8735 0.0784  -0.0655 -0.1899 38  GLU B OE2 
3392 N N   . GLU B 41  ? 1.8364 1.9793 1.7428 0.1418  -0.0737 -0.1240 39  GLU B N   
3393 C CA  . GLU B 41  ? 1.7537 1.8948 1.6649 0.1246  -0.0869 -0.1381 39  GLU B CA  
3394 C C   . GLU B 41  ? 1.7223 1.7775 1.6649 0.1342  -0.0842 -0.1345 39  GLU B C   
3395 O O   . GLU B 41  ? 1.6974 1.7168 1.6348 0.1124  -0.0966 -0.1526 39  GLU B O   
3396 C CB  . GLU B 41  ? 1.7609 1.9975 1.6694 0.1428  -0.0893 -0.1283 39  GLU B CB  
3397 C CG  . GLU B 41  ? 1.8608 2.1577 1.7662 0.1913  -0.0797 -0.0949 39  GLU B CG  
3398 C CD  . GLU B 41  ? 2.2129 2.5774 2.0838 0.1826  -0.0856 -0.1041 39  GLU B CD  
3399 O OE1 . GLU B 41  ? 2.3406 2.7860 2.1996 0.1547  -0.1007 -0.1340 39  GLU B OE1 
3400 O OE2 . GLU B 41  ? 2.4177 2.7556 2.2743 0.2000  -0.0722 -0.0858 39  GLU B OE2 
3401 N N   . ALA B 42  ? 1.7956 1.8178 1.7679 0.1661  -0.0655 -0.1133 40  ALA B N   
3402 C CA  . ALA B 42  ? 1.7184 1.6643 1.7299 0.1712  -0.0617 -0.1202 40  ALA B CA  
3403 C C   . ALA B 42  ? 1.6748 1.5643 1.6889 0.1443  -0.0773 -0.1488 40  ALA B C   
3404 O O   . ALA B 42  ? 1.7555 1.5977 1.7801 0.1358  -0.0933 -0.1677 40  ALA B O   
3405 C CB  . ALA B 42  ? 1.7682 1.6886 1.8157 0.2051  -0.0298 -0.0963 40  ALA B CB  
3406 N N   . LEU B 43  ? 1.6911 1.5879 1.6932 0.1347  -0.0730 -0.1523 41  LEU B N   
3407 C CA  . LEU B 43  ? 1.6094 1.4588 1.6128 0.1122  -0.0868 -0.1797 41  LEU B CA  
3408 C C   . LEU B 43  ? 1.6327 1.4684 1.5963 0.0841  -0.1118 -0.1977 41  LEU B C   
3409 O O   . LEU B 43  ? 1.8263 1.6012 1.7928 0.0786  -0.1298 -0.2146 41  LEU B O   
3410 C CB  . LEU B 43  ? 1.6272 1.4968 1.6202 0.1058  -0.0726 -0.1815 41  LEU B CB  
3411 C CG  . LEU B 43  ? 1.7208 1.5431 1.7192 0.0851  -0.0830 -0.2115 41  LEU B CG  
3412 C CD1 . LEU B 43  ? 1.8781 1.6450 1.9369 0.0997  -0.0801 -0.2243 41  LEU B CD1 
3413 C CD2 . LEU B 43  ? 1.6235 1.4797 1.5983 0.0717  -0.0687 -0.2179 41  LEU B CD2 
3414 N N   . PHE B 44  ? 1.5656 1.4591 1.4910 0.0678  -0.1111 -0.1947 42  PHE B N   
3415 C CA  . PHE B 44  ? 1.5563 1.4376 1.4406 0.0355  -0.1235 -0.2112 42  PHE B CA  
3416 C C   . PHE B 44  ? 1.6789 1.5134 1.5578 0.0395  -0.1356 -0.2108 42  PHE B C   
3417 O O   . PHE B 44  ? 1.7564 1.5292 1.6027 0.0221  -0.1481 -0.2231 42  PHE B O   
3418 C CB  . PHE B 44  ? 1.5947 1.5657 1.4554 0.0182  -0.1159 -0.2131 42  PHE B CB  
3419 C CG  . PHE B 44  ? 1.5817 1.5428 1.4043 -0.0213 -0.1181 -0.2330 42  PHE B CG  
3420 C CD1 . PHE B 44  ? 1.5776 1.4822 1.3712 -0.0538 -0.1177 -0.2539 42  PHE B CD1 
3421 C CD2 . PHE B 44  ? 1.6820 1.6870 1.4982 -0.0269 -0.1148 -0.2319 42  PHE B CD2 
3422 C CE1 . PHE B 44  ? 1.7677 1.6495 1.5212 -0.0929 -0.1106 -0.2705 42  PHE B CE1 
3423 C CE2 . PHE B 44  ? 1.8682 1.8598 1.6480 -0.0683 -0.1082 -0.2519 42  PHE B CE2 
3424 C CZ  . PHE B 44  ? 1.8948 1.8203 1.6404 -0.1024 -0.1044 -0.2698 42  PHE B CZ  
3425 N N   . LEU B 45  ? 1.7148 1.5738 1.6207 0.0644  -0.1301 -0.1963 43  LEU B N   
3426 C CA  . LEU B 45  ? 1.6319 1.4548 1.5328 0.0686  -0.1394 -0.1998 43  LEU B CA  
3427 C C   . LEU B 45  ? 1.6016 1.3471 1.5151 0.0776  -0.1580 -0.2130 43  LEU B C   
3428 O O   . LEU B 45  ? 1.6729 1.3673 1.5459 0.0670  -0.1761 -0.2232 43  LEU B O   
3429 C CB  . LEU B 45  ? 1.5237 1.3878 1.4597 0.0953  -0.1252 -0.1852 43  LEU B CB  
3430 C CG  . LEU B 45  ? 1.5881 1.5040 1.4998 0.0842  -0.1195 -0.1845 43  LEU B CG  
3431 C CD1 . LEU B 45  ? 1.5970 1.5267 1.5420 0.1114  -0.1083 -0.1769 43  LEU B CD1 
3432 C CD2 . LEU B 45  ? 1.5990 1.4744 1.4550 0.0490  -0.1301 -0.2019 43  LEU B CD2 
3433 N N   . LEU B 46  ? 1.3774 1.1159 1.3459 0.0987  -0.1524 -0.2139 44  LEU B N   
3434 C CA  . LEU B 46  ? 1.3009 0.9836 1.2983 0.1093  -0.1712 -0.2345 44  LEU B CA  
3435 C C   . LEU B 46  ? 1.3041 0.9385 1.2611 0.0964  -0.1940 -0.2468 44  LEU B C   
3436 O O   . LEU B 46  ? 1.4875 1.0735 1.4288 0.1045  -0.2209 -0.2600 44  LEU B O   
3437 C CB  . LEU B 46  ? 1.2644 0.9539 1.3297 0.1247  -0.1525 -0.2377 44  LEU B CB  
3438 C CG  . LEU B 46  ? 1.3917 1.0512 1.5218 0.1408  -0.1607 -0.2643 44  LEU B CG  
3439 C CD1 . LEU B 46  ? 1.5756 1.2241 1.7071 0.1486  -0.1772 -0.2770 44  LEU B CD1 
3440 C CD2 . LEU B 46  ? 1.6127 1.2858 1.8099 0.1508  -0.1237 -0.2622 44  LEU B CD2 
3441 N N   . ALA B 47  ? 1.3536 0.9995 1.2908 0.0787  -0.1832 -0.2433 45  ALA B N   
3442 C CA  . ALA B 47  ? 1.4359 1.0276 1.3347 0.0657  -0.1975 -0.2545 45  ALA B CA  
3443 C C   . ALA B 47  ? 1.6668 1.2234 1.4902 0.0469  -0.2054 -0.2493 45  ALA B C   
3444 O O   . ALA B 47  ? 1.9174 1.4020 1.7004 0.0486  -0.2235 -0.2544 45  ALA B O   
3445 C CB  . ALA B 47  ? 1.3978 1.0140 1.2971 0.0475  -0.1783 -0.2576 45  ALA B CB  
3446 N N   . THR B 48  ? 1.5937 1.1994 1.3972 0.0310  -0.1894 -0.2389 46  THR B N   
3447 C CA  . THR B 48  ? 1.6517 1.2284 1.3873 0.0096  -0.1887 -0.2360 46  THR B CA  
3448 C C   . THR B 48  ? 1.6743 1.2012 1.3906 0.0318  -0.2117 -0.2357 46  THR B C   
3449 O O   . THR B 48  ? 1.7526 1.2127 1.3984 0.0239  -0.2202 -0.2336 46  THR B O   
3450 C CB  . THR B 48  ? 1.5532 1.2106 1.2873 -0.0104 -0.1651 -0.2312 46  THR B CB  
3451 O OG1 . THR B 48  ? 1.5199 1.2110 1.2411 -0.0424 -0.1473 -0.2395 46  THR B OG1 
3452 C CG2 . THR B 48  ? 1.7976 1.4341 1.4812 -0.0232 -0.1620 -0.2297 46  THR B CG2 
3453 N N   . CYS B 49  ? 1.4924 1.0476 1.2681 0.0599  -0.2200 -0.2394 47  CYS B N   
3454 C CA  . CYS B 49  ? 1.4686 0.9904 1.2348 0.0811  -0.2437 -0.2480 47  CYS B CA  
3455 C C   . CYS B 49  ? 1.4562 0.9148 1.2143 0.1032  -0.2778 -0.2602 47  CYS B C   
3456 O O   . CYS B 49  ? 1.6668 1.0778 1.3708 0.1155  -0.3027 -0.2633 47  CYS B O   
3457 C CB  . CYS B 49  ? 1.4038 0.9759 1.2447 0.1004  -0.2364 -0.2552 47  CYS B CB  
3458 S SG  . CYS B 49  ? 1.7240 1.3667 1.5737 0.0888  -0.2014 -0.2400 47  CYS B SG  
3459 N N   . TYR B 50  ? 1.4837 0.9444 1.2928 0.1111  -0.2794 -0.2678 48  TYR B N   
3460 C CA  . TYR B 50  ? 1.6900 1.0971 1.4995 0.1354  -0.3118 -0.2817 48  TYR B CA  
3461 C C   . TYR B 50  ? 1.6529 0.9827 1.3677 0.1256  -0.3176 -0.2673 48  TYR B C   
3462 O O   . TYR B 50  ? 1.8227 1.0908 1.4929 0.1515  -0.3500 -0.2689 48  TYR B O   
3463 C CB  . TYR B 50  ? 1.6242 1.0560 1.5179 0.1436  -0.3050 -0.2969 48  TYR B CB  
3464 C CG  . TYR B 50  ? 1.4510 0.9358 1.4393 0.1585  -0.3000 -0.3160 48  TYR B CG  
3465 C CD1 . TYR B 50  ? 1.2585 0.7834 1.3146 0.1521  -0.2690 -0.3183 48  TYR B CD1 
3466 C CD2 . TYR B 50  ? 1.6038 1.0942 1.6106 0.1777  -0.3228 -0.3340 48  TYR B CD2 
3467 C CE1 . TYR B 50  ? 1.3281 0.8879 1.4682 0.1627  -0.2553 -0.3351 48  TYR B CE1 
3468 C CE2 . TYR B 50  ? 1.5795 1.1127 1.6783 0.1862  -0.3115 -0.3572 48  TYR B CE2 
3469 C CZ  . TYR B 50  ? 1.4703 1.0332 1.6360 0.1779  -0.2751 -0.3562 48  TYR B CZ  
3470 O OH  . TYR B 50  ? 1.4070 0.9999 1.6615 0.1832  -0.2548 -0.3783 48  TYR B OH  
3471 N N   . TYR B 51  ? 1.5042 0.8368 1.1876 0.0894  -0.2850 -0.2546 49  TYR B N   
3472 C CA  . TYR B 51  ? 1.6077 0.8601 1.2052 0.0717  -0.2780 -0.2435 49  TYR B CA  
3473 C C   . TYR B 51  ? 1.8820 1.0794 1.3842 0.0685  -0.2825 -0.2282 49  TYR B C   
3474 O O   . TYR B 51  ? 2.0988 1.2023 1.5261 0.0828  -0.2971 -0.2178 49  TYR B O   
3475 C CB  . TYR B 51  ? 1.5915 0.8754 1.1881 0.0269  -0.2379 -0.2434 49  TYR B CB  
3476 C CG  . TYR B 51  ? 1.6836 0.8809 1.2015 0.0008  -0.2205 -0.2383 49  TYR B CG  
3477 C CD1 . TYR B 51  ? 1.7023 0.8469 1.2268 0.0055  -0.2202 -0.2468 49  TYR B CD1 
3478 C CD2 . TYR B 51  ? 1.7688 0.9334 1.2084 -0.0309 -0.1978 -0.2275 49  TYR B CD2 
3479 C CE1 . TYR B 51  ? 1.7968 0.8504 1.2503 -0.0192 -0.1977 -0.2430 49  TYR B CE1 
3480 C CE2 . TYR B 51  ? 1.9033 0.9776 1.2704 -0.0590 -0.1727 -0.2238 49  TYR B CE2 
3481 C CZ  . TYR B 51  ? 1.9414 0.9570 1.3152 -0.0526 -0.1723 -0.2308 49  TYR B CZ  
3482 O OH  . TYR B 51  ? 2.2823 1.1964 1.5845 -0.0813 -0.1412 -0.2278 49  TYR B OH  
3483 N N   . ARG B 52  ? 1.8190 1.0709 1.3201 0.0523  -0.2679 -0.2257 50  ARG B N   
3484 C CA  . ARG B 52  ? 2.0006 1.2081 1.4121 0.0462  -0.2667 -0.2142 50  ARG B CA  
3485 C C   . ARG B 52  ? 1.9920 1.1688 1.3833 0.0911  -0.3103 -0.2181 50  ARG B C   
3486 O O   . ARG B 52  ? 2.1706 1.2805 1.4635 0.0964  -0.3178 -0.2057 50  ARG B O   
3487 C CB  . ARG B 52  ? 2.1546 1.4398 1.5827 0.0170  -0.2364 -0.2159 50  ARG B CB  
3488 C CG  . ARG B 52  ? 2.2442 1.5698 1.6805 -0.0285 -0.1958 -0.2168 50  ARG B CG  
3489 C CD  . ARG B 52  ? 2.1789 1.5790 1.6236 -0.0521 -0.1691 -0.2201 50  ARG B CD  
3490 N NE  . ARG B 52  ? 2.0808 1.5483 1.5537 -0.0896 -0.1372 -0.2286 50  ARG B NE  
3491 C CZ  . ARG B 52  ? 2.0112 1.5431 1.4857 -0.1185 -0.1087 -0.2364 50  ARG B CZ  
3492 N NH1 . ARG B 52  ? 2.0256 1.5582 1.4748 -0.1152 -0.1042 -0.2348 50  ARG B NH1 
3493 N NH2 . ARG B 52  ? 1.9941 1.5989 1.5005 -0.1494 -0.0856 -0.2503 50  ARG B NH2 
3494 N N   . SER B 53  ? 1.8195 1.0467 1.3020 0.1222  -0.3370 -0.2379 51  SER B N   
3495 C CA  . SER B 53  ? 1.7763 0.9881 1.2577 0.1667  -0.3840 -0.2530 51  SER B CA  
3496 C C   . SER B 53  ? 2.0176 1.1400 1.4346 0.1985  -0.4166 -0.2442 51  SER B C   
3497 O O   . SER B 53  ? 2.1821 1.2845 1.5730 0.2401  -0.4611 -0.2538 51  SER B O   
3498 C CB  . SER B 53  ? 1.6746 0.9635 1.2834 0.1861  -0.3971 -0.2833 51  SER B CB  
3499 O OG  . SER B 53  ? 1.6693 0.9506 1.3328 0.2006  -0.4070 -0.2917 51  SER B OG  
3500 N N   . GLY B 54  ? 2.1358 1.2060 1.5270 0.1812  -0.3947 -0.2279 52  GLY B N   
3501 C CA  . GLY B 54  ? 2.1939 1.1682 1.5254 0.2130  -0.4186 -0.2163 52  GLY B CA  
3502 C C   . GLY B 54  ? 1.9960 1.0002 1.4288 0.2473  -0.4467 -0.2412 52  GLY B C   
3503 O O   . GLY B 54  ? 2.1278 1.0779 1.5382 0.2941  -0.4849 -0.2420 52  GLY B O   
3504 N N   . LYS B 55  ? 1.7691 0.8604 1.3125 0.2258  -0.4257 -0.2613 53  LYS B N   
3505 C CA  . LYS B 55  ? 1.7271 0.8555 1.3765 0.2488  -0.4401 -0.2887 53  LYS B CA  
3506 C C   . LYS B 55  ? 1.8006 0.9512 1.4916 0.2091  -0.3944 -0.2873 53  LYS B C   
3507 O O   . LYS B 55  ? 1.6785 0.9086 1.4486 0.1910  -0.3726 -0.2994 53  LYS B O   
3508 C CB  . LYS B 55  ? 1.6155 0.8329 1.3649 0.2659  -0.4589 -0.3211 53  LYS B CB  
3509 N N   . ALA B 56  ? 1.9520 1.0276 1.5835 0.1969  -0.3785 -0.2729 54  ALA B N   
3510 C CA  . ALA B 56  ? 1.8781 0.9698 1.5348 0.1570  -0.3361 -0.2761 54  ALA B CA  
3511 C C   . ALA B 56  ? 1.7144 0.8602 1.4790 0.1677  -0.3343 -0.3037 54  ALA B C   
3512 O O   . ALA B 56  ? 1.8015 1.0092 1.6084 0.1362  -0.3012 -0.3097 54  ALA B O   
3513 C CB  . ALA B 56  ? 2.1653 1.1523 1.7368 0.1435  -0.3191 -0.2616 54  ALA B CB  
3514 N N   . TYR B 57  ? 1.6266 0.7513 1.4327 0.2136  -0.3690 -0.3215 55  TYR B N   
3515 C CA  . TYR B 57  ? 1.5680 0.7441 1.4835 0.2255  -0.3659 -0.3533 55  TYR B CA  
3516 C C   . TYR B 57  ? 1.4640 0.7377 1.4557 0.2084  -0.3469 -0.3638 55  TYR B C   
3517 O O   . TYR B 57  ? 1.4111 0.7297 1.4650 0.1918  -0.3168 -0.3774 55  TYR B O   
3518 C CB  . TYR B 57  ? 1.8669 1.0222 1.8252 0.2830  -0.4130 -0.3765 55  TYR B CB  
3519 C CG  . TYR B 57  ? 1.9179 1.1208 1.9116 0.3142  -0.4527 -0.3914 55  TYR B CG  
3520 C CD1 . TYR B 57  ? 1.8485 1.1415 1.9535 0.3103  -0.4449 -0.4229 55  TYR B CD1 
3521 C CD2 . TYR B 57  ? 2.1108 1.2667 2.0232 0.3448  -0.4935 -0.3760 55  TYR B CD2 
3522 C CE1 . TYR B 57  ? 1.8368 1.1755 1.9812 0.3332  -0.4767 -0.4447 55  TYR B CE1 
3523 C CE2 . TYR B 57  ? 2.1446 1.3520 2.0894 0.3709  -0.5302 -0.3967 55  TYR B CE2 
3524 C CZ  . TYR B 57  ? 1.9531 1.2541 2.0189 0.3635  -0.5218 -0.4341 55  TYR B CZ  
3525 O OH  . TYR B 57  ? 1.8739 1.2277 1.9785 0.3850  -0.5550 -0.4627 55  TYR B OH  
3526 N N   . LYS B 58  ? 1.4509 0.7502 1.4316 0.2136  -0.3618 -0.3569 56  LYS B N   
3527 C CA  . LYS B 58  ? 1.4734 0.8506 1.5237 0.2036  -0.3437 -0.3656 56  LYS B CA  
3528 C C   . LYS B 58  ? 1.4660 0.8787 1.5027 0.1638  -0.2972 -0.3450 56  LYS B C   
3529 O O   . LYS B 58  ? 1.5770 1.0425 1.6786 0.1565  -0.2699 -0.3519 56  LYS B O   
3530 C CB  . LYS B 58  ? 1.6515 1.0390 1.6813 0.2159  -0.3676 -0.3637 56  LYS B CB  
3531 N N   . ALA B 59  ? 1.4447 0.8297 1.3958 0.1390  -0.2870 -0.3211 57  ALA B N   
3532 C CA  . ALA B 59  ? 1.4724 0.9034 1.4100 0.1040  -0.2490 -0.3067 57  ALA B CA  
3533 C C   . ALA B 59  ? 1.3765 0.8141 1.3418 0.0925  -0.2277 -0.3200 57  ALA B C   
3534 O O   . ALA B 59  ? 1.3885 0.8845 1.3932 0.0837  -0.2012 -0.3205 57  ALA B O   
3535 C CB  . ALA B 59  ? 1.7582 1.1659 1.6075 0.0770  -0.2423 -0.2876 57  ALA B CB  
3536 N N   . TYR B 60  ? 1.4281 0.8014 1.3650 0.0931  -0.2361 -0.3293 58  TYR B N   
3537 C CA  . TYR B 60  ? 1.4143 0.7855 1.3791 0.0835  -0.2161 -0.3486 58  TYR B CA  
3538 C C   . TYR B 60  ? 1.3554 0.7801 1.4098 0.0971  -0.2041 -0.3666 58  TYR B C   
3539 O O   . TYR B 60  ? 1.3962 0.8686 1.4638 0.0768  -0.1718 -0.3688 58  TYR B O   
3540 C CB  . TYR B 60  ? 1.4543 0.7368 1.3985 0.1009  -0.2344 -0.3599 58  TYR B CB  
3541 C CG  . TYR B 60  ? 1.5380 0.8147 1.5198 0.0942  -0.2131 -0.3858 58  TYR B CG  
3542 C CD1 . TYR B 60  ? 1.6770 0.9427 1.6165 0.0549  -0.1816 -0.3907 58  TYR B CD1 
3543 C CD2 . TYR B 60  ? 1.4477 0.7353 1.5127 0.1249  -0.2221 -0.4116 58  TYR B CD2 
3544 C CE1 . TYR B 60  ? 1.6858 0.9471 1.6589 0.0473  -0.1599 -0.4190 58  TYR B CE1 
3545 C CE2 . TYR B 60  ? 1.6492 0.9330 1.7507 0.1184  -0.1991 -0.4384 58  TYR B CE2 
3546 C CZ  . TYR B 60  ? 1.7464 1.0146 1.7985 0.0801  -0.1682 -0.4411 58  TYR B CZ  
3547 O OH  . TYR B 60  ? 1.9244 1.1891 2.0116 0.0722  -0.1432 -0.4722 58  TYR B OH  
3548 N N   . ARG B 61  ? 1.3146 0.7321 1.4280 0.1313  -0.2289 -0.3820 59  ARG B N   
3549 C CA  . ARG B 61  ? 1.3342 0.7953 1.5421 0.1423  -0.2135 -0.4060 59  ARG B CA  
3550 C C   . ARG B 61  ? 1.2197 0.7413 1.4418 0.1265  -0.1805 -0.3889 59  ARG B C   
3551 O O   . ARG B 61  ? 1.1983 0.7526 1.4650 0.1196  -0.1463 -0.3974 59  ARG B O   
3552 C CB  . ARG B 61  ? 1.2770 0.7309 1.5498 0.1799  -0.2494 -0.4317 59  ARG B CB  
3553 N N   . LEU B 62  ? 1.2085 0.7401 1.3884 0.1230  -0.1884 -0.3636 60  LEU B N   
3554 C CA  . LEU B 62  ? 1.1708 0.7527 1.3535 0.1139  -0.1583 -0.3415 60  LEU B CA  
3555 C C   . LEU B 62  ? 1.3005 0.9140 1.4358 0.0898  -0.1297 -0.3247 60  LEU B C   
3556 O O   . LEU B 62  ? 1.3669 1.0154 1.5239 0.0880  -0.0967 -0.3194 60  LEU B O   
3557 C CB  . LEU B 62  ? 1.1754 0.7600 1.3258 0.1180  -0.1749 -0.3224 60  LEU B CB  
3558 C CG  . LEU B 62  ? 1.1905 0.8214 1.3413 0.1155  -0.1463 -0.2967 60  LEU B CG  
3559 C CD1 . LEU B 62  ? 1.1419 0.7769 1.3661 0.1331  -0.1362 -0.3078 60  LEU B CD1 
3560 C CD2 . LEU B 62  ? 1.2300 0.8694 1.3163 0.1071  -0.1581 -0.2753 60  LEU B CD2 
3561 N N   . LEU B 63  ? 1.4672 1.0687 1.5351 0.0709  -0.1404 -0.3184 61  LEU B N   
3562 C CA  . LEU B 63  ? 1.5133 1.1574 1.5376 0.0452  -0.1178 -0.3114 61  LEU B CA  
3563 C C   . LEU B 63  ? 1.5604 1.2104 1.6057 0.0376  -0.0954 -0.3323 61  LEU B C   
3564 O O   . LEU B 63  ? 1.5804 1.2841 1.6058 0.0257  -0.0710 -0.3264 61  LEU B O   
3565 C CB  . LEU B 63  ? 1.6833 1.3073 1.6422 0.0200  -0.1295 -0.3119 61  LEU B CB  
3566 C CG  . LEU B 63  ? 1.8457 1.4848 1.7711 0.0182  -0.1403 -0.2908 61  LEU B CG  
3567 C CD1 . LEU B 63  ? 2.0083 1.5928 1.8758 -0.0033 -0.1515 -0.2956 61  LEU B CD1 
3568 C CD2 . LEU B 63  ? 1.8409 1.5675 1.7537 0.0100  -0.1217 -0.2752 61  LEU B CD2 
3569 N N   . LYS B 64  ? 1.7218 1.3206 1.8048 0.0468  -0.1044 -0.3582 62  LYS B N   
3570 C CA  . LYS B 64  ? 1.6599 1.2633 1.7711 0.0402  -0.0799 -0.3830 62  LYS B CA  
3571 C C   . LYS B 64  ? 1.5842 1.2269 1.7444 0.0517  -0.0503 -0.3786 62  LYS B C   
3572 O O   . LYS B 64  ? 1.4625 1.1410 1.6093 0.0398  -0.0179 -0.3793 62  LYS B O   
3573 C CB  . LYS B 64  ? 1.5765 1.1163 1.7250 0.0538  -0.0976 -0.4134 62  LYS B CB  
3574 N N   . GLY B 65  ? 1.7131 1.3462 1.9272 0.0740  -0.0586 -0.3759 63  GLY B N   
3575 C CA  . GLY B 65  ? 1.6639 1.3197 1.9311 0.0826  -0.0237 -0.3739 63  GLY B CA  
3576 C C   . GLY B 65  ? 1.6160 1.3103 1.8426 0.0824  0.0030  -0.3340 63  GLY B C   
3577 O O   . GLY B 65  ? 1.5806 1.2793 1.8442 0.0912  0.0373  -0.3262 63  GLY B O   
3578 N N   . HIS B 66  ? 1.5832 1.3049 1.7358 0.0732  -0.0092 -0.3105 64  HIS B N   
3579 C CA  . HIS B 66  ? 1.5470 1.3156 1.6550 0.0795  0.0117  -0.2726 64  HIS B CA  
3580 C C   . HIS B 66  ? 1.6444 1.4614 1.6804 0.0609  0.0074  -0.2702 64  HIS B C   
3581 O O   . HIS B 66  ? 1.6527 1.4578 1.6723 0.0400  -0.0137 -0.2943 64  HIS B O   
3582 C CB  . HIS B 66  ? 1.5512 1.3205 1.6595 0.0947  -0.0044 -0.2482 64  HIS B CB  
3583 C CG  . HIS B 66  ? 1.5251 1.2573 1.7047 0.1107  0.0040  -0.2545 64  HIS B CG  
3584 N ND1 . HIS B 66  ? 1.7848 1.4969 1.9857 0.1178  -0.0244 -0.2599 64  HIS B ND1 
3585 C CD2 . HIS B 66  ? 1.5727 1.2876 1.8084 0.1179  0.0411  -0.2608 64  HIS B CD2 
3586 C CE1 . HIS B 66  ? 1.8437 1.5334 2.1150 0.1285  -0.0087 -0.2733 64  HIS B CE1 
3587 N NE2 . HIS B 66  ? 1.7210 1.4104 2.0181 0.1272  0.0332  -0.2747 64  HIS B NE2 
3588 N N   . SER B 67  ? 1.7950 1.6661 1.7871 0.0698  0.0279  -0.2428 65  SER B N   
3589 C CA  . SER B 67  ? 1.8908 1.8281 1.8179 0.0538  0.0223  -0.2463 65  SER B CA  
3590 C C   . SER B 67  ? 1.8567 1.8322 1.7533 0.0419  -0.0090 -0.2458 65  SER B C   
3591 O O   . SER B 67  ? 1.8960 1.9190 1.7723 0.0610  -0.0135 -0.2166 65  SER B O   
3592 C CB  . SER B 67  ? 2.0301 2.0207 1.9135 0.0760  0.0492  -0.2146 65  SER B CB  
3593 O OG  . SER B 67  ? 2.0608 2.0698 1.9361 0.1063  0.0461  -0.1737 65  SER B OG  
3594 N N   . CYS B 68  ? 1.7503 1.7008 1.6451 0.0112  -0.0266 -0.2784 66  CYS B N   
3595 C CA  . CYS B 68  ? 1.8113 1.7957 1.6754 -0.0097 -0.0469 -0.2850 66  CYS B CA  
3596 C C   . CYS B 68  ? 1.9005 1.9564 1.7239 -0.0401 -0.0423 -0.3129 66  CYS B C   
3597 O O   . CYS B 68  ? 1.9846 2.0142 1.8064 -0.0653 -0.0330 -0.3464 66  CYS B O   
3598 C CB  . CYS B 68  ? 1.8417 1.7441 1.7201 -0.0248 -0.0644 -0.3000 66  CYS B CB  
3599 S SG  . CYS B 68  ? 2.7529 2.6228 2.6024 -0.0723 -0.0650 -0.3425 66  CYS B SG  
3600 N N   . THR B 69  ? 1.8836 2.0363 1.6781 -0.0354 -0.0482 -0.3030 67  THR B N   
3601 C CA  . THR B 69  ? 1.9683 2.2106 1.7274 -0.0587 -0.0450 -0.3332 67  THR B CA  
3602 C C   . THR B 69  ? 1.7624 2.0894 1.5086 -0.0786 -0.0610 -0.3487 67  THR B C   
3603 O O   . THR B 69  ? 1.8104 2.2396 1.5322 -0.0940 -0.0636 -0.3758 67  THR B O   
3604 C CB  . THR B 69  ? 2.2513 2.5594 1.9814 -0.0242 -0.0341 -0.3098 67  THR B CB  
3605 O OG1 . THR B 69  ? 2.2662 2.6118 1.9927 0.0197  -0.0420 -0.2634 67  THR B OG1 
3606 C CG2 . THR B 69  ? 2.3282 2.5595 2.0727 -0.0122 -0.0092 -0.3021 67  THR B CG2 
3607 N N   . THR B 70  ? 1.6852 1.9741 1.4498 -0.0791 -0.0708 -0.3357 68  THR B N   
3608 C CA  . THR B 70  ? 1.6539 2.0227 1.4159 -0.0923 -0.0820 -0.3454 68  THR B CA  
3609 C C   . THR B 70  ? 1.7948 2.1032 1.5583 -0.1446 -0.0764 -0.3795 68  THR B C   
3610 O O   . THR B 70  ? 2.0037 2.1946 1.7699 -0.1526 -0.0707 -0.3782 68  THR B O   
3611 C CB  . THR B 70  ? 1.7418 2.1227 1.5192 -0.0475 -0.0917 -0.3006 68  THR B CB  
3612 O OG1 . THR B 70  ? 1.8218 2.0878 1.6186 -0.0274 -0.0880 -0.2729 68  THR B OG1 
3613 C CG2 . THR B 70  ? 1.8484 2.3243 1.6124 0.0000  -0.0957 -0.2727 68  THR B CG2 
3614 N N   . PRO B 71  ? 1.7987 2.1856 1.5598 -0.1792 -0.0758 -0.4112 69  PRO B N   
3615 C CA  . PRO B 71  ? 1.8519 2.1679 1.6060 -0.2345 -0.0598 -0.4447 69  PRO B CA  
3616 C C   . PRO B 71  ? 1.7511 1.9492 1.5028 -0.2206 -0.0622 -0.4110 69  PRO B C   
3617 O O   . PRO B 71  ? 1.8537 1.9307 1.5911 -0.2346 -0.0544 -0.4130 69  PRO B O   
3618 C CB  . PRO B 71  ? 1.9877 2.4252 1.7501 -0.2693 -0.0562 -0.4824 69  PRO B CB  
3619 C CG  . PRO B 71  ? 1.9836 2.5638 1.7567 -0.2260 -0.0772 -0.4696 69  PRO B CG  
3620 C CD  . PRO B 71  ? 1.8562 2.3853 1.6253 -0.1645 -0.0882 -0.4129 69  PRO B CD  
3621 N N   . GLN B 72  ? 1.6672 1.9055 1.4311 -0.1904 -0.0738 -0.3821 70  GLN B N   
3622 C CA  . GLN B 72  ? 1.8236 1.9699 1.5845 -0.1724 -0.0787 -0.3517 70  GLN B CA  
3623 C C   . GLN B 72  ? 1.6495 1.6787 1.4099 -0.1482 -0.0853 -0.3315 70  GLN B C   
3624 O O   . GLN B 72  ? 1.6567 1.5808 1.3980 -0.1558 -0.0860 -0.3279 70  GLN B O   
3625 C CB  . GLN B 72  ? 2.0696 2.2884 1.8533 -0.1311 -0.0899 -0.3226 70  GLN B CB  
3626 C CG  . GLN B 72  ? 2.1493 2.4553 1.9497 -0.0895 -0.0980 -0.3054 70  GLN B CG  
3627 C CD  . GLN B 72  ? 2.1329 2.4521 1.9544 -0.0356 -0.1049 -0.2638 70  GLN B CD  
3628 O OE1 . GLN B 72  ? 2.2534 2.5767 2.0845 -0.0322 -0.1057 -0.2579 70  GLN B OE1 
3629 N NE2 . GLN B 72  ? 1.9256 2.2484 1.7533 0.0056  -0.1046 -0.2362 70  GLN B NE2 
3630 N N   . CYS B 73  ? 1.5825 1.6331 1.3627 -0.1171 -0.0895 -0.3193 71  CYS B N   
3631 C CA  . CYS B 73  ? 1.5809 1.5386 1.3751 -0.0946 -0.0934 -0.3078 71  CYS B CA  
3632 C C   . CYS B 73  ? 1.5627 1.4472 1.3408 -0.1264 -0.0853 -0.3373 71  CYS B C   
3633 O O   . CYS B 73  ? 1.5513 1.3333 1.3260 -0.1204 -0.0922 -0.3342 71  CYS B O   
3634 C CB  . CYS B 73  ? 1.5940 1.5948 1.4123 -0.0597 -0.0899 -0.2909 71  CYS B CB  
3635 S SG  . CYS B 73  ? 2.3712 2.3958 2.2158 -0.0099 -0.0943 -0.2480 71  CYS B SG  
3636 N N   . LYS B 74  ? 1.6838 1.6244 1.4518 -0.1570 -0.0713 -0.3678 72  LYS B N   
3637 C CA  . LYS B 74  ? 1.7373 1.6158 1.4931 -0.1901 -0.0568 -0.4017 72  LYS B CA  
3638 C C   . LYS B 74  ? 1.7361 1.5180 1.4615 -0.2207 -0.0492 -0.4113 72  LYS B C   
3639 O O   . LYS B 74  ? 1.7918 1.4739 1.5078 -0.2279 -0.0419 -0.4229 72  LYS B O   
3640 C CB  . LYS B 74  ? 1.7634 1.7392 1.5127 -0.2231 -0.0416 -0.4397 72  LYS B CB  
3641 N N   . TYR B 75  ? 1.6526 1.4596 1.3603 -0.2362 -0.0482 -0.4051 73  TYR B N   
3642 C CA  . TYR B 75  ? 1.6979 1.4041 1.3652 -0.2625 -0.0364 -0.4065 73  TYR B CA  
3643 C C   . TYR B 75  ? 1.8425 1.4336 1.4961 -0.2221 -0.0568 -0.3727 73  TYR B C   
3644 O O   . TYR B 75  ? 2.0467 1.5223 1.6712 -0.2254 -0.0517 -0.3748 73  TYR B O   
3645 C CB  . TYR B 75  ? 1.6967 1.4687 1.3524 -0.2888 -0.0268 -0.4101 73  TYR B CB  
3646 C CG  . TYR B 75  ? 1.7545 1.4227 1.3590 -0.3217 -0.0054 -0.4112 73  TYR B CG  
3647 C CD1 . TYR B 75  ? 1.9481 1.5409 1.5223 -0.2943 -0.0189 -0.3756 73  TYR B CD1 
3648 C CD2 . TYR B 75  ? 1.7979 1.4392 1.3800 -0.3814 0.0320  -0.4492 73  TYR B CD2 
3649 C CE1 . TYR B 75  ? 2.1795 1.6700 1.6923 -0.3217 0.0035  -0.3720 73  TYR B CE1 
3650 C CE2 . TYR B 75  ? 2.0108 1.5428 1.5372 -0.4124 0.0598  -0.4462 73  TYR B CE2 
3651 C CZ  . TYR B 75  ? 2.1885 1.6436 1.6752 -0.3805 0.0450  -0.4046 73  TYR B CZ  
3652 O OH  . TYR B 75  ? 2.3130 1.6526 1.7302 -0.4089 0.0754  -0.3974 73  TYR B OH  
3653 N N   . LEU B 76  ? 1.7510 1.3749 1.4254 -0.1824 -0.0797 -0.3438 74  LEU B N   
3654 C CA  . LEU B 76  ? 1.5993 1.1376 1.2690 -0.1419 -0.1039 -0.3183 74  LEU B CA  
3655 C C   . LEU B 76  ? 1.5649 1.0330 1.2540 -0.1179 -0.1143 -0.3239 74  LEU B C   
3656 O O   . LEU B 76  ? 1.5924 0.9600 1.2563 -0.0989 -0.1286 -0.3155 74  LEU B O   
3657 C CB  . LEU B 76  ? 1.5269 1.1288 1.2334 -0.1056 -0.1216 -0.2963 74  LEU B CB  
3658 C CG  . LEU B 76  ? 1.5119 1.0425 1.2212 -0.0663 -0.1480 -0.2791 74  LEU B CG  
3659 C CD1 . LEU B 76  ? 1.7147 1.1649 1.3562 -0.0777 -0.1504 -0.2715 74  LEU B CD1 
3660 C CD2 . LEU B 76  ? 1.4684 1.0636 1.2219 -0.0368 -0.1570 -0.2642 74  LEU B CD2 
3661 N N   . LEU B 77  ? 1.5364 1.0607 1.2681 -0.1164 -0.1071 -0.3388 75  LEU B N   
3662 C CA  . LEU B 77  ? 1.5242 0.9967 1.2856 -0.0962 -0.1116 -0.3507 75  LEU B CA  
3663 C C   . LEU B 77  ? 1.5818 0.9629 1.3074 -0.1204 -0.0968 -0.3706 75  LEU B C   
3664 O O   . LEU B 77  ? 1.7663 1.0575 1.4941 -0.0934 -0.1101 -0.3696 75  LEU B O   
3665 C CB  . LEU B 77  ? 1.4887 1.0457 1.2952 -0.0941 -0.0994 -0.3630 75  LEU B CB  
3666 N N   . ALA B 78  ? 1.6075 1.0128 1.3040 -0.1698 -0.0684 -0.3916 76  ALA B N   
3667 C CA  . ALA B 78  ? 1.6974 1.0060 1.3559 -0.2001 -0.0447 -0.4121 76  ALA B CA  
3668 C C   . ALA B 78  ? 1.8950 1.0786 1.4979 -0.1846 -0.0538 -0.3857 76  ALA B C   
3669 O O   . ALA B 78  ? 1.9899 1.0606 1.5739 -0.1678 -0.0539 -0.3854 76  ALA B O   
3670 C CB  . ALA B 78  ? 1.6761 1.0437 1.3166 -0.2621 -0.0102 -0.4439 76  ALA B CB  
3671 N N   . LYS B 79  ? 1.8935 1.0971 1.4660 -0.1879 -0.0605 -0.3634 77  LYS B N   
3672 C CA  . LYS B 79  ? 1.8866 0.9803 1.3942 -0.1708 -0.0701 -0.3347 77  LYS B CA  
3673 C C   . LYS B 79  ? 1.8921 0.9178 1.4088 -0.1068 -0.1105 -0.3151 77  LYS B C   
3674 O O   . LYS B 79  ? 2.1322 1.0350 1.5927 -0.0878 -0.1150 -0.3008 77  LYS B O   
3675 C CB  . LYS B 79  ? 1.7977 0.9485 1.2851 -0.1796 -0.0734 -0.3175 77  LYS B CB  
3676 N N   . CYS B 80  ? 1.7338 0.8394 1.3214 -0.0727 -0.1380 -0.3161 78  CYS B N   
3677 C CA  . CYS B 80  ? 1.7164 0.7811 1.3339 -0.0147 -0.1761 -0.3098 78  CYS B CA  
3678 C C   . CYS B 80  ? 1.7729 0.7681 1.4057 -0.0027 -0.1709 -0.3279 78  CYS B C   
3679 O O   . CYS B 80  ? 1.8409 0.7499 1.4577 0.0408  -0.1966 -0.3196 78  CYS B O   
3680 C CB  . CYS B 80  ? 1.6099 0.7787 1.3100 0.0089  -0.1943 -0.3144 78  CYS B CB  
3681 S SG  . CYS B 80  ? 1.9301 1.1624 1.6230 0.0141  -0.2083 -0.2927 78  CYS B SG  
3682 N N   . CYS B 81  ? 1.7987 0.8363 1.4629 -0.0380 -0.1391 -0.3547 79  CYS B N   
3683 C CA  . CYS B 81  ? 1.8313 0.8081 1.5144 -0.0331 -0.1262 -0.3784 79  CYS B CA  
3684 C C   . CYS B 81  ? 1.9939 0.8277 1.5973 -0.0338 -0.1157 -0.3660 79  CYS B C   
3685 O O   . CYS B 81  ? 2.1932 0.9370 1.7938 0.0121  -0.1348 -0.3611 79  CYS B O   
3686 C CB  . CYS B 81  ? 1.8035 0.8522 1.5164 -0.0809 -0.0884 -0.4122 79  CYS B CB  
3687 S SG  . CYS B 81  ? 2.0892 1.2724 1.8909 -0.0660 -0.0958 -0.4255 79  CYS B SG  
3688 N N   . VAL B 82  ? 1.9995 0.8126 1.5391 -0.0851 -0.0824 -0.3620 80  VAL B N   
3689 C CA  . VAL B 82  ? 2.1256 0.7928 1.5803 -0.0967 -0.0576 -0.3498 80  VAL B CA  
3690 C C   . VAL B 82  ? 2.1951 0.7700 1.5930 -0.0370 -0.0966 -0.3081 80  VAL B C   
3691 O O   . VAL B 82  ? 2.3629 0.8034 1.7108 -0.0061 -0.0967 -0.2939 80  VAL B O   
3692 C CB  . VAL B 82  ? 2.1545 0.8309 1.5572 -0.1673 -0.0119 -0.3559 80  VAL B CB  
3693 N N   . ASP B 83  ? 2.1227 0.7703 1.5251 -0.0188 -0.1294 -0.2895 81  ASP B N   
3694 C CA  . ASP B 83  ? 2.1735 0.7626 1.5309 0.0411  -0.1746 -0.2570 81  ASP B CA  
3695 C C   . ASP B 83  ? 2.3363 0.8982 1.7435 0.1093  -0.2166 -0.2632 81  ASP B C   
3696 O O   . ASP B 83  ? 2.6084 1.0736 1.9589 0.1626  -0.2465 -0.2396 81  ASP B O   
3697 C CB  . ASP B 83  ? 2.0772 0.7721 1.4549 0.0455  -0.2007 -0.2484 81  ASP B CB  
3698 C CG  . ASP B 83  ? 2.1206 0.8171 1.4287 -0.0044 -0.1686 -0.2344 81  ASP B CG  
3699 O OD1 . ASP B 83  ? 2.2297 0.8570 1.4823 -0.0498 -0.1224 -0.2359 81  ASP B OD1 
3700 O OD2 . ASP B 83  ? 2.0949 0.8615 1.4081 0.0002  -0.1862 -0.2257 81  ASP B OD2 
3701 N N   . LEU B 84  ? 1.7710 0.7997 1.6316 -0.2054 -0.0677 0.4580  82  LEU B N   
3702 C CA  . LEU B 84  ? 1.7165 0.6860 1.6716 -0.1233 -0.0609 0.4848  82  LEU B CA  
3703 C C   . LEU B 84  ? 1.9130 0.7421 1.8386 -0.1140 -0.0404 0.4696  82  LEU B C   
3704 O O   . LEU B 84  ? 2.0306 0.8347 2.0011 -0.0414 -0.0216 0.4678  82  LEU B O   
3705 C CB  . LEU B 84  ? 1.6022 0.6763 1.6561 -0.0418 -0.0304 0.4969  82  LEU B CB  
3706 N N   . SER B 85  ? 1.9619 0.7041 1.7758 -0.1934 -0.0472 0.4431  83  SER B N   
3707 C CA  . SER B 85  ? 2.3062 0.9039 2.0730 -0.1929 -0.0218 0.4212  83  SER B CA  
3708 C C   . SER B 85  ? 2.3488 0.9690 2.1541 -0.1168 0.0339  0.3998  83  SER B C   
3709 O O   . SER B 85  ? 2.2850 0.7911 2.1339 -0.0627 0.0574  0.4169  83  SER B O   
3710 C CB  . SER B 85  ? 2.2111 0.7749 2.0525 -0.1560 -0.0164 0.4389  83  SER B CB  
3711 O OG  . SER B 85  ? 2.2260 0.8013 2.0241 -0.2175 -0.0514 0.4363  83  SER B OG  
3712 N N   . LYS B 86  ? 2.3644 1.1314 2.1519 -0.1115 0.0568  0.3644  84  LYS B N   
3713 C CA  . LYS B 86  ? 2.0127 0.8090 1.8090 -0.0474 0.1112  0.3372  84  LYS B CA  
3714 C C   . LYS B 86  ? 2.2064 1.0362 1.8703 -0.1091 0.1278  0.2672  84  LYS B C   
3715 O O   . LYS B 86  ? 2.0945 1.0673 1.7442 -0.1015 0.1411  0.2416  84  LYS B O   
3716 C CB  . LYS B 86  ? 1.8558 0.8007 1.7555 0.0248  0.1240  0.3629  84  LYS B CB  
3717 N N   . LEU B 87  ? 2.3076 1.0025 1.8762 -0.1718 0.1248  0.2384  85  LEU B N   
3718 C CA  . LEU B 87  ? 2.4604 1.1732 1.8989 -0.2540 0.1274  0.1726  85  LEU B CA  
3719 C C   . LEU B 87  ? 2.4798 1.2275 1.8670 -0.2203 0.1713  0.1248  85  LEU B C   
3720 O O   . LEU B 87  ? 2.4149 1.2612 1.7252 -0.2718 0.1663  0.0768  85  LEU B O   
3721 C CB  . LEU B 87  ? 2.4808 1.0147 1.8342 -0.3220 0.1207  0.1560  85  LEU B CB  
3722 N N   . ALA B 88  ? 2.5403 1.2059 1.9703 -0.1339 0.2140  0.1398  86  ALA B N   
3723 C CA  . ALA B 88  ? 2.5654 1.2426 1.9397 -0.0924 0.2618  0.0986  86  ALA B CA  
3724 C C   . ALA B 88  ? 2.4788 1.3629 1.8914 -0.0625 0.2575  0.1002  86  ALA B C   
3725 O O   . ALA B 88  ? 2.6592 1.6243 1.9852 -0.0878 0.2630  0.0520  86  ALA B O   
3726 C CB  . ALA B 88  ? 2.7314 1.2770 2.1602 0.0014  0.3149  0.1240  86  ALA B CB  
3727 N N   . GLU B 89  ? 2.2630 1.2287 1.8057 -0.0088 0.2464  0.1575  87  GLU B N   
3728 C CA  . GLU B 89  ? 2.2475 1.4068 1.8404 0.0202  0.2421  0.1685  87  GLU B CA  
3729 C C   . GLU B 89  ? 2.2505 1.5345 1.7713 -0.0693 0.2047  0.1346  87  GLU B C   
3730 O O   . GLU B 89  ? 2.3614 1.7618 1.8339 -0.0699 0.2138  0.1023  87  GLU B O   
3731 C CB  . GLU B 89  ? 2.2407 1.4442 1.9769 0.0689  0.2268  0.2352  87  GLU B CB  
3732 C CG  . GLU B 89  ? 2.1155 1.3322 1.9546 0.1791  0.2710  0.2690  87  GLU B CG  
3733 C CD  . GLU B 89  ? 1.9291 1.3083 1.7691 0.2198  0.2954  0.2575  87  GLU B CD  
3734 O OE1 . GLU B 89  ? 1.9087 1.4074 1.6868 0.1641  0.2716  0.2305  87  GLU B OE1 
3735 O OE2 . GLU B 89  ? 1.9675 1.3550 1.8745 0.3093  0.3405  0.2783  87  GLU B OE2 
3736 N N   . GLY B 90  ? 2.2458 1.5080 1.7651 -0.1418 0.1635  0.1461  88  GLY B N   
3737 C CA  . GLY B 90  ? 2.2888 1.6593 1.7531 -0.2311 0.1310  0.1197  88  GLY B CA  
3738 C C   . GLY B 90  ? 2.5047 1.9040 1.8554 -0.2814 0.1368  0.0547  88  GLY B C   
3739 O O   . GLY B 90  ? 2.5351 2.0964 1.8719 -0.3059 0.1257  0.0363  88  GLY B O   
3740 N N   . GLU B 91  ? 2.4896 1.7274 1.7588 -0.2976 0.1536  0.0209  89  GLU B N   
3741 C CA  . GLU B 91  ? 2.7110 1.9459 1.8589 -0.3444 0.1601  -0.0449 89  GLU B CA  
3742 C C   . GLU B 91  ? 2.7406 2.0887 1.8844 -0.2762 0.1844  -0.0563 89  GLU B C   
3743 O O   . GLU B 91  ? 2.6904 2.1759 1.7868 -0.3132 0.1667  -0.0884 89  GLU B O   
3744 C CB  . GLU B 91  ? 2.9380 1.9527 2.0004 -0.3607 0.1840  -0.0745 89  GLU B CB  
3745 N N   . GLN B 92  ? 2.8217 2.1114 2.0181 -0.1754 0.2256  -0.0275 90  GLN B N   
3746 C CA  . GLN B 92  ? 2.8062 2.1796 1.9913 -0.1029 0.2570  -0.0357 90  GLN B CA  
3747 C C   . GLN B 92  ? 2.6324 2.2284 1.8831 -0.0881 0.2369  -0.0131 90  GLN B C   
3748 O O   . GLN B 92  ? 2.5217 2.2157 1.7409 -0.0500 0.2517  -0.0275 90  GLN B O   
3749 C CB  . GLN B 92  ? 2.7141 1.9852 1.9662 0.0056  0.3101  0.0002  90  GLN B CB  
3750 N N   . ILE B 93  ? 2.6095 2.2811 1.9480 -0.1129 0.2072  0.0247  91  ILE B N   
3751 C CA  . ILE B 93  ? 2.4089 2.2875 1.8019 -0.1000 0.1949  0.0437  91  ILE B CA  
3752 C C   . ILE B 93  ? 2.3646 2.3708 1.6926 -0.1880 0.1586  0.0055  91  ILE B C   
3753 O O   . ILE B 93  ? 2.4301 2.5802 1.7442 -0.1664 0.1601  -0.0045 91  ILE B O   
3754 C CB  . ILE B 93  ? 2.2407 2.1620 1.7525 -0.0870 0.1825  0.1009  91  ILE B CB  
3755 C CG1 . ILE B 93  ? 2.1959 2.0298 1.7976 0.0063  0.2139  0.1459  91  ILE B CG1 
3756 C CG2 . ILE B 93  ? 2.0430 2.1714 1.6055 -0.0763 0.1762  0.1195  91  ILE B CG2 
3757 C CD1 . ILE B 93  ? 2.2119 2.1470 1.8667 0.1034  0.2525  0.1657  91  ILE B CD1 
3758 N N   . LEU B 94  ? 2.2803 2.2382 1.5703 -0.2864 0.1265  -0.0147 92  LEU B N   
3759 C CA  . LEU B 94  ? 2.1982 2.2944 1.4459 -0.3683 0.0938  -0.0471 92  LEU B CA  
3760 C C   . LEU B 94  ? 2.3629 2.4473 1.4901 -0.4083 0.0857  -0.1095 92  LEU B C   
3761 O O   . LEU B 94  ? 2.3372 2.5772 1.4480 -0.4071 0.0732  -0.1240 92  LEU B O   
3762 C CB  . LEU B 94  ? 2.1820 2.2415 1.4332 -0.4647 0.0653  -0.0466 92  LEU B CB  
3763 N N   . SER B 95  ? 2.6372 2.5317 1.6775 -0.4435 0.0923  -0.1451 93  SER B N   
3764 C CA  . SER B 95  ? 2.9101 2.7533 1.8181 -0.4845 0.0882  -0.2088 93  SER B CA  
3765 C C   . SER B 95  ? 3.0775 2.9058 1.9461 -0.3910 0.1235  -0.2139 93  SER B C   
3766 O O   . SER B 95  ? 3.2348 3.1251 2.0166 -0.4010 0.1137  -0.2524 93  SER B O   
3767 C CB  . SER B 95  ? 3.1430 2.7686 1.9669 -0.5492 0.0927  -0.2439 93  SER B CB  
3768 O OG  . SER B 95  ? 3.1405 2.5871 1.9612 -0.4729 0.1382  -0.2283 93  SER B OG  
3769 N N   . GLY B 96  ? 3.1747 2.9241 2.1153 -0.2977 0.1643  -0.1695 94  GLY B N   
3770 C CA  . GLY B 96  ? 3.3518 3.0409 2.2617 -0.2027 0.2116  -0.1692 94  GLY B CA  
3771 C C   . GLY B 96  ? 3.3577 3.1781 2.3221 -0.1044 0.2357  -0.1368 94  GLY B C   
3772 O O   . GLY B 96  ? 3.2483 3.1682 2.3383 -0.0531 0.2405  -0.0829 94  GLY B O   
3773 N N   . GLY B 97  ? 3.4349 3.2534 2.2902 -0.0830 0.2502  -0.1732 95  GLY B N   
3774 C CA  . GLY B 97  ? 3.1950 3.0872 2.0755 0.0212  0.2872  -0.1465 95  GLY B CA  
3775 C C   . GLY B 97  ? 3.0716 2.7655 1.9308 0.0962  0.3523  -0.1427 95  GLY B C   
3776 O O   . GLY B 97  ? 3.1239 2.6433 1.8787 0.0608  0.3658  -0.1846 95  GLY B O   
3777 N N   . VAL B 98  ? 2.9394 2.6627 1.9014 0.2003  0.3962  -0.0914 96  VAL B N   
3778 C CA  . VAL B 98  ? 2.8869 2.4538 1.8618 0.2899  0.4665  -0.0752 96  VAL B CA  
3779 C C   . VAL B 98  ? 2.9649 2.5009 1.7670 0.2906  0.4823  -0.1280 96  VAL B C   
3780 O O   . VAL B 98  ? 3.2142 2.5693 1.9141 0.3004  0.5236  -0.1602 96  VAL B O   
3781 C CB  . VAL B 98  ? 2.3571 1.9823 1.4861 0.3988  0.5093  -0.0086 96  VAL B CB  
3782 C CG1 . VAL B 98  ? 2.2740 1.9083 1.5573 0.3844  0.4851  0.0386  96  VAL B CG1 
3783 C CG2 . VAL B 98  ? 2.1975 2.0133 1.3374 0.4436  0.5084  0.0073  96  VAL B CG2 
3784 N N   . PHE B 99  ? 2.8890 2.6049 1.6581 0.2808  0.4487  -0.1347 97  PHE B N   
3785 C CA  . PHE B 99  ? 3.2623 2.9821 1.8714 0.2852  0.4536  -0.1779 97  PHE B CA  
3786 C C   . PHE B 99  ? 3.4727 3.2379 1.9631 0.1634  0.3819  -0.2366 97  PHE B C   
3787 O O   . PHE B 99  ? 3.7344 3.3564 2.0698 0.1201  0.3864  -0.2933 97  PHE B O   
3788 C CB  . PHE B 99  ? 3.1807 3.0791 1.8353 0.3628  0.4630  -0.1406 97  PHE B CB  
3789 N N   . ASN B 100 ? 3.1969 3.1473 1.7545 0.1039  0.3191  -0.2260 98  ASN B N   
3790 C CA  . ASN B 100 ? 3.1341 3.1002 1.6122 -0.0236 0.2542  -0.2779 98  ASN B CA  
3791 C C   . ASN B 100 ? 3.3202 3.0681 1.7199 -0.0950 0.2600  -0.3225 98  ASN B C   
3792 O O   . ASN B 100 ? 3.3312 2.9259 1.7848 -0.0562 0.3058  -0.3007 98  ASN B O   
3793 C CB  . ASN B 100 ? 2.9358 3.0864 1.5470 -0.0740 0.2032  -0.2463 98  ASN B CB  
3794 N N   . LYS B 101 ? 3.4591 3.1876 1.7221 -0.1942 0.2163  -0.3858 99  LYS B N   
3795 C CA  . LYS B 101 ? 3.5948 3.1127 1.7542 -0.2684 0.2228  -0.4372 99  LYS B CA  
3796 C C   . LYS B 101 ? 3.3242 2.8855 1.5837 -0.3535 0.1809  -0.4253 99  LYS B C   
3797 O O   . LYS B 101 ? 3.1079 2.8381 1.5091 -0.3387 0.1590  -0.3759 99  LYS B O   
3798 C CB  . LYS B 101 ? 4.0302 3.5079 1.9930 -0.3425 0.1931  -0.5127 99  LYS B CB  
3799 N N   . GLN B 102 ? 3.4075 2.8130 1.5897 -0.4420 0.1733  -0.4695 100 GLN B N   
3800 C CA  . GLN B 102 ? 3.3454 2.7771 1.6119 -0.5237 0.1382  -0.4581 100 GLN B CA  
3801 C C   . GLN B 102 ? 3.2713 2.9483 1.5709 -0.5853 0.0725  -0.4623 100 GLN B C   
3802 O O   . GLN B 102 ? 3.5640 3.2915 1.7527 -0.6425 0.0373  -0.5132 100 GLN B O   
3803 C CB  . GLN B 102 ? 3.6481 2.8717 1.8079 -0.6136 0.1417  -0.5103 100 GLN B CB  
3804 C CG  . GLN B 102 ? 3.6074 2.8312 1.8456 -0.6952 0.1131  -0.4964 100 GLN B CG  
3805 C CD  . GLN B 102 ? 3.4435 2.6575 1.8348 -0.6242 0.1372  -0.4233 100 GLN B CD  
3806 O OE1 . GLN B 102 ? 3.3507 2.7106 1.8547 -0.6415 0.1065  -0.3851 100 GLN B OE1 
3807 N NE2 . GLN B 102 ? 3.5145 2.5536 1.9100 -0.5454 0.1926  -0.4029 100 GLN B NE2 
3808 N N   . LYS B 103 ? 3.0055 2.8312 1.4565 -0.5761 0.0557  -0.4086 101 LYS B N   
3809 C CA  . LYS B 103 ? 2.7806 2.8457 1.2840 -0.6249 0.0016  -0.4035 101 LYS B CA  
3810 C C   . LYS B 103 ? 2.8891 2.9608 1.3356 -0.7627 -0.0475 -0.4543 101 LYS B C   
3811 O O   . LYS B 103 ? 2.9760 2.8861 1.3924 -0.8240 -0.0396 -0.4746 101 LYS B O   
3812 C CB  . LYS B 103 ? 2.5571 2.7561 1.2308 -0.5843 0.0045  -0.3342 101 LYS B CB  
3813 N N   . SER B 104 ? 2.8823 3.1477 1.3228 -0.8113 -0.0985 -0.4713 102 SER B N   
3814 C CA  . SER B 104 ? 2.9587 3.2657 1.3778 -0.9447 -0.1478 -0.5117 102 SER B CA  
3815 C C   . SER B 104 ? 2.8074 3.1744 1.3682 -0.9695 -0.1462 -0.4655 102 SER B C   
3816 O O   . SER B 104 ? 2.6406 3.0598 1.3112 -0.8855 -0.1186 -0.4048 102 SER B O   
3817 C CB  . SER B 104 ? 3.0763 3.5957 1.4754 -0.9876 -0.2068 -0.5335 102 SER B CB  
3818 O OG  . SER B 104 ? 2.7811 3.5360 1.3326 -0.9643 -0.2236 -0.4777 102 SER B OG  
3819 N N   . HIS B 105 ? 2.8884 3.2491 1.4427 -1.0879 -0.1755 -0.4950 103 HIS B N   
3820 C CA  . HIS B 105 ? 2.8180 3.2664 1.4961 -1.1290 -0.1808 -0.4566 103 HIS B CA  
3821 C C   . HIS B 105 ? 2.5857 3.3087 1.3774 -1.1006 -0.2045 -0.4168 103 HIS B C   
3822 O O   . HIS B 105 ? 2.4194 3.2274 1.3300 -1.0525 -0.1849 -0.3584 103 HIS B O   
3823 C CB  . HIS B 105 ? 3.0663 3.4428 1.6928 -1.2665 -0.2053 -0.5058 103 HIS B CB  
3824 C CG  . HIS B 105 ? 3.1545 3.2618 1.7082 -1.2823 -0.1700 -0.5224 103 HIS B CG  
3825 N ND1 . HIS B 105 ? 3.0723 3.0159 1.5892 -1.1843 -0.1262 -0.5068 103 HIS B ND1 
3826 C CD2 . HIS B 105 ? 3.3291 3.2965 1.8318 -1.3839 -0.1710 -0.5563 103 HIS B CD2 
3827 C CE1 . HIS B 105 ? 3.2157 2.9364 1.6728 -1.2206 -0.1022 -0.5244 103 HIS B CE1 
3828 N NE2 . HIS B 105 ? 3.3692 3.0952 1.8107 -1.3414 -0.1281 -0.5554 103 HIS B NE2 
3829 N N   . ASP B 106 ? 2.7577 3.6102 1.5031 -1.1314 -0.2473 -0.4501 104 ASP B N   
3830 C CA  . ASP B 106 ? 2.6353 3.7540 1.4724 -1.1063 -0.2765 -0.4184 104 ASP B CA  
3831 C C   . ASP B 106 ? 2.3913 3.5828 1.2818 -0.9675 -0.2441 -0.3637 104 ASP B C   
3832 O O   . ASP B 106 ? 2.3595 3.7439 1.3711 -0.9311 -0.2447 -0.3133 104 ASP B O   
3833 C CB  . ASP B 106 ? 2.6681 3.8458 1.4619 -1.1398 -0.3179 -0.4534 104 ASP B CB  
3834 N N   . ASP B 107 ? 2.4501 3.4843 1.2527 -0.8896 -0.2113 -0.3729 105 ASP B N   
3835 C CA  . ASP B 107 ? 2.3231 3.3962 1.1778 -0.7563 -0.1714 -0.3207 105 ASP B CA  
3836 C C   . ASP B 107 ? 2.1546 3.2287 1.1410 -0.7168 -0.1349 -0.2615 105 ASP B C   
3837 O O   . ASP B 107 ? 2.0009 3.2272 1.0901 -0.6494 -0.1218 -0.2090 105 ASP B O   
3838 C CB  . ASP B 107 ? 2.5293 3.4037 1.2675 -0.6876 -0.1346 -0.3431 105 ASP B CB  
3839 C CG  . ASP B 107 ? 2.6184 3.5331 1.2351 -0.6770 -0.1594 -0.3811 105 ASP B CG  
3840 O OD1 . ASP B 107 ? 2.5178 3.6367 1.1777 -0.6433 -0.1832 -0.3563 105 ASP B OD1 
3841 O OD2 . ASP B 107 ? 2.7618 3.4987 1.2341 -0.7024 -0.1545 -0.4351 105 ASP B OD2 
3842 N N   . ILE B 108 ? 2.1939 3.0915 1.1700 -0.7584 -0.1184 -0.2696 106 ILE B N   
3843 C CA  . ILE B 108 ? 2.0597 2.9304 1.1413 -0.7285 -0.0884 -0.2168 106 ILE B CA  
3844 C C   . ILE B 108 ? 2.0369 3.1107 1.2316 -0.7643 -0.1045 -0.1830 106 ILE B C   
3845 O O   . ILE B 108 ? 1.8382 2.9901 1.1312 -0.6988 -0.0791 -0.1282 106 ILE B O   
3846 C CB  . ILE B 108 ? 2.1661 2.8185 1.2048 -0.7874 -0.0790 -0.2355 106 ILE B CB  
3847 C CG1 . ILE B 108 ? 2.2995 2.7436 1.2687 -0.7201 -0.0446 -0.2442 106 ILE B CG1 
3848 C CG2 . ILE B 108 ? 2.0898 2.7503 1.2286 -0.7989 -0.0673 -0.1879 106 ILE B CG2 
3849 C CD1 . ILE B 108 ? 2.4540 2.6768 1.3665 -0.7785 -0.0369 -0.2668 106 ILE B CD1 
3850 N N   . VAL B 109 ? 2.0014 3.1606 1.1820 -0.8688 -0.1443 -0.2165 107 VAL B N   
3851 C CA  . VAL B 109 ? 1.9017 3.2547 1.1911 -0.9133 -0.1575 -0.1879 107 VAL B CA  
3852 C C   . VAL B 109 ? 1.7780 3.3484 1.1454 -0.8336 -0.1562 -0.1475 107 VAL B C   
3853 O O   . VAL B 109 ? 1.6419 3.3331 1.1200 -0.8074 -0.1360 -0.0972 107 VAL B O   
3854 C CB  . VAL B 109 ? 2.0134 3.4224 1.2754 -1.0426 -0.2027 -0.2352 107 VAL B CB  
3855 N N   . THR B 110 ? 1.8374 3.4465 1.1380 -0.7941 -0.1748 -0.1696 108 THR B N   
3856 C CA  . THR B 110 ? 1.7416 3.5426 1.0978 -0.7110 -0.1741 -0.1326 108 THR B CA  
3857 C C   . THR B 110 ? 1.7762 3.5503 1.1999 -0.5969 -0.1181 -0.0757 108 THR B C   
3858 O O   . THR B 110 ? 1.6067 3.5379 1.1373 -0.5531 -0.1010 -0.0250 108 THR B O   
3859 C CB  . THR B 110 ? 1.8577 3.6616 1.1014 -0.6852 -0.2013 -0.1693 108 THR B CB  
3860 N N   . GLU B 111 ? 1.6971 3.2696 1.0597 -0.5498 -0.0883 -0.0841 109 GLU B N   
3861 C CA  . GLU B 111 ? 1.5916 3.1195 1.0116 -0.4422 -0.0377 -0.0348 109 GLU B CA  
3862 C C   . GLU B 111 ? 1.4965 3.0438 1.0228 -0.4516 -0.0157 0.0097  109 GLU B C   
3863 O O   . GLU B 111 ? 1.3651 3.0130 0.9771 -0.3808 0.0133  0.0594  109 GLU B O   
3864 C CB  . GLU B 111 ? 1.7419 3.0412 1.0841 -0.4026 -0.0126 -0.0539 109 GLU B CB  
3865 C CG  . GLU B 111 ? 1.6687 2.9333 1.0712 -0.2851 0.0374  -0.0050 109 GLU B CG  
3866 C CD  . GLU B 111 ? 1.7792 2.8202 1.1274 -0.2485 0.0644  -0.0179 109 GLU B CD  
3867 O OE1 . GLU B 111 ? 1.9437 2.8549 1.1923 -0.3054 0.0482  -0.0672 109 GLU B OE1 
3868 O OE2 . GLU B 111 ? 1.6886 2.6831 1.0978 -0.1631 0.1038  0.0224  109 GLU B OE2 
3869 N N   . PHE B 112 ? 1.5740 3.0220 1.0874 -0.5408 -0.0278 -0.0085 110 PHE B N   
3870 C CA  . PHE B 112 ? 1.5610 2.9812 1.1493 -0.5507 -0.0049 0.0307  110 PHE B CA  
3871 C C   . PHE B 112 ? 1.5120 3.0928 1.1713 -0.6178 -0.0142 0.0456  110 PHE B C   
3872 O O   . PHE B 112 ? 1.3776 2.9455 1.0935 -0.6260 0.0089  0.0796  110 PHE B O   
3873 C CB  . PHE B 112 ? 1.7154 2.9109 1.2470 -0.5999 -0.0059 0.0109  110 PHE B CB  
3874 C CG  . PHE B 112 ? 1.7451 2.7703 1.2318 -0.5282 0.0129  0.0087  110 PHE B CG  
3875 C CD1 . PHE B 112 ? 1.6948 2.6799 1.2428 -0.4426 0.0452  0.0558  110 PHE B CD1 
3876 C CD2 . PHE B 112 ? 1.8050 2.7062 1.1906 -0.5484 0.0006  -0.0402 110 PHE B CD2 
3877 C CE1 . PHE B 112 ? 1.6498 2.4856 1.1726 -0.3765 0.0642  0.0572  110 PHE B CE1 
3878 C CE2 . PHE B 112 ? 1.8848 2.6282 1.2371 -0.4797 0.0251  -0.0391 110 PHE B CE2 
3879 C CZ  . PHE B 112 ? 1.8079 2.5235 1.2357 -0.3929 0.0565  0.0111  110 PHE B CZ  
3880 N N   . GLY B 113 ? 1.5912 3.3239 1.2491 -0.6629 -0.0467 0.0223  111 GLY B N   
3881 C CA  . GLY B 113 ? 1.5714 3.4834 1.3138 -0.7195 -0.0536 0.0400  111 GLY B CA  
3882 C C   . GLY B 113 ? 1.5950 3.4332 1.3587 -0.8022 -0.0426 0.0441  111 GLY B C   
3883 O O   . GLY B 113 ? 1.6844 3.4311 1.3903 -0.8951 -0.0673 0.0022  111 GLY B O   
3884 N N   . ASP B 114 ? 1.5554 3.4286 1.3956 -0.7704 -0.0030 0.0942  112 ASP B N   
3885 C CA  . ASP B 114 ? 1.6011 3.3998 1.4541 -0.8431 0.0133  0.1032  112 ASP B CA  
3886 C C   . ASP B 114 ? 1.5814 3.1311 1.3552 -0.8478 0.0177  0.0926  112 ASP B C   
3887 O O   . ASP B 114 ? 1.5065 2.9461 1.2452 -0.9294 0.0142  0.0784  112 ASP B O   
3888 C CB  . ASP B 114 ? 1.5007 3.3325 1.4216 -0.7727 0.0421  0.1505  112 ASP B CB  
3889 N N   . SER B 115 ? 1.5776 3.0409 1.3280 -0.7584 0.0264  0.1026  113 SER B N   
3890 C CA  . SER B 115 ? 1.5602 2.7961 1.2475 -0.7502 0.0279  0.0975  113 SER B CA  
3891 C C   . SER B 115 ? 1.6678 2.7770 1.2611 -0.7987 -0.0022 0.0427  113 SER B C   
3892 O O   . SER B 115 ? 1.7449 2.6650 1.2851 -0.7860 -0.0013 0.0365  113 SER B O   
3893 C CB  . SER B 115 ? 1.4076 2.6052 1.1193 -0.6362 0.0508  0.1306  113 SER B CB  
3894 O OG  . SER B 115 ? 1.4049 2.7188 1.1978 -0.5897 0.0817  0.1786  113 SER B OG  
3895 N N   . ALA B 116 ? 1.7060 2.9184 1.2803 -0.8555 -0.0288 0.0043  114 ALA B N   
3896 C CA  . ALA B 116 ? 1.8062 2.9075 1.2824 -0.9051 -0.0564 -0.0529 114 ALA B CA  
3897 C C   . ALA B 116 ? 1.9015 2.8194 1.3214 -0.9905 -0.0595 -0.0727 114 ALA B C   
3898 O O   . ALA B 116 ? 2.0369 2.7724 1.3767 -0.9919 -0.0624 -0.0990 114 ALA B O   
3899 C CB  . ALA B 116 ? 1.8263 3.0912 1.2980 -0.9577 -0.0895 -0.0882 114 ALA B CB  
3900 N N   . CYS B 117 ? 1.9289 2.8921 1.3897 -1.0603 -0.0547 -0.0583 115 CYS B N   
3901 C CA  . CYS B 117 ? 1.9859 2.7813 1.3923 -1.1453 -0.0550 -0.0737 115 CYS B CA  
3902 C C   . CYS B 117 ? 1.9699 2.5622 1.3445 -1.0974 -0.0381 -0.0462 115 CYS B C   
3903 O O   . CYS B 117 ? 2.0586 2.4651 1.3588 -1.1404 -0.0433 -0.0680 115 CYS B O   
3904 C CB  . CYS B 117 ? 1.9293 2.8234 1.3927 -1.2212 -0.0450 -0.0568 115 CYS B CB  
3905 S SG  . CYS B 117 ? 2.0922 3.1095 1.6580 -1.1515 -0.0082 0.0132  115 CYS B SG  
3906 N N   . PHE B 118 ? 1.8569 2.4842 1.2895 -1.0089 -0.0190 0.0025  116 PHE B N   
3907 C CA  . PHE B 118 ? 1.8621 2.3137 1.2776 -0.9613 -0.0092 0.0335  116 PHE B CA  
3908 C C   . PHE B 118 ? 1.9624 2.2957 1.3399 -0.8943 -0.0129 0.0198  116 PHE B C   
3909 O O   . PHE B 118 ? 2.2513 2.3953 1.5841 -0.8950 -0.0149 0.0224  116 PHE B O   
3910 C CB  . PHE B 118 ? 1.7265 2.2562 1.2179 -0.8954 0.0121  0.0892  116 PHE B CB  
3911 C CG  . PHE B 118 ? 1.6946 2.3231 1.2220 -0.9523 0.0263  0.1085  116 PHE B CG  
3912 C CD1 . PHE B 118 ? 1.7034 2.5462 1.3036 -0.9375 0.0398  0.1186  116 PHE B CD1 
3913 C CD2 . PHE B 118 ? 1.9458 2.4512 1.4326 -1.0207 0.0293  0.1177  116 PHE B CD2 
3914 C CE1 . PHE B 118 ? 1.8884 2.8214 1.5282 -0.9870 0.0606  0.1386  116 PHE B CE1 
3915 C CE2 . PHE B 118 ? 2.0321 2.6152 1.5468 -1.0616 0.0478  0.1331  116 PHE B CE2 
3916 C CZ  . PHE B 118 ? 1.9562 2.7390 1.5477 -1.0272 0.0602  0.1388  116 PHE B CZ  
3917 N N   . THR B 119 ? 1.8408 2.2835 1.2364 -0.8344 -0.0112 0.0080  117 THR B N   
3918 C CA  . THR B 119 ? 1.9287 2.2672 1.2860 -0.7686 -0.0068 -0.0069 117 THR B CA  
3919 C C   . THR B 119 ? 2.0387 2.2293 1.2962 -0.8375 -0.0196 -0.0593 117 THR B C   
3920 O O   . THR B 119 ? 2.1361 2.1509 1.3527 -0.8080 -0.0110 -0.0626 117 THR B O   
3921 C CB  . THR B 119 ? 2.0536 2.5399 1.4368 -0.6940 0.0005  -0.0106 117 THR B CB  
3922 O OG1 . THR B 119 ? 2.1545 2.5179 1.4911 -0.6340 0.0117  -0.0263 117 THR B OG1 
3923 C CG2 . THR B 119 ? 2.1865 2.8248 1.5479 -0.7541 -0.0207 -0.0489 117 THR B CG2 
3924 N N   . LEU B 120 ? 2.1528 2.4152 1.3759 -0.9296 -0.0383 -0.0991 118 LEU B N   
3925 C CA  . LEU B 120 ? 2.2762 2.4035 1.4001 -1.0070 -0.0499 -0.1533 118 LEU B CA  
3926 C C   . LEU B 120 ? 2.3756 2.3168 1.4721 -1.0526 -0.0443 -0.1404 118 LEU B C   
3927 O O   . LEU B 120 ? 2.6264 2.3804 1.6495 -1.0628 -0.0390 -0.1631 118 LEU B O   
3928 C CB  . LEU B 120 ? 2.2663 2.5295 1.3734 -1.1021 -0.0748 -0.1958 118 LEU B CB  
3929 C CG  . LEU B 120 ? 2.2596 2.6868 1.3645 -1.0758 -0.0911 -0.2206 118 LEU B CG  
3930 C CD1 . LEU B 120 ? 2.2689 2.8551 1.3881 -1.1752 -0.1213 -0.2491 118 LEU B CD1 
3931 C CD2 . LEU B 120 ? 2.3887 2.6801 1.3888 -1.0515 -0.0893 -0.2644 118 LEU B CD2 
3932 N N   . SER B 121 ? 2.2198 2.2074 1.3694 -1.0800 -0.0430 -0.1034 119 SER B N   
3933 C CA  . SER B 121 ? 2.3563 2.1702 1.4777 -1.1165 -0.0388 -0.0827 119 SER B CA  
3934 C C   . SER B 121 ? 2.2470 1.8961 1.3619 -1.0329 -0.0303 -0.0545 119 SER B C   
3935 O O   . SER B 121 ? 2.3695 1.8279 1.4233 -1.0567 -0.0291 -0.0631 119 SER B O   
3936 C CB  . SER B 121 ? 2.3846 2.2811 1.5641 -1.1376 -0.0340 -0.0394 119 SER B CB  
3937 O OG  . SER B 121 ? 2.5703 2.2939 1.7098 -1.1748 -0.0321 -0.0182 119 SER B OG  
3938 N N   . LEU B 122 ? 2.1192 1.8449 1.3037 -0.9345 -0.0228 -0.0190 120 LEU B N   
3939 C CA  . LEU B 122 ? 2.1106 1.7050 1.3132 -0.8489 -0.0148 0.0134  120 LEU B CA  
3940 C C   . LEU B 122 ? 2.2586 1.7306 1.4028 -0.8242 -0.0041 -0.0226 120 LEU B C   
3941 O O   . LEU B 122 ? 2.3207 1.6183 1.4500 -0.7962 0.0022  -0.0071 120 LEU B O   
3942 C CB  . LEU B 122 ? 1.9882 1.7068 1.2833 -0.7525 -0.0057 0.0554  120 LEU B CB  
3943 C CG  . LEU B 122 ? 2.0243 1.6281 1.3590 -0.6606 0.0025  0.0923  120 LEU B CG  
3944 C CD1 . LEU B 122 ? 2.1901 1.6192 1.5077 -0.6873 -0.0124 0.1219  120 LEU B CD1 
3945 C CD2 . LEU B 122 ? 1.9071 1.6382 1.3361 -0.5760 0.0124  0.1338  120 LEU B CD2 
3946 N N   . LEU B 123 ? 2.2992 1.8592 1.4069 -0.8365 -0.0017 -0.0699 121 LEU B N   
3947 C CA  . LEU B 123 ? 2.4261 1.8641 1.4548 -0.8270 0.0117  -0.1132 121 LEU B CA  
3948 C C   . LEU B 123 ? 2.6443 1.8979 1.5873 -0.9107 0.0096  -0.1418 121 LEU B C   
3949 O O   . LEU B 123 ? 2.6590 1.7303 1.5641 -0.8811 0.0281  -0.1430 121 LEU B O   
3950 C CB  . LEU B 123 ? 2.4923 2.0664 1.4830 -0.8380 0.0074  -0.1607 121 LEU B CB  
3951 C CG  . LEU B 123 ? 2.5302 2.1779 1.5568 -0.7283 0.0267  -0.1465 121 LEU B CG  
3952 C CD1 . LEU B 123 ? 2.6445 2.4286 1.6220 -0.7454 0.0159  -0.1917 121 LEU B CD1 
3953 C CD2 . LEU B 123 ? 2.6523 2.1093 1.6533 -0.6593 0.0582  -0.1417 121 LEU B CD2 
3954 N N   . GLY B 124 ? 2.5954 1.8964 1.5110 -1.0139 -0.0087 -0.1642 122 GLY B N   
3955 C CA  . GLY B 124 ? 2.7569 1.8898 1.5913 -1.1021 -0.0087 -0.1913 122 GLY B CA  
3956 C C   . GLY B 124 ? 2.7849 1.7336 1.6290 -1.0670 0.0008  -0.1447 122 GLY B C   
3957 O O   . GLY B 124 ? 2.9305 1.6872 1.7076 -1.0793 0.0152  -0.1608 122 GLY B O   
3958 N N   . HIS B 125 ? 2.6516 1.6579 1.5779 -1.0227 -0.0079 -0.0855 123 HIS B N   
3959 C CA  . HIS B 125 ? 2.9382 1.7922 1.8874 -0.9783 -0.0079 -0.0326 123 HIS B CA  
3960 C C   . HIS B 125 ? 2.8186 1.5550 1.7772 -0.8882 0.0115  -0.0239 123 HIS B C   
3961 O O   . HIS B 125 ? 2.8061 1.3550 1.7367 -0.8828 0.0182  -0.0091 123 HIS B O   
3962 C CB  . HIS B 125 ? 2.8228 1.7798 1.8584 -0.9395 -0.0228 0.0260  123 HIS B CB  
3963 C CG  . HIS B 125 ? 2.7819 1.5977 1.8470 -0.8892 -0.0316 0.0831  123 HIS B CG  
3964 N ND1 . HIS B 125 ? 2.6222 1.2760 1.6347 -0.9412 -0.0420 0.0997  123 HIS B ND1 
3965 C CD2 . HIS B 125 ? 2.5618 1.3738 1.7058 -0.7923 -0.0337 0.1287  123 HIS B CD2 
3966 C CE1 . HIS B 125 ? 2.8862 1.4694 1.9549 -0.8644 -0.0546 0.1521  123 HIS B CE1 
3967 N NE2 . HIS B 125 ? 2.6723 1.3286 1.8140 -0.7888 -0.0507 0.1726  123 HIS B NE2 
3968 N N   . VAL B 126 ? 2.6148 1.4602 1.6150 -0.8158 0.0240  -0.0304 124 VAL B N   
3969 C CA  . VAL B 126 ? 2.6486 1.3942 1.6628 -0.7262 0.0509  -0.0231 124 VAL B CA  
3970 C C   . VAL B 126 ? 2.8418 1.4252 1.7480 -0.7648 0.0742  -0.0758 124 VAL B C   
3971 O O   . VAL B 126 ? 2.9343 1.3409 1.8325 -0.7268 0.0952  -0.0600 124 VAL B O   
3972 C CB  . VAL B 126 ? 2.5310 1.4308 1.5985 -0.6467 0.0648  -0.0242 124 VAL B CB  
3973 C CG1 . VAL B 126 ? 2.6086 1.3946 1.6798 -0.5597 0.1018  -0.0226 124 VAL B CG1 
3974 C CG2 . VAL B 126 ? 2.5038 1.5437 1.6805 -0.6003 0.0485  0.0308  124 VAL B CG2 
3975 N N   . TYR B 127 ? 3.1349 1.7780 1.9603 -0.8406 0.0707  -0.1374 125 TYR B N   
3976 C CA  . TYR B 127 ? 3.3932 1.8842 2.1007 -0.8924 0.0912  -0.1957 125 TYR B CA  
3977 C C   . TYR B 127 ? 3.6010 1.8996 2.2690 -0.9460 0.0929  -0.1840 125 TYR B C   
3978 O O   . TYR B 127 ? 3.7944 1.9013 2.3989 -0.9398 0.1228  -0.2004 125 TYR B O   
3979 C CB  . TYR B 127 ? 3.4213 2.0287 2.0563 -0.9790 0.0752  -0.2612 125 TYR B CB  
3980 C CG  . TYR B 127 ? 3.3097 2.0632 1.9510 -0.9241 0.0787  -0.2813 125 TYR B CG  
3981 C CD1 . TYR B 127 ? 3.2376 1.9171 1.8756 -0.8263 0.1141  -0.2753 125 TYR B CD1 
3982 C CD2 . TYR B 127 ? 3.2870 2.2498 1.9382 -0.9681 0.0489  -0.3036 125 TYR B CD2 
3983 C CE1 . TYR B 127 ? 3.2786 2.0814 1.9122 -0.7742 0.1204  -0.2920 125 TYR B CE1 
3984 C CE2 . TYR B 127 ? 3.2078 2.3011 1.8590 -0.9151 0.0503  -0.3184 125 TYR B CE2 
3985 C CZ  . TYR B 127 ? 3.2192 2.2279 1.8557 -0.8186 0.0863  -0.3132 125 TYR B CZ  
3986 O OH  . TYR B 127 ? 3.2545 2.3837 1.8814 -0.7643 0.0907  -0.3263 125 TYR B OH  
3987 N N   . CYS B 128 ? 3.5090 1.8542 2.2100 -0.9974 0.0646  -0.1545 126 CYS B N   
3988 C CA  . CYS B 128 ? 3.5419 1.7138 2.2014 -1.0521 0.0636  -0.1390 126 CYS B CA  
3989 C C   . CYS B 128 ? 3.2801 1.3159 1.9957 -0.9643 0.0713  -0.0754 126 CYS B C   
3990 O O   . CYS B 128 ? 3.3800 1.3026 2.0895 -0.9430 0.0820  -0.0645 126 CYS B O   
3991 C CB  . CYS B 128 ? 3.2129 1.4990 1.8993 -1.1140 0.0345  -0.1210 126 CYS B CB  
3992 S SG  . CYS B 128 ? 4.1663 2.5908 2.7980 -1.2260 0.0270  -0.1883 126 CYS B SG  
3993 N N   . LYS B 129 ? 3.1232 1.2615 1.9428 -0.8725 0.0629  -0.0288 127 LYS B N   
3994 C CA  . LYS B 129 ? 3.1100 1.1383 2.0008 -0.7864 0.0653  0.0344  127 LYS B CA  
3995 C C   . LYS B 129 ? 3.2150 1.1101 2.0896 -0.7231 0.1092  0.0195  127 LYS B C   
3996 O O   . LYS B 129 ? 3.4096 1.1931 2.3217 -0.6745 0.1185  0.0501  127 LYS B O   
3997 C CB  . LYS B 129 ? 2.9138 1.0954 1.9245 -0.7125 0.0435  0.0866  127 LYS B CB  
3998 N N   . THR B 130 ? 3.2060 1.1777 2.0566 -0.7007 0.1344  -0.0270 128 THR B N   
3999 C CA  . THR B 130 ? 3.4772 1.3035 2.2712 -0.6641 0.1842  -0.0583 128 THR B CA  
4000 C C   . THR B 130 ? 3.6600 1.3467 2.3166 -0.7645 0.1968  -0.1165 128 THR B C   
4001 O O   . THR B 130 ? 3.6959 1.3929 2.3179 -0.8539 0.1675  -0.1232 128 THR B O   
4002 C CB  . THR B 130 ? 3.5606 1.5007 2.3515 -0.6124 0.2083  -0.0923 128 THR B CB  
4003 O OG1 . THR B 130 ? 3.6369 1.7191 2.3601 -0.6927 0.1854  -0.1477 128 THR B OG1 
4004 C CG2 . THR B 130 ? 3.3947 1.4664 2.3237 -0.5126 0.2016  -0.0347 128 THR B CG2 
4005 N N   . ASP B 131 ? 3.7031 1.2539 2.2774 -0.7522 0.2442  -0.1595 129 ASP B N   
4006 C CA  . ASP B 131 ? 3.8999 1.3044 2.3589 -0.8312 0.2611  -0.2064 129 ASP B CA  
4007 C C   . ASP B 131 ? 3.9769 1.4333 2.3111 -0.9331 0.2552  -0.2918 129 ASP B C   
4008 O O   . ASP B 131 ? 4.6548 2.0044 2.8857 -0.9753 0.2816  -0.3434 129 ASP B O   
4009 C CB  . ASP B 131 ? 4.0344 1.2783 2.4855 -0.7559 0.3159  -0.2019 129 ASP B CB  
4010 N N   . ARG B 132 ? 3.8195 1.5054 2.1975 -0.9517 0.2149  -0.2970 130 ARG B N   
4011 C CA  . ARG B 132 ? 3.8670 1.6550 2.1566 -1.0367 0.1990  -0.3698 130 ARG B CA  
4012 C C   . ARG B 132 ? 3.7927 1.7181 2.1051 -1.1336 0.1516  -0.3710 130 ARG B C   
4013 O O   . ARG B 132 ? 3.6289 1.7703 2.0110 -1.1276 0.1198  -0.3584 130 ARG B O   
4014 C CB  . ARG B 132 ? 3.8163 1.7636 2.1277 -0.9707 0.1993  -0.3821 130 ARG B CB  
4015 N N   . LEU B 133 ? 3.9042 1.7306 2.1766 -1.2025 0.1525  -0.3773 131 LEU B N   
4016 C CA  . LEU B 133 ? 3.8412 1.8098 2.1533 -1.2711 0.1184  -0.3677 131 LEU B CA  
4017 C C   . LEU B 133 ? 3.9126 2.0430 2.1882 -1.3528 0.0948  -0.4262 131 LEU B C   
4018 O O   . LEU B 133 ? 3.7810 2.0946 2.1211 -1.3858 0.0636  -0.4125 131 LEU B O   
4019 C CB  . LEU B 133 ? 3.9601 1.8179 2.2552 -1.2886 0.1328  -0.3540 131 LEU B CB  
4020 N N   . ALA B 134 ? 4.0558 2.1219 2.2326 -1.3788 0.1105  -0.4877 132 ALA B N   
4021 C CA  . ALA B 134 ? 4.0190 2.2339 2.1599 -1.4504 0.0847  -0.5425 132 ALA B CA  
4022 C C   . ALA B 134 ? 3.8633 2.2768 2.0460 -1.4376 0.0518  -0.5487 132 ALA B C   
4023 O O   . ALA B 134 ? 3.7814 2.3979 2.0182 -1.4848 0.0176  -0.5508 132 ALA B O   
4024 C CB  . ALA B 134 ? 4.2236 2.3075 2.2414 -1.4681 0.1096  -0.6030 132 ALA B CB  
4025 N N   . LYS B 135 ? 3.8134 2.1955 1.9964 -1.3472 0.0682  -0.5374 133 LYS B N   
4026 C CA  . LYS B 135 ? 3.6260 2.2352 1.8958 -1.2780 0.0472  -0.5108 133 LYS B CA  
4027 C C   . LYS B 135 ? 3.5514 2.3171 1.9520 -1.2731 0.0231  -0.4504 133 LYS B C   
4028 O O   . LYS B 135 ? 3.4523 2.4386 1.9172 -1.2708 -0.0043 -0.4420 133 LYS B O   
4029 C CB  . LYS B 135 ? 3.5918 2.1423 1.8763 -1.1472 0.0826  -0.4840 133 LYS B CB  
4030 N N   . GLY B 136 ? 3.4262 2.0707 1.8599 -1.2708 0.0349  -0.4075 134 GLY B N   
4031 C CA  . GLY B 136 ? 3.2708 2.0251 1.8078 -1.2707 0.0164  -0.3508 134 GLY B CA  
4032 C C   . GLY B 136 ? 3.2674 2.1367 1.8098 -1.3844 -0.0094 -0.3704 134 GLY B C   
4033 O O   . GLY B 136 ? 3.1158 2.1813 1.7434 -1.3801 -0.0281 -0.3436 134 GLY B O   
4034 N N   . SER B 137 ? 3.4171 2.1996 1.9007 -1.4455 -0.0006 -0.3991 135 SER B N   
4035 C CA  . SER B 137 ? 3.4992 2.4076 2.0214 -1.5081 -0.0117 -0.3970 135 SER B CA  
4036 C C   . SER B 137 ? 3.3715 2.4866 1.9117 -1.5470 -0.0380 -0.4340 135 SER B C   
4037 O O   . SER B 137 ? 3.3096 2.5841 1.9158 -1.5847 -0.0503 -0.4218 135 SER B O   
4038 C CB  . SER B 137 ? 3.7544 2.5154 2.2138 -1.5501 0.0083  -0.4152 135 SER B CB  
4039 O OG  . SER B 137 ? 3.9421 2.5322 2.3077 -1.5379 0.0272  -0.4529 135 SER B OG  
4040 N N   . GLU B 138 ? 3.4150 2.5255 1.8955 -1.5312 -0.0453 -0.4769 136 GLU B N   
4041 C CA  . GLU B 138 ? 3.3701 2.6880 1.8697 -1.5496 -0.0762 -0.5052 136 GLU B CA  
4042 C C   . GLU B 138 ? 3.4438 2.9536 2.0405 -1.5059 -0.0936 -0.4664 136 GLU B C   
4043 O O   . GLU B 138 ? 3.3485 3.0716 2.0199 -1.5264 -0.1154 -0.4580 136 GLU B O   
4044 C CB  . GLU B 138 ? 3.4899 2.7361 1.8808 -1.5339 -0.0773 -0.5607 136 GLU B CB  
4045 N N   . CYS B 139 ? 3.3103 2.7552 1.9307 -1.4169 -0.0753 -0.4267 137 CYS B N   
4046 C CA  . CYS B 139 ? 3.0653 2.6889 1.8027 -1.3376 -0.0779 -0.3686 137 CYS B CA  
4047 C C   . CYS B 139 ? 2.7823 2.4879 1.5981 -1.3890 -0.0828 -0.3319 137 CYS B C   
4048 O O   . CYS B 139 ? 2.6686 2.5778 1.5725 -1.3747 -0.0928 -0.3053 137 CYS B O   
4049 C CB  . CYS B 139 ? 2.8027 2.3271 1.5658 -1.2158 -0.0505 -0.3229 137 CYS B CB  
4050 S SG  . CYS B 139 ? 3.9841 3.5281 2.7119 -1.1153 -0.0389 -0.3415 137 CYS B SG  
4051 N N   . TYR B 140 ? 2.8736 2.4142 1.6526 -1.4479 -0.0716 -0.3295 138 TYR B N   
4052 C CA  . TYR B 140 ? 2.8113 2.4100 1.6587 -1.4674 -0.0632 -0.2849 138 TYR B CA  
4053 C C   . TYR B 140 ? 2.8184 2.5859 1.7036 -1.5237 -0.0713 -0.3014 138 TYR B C   
4054 O O   . TYR B 140 ? 2.7037 2.6282 1.6722 -1.5220 -0.0704 -0.2688 138 TYR B O   
4055 C CB  . TYR B 140 ? 2.9161 2.3070 1.7190 -1.4707 -0.0421 -0.2658 138 TYR B CB  
4056 C CG  . TYR B 140 ? 2.8848 2.1267 1.6855 -1.4068 -0.0335 -0.2236 138 TYR B CG  
4057 C CD1 . TYR B 140 ? 2.8966 2.2178 1.7644 -1.3575 -0.0398 -0.1827 138 TYR B CD1 
4058 C CD2 . TYR B 140 ? 3.0102 2.0385 1.7516 -1.3927 -0.0189 -0.2189 138 TYR B CD2 
4059 C CE1 . TYR B 140 ? 2.8520 2.0483 1.7342 -1.2798 -0.0324 -0.1343 138 TYR B CE1 
4060 C CE2 . TYR B 140 ? 2.9834 1.8854 1.7368 -1.3267 -0.0144 -0.1734 138 TYR B CE2 
4061 C CZ  . TYR B 140 ? 2.8335 1.8125 1.6546 -1.2789 -0.0235 -0.1321 138 TYR B CZ  
4062 O OH  . TYR B 140 ? 2.8354 1.6928 1.6777 -1.2086 -0.0221 -0.0816 138 TYR B OH  
4063 N N   . GLN B 141 ? 2.9630 2.6881 1.7878 -1.5729 -0.0766 -0.3500 139 GLN B N   
4064 C CA  . GLN B 141 ? 2.9926 2.8637 1.8538 -1.6317 -0.0872 -0.3676 139 GLN B CA  
4065 C C   . GLN B 141 ? 2.8551 2.9699 1.7978 -1.6117 -0.1100 -0.3596 139 GLN B C   
4066 O O   . GLN B 141 ? 2.7884 3.0613 1.8134 -1.6310 -0.1101 -0.3377 139 GLN B O   
4067 C CB  . GLN B 141 ? 3.1756 2.9602 1.9534 -1.6836 -0.0944 -0.4246 139 GLN B CB  
4068 N N   . LYS B 142 ? 2.8214 2.9628 1.7376 -1.5680 -0.1270 -0.3771 140 LYS B N   
4069 C CA  . LYS B 142 ? 2.6913 3.0630 1.6788 -1.5335 -0.1492 -0.3664 140 LYS B CA  
4070 C C   . LYS B 142 ? 2.5144 3.0034 1.6067 -1.4966 -0.1347 -0.3068 140 LYS B C   
4071 O O   . LYS B 142 ? 2.4234 3.1169 1.6056 -1.4945 -0.1404 -0.2852 140 LYS B O   
4072 C CB  . LYS B 142 ? 2.6934 3.0421 1.6148 -1.4779 -0.1642 -0.3929 140 LYS B CB  
4073 N N   . SER B 143 ? 2.6555 3.0092 1.7360 -1.4650 -0.1148 -0.2782 141 SER B N   
4074 C CA  . SER B 143 ? 2.6138 3.0435 1.7815 -1.4313 -0.0968 -0.2197 141 SER B CA  
4075 C C   . SER B 143 ? 2.3270 2.8282 1.5479 -1.4706 -0.0796 -0.1979 141 SER B C   
4076 O O   . SER B 143 ? 2.2093 2.8802 1.5186 -1.4489 -0.0711 -0.1637 141 SER B O   
4077 C CB  . SER B 143 ? 2.3246 2.5545 1.4604 -1.3852 -0.0765 -0.1882 141 SER B CB  
4078 N N   . LEU B 144 ? 2.4679 2.8334 1.6316 -1.5240 -0.0717 -0.2185 142 LEU B N   
4079 C CA  . LEU B 144 ? 2.4948 2.8971 1.6930 -1.5638 -0.0542 -0.2041 142 LEU B CA  
4080 C C   . LEU B 144 ? 2.4779 3.0922 1.7455 -1.5949 -0.0681 -0.2170 142 LEU B C   
4081 O O   . LEU B 144 ? 2.4223 3.1489 1.7618 -1.5983 -0.0531 -0.1894 142 LEU B O   
4082 C CB  . LEU B 144 ? 2.6599 2.8684 1.7776 -1.6122 -0.0440 -0.2269 142 LEU B CB  
4083 N N   . SER B 145 ? 2.5362 3.1977 1.7791 -1.6141 -0.0975 -0.2587 143 SER B N   
4084 C CA  . SER B 145 ? 2.8306 3.6936 2.1380 -1.6399 -0.1192 -0.2703 143 SER B CA  
4085 C C   . SER B 145 ? 2.7753 3.8449 2.1784 -1.5781 -0.1212 -0.2313 143 SER B C   
4086 O O   . SER B 145 ? 2.6771 3.9183 2.1656 -1.5854 -0.1224 -0.2139 143 SER B O   
4087 C CB  . SER B 145 ? 2.6494 3.4957 1.8921 -1.6687 -0.1538 -0.3244 143 SER B CB  
4088 O OG  . SER B 145 ? 2.6898 3.5593 1.9070 -1.6096 -0.1709 -0.3304 143 SER B OG  
4089 N N   . LEU B 146 ? 2.2676 3.3198 1.6592 -1.5144 -0.1207 -0.2168 144 LEU B N   
4090 C CA  . LEU B 146 ? 2.2572 3.4920 1.7386 -1.4458 -0.1159 -0.1746 144 LEU B CA  
4091 C C   . LEU B 146 ? 2.2677 3.5205 1.8135 -1.4259 -0.0776 -0.1235 144 LEU B C   
4092 O O   . LEU B 146 ? 2.2079 3.6305 1.8422 -1.3835 -0.0671 -0.0881 144 LEU B O   
4093 C CB  . LEU B 146 ? 2.0322 3.2325 1.4820 -1.3825 -0.1246 -0.1742 144 LEU B CB  
4094 N N   . ASN B 147 ? 1.7321 2.5490 1.3153 -0.4967 0.3865  -0.3358 145 ASN B N   
4095 C CA  . ASN B 147 ? 1.6363 2.5371 1.2728 -0.4722 0.4091  -0.3217 145 ASN B CA  
4096 C C   . ASN B 147 ? 1.6134 2.5409 1.2870 -0.4663 0.4174  -0.3019 145 ASN B C   
4097 O O   . ASN B 147 ? 1.7224 2.6442 1.3810 -0.4509 0.4396  -0.3166 145 ASN B O   
4098 C CB  . ASN B 147 ? 1.7109 2.6264 1.3216 -0.4462 0.4405  -0.3512 145 ASN B CB  
4099 C CG  . ASN B 147 ? 1.7621 2.7608 1.4212 -0.4223 0.4639  -0.3381 145 ASN B CG  
4100 O OD1 . ASN B 147 ? 1.6323 2.6776 1.3443 -0.4234 0.4605  -0.3076 145 ASN B OD1 
4101 N ND2 . ASN B 147 ? 1.2997 2.2671 0.9616 -0.3851 0.4595  -0.3461 145 ASN B ND2 
4102 N N   . PRO B 148 ? 1.5827 2.5392 1.3067 -0.4786 0.3994  -0.2676 146 PRO B N   
4103 C CA  . PRO B 148 ? 1.5971 2.5747 1.3561 -0.4762 0.4039  -0.2467 146 PRO B CA  
4104 C C   . PRO B 148 ? 1.4838 2.5366 1.2858 -0.4509 0.4322  -0.2352 146 PRO B C   
4105 O O   . PRO B 148 ? 1.4773 2.5560 1.3140 -0.4483 0.4364  -0.2144 146 PRO B O   
4106 C CB  . PRO B 148 ? 1.7486 2.7231 1.5420 -0.5015 0.3713  -0.2154 146 PRO B CB  
4107 C CG  . PRO B 148 ? 1.8081 2.8086 1.6185 -0.5049 0.3615  -0.2091 146 PRO B CG  
4108 C CD  . PRO B 148 ? 1.6186 2.5891 1.3720 -0.4961 0.3730  -0.2455 146 PRO B CD  
4109 N N   . PHE B 149 ? 1.3904 2.4754 1.1873 -0.4331 0.4515  -0.2491 147 PHE B N   
4110 C CA  . PHE B 149 ? 1.4345 2.5824 1.2590 -0.4085 0.4812  -0.2438 147 PHE B CA  
4111 C C   . PHE B 149 ? 1.5716 2.6847 1.3679 -0.3856 0.4931  -0.2629 147 PHE B C   
4112 O O   . PHE B 149 ? 1.5864 2.7077 1.4087 -0.3590 0.4968  -0.2492 147 PHE B O   
4113 C CB  . PHE B 149 ? 1.2259 2.3919 1.0616 -0.3904 0.4821  -0.2451 147 PHE B CB  
4114 N N   . LEU B 150 ? 1.6139 2.6730 1.3587 -0.3936 0.4925  -0.2913 148 LEU B N   
4115 C CA  . LEU B 150 ? 1.6284 2.6402 1.3529 -0.3720 0.4971  -0.3060 148 LEU B CA  
4116 C C   . LEU B 150 ? 1.5130 2.5407 1.2477 -0.3859 0.5076  -0.2960 148 LEU B C   
4117 O O   . LEU B 150 ? 1.5170 2.5157 1.2470 -0.4103 0.4909  -0.2889 148 LEU B O   
4118 C CB  . LEU B 150 ? 1.3287 2.2730 0.9983 -0.3771 0.4937  -0.3379 148 LEU B CB  
4119 N N   . TRP B 151 ? 1.3625 2.3963 1.1217 -0.3595 0.5122  -0.2847 149 TRP B N   
4120 C CA  . TRP B 151 ? 1.3825 2.4296 1.1528 -0.3702 0.5223  -0.2753 149 TRP B CA  
4121 C C   . TRP B 151 ? 1.4047 2.3971 1.1403 -0.3674 0.5295  -0.2986 149 TRP B C   
4122 O O   . TRP B 151 ? 1.4591 2.4321 1.1916 -0.3842 0.5290  -0.2956 149 TRP B O   
4123 C CB  . TRP B 151 ? 1.3698 2.4536 1.1839 -0.3469 0.5241  -0.2487 149 TRP B CB  
4124 C CG  . TRP B 151 ? 1.6057 2.6956 1.4296 -0.3505 0.5337  -0.2410 149 TRP B CG  
4125 C CD1 . TRP B 151 ? 1.7064 2.7673 1.5217 -0.3307 0.5389  -0.2491 149 TRP B CD1 
4126 C CD2 . TRP B 151 ? 1.6819 2.7990 1.5307 -0.3741 0.5334  -0.2201 149 TRP B CD2 
4127 N NE1 . TRP B 151 ? 1.6814 2.7612 1.5122 -0.3430 0.5479  -0.2375 149 TRP B NE1 
4128 C CE2 . TRP B 151 ? 1.6903 2.7981 1.5420 -0.3678 0.5417  -0.2185 149 TRP B CE2 
4129 C CE3 . TRP B 151 ? 1.6984 2.8217 1.5739 -0.3923 0.5127  -0.1965 149 TRP B CE3 
4130 C CZ2 . TRP B 151 ? 1.7318 2.8362 1.6100 -0.3787 0.5307  -0.1950 149 TRP B CZ2 
4131 C CZ3 . TRP B 151 ? 1.6987 2.8186 1.6008 -0.4031 0.5017  -0.1733 149 TRP B CZ3 
4132 C CH2 . TRP B 151 ? 1.7227 2.8331 1.6248 -0.3962 0.5112  -0.1732 149 TRP B CH2 
4133 N N   . SER B 152 ? 1.3576 2.3061 1.0758 -0.3407 0.5256  -0.3149 150 SER B N   
4134 C CA  . SER B 152 ? 1.4055 2.3054 1.1029 -0.3315 0.5332  -0.3320 150 SER B CA  
4135 C C   . SER B 152 ? 1.5447 2.3983 1.1979 -0.3614 0.5406  -0.3558 150 SER B C   
4136 O O   . SER B 152 ? 1.5550 2.3859 1.2013 -0.3651 0.5527  -0.3624 150 SER B O   
4137 C CB  . SER B 152 ? 1.3229 2.1861 1.0144 -0.2985 0.5260  -0.3409 150 SER B CB  
4138 O OG  . SER B 152 ? 1.6570 2.4776 1.3146 -0.3042 0.5193  -0.3617 150 SER B OG  
4139 N N   . PRO B 153 ? 1.6907 2.5252 1.3107 -0.3840 0.5342  -0.3690 151 PRO B N   
4140 C CA  . PRO B 153 ? 1.8217 2.5833 1.4018 -0.4073 0.5275  -0.3833 151 PRO B CA  
4141 C C   . PRO B 153 ? 1.7368 2.4884 1.3414 -0.4232 0.5119  -0.3581 151 PRO B C   
4142 O O   . PRO B 153 ? 1.8604 2.5586 1.4475 -0.4301 0.5146  -0.3661 151 PRO B O   
4143 C CB  . PRO B 153 ? 1.9863 2.7227 1.5372 -0.4240 0.5088  -0.3906 151 PRO B CB  
4144 C CG  . PRO B 153 ? 1.9138 2.7026 1.4772 -0.4045 0.5173  -0.3937 151 PRO B CG  
4145 C CD  . PRO B 153 ? 1.7722 2.6238 1.3928 -0.3841 0.5208  -0.3664 151 PRO B CD  
4146 N N   . PHE B 154 ? 1.6100 2.4122 1.2561 -0.4286 0.4973  -0.3280 152 PHE B N   
4147 C CA  . PHE B 154 ? 1.7076 2.5107 1.3838 -0.4418 0.4831  -0.3011 152 PHE B CA  
4148 C C   . PHE B 154 ? 1.6994 2.5207 1.3985 -0.4262 0.5015  -0.2957 152 PHE B C   
4149 O O   . PHE B 154 ? 1.7907 2.5808 1.4940 -0.4364 0.4960  -0.2877 152 PHE B O   
4150 C CB  . PHE B 154 ? 1.8135 2.6732 1.5340 -0.4480 0.4669  -0.2700 152 PHE B CB  
4151 C CG  . PHE B 154 ? 1.8109 2.6821 1.5691 -0.4585 0.4548  -0.2402 152 PHE B CG  
4152 C CD1 . PHE B 154 ? 1.8579 2.6865 1.6104 -0.4849 0.4285  -0.2294 152 PHE B CD1 
4153 C CD2 . PHE B 154 ? 1.7698 2.6940 1.5683 -0.4429 0.4690  -0.2223 152 PHE B CD2 
4154 C CE1 . PHE B 154 ? 1.9360 2.7755 1.7240 -0.4945 0.4173  -0.2020 152 PHE B CE1 
4155 C CE2 . PHE B 154 ? 1.8164 2.7507 1.6492 -0.4525 0.4583  -0.1950 152 PHE B CE2 
4156 C CZ  . PHE B 154 ? 1.8985 2.7914 1.7273 -0.4779 0.4328  -0.1850 152 PHE B CZ  
4157 N N   . GLU B 155 ? 1.6018 2.4732 1.3157 -0.4023 0.5224  -0.2991 153 GLU B N   
4158 C CA  . GLU B 155 ? 1.5808 2.4698 1.3145 -0.3866 0.5396  -0.2950 153 GLU B CA  
4159 C C   . GLU B 155 ? 1.6145 2.4353 1.3176 -0.3891 0.5474  -0.3171 153 GLU B C   
4160 O O   . GLU B 155 ? 1.7665 2.5731 1.4851 -0.3912 0.5489  -0.3074 153 GLU B O   
4161 C CB  . GLU B 155 ? 1.6760 2.6196 1.4193 -0.3620 0.5603  -0.3004 153 GLU B CB  
4162 C CG  . GLU B 155 ? 1.7044 2.6812 1.4787 -0.3469 0.5718  -0.2855 153 GLU B CG  
4163 C CD  . GLU B 155 ? 1.6940 2.6715 1.4815 -0.3100 0.5638  -0.2795 153 GLU B CD  
4164 O OE1 . GLU B 155 ? 1.8633 2.8005 1.6288 -0.2945 0.5589  -0.2973 153 GLU B OE1 
4165 O OE2 . GLU B 155 ? 1.4539 2.4687 1.2719 -0.2979 0.5625  -0.2562 153 GLU B OE2 
4166 N N   . SER B 156 ? 1.5303 2.3081 1.1907 -0.3888 0.5537  -0.3467 154 SER B N   
4167 C CA  . SER B 156 ? 1.6468 2.3547 1.2746 -0.3908 0.5647  -0.3708 154 SER B CA  
4168 C C   . SER B 156 ? 1.7573 2.4047 1.3716 -0.4159 0.5485  -0.3648 154 SER B C   
4169 O O   . SER B 156 ? 1.7814 2.3939 1.3977 -0.4168 0.5569  -0.3666 154 SER B O   
4170 C CB  . SER B 156 ? 1.7862 2.4599 1.3686 -0.3870 0.5742  -0.4033 154 SER B CB  
4171 O OG  . SER B 156 ? 1.8918 2.6086 1.4941 -0.3591 0.5758  -0.4010 154 SER B OG  
4172 N N   . LEU B 157 ? 1.8348 2.4685 1.4358 -0.4367 0.5251  -0.3574 155 LEU B N   
4173 C CA  . LEU B 157 ? 1.9300 2.5097 1.5184 -0.4630 0.5057  -0.3483 155 LEU B CA  
4174 C C   . LEU B 157 ? 1.9190 2.5150 1.5472 -0.4642 0.5039  -0.3238 155 LEU B C   
4175 O O   . LEU B 157 ? 2.0415 2.5804 1.6549 -0.4770 0.5033  -0.3269 155 LEU B O   
4176 C CB  . LEU B 157 ? 1.9351 2.5214 1.5209 -0.4831 0.4770  -0.3342 155 LEU B CB  
4177 C CG  . LEU B 157 ? 2.0092 2.5331 1.5394 -0.5018 0.4644  -0.3548 155 LEU B CG  
4178 C CD1 . LEU B 157 ? 1.9565 2.4434 1.4448 -0.4887 0.4886  -0.3902 155 LEU B CD1 
4179 C CD2 . LEU B 157 ? 2.0273 2.5928 1.5705 -0.5080 0.4439  -0.3414 155 LEU B CD2 
4180 N N   . CYS B 158 ? 1.8067 2.4785 1.4840 -0.4514 0.5041  -0.2995 156 CYS B N   
4181 C CA  . CYS B 158 ? 1.7958 2.4877 1.5124 -0.4516 0.5026  -0.2749 156 CYS B CA  
4182 C C   . CYS B 158 ? 1.7830 2.4540 1.5002 -0.4376 0.5252  -0.2869 156 CYS B C   
4183 O O   . CYS B 158 ? 1.9388 2.5759 1.6617 -0.4466 0.5241  -0.2804 156 CYS B O   
4184 C CB  . CYS B 158 ? 1.7332 2.5094 1.4986 -0.4405 0.5001  -0.2475 156 CYS B CB  
4185 S SG  . CYS B 158 ? 1.7406 2.5442 1.5188 -0.4577 0.4736  -0.2274 156 CYS B SG  
4186 N N   . GLU B 159 ? 1.6831 2.3743 1.3963 -0.4160 0.5455  -0.3039 157 GLU B N   
4187 C CA  . GLU B 159 ? 1.6617 2.3401 1.3822 -0.4006 0.5671  -0.3138 157 GLU B CA  
4188 C C   . GLU B 159 ? 1.7248 2.3175 1.4084 -0.4102 0.5759  -0.3379 157 GLU B C   
4189 O O   . GLU B 159 ? 1.7408 2.3103 1.4381 -0.4069 0.5874  -0.3369 157 GLU B O   
4190 C CB  . GLU B 159 ? 1.6492 2.3701 1.3743 -0.3758 0.5854  -0.3257 157 GLU B CB  
4191 C CG  . GLU B 159 ? 1.6761 2.4798 1.4393 -0.3636 0.5830  -0.3017 157 GLU B CG  
4192 C CD  . GLU B 159 ? 1.8115 2.6528 1.5698 -0.3425 0.5985  -0.3155 157 GLU B CD  
4193 O OE1 . GLU B 159 ? 1.9040 2.7360 1.6625 -0.3279 0.6156  -0.3287 157 GLU B OE1 
4194 O OE2 . GLU B 159 ? 1.8228 2.7028 1.5791 -0.3407 0.5938  -0.3125 157 GLU B OE2 
4195 N N   . ILE B 160 ? 1.7151 2.2589 1.3519 -0.4227 0.5713  -0.3590 158 ILE B N   
4196 C CA  . ILE B 160 ? 1.7767 2.2323 1.3723 -0.4343 0.5806  -0.3825 158 ILE B CA  
4197 C C   . ILE B 160 ? 1.9631 2.3683 1.5455 -0.4617 0.5624  -0.3715 158 ILE B C   
4198 O O   . ILE B 160 ? 2.0916 2.4174 1.6278 -0.4783 0.5643  -0.3905 158 ILE B O   
4199 C CB  . ILE B 160 ? 1.7531 2.1695 1.2969 -0.4363 0.5858  -0.4129 158 ILE B CB  
4200 N N   . GLY B 161 ? 2.0343 2.4839 1.6560 -0.4670 0.5455  -0.3405 159 GLY B N   
4201 C CA  . GLY B 161 ? 2.2654 2.6741 1.8858 -0.4896 0.5311  -0.3265 159 GLY B CA  
4202 C C   . GLY B 161 ? 2.4644 2.8453 2.0573 -0.5168 0.5030  -0.3205 159 GLY B C   
4203 O O   . GLY B 161 ? 2.5666 2.9200 2.1617 -0.5365 0.4880  -0.3054 159 GLY B O   
4204 N N   . GLU B 162 ? 2.4097 2.7976 1.9779 -0.5188 0.4944  -0.3309 160 GLU B N   
4205 C CA  . GLU B 162 ? 2.2654 2.6304 1.8118 -0.5453 0.4646  -0.3224 160 GLU B CA  
4206 C C   . GLU B 162 ? 2.2180 2.6612 1.8173 -0.5444 0.4451  -0.2888 160 GLU B C   
4207 O O   . GLU B 162 ? 2.2098 2.7250 1.8523 -0.5220 0.4563  -0.2775 160 GLU B O   
4208 C CB  . GLU B 162 ? 2.1707 2.5057 1.6679 -0.5500 0.4620  -0.3467 160 GLU B CB  
4209 N N   . LYS B 163 ? 2.2702 2.6967 1.8654 -0.5697 0.4160  -0.2726 161 LYS B N   
4210 C CA  . LYS B 163 ? 2.1659 2.6586 1.8149 -0.5719 0.3974  -0.2382 161 LYS B CA  
4211 C C   . LYS B 163 ? 2.1899 2.6920 1.8334 -0.5874 0.3709  -0.2301 161 LYS B C   
4212 O O   . LYS B 163 ? 2.3907 2.8625 2.0287 -0.6134 0.3440  -0.2159 161 LYS B O   
4213 C CB  . LYS B 163 ? 2.1546 2.6273 1.8219 -0.5876 0.3860  -0.2175 161 LYS B CB  
4214 N N   . PRO B 164 ? 2.0447 2.5888 1.6914 -0.5722 0.3777  -0.2380 162 PRO B N   
4215 C CA  . PRO B 164 ? 2.0637 2.6193 1.7122 -0.5877 0.3513  -0.2270 162 PRO B CA  
4216 C C   . PRO B 164 ? 2.0365 2.6581 1.7493 -0.5897 0.3359  -0.1893 162 PRO B C   
4217 O O   . PRO B 164 ? 2.0245 2.6931 1.7789 -0.5740 0.3501  -0.1746 162 PRO B O   
4218 C CB  . PRO B 164 ? 2.0186 2.6028 1.6554 -0.5683 0.3670  -0.2465 162 PRO B CB  
4219 C CG  . PRO B 164 ? 1.9427 2.5731 1.6051 -0.5386 0.3981  -0.2504 162 PRO B CG  
4220 C CD  . PRO B 164 ? 1.9774 2.5639 1.6314 -0.5422 0.4065  -0.2534 162 PRO B CD  
4221 N N   . ASP B 165 ? 2.0748 2.6983 1.7961 -0.6093 0.3072  -0.1733 163 ASP B N   
4222 C CA  . ASP B 165 ? 2.0553 2.7358 1.8392 -0.6139 0.2911  -0.1365 163 ASP B CA  
4223 C C   . ASP B 165 ? 1.9958 2.7490 1.8149 -0.5955 0.3001  -0.1298 163 ASP B C   
4224 O O   . ASP B 165 ? 2.0205 2.7671 1.8239 -0.6025 0.2882  -0.1364 163 ASP B O   
4225 C CB  . ASP B 165 ? 2.1515 2.7907 1.9296 -0.6473 0.2533  -0.1203 163 ASP B CB  
4226 C CG  . ASP B 165 ? 2.1525 2.8507 1.9995 -0.6524 0.2364  -0.0815 163 ASP B CG  
4227 O OD1 . ASP B 165 ? 2.0619 2.8110 1.9545 -0.6364 0.2523  -0.0651 163 ASP B OD1 
4228 O OD2 . ASP B 165 ? 2.2364 2.9290 2.0926 -0.6727 0.2071  -0.0669 163 ASP B OD2 
4229 N N   . PRO B 166 ? 1.9657 2.7869 1.8325 -0.5733 0.3207  -0.1152 164 PRO B N   
4230 C CA  . PRO B 166 ? 2.0104 2.9011 1.9126 -0.5566 0.3312  -0.1066 164 PRO B CA  
4231 C C   . PRO B 166 ? 2.1148 3.0234 2.0464 -0.5732 0.3052  -0.0851 164 PRO B C   
4232 O O   . PRO B 166 ? 2.0280 2.9535 1.9540 -0.5674 0.3077  -0.0940 164 PRO B O   
4233 C CB  . PRO B 166 ? 1.9533 2.9030 1.9042 -0.5389 0.3503  -0.0863 164 PRO B CB  
4234 N N   . ASP B 167 ? 2.2561 3.1629 2.2210 -0.5926 0.2815  -0.0569 165 ASP B N   
4235 C CA  . ASP B 167 ? 2.2250 3.1542 2.2284 -0.6079 0.2565  -0.0322 165 ASP B CA  
4236 C C   . ASP B 167 ? 2.3203 3.2052 2.2802 -0.6229 0.2370  -0.0500 165 ASP B C   
4237 O O   . ASP B 167 ? 2.3558 3.2716 2.3403 -0.6237 0.2291  -0.0407 165 ASP B O   
4238 C CB  . ASP B 167 ? 2.1043 3.0224 2.1408 -0.6302 0.2302  -0.0024 165 ASP B CB  
4239 N N   . GLN B 168 ? 2.3144 3.1245 2.2090 -0.6349 0.2304  -0.0754 166 GLN B N   
4240 C CA  . GLN B 168 ? 2.2641 3.0173 2.1049 -0.6522 0.2114  -0.0949 166 GLN B CA  
4241 C C   . GLN B 168 ? 2.2206 2.9669 2.0166 -0.6329 0.2362  -0.1300 166 GLN B C   
4242 O O   . GLN B 168 ? 2.2184 2.9548 1.9948 -0.6386 0.2258  -0.1391 166 GLN B O   
4243 C CB  . GLN B 168 ? 2.2947 2.9614 2.0841 -0.6795 0.1899  -0.1031 166 GLN B CB  
4244 N N   . THR B 169 ? 2.2005 2.9512 1.9812 -0.6107 0.2681  -0.1488 167 THR B N   
4245 C CA  . THR B 169 ? 2.2282 2.9698 1.9666 -0.5916 0.2934  -0.1827 167 THR B CA  
4246 C C   . THR B 169 ? 2.2185 3.0300 1.9890 -0.5710 0.3077  -0.1799 167 THR B C   
4247 O O   . THR B 169 ? 2.2283 3.0268 1.9649 -0.5663 0.3127  -0.2024 167 THR B O   
4248 C CB  . THR B 169 ? 2.0452 2.7764 1.7654 -0.5723 0.3240  -0.2016 167 THR B CB  
4249 O OG1 . THR B 169 ? 2.1225 2.8268 1.7932 -0.5597 0.3433  -0.2366 167 THR B OG1 
4250 C CG2 . THR B 169 ? 1.9472 2.7545 1.7234 -0.5485 0.3458  -0.1837 167 THR B CG2 
4251 N N   . PHE B 170 ? 2.2957 3.1788 2.1298 -0.5592 0.3154  -0.1527 168 PHE B N   
4252 C CA  . PHE B 170 ? 2.2324 3.1809 2.0985 -0.5410 0.3304  -0.1481 168 PHE B CA  
4253 C C   . PHE B 170 ? 2.2853 3.2614 2.1951 -0.5557 0.3063  -0.1210 168 PHE B C   
4254 O O   . PHE B 170 ? 2.3278 3.3666 2.2806 -0.5416 0.3194  -0.1082 168 PHE B O   
4255 C CB  . PHE B 170 ? 2.1132 3.1247 2.0201 -0.5167 0.3592  -0.1365 168 PHE B CB  
4256 C CG  . PHE B 170 ? 2.0599 3.0573 1.9317 -0.4979 0.3858  -0.1622 168 PHE B CG  
4257 C CD1 . PHE B 170 ? 2.0947 3.0794 1.9246 -0.4843 0.4023  -0.1935 168 PHE B CD1 
4258 C CD2 . PHE B 170 ? 2.0287 3.0263 1.9122 -0.4937 0.3942  -0.1541 168 PHE B CD2 
4259 C CE1 . PHE B 170 ? 2.1133 3.0855 1.9158 -0.4670 0.4263  -0.2157 168 PHE B CE1 
4260 C CE2 . PHE B 170 ? 1.9759 2.9612 1.8320 -0.4768 0.4175  -0.1757 168 PHE B CE2 
4261 C CZ  . PHE B 170 ? 2.0153 2.9881 1.8321 -0.4634 0.4335  -0.2062 168 PHE B CZ  
4262 N N   . LYS B 171 ? 2.2895 3.2175 2.1885 -0.5844 0.2716  -0.1120 169 LYS B N   
4263 C CA  . LYS B 171 ? 2.1856 3.1326 2.1234 -0.6008 0.2449  -0.0874 169 LYS B CA  
4264 C C   . LYS B 171 ? 2.1131 3.0496 2.0167 -0.5977 0.2457  -0.1099 169 LYS B C   
4265 O O   . LYS B 171 ? 2.2306 3.1096 2.0670 -0.6005 0.2470  -0.1414 169 LYS B O   
4266 C CB  . LYS B 171 ? 2.2187 3.1151 2.1536 -0.6338 0.2055  -0.0701 169 LYS B CB  
4267 N N   . PHE B 172 ? 1.9782 2.9675 1.9302 -0.5937 0.2438  -0.0920 170 PHE B N   
4268 C CA  . PHE B 172 ? 2.0337 3.0311 1.9706 -0.5878 0.2472  -0.1069 170 PHE B CA  
4269 C C   . PHE B 172 ? 2.2693 3.2097 2.1710 -0.6151 0.2107  -0.1118 170 PHE B C   
4270 O O   . PHE B 172 ? 2.4194 3.3641 2.3606 -0.6363 0.1792  -0.0831 170 PHE B O   
4271 C CB  . PHE B 172 ? 1.9072 2.9857 1.9168 -0.5734 0.2608  -0.0823 170 PHE B CB  
4272 N N   . THR B 173 ? 2.1997 3.0815 2.0259 -0.6167 0.2130  -0.1473 171 THR B N   
4273 C CA  . THR B 173 ? 2.0625 2.8816 1.8433 -0.6433 0.1796  -0.1556 171 THR B CA  
4274 C C   . THR B 173 ? 2.0453 2.8233 1.7523 -0.6333 0.1972  -0.1976 171 THR B C   
4275 O O   . THR B 173 ? 2.0302 2.8201 1.7313 -0.6293 0.1971  -0.2061 171 THR B O   
4276 C CB  . THR B 173 ? 2.0858 2.8358 1.8400 -0.6759 0.1449  -0.1464 171 THR B CB  
4277 N N   . ALA B 195 ? 1.9754 2.9992 2.8796 -0.3779 -0.3373 0.3378  465 ALA B N   
4278 C CA  . ALA B 195 ? 1.9876 2.9841 2.7713 -0.4136 -0.3675 0.3294  465 ALA B CA  
4279 C C   . ALA B 195 ? 1.8671 2.8780 2.5940 -0.4657 -0.3716 0.2824  465 ALA B C   
4280 O O   . ALA B 195 ? 1.7453 2.6793 2.3727 -0.4903 -0.3594 0.2447  465 ALA B O   
4281 C CB  . ALA B 195 ? 2.1263 3.1984 2.9173 -0.4076 -0.4217 0.3868  465 ALA B CB  
4282 N N   . GLU B 196 ? 1.8513 2.9621 2.6492 -0.4820 -0.3893 0.2871  466 GLU B N   
4283 C CA  . GLU B 196 ? 1.7686 2.9007 2.5349 -0.5349 -0.3941 0.2462  466 GLU B CA  
4284 C C   . GLU B 196 ? 1.7359 2.7748 2.4597 -0.5476 -0.3417 0.1992  466 GLU B C   
4285 O O   . GLU B 196 ? 1.7345 2.7392 2.3890 -0.5898 -0.3417 0.1637  466 GLU B O   
4286 C CB  . GLU B 196 ? 1.6755 2.9354 2.5531 -0.5460 -0.4135 0.2623  466 GLU B CB  
4287 N N   . GLY B 197 ? 1.7171 2.7154 2.4830 -0.5101 -0.2971 0.1999  467 GLY B N   
4288 C CA  . GLY B 197 ? 1.7414 2.6566 2.4630 -0.5165 -0.2467 0.1603  467 GLY B CA  
4289 C C   . GLY B 197 ? 1.6923 2.4998 2.2934 -0.5239 -0.2407 0.1372  467 GLY B C   
4290 O O   . GLY B 197 ? 1.7114 2.4672 2.2513 -0.5504 -0.2198 0.1051  467 GLY B O   
4291 N N   . LEU B 198 ? 1.6158 2.3924 2.1862 -0.5011 -0.2583 0.1569  468 LEU B N   
4292 C CA  . LEU B 198 ? 1.6181 2.3051 2.0815 -0.5089 -0.2543 0.1365  468 LEU B CA  
4293 C C   . LEU B 198 ? 1.5413 2.2345 1.9326 -0.5497 -0.2838 0.1204  468 LEU B C   
4294 O O   . LEU B 198 ? 1.4808 2.1128 1.8031 -0.5703 -0.2680 0.0882  468 LEU B O   
4295 C CB  . LEU B 198 ? 1.6310 2.2914 2.0859 -0.4791 -0.2657 0.1649  468 LEU B CB  
4296 N N   . MET B 199 ? 1.5937 2.3601 2.0004 -0.5601 -0.3269 0.1423  469 MET B N   
4297 C CA  . MET B 199 ? 1.7530 2.5272 2.0897 -0.5989 -0.3566 0.1208  469 MET B CA  
4298 C C   . MET B 199 ? 1.8241 2.5813 2.1535 -0.6365 -0.3413 0.0832  469 MET B C   
4299 O O   . MET B 199 ? 1.9902 2.6874 2.2418 -0.6595 -0.3391 0.0517  469 MET B O   
4300 C CB  . MET B 199 ? 1.8501 2.7263 2.2161 -0.6072 -0.4060 0.1488  469 MET B CB  
4301 C CG  . MET B 199 ? 1.5208 2.4153 1.8852 -0.5740 -0.4249 0.1944  469 MET B CG  
4302 N N   . SER B 200 ? 1.6917 2.5022 2.1079 -0.6413 -0.3290 0.0893  470 SER B N   
4303 C CA  . SER B 200 ? 1.6268 2.4280 2.0500 -0.6795 -0.3112 0.0617  470 SER B CA  
4304 C C   . SER B 200 ? 1.6271 2.3245 1.9878 -0.6773 -0.2686 0.0392  470 SER B C   
4305 O O   . SER B 200 ? 1.7364 2.3904 2.0572 -0.7108 -0.2610 0.0151  470 SER B O   
4306 C CB  . SER B 200 ? 1.5688 2.4569 2.1068 -0.6800 -0.2999 0.0782  470 SER B CB  
4307 O OG  . SER B 200 ? 1.5416 2.4126 2.1200 -0.6387 -0.2594 0.0903  470 SER B OG  
4308 N N   . LEU B 201 ? 1.5288 2.1866 1.8830 -0.6382 -0.2423 0.0480  471 LEU B N   
4309 C CA  . LEU B 201 ? 1.5439 2.1106 1.8296 -0.6334 -0.2086 0.0289  471 LEU B CA  
4310 C C   . LEU B 201 ? 1.5564 2.0618 1.7483 -0.6394 -0.2280 0.0150  471 LEU B C   
4311 O O   . LEU B 201 ? 1.5787 2.0252 1.7140 -0.6580 -0.2173 -0.0049 471 LEU B O   
4312 C CB  . LEU B 201 ? 1.5447 2.0918 1.8503 -0.5932 -0.1783 0.0361  471 LEU B CB  
4313 N N   . LEU B 202 ? 1.6442 2.1652 1.8233 -0.6216 -0.2543 0.0288  472 LEU B N   
4314 C CA  . LEU B 202 ? 1.7206 2.1972 1.8163 -0.6237 -0.2707 0.0171  472 LEU B CA  
4315 C C   . LEU B 202 ? 1.7512 2.2202 1.8070 -0.6603 -0.2884 -0.0094 472 LEU B C   
4316 O O   . LEU B 202 ? 1.9323 2.3362 1.9208 -0.6654 -0.2818 -0.0315 472 LEU B O   
4317 C CB  . LEU B 202 ? 1.8310 2.3477 1.9307 -0.6043 -0.2977 0.0433  472 LEU B CB  
4318 C CG  . LEU B 202 ? 1.7078 2.2114 1.8354 -0.5677 -0.2828 0.0684  472 LEU B CG  
4319 C CD1 . LEU B 202 ? 1.7453 2.2831 1.8652 -0.5557 -0.3119 0.0990  472 LEU B CD1 
4320 C CD2 . LEU B 202 ? 1.6163 2.0390 1.6933 -0.5576 -0.2528 0.0490  472 LEU B CD2 
4321 N N   . ARG B 203 ? 1.6598 2.1970 1.7634 -0.6855 -0.3111 -0.0082 473 ARG B N   
4322 C CA  . ARG B 203 ? 1.6764 2.2110 1.7549 -0.7269 -0.3293 -0.0386 473 ARG B CA  
4323 C C   . ARG B 203 ? 1.7069 2.1662 1.7665 -0.7480 -0.3004 -0.0613 473 ARG B C   
4324 O O   . ARG B 203 ? 1.8390 2.2408 1.8416 -0.7650 -0.3040 -0.0900 473 ARG B O   
4325 C CB  . ARG B 203 ? 1.6710 2.3050 1.8204 -0.7529 -0.3583 -0.0310 473 ARG B CB  
4326 N N   . GLU B 204 ? 1.5966 2.0559 1.7042 -0.7450 -0.2698 -0.0469 474 GLU B N   
4327 C CA  . GLU B 204 ? 1.6239 2.0175 1.7157 -0.7645 -0.2399 -0.0574 474 GLU B CA  
4328 C C   . GLU B 204 ? 1.6725 1.9765 1.6868 -0.7403 -0.2214 -0.0628 474 GLU B C   
4329 O O   . GLU B 204 ? 1.6669 1.9023 1.6402 -0.7558 -0.2136 -0.0774 474 GLU B O   
4330 C CB  . GLU B 204 ? 1.6090 2.0387 1.7684 -0.7655 -0.2086 -0.0377 474 GLU B CB  
4331 N N   . MET B 205 ? 1.8233 2.1295 1.8239 -0.7024 -0.2152 -0.0496 475 MET B N   
4332 C CA  . MET B 205 ? 1.9072 2.1450 1.8416 -0.6784 -0.2014 -0.0530 475 MET B CA  
4333 C C   . MET B 205 ? 1.9314 2.1379 1.8087 -0.6786 -0.2239 -0.0720 475 MET B C   
4334 O O   . MET B 205 ? 1.9270 2.0682 1.7538 -0.6734 -0.2144 -0.0825 475 MET B O   
4335 C CB  . MET B 205 ? 1.9150 2.1697 1.8587 -0.6438 -0.1917 -0.0378 475 MET B CB  
4336 C CG  . MET B 205 ? 1.9343 2.2046 1.9199 -0.6379 -0.1602 -0.0278 475 MET B CG  
4337 S SD  . MET B 205 ? 1.7010 1.9845 1.7059 -0.5994 -0.1490 -0.0190 475 MET B SD  
4338 C CE  . MET B 205 ? 1.7316 1.9427 1.6509 -0.5867 -0.1387 -0.0302 475 MET B CE  
4339 N N   . GLY B 206 ? 1.9444 2.2035 1.8315 -0.6828 -0.2531 -0.0751 476 GLY B N   
4340 C CA  . GLY B 206 ? 1.9848 2.2310 1.8186 -0.6853 -0.2739 -0.0970 476 GLY B CA  
4341 C C   . GLY B 206 ? 2.1148 2.3148 1.9281 -0.7157 -0.2758 -0.1292 476 GLY B C   
4342 O O   . GLY B 206 ? 2.1216 2.2652 1.8821 -0.7088 -0.2725 -0.1510 476 GLY B O   
4343 N N   . LYS B 207 ? 2.2222 2.4465 2.0838 -0.7497 -0.2799 -0.1326 477 LYS B N   
4344 C CA  . LYS B 207 ? 2.2254 2.3991 2.0805 -0.7854 -0.2793 -0.1622 477 LYS B CA  
4345 C C   . LYS B 207 ? 2.0005 2.0788 1.8272 -0.7739 -0.2481 -0.1582 477 LYS B C   
4346 O O   . LYS B 207 ? 2.1007 2.1087 1.8981 -0.7853 -0.2455 -0.1837 477 LYS B O   
4347 C CB  . LYS B 207 ? 2.2833 2.5077 2.2087 -0.8262 -0.2856 -0.1592 477 LYS B CB  
4348 N N   . GLY B 208 ? 1.7519 1.8286 1.5880 -0.7507 -0.2246 -0.1263 478 GLY B N   
4349 C CA  . GLY B 208 ? 1.8304 1.8308 1.6367 -0.7379 -0.1977 -0.1147 478 GLY B CA  
4350 C C   . GLY B 208 ? 1.9121 1.8665 1.6587 -0.7047 -0.1999 -0.1245 478 GLY B C   
4351 O O   . GLY B 208 ? 1.9864 1.8675 1.7054 -0.7027 -0.1914 -0.1326 478 GLY B O   
4352 N N   . TYR B 209 ? 1.8938 1.8915 1.6264 -0.6779 -0.2099 -0.1211 479 TYR B N   
4353 C CA  . TYR B 209 ? 1.9097 1.8784 1.5931 -0.6471 -0.2108 -0.1286 479 TYR B CA  
4354 C C   . TYR B 209 ? 1.9528 1.8895 1.6080 -0.6541 -0.2223 -0.1644 479 TYR B C   
4355 O O   . TYR B 209 ? 2.0277 1.9096 1.6506 -0.6341 -0.2135 -0.1735 479 TYR B O   
4356 C CB  . TYR B 209 ? 1.8394 1.8664 1.5213 -0.6249 -0.2199 -0.1173 479 TYR B CB  
4357 C CG  . TYR B 209 ? 1.8479 1.8559 1.4883 -0.5943 -0.2168 -0.1189 479 TYR B CG  
4358 C CD1 . TYR B 209 ? 1.9936 2.0335 1.6130 -0.5853 -0.2307 -0.1306 479 TYR B CD1 
4359 C CD2 . TYR B 209 ? 1.9002 1.8679 1.5236 -0.5754 -0.2003 -0.1065 479 TYR B CD2 
4360 C CE1 . TYR B 209 ? 2.0779 2.1099 1.6672 -0.5589 -0.2255 -0.1312 479 TYR B CE1 
4361 C CE2 . TYR B 209 ? 1.9443 1.9060 1.5387 -0.5483 -0.1995 -0.1071 479 TYR B CE2 
4362 C CZ  . TYR B 209 ? 2.0664 2.0604 1.6474 -0.5404 -0.2108 -0.1201 479 TYR B CZ  
4363 O OH  . TYR B 209 ? 2.1169 2.1136 1.6762 -0.5150 -0.2076 -0.1198 479 TYR B OH  
4364 N N   . LEU B 210 ? 2.0496 2.0249 1.7181 -0.6815 -0.2422 -0.1863 480 LEU B N   
4365 C CA  . LEU B 210 ? 2.0825 2.0298 1.7231 -0.6950 -0.2528 -0.2302 480 LEU B CA  
4366 C C   . LEU B 210 ? 2.0612 1.9129 1.7009 -0.7055 -0.2364 -0.2455 480 LEU B C   
4367 O O   . LEU B 210 ? 2.1238 1.9198 1.7313 -0.6914 -0.2312 -0.2742 480 LEU B O   
4368 C CB  . LEU B 210 ? 2.1685 2.1804 1.8286 -0.7315 -0.2792 -0.2498 480 LEU B CB  
4369 C CG  . LEU B 210 ? 2.3782 2.4001 1.9992 -0.7458 -0.2981 -0.2993 480 LEU B CG  
4370 C CD1 . LEU B 210 ? 2.4344 2.5459 2.0811 -0.7793 -0.3284 -0.3022 480 LEU B CD1 
4371 C CD2 . LEU B 210 ? 2.5161 2.4469 2.1240 -0.7637 -0.2884 -0.3447 480 LEU B CD2 
4372 N N   . ALA B 211 ? 1.9514 1.7845 1.6302 -0.7289 -0.2261 -0.2239 481 ALA B N   
4373 C CA  . ALA B 211 ? 2.0581 1.7981 1.7435 -0.7427 -0.2090 -0.2269 481 ALA B CA  
4374 C C   . ALA B 211 ? 2.0944 1.7733 1.7472 -0.6991 -0.1908 -0.2085 481 ALA B C   
4375 O O   . ALA B 211 ? 2.1592 1.7588 1.7973 -0.6909 -0.1835 -0.2279 481 ALA B O   
4376 C CB  . ALA B 211 ? 2.1352 1.8821 1.8685 -0.7744 -0.1976 -0.1966 481 ALA B CB  
4377 N N   . LEU B 212 ? 2.1219 1.8389 1.7675 -0.6714 -0.1841 -0.1721 482 LEU B N   
4378 C CA  . LEU B 212 ? 2.1601 1.8387 1.7772 -0.6310 -0.1713 -0.1508 482 LEU B CA  
4379 C C   . LEU B 212 ? 2.3559 2.0212 1.9436 -0.6036 -0.1782 -0.1834 482 LEU B C   
4380 O O   . LEU B 212 ? 2.5053 2.1075 2.0800 -0.5786 -0.1682 -0.1840 482 LEU B O   
4381 C CB  . LEU B 212 ? 2.0586 1.7948 1.6714 -0.6113 -0.1676 -0.1172 482 LEU B CB  
4382 N N   . CYS B 213 ? 2.3752 2.1052 1.9543 -0.6064 -0.1939 -0.2073 483 CYS B N   
4383 C CA  . CYS B 213 ? 2.2781 2.0108 1.8266 -0.5835 -0.1976 -0.2404 483 CYS B CA  
4384 C C   . CYS B 213 ? 2.3264 1.9910 1.8686 -0.5959 -0.1950 -0.2872 483 CYS B C   
4385 O O   . CYS B 213 ? 2.4036 2.0305 1.9266 -0.5663 -0.1854 -0.3092 483 CYS B O   
4386 C CB  . CYS B 213 ? 2.1918 2.0150 1.7299 -0.5883 -0.2144 -0.2484 483 CYS B CB  
4387 S SG  . CYS B 213 ? 2.0744 1.9642 1.6189 -0.5655 -0.2144 -0.2019 483 CYS B SG  
4388 N N   . SER B 214 ? 2.4245 2.0758 1.9872 -0.6401 -0.2029 -0.3058 484 SER B N   
4389 C CA  . SER B 214 ? 2.5745 2.1506 2.1362 -0.6594 -0.2001 -0.3550 484 SER B CA  
4390 C C   . SER B 214 ? 2.6276 2.0955 2.2106 -0.6528 -0.1794 -0.3354 484 SER B C   
4391 O O   . SER B 214 ? 2.7259 2.1112 2.3187 -0.6702 -0.1734 -0.3704 484 SER B O   
4392 C CB  . SER B 214 ? 2.7426 2.3520 2.3216 -0.7147 -0.2197 -0.3844 484 SER B CB  
4393 O OG  . SER B 214 ? 2.8116 2.5158 2.3647 -0.7184 -0.2409 -0.4055 484 SER B OG  
4394 N N   . TYR B 215 ? 2.5699 2.0410 2.1601 -0.6300 -0.1693 -0.2777 485 TYR B N   
4395 C CA  . TYR B 215 ? 2.6963 2.0809 2.2996 -0.6147 -0.1506 -0.2411 485 TYR B CA  
4396 C C   . TYR B 215 ? 2.8866 2.2041 2.5247 -0.6592 -0.1424 -0.2306 485 TYR B C   
4397 O O   . TYR B 215 ? 2.9540 2.1780 2.6032 -0.6492 -0.1266 -0.2101 485 TYR B O   
4398 C CB  . TYR B 215 ? 2.8089 2.1272 2.3988 -0.5704 -0.1402 -0.2597 485 TYR B CB  
4399 C CG  . TYR B 215 ? 2.8272 2.2050 2.3936 -0.5204 -0.1412 -0.2421 485 TYR B CG  
4400 C CD1 . TYR B 215 ? 2.8237 2.2090 2.3903 -0.4932 -0.1361 -0.1844 485 TYR B CD1 
4401 C CD2 . TYR B 215 ? 2.9205 2.3543 2.4641 -0.5041 -0.1476 -0.2820 485 TYR B CD2 
4402 C CE1 . TYR B 215 ? 2.8579 2.3023 2.4084 -0.4530 -0.1393 -0.1702 485 TYR B CE1 
4403 C CE2 . TYR B 215 ? 2.9428 2.4347 2.4722 -0.4633 -0.1474 -0.2638 485 TYR B CE2 
4404 C CZ  . TYR B 215 ? 2.9276 2.4240 2.4636 -0.4390 -0.1442 -0.2094 485 TYR B CZ  
4405 O OH  . TYR B 215 ? 2.9278 2.4863 2.4547 -0.4035 -0.1462 -0.1938 485 TYR B OH  
4406 N N   . ASN B 216 ? 2.8693 2.2348 2.5293 -0.7081 -0.1532 -0.2431 486 ASN B N   
4407 C CA  . ASN B 216 ? 2.7211 2.0525 2.4217 -0.7547 -0.1442 -0.2207 486 ASN B CA  
4408 C C   . ASN B 216 ? 2.6381 2.0401 2.3439 -0.7502 -0.1373 -0.1638 486 ASN B C   
4409 O O   . ASN B 216 ? 2.5428 2.0312 2.2674 -0.7737 -0.1470 -0.1646 486 ASN B O   
4410 C CB  . ASN B 216 ? 2.6365 1.9832 2.3669 -0.8127 -0.1593 -0.2678 486 ASN B CB  
4411 C CG  . ASN B 216 ? 2.6440 1.9435 2.3553 -0.8139 -0.1692 -0.3378 486 ASN B CG  
4412 O OD1 . ASN B 216 ? 2.7330 1.9322 2.4352 -0.7896 -0.1546 -0.3498 486 ASN B OD1 
4413 N ND2 . ASN B 216 ? 2.5909 1.9625 2.2979 -0.8428 -0.1934 -0.3848 486 ASN B ND2 
4414 N N   . CYS B 217 ? 2.6304 1.9968 2.3202 -0.7188 -0.1204 -0.1156 487 CYS B N   
4415 C CA  . CYS B 217 ? 2.4939 1.9250 2.1719 -0.7029 -0.1127 -0.0682 487 CYS B CA  
4416 C C   . CYS B 217 ? 2.5324 1.9799 2.2426 -0.7439 -0.0967 -0.0346 487 CYS B C   
4417 O O   . CYS B 217 ? 2.3615 1.8923 2.0782 -0.7483 -0.0943 -0.0208 487 CYS B O   
4418 C CB  . CYS B 217 ? 2.4354 1.8296 2.0791 -0.6551 -0.1039 -0.0314 487 CYS B CB  
4419 N N   . LYS B 218 ? 2.7574 2.1251 2.4913 -0.7732 -0.0832 -0.0208 488 LYS B N   
4420 C CA  . LYS B 218 ? 2.7242 2.1087 2.4952 -0.8186 -0.0649 0.0113  488 LYS B CA  
4421 C C   . LYS B 218 ? 2.5968 2.0722 2.4088 -0.8551 -0.0774 -0.0207 488 LYS B C   
4422 O O   . LYS B 218 ? 2.6598 2.2005 2.4990 -0.8762 -0.0635 0.0051  488 LYS B O   
4423 C CB  . LYS B 218 ? 2.7676 2.0437 2.5662 -0.8515 -0.0510 0.0243  488 LYS B CB  
4424 N N   . GLU B 219 ? 2.4389 1.9254 2.2559 -0.8611 -0.1032 -0.0756 489 GLU B N   
4425 C CA  . GLU B 219 ? 2.3019 1.8871 2.1551 -0.8888 -0.1210 -0.1012 489 GLU B CA  
4426 C C   . GLU B 219 ? 2.1932 1.8685 2.0276 -0.8503 -0.1239 -0.0857 489 GLU B C   
4427 O O   . GLU B 219 ? 2.0442 1.7996 1.9148 -0.8635 -0.1184 -0.0697 489 GLU B O   
4428 C CB  . GLU B 219 ? 2.3966 1.9765 2.2491 -0.9043 -0.1501 -0.1625 489 GLU B CB  
4429 N N   . ALA B 220 ? 2.3227 1.9841 2.1064 -0.8033 -0.1313 -0.0923 490 ALA B N   
4430 C CA  . ALA B 220 ? 2.3765 2.1106 2.1415 -0.7674 -0.1352 -0.0820 490 ALA B CA  
4431 C C   . ALA B 220 ? 2.3150 2.0831 2.0876 -0.7627 -0.1108 -0.0405 490 ALA B C   
4432 O O   . ALA B 220 ? 2.2816 2.1264 2.0720 -0.7555 -0.1111 -0.0371 490 ALA B O   
4433 C CB  . ALA B 220 ? 2.5085 2.2098 2.2207 -0.7217 -0.1414 -0.0891 490 ALA B CB  
4434 N N   . ILE B 221 ? 2.2720 1.9819 2.0303 -0.7657 -0.0884 -0.0085 491 ILE B N   
4435 C CA  . ILE B 221 ? 2.1989 1.9412 1.9562 -0.7658 -0.0615 0.0302  491 ILE B CA  
4436 C C   . ILE B 221 ? 2.1551 1.9569 1.9741 -0.8064 -0.0496 0.0331  491 ILE B C   
4437 O O   . ILE B 221 ? 2.1293 2.0043 1.9642 -0.7999 -0.0371 0.0408  491 ILE B O   
4438 C CB  . ILE B 221 ? 2.2275 1.8961 1.9528 -0.7630 -0.0413 0.0708  491 ILE B CB  
4439 N N   . ASN B 222 ? 2.1328 1.9033 1.9911 -0.8485 -0.0530 0.0244  492 ASN B N   
4440 C CA  . ASN B 222 ? 2.1915 2.0209 2.1187 -0.8934 -0.0431 0.0279  492 ASN B CA  
4441 C C   . ASN B 222 ? 2.0756 2.0076 2.0441 -0.8891 -0.0613 0.0041  492 ASN B C   
4442 O O   . ASN B 222 ? 2.0341 2.0435 2.0484 -0.8974 -0.0439 0.0185  492 ASN B O   
4443 C CB  . ASN B 222 ? 2.3388 2.1111 2.3014 -0.9424 -0.0508 0.0136  492 ASN B CB  
4444 C CG  . ASN B 222 ? 2.4389 2.1217 2.3890 -0.9593 -0.0233 0.0523  492 ASN B CG  
4445 O OD1 . ASN B 222 ? 2.4703 2.1522 2.3886 -0.9398 0.0033  0.0954  492 ASN B OD1 
4446 N ND2 . ASN B 222 ? 2.4962 2.1029 2.4709 -0.9973 -0.0294 0.0377  492 ASN B ND2 
4447 N N   . ILE B 223 ? 2.0397 1.9744 1.9929 -0.8736 -0.0948 -0.0299 493 ILE B N   
4448 C CA  . ILE B 223 ? 2.0871 2.1144 2.0827 -0.8741 -0.1185 -0.0487 493 ILE B CA  
4449 C C   . ILE B 223 ? 1.9710 2.0551 1.9595 -0.8307 -0.1119 -0.0363 493 ILE B C   
4450 O O   . ILE B 223 ? 1.8744 2.0431 1.9164 -0.8300 -0.1186 -0.0360 493 ILE B O   
4451 C CB  . ILE B 223 ? 1.8885 1.9032 1.8633 -0.8756 -0.1565 -0.0877 493 ILE B CB  
4452 N N   . LEU B 224 ? 2.0211 2.0603 1.9491 -0.7946 -0.0998 -0.0263 494 LEU B N   
4453 C CA  . LEU B 224 ? 1.9780 2.0630 1.9009 -0.7582 -0.0914 -0.0190 494 LEU B CA  
4454 C C   . LEU B 224 ? 2.1152 2.2063 2.0327 -0.7539 -0.0525 0.0051  494 LEU B C   
4455 O O   . LEU B 224 ? 2.2657 2.3899 2.1783 -0.7264 -0.0404 0.0061  494 LEU B O   
4456 C CB  . LEU B 224 ? 1.8953 1.9450 1.7579 -0.7218 -0.1073 -0.0291 494 LEU B CB  
4457 N N   . SER B 225 ? 2.1134 2.1714 2.0298 -0.7824 -0.0317 0.0238  495 SER B N   
4458 C CA  . SER B 225 ? 2.1449 2.2317 2.0683 -0.7882 0.0081  0.0483  495 SER B CA  
4459 C C   . SER B 225 ? 2.1067 2.2699 2.1163 -0.8185 0.0212  0.0505  495 SER B C   
4460 O O   . SER B 225 ? 2.1160 2.3158 2.1439 -0.8287 0.0583  0.0696  495 SER B O   
4461 C CB  . SER B 225 ? 2.2330 2.2502 2.1092 -0.8023 0.0272  0.0779  495 SER B CB  
4462 O OG  . SER B 225 ? 2.3824 2.3751 2.3003 -0.8471 0.0280  0.0861  495 SER B OG  
4463 N N   . HIS B 226 ? 2.1418 2.3369 2.2043 -0.8331 -0.0095 0.0312  496 HIS B N   
4464 C CA  . HIS B 226 ? 2.1026 2.3913 2.2573 -0.8534 -0.0055 0.0311  496 HIS B CA  
4465 C C   . HIS B 226 ? 2.0322 2.3894 2.2172 -0.8137 -0.0100 0.0223  496 HIS B C   
4466 O O   . HIS B 226 ? 2.0249 2.4681 2.2930 -0.8190 -0.0089 0.0237  496 HIS B O   
4467 C CB  . HIS B 226 ? 2.0621 2.3598 2.2609 -0.8929 -0.0402 0.0158  496 HIS B CB  
4468 N N   . LEU B 227 ? 1.9312 2.2496 2.0540 -0.7739 -0.0145 0.0150  497 LEU B N   
4469 C CA  . LEU B 227 ? 1.7597 2.1224 1.9059 -0.7351 -0.0200 0.0067  497 LEU B CA  
4470 C C   . LEU B 227 ? 1.8363 2.2406 2.0082 -0.7190 0.0243  0.0113  497 LEU B C   
4471 O O   . LEU B 227 ? 1.8840 2.2682 2.0213 -0.7308 0.0578  0.0206  497 LEU B O   
4472 C CB  . LEU B 227 ? 1.6948 1.9994 1.7683 -0.7043 -0.0396 -0.0038 497 LEU B CB  
4473 N N   . PRO B 228 ? 1.8939 2.3582 2.1284 -0.6917 0.0262  0.0057  498 PRO B N   
4474 C CA  . PRO B 228 ? 1.9488 2.4491 2.2064 -0.6745 0.0739  0.0024  498 PRO B CA  
4475 C C   . PRO B 228 ? 2.1868 2.6266 2.3515 -0.6571 0.0954  -0.0083 498 PRO B C   
4476 O O   . PRO B 228 ? 2.1750 2.5604 2.2825 -0.6402 0.0706  -0.0169 498 PRO B O   
4477 C CB  . PRO B 228 ? 1.7685 2.3239 2.1049 -0.6400 0.0668  -0.0037 498 PRO B CB  
4478 N N   . SER B 229 ? 2.2781 2.7358 2.4284 -0.6634 0.1410  -0.0069 499 SER B N   
4479 C CA  . SER B 229 ? 2.2926 2.7019 2.3451 -0.6572 0.1603  -0.0119 499 SER B CA  
4480 C C   . SER B 229 ? 2.3659 2.7497 2.3822 -0.6201 0.1560  -0.0405 499 SER B C   
4481 O O   . SER B 229 ? 2.4017 2.7390 2.3320 -0.6169 0.1532  -0.0444 499 SER B O   
4482 C CB  . SER B 229 ? 2.2099 2.6600 2.2564 -0.6714 0.2134  -0.0043 499 SER B CB  
4483 O OG  . SER B 229 ? 2.1653 2.6908 2.2973 -0.6573 0.2439  -0.0187 499 SER B OG  
4484 N N   . HIS B 230 ? 2.3266 2.7408 2.4122 -0.5934 0.1544  -0.0582 500 HIS B N   
4485 C CA  . HIS B 230 ? 2.3519 2.7341 2.4144 -0.5620 0.1491  -0.0854 500 HIS B CA  
4486 C C   . HIS B 230 ? 2.3082 2.6444 2.3528 -0.5559 0.0996  -0.0793 500 HIS B C   
4487 O O   . HIS B 230 ? 2.4795 2.7887 2.5129 -0.5346 0.0919  -0.0970 500 HIS B O   
4488 C CB  . HIS B 230 ? 2.3773 2.7998 2.5291 -0.5317 0.1688  -0.1043 500 HIS B CB  
4489 C CG  . HIS B 230 ? 2.6197 3.1041 2.8187 -0.5303 0.2196  -0.1132 500 HIS B CG  
4490 N ND1 . HIS B 230 ? 2.8409 3.3270 2.9914 -0.5245 0.2645  -0.1425 500 HIS B ND1 
4491 C CD2 . HIS B 230 ? 2.6221 3.1780 2.9162 -0.5339 0.2336  -0.0979 500 HIS B CD2 
4492 C CE1 . HIS B 230 ? 2.8252 3.3799 3.0381 -0.5232 0.3077  -0.1449 500 HIS B CE1 
4493 N NE2 . HIS B 230 ? 2.7103 3.3096 3.0151 -0.5289 0.2898  -0.1167 500 HIS B NE2 
4494 N N   . HIS B 231 ? 2.1435 2.4792 2.1982 -0.5758 0.0691  -0.0559 501 HIS B N   
4495 C CA  . HIS B 231 ? 1.9837 2.2766 2.0024 -0.5749 0.0266  -0.0504 501 HIS B CA  
4496 C C   . HIS B 231 ? 1.9620 2.2110 1.9063 -0.5969 0.0185  -0.0402 501 HIS B C   
4497 O O   . HIS B 231 ? 1.9675 2.1758 1.8677 -0.5949 -0.0098 -0.0389 501 HIS B O   
4498 C CB  . HIS B 231 ? 1.9991 2.3266 2.0855 -0.5777 -0.0045 -0.0364 501 HIS B CB  
4499 C CG  . HIS B 231 ? 1.9723 2.3371 2.1340 -0.5498 -0.0027 -0.0379 501 HIS B CG  
4500 N ND1 . HIS B 231 ? 1.9562 2.3857 2.2053 -0.5454 0.0167  -0.0329 501 HIS B ND1 
4501 C CD2 . HIS B 231 ? 1.9342 2.2808 2.1043 -0.5242 -0.0164 -0.0406 501 HIS B CD2 
4502 C CE1 . HIS B 231 ? 1.9123 2.3584 2.2210 -0.5143 0.0141  -0.0319 501 HIS B CE1 
4503 N NE2 . HIS B 231 ? 1.9055 2.2982 2.1666 -0.5026 -0.0057 -0.0356 501 HIS B NE2 
4504 N N   . TYR B 232 ? 2.0409 2.3010 1.9785 -0.6172 0.0456  -0.0302 502 TYR B N   
4505 C CA  . TYR B 232 ? 2.1029 2.3167 1.9722 -0.6350 0.0446  -0.0149 502 TYR B CA  
4506 C C   . TYR B 232 ? 2.1878 2.3735 1.9810 -0.6170 0.0527  -0.0238 502 TYR B C   
4507 O O   . TYR B 232 ? 2.3042 2.4446 2.0396 -0.6141 0.0325  -0.0170 502 TYR B O   
4508 C CB  . TYR B 232 ? 2.1449 2.3804 2.0317 -0.6639 0.0744  0.0047  502 TYR B CB  
4509 C CG  . TYR B 232 ? 2.2142 2.3949 2.0374 -0.6821 0.0741  0.0285  502 TYR B CG  
4510 C CD1 . TYR B 232 ? 2.2794 2.4505 2.0371 -0.6793 0.0999  0.0408  502 TYR B CD1 
4511 C CD2 . TYR B 232 ? 2.2289 2.3671 2.0569 -0.7010 0.0480  0.0388  502 TYR B CD2 
4512 C CE1 . TYR B 232 ? 2.3475 2.4684 2.0508 -0.6921 0.0985  0.0709  502 TYR B CE1 
4513 C CE2 . TYR B 232 ? 2.3001 2.3794 2.0776 -0.7135 0.0494  0.0626  502 TYR B CE2 
4514 C CZ  . TYR B 232 ? 2.3441 2.4151 2.0616 -0.7077 0.0740  0.0828  502 TYR B CZ  
4515 O OH  . TYR B 232 ? 2.4090 2.4213 2.0798 -0.7168 0.0742  0.1150  502 TYR B OH  
4516 N N   . ASN B 233 ? 2.1730 2.3903 1.9700 -0.6045 0.0820  -0.0420 503 ASN B N   
4517 C CA  . ASN B 233 ? 2.2261 2.4289 1.9509 -0.5925 0.0918  -0.0569 503 ASN B CA  
4518 C C   . ASN B 233 ? 2.2834 2.4652 1.9993 -0.5710 0.0674  -0.0810 503 ASN B C   
4519 O O   . ASN B 233 ? 2.3394 2.5167 2.0058 -0.5631 0.0745  -0.1011 503 ASN B O   
4520 C CB  . ASN B 233 ? 2.2722 2.5188 1.9984 -0.5914 0.1379  -0.0736 503 ASN B CB  
4521 N N   . THR B 234 ? 2.2840 2.4578 2.0477 -0.5643 0.0394  -0.0791 504 THR B N   
4522 C CA  . THR B 234 ? 2.2068 2.3542 1.9532 -0.5502 0.0117  -0.0900 504 THR B CA  
4523 C C   . THR B 234 ? 2.2057 2.3200 1.8841 -0.5543 -0.0104 -0.0763 504 THR B C   
4524 O O   . THR B 234 ? 2.1827 2.2841 1.8410 -0.5667 -0.0118 -0.0542 504 THR B O   
4525 C CB  . THR B 234 ? 2.1343 2.2871 1.9428 -0.5431 -0.0125 -0.0842 504 THR B CB  
4526 O OG1 . THR B 234 ? 2.2520 2.3851 2.0500 -0.5303 -0.0309 -0.0946 504 THR B OG1 
4527 C CG2 . THR B 234 ? 2.0487 2.1933 1.8548 -0.5570 -0.0358 -0.0625 504 THR B CG2 
4528 N N   . GLY B 235 ? 2.2069 2.3074 1.8564 -0.5437 -0.0267 -0.0890 505 GLY B N   
4529 C CA  . GLY B 235 ? 2.2354 2.3145 1.8270 -0.5422 -0.0467 -0.0773 505 GLY B CA  
4530 C C   . GLY B 235 ? 2.2287 2.2869 1.8307 -0.5423 -0.0705 -0.0587 505 GLY B C   
4531 O O   . GLY B 235 ? 2.3036 2.3395 1.8705 -0.5439 -0.0766 -0.0407 505 GLY B O   
4532 N N   . TRP B 236 ? 2.1583 2.2235 1.8076 -0.5395 -0.0833 -0.0631 506 TRP B N   
4533 C CA  . TRP B 236 ? 2.1446 2.1970 1.8001 -0.5404 -0.1056 -0.0533 506 TRP B CA  
4534 C C   . TRP B 236 ? 2.1021 2.1386 1.7582 -0.5556 -0.1014 -0.0408 506 TRP B C   
4535 O O   . TRP B 236 ? 2.1360 2.1417 1.7650 -0.5552 -0.1122 -0.0341 506 TRP B O   
4536 C CB  . TRP B 236 ? 2.1574 2.2322 1.8629 -0.5378 -0.1180 -0.0563 506 TRP B CB  
4537 C CG  . TRP B 236 ? 2.1713 2.2421 1.8747 -0.5399 -0.1405 -0.0513 506 TRP B CG  
4538 C CD1 . TRP B 236 ? 2.2768 2.3439 1.9590 -0.5302 -0.1570 -0.0525 506 TRP B CD1 
4539 C CD2 . TRP B 236 ? 2.0957 2.1709 1.8180 -0.5547 -0.1476 -0.0483 506 TRP B CD2 
4540 N NE1 . TRP B 236 ? 2.3649 2.4328 2.0460 -0.5358 -0.1718 -0.0528 506 TRP B NE1 
4541 C CE2 . TRP B 236 ? 2.2056 2.2767 1.9102 -0.5523 -0.1683 -0.0521 506 TRP B CE2 
4542 C CE3 . TRP B 236 ? 1.9841 2.0711 1.7385 -0.5722 -0.1379 -0.0449 506 TRP B CE3 
4543 C CZ2 . TRP B 236 ? 2.1076 2.1821 1.8196 -0.5675 -0.1810 -0.0575 506 TRP B CZ2 
4544 C CZ3 . TRP B 236 ? 2.0159 2.1076 1.7843 -0.5896 -0.1527 -0.0471 506 TRP B CZ3 
4545 C CH2 . TRP B 236 ? 2.0622 2.1458 1.8068 -0.5875 -0.1749 -0.0557 506 TRP B CH2 
4546 N N   . VAL B 237 ? 1.9499 2.0070 1.6424 -0.5690 -0.0840 -0.0385 507 VAL B N   
4547 C CA  . VAL B 237 ? 1.9022 1.9476 1.6047 -0.5903 -0.0774 -0.0263 507 VAL B CA  
4548 C C   . VAL B 237 ? 2.0010 2.0086 1.6516 -0.5935 -0.0662 -0.0097 507 VAL B C   
4549 O O   . VAL B 237 ? 2.0440 2.0116 1.6824 -0.6011 -0.0749 -0.0003 507 VAL B O   
4550 C CB  . VAL B 237 ? 1.8797 1.9673 1.6378 -0.6045 -0.0569 -0.0250 507 VAL B CB  
4551 C CG1 . VAL B 237 ? 1.9200 1.9954 1.6847 -0.6317 -0.0441 -0.0093 507 VAL B CG1 
4552 C CG2 . VAL B 237 ? 1.8573 1.9824 1.6748 -0.6025 -0.0745 -0.0322 507 VAL B CG2 
4553 N N   . LEU B 238 ? 2.1002 2.1199 1.7202 -0.5876 -0.0467 -0.0059 508 LEU B N   
4554 C CA  . LEU B 238 ? 2.1859 2.1784 1.7507 -0.5881 -0.0382 0.0173  508 LEU B CA  
4555 C C   . LEU B 238 ? 2.2061 2.1596 1.7389 -0.5714 -0.0638 0.0233  508 LEU B C   
4556 O O   . LEU B 238 ? 2.2822 2.1951 1.7932 -0.5731 -0.0642 0.0474  508 LEU B O   
4557 C CB  . LEU B 238 ? 2.1179 2.1412 1.6444 -0.5818 -0.0194 0.0135  508 LEU B CB  
4558 N N   . CYS B 239 ? 2.2222 2.1886 1.7568 -0.5543 -0.0828 0.0035  509 CYS B N   
4559 C CA  . CYS B 239 ? 2.2373 2.1801 1.7486 -0.5356 -0.1046 0.0064  509 CYS B CA  
4560 C C   . CYS B 239 ? 2.2809 2.1814 1.8081 -0.5395 -0.1131 0.0092  509 CYS B C   
4561 O O   . CYS B 239 ? 2.4615 2.3233 1.9665 -0.5275 -0.1185 0.0238  509 CYS B O   
4562 C CB  . CYS B 239 ? 2.1503 2.1218 1.6721 -0.5226 -0.1201 -0.0154 509 CYS B CB  
4563 S SG  . CYS B 239 ? 2.8797 2.8499 2.3684 -0.4978 -0.1401 -0.0106 509 CYS B SG  
4564 N N   . GLN B 240 ? 2.2122 2.1213 1.7795 -0.5558 -0.1149 -0.0060 510 GLN B N   
4565 C CA  . GLN B 240 ? 2.1760 2.0490 1.7582 -0.5660 -0.1235 -0.0128 510 GLN B CA  
4566 C C   . GLN B 240 ? 2.2360 2.0602 1.8131 -0.5815 -0.1092 0.0087  510 GLN B C   
4567 O O   . GLN B 240 ? 2.4118 2.1814 1.9827 -0.5791 -0.1142 0.0091  510 GLN B O   
4568 C CB  . GLN B 240 ? 2.0299 1.9364 1.6561 -0.5854 -0.1303 -0.0310 510 GLN B CB  
4569 C CG  . GLN B 240 ? 1.9416 1.8970 1.5804 -0.5727 -0.1425 -0.0434 510 GLN B CG  
4570 C CD  . GLN B 240 ? 2.0608 2.0103 1.6688 -0.5479 -0.1546 -0.0488 510 GLN B CD  
4571 O OE1 . GLN B 240 ? 2.1310 2.0511 1.7219 -0.5411 -0.1628 -0.0566 510 GLN B OE1 
4572 N NE2 . GLN B 240 ? 2.1476 2.1264 1.7529 -0.5349 -0.1543 -0.0473 510 GLN B NE2 
4573 N N   . ILE B 241 ? 2.0974 1.9404 1.6793 -0.5973 -0.0888 0.0265  511 ILE B N   
4574 C CA  . ILE B 241 ? 2.1653 1.9687 1.7416 -0.6152 -0.0707 0.0560  511 ILE B CA  
4575 C C   . ILE B 241 ? 2.2996 2.0624 1.8280 -0.5907 -0.0727 0.0832  511 ILE B C   
4576 O O   . ILE B 241 ? 2.3290 2.0284 1.8554 -0.5925 -0.0718 0.1014  511 ILE B O   
4577 C CB  . ILE B 241 ? 2.1599 2.0073 1.7473 -0.6349 -0.0443 0.0702  511 ILE B CB  
4578 C CG1 . ILE B 241 ? 2.0766 1.9605 1.7262 -0.6610 -0.0422 0.0508  511 ILE B CG1 
4579 C CG2 . ILE B 241 ? 2.3937 2.2059 1.9592 -0.6489 -0.0229 0.1113  511 ILE B CG2 
4580 C CD1 . ILE B 241 ? 2.0410 1.9927 1.7121 -0.6638 -0.0214 0.0477  511 ILE B CD1 
4581 N N   . GLY B 242 ? 2.4772 2.2781 1.9711 -0.5684 -0.0759 0.0861  512 GLY B N   
4582 C CA  . GLY B 242 ? 2.5805 2.3630 2.0312 -0.5418 -0.0839 0.1119  512 GLY B CA  
4583 C C   . GLY B 242 ? 2.5898 2.3268 2.0501 -0.5201 -0.1025 0.1032  512 GLY B C   
4584 O O   . GLY B 242 ? 2.6793 2.3683 2.1264 -0.5041 -0.1041 0.1317  512 GLY B O   
4585 N N   . ARG B 243 ? 2.4480 2.2029 1.9323 -0.5176 -0.1150 0.0649  513 ARG B N   
4586 C CA  . ARG B 243 ? 2.4108 2.1316 1.9052 -0.4992 -0.1286 0.0467  513 ARG B CA  
4587 C C   . ARG B 243 ? 2.4833 2.1280 1.9941 -0.5120 -0.1211 0.0514  513 ARG B C   
4588 O O   . ARG B 243 ? 2.5905 2.1821 2.0981 -0.4891 -0.1237 0.0592  513 ARG B O   
4589 C CB  . ARG B 243 ? 2.3126 2.0729 1.8270 -0.5032 -0.1397 0.0074  513 ARG B CB  
4590 N N   . ALA B 244 ? 2.4939 2.1344 2.0285 -0.5489 -0.1112 0.0459  514 ALA B N   
4591 C CA  . ALA B 244 ? 2.5711 2.1413 2.1289 -0.5724 -0.1036 0.0463  514 ALA B CA  
4592 C C   . ALA B 244 ? 2.6108 2.1169 2.1550 -0.5653 -0.0904 0.0940  514 ALA B C   
4593 O O   . ALA B 244 ? 2.6760 2.1051 2.2290 -0.5553 -0.0907 0.0948  514 ALA B O   
4594 C CB  . ALA B 244 ? 2.6257 2.2237 2.2171 -0.6167 -0.0958 0.0366  514 ALA B CB  
4595 N N   . TYR B 245 ? 2.6492 2.1864 2.1715 -0.5698 -0.0778 0.1342  515 TYR B N   
4596 C CA  . TYR B 245 ? 2.7457 2.2348 2.2467 -0.5612 -0.0665 0.1903  515 TYR B CA  
4597 C C   . TYR B 245 ? 2.8056 2.2574 2.2886 -0.5144 -0.0800 0.2085  515 TYR B C   
4598 O O   . TYR B 245 ? 2.9049 2.2936 2.3846 -0.5053 -0.0730 0.2544  515 TYR B O   
4599 C CB  . TYR B 245 ? 2.7756 2.3273 2.2420 -0.5692 -0.0528 0.2248  515 TYR B CB  
4600 C CG  . TYR B 245 ? 2.7677 2.3314 2.2563 -0.6147 -0.0283 0.2337  515 TYR B CG  
4601 C CD1 . TYR B 245 ? 2.8554 2.3502 2.3669 -0.6416 -0.0123 0.2651  515 TYR B CD1 
4602 C CD2 . TYR B 245 ? 2.6832 2.3270 2.1761 -0.6307 -0.0191 0.2118  515 TYR B CD2 
4603 C CE1 . TYR B 245 ? 2.8656 2.3797 2.4043 -0.6863 0.0117  0.2751  515 TYR B CE1 
4604 C CE2 . TYR B 245 ? 2.6728 2.3376 2.1942 -0.6699 0.0057  0.2205  515 TYR B CE2 
4605 C CZ  . TYR B 245 ? 2.7641 2.3683 2.3084 -0.6991 0.0209  0.2526  515 TYR B CZ  
4606 O OH  . TYR B 245 ? 2.7796 2.4129 2.3588 -0.7412 0.0470  0.2629  515 TYR B OH  
4607 N N   . PHE B 246 ? 2.7502 2.2423 2.2268 -0.4841 -0.0983 0.1772  516 PHE B N   
4608 C CA  . PHE B 246 ? 2.8065 2.2730 2.2771 -0.4377 -0.1103 0.1925  516 PHE B CA  
4609 C C   . PHE B 246 ? 2.9243 2.3051 2.4310 -0.4319 -0.1080 0.1655  516 PHE B C   
4610 O O   . PHE B 246 ? 3.0993 2.4160 2.6157 -0.4011 -0.1072 0.1896  516 PHE B O   
4611 C CB  . PHE B 246 ? 2.6873 2.2333 2.1445 -0.4107 -0.1284 0.1688  516 PHE B CB  
4612 N N   . GLU B 247 ? 2.8899 2.2731 2.4168 -0.4612 -0.1072 0.1136  517 GLU B N   
4613 C CA  . GLU B 247 ? 2.9308 2.2432 2.4865 -0.4655 -0.1054 0.0717  517 GLU B CA  
4614 C C   . GLU B 247 ? 3.0883 2.3028 2.6682 -0.4937 -0.0898 0.0913  517 GLU B C   
4615 O O   . GLU B 247 ? 3.1969 2.3242 2.7993 -0.4839 -0.0855 0.0729  517 GLU B O   
4616 C CB  . GLU B 247 ? 2.9156 2.2781 2.4788 -0.4926 -0.1133 0.0134  517 GLU B CB  
4617 N N   . LEU B 248 ? 3.1093 2.3388 2.6870 -0.5297 -0.0791 0.1272  518 LEU B N   
4618 C CA  . LEU B 248 ? 3.1634 2.3090 2.7593 -0.5536 -0.0613 0.1706  518 LEU B CA  
4619 C C   . LEU B 248 ? 3.2251 2.3300 2.8027 -0.5172 -0.0564 0.2404  518 LEU B C   
4620 O O   . LEU B 248 ? 3.2866 2.3169 2.8783 -0.5339 -0.0407 0.2870  518 LEU B O   
4621 C CB  . LEU B 248 ? 3.0569 2.2507 2.6564 -0.6043 -0.0481 0.1891  518 LEU B CB  
4622 C CG  . LEU B 248 ? 2.9458 2.2128 2.5628 -0.6387 -0.0544 0.1366  518 LEU B CG  
4623 C CD1 . LEU B 248 ? 2.9537 2.2795 2.5750 -0.6756 -0.0374 0.1664  518 LEU B CD1 
4624 C CD2 . LEU B 248 ? 2.9682 2.1758 2.6258 -0.6693 -0.0584 0.0873  518 LEU B CD2 
4625 N N   . SER B 249 ? 3.1592 2.3166 2.7085 -0.4691 -0.0709 0.2503  519 SER B N   
4626 C CA  . SER B 249 ? 3.1731 2.3216 2.7001 -0.4307 -0.0731 0.3194  519 SER B CA  
4627 C C   . SER B 249 ? 3.1750 2.3494 2.6715 -0.4583 -0.0600 0.3829  519 SER B C   
4628 O O   . SER B 249 ? 3.2210 2.3659 2.7019 -0.4383 -0.0574 0.4523  519 SER B O   
4629 C CB  . SER B 249 ? 3.3404 2.3705 2.9024 -0.4015 -0.0682 0.3394  519 SER B CB  
4630 N N   . GLU B 250 ? 3.1226 2.3561 2.6116 -0.5026 -0.0506 0.3611  520 GLU B N   
4631 C CA  . GLU B 250 ? 3.1041 2.3776 2.5621 -0.5302 -0.0333 0.4124  520 GLU B CA  
4632 C C   . GLU B 250 ? 3.0916 2.4631 2.4961 -0.5005 -0.0482 0.4212  520 GLU B C   
4633 O O   . GLU B 250 ? 3.0905 2.5441 2.4803 -0.5154 -0.0482 0.3849  520 GLU B O   
4634 C CB  . GLU B 250 ? 2.9856 2.2908 2.4658 -0.5850 -0.0157 0.3817  520 GLU B CB  
4635 N N   . TYR B 251 ? 3.0548 2.4193 2.4342 -0.4588 -0.0617 0.4686  521 TYR B N   
4636 C CA  . TYR B 251 ? 2.9507 2.4108 2.2850 -0.4306 -0.0820 0.4679  521 TYR B CA  
4637 C C   . TYR B 251 ? 3.0050 2.5483 2.2818 -0.4542 -0.0717 0.4906  521 TYR B C   
4638 O O   . TYR B 251 ? 2.9536 2.5817 2.2036 -0.4513 -0.0825 0.4552  521 TYR B O   
4639 C CB  . TYR B 251 ? 2.9200 2.3602 2.2483 -0.3788 -0.1022 0.5162  521 TYR B CB  
4640 N N   . MET B 252 ? 3.1788 2.6987 2.4368 -0.4788 -0.0488 0.5471  522 MET B N   
4641 C CA  . MET B 252 ? 3.2640 2.8682 2.4598 -0.4988 -0.0354 0.5689  522 MET B CA  
4642 C C   . MET B 252 ? 3.2187 2.8699 2.4272 -0.5381 -0.0136 0.5119  522 MET B C   
4643 O O   . MET B 252 ? 3.2746 3.0112 2.4397 -0.5452 -0.0086 0.4930  522 MET B O   
4644 C CB  . MET B 252 ? 3.3289 2.9005 2.4964 -0.5121 -0.0151 0.6555  522 MET B CB  
4645 N N   . GLN B 253 ? 3.0588 2.6550 2.3300 -0.5624 -0.0016 0.4827  523 GLN B N   
4646 C CA  . GLN B 253 ? 2.9527 2.5928 2.2536 -0.5937 0.0134  0.4263  523 GLN B CA  
4647 C C   . GLN B 253 ? 2.9165 2.6021 2.2272 -0.5739 -0.0096 0.3595  523 GLN B C   
4648 O O   . GLN B 253 ? 2.8318 2.5800 2.1461 -0.5880 -0.0005 0.3202  523 GLN B O   
4649 C CB  . GLN B 253 ? 2.9449 2.5187 2.3124 -0.6273 0.0275  0.4175  523 GLN B CB  
4650 C CG  . GLN B 253 ? 2.8811 2.5105 2.2834 -0.6630 0.0464  0.3762  523 GLN B CG  
4651 C CD  . GLN B 253 ? 2.8651 2.5713 2.2274 -0.6790 0.0757  0.3989  523 GLN B CD  
4652 O OE1 . GLN B 253 ? 2.8988 2.5959 2.2245 -0.6878 0.0942  0.4597  523 GLN B OE1 
4653 N NE2 . GLN B 253 ? 2.8440 2.6264 2.2127 -0.6818 0.0816  0.3509  523 GLN B NE2 
4654 N N   . ALA B 254 ? 3.0026 2.6555 2.3224 -0.5404 -0.0372 0.3490  524 ALA B N   
4655 C CA  . ALA B 254 ? 2.9986 2.6926 2.3276 -0.5209 -0.0592 0.2939  524 ALA B CA  
4656 C C   . ALA B 254 ? 3.0553 2.8336 2.3346 -0.5123 -0.0645 0.2877  524 ALA B C   
4657 O O   . ALA B 254 ? 3.0677 2.8957 2.3552 -0.5216 -0.0628 0.2418  524 ALA B O   
4658 C CB  . ALA B 254 ? 3.0119 2.6604 2.3580 -0.4851 -0.0832 0.2913  524 ALA B CB  
4659 N N   . GLU B 255 ? 3.0590 2.8527 2.2880 -0.4949 -0.0720 0.3340  525 GLU B N   
4660 C CA  . GLU B 255 ? 2.9556 2.8315 2.1304 -0.4891 -0.0804 0.3263  525 GLU B CA  
4661 C C   . GLU B 255 ? 2.9421 2.8658 2.0918 -0.5211 -0.0505 0.3118  525 GLU B C   
4662 O O   . GLU B 255 ? 2.9423 2.9304 2.0625 -0.5231 -0.0526 0.2775  525 GLU B O   
4663 C CB  . GLU B 255 ? 3.0252 2.9136 2.1492 -0.4654 -0.0970 0.3861  525 GLU B CB  
4664 N N   . ARG B 256 ? 2.8532 2.7456 2.0182 -0.5469 -0.0210 0.3359  526 ARG B N   
4665 C CA  . ARG B 256 ? 2.7921 2.7303 1.9527 -0.5767 0.0128  0.3161  526 ARG B CA  
4666 C C   . ARG B 256 ? 2.7331 2.6968 1.9409 -0.5803 0.0122  0.2468  526 ARG B C   
4667 O O   . ARG B 256 ? 2.7565 2.7788 1.9437 -0.5842 0.0232  0.2124  526 ARG B O   
4668 C CB  . ARG B 256 ? 2.7738 2.6722 1.9627 -0.6059 0.0432  0.3534  526 ARG B CB  
4669 N N   . ILE B 257 ? 2.6312 2.5492 1.9016 -0.5785 -0.0006 0.2270  527 ILE B N   
4670 C CA  . ILE B 257 ? 2.5301 2.4685 1.8512 -0.5820 -0.0030 0.1719  527 ILE B CA  
4671 C C   . ILE B 257 ? 2.4733 2.4446 1.7798 -0.5601 -0.0262 0.1356  527 ILE B C   
4672 O O   . ILE B 257 ? 2.4307 2.4410 1.7523 -0.5640 -0.0184 0.0964  527 ILE B O   
4673 C CB  . ILE B 257 ? 2.4388 2.3250 1.8214 -0.5871 -0.0143 0.1626  527 ILE B CB  
4674 N N   . PHE B 258 ? 2.4729 2.4283 1.7571 -0.5370 -0.0536 0.1495  528 PHE B N   
4675 C CA  . PHE B 258 ? 2.4138 2.4051 1.6864 -0.5198 -0.0764 0.1198  528 PHE B CA  
4676 C C   . PHE B 258 ? 2.5118 2.5615 1.7340 -0.5267 -0.0672 0.1065  528 PHE B C   
4677 O O   . PHE B 258 ? 2.4221 2.5016 1.6576 -0.5308 -0.0657 0.0618  528 PHE B O   
4678 C CB  . PHE B 258 ? 2.3935 2.3674 1.6544 -0.4931 -0.1052 0.1434  528 PHE B CB  
4679 C CG  . PHE B 258 ? 2.3835 2.3091 1.6946 -0.4822 -0.1163 0.1358  528 PHE B CG  
4680 C CD1 . PHE B 258 ? 2.4167 2.3496 1.7698 -0.4869 -0.1198 0.0941  528 PHE B CD1 
4681 C CD2 . PHE B 258 ? 2.4531 2.3258 1.7682 -0.4665 -0.1223 0.1701  528 PHE B CD2 
4682 C CE1 . PHE B 258 ? 2.4240 2.3208 1.8137 -0.4786 -0.1293 0.0843  528 PHE B CE1 
4683 C CE2 . PHE B 258 ? 2.4870 2.3159 1.8439 -0.4568 -0.1298 0.1544  528 PHE B CE2 
4684 C CZ  . PHE B 258 ? 2.4580 2.3032 1.8480 -0.4641 -0.1333 0.1101  528 PHE B CZ  
4685 N N   . SER B 259 ? 2.7305 2.7953 1.8935 -0.5278 -0.0618 0.1453  529 SER B N   
4686 C CA  . SER B 259 ? 2.8311 2.9563 1.9332 -0.5378 -0.0500 0.1326  529 SER B CA  
4687 C C   . SER B 259 ? 2.9343 3.0814 2.0593 -0.5557 -0.0190 0.0841  529 SER B C   
4688 O O   . SER B 259 ? 3.1389 3.3279 2.2397 -0.5592 -0.0166 0.0418  529 SER B O   
4689 C CB  . SER B 259 ? 2.8534 2.9878 1.8936 -0.5432 -0.0370 0.1900  529 SER B CB  
4690 O OG  . SER B 259 ? 2.8720 3.0725 1.8433 -0.5542 -0.0250 0.1747  529 SER B OG  
4691 N N   . GLU B 260 ? 2.7518 2.8710 1.9282 -0.5669 0.0045  0.0888  530 GLU B N   
4692 C CA  . GLU B 260 ? 2.5880 2.7292 1.8037 -0.5784 0.0332  0.0466  530 GLU B CA  
4693 C C   . GLU B 260 ? 2.4704 2.6054 1.7378 -0.5678 0.0145  0.0005  530 GLU B C   
4694 O O   . GLU B 260 ? 2.5062 2.6684 1.7783 -0.5685 0.0259  -0.0434 530 GLU B O   
4695 C CB  . GLU B 260 ? 2.4747 2.5967 1.7412 -0.5940 0.0584  0.0680  530 GLU B CB  
4696 N N   . VAL B 261 ? 2.4661 2.5634 1.7722 -0.5584 -0.0121 0.0111  531 VAL B N   
4697 C CA  . VAL B 261 ? 2.3625 2.4545 1.7151 -0.5492 -0.0312 -0.0222 531 VAL B CA  
4698 C C   . VAL B 261 ? 2.3705 2.4886 1.6912 -0.5430 -0.0467 -0.0502 531 VAL B C   
4699 O O   . VAL B 261 ? 2.4278 2.5509 1.7835 -0.5420 -0.0492 -0.0860 531 VAL B O   
4700 C CB  . VAL B 261 ? 2.3759 2.4299 1.7579 -0.5396 -0.0572 -0.0039 531 VAL B CB  
4701 N N   . ARG B 262 ? 2.3630 2.4990 1.6200 -0.5402 -0.0581 -0.0315 532 ARG B N   
4702 C CA  . ARG B 262 ? 2.3658 2.5388 1.5848 -0.5407 -0.0730 -0.0594 532 ARG B CA  
4703 C C   . ARG B 262 ? 2.4712 2.6718 1.6739 -0.5546 -0.0448 -0.1037 532 ARG B C   
4704 O O   . ARG B 262 ? 2.5524 2.7633 1.7680 -0.5585 -0.0500 -0.1489 532 ARG B O   
4705 C CB  . ARG B 262 ? 2.3481 2.5448 1.5011 -0.5345 -0.0928 -0.0228 532 ARG B CB  
4706 N N   . ARG B 263 ? 2.4650 2.6767 1.6414 -0.5627 -0.0126 -0.0916 533 ARG B N   
4707 C CA  . ARG B 263 ? 2.4995 2.7419 1.6567 -0.5734 0.0212  -0.1352 533 ARG B CA  
4708 C C   . ARG B 263 ? 2.4737 2.6953 1.7126 -0.5700 0.0371  -0.1759 533 ARG B C   
4709 O O   . ARG B 263 ? 2.5995 2.8294 1.8441 -0.5722 0.0457  -0.2281 533 ARG B O   
4710 C CB  . ARG B 263 ? 2.4888 2.7525 1.6075 -0.5825 0.0564  -0.1066 533 ARG B CB  
4711 N N   . ILE B 264 ? 2.4029 2.5966 1.7067 -0.5648 0.0395  -0.1507 534 ILE B N   
4712 C CA  . ILE B 264 ? 2.3093 2.4867 1.6971 -0.5583 0.0481  -0.1759 534 ILE B CA  
4713 C C   . ILE B 264 ? 2.2115 2.3697 1.6264 -0.5521 0.0200  -0.2003 534 ILE B C   
4714 O O   . ILE B 264 ? 2.2254 2.3793 1.6758 -0.5498 0.0318  -0.2411 534 ILE B O   
4715 C CB  . ILE B 264 ? 2.2600 2.4189 1.7052 -0.5569 0.0457  -0.1393 534 ILE B CB  
4716 C CG1 . ILE B 264 ? 2.3313 2.5074 1.7577 -0.5685 0.0738  -0.1105 534 ILE B CG1 
4717 C CG2 . ILE B 264 ? 2.2180 2.3722 1.7498 -0.5488 0.0527  -0.1589 534 ILE B CG2 
4718 C CD1 . ILE B 264 ? 2.4688 2.6842 1.8854 -0.5727 0.1176  -0.1390 534 ILE B CD1 
4719 N N   . GLU B 265 ? 2.8943 2.4644 1.7005 -0.2488 -0.2354 -0.2153 535 GLU B N   
4720 C CA  . GLU B 265 ? 2.7916 2.3204 1.6724 -0.2276 -0.2438 -0.1969 535 GLU B CA  
4721 C C   . GLU B 265 ? 2.7112 2.1731 1.6409 -0.2487 -0.2798 -0.1616 535 GLU B C   
4722 O O   . GLU B 265 ? 2.7196 2.1729 1.7107 -0.2583 -0.2701 -0.1277 535 GLU B O   
4723 C CB  . GLU B 265 ? 2.7629 2.3342 1.6870 -0.2190 -0.2042 -0.1841 535 GLU B CB  
4724 C CG  . GLU B 265 ? 2.7820 2.3394 1.7525 -0.1795 -0.1957 -0.1804 535 GLU B CG  
4725 C CD  . GLU B 265 ? 2.7099 2.3309 1.6953 -0.1622 -0.1558 -0.1828 535 GLU B CD  
4726 O OE1 . GLU B 265 ? 2.6865 2.2970 1.7270 -0.1641 -0.1441 -0.1515 535 GLU B OE1 
4727 O OE2 . GLU B 265 ? 2.6627 2.3500 1.6068 -0.1460 -0.1364 -0.2187 535 GLU B OE2 
4728 N N   . ASN B 266 ? 2.7898 2.2114 1.6935 -0.2547 -0.3214 -0.1724 536 ASN B N   
4729 C CA  . ASN B 266 ? 2.8610 2.2288 1.8129 -0.2734 -0.3621 -0.1459 536 ASN B CA  
4730 C C   . ASN B 266 ? 2.9526 2.2836 2.0045 -0.2647 -0.3653 -0.1239 536 ASN B C   
4731 O O   . ASN B 266 ? 3.0269 2.3244 2.1379 -0.2810 -0.3940 -0.1006 536 ASN B O   
4732 C CB  . ASN B 266 ? 2.8616 2.1971 1.7717 -0.2725 -0.4092 -0.1740 536 ASN B CB  
4733 C CG  . ASN B 266 ? 2.8798 2.2012 1.7819 -0.2423 -0.4114 -0.2128 536 ASN B CG  
4734 O OD1 . ASN B 266 ? 2.9709 2.3105 1.8884 -0.2192 -0.3765 -0.2170 536 ASN B OD1 
4735 N ND2 . ASN B 266 ? 2.8889 2.1727 1.7713 -0.2397 -0.4556 -0.2413 536 ASN B ND2 
4736 N N   . TYR B 267 ? 2.9511 2.2880 2.0196 -0.2366 -0.3376 -0.1335 537 TYR B N   
4737 C CA  . TYR B 267 ? 2.9696 2.2740 2.1251 -0.2266 -0.3290 -0.1080 537 TYR B CA  
4738 C C   . TYR B 267 ? 2.9365 2.2715 2.1357 -0.2267 -0.2907 -0.0742 537 TYR B C   
4739 O O   . TYR B 267 ? 3.0423 2.3545 2.3151 -0.2208 -0.2799 -0.0469 537 TYR B O   
4740 C CB  . TYR B 267 ? 3.0016 2.2836 2.1475 -0.1919 -0.3208 -0.1317 537 TYR B CB  
4741 C CG  . TYR B 267 ? 2.9533 2.2879 2.0350 -0.1611 -0.2868 -0.1562 537 TYR B CG  
4742 C CD1 . TYR B 267 ? 2.9238 2.2793 1.9272 -0.1500 -0.2963 -0.1999 537 TYR B CD1 
4743 C CD2 . TYR B 267 ? 3.0038 2.3721 2.1053 -0.1399 -0.2461 -0.1386 537 TYR B CD2 
4744 C CE1 . TYR B 267 ? 2.9089 2.3219 1.8630 -0.1201 -0.2660 -0.2256 537 TYR B CE1 
4745 C CE2 . TYR B 267 ? 3.0833 2.5078 2.1328 -0.1090 -0.2193 -0.1650 537 TYR B CE2 
4746 C CZ  . TYR B 267 ? 3.0233 2.4720 2.0034 -0.0998 -0.2290 -0.2084 537 TYR B CZ  
4747 O OH  . TYR B 267 ? 3.1193 2.6342 2.0561 -0.0678 -0.2025 -0.2375 537 TYR B OH  
4748 N N   . ARG B 268 ? 2.8139 2.2008 1.9688 -0.2341 -0.2684 -0.0775 538 ARG B N   
4749 C CA  . ARG B 268 ? 2.7307 2.1489 1.9228 -0.2346 -0.2337 -0.0527 538 ARG B CA  
4750 C C   . ARG B 268 ? 2.7094 2.1022 1.9574 -0.2622 -0.2514 -0.0185 538 ARG B C   
4751 O O   . ARG B 268 ? 2.6990 2.0810 1.9190 -0.2862 -0.2786 -0.0179 538 ARG B O   
4752 C CB  . ARG B 268 ? 2.6839 2.1647 1.8187 -0.2375 -0.2047 -0.0723 538 ARG B CB  
4753 C CG  . ARG B 268 ? 2.6687 2.1837 1.8418 -0.2322 -0.1691 -0.0562 538 ARG B CG  
4754 C CD  . ARG B 268 ? 2.6049 2.1823 1.7317 -0.2423 -0.1428 -0.0799 538 ARG B CD  
4755 N NE  . ARG B 268 ? 2.7072 2.3216 1.8699 -0.2319 -0.1102 -0.0737 538 ARG B NE  
4756 C CZ  . ARG B 268 ? 2.9015 2.5510 2.0700 -0.1940 -0.0882 -0.0857 538 ARG B CZ  
4757 N NH1 . ARG B 268 ? 2.9840 2.6307 2.1269 -0.1619 -0.0939 -0.1019 538 ARG B NH1 
4758 N NH2 . ARG B 268 ? 2.9070 2.5915 2.1045 -0.1850 -0.0616 -0.0816 538 ARG B NH2 
4759 N N   . VAL B 269 ? 2.6827 2.0672 2.0071 -0.2557 -0.2360 0.0107  539 VAL B N   
4760 C CA  . VAL B 269 ? 2.6517 2.0260 2.0340 -0.2764 -0.2449 0.0420  539 VAL B CA  
4761 C C   . VAL B 269 ? 2.6427 2.0562 2.0334 -0.2717 -0.2043 0.0522  539 VAL B C   
4762 O O   . VAL B 269 ? 2.6137 2.0284 2.0163 -0.2902 -0.2066 0.0671  539 VAL B O   
4763 C CB  . VAL B 269 ? 2.9534 2.2916 2.4298 -0.2764 -0.2601 0.0665  539 VAL B CB  
4764 C CG1 . VAL B 269 ? 2.9719 2.2707 2.4460 -0.2841 -0.3039 0.0495  539 VAL B CG1 
4765 C CG2 . VAL B 269 ? 2.9105 2.2545 2.4292 -0.2502 -0.2201 0.0800  539 VAL B CG2 
4766 N N   . GLU B 270 ? 2.6995 2.1423 2.0843 -0.2440 -0.1691 0.0434  540 GLU B N   
4767 C CA  . GLU B 270 ? 2.6739 2.1626 2.0582 -0.2348 -0.1313 0.0423  540 GLU B CA  
4768 C C   . GLU B 270 ? 2.6453 2.1584 1.9832 -0.2606 -0.1289 0.0265  540 GLU B C   
4769 O O   . GLU B 270 ? 2.6583 2.1915 1.9316 -0.2665 -0.1310 -0.0016 540 GLU B O   
4770 C CB  . GLU B 270 ? 2.6442 2.1689 2.0001 -0.1976 -0.1022 0.0231  540 GLU B CB  
4771 N N   . GLY B 271 ? 2.5973 2.1071 1.9700 -0.2758 -0.1221 0.0448  541 GLY B N   
4772 C CA  . GLY B 271 ? 2.6222 2.1464 1.9581 -0.3016 -0.1132 0.0338  541 GLY B CA  
4773 C C   . GLY B 271 ? 2.5964 2.0779 1.9038 -0.3314 -0.1457 0.0467  541 GLY B C   
4774 O O   . GLY B 271 ? 2.6244 2.1098 1.8854 -0.3554 -0.1380 0.0389  541 GLY B O   
4775 N N   . MET B 272 ? 2.5118 1.9528 1.8466 -0.3300 -0.1817 0.0664  542 MET B N   
4776 C CA  . MET B 272 ? 2.4917 1.8950 1.7924 -0.3518 -0.2184 0.0774  542 MET B CA  
4777 C C   . MET B 272 ? 2.5149 1.8838 1.8776 -0.3569 -0.2390 0.1120  542 MET B C   
4778 O O   . MET B 272 ? 2.4981 1.8341 1.8360 -0.3709 -0.2709 0.1267  542 MET B O   
4779 C CB  . MET B 272 ? 2.5052 1.8930 1.7812 -0.3462 -0.2526 0.0645  542 MET B CB  
4780 N N   . GLU B 273 ? 2.6511 2.0302 2.0919 -0.3421 -0.2208 0.1250  543 GLU B N   
4781 C CA  . GLU B 273 ? 2.6316 1.9901 2.1329 -0.3439 -0.2285 0.1536  543 GLU B CA  
4782 C C   . GLU B 273 ? 2.6717 2.0137 2.1291 -0.3616 -0.2186 0.1585  543 GLU B C   
4783 O O   . GLU B 273 ? 2.8154 2.1210 2.2851 -0.3676 -0.2431 0.1828  543 GLU B O   
4784 C CB  . GLU B 273 ? 2.6244 2.0070 2.2068 -0.3230 -0.1986 0.1616  543 GLU B CB  
4785 C CG  . GLU B 273 ? 2.6763 2.0965 2.2381 -0.3139 -0.1509 0.1420  543 GLU B CG  
4786 C CD  . GLU B 273 ? 2.7145 2.1670 2.2445 -0.2980 -0.1329 0.1187  543 GLU B CD  
4787 O OE1 . GLU B 273 ? 2.7480 2.1919 2.2303 -0.3045 -0.1533 0.1063  543 GLU B OE1 
4788 O OE2 . GLU B 273 ? 2.6919 2.1785 2.2405 -0.2756 -0.0990 0.1118  543 GLU B OE2 
4789 N N   . ILE B 274 ? 2.5810 1.9495 1.9896 -0.3694 -0.1825 0.1348  544 ILE B N   
4790 C CA  . ILE B 274 ? 2.5292 1.8816 1.9045 -0.3903 -0.1639 0.1362  544 ILE B CA  
4791 C C   . ILE B 274 ? 2.5707 1.8975 1.8591 -0.4148 -0.1797 0.1378  544 ILE B C   
4792 O O   . ILE B 274 ? 2.6285 1.9203 1.8847 -0.4352 -0.1737 0.1518  544 ILE B O   
4793 C CB  . ILE B 274 ? 2.5172 1.9163 1.8914 -0.3904 -0.1167 0.1056  544 ILE B CB  
4794 C CG1 . ILE B 274 ? 2.4940 1.9302 1.7969 -0.4041 -0.1010 0.0732  544 ILE B CG1 
4795 C CG2 . ILE B 274 ? 2.5158 1.9519 1.9548 -0.3588 -0.1008 0.0995  544 ILE B CG2 
4796 C CD1 . ILE B 274 ? 2.5211 1.9729 1.7998 -0.4295 -0.0660 0.0527  544 ILE B CD1 
4797 N N   . TYR B 275 ? 2.6134 1.9548 1.8615 -0.4115 -0.1976 0.1238  545 TYR B N   
4798 C CA  . TYR B 275 ? 2.7264 2.0428 1.8922 -0.4283 -0.2203 0.1282  545 TYR B CA  
4799 C C   . TYR B 275 ? 2.7460 2.0075 1.9234 -0.4260 -0.2644 0.1648  545 TYR B C   
4800 O O   . TYR B 275 ? 2.7928 2.0161 1.9079 -0.4411 -0.2743 0.1841  545 TYR B O   
4801 C CB  . TYR B 275 ? 2.7691 2.1128 1.8987 -0.4185 -0.2343 0.1013  545 TYR B CB  
4802 C CG  . TYR B 275 ? 2.7439 2.0701 1.7809 -0.4319 -0.2559 0.0998  545 TYR B CG  
4803 C CD1 . TYR B 275 ? 2.8166 2.1163 1.7906 -0.4561 -0.2450 0.1179  545 TYR B CD1 
4804 C CD2 . TYR B 275 ? 2.8120 2.1440 1.8219 -0.4192 -0.2862 0.0808  545 TYR B CD2 
4805 C CE1 . TYR B 275 ? 2.9530 2.2377 1.8344 -0.4658 -0.2618 0.1197  545 TYR B CE1 
4806 C CE2 . TYR B 275 ? 2.9221 2.2416 1.8419 -0.4277 -0.3061 0.0766  545 TYR B CE2 
4807 C CZ  . TYR B 275 ? 3.0643 2.3626 1.9175 -0.4502 -0.2931 0.0975  545 TYR B CZ  
4808 O OH  . TYR B 275 ? 3.3001 2.5872 2.0553 -0.4564 -0.3097 0.0961  545 TYR B OH  
4809 N N   . SER B 276 ? 2.7936 2.0535 2.0519 -0.4059 -0.2898 0.1748  546 SER B N   
4810 C CA  . SER B 276 ? 2.8984 2.1192 2.1867 -0.3988 -0.3348 0.2053  546 SER B CA  
4811 C C   . SER B 276 ? 2.8735 2.0585 2.1677 -0.4041 -0.3211 0.2325  546 SER B C   
4812 O O   . SER B 276 ? 3.0834 2.2233 2.3404 -0.4058 -0.3499 0.2591  546 SER B O   
4813 C CB  . SER B 276 ? 3.0280 2.2659 2.4199 -0.3793 -0.3552 0.2070  546 SER B CB  
4814 O OG  . SER B 276 ? 3.0674 2.3133 2.5379 -0.3698 -0.3284 0.2190  546 SER B OG  
4815 N N   . THR B 277 ? 2.7116 1.9146 2.0492 -0.4041 -0.2776 0.2245  547 THR B N   
4816 C CA  . THR B 277 ? 2.6565 1.8235 2.0079 -0.4084 -0.2598 0.2436  547 THR B CA  
4817 C C   . THR B 277 ? 2.7027 1.8353 1.9598 -0.4368 -0.2402 0.2475  547 THR B C   
4818 O O   . THR B 277 ? 2.7849 1.8616 2.0283 -0.4427 -0.2398 0.2739  547 THR B O   
4819 C CB  . THR B 277 ? 2.6000 1.8017 2.0194 -0.4000 -0.2172 0.2254  547 THR B CB  
4820 O OG1 . THR B 277 ? 2.5745 1.8071 2.0790 -0.3746 -0.2292 0.2265  547 THR B OG1 
4821 C CG2 . THR B 277 ? 2.6634 1.8235 2.1021 -0.4027 -0.2002 0.2400  547 THR B CG2 
4822 N N   . THR B 278 ? 2.7067 1.8704 1.8988 -0.4536 -0.2237 0.2226  548 THR B N   
4823 C CA  . THR B 278 ? 2.8061 1.9436 1.9052 -0.4834 -0.2046 0.2272  548 THR B CA  
4824 C C   . THR B 278 ? 2.9259 2.0088 1.9617 -0.4806 -0.2478 0.2627  548 THR B C   
4825 O O   . THR B 278 ? 2.9393 1.9635 1.9238 -0.4948 -0.2418 0.2925  548 THR B O   
4826 C CB  . THR B 278 ? 2.7797 1.9759 1.8291 -0.4984 -0.1777 0.1887  548 THR B CB  
4827 O OG1 . THR B 278 ? 2.7530 2.0018 1.8536 -0.4991 -0.1378 0.1552  548 THR B OG1 
4828 C CG2 . THR B 278 ? 2.8610 2.0336 1.8148 -0.5311 -0.1567 0.1963  548 THR B CG2 
4829 N N   . LEU B 279 ? 3.0906 2.1908 2.1288 -0.4609 -0.2920 0.2588  549 LEU B N   
4830 C CA  . LEU B 279 ? 3.2779 2.3372 2.2561 -0.4524 -0.3409 0.2859  549 LEU B CA  
4831 C C   . LEU B 279 ? 3.4048 2.4152 2.4314 -0.4325 -0.3738 0.3238  549 LEU B C   
4832 O O   . LEU B 279 ? 3.5950 2.5652 2.5700 -0.4215 -0.4154 0.3517  549 LEU B O   
4833 C CB  . LEU B 279 ? 3.2775 2.3733 2.2549 -0.4373 -0.3813 0.2622  549 LEU B CB  
4834 N N   . TRP B 280 ? 3.2872 2.3066 2.4130 -0.4230 -0.3580 0.3226  550 TRP B N   
4835 C CA  . TRP B 280 ? 3.2360 2.2127 2.4151 -0.4019 -0.3824 0.3556  550 TRP B CA  
4836 C C   . TRP B 280 ? 3.1145 2.0247 2.2558 -0.4144 -0.3518 0.3823  550 TRP B C   
4837 O O   . TRP B 280 ? 3.2021 2.0525 2.3240 -0.3988 -0.3807 0.4199  550 TRP B O   
4838 C CB  . TRP B 280 ? 3.2602 2.2789 2.5666 -0.3826 -0.3797 0.3421  550 TRP B CB  
4839 C CG  . TRP B 280 ? 3.2874 2.2755 2.6606 -0.3559 -0.4083 0.3713  550 TRP B CG  
4840 C CD1 . TRP B 280 ? 3.3276 2.3270 2.7532 -0.3307 -0.4636 0.3827  550 TRP B CD1 
4841 C CD2 . TRP B 280 ? 3.2071 2.1529 2.6085 -0.3498 -0.3841 0.3884  550 TRP B CD2 
4842 N NE1 . TRP B 280 ? 3.3008 2.2718 2.7846 -0.3069 -0.4755 0.4074  550 TRP B NE1 
4843 C CE2 . TRP B 280 ? 3.2169 2.1504 2.6847 -0.3169 -0.4269 0.4118  550 TRP B CE2 
4844 C CE3 . TRP B 280 ? 3.1437 2.0618 2.5243 -0.3690 -0.3314 0.3826  550 TRP B CE3 
4845 C CZ2 . TRP B 280 ? 3.1403 2.0312 2.6497 -0.2990 -0.4180 0.4310  550 TRP B CZ2 
4846 C CZ3 . TRP B 280 ? 3.1209 1.9918 2.5427 -0.3544 -0.3228 0.4002  550 TRP B CZ3 
4847 C CH2 . TRP B 280 ? 3.0846 1.9403 2.5679 -0.3179 -0.3654 0.4250  550 TRP B CH2 
4848 N N   . HIS B 281 ? 3.0150 1.9340 2.1468 -0.4414 -0.2948 0.3618  551 HIS B N   
4849 C CA  . HIS B 281 ? 3.0719 1.9245 2.1685 -0.4613 -0.2600 0.3816  551 HIS B CA  
4850 C C   . HIS B 281 ? 3.2531 2.0473 2.2290 -0.4793 -0.2640 0.4133  551 HIS B C   
4851 O O   . HIS B 281 ? 3.4128 2.1270 2.3556 -0.4709 -0.2776 0.4560  551 HIS B O   
4852 C CB  . HIS B 281 ? 2.9991 1.8879 2.1182 -0.4894 -0.2000 0.3431  551 HIS B CB  
4853 N N   . LEU B 282 ? 3.2089 2.0426 2.1164 -0.5011 -0.2506 0.3933  552 LEU B N   
4854 C CA  . LEU B 282 ? 3.3072 2.1066 2.0998 -0.5054 -0.2708 0.4208  552 LEU B CA  
4855 C C   . LEU B 282 ? 3.4200 2.2163 2.2307 -0.4638 -0.3414 0.4380  552 LEU B C   
4856 O O   . LEU B 282 ? 3.4684 2.3200 2.3656 -0.4448 -0.3644 0.4119  552 LEU B O   
4857 C CB  . LEU B 282 ? 3.2443 2.1042 1.9751 -0.5289 -0.2478 0.3873  552 LEU B CB  
4858 N N   . GLN B 283 ? 3.4128 2.1488 2.1440 -0.4491 -0.3765 0.4804  553 GLN B N   
4859 C CA  . GLN B 283 ? 3.4354 2.1749 2.1977 -0.4073 -0.4480 0.4927  553 GLN B CA  
4860 C C   . GLN B 283 ? 3.5670 2.3425 2.2588 -0.3994 -0.4891 0.4783  553 GLN B C   
4861 O O   . GLN B 283 ? 3.8339 2.5694 2.4318 -0.3838 -0.5247 0.5090  553 GLN B O   
4862 C CB  . GLN B 283 ? 3.5505 2.2035 2.2837 -0.3829 -0.4736 0.5475  553 GLN B CB  
4863 N N   . LYS B 284 ? 3.4485 2.2981 2.1840 -0.4077 -0.4840 0.4302  554 LYS B N   
4864 C CA  . LYS B 284 ? 3.5529 2.4405 2.2257 -0.4041 -0.5146 0.4049  554 LYS B CA  
4865 C C   . LYS B 284 ? 3.6759 2.6108 2.4398 -0.3791 -0.5710 0.3775  554 LYS B C   
4866 O O   . LYS B 284 ? 3.6777 2.6663 2.4802 -0.3863 -0.5631 0.3354  554 LYS B O   
4867 C CB  . LYS B 284 ? 3.4722 2.4033 2.1081 -0.4347 -0.4608 0.3683  554 LYS B CB  
4868 N N   . ASP B 285 ? 3.8078 2.7225 2.6122 -0.3500 -0.6257 0.4011  555 ASP B N   
4869 C CA  . ASP B 285 ? 3.8864 2.8470 2.7836 -0.3291 -0.6827 0.3757  555 ASP B CA  
4870 C C   . ASP B 285 ? 3.9203 2.9166 2.7640 -0.3316 -0.7113 0.3366  555 ASP B C   
4871 O O   . ASP B 285 ? 3.8571 2.8991 2.7847 -0.3304 -0.7305 0.2999  555 ASP B O   
4872 C CB  . ASP B 285 ? 3.9436 2.8797 2.8646 -0.2951 -0.7446 0.4070  555 ASP B CB  
4873 N N   . VAL B 286 ? 3.9191 2.8908 2.6217 -0.3345 -0.7126 0.3455  556 VAL B N   
4874 C CA  . VAL B 286 ? 3.9204 2.9221 2.5505 -0.3368 -0.7312 0.3066  556 VAL B CA  
4875 C C   . VAL B 286 ? 3.8218 2.8701 2.5038 -0.3570 -0.6900 0.2602  556 VAL B C   
4876 O O   . VAL B 286 ? 3.8685 2.9507 2.5915 -0.3508 -0.7223 0.2196  556 VAL B O   
4877 C CB  . VAL B 286 ? 3.6242 2.5923 2.0855 -0.3411 -0.7163 0.3281  556 VAL B CB  
4878 C CG1 . VAL B 286 ? 3.6223 2.5671 2.0452 -0.3717 -0.6349 0.3501  556 VAL B CG1 
4879 C CG2 . VAL B 286 ? 3.6418 2.6445 2.0259 -0.3383 -0.7385 0.2839  556 VAL B CG2 
4880 N N   . ALA B 287 ? 3.6500 2.6982 2.3318 -0.3797 -0.6204 0.2655  557 ALA B N   
4881 C CA  . ALA B 287 ? 3.4366 2.5290 2.1481 -0.3946 -0.5778 0.2245  557 ALA B CA  
4882 C C   . ALA B 287 ? 3.3269 2.4437 2.1823 -0.3900 -0.5744 0.2124  557 ALA B C   
4883 O O   . ALA B 287 ? 3.2519 2.4029 2.1504 -0.3894 -0.5700 0.1757  557 ALA B O   
4884 C CB  . ALA B 287 ? 3.4139 2.5052 2.0677 -0.4199 -0.5073 0.2317  557 ALA B CB  
4885 N N   . LEU B 288 ? 3.4260 2.5222 2.3525 -0.3848 -0.5748 0.2447  558 LEU B N   
4886 C CA  . LEU B 288 ? 3.4278 2.5475 2.4907 -0.3783 -0.5706 0.2388  558 LEU B CA  
4887 C C   . LEU B 288 ? 3.5148 2.6546 2.6444 -0.3642 -0.6286 0.2186  558 LEU B C   
4888 O O   . LEU B 288 ? 3.5113 2.6783 2.7433 -0.3632 -0.6211 0.2023  558 LEU B O   
4889 C CB  . LEU B 288 ? 3.3448 2.4379 2.4631 -0.3720 -0.5621 0.2769  558 LEU B CB  
4890 N N   . SER B 289 ? 3.4587 2.5849 2.5293 -0.3537 -0.6856 0.2192  559 SER B N   
4891 C CA  . SER B 289 ? 3.3703 2.5181 2.4955 -0.3438 -0.7451 0.1907  559 SER B CA  
4892 C C   . SER B 289 ? 3.3679 2.5357 2.4711 -0.3526 -0.7359 0.1445  559 SER B C   
4893 O O   . SER B 289 ? 3.4776 2.6652 2.6774 -0.3542 -0.7440 0.1200  559 SER B O   
4894 C CB  . SER B 289 ? 3.4428 2.5742 2.5005 -0.3263 -0.8122 0.2003  559 SER B CB  
4895 N N   . VAL B 290 ? 3.2665 2.4272 2.2432 -0.3575 -0.7185 0.1333  560 VAL B N   
4896 C CA  . VAL B 290 ? 3.1586 2.3377 2.1040 -0.3620 -0.7025 0.0889  560 VAL B CA  
4897 C C   . VAL B 290 ? 3.0124 2.2101 2.0489 -0.3684 -0.6529 0.0795  560 VAL B C   
4898 O O   . VAL B 290 ? 2.9397 2.1472 2.0271 -0.3658 -0.6607 0.0474  560 VAL B O   
4899 C CB  . VAL B 290 ? 3.1676 2.3448 1.9698 -0.3677 -0.6719 0.0846  560 VAL B CB  
4900 C CG1 . VAL B 290 ? 3.1646 2.3681 1.9532 -0.3710 -0.6349 0.0433  560 VAL B CG1 
4901 C CG2 . VAL B 290 ? 3.2875 2.4511 1.9859 -0.3563 -0.7254 0.0801  560 VAL B CG2 
4902 N N   . LEU B 291 ? 2.9826 2.1815 2.0362 -0.3754 -0.6022 0.1079  561 LEU B N   
4903 C CA  . LEU B 291 ? 2.8925 2.1126 2.0115 -0.3779 -0.5500 0.1011  561 LEU B CA  
4904 C C   . LEU B 291 ? 2.9166 2.1422 2.1671 -0.3715 -0.5651 0.1019  561 LEU B C   
4905 O O   . LEU B 291 ? 2.9626 2.1993 2.2557 -0.3681 -0.5492 0.0800  561 LEU B O   
4906 C CB  . LEU B 291 ? 2.8287 2.0494 1.9395 -0.3865 -0.4991 0.1287  561 LEU B CB  
4907 N N   . SER B 292 ? 2.8953 2.1125 2.2097 -0.3687 -0.5942 0.1288  562 SER B N   
4908 C CA  . SER B 292 ? 2.8524 2.0814 2.3015 -0.3651 -0.6037 0.1341  562 SER B CA  
4909 C C   . SER B 292 ? 2.9400 2.1709 2.4327 -0.3663 -0.6468 0.1026  562 SER B C   
4910 O O   . SER B 292 ? 3.0086 2.2473 2.5885 -0.3684 -0.6296 0.0944  562 SER B O   
4911 C CB  . SER B 292 ? 2.8234 2.0488 2.3273 -0.3590 -0.6289 0.1670  562 SER B CB  
4912 O OG  . SER B 292 ? 2.9008 2.1219 2.4023 -0.3540 -0.6976 0.1601  562 SER B OG  
4913 N N   . LYS B 293 ? 2.9860 2.2072 2.4176 -0.3649 -0.7019 0.0850  563 LYS B N   
4914 C CA  . LYS B 293 ? 3.1093 2.3297 2.5726 -0.3673 -0.7470 0.0464  563 LYS B CA  
4915 C C   . LYS B 293 ? 3.1641 2.3780 2.6164 -0.3697 -0.7101 0.0178  563 LYS B C   
4916 O O   . LYS B 293 ? 3.2022 2.4126 2.7470 -0.3746 -0.7100 0.0037  563 LYS B O   
4917 C CB  . LYS B 293 ? 3.1406 2.3531 2.5058 -0.3612 -0.8063 0.0268  563 LYS B CB  
4918 N N   . ASP B 294 ? 3.0696 2.2815 2.4082 -0.3655 -0.6784 0.0100  564 ASP B N   
4919 C CA  . ASP B 294 ? 2.9831 2.1930 2.2949 -0.3609 -0.6414 -0.0168 564 ASP B CA  
4920 C C   . ASP B 294 ? 2.8124 2.0264 2.2162 -0.3589 -0.5925 -0.0018 564 ASP B C   
4921 O O   . ASP B 294 ? 2.8120 2.0110 2.2616 -0.3558 -0.5896 -0.0216 564 ASP B O   
4922 C CB  . ASP B 294 ? 3.0425 2.2642 2.2287 -0.3571 -0.6079 -0.0209 564 ASP B CB  
4923 C CG  . ASP B 294 ? 3.1967 2.4127 2.2798 -0.3523 -0.6414 -0.0581 564 ASP B CG  
4924 O OD1 . ASP B 294 ? 3.2917 2.4948 2.3900 -0.3461 -0.6637 -0.0957 564 ASP B OD1 
4925 O OD2 . ASP B 294 ? 3.2186 2.4402 2.2037 -0.3544 -0.6439 -0.0496 564 ASP B OD2 
4926 N N   . LEU B 295 ? 2.6912 1.9218 2.1189 -0.3591 -0.5541 0.0332  565 LEU B N   
4927 C CA  . LEU B 295 ? 2.6053 1.8456 2.1032 -0.3528 -0.5031 0.0492  565 LEU B CA  
4928 C C   . LEU B 295 ? 2.6566 1.8891 2.2835 -0.3576 -0.5160 0.0605  565 LEU B C   
4929 O O   . LEU B 295 ? 2.7375 1.9632 2.4148 -0.3518 -0.4853 0.0610  565 LEU B O   
4930 C CB  . LEU B 295 ? 2.5266 1.7881 2.0148 -0.3518 -0.4631 0.0786  565 LEU B CB  
4931 N N   . THR B 296 ? 2.6137 1.8490 2.2942 -0.3671 -0.5596 0.0710  566 THR B N   
4932 C CA  . THR B 296 ? 2.6117 1.8516 2.4277 -0.3751 -0.5719 0.0819  566 THR B CA  
4933 C C   . THR B 296 ? 2.6544 1.8693 2.5060 -0.3816 -0.5827 0.0529  566 THR B C   
4934 O O   . THR B 296 ? 2.6629 1.8710 2.5927 -0.3829 -0.5477 0.0639  566 THR B O   
4935 C CB  . THR B 296 ? 2.6287 1.8817 2.4901 -0.3814 -0.6289 0.0881  566 THR B CB  
4936 O OG1 . THR B 296 ? 2.7205 1.9622 2.4779 -0.3799 -0.6762 0.0661  566 THR B OG1 
4937 C CG2 . THR B 296 ? 2.5105 1.7840 2.3967 -0.3737 -0.6069 0.1262  566 THR B CG2 
4938 N N   . ASP B 297 ? 2.6883 1.8859 2.4794 -0.3847 -0.6302 0.0161  567 ASP B N   
4939 C CA  . ASP B 297 ? 2.7434 1.9109 2.5744 -0.3929 -0.6514 -0.0178 567 ASP B CA  
4940 C C   . ASP B 297 ? 2.7802 1.9204 2.5290 -0.3781 -0.6167 -0.0375 567 ASP B C   
4941 O O   . ASP B 297 ? 2.8721 1.9775 2.6254 -0.3800 -0.6345 -0.0714 567 ASP B O   
4942 C CB  . ASP B 297 ? 2.8412 2.0062 2.6557 -0.4014 -0.7270 -0.0546 567 ASP B CB  
4943 N N   . MET B 298 ? 2.6850 1.8421 2.3612 -0.3621 -0.5688 -0.0193 568 MET B N   
4944 C CA  . MET B 298 ? 2.6938 1.8352 2.3175 -0.3430 -0.5266 -0.0308 568 MET B CA  
4945 C C   . MET B 298 ? 2.7301 1.8659 2.4374 -0.3371 -0.4755 0.0016  568 MET B C   
4946 O O   . MET B 298 ? 2.9305 2.0323 2.6492 -0.3261 -0.4547 -0.0061 568 MET B O   
4947 C CB  . MET B 298 ? 2.6177 1.7889 2.1243 -0.3286 -0.5012 -0.0335 568 MET B CB  
4948 N N   . ASP B 299 ? 2.6583 1.8250 2.4190 -0.3416 -0.4544 0.0387  569 ASP B N   
4949 C CA  . ASP B 299 ? 2.6198 1.7904 2.4502 -0.3330 -0.4015 0.0729  569 ASP B CA  
4950 C C   . ASP B 299 ? 2.6626 1.8593 2.5961 -0.3480 -0.4035 0.1044  569 ASP B C   
4951 O O   . ASP B 299 ? 2.5485 1.7789 2.4673 -0.3417 -0.3850 0.1244  569 ASP B O   
4952 C CB  . ASP B 299 ? 2.4615 1.6569 2.2143 -0.3073 -0.3511 0.0816  569 ASP B CB  
4953 N N   . LYS B 300 ? 2.7024 1.8855 2.7436 -0.3677 -0.4261 0.1059  570 LYS B N   
4954 C CA  . LYS B 300 ? 2.6120 1.8275 2.7649 -0.3798 -0.4253 0.1340  570 LYS B CA  
4955 C C   . LYS B 300 ? 2.6448 1.8813 2.8355 -0.3648 -0.3590 0.1730  570 LYS B C   
4956 O O   . LYS B 300 ? 2.5939 1.8673 2.8456 -0.3657 -0.3516 0.1958  570 LYS B O   
4957 C CB  . LYS B 300 ? 2.5351 1.7371 2.8072 -0.4062 -0.4572 0.1237  570 LYS B CB  
4958 N N   . ASN B 301 ? 2.6849 1.8993 2.8346 -0.3467 -0.3120 0.1794  571 ASN B N   
4959 C CA  . ASN B 301 ? 2.5949 1.8286 2.7696 -0.3275 -0.2483 0.2149  571 ASN B CA  
4960 C C   . ASN B 301 ? 2.6389 1.9040 2.7202 -0.3021 -0.2216 0.2169  571 ASN B C   
4961 O O   . ASN B 301 ? 2.5995 1.8844 2.6845 -0.2811 -0.1705 0.2403  571 ASN B O   
4962 C CB  . ASN B 301 ? 2.4859 1.6782 2.6724 -0.3171 -0.2082 0.2271  571 ASN B CB  
4963 C CG  . ASN B 301 ? 2.4768 1.6505 2.7954 -0.3433 -0.2054 0.2439  571 ASN B CG  
4964 O OD1 . ASN B 301 ? 2.4701 1.6806 2.8800 -0.3517 -0.1871 0.2702  571 ASN B OD1 
4965 N ND2 . ASN B 301 ? 2.5382 1.6555 2.8719 -0.3567 -0.2210 0.2273  571 ASN B ND2 
4966 N N   . SER B 302 ? 2.6869 1.9584 2.6856 -0.3048 -0.2549 0.1917  572 SER B N   
4967 C CA  . SER B 302 ? 2.5982 1.9010 2.5197 -0.2881 -0.2309 0.1905  572 SER B CA  
4968 C C   . SER B 302 ? 2.4893 1.8175 2.4494 -0.2987 -0.2454 0.2036  572 SER B C   
4969 O O   . SER B 302 ? 2.4059 1.7261 2.3847 -0.3172 -0.2938 0.1974  572 SER B O   
4970 C CB  . SER B 302 ? 2.5466 1.8428 2.3535 -0.2851 -0.2489 0.1573  572 SER B CB  
4971 O OG  . SER B 302 ? 2.5219 1.8211 2.2994 -0.3037 -0.2906 0.1467  572 SER B OG  
4972 N N   . PRO B 303 ? 2.4213 1.7796 2.3905 -0.2833 -0.2048 0.2205  573 PRO B N   
4973 C CA  . PRO B 303 ? 2.3210 1.6985 2.3196 -0.2880 -0.2142 0.2316  573 PRO B CA  
4974 C C   . PRO B 303 ? 2.2758 1.6460 2.1847 -0.2968 -0.2404 0.2140  573 PRO B C   
4975 O O   . PRO B 303 ? 2.2701 1.6363 2.1973 -0.3060 -0.2697 0.2219  573 PRO B O   
4976 C CB  . PRO B 303 ? 2.2932 1.7016 2.3077 -0.2652 -0.1584 0.2462  573 PRO B CB  
4977 N N   . GLU B 304 ? 2.3251 1.6946 2.1395 -0.2924 -0.2280 0.1921  574 GLU B N   
4978 C CA  . GLU B 304 ? 2.3388 1.7016 2.0656 -0.3046 -0.2479 0.1756  574 GLU B CA  
4979 C C   . GLU B 304 ? 2.3621 1.6974 2.0850 -0.3224 -0.3050 0.1737  574 GLU B C   
4980 O O   . GLU B 304 ? 2.3849 1.7099 2.0728 -0.3322 -0.3268 0.1785  574 GLU B O   
4981 C CB  . GLU B 304 ? 2.4099 1.7838 2.0463 -0.2977 -0.2278 0.1480  574 GLU B CB  
4982 C CG  . GLU B 304 ? 2.5352 1.9283 2.1837 -0.2726 -0.1867 0.1458  574 GLU B CG  
4983 C CD  . GLU B 304 ? 2.6238 2.0485 2.3006 -0.2576 -0.1451 0.1577  574 GLU B CD  
4984 O OE1 . GLU B 304 ? 2.6125 2.0484 2.2698 -0.2668 -0.1412 0.1543  574 GLU B OE1 
4985 O OE2 . GLU B 304 ? 2.6910 2.1270 2.4052 -0.2354 -0.1148 0.1697  574 GLU B OE2 
4986 N N   . ALA B 305 ? 2.4786 1.7993 2.2353 -0.3253 -0.3295 0.1663  575 ALA B N   
4987 C CA  . ALA B 305 ? 2.6536 1.9538 2.4119 -0.3397 -0.3884 0.1585  575 ALA B CA  
4988 C C   . ALA B 305 ? 2.5825 1.8877 2.4215 -0.3441 -0.4163 0.1813  575 ALA B C   
4989 O O   . ALA B 305 ? 2.5769 1.8707 2.3888 -0.3506 -0.4628 0.1801  575 ALA B O   
4990 C CB  . ALA B 305 ? 2.8009 2.0838 2.5895 -0.3428 -0.4066 0.1403  575 ALA B CB  
4991 N N   . TRP B 306 ? 2.4916 1.8162 2.4272 -0.3372 -0.3881 0.2022  576 TRP B N   
4992 C CA  . TRP B 306 ? 2.4821 1.8198 2.5053 -0.3372 -0.4117 0.2221  576 TRP B CA  
4993 C C   . TRP B 306 ? 2.4907 1.8283 2.4772 -0.3286 -0.4010 0.2375  576 TRP B C   
4994 O O   . TRP B 306 ? 2.5120 1.8459 2.5228 -0.3266 -0.4371 0.2495  576 TRP B O   
4995 C CB  . TRP B 306 ? 2.4498 1.8126 2.5969 -0.3335 -0.3828 0.2376  576 TRP B CB  
4996 C CG  . TRP B 306 ? 2.5799 1.9347 2.7816 -0.3470 -0.3980 0.2254  576 TRP B CG  
4997 C CD1 . TRP B 306 ? 2.6355 1.9827 2.8542 -0.3456 -0.3575 0.2260  576 TRP B CD1 
4998 C CD2 . TRP B 306 ? 2.6485 1.9973 2.8911 -0.3634 -0.4591 0.2088  576 TRP B CD2 
4999 N NE1 . TRP B 306 ? 2.6963 2.0267 2.9693 -0.3633 -0.3869 0.2118  576 TRP B NE1 
5000 C CE2 . TRP B 306 ? 2.7402 2.0751 3.0312 -0.3755 -0.4508 0.1977  576 TRP B CE2 
5001 C CE3 . TRP B 306 ? 2.5806 1.9335 2.8221 -0.3671 -0.5214 0.2016  576 TRP B CE3 
5002 C CZ2 . TRP B 306 ? 2.7764 2.1032 3.1214 -0.3950 -0.5029 0.1745  576 TRP B CZ2 
5003 C CZ3 . TRP B 306 ? 2.6320 1.9840 2.9224 -0.3825 -0.5756 0.1786  576 TRP B CZ3 
5004 C CH2 . TRP B 306 ? 2.7382 2.0783 3.0831 -0.3982 -0.5663 0.1627  576 TRP B CH2 
5005 N N   . CYS B 307 ? 2.5889 1.9294 2.5180 -0.3221 -0.3525 0.2355  577 CYS B N   
5006 C CA  . CYS B 307 ? 2.6116 1.9416 2.4870 -0.3197 -0.3410 0.2428  577 CYS B CA  
5007 C C   . CYS B 307 ? 2.6840 1.9822 2.4655 -0.3321 -0.3800 0.2377  577 CYS B C   
5008 O O   . CYS B 307 ? 2.7017 1.9778 2.4615 -0.3314 -0.3946 0.2534  577 CYS B O   
5009 C CB  . CYS B 307 ? 2.5979 1.9429 2.4280 -0.3138 -0.2843 0.2321  577 CYS B CB  
5010 N N   . ALA B 308 ? 2.7604 2.0534 2.4831 -0.3411 -0.3953 0.2167  578 ALA B N   
5011 C CA  . ALA B 308 ? 2.8650 2.1323 2.4909 -0.3512 -0.4305 0.2100  578 ALA B CA  
5012 C C   . ALA B 308 ? 2.9015 2.1543 2.5590 -0.3486 -0.4908 0.2235  578 ALA B C   
5013 O O   . ALA B 308 ? 2.9363 2.1633 2.5373 -0.3482 -0.5119 0.2391  578 ALA B O   
5014 C CB  . ALA B 308 ? 2.9277 2.1982 2.4931 -0.3568 -0.4337 0.1800  578 ALA B CB  
5015 N N   . ALA B 309 ? 2.9394 2.2090 2.6879 -0.3464 -0.5183 0.2173  579 ALA B N   
5016 C CA  . ALA B 309 ? 3.0652 2.3349 2.8630 -0.3419 -0.5791 0.2245  579 ALA B CA  
5017 C C   . ALA B 309 ? 3.0154 2.2884 2.8741 -0.3278 -0.5781 0.2546  579 ALA B C   
5018 O O   . ALA B 309 ? 3.0306 2.2926 2.8834 -0.3180 -0.6257 0.2671  579 ALA B O   
5019 C CB  . ALA B 309 ? 3.1668 2.4594 3.0644 -0.3475 -0.6028 0.2065  579 ALA B CB  
5020 N N   . GLY B 310 ? 2.9348 2.2233 2.8490 -0.3229 -0.5248 0.2649  580 GLY B N   
5021 C CA  . GLY B 310 ? 2.9159 2.2064 2.8851 -0.3068 -0.5161 0.2895  580 GLY B CA  
5022 C C   . GLY B 310 ? 2.9694 2.2156 2.8455 -0.3021 -0.5209 0.3062  580 GLY B C   
5023 O O   . GLY B 310 ? 3.0479 2.2805 2.9485 -0.2858 -0.5522 0.3264  580 GLY B O   
5024 N N   . ASN B 311 ? 2.8735 2.0968 2.6448 -0.3158 -0.4887 0.2983  581 ASN B N   
5025 C CA  . ASN B 311 ? 2.8083 1.9831 2.4805 -0.3189 -0.4889 0.3141  581 ASN B CA  
5026 C C   . ASN B 311 ? 2.8633 2.0105 2.4723 -0.3157 -0.5497 0.3243  581 ASN B C   
5027 O O   . ASN B 311 ? 2.8043 1.9115 2.3811 -0.3041 -0.5698 0.3511  581 ASN B O   
5028 C CB  . ASN B 311 ? 2.7564 1.9249 2.3380 -0.3391 -0.4408 0.2977  581 ASN B CB  
5029 N N   . CYS B 312 ? 2.9483 2.1136 2.5335 -0.3235 -0.5783 0.3019  582 CYS B N   
5030 C CA  . CYS B 312 ? 3.0683 2.2151 2.5838 -0.3190 -0.6380 0.3035  582 CYS B CA  
5031 C C   . CYS B 312 ? 3.1425 2.2839 2.7120 -0.2943 -0.6923 0.3266  582 CYS B C   
5032 O O   . CYS B 312 ? 3.2721 2.3740 2.7609 -0.2825 -0.7224 0.3496  582 CYS B O   
5033 C CB  . CYS B 312 ? 3.0624 2.2385 2.5821 -0.3276 -0.6639 0.2680  582 CYS B CB  
5034 S SG  . CYS B 312 ? 3.6901 2.8500 3.1112 -0.3206 -0.7376 0.2596  582 CYS B SG  
5035 N N   . PHE B 313 ? 3.1302 2.3134 2.8366 -0.2850 -0.7032 0.3213  583 PHE B N   
5036 C CA  . PHE B 313 ? 3.2106 2.4066 2.9918 -0.2595 -0.7577 0.3360  583 PHE B CA  
5037 C C   . PHE B 313 ? 3.1568 2.3229 2.9522 -0.2389 -0.7382 0.3702  583 PHE B C   
5038 O O   . PHE B 313 ? 3.2101 2.3717 3.0342 -0.2112 -0.7842 0.3890  583 PHE B O   
5039 C CB  . PHE B 313 ? 3.1664 2.4255 3.0996 -0.2610 -0.7715 0.3150  583 PHE B CB  
5040 N N   . SER B 314 ? 3.0157 2.1619 2.7913 -0.2505 -0.6717 0.3752  584 SER B N   
5041 C CA  . SER B 314 ? 2.9871 2.0923 2.7596 -0.2349 -0.6469 0.4029  584 SER B CA  
5042 C C   . SER B 314 ? 3.1774 2.2121 2.8214 -0.2289 -0.6701 0.4305  584 SER B C   
5043 O O   . SER B 314 ? 3.2874 2.2860 2.9355 -0.2013 -0.6945 0.4594  584 SER B O   
5044 C CB  . SER B 314 ? 2.8498 1.9530 2.6232 -0.2521 -0.5718 0.3936  584 SER B CB  
5045 O OG  . SER B 314 ? 2.8154 1.8688 2.5723 -0.2407 -0.5477 0.4156  584 SER B OG  
5046 N N   . LEU B 315 ? 3.2417 2.2560 2.7700 -0.2533 -0.6595 0.4226  585 LEU B N   
5047 C CA  . LEU B 315 ? 3.3897 2.3407 2.7823 -0.2515 -0.6787 0.4490  585 LEU B CA  
5048 C C   . LEU B 315 ? 3.4830 2.4316 2.8674 -0.2191 -0.7576 0.4646  585 LEU B C   
5049 O O   . LEU B 315 ? 3.5049 2.3950 2.8276 -0.1969 -0.7784 0.5019  585 LEU B O   
5050 C CB  . LEU B 315 ? 3.3803 2.3320 2.6653 -0.2826 -0.6559 0.4295  585 LEU B CB  
5051 C CG  . LEU B 315 ? 3.3626 2.2743 2.5728 -0.3101 -0.5881 0.4363  585 LEU B CG  
5052 C CD1 . LEU B 315 ? 3.4219 2.3432 2.5262 -0.3365 -0.5722 0.4165  585 LEU B CD1 
5053 C CD2 . LEU B 315 ? 3.3779 2.2089 2.5301 -0.2999 -0.5848 0.4812  585 LEU B CD2 
5054 N N   . GLN B 316 ? 3.5570 2.5678 3.0034 -0.2157 -0.8022 0.4351  586 GLN B N   
5055 C CA  . GLN B 316 ? 3.6667 2.6920 3.1189 -0.1851 -0.8834 0.4392  586 GLN B CA  
5056 C C   . GLN B 316 ? 3.6506 2.6830 3.2061 -0.1480 -0.9122 0.4610  586 GLN B C   
5057 O O   . GLN B 316 ? 3.6996 2.7545 3.2797 -0.1174 -0.9827 0.4628  586 GLN B O   
5058 C CB  . GLN B 316 ? 3.7008 2.7945 3.2119 -0.1964 -0.9200 0.3941  586 GLN B CB  
5059 N N   . ARG B 317 ? 3.5200 2.5394 3.1388 -0.1490 -0.8583 0.4728  587 ARG B N   
5060 C CA  . ARG B 317 ? 3.4398 2.4644 3.1602 -0.1131 -0.8724 0.4915  587 ARG B CA  
5061 C C   . ARG B 317 ? 3.4190 2.5350 3.2949 -0.1005 -0.9128 0.4649  587 ARG B C   
5062 O O   . ARG B 317 ? 3.5066 2.6429 3.4468 -0.0622 -0.9644 0.4755  587 ARG B O   
5063 C CB  . ARG B 317 ? 3.5428 2.5001 3.1771 -0.0746 -0.9162 0.5333  587 ARG B CB  
5064 N N   . GLU B 318 ? 3.3022 2.4731 3.2390 -0.1330 -0.8883 0.4301  588 GLU B N   
5065 C CA  . GLU B 318 ? 3.2164 2.4724 3.3158 -0.1315 -0.9057 0.4050  588 GLU B CA  
5066 C C   . GLU B 318 ? 3.1146 2.3915 3.2994 -0.1460 -0.8302 0.4005  588 GLU B C   
5067 O O   . GLU B 318 ? 3.0933 2.3880 3.2829 -0.1779 -0.7899 0.3796  588 GLU B O   
5068 C CB  . GLU B 318 ? 3.2256 2.5237 3.3319 -0.1562 -0.9400 0.3689  588 GLU B CB  
5069 N N   . HIS B 319 ? 3.0881 2.3633 3.3378 -0.1185 -0.8127 0.4194  589 HIS B N   
5070 C CA  . HIS B 319 ? 3.0962 2.3874 3.4138 -0.1253 -0.7400 0.4165  589 HIS B CA  
5071 C C   . HIS B 319 ? 3.1320 2.5078 3.5870 -0.1407 -0.7258 0.3922  589 HIS B C   
5072 O O   . HIS B 319 ? 3.0360 2.4240 3.5030 -0.1627 -0.6664 0.3818  589 HIS B O   
5073 C CB  . HIS B 319 ? 3.0581 2.3296 3.4173 -0.0873 -0.7320 0.4385  589 HIS B CB  
5074 N N   . ASP B 320 ? 3.1923 2.6259 3.7474 -0.1294 -0.7819 0.3831  590 ASP B N   
5075 C CA  . ASP B 320 ? 3.1545 2.6684 3.8508 -0.1468 -0.7766 0.3610  590 ASP B CA  
5076 C C   . ASP B 320 ? 3.1601 2.6709 3.8156 -0.1876 -0.7645 0.3391  590 ASP B C   
5077 O O   . ASP B 320 ? 3.1294 2.6709 3.8525 -0.2087 -0.7147 0.3300  590 ASP B O   
5078 C CB  . ASP B 320 ? 3.1589 2.7335 3.9637 -0.1248 -0.8495 0.3533  590 ASP B CB  
5079 C CG  . ASP B 320 ? 3.1225 2.7248 4.0181 -0.0834 -0.8472 0.3700  590 ASP B CG  
5080 O OD1 . ASP B 320 ? 3.1117 2.6601 3.9447 -0.0643 -0.8101 0.3914  590 ASP B OD1 
5081 O OD2 . ASP B 320 ? 3.1575 2.8259 4.1652 -0.0636 -0.9014 0.3607  590 ASP B OD2 
5082 N N   . ILE B 321 ? 3.1650 2.6336 3.7017 -0.1956 -0.8057 0.3325  591 ILE B N   
5083 C CA  . ILE B 321 ? 3.0304 2.4906 3.5179 -0.2299 -0.7991 0.3085  591 ILE B CA  
5084 C C   . ILE B 321 ? 2.8214 2.2411 3.2254 -0.2449 -0.7242 0.3149  591 ILE B C   
5085 O O   . ILE B 321 ? 2.7368 2.1635 3.1453 -0.2692 -0.6917 0.2985  591 ILE B O   
5086 C CB  . ILE B 321 ? 3.0823 2.5122 3.4586 -0.2303 -0.8644 0.2969  591 ILE B CB  
5087 N N   . ALA B 322 ? 2.7796 2.1560 3.1084 -0.2288 -0.6989 0.3375  592 ALA B N   
5088 C CA  . ALA B 322 ? 2.7567 2.1010 3.0118 -0.2402 -0.6304 0.3407  592 ALA B CA  
5089 C C   . ALA B 322 ? 2.8438 2.2300 3.1980 -0.2428 -0.5699 0.3376  592 ALA B C   
5090 O O   . ALA B 322 ? 2.9085 2.2962 3.2357 -0.2608 -0.5278 0.3257  592 ALA B O   
5091 C CB  . ALA B 322 ? 2.7318 2.0214 2.9046 -0.2237 -0.6196 0.3637  592 ALA B CB  
5092 N N   . ILE B 323 ? 2.8048 2.2261 3.2698 -0.2213 -0.5653 0.3489  593 ILE B N   
5093 C CA  . ILE B 323 ? 2.7484 2.2143 3.3097 -0.2195 -0.5065 0.3489  593 ILE B CA  
5094 C C   . ILE B 323 ? 2.6262 2.1362 3.2698 -0.2418 -0.5026 0.3358  593 ILE B C   
5095 O O   . ILE B 323 ? 2.4897 2.0192 3.1656 -0.2482 -0.4452 0.3360  593 ILE B O   
5096 C CB  . ILE B 323 ? 2.8470 2.3455 3.5127 -0.1880 -0.5046 0.3624  593 ILE B CB  
5097 C CG1 . ILE B 323 ? 2.8337 2.3815 3.6120 -0.1802 -0.5650 0.3604  593 ILE B CG1 
5098 C CG2 . ILE B 323 ? 2.8447 2.2866 3.4289 -0.1655 -0.5087 0.3759  593 ILE B CG2 
5099 C CD1 . ILE B 323 ? 2.7672 2.3913 3.6967 -0.1907 -0.5426 0.3533  593 ILE B CD1 
5100 N N   . LYS B 324 ? 2.7089 2.2320 3.3852 -0.2524 -0.5636 0.3242  594 LYS B N   
5101 C CA  . LYS B 324 ? 2.7286 2.2820 3.4792 -0.2787 -0.5667 0.3077  594 LYS B CA  
5102 C C   . LYS B 324 ? 2.7556 2.2718 3.4138 -0.2978 -0.5249 0.2997  594 LYS B C   
5103 O O   . LYS B 324 ? 2.8237 2.3564 3.5360 -0.3102 -0.4806 0.2995  594 LYS B O   
5104 C CB  . LYS B 324 ? 2.7424 2.3060 3.5142 -0.2873 -0.6471 0.2885  594 LYS B CB  
5105 N N   . PHE B 325 ? 2.6274 2.0937 3.1446 -0.2980 -0.5383 0.2945  595 PHE B N   
5106 C CA  . PHE B 325 ? 2.5418 1.9757 2.9605 -0.3122 -0.5073 0.2825  595 PHE B CA  
5107 C C   . PHE B 325 ? 2.4344 1.8674 2.8266 -0.3031 -0.4339 0.2933  595 PHE B C   
5108 O O   . PHE B 325 ? 2.3935 1.8281 2.7824 -0.3104 -0.3950 0.2880  595 PHE B O   
5109 C CB  . PHE B 325 ? 2.6268 2.0165 2.9066 -0.3149 -0.5433 0.2728  595 PHE B CB  
5110 N N   . PHE B 326 ? 2.4977 1.9257 2.8674 -0.2852 -0.4166 0.3068  596 PHE B N   
5111 C CA  . PHE B 326 ? 2.5515 1.9854 2.9023 -0.2741 -0.3506 0.3116  596 PHE B CA  
5112 C C   . PHE B 326 ? 2.5403 2.0171 2.9939 -0.2689 -0.3054 0.3194  596 PHE B C   
5113 O O   . PHE B 326 ? 2.5063 1.9866 2.9266 -0.2645 -0.2541 0.3177  596 PHE B O   
5114 C CB  . PHE B 326 ? 2.5537 1.9760 2.8900 -0.2552 -0.3443 0.3223  596 PHE B CB  
5115 N N   . GLN B 327 ? 2.4915 2.0040 3.0688 -0.2683 -0.3229 0.3282  597 GLN B N   
5116 C CA  . GLN B 327 ? 2.4458 1.9995 3.1251 -0.2675 -0.2767 0.3388  597 GLN B CA  
5117 C C   . GLN B 327 ? 2.3730 1.9127 3.0436 -0.2890 -0.2665 0.3326  597 GLN B C   
5118 O O   . GLN B 327 ? 2.3459 1.8956 3.0327 -0.2850 -0.2108 0.3432  597 GLN B O   
5119 C CB  . GLN B 327 ? 2.5320 2.1355 3.3576 -0.2646 -0.2958 0.3477  597 GLN B CB  
5120 C CG  . GLN B 327 ? 2.6008 2.2276 3.4604 -0.2348 -0.2829 0.3578  597 GLN B CG  
5121 C CD  . GLN B 327 ? 2.6402 2.3198 3.6405 -0.2287 -0.3141 0.3622  597 GLN B CD  
5122 O OE1 . GLN B 327 ? 2.6357 2.3324 3.7005 -0.2490 -0.3578 0.3543  597 GLN B OE1 
5123 N NE2 . GLN B 327 ? 2.6604 2.3707 3.7145 -0.1995 -0.2919 0.3711  597 GLN B NE2 
5124 N N   . ARG B 328 ? 2.3349 1.8482 2.9752 -0.3089 -0.3204 0.3154  598 ARG B N   
5125 C CA  . ARG B 328 ? 2.3419 1.8305 2.9619 -0.3276 -0.3155 0.3046  598 ARG B CA  
5126 C C   . ARG B 328 ? 2.4132 1.8723 2.9115 -0.3169 -0.2743 0.3012  598 ARG B C   
5127 O O   . ARG B 328 ? 2.5188 1.9661 3.0146 -0.3189 -0.2396 0.3040  598 ARG B O   
5128 C CB  . ARG B 328 ? 2.2974 1.7641 2.8989 -0.3474 -0.3861 0.2803  598 ARG B CB  
5129 N N   . ALA B 329 ? 2.3042 1.7509 2.7035 -0.3054 -0.2785 0.2948  599 ALA B N   
5130 C CA  . ALA B 329 ? 2.2540 1.6859 2.5467 -0.2944 -0.2396 0.2874  599 ALA B CA  
5131 C C   . ALA B 329 ? 2.3304 1.7898 2.6628 -0.2749 -0.1751 0.3049  599 ALA B C   
5132 O O   . ALA B 329 ? 2.4146 1.8678 2.7118 -0.2669 -0.1394 0.3050  599 ALA B O   
5133 C CB  . ALA B 329 ? 2.2513 1.6714 2.4515 -0.2896 -0.2505 0.2783  599 ALA B CB  
5134 N N   . ILE B 330 ? 2.2972 1.7873 2.7003 -0.2635 -0.1616 0.3197  600 ILE B N   
5135 C CA  . ILE B 330 ? 2.1887 1.7124 2.6419 -0.2429 -0.1018 0.3376  600 ILE B CA  
5136 C C   . ILE B 330 ? 2.2057 1.7358 2.7385 -0.2517 -0.0795 0.3549  600 ILE B C   
5137 O O   . ILE B 330 ? 2.2455 1.7833 2.7689 -0.2357 -0.0254 0.3687  600 ILE B O   
5138 C CB  . ILE B 330 ? 2.1531 1.7100 2.6802 -0.2292 -0.0981 0.3473  600 ILE B CB  
5139 N N   . GLN B 331 ? 2.1772 1.7033 2.7885 -0.2770 -0.1214 0.3538  601 GLN B N   
5140 C CA  . GLN B 331 ? 2.1541 1.6804 2.8536 -0.2938 -0.1043 0.3676  601 GLN B CA  
5141 C C   . GLN B 331 ? 2.2409 1.7219 2.8589 -0.2940 -0.0847 0.3643  601 GLN B C   
5142 O O   . GLN B 331 ? 2.3600 1.8358 3.0081 -0.2901 -0.0360 0.3859  601 GLN B O   
5143 C CB  . GLN B 331 ? 2.1292 1.6599 2.9218 -0.3236 -0.1635 0.3563  601 GLN B CB  
5144 N N   . VAL B 332 ? 2.2937 1.7414 2.8069 -0.2964 -0.1212 0.3385  602 VAL B N   
5145 C CA  . VAL B 332 ? 2.3222 1.7274 2.7563 -0.2937 -0.1107 0.3297  602 VAL B CA  
5146 C C   . VAL B 332 ? 2.3467 1.7600 2.6996 -0.2598 -0.0547 0.3390  602 VAL B C   
5147 O O   . VAL B 332 ? 2.4689 1.8579 2.7922 -0.2476 -0.0223 0.3483  602 VAL B O   
5148 C CB  . VAL B 332 ? 2.3733 1.7485 2.7203 -0.3050 -0.1666 0.2958  602 VAL B CB  
5149 N N   . ASP B 333 ? 2.2580 1.7040 2.5744 -0.2429 -0.0449 0.3351  603 ASP B N   
5150 C CA  . ASP B 333 ? 2.2134 1.6789 2.4620 -0.2094 0.0056  0.3387  603 ASP B CA  
5151 C C   . ASP B 333 ? 2.2063 1.7158 2.4870 -0.1939 0.0288  0.3459  603 ASP B C   
5152 O O   . ASP B 333 ? 2.2026 1.7205 2.4394 -0.1931 0.0101  0.3262  603 ASP B O   
5153 C CB  . ASP B 333 ? 2.2353 1.6889 2.3610 -0.2015 -0.0089 0.3082  603 ASP B CB  
5154 N N   . PRO B 334 ? 2.3080 1.8435 2.6667 -0.1820 0.0716  0.3740  604 PRO B N   
5155 C CA  . PRO B 334 ? 2.3216 1.9010 2.7133 -0.1628 0.0964  0.3782  604 PRO B CA  
5156 C C   . PRO B 334 ? 2.4347 2.0322 2.7284 -0.1317 0.1239  0.3599  604 PRO B C   
5157 O O   . PRO B 334 ? 2.3850 2.0120 2.6911 -0.1169 0.1364  0.3528  604 PRO B O   
5158 C CB  . PRO B 334 ? 2.3385 1.9420 2.8235 -0.1552 0.1443  0.4130  604 PRO B CB  
5159 N N   . ASN B 335 ? 2.5706 2.1525 2.7714 -0.1208 0.1314  0.3486  605 ASN B N   
5160 C CA  . ASN B 335 ? 2.5345 2.1396 2.6426 -0.0945 0.1488  0.3227  605 ASN B CA  
5161 C C   . ASN B 335 ? 2.4983 2.0853 2.5349 -0.1139 0.1064  0.2881  605 ASN B C   
5162 O O   . ASN B 335 ? 2.5405 2.1363 2.4913 -0.1001 0.1128  0.2648  605 ASN B O   
5163 C CB  . ASN B 335 ? 2.5502 2.1633 2.6003 -0.0604 0.1904  0.3322  605 ASN B CB  
5164 N N   . TYR B 336 ? 2.4752 2.0407 2.5482 -0.1445 0.0640  0.2852  606 TYR B N   
5165 C CA  . TYR B 336 ? 2.4864 2.0310 2.4950 -0.1662 0.0251  0.2583  606 TYR B CA  
5166 C C   . TYR B 336 ? 2.5486 2.0961 2.5786 -0.1730 0.0140  0.2520  606 TYR B C   
5167 O O   . TYR B 336 ? 2.5707 2.0984 2.6534 -0.1905 -0.0190 0.2642  606 TYR B O   
5168 C CB  . TYR B 336 ? 2.4534 1.9597 2.4704 -0.1939 -0.0195 0.2621  606 TYR B CB  
5169 N N   . ALA B 337 ? 2.5523 2.1238 2.5412 -0.1570 0.0405  0.2311  607 ALA B N   
5170 C CA  . ALA B 337 ? 2.5441 2.1152 2.5549 -0.1573 0.0398  0.2233  607 ALA B CA  
5171 C C   . ALA B 337 ? 2.5553 2.0830 2.5574 -0.1871 -0.0050 0.2225  607 ALA B C   
5172 O O   . ALA B 337 ? 2.5287 2.0424 2.5834 -0.1871 -0.0176 0.2339  607 ALA B O   
5173 C CB  . ALA B 337 ? 2.5273 2.1269 2.4808 -0.1412 0.0703  0.1907  607 ALA B CB  
5174 N N   . TYR B 338 ? 2.5810 2.0880 2.5131 -0.2088 -0.0278 0.2098  608 TYR B N   
5175 C CA  . TYR B 338 ? 2.6404 2.1054 2.5415 -0.2353 -0.0647 0.2088  608 TYR B CA  
5176 C C   . TYR B 338 ? 2.6753 2.1131 2.6368 -0.2430 -0.1059 0.2364  608 TYR B C   
5177 O O   . TYR B 338 ? 2.6505 2.0533 2.6031 -0.2542 -0.1335 0.2431  608 TYR B O   
5178 C CB  . TYR B 338 ? 2.6803 2.1371 2.4938 -0.2548 -0.0768 0.1900  608 TYR B CB  
5179 C CG  . TYR B 338 ? 2.7084 2.1251 2.4706 -0.2816 -0.1026 0.1872  608 TYR B CG  
5180 C CD1 . TYR B 338 ? 2.7166 2.1175 2.4703 -0.2872 -0.0893 0.1805  608 TYR B CD1 
5181 C CD2 . TYR B 338 ? 2.7354 2.1263 2.4546 -0.3005 -0.1385 0.1916  608 TYR B CD2 
5182 C CE1 . TYR B 338 ? 2.7919 2.1476 2.4951 -0.3124 -0.1082 0.1837  608 TYR B CE1 
5183 C CE2 . TYR B 338 ? 2.7646 2.1173 2.4281 -0.3231 -0.1583 0.1938  608 TYR B CE2 
5184 C CZ  . TYR B 338 ? 2.7479 2.0807 2.4033 -0.3296 -0.1416 0.1927  608 TYR B CZ  
5185 O OH  . TYR B 338 ? 2.6492 1.9356 2.2459 -0.3529 -0.1569 0.2005  608 TYR B OH  
5186 N N   . ALA B 339 ? 2.7315 2.1852 2.7555 -0.2363 -0.1099 0.2522  609 ALA B N   
5187 C CA  . ALA B 339 ? 2.7868 2.2292 2.8858 -0.2421 -0.1488 0.2734  609 ALA B CA  
5188 C C   . ALA B 339 ? 2.7972 2.2528 2.9778 -0.2245 -0.1405 0.2873  609 ALA B C   
5189 O O   . ALA B 339 ? 2.7957 2.2357 3.0177 -0.2266 -0.1785 0.2998  609 ALA B O   
5190 C CB  . ALA B 339 ? 2.8327 2.2896 2.9830 -0.2448 -0.1516 0.2821  609 ALA B CB  
5191 N N   . TYR B 340 ? 2.7973 2.2842 2.9985 -0.2030 -0.0918 0.2835  610 TYR B N   
5192 C CA  . TYR B 340 ? 2.7090 2.2120 2.9819 -0.1816 -0.0775 0.2913  610 TYR B CA  
5193 C C   . TYR B 340 ? 2.6364 2.0990 2.8711 -0.1834 -0.0955 0.2833  610 TYR B C   
5194 O O   . TYR B 340 ? 2.6662 2.1185 2.9588 -0.1730 -0.1162 0.2959  610 TYR B O   
5195 C CB  . TYR B 340 ? 2.7358 2.2814 3.0193 -0.1561 -0.0189 0.2842  610 TYR B CB  
5196 C CG  . TYR B 340 ? 2.7179 2.2995 3.0576 -0.1491 0.0058  0.3024  610 TYR B CG  
5197 C CD1 . TYR B 340 ? 2.7056 2.2947 3.1373 -0.1591 -0.0170 0.3245  610 TYR B CD1 
5198 C CD2 . TYR B 340 ? 2.7343 2.3409 3.0341 -0.1328 0.0516  0.2974  610 TYR B CD2 
5199 C CE1 . TYR B 340 ? 2.7621 2.3778 3.2496 -0.1580 0.0098  0.3425  610 TYR B CE1 
5200 C CE2 . TYR B 340 ? 2.7822 2.4111 3.1273 -0.1265 0.0782  0.3196  610 TYR B CE2 
5201 C CZ  . TYR B 340 ? 2.8305 2.4610 3.2713 -0.1418 0.0593  0.3428  610 TYR B CZ  
5202 O OH  . TYR B 340 ? 2.9069 2.5539 3.3979 -0.1404 0.0900  0.3662  610 TYR B OH  
5203 N N   . THR B 341 ? 2.6126 2.0521 2.7526 -0.1962 -0.0864 0.2624  611 THR B N   
5204 C CA  . THR B 341 ? 2.5268 1.9186 2.6235 -0.2036 -0.0973 0.2553  611 THR B CA  
5205 C C   . THR B 341 ? 2.4823 1.8234 2.5576 -0.2205 -0.1499 0.2747  611 THR B C   
5206 O O   . THR B 341 ? 2.4310 1.7289 2.5066 -0.2163 -0.1655 0.2837  611 THR B O   
5207 C CB  . THR B 341 ? 2.5815 1.9682 2.5875 -0.2188 -0.0715 0.2253  611 THR B CB  
5208 O OG1 . THR B 341 ? 2.5454 1.9470 2.4991 -0.2349 -0.0769 0.2195  611 THR B OG1 
5209 C CG2 . THR B 341 ? 2.6549 2.0823 2.6764 -0.1962 -0.0238 0.2011  611 THR B CG2 
5210 N N   . LEU B 342 ? 2.5182 1.8620 2.5712 -0.2367 -0.1778 0.2807  612 LEU B N   
5211 C CA  . LEU B 342 ? 2.5434 1.8464 2.5704 -0.2491 -0.2310 0.2973  612 LEU B CA  
5212 C C   . LEU B 342 ? 2.5558 1.8671 2.6785 -0.2305 -0.2656 0.3190  612 LEU B C   
5213 O O   . LEU B 342 ? 2.6099 1.8827 2.7211 -0.2272 -0.3062 0.3350  612 LEU B O   
5214 C CB  . LEU B 342 ? 2.6518 1.9593 2.6253 -0.2696 -0.2505 0.2902  612 LEU B CB  
5215 C CG  . LEU B 342 ? 2.6867 1.9766 2.5501 -0.2907 -0.2327 0.2711  612 LEU B CG  
5216 C CD1 . LEU B 342 ? 2.7379 2.0441 2.5625 -0.3030 -0.2447 0.2591  612 LEU B CD1 
5217 C CD2 . LEU B 342 ? 2.6768 1.9090 2.4722 -0.3038 -0.2529 0.2819  612 LEU B CD2 
5218 N N   . LEU B 343 ? 2.5321 1.8962 2.7494 -0.2170 -0.2487 0.3202  613 LEU B N   
5219 C CA  . LEU B 343 ? 2.5284 1.9166 2.8557 -0.1978 -0.2725 0.3364  613 LEU B CA  
5220 C C   . LEU B 343 ? 2.6110 1.9768 2.9546 -0.1739 -0.2635 0.3414  613 LEU B C   
5221 O O   . LEU B 343 ? 2.7189 2.0675 3.0980 -0.1590 -0.3032 0.3564  613 LEU B O   
5222 C CB  . LEU B 343 ? 2.4579 1.9092 2.8833 -0.1910 -0.2423 0.3369  613 LEU B CB  
5223 N N   . GLY B 344 ? 2.5676 1.9345 2.8858 -0.1676 -0.2126 0.3262  614 GLY B N   
5224 C CA  . GLY B 344 ? 2.5450 1.8848 2.8722 -0.1460 -0.1977 0.3236  614 GLY B CA  
5225 C C   . GLY B 344 ? 2.5731 1.8370 2.8393 -0.1509 -0.2360 0.3362  614 GLY B C   
5226 O O   . GLY B 344 ? 2.6269 1.8707 2.9407 -0.1263 -0.2606 0.3513  614 GLY B O   
5227 N N   . HIS B 345 ? 2.5264 1.7484 2.6864 -0.1805 -0.2392 0.3315  615 HIS B N   
5228 C CA  . HIS B 345 ? 2.6149 1.7592 2.7029 -0.1885 -0.2705 0.3485  615 HIS B CA  
5229 C C   . HIS B 345 ? 2.6254 1.7622 2.7447 -0.1739 -0.3315 0.3759  615 HIS B C   
5230 O O   . HIS B 345 ? 2.6521 1.7335 2.7591 -0.1572 -0.3590 0.3967  615 HIS B O   
5231 C CB  . HIS B 345 ? 2.6587 1.7753 2.6328 -0.2257 -0.2624 0.3393  615 HIS B CB  
5232 N N   . GLU B 346 ? 2.6956 1.8858 2.8526 -0.1798 -0.3543 0.3747  616 GLU B N   
5233 C CA  . GLU B 346 ? 2.8734 2.0701 3.0687 -0.1670 -0.4162 0.3930  616 GLU B CA  
5234 C C   . GLU B 346 ? 2.8982 2.1225 3.2106 -0.1293 -0.4287 0.4026  616 GLU B C   
5235 O O   . GLU B 346 ? 2.8365 2.0488 3.1708 -0.1084 -0.4817 0.4202  616 GLU B O   
5236 C CB  . GLU B 346 ? 2.8880 2.1376 3.1077 -0.1854 -0.4343 0.3822  616 GLU B CB  
5237 N N   . PHE B 347 ? 2.9172 2.1822 3.3022 -0.1173 -0.3799 0.3899  617 PHE B N   
5238 C CA  . PHE B 347 ? 2.8697 2.1638 3.3646 -0.0791 -0.3811 0.3953  617 PHE B CA  
5239 C C   . PHE B 347 ? 2.8960 2.1189 3.3574 -0.0539 -0.3811 0.4043  617 PHE B C   
5240 O O   . PHE B 347 ? 2.9176 2.1403 3.4434 -0.0181 -0.4117 0.4173  617 PHE B O   
5241 C CB  . PHE B 347 ? 2.7810 2.1450 3.3582 -0.0733 -0.3241 0.3787  617 PHE B CB  
5242 N N   . VAL B 348 ? 2.8816 2.0443 3.2473 -0.0718 -0.3469 0.3959  618 VAL B N   
5243 C CA  . VAL B 348 ? 2.9758 2.0585 3.3076 -0.0527 -0.3429 0.4032  618 VAL B CA  
5244 C C   . VAL B 348 ? 3.1680 2.1848 3.4463 -0.0445 -0.4025 0.4358  618 VAL B C   
5245 O O   . VAL B 348 ? 3.2078 2.1779 3.5062 -0.0091 -0.4228 0.4525  618 VAL B O   
5246 C CB  . VAL B 348 ? 3.0344 2.0683 3.2809 -0.0798 -0.2918 0.3824  618 VAL B CB  
5247 C CG1 . VAL B 348 ? 2.9341 2.0429 3.2185 -0.0869 -0.2393 0.3499  618 VAL B CG1 
5248 C CG2 . VAL B 348 ? 3.0551 2.0344 3.1797 -0.1200 -0.3022 0.3912  618 VAL B CG2 
5249 N N   . LEU B 349 ? 3.2803 2.2900 3.4835 -0.0737 -0.4295 0.4447  619 LEU B N   
5250 C CA  . LEU B 349 ? 3.3594 2.3157 3.5038 -0.0633 -0.4888 0.4760  619 LEU B CA  
5251 C C   . LEU B 349 ? 3.3431 2.3383 3.5894 -0.0175 -0.5404 0.4889  619 LEU B C   
5252 O O   . LEU B 349 ? 3.3098 2.2462 3.5314 0.0142  -0.5789 0.5159  619 LEU B O   
5253 C CB  . LEU B 349 ? 3.2650 2.2343 3.3325 -0.0980 -0.5111 0.4754  619 LEU B CB  
5254 N N   . THR B 350 ? 3.3226 2.4178 3.6843 -0.0136 -0.5406 0.4704  620 THR B N   
5255 C CA  . THR B 350 ? 3.3061 2.4578 3.7863 0.0273  -0.5848 0.4761  620 THR B CA  
5256 C C   . THR B 350 ? 3.1839 2.3475 3.7555 0.0651  -0.5531 0.4706  620 THR B C   
5257 O O   . THR B 350 ? 3.1859 2.4197 3.8807 0.0975  -0.5740 0.4677  620 THR B O   
5258 C CB  . THR B 350 ? 3.2737 2.5299 3.8486 0.0113  -0.5999 0.4585  620 THR B CB  
5259 O OG1 . THR B 350 ? 3.2079 2.5051 3.8068 -0.0177 -0.5359 0.4369  620 THR B OG1 
5260 C CG2 . THR B 350 ? 3.3244 2.5705 3.8242 -0.0119 -0.6519 0.4628  620 THR B CG2 
5261 N N   . GLU B 351 ? 3.1929 2.2904 3.7062 0.0611  -0.5037 0.4662  621 GLU B N   
5262 C CA  . GLU B 351 ? 3.0916 2.1918 3.6775 0.0961  -0.4678 0.4546  621 GLU B CA  
5263 C C   . GLU B 351 ? 2.9881 2.2060 3.7189 0.1120  -0.4468 0.4349  621 GLU B C   
5264 O O   . GLU B 351 ? 2.9835 2.2313 3.8107 0.1573  -0.4543 0.4344  621 GLU B O   
5265 C CB  . GLU B 351 ? 3.2351 2.2665 3.8207 0.1450  -0.5085 0.4787  621 GLU B CB  
5266 N N   . GLU B 352 ? 2.9750 2.2576 3.7192 0.0756  -0.4178 0.4197  622 GLU B N   
5267 C CA  . GLU B 352 ? 2.9380 2.3259 3.8076 0.0840  -0.3844 0.4040  622 GLU B CA  
5268 C C   . GLU B 352 ? 2.8374 2.2322 3.6788 0.0699  -0.3110 0.3821  622 GLU B C   
5269 O O   . GLU B 352 ? 2.7633 2.2000 3.5951 0.0387  -0.2824 0.3738  622 GLU B O   
5270 C CB  . GLU B 352 ? 2.9222 2.3827 3.8432 0.0569  -0.4098 0.4060  622 GLU B CB  
5271 N N   . LEU B 353 ? 2.8374 2.1888 3.6645 0.0962  -0.2828 0.3713  623 LEU B N   
5272 C CA  . LEU B 353 ? 2.7932 2.1260 3.5588 0.0822  -0.2233 0.3468  623 LEU B CA  
5273 C C   . LEU B 353 ? 2.7072 2.1356 3.5470 0.0892  -0.1691 0.3291  623 LEU B C   
5274 O O   . LEU B 353 ? 2.6394 2.0759 3.4235 0.0687  -0.1256 0.3114  623 LEU B O   
5275 C CB  . LEU B 353 ? 2.8817 2.1349 3.6148 0.1084  -0.2126 0.3362  623 LEU B CB  
5276 N N   . ASP B 354 ? 2.7655 2.2686 3.7297 0.1197  -0.1701 0.3342  624 ASP B N   
5277 C CA  . ASP B 354 ? 2.7523 2.3488 3.7879 0.1246  -0.1157 0.3241  624 ASP B CA  
5278 C C   . ASP B 354 ? 2.8649 2.4908 3.8704 0.0807  -0.1078 0.3322  624 ASP B C   
5279 O O   . ASP B 354 ? 2.8798 2.5380 3.8632 0.0727  -0.0553 0.3219  624 ASP B O   
5280 C CB  . ASP B 354 ? 2.6778 2.3558 3.8614 0.1593  -0.1210 0.3312  624 ASP B CB  
5281 N N   . LYS B 355 ? 2.9651 2.5783 3.9673 0.0560  -0.1614 0.3497  625 LYS B N   
5282 C CA  . LYS B 355 ? 3.0174 2.6471 3.9882 0.0150  -0.1603 0.3553  625 LYS B CA  
5283 C C   . LYS B 355 ? 2.9887 2.5538 3.8176 -0.0112 -0.1474 0.3446  625 LYS B C   
5284 O O   . LYS B 355 ? 3.0293 2.6138 3.8215 -0.0328 -0.1162 0.3399  625 LYS B O   
5285 C CB  . LYS B 355 ? 3.0401 2.6769 4.0499 -0.0019 -0.2249 0.3705  625 LYS B CB  
5286 C CG  . LYS B 355 ? 2.9706 2.6868 4.1345 0.0195  -0.2396 0.3770  625 LYS B CG  
5287 C CD  . LYS B 355 ? 2.9931 2.7281 4.1988 -0.0027 -0.3020 0.3847  625 LYS B CD  
5288 C CE  . LYS B 355 ? 2.9810 2.8125 4.3561 0.0113  -0.3093 0.3861  625 LYS B CE  
5289 N NZ  . LYS B 355 ? 3.0081 2.8649 4.4331 -0.0113 -0.3739 0.3866  625 LYS B NZ  
5290 N N   . ALA B 356 ? 2.8691 2.3572 3.6210 -0.0083 -0.1706 0.3414  626 ALA B N   
5291 C CA  . ALA B 356 ? 2.7583 2.1870 3.3827 -0.0347 -0.1580 0.3287  626 ALA B CA  
5292 C C   . ALA B 356 ? 2.6616 2.1091 3.2580 -0.0280 -0.0957 0.3024  626 ALA B C   
5293 O O   . ALA B 356 ? 2.6090 2.0543 3.1294 -0.0522 -0.0751 0.2900  626 ALA B O   
5294 C CB  . ALA B 356 ? 2.8655 2.2051 3.4246 -0.0333 -0.1924 0.3346  626 ALA B CB  
5295 N N   . LEU B 357 ? 2.6698 2.1395 3.3264 0.0080  -0.0676 0.2913  627 LEU B N   
5296 C CA  . LEU B 357 ? 2.6782 2.1755 3.3130 0.0208  -0.0097 0.2628  627 LEU B CA  
5297 C C   . LEU B 357 ? 2.7034 2.2742 3.3544 0.0152  0.0262  0.2663  627 LEU B C   
5298 O O   . LEU B 357 ? 2.6223 2.2042 3.2081 0.0102  0.0614  0.2464  627 LEU B O   
5299 C CB  . LEU B 357 ? 2.7014 2.2127 3.4034 0.0653  0.0122  0.2488  627 LEU B CB  
5300 C CG  . LEU B 357 ? 2.7160 2.1494 3.3634 0.0735  0.0111  0.2240  627 LEU B CG  
5301 C CD1 . LEU B 357 ? 2.7438 2.1162 3.4236 0.0891  -0.0352 0.2428  627 LEU B CD1 
5302 C CD2 . LEU B 357 ? 2.7763 2.2427 3.4406 0.1070  0.0624  0.1880  627 LEU B CD2 
5303 N N   . ALA B 358 ? 2.8188 2.4377 3.5572 0.0157  0.0157  0.2916  628 ALA B N   
5304 C CA  . ALA B 358 ? 2.8256 2.5057 3.5897 0.0087  0.0500  0.3022  628 ALA B CA  
5305 C C   . ALA B 358 ? 2.9264 2.5810 3.5985 -0.0263 0.0423  0.3024  628 ALA B C   
5306 O O   . ALA B 358 ? 2.9542 2.6339 3.5842 -0.0247 0.0834  0.2959  628 ALA B O   
5307 C CB  . ALA B 358 ? 2.8035 2.5336 3.6902 0.0092  0.0352  0.3277  628 ALA B CB  
5308 N N   . CYS B 359 ? 2.9009 2.5070 3.5386 -0.0536 -0.0105 0.3095  629 CYS B N   
5309 C CA  . CYS B 359 ? 2.7240 2.3034 3.2715 -0.0853 -0.0217 0.3064  629 CYS B CA  
5310 C C   . CYS B 359 ? 2.6905 2.2526 3.1388 -0.0842 0.0093  0.2787  629 CYS B C   
5311 O O   . CYS B 359 ? 2.6887 2.2719 3.0894 -0.0890 0.0363  0.2713  629 CYS B O   
5312 C CB  . CYS B 359 ? 2.6462 2.1743 3.1642 -0.1098 -0.0834 0.3152  629 CYS B CB  
5313 S SG  . CYS B 359 ? 3.3428 2.8973 3.9777 -0.1108 -0.1312 0.3399  629 CYS B SG  
5314 N N   . PHE B 360 ? 2.6389 2.1614 3.0576 -0.0778 0.0040  0.2621  630 PHE B N   
5315 C CA  . PHE B 360 ? 2.5887 2.0963 2.9228 -0.0809 0.0303  0.2296  630 PHE B CA  
5316 C C   . PHE B 360 ? 2.6539 2.2236 3.0026 -0.0519 0.0838  0.2139  630 PHE B C   
5317 O O   . PHE B 360 ? 2.6290 2.2174 2.9110 -0.0545 0.1078  0.1929  630 PHE B O   
5318 C CB  . PHE B 360 ? 2.5835 2.0338 2.9021 -0.0782 0.0189  0.2152  630 PHE B CB  
5319 C CG  . PHE B 360 ? 2.6183 1.9998 2.8991 -0.1052 -0.0290 0.2322  630 PHE B CG  
5320 C CD1 . PHE B 360 ? 2.5637 1.9334 2.7805 -0.1377 -0.0492 0.2388  630 PHE B CD1 
5321 C CD2 . PHE B 360 ? 2.7028 2.0301 3.0079 -0.0942 -0.0533 0.2425  630 PHE B CD2 
5322 C CE1 . PHE B 360 ? 2.6053 1.9140 2.7792 -0.1598 -0.0912 0.2555  630 PHE B CE1 
5323 C CE2 . PHE B 360 ? 2.7203 1.9815 2.9809 -0.1150 -0.0964 0.2627  630 PHE B CE2 
5324 C CZ  . PHE B 360 ? 2.6681 1.9218 2.8611 -0.1484 -0.1145 0.2694  630 PHE B CZ  
5325 N N   . ARG B 361 ? 2.6928 2.2978 3.1274 -0.0211 0.1023  0.2233  631 ARG B N   
5326 C CA  . ARG B 361 ? 2.7052 2.3723 3.1551 0.0110  0.1557  0.2132  631 ARG B CA  
5327 C C   . ARG B 361 ? 2.6683 2.3710 3.1003 0.0035  0.1738  0.2319  631 ARG B C   
5328 O O   . ARG B 361 ? 2.7297 2.4650 3.1108 0.0199  0.2111  0.2177  631 ARG B O   
5329 C CB  . ARG B 361 ? 2.7748 2.4781 3.3286 0.0439  0.1724  0.2246  631 ARG B CB  
5330 N N   . ASN B 362 ? 2.6392 2.3354 3.1159 -0.0183 0.1468  0.2635  632 ASN B N   
5331 C CA  . ASN B 362 ? 2.6116 2.3254 3.0712 -0.0295 0.1595  0.2818  632 ASN B CA  
5332 C C   . ASN B 362 ? 2.6235 2.3112 2.9708 -0.0459 0.1510  0.2612  632 ASN B C   
5333 O O   . ASN B 362 ? 2.7451 2.4564 3.0452 -0.0350 0.1812  0.2596  632 ASN B O   
5334 C CB  . ASN B 362 ? 2.6089 2.3138 3.1412 -0.0544 0.1245  0.3118  632 ASN B CB  
5335 C CG  . ASN B 362 ? 2.6392 2.3956 3.2832 -0.0401 0.1541  0.3379  632 ASN B CG  
5336 O OD1 . ASN B 362 ? 2.6696 2.4569 3.3159 -0.0303 0.1988  0.3523  632 ASN B OD1 
5337 N ND2 . ASN B 362 ? 2.6171 2.3842 3.3552 -0.0375 0.1305  0.3453  632 ASN B ND2 
5338 N N   . ALA B 363 ? 2.5482 2.1880 2.8532 -0.0705 0.1105  0.2468  633 ALA B N   
5339 C CA  . ALA B 363 ? 2.4738 2.0920 2.6779 -0.0892 0.1013  0.2232  633 ALA B CA  
5340 C C   . ALA B 363 ? 2.5241 2.1751 2.6661 -0.0679 0.1401  0.1897  633 ALA B C   
5341 O O   . ALA B 363 ? 2.5375 2.2022 2.6146 -0.0701 0.1476  0.1788  633 ALA B O   
5342 C CB  . ALA B 363 ? 2.4392 2.0018 2.6147 -0.1159 0.0608  0.2142  633 ALA B CB  
5343 N N   . ILE B 364 ? 2.5538 2.2202 2.7158 -0.0443 0.1627  0.1703  634 ILE B N   
5344 C CA  . ILE B 364 ? 2.6124 2.3150 2.7170 -0.0222 0.1955  0.1314  634 ILE B CA  
5345 C C   . ILE B 364 ? 2.6979 2.4581 2.7949 0.0132  0.2362  0.1417  634 ILE B C   
5346 O O   . ILE B 364 ? 2.7027 2.4922 2.7295 0.0260  0.2516  0.1173  634 ILE B O   
5347 C CB  . ILE B 364 ? 2.6397 2.3373 2.7644 -0.0069 0.2061  0.1004  634 ILE B CB  
5348 C CG1 . ILE B 364 ? 2.6595 2.3585 2.8772 0.0133  0.2112  0.1263  634 ILE B CG1 
5349 C CG2 . ILE B 364 ? 2.6283 2.2671 2.7215 -0.0419 0.1754  0.0783  634 ILE B CG2 
5350 C CD1 . ILE B 364 ? 2.7148 2.4746 2.9568 0.0592  0.2585  0.1190  634 ILE B CD1 
5351 N N   . ARG B 365 ? 2.7925 2.5711 2.9611 0.0306  0.2550  0.1775  635 ARG B N   
5352 C CA  . ARG B 365 ? 2.8119 2.6353 2.9750 0.0610  0.2968  0.1994  635 ARG B CA  
5353 C C   . ARG B 365 ? 2.7744 2.5856 2.8733 0.0471  0.2861  0.2077  635 ARG B C   
5354 O O   . ARG B 365 ? 2.9306 2.7717 2.9635 0.0737  0.3114  0.1990  635 ARG B O   
5355 C CB  . ARG B 365 ? 2.7997 2.6352 3.0625 0.0664  0.3133  0.2432  635 ARG B CB  
5356 N N   . VAL B 366 ? 2.6780 2.4443 2.7956 0.0082  0.2452  0.2219  636 VAL B N   
5357 C CA  . VAL B 366 ? 2.7064 2.4479 2.7811 -0.0129 0.2238  0.2311  636 VAL B CA  
5358 C C   . VAL B 366 ? 2.7300 2.4752 2.7104 -0.0159 0.2135  0.1894  636 VAL B C   
5359 O O   . VAL B 366 ? 2.7224 2.4804 2.6427 -0.0041 0.2217  0.1851  636 VAL B O   
5360 C CB  . VAL B 366 ? 2.7216 2.4166 2.8466 -0.0531 0.1778  0.2508  636 VAL B CB  
5361 N N   . ASN B 367 ? 2.7429 2.4769 2.7141 -0.0312 0.1966  0.1582  637 ASN B N   
5362 C CA  . ASN B 367 ? 2.7537 2.4972 2.6483 -0.0392 0.1900  0.1150  637 ASN B CA  
5363 C C   . ASN B 367 ? 2.8390 2.6063 2.7235 -0.0262 0.2061  0.0734  637 ASN B C   
5364 O O   . ASN B 367 ? 2.7988 2.5350 2.7153 -0.0432 0.1939  0.0647  637 ASN B O   
5365 C CB  . ASN B 367 ? 2.7820 2.4772 2.6614 -0.0839 0.1490  0.1136  637 ASN B CB  
5366 N N   . PRO B 368 ? 3.0490 2.8721 2.8897 0.0097  0.2349  0.0490  638 PRO B N   
5367 C CA  . PRO B 368 ? 3.0966 2.9570 2.9193 0.0299  0.2531  0.0008  638 PRO B CA  
5368 C C   . PRO B 368 ? 3.0846 2.9291 2.8801 -0.0068 0.2318  -0.0458 638 PRO B C   
5369 O O   . PRO B 368 ? 3.1536 2.9785 2.9778 -0.0150 0.2322  -0.0680 638 PRO B O   
5370 C CB  . PRO B 368 ? 3.1262 3.0498 2.8900 0.0737  0.2781  -0.0106 638 PRO B CB  
5371 N N   . ARG B 369 ? 3.0494 2.9003 2.7945 -0.0282 0.2159  -0.0594 639 ARG B N   
5372 C CA  . ARG B 369 ? 2.9804 2.8189 2.7003 -0.0696 0.1992  -0.1001 639 ARG B CA  
5373 C C   . ARG B 369 ? 3.0336 2.7993 2.7664 -0.1199 0.1704  -0.0743 639 ARG B C   
5374 O O   . ARG B 369 ? 3.0417 2.8033 2.7378 -0.1537 0.1586  -0.0959 639 ARG B O   
5375 C CB  . ARG B 369 ? 2.8935 2.7917 2.5510 -0.0629 0.2003  -0.1346 639 ARG B CB  
5376 N N   . HIS B 370 ? 3.0754 2.7894 2.8587 -0.1232 0.1596  -0.0304 640 HIS B N   
5377 C CA  . HIS B 370 ? 3.0458 2.6907 2.8393 -0.1625 0.1287  -0.0007 640 HIS B CA  
5378 C C   . HIS B 370 ? 3.1500 2.7351 2.9700 -0.1849 0.1196  -0.0031 640 HIS B C   
5379 O O   . HIS B 370 ? 3.3428 2.9011 3.2183 -0.1695 0.1163  0.0218  640 HIS B O   
5380 C CB  . HIS B 370 ? 3.0032 2.6295 2.8367 -0.1525 0.1143  0.0513  640 HIS B CB  
5381 N N   . TYR B 371 ? 2.9963 2.5600 2.7790 -0.2201 0.1172  -0.0321 641 TYR B N   
5382 C CA  . TYR B 371 ? 2.8794 2.3763 2.6792 -0.2426 0.1128  -0.0359 641 TYR B CA  
5383 C C   . TYR B 371 ? 2.7230 2.1510 2.5552 -0.2453 0.0849  0.0169  641 TYR B C   
5384 O O   . TYR B 371 ? 2.6776 2.0600 2.5485 -0.2376 0.0838  0.0225  641 TYR B O   
5385 C CB  . TYR B 371 ? 2.7553 2.2316 2.5045 -0.2904 0.1134  -0.0628 641 TYR B CB  
5386 C CG  . TYR B 371 ? 2.6687 2.1044 2.3776 -0.3233 0.0887  -0.0279 641 TYR B CG  
5387 C CD1 . TYR B 371 ? 2.6900 2.0407 2.4030 -0.3405 0.0667  0.0118  641 TYR B CD1 
5388 C CD2 . TYR B 371 ? 2.6538 2.1366 2.3178 -0.3313 0.0857  -0.0342 641 TYR B CD2 
5389 C CE1 . TYR B 371 ? 2.7257 2.0425 2.3945 -0.3659 0.0432  0.0426  641 TYR B CE1 
5390 C CE2 . TYR B 371 ? 2.6817 2.1301 2.3057 -0.3579 0.0634  -0.0058 641 TYR B CE2 
5391 C CZ  . TYR B 371 ? 2.7089 2.0756 2.3333 -0.3754 0.0423  0.0323  641 TYR B CZ  
5392 O OH  . TYR B 371 ? 2.7257 2.0610 2.3024 -0.3982 0.0192  0.0592  641 TYR B OH  
5393 N N   . ASN B 372 ? 2.7397 2.1607 2.5559 -0.2545 0.0602  0.0518  642 ASN B N   
5394 C CA  . ASN B 372 ? 2.7109 2.0723 2.5509 -0.2590 0.0267  0.0979  642 ASN B CA  
5395 C C   . ASN B 372 ? 2.7346 2.0850 2.6523 -0.2261 0.0243  0.1171  642 ASN B C   
5396 O O   . ASN B 372 ? 2.6923 1.9811 2.6286 -0.2287 0.0047  0.1375  642 ASN B O   
5397 C CB  . ASN B 372 ? 2.6449 2.0221 2.4701 -0.2628 0.0025  0.1244  642 ASN B CB  
5398 N N   . ALA B 373 ? 2.9301 2.3407 2.8915 -0.1927 0.0456  0.1120  643 ALA B N   
5399 C CA  . ALA B 373 ? 3.0109 2.4249 3.0529 -0.1601 0.0465  0.1313  643 ALA B CA  
5400 C C   . ALA B 373 ? 3.0610 2.4570 3.1211 -0.1452 0.0673  0.1026  643 ALA B C   
5401 O O   . ALA B 373 ? 3.1504 2.5029 3.2555 -0.1335 0.0542  0.1173  643 ALA B O   
5402 C CB  . ALA B 373 ? 3.0359 2.5194 3.1164 -0.1316 0.0675  0.1398  643 ALA B CB  
5403 N N   . TRP B 374 ? 3.0252 2.4580 3.0513 -0.1425 0.0984  0.0587  644 TRP B N   
5404 C CA  . TRP B 374 ? 2.9998 2.4194 3.0338 -0.1322 0.1197  0.0183  644 TRP B CA  
5405 C C   . TRP B 374 ? 2.9859 2.3117 3.0167 -0.1569 0.0996  0.0246  644 TRP B C   
5406 O O   . TRP B 374 ? 3.0524 2.3415 3.1278 -0.1359 0.1011  0.0227  644 TRP B O   
5407 C CB  . TRP B 374 ? 3.0372 2.5051 3.0181 -0.1404 0.1445  -0.0337 644 TRP B CB  
5408 C CG  . TRP B 374 ? 3.0328 2.5874 3.0197 -0.1000 0.1717  -0.0472 644 TRP B CG  
5409 C CD1 . TRP B 374 ? 2.9713 2.5838 2.9184 -0.0961 0.1785  -0.0468 644 TRP B CD1 
5410 C CD2 . TRP B 374 ? 3.1082 2.6984 3.1380 -0.0546 0.1971  -0.0600 644 TRP B CD2 
5411 N NE1 . TRP B 374 ? 2.9679 2.6457 2.9262 -0.0511 0.2070  -0.0548 644 TRP B NE1 
5412 C CE2 . TRP B 374 ? 3.0767 2.7456 3.0849 -0.0257 0.2201  -0.0636 644 TRP B CE2 
5413 C CE3 . TRP B 374 ? 3.1882 2.7508 3.2699 -0.0325 0.2038  -0.0689 644 TRP B CE3 
5414 C CZ2 . TRP B 374 ? 3.1467 2.8690 3.1789 0.0227  0.2515  -0.0735 644 TRP B CZ2 
5415 C CZ3 . TRP B 374 ? 3.1985 2.8187 3.3091 0.0157  0.2343  -0.0834 644 TRP B CZ3 
5416 C CH2 . TRP B 374 ? 3.1799 2.8801 3.2636 0.0420  0.2589  -0.0845 644 TRP B CH2 
5417 N N   . TYR B 375 ? 2.8742 2.1596 2.8487 -0.1995 0.0828  0.0332  645 TYR B N   
5418 C CA  . TYR B 375 ? 2.8767 2.0652 2.8350 -0.2255 0.0657  0.0476  645 TYR B CA  
5419 C C   . TYR B 375 ? 2.8790 2.0232 2.8754 -0.2072 0.0314  0.1006  645 TYR B C   
5420 O O   . TYR B 375 ? 2.9194 1.9938 2.9386 -0.1974 0.0222  0.1114  645 TYR B O   
5421 C CB  . TYR B 375 ? 2.8930 2.0582 2.7771 -0.2754 0.0608  0.0464  645 TYR B CB  
5422 N N   . GLY B 376 ? 2.9275 2.1117 2.9311 -0.2023 0.0110  0.1313  646 GLY B N   
5423 C CA  . GLY B 376 ? 2.9973 2.1617 3.0481 -0.1826 -0.0244 0.1758  646 GLY B CA  
5424 C C   . GLY B 376 ? 3.0776 2.2432 3.2102 -0.1402 -0.0189 0.1764  646 GLY B C   
5425 O O   . GLY B 376 ? 3.0445 2.1539 3.2037 -0.1265 -0.0460 0.2021  646 GLY B O   
5426 N N   . LEU B 377 ? 3.1203 2.3525 3.2897 -0.1154 0.0166  0.1477  647 LEU B N   
5427 C CA  . LEU B 377 ? 3.1137 2.3554 3.3568 -0.0730 0.0306  0.1393  647 LEU B CA  
5428 C C   . LEU B 377 ? 3.1446 2.3059 3.3729 -0.0735 0.0349  0.1172  647 LEU B C   
5429 O O   . LEU B 377 ? 3.2371 2.3534 3.5121 -0.0474 0.0194  0.1322  647 LEU B O   
5430 C CB  . LEU B 377 ? 3.0428 2.3734 3.3106 -0.0473 0.0727  0.1107  647 LEU B CB  
5431 N N   . GLY B 378 ? 3.0685 2.2145 3.2367 -0.1018 0.0569  0.0788  648 GLY B N   
5432 C CA  . GLY B 378 ? 3.0546 2.1158 3.2037 -0.1135 0.0635  0.0545  648 GLY B CA  
5433 C C   . GLY B 378 ? 3.0743 2.0313 3.2192 -0.1184 0.0297  0.0964  648 GLY B C   
5434 O O   . GLY B 378 ? 3.0856 1.9804 3.2627 -0.0945 0.0292  0.0921  648 GLY B O   
5435 N N   . MET B 379 ? 3.0340 1.9701 3.1344 -0.1460 0.0010  0.1364  649 MET B N   
5436 C CA  . MET B 379 ? 2.9849 1.8233 3.0662 -0.1485 -0.0340 0.1810  649 MET B CA  
5437 C C   . MET B 379 ? 2.9702 1.8101 3.1294 -0.0962 -0.0606 0.2087  649 MET B C   
5438 O O   . MET B 379 ? 3.0281 1.7808 3.1903 -0.0794 -0.0817 0.2322  649 MET B O   
5439 C CB  . MET B 379 ? 2.9030 1.7357 2.9184 -0.1833 -0.0602 0.2156  649 MET B CB  
5440 N N   . ILE B 380 ? 2.9745 1.9141 3.1979 -0.0697 -0.0583 0.2065  650 ILE B N   
5441 C CA  . ILE B 380 ? 3.0251 1.9886 3.3382 -0.0205 -0.0783 0.2265  650 ILE B CA  
5442 C C   . ILE B 380 ? 3.1065 2.0469 3.4682 0.0170  -0.0538 0.1967  650 ILE B C   
5443 O O   . ILE B 380 ? 3.1742 2.0642 3.5764 0.0516  -0.0762 0.2143  650 ILE B O   
5444 C CB  . ILE B 380 ? 2.9115 1.9910 3.2862 -0.0076 -0.0738 0.2304  650 ILE B CB  
5445 N N   . TYR B 381 ? 3.0991 2.0790 3.4549 0.0133  -0.0094 0.1490  651 TYR B N   
5446 C CA  . TYR B 381 ? 3.1497 2.1140 3.5444 0.0475  0.0179  0.1097  651 TYR B CA  
5447 C C   . TYR B 381 ? 3.2460 2.0807 3.6011 0.0358  0.0117  0.1029  651 TYR B C   
5448 O O   . TYR B 381 ? 3.3361 2.1273 3.7320 0.0721  0.0185  0.0845  651 TYR B O   
5449 C CB  . TYR B 381 ? 3.1579 2.1988 3.5418 0.0442  0.0639  0.0572  651 TYR B CB  
5450 N N   . TYR B 382 ? 3.2724 2.0435 3.5479 -0.0148 0.0011  0.1184  652 TYR B N   
5451 C CA  . TYR B 382 ? 3.4210 2.0584 3.6518 -0.0337 -0.0034 0.1227  652 TYR B CA  
5452 C C   . TYR B 382 ? 3.5286 2.0862 3.7744 -0.0025 -0.0454 0.1769  652 TYR B C   
5453 O O   . TYR B 382 ? 3.5361 1.9887 3.7837 0.0145  -0.0470 0.1774  652 TYR B O   
5454 C CB  . TYR B 382 ? 3.4416 2.0453 3.5830 -0.0994 0.0029  0.1254  652 TYR B CB  
5455 N N   . LYS B 383 ? 3.5333 2.1401 3.7901 0.0070  -0.0809 0.2207  653 LYS B N   
5456 C CA  . LYS B 383 ? 3.5839 2.1373 3.8613 0.0438  -0.1273 0.2703  653 LYS B CA  
5457 C C   . LYS B 383 ? 3.5814 2.1731 3.9632 0.1092  -0.1299 0.2587  653 LYS B C   
5458 O O   . LYS B 383 ? 3.5968 2.1284 4.0043 0.1504  -0.1624 0.2875  653 LYS B O   
5459 C CB  . LYS B 383 ? 3.5066 2.1120 3.7675 0.0323  -0.1669 0.3124  653 LYS B CB  
5460 N N   . GLN B 384 ? 3.5285 2.2223 3.9678 0.1215  -0.0948 0.2169  654 GLN B N   
5461 C CA  . GLN B 384 ? 3.5838 2.3224 4.1214 0.1823  -0.0860 0.1980  654 GLN B CA  
5462 C C   . GLN B 384 ? 3.6621 2.3292 4.1985 0.1987  -0.0541 0.1524  654 GLN B C   
5463 O O   . GLN B 384 ? 3.7110 2.4175 4.3219 0.2486  -0.0374 0.1247  654 GLN B O   
5464 C CB  . GLN B 384 ? 3.4991 2.3850 4.0986 0.1912  -0.0608 0.1795  654 GLN B CB  
5465 N N   . GLU B 385 ? 3.6286 2.1940 4.0829 0.1549  -0.0438 0.1421  655 GLU B N   
5466 C CA  . GLU B 385 ? 3.6478 2.1314 4.0949 0.1593  -0.0142 0.0945  655 GLU B CA  
5467 C C   . GLU B 385 ? 3.6123 2.1891 4.0961 0.1718  0.0304  0.0276  655 GLU B C   
5468 O O   . GLU B 385 ? 3.6538 2.1858 4.1589 0.1958  0.0516  -0.0183 655 GLU B O   
5469 C CB  . GLU B 385 ? 3.7850 2.1744 4.2742 0.2154  -0.0363 0.1107  655 GLU B CB  
5470 N N   . LYS B 386 ? 3.5647 2.2673 4.0516 0.1579  0.0442  0.0219  656 LYS B N   
5471 C CA  . LYS B 386 ? 3.5342 2.3335 4.0453 0.1736  0.0861  -0.0357 656 LYS B CA  
5472 C C   . LYS B 386 ? 3.4761 2.2768 3.9133 0.1181  0.1099  -0.0751 656 LYS B C   
5473 O O   . LYS B 386 ? 3.4148 2.3121 3.8309 0.0994  0.1233  -0.0805 656 LYS B O   
5474 C CB  . LYS B 386 ? 3.4375 2.3744 4.0004 0.1984  0.0911  -0.0166 656 LYS B CB  
5475 N N   . PHE B 387 ? 3.5211 2.2135 3.9230 0.0928  0.1154  -0.1036 657 PHE B N   
5476 C CA  . PHE B 387 ? 3.4503 2.1289 3.7843 0.0306  0.1313  -0.1344 657 PHE B CA  
5477 C C   . PHE B 387 ? 3.4028 2.1880 3.7371 0.0352  0.1659  -0.2020 657 PHE B C   
5478 O O   . PHE B 387 ? 3.3549 2.1821 3.6402 -0.0088 0.1768  -0.2232 657 PHE B O   
5479 C CB  . PHE B 387 ? 3.6209 2.1527 3.9293 0.0020  0.1324  -0.1501 657 PHE B CB  
5480 N N   . SER B 388 ? 3.5022 2.3351 3.8895 0.0920  0.1828  -0.2360 658 SER B N   
5481 C CA  . SER B 388 ? 3.5530 2.4949 3.9361 0.1075  0.2149  -0.2968 658 SER B CA  
5482 C C   . SER B 388 ? 3.4790 2.5364 3.8396 0.0988  0.2178  -0.2676 658 SER B C   
5483 O O   . SER B 388 ? 3.4388 2.5612 3.7560 0.0781  0.2345  -0.3045 658 SER B O   
5484 C CB  . SER B 388 ? 3.5996 2.5770 4.0425 0.1766  0.2332  -0.3295 658 SER B CB  
5485 O OG  . SER B 388 ? 3.6959 2.5584 4.1610 0.1886  0.2293  -0.3575 658 SER B OG  
5486 N N   . LEU B 389 ? 3.4572 2.5401 3.8502 0.1164  0.2004  -0.2032 659 LEU B N   
5487 C CA  . LEU B 389 ? 3.3429 2.5180 3.7174 0.1044  0.2005  -0.1696 659 LEU B CA  
5488 C C   . LEU B 389 ? 3.3123 2.4506 3.6202 0.0416  0.1824  -0.1515 659 LEU B C   
5489 O O   . LEU B 389 ? 3.2331 2.4351 3.4956 0.0197  0.1956  -0.1716 659 LEU B O   
5490 C CB  . LEU B 389 ? 3.2693 2.4763 3.7056 0.1348  0.1847  -0.1093 659 LEU B CB  
5491 N N   . ALA B 390 ? 3.3433 2.3823 3.6443 0.0172  0.1523  -0.1117 660 ALA B N   
5492 C CA  . ALA B 390 ? 3.3302 2.3267 3.5674 -0.0409 0.1349  -0.0876 660 ALA B CA  
5493 C C   . ALA B 390 ? 3.2415 2.2573 3.4239 -0.0821 0.1575  -0.1418 660 ALA B C   
5494 O O   . ALA B 390 ? 3.2622 2.3201 3.3987 -0.1157 0.1553  -0.1332 660 ALA B O   
5495 C CB  . ALA B 390 ? 3.4600 2.3270 3.6890 -0.0564 0.1084  -0.0523 660 ALA B CB  
5496 N N   . GLU B 391 ? 3.1896 2.1773 3.3814 -0.0776 0.1780  -0.2012 661 GLU B N   
5497 C CA  . GLU B 391 ? 3.1790 2.1970 3.3334 -0.1115 0.1995  -0.2658 661 GLU B CA  
5498 C C   . GLU B 391 ? 3.2308 2.3812 3.3639 -0.1001 0.2119  -0.2814 661 GLU B C   
5499 O O   . GLU B 391 ? 3.0698 2.2530 3.1565 -0.1389 0.2103  -0.2826 661 GLU B O   
5500 C CB  . GLU B 391 ? 3.3081 2.2951 3.4909 -0.0931 0.2187  -0.3340 661 GLU B CB  
5501 N N   . MET B 392 ? 3.4902 2.7145 3.6559 -0.0440 0.2263  -0.2933 662 MET B N   
5502 C CA  . MET B 392 ? 3.4898 2.8357 3.6338 -0.0215 0.2437  -0.3104 662 MET B CA  
5503 C C   . MET B 392 ? 3.4811 2.8598 3.5941 -0.0445 0.2292  -0.2567 662 MET B C   
5504 O O   . MET B 392 ? 3.5098 2.9627 3.5809 -0.0511 0.2376  -0.2741 662 MET B O   
5505 C CB  . MET B 392 ? 3.5488 2.9544 3.7365 0.0441  0.2622  -0.3098 662 MET B CB  
5506 N N   . HIS B 393 ? 3.4117 2.7337 3.5459 -0.0531 0.2053  -0.1935 663 HIS B N   
5507 C CA  . HIS B 393 ? 3.2631 2.6006 3.3727 -0.0757 0.1862  -0.1414 663 HIS B CA  
5508 C C   . HIS B 393 ? 3.2372 2.5399 3.2871 -0.1336 0.1756  -0.1484 663 HIS B C   
5509 O O   . HIS B 393 ? 3.1999 2.5615 3.2093 -0.1484 0.1775  -0.1506 663 HIS B O   
5510 C CB  . HIS B 393 ? 3.2412 2.5306 3.3953 -0.0649 0.1599  -0.0786 663 HIS B CB  
5511 N N   . PHE B 394 ? 3.2344 2.4404 3.2789 -0.1649 0.1666  -0.1507 664 PHE B N   
5512 C CA  . PHE B 394 ? 3.1174 2.2874 3.1083 -0.2232 0.1636  -0.1597 664 PHE B CA  
5513 C C   . PHE B 394 ? 3.0048 2.2517 2.9663 -0.2399 0.1858  -0.2233 664 PHE B C   
5514 O O   . PHE B 394 ? 2.9846 2.2581 2.9025 -0.2753 0.1835  -0.2231 664 PHE B O   
5515 C CB  . PHE B 394 ? 3.2427 2.2923 3.2361 -0.2512 0.1606  -0.1599 664 PHE B CB  
5516 C CG  . PHE B 394 ? 3.2793 2.2436 3.2847 -0.2417 0.1327  -0.0933 664 PHE B CG  
5517 C CD1 . PHE B 394 ? 3.1956 2.1748 3.1801 -0.2454 0.1075  -0.0379 664 PHE B CD1 
5518 C CD2 . PHE B 394 ? 3.3814 2.2492 3.4173 -0.2274 0.1293  -0.0887 664 PHE B CD2 
5519 C CE1 . PHE B 394 ? 3.2380 2.1459 3.2321 -0.2341 0.0772  0.0196  664 PHE B CE1 
5520 C CE2 . PHE B 394 ? 3.4047 2.1975 3.4490 -0.2130 0.0999  -0.0274 664 PHE B CE2 
5521 C CZ  . PHE B 394 ? 3.3386 2.1553 3.3617 -0.2163 0.0727  0.0261  664 PHE B CZ  
5522 N N   . GLN B 395 ? 2.9566 2.2461 2.9418 -0.2106 0.2058  -0.2794 665 GLN B N   
5523 C CA  . GLN B 395 ? 3.0043 2.3809 2.9644 -0.2165 0.2232  -0.3451 665 GLN B CA  
5524 C C   . GLN B 395 ? 3.0356 2.5070 2.9622 -0.2013 0.2206  -0.3249 665 GLN B C   
5525 O O   . GLN B 395 ? 3.0099 2.5261 2.8983 -0.2303 0.2215  -0.3479 665 GLN B O   
5526 C CB  . GLN B 395 ? 3.0069 2.4209 2.9961 -0.1737 0.2416  -0.4041 665 GLN B CB  
5527 C CG  . GLN B 395 ? 2.9695 2.4768 2.9343 -0.1740 0.2560  -0.4816 665 GLN B CG  
5528 C CD  . GLN B 395 ? 2.9834 2.4591 2.9388 -0.2380 0.2572  -0.5288 665 GLN B CD  
5529 O OE1 . GLN B 395 ? 3.0513 2.4199 3.0232 -0.2775 0.2543  -0.5151 665 GLN B OE1 
5530 N NE2 . GLN B 395 ? 2.9268 2.4969 2.8570 -0.2475 0.2626  -0.5842 665 GLN B NE2 
5531 N N   . LYS B 396 ? 3.1380 2.6384 3.0824 -0.1560 0.2187  -0.2824 666 LYS B N   
5532 C CA  . LYS B 396 ? 3.1339 2.7139 3.0505 -0.1363 0.2191  -0.2597 666 LYS B CA  
5533 C C   . LYS B 396 ? 3.1787 2.7374 3.0609 -0.1770 0.1990  -0.2214 666 LYS B C   
5534 O O   . LYS B 396 ? 3.2416 2.8630 3.0844 -0.1787 0.2003  -0.2292 666 LYS B O   
5535 C CB  . LYS B 396 ? 3.1829 2.7829 3.1366 -0.0867 0.2239  -0.2159 666 LYS B CB  
5536 N N   . ALA B 397 ? 3.1487 2.6190 3.0423 -0.2058 0.1798  -0.1807 667 ALA B N   
5537 C CA  . ALA B 397 ? 3.0106 2.4554 2.8663 -0.2442 0.1603  -0.1462 667 ALA B CA  
5538 C C   . ALA B 397 ? 2.9450 2.3966 2.7602 -0.2901 0.1691  -0.1907 667 ALA B C   
5539 O O   . ALA B 397 ? 3.0287 2.5277 2.8037 -0.3060 0.1670  -0.1951 667 ALA B O   
5540 C CB  . ALA B 397 ? 3.0515 2.4015 2.9240 -0.2578 0.1363  -0.0925 667 ALA B CB  
5541 N N   . LEU B 398 ? 2.8828 2.2868 2.7138 -0.3111 0.1802  -0.2257 668 LEU B N   
5542 C CA  . LEU B 398 ? 2.8553 2.2599 2.6626 -0.3613 0.1926  -0.2720 668 LEU B CA  
5543 C C   . LEU B 398 ? 2.8700 2.3871 2.6678 -0.3500 0.2083  -0.3391 668 LEU B C   
5544 O O   . LEU B 398 ? 2.8765 2.4248 2.6531 -0.3900 0.2157  -0.3755 668 LEU B O   
5545 C CB  . LEU B 398 ? 2.8929 2.2048 2.7272 -0.3867 0.2014  -0.2903 668 LEU B CB  
5546 C CG  . LEU B 398 ? 2.9129 2.1070 2.7433 -0.4031 0.1845  -0.2237 668 LEU B CG  
5547 C CD1 . LEU B 398 ? 2.9436 2.0415 2.8107 -0.4027 0.1909  -0.2338 668 LEU B CD1 
5548 C CD2 . LEU B 398 ? 2.9592 2.1208 2.7395 -0.4579 0.1817  -0.1993 668 LEU B CD2 
5549 N N   . ASP B 399 ? 2.9559 2.5377 2.7684 -0.2946 0.2138  -0.3555 669 ASP B N   
5550 C CA  . ASP B 399 ? 2.9748 2.6708 2.7653 -0.2726 0.2234  -0.4085 669 ASP B CA  
5551 C C   . ASP B 399 ? 2.9287 2.6746 2.6767 -0.2745 0.2139  -0.3814 669 ASP B C   
5552 O O   . ASP B 399 ? 2.9741 2.7888 2.6972 -0.2892 0.2173  -0.4244 669 ASP B O   
5553 C CB  . ASP B 399 ? 3.0352 2.7864 2.8396 -0.2072 0.2334  -0.4235 669 ASP B CB  
5554 C CG  . ASP B 399 ? 3.2044 2.9504 3.0392 -0.2010 0.2461  -0.4868 669 ASP B CG  
5555 O OD1 . ASP B 399 ? 3.2451 2.9856 3.0839 -0.2447 0.2492  -0.5405 669 ASP B OD1 
5556 O OD2 . ASP B 399 ? 3.2909 3.0398 3.1479 -0.1536 0.2544  -0.4855 669 ASP B OD2 
5557 N N   . ILE B 400 ? 2.8436 2.5577 2.5874 -0.2586 0.2010  -0.3140 670 ILE B N   
5558 C CA  . ILE B 400 ? 2.7592 2.5100 2.4641 -0.2576 0.1906  -0.2869 670 ILE B CA  
5559 C C   . ILE B 400 ? 2.6951 2.4163 2.3731 -0.3157 0.1831  -0.2863 670 ILE B C   
5560 O O   . ILE B 400 ? 2.6589 2.4435 2.3048 -0.3262 0.1851  -0.3141 670 ILE B O   
5561 C CB  . ILE B 400 ? 2.7608 2.4786 2.4762 -0.2310 0.1776  -0.2178 670 ILE B CB  
5562 N N   . ASN B 401 ? 2.7525 2.3783 2.4420 -0.3500 0.1754  -0.2531 671 ASN B N   
5563 C CA  . ASN B 401 ? 2.7680 2.3531 2.4268 -0.4049 0.1715  -0.2427 671 ASN B CA  
5564 C C   . ASN B 401 ? 2.8617 2.3587 2.5412 -0.4429 0.1799  -0.2471 671 ASN B C   
5565 O O   . ASN B 401 ? 2.9492 2.3664 2.6503 -0.4322 0.1695  -0.2070 671 ASN B O   
5566 C CB  . ASN B 401 ? 2.6852 2.2325 2.3177 -0.4037 0.1479  -0.1789 671 ASN B CB  
5567 C CG  . ASN B 401 ? 2.6826 2.1772 2.2766 -0.4565 0.1441  -0.1608 671 ASN B CG  
5568 O OD1 . ASN B 401 ? 2.6701 2.1998 2.2427 -0.4918 0.1607  -0.1985 671 ASN B OD1 
5569 N ND2 . ASN B 401 ? 2.7401 2.1546 2.3249 -0.4611 0.1227  -0.1033 671 ASN B ND2 
5570 N N   . PRO B 402 ? 2.8568 2.3678 2.5335 -0.4871 0.1992  -0.2968 672 PRO B N   
5571 C CA  . PRO B 402 ? 2.9253 2.3465 2.6233 -0.5272 0.2120  -0.3053 672 PRO B CA  
5572 C C   . PRO B 402 ? 2.9192 2.2247 2.5917 -0.5579 0.2027  -0.2399 672 PRO B C   
5573 O O   . PRO B 402 ? 2.8832 2.0933 2.5759 -0.5686 0.2062  -0.2272 672 PRO B O   
5574 C CB  . PRO B 402 ? 2.9754 2.4544 2.6741 -0.5736 0.2353  -0.3716 672 PRO B CB  
5575 C CG  . PRO B 402 ? 2.9284 2.4897 2.5866 -0.5741 0.2299  -0.3675 672 PRO B CG  
5576 C CD  . PRO B 402 ? 2.8333 2.4362 2.4850 -0.5085 0.2093  -0.3400 672 PRO B CD  
5577 N N   . GLN B 403 ? 2.9223 2.2343 2.5473 -0.5707 0.1912  -0.2017 673 GLN B N   
5578 C CA  . GLN B 403 ? 3.0400 2.2491 2.6282 -0.6005 0.1827  -0.1428 673 GLN B CA  
5579 C C   . GLN B 403 ? 3.1122 2.2657 2.6991 -0.5603 0.1492  -0.0784 673 GLN B C   
5580 O O   . GLN B 403 ? 3.1669 2.2581 2.7109 -0.5747 0.1335  -0.0271 673 GLN B O   
5581 C CB  . GLN B 403 ? 3.0701 2.3122 2.6020 -0.6383 0.1888  -0.1375 673 GLN B CB  
5582 N N   . SER B 404 ? 3.2049 2.3855 2.8384 -0.5096 0.1384  -0.0816 674 SER B N   
5583 C CA  . SER B 404 ? 3.2269 2.3905 2.8674 -0.4706 0.1063  -0.0281 674 SER B CA  
5584 C C   . SER B 404 ? 3.3044 2.3533 2.9429 -0.4740 0.0882  0.0230  674 SER B C   
5585 O O   . SER B 404 ? 3.4391 2.4633 3.0679 -0.4560 0.0568  0.0721  674 SER B O   
5586 C CB  . SER B 404 ? 3.2428 2.4648 2.9389 -0.4179 0.1059  -0.0432 674 SER B CB  
5587 O OG  . SER B 404 ? 3.2358 2.5476 2.9361 -0.4129 0.1295  -0.1010 674 SER B OG  
5588 N N   . SER B 405 ? 3.2420 2.2206 2.8909 -0.4954 0.1067  0.0091  675 SER B N   
5589 C CA  . SER B 405 ? 3.1037 1.9636 2.7478 -0.4950 0.0922  0.0563  675 SER B CA  
5590 C C   . SER B 405 ? 3.0944 1.9021 2.6672 -0.5203 0.0741  0.1095  675 SER B C   
5591 O O   . SER B 405 ? 3.1508 1.9098 2.7159 -0.4946 0.0404  0.1611  675 SER B O   
5592 C CB  . SER B 405 ? 3.1021 1.8911 2.7625 -0.5218 0.1213  0.0265  675 SER B CB  
5593 O OG  . SER B 405 ? 3.0051 1.8368 2.7293 -0.4912 0.1334  -0.0225 675 SER B OG  
5594 N N   . VAL B 406 ? 3.0551 1.8843 2.5767 -0.5677 0.0958  0.0937  676 VAL B N   
5595 C CA  . VAL B 406 ? 3.1143 1.8945 2.5581 -0.5960 0.0865  0.1397  676 VAL B CA  
5596 C C   . VAL B 406 ? 3.1627 1.9700 2.5852 -0.5619 0.0432  0.1793  676 VAL B C   
5597 O O   . VAL B 406 ? 3.2531 1.9896 2.6304 -0.5576 0.0172  0.2322  676 VAL B O   
5598 C CB  . VAL B 406 ? 3.0341 1.8647 2.4357 -0.6488 0.1204  0.1069  676 VAL B CB  
5599 C CG1 . VAL B 406 ? 3.0852 1.8879 2.4017 -0.6695 0.1096  0.1526  676 VAL B CG1 
5600 C CG2 . VAL B 406 ? 3.0536 1.8391 2.4721 -0.6940 0.1626  0.0743  676 VAL B CG2 
5601 N N   . LEU B 407 ? 3.1331 2.0399 2.5891 -0.5357 0.0347  0.1532  677 LEU B N   
5602 C CA  . LEU B 407 ? 3.0835 2.0210 2.5305 -0.5065 -0.0045 0.1827  677 LEU B CA  
5603 C C   . LEU B 407 ? 3.0743 1.9710 2.5739 -0.4633 -0.0369 0.2161  677 LEU B C   
5604 O O   . LEU B 407 ? 3.0740 1.9344 2.5516 -0.4494 -0.0748 0.2594  677 LEU B O   
5605 C CB  . LEU B 407 ? 3.0336 2.0814 2.5016 -0.4926 0.0006  0.1458  677 LEU B CB  
5606 N N   . LEU B 408 ? 3.0030 1.9126 2.5735 -0.4400 -0.0226 0.1925  678 LEU B N   
5607 C CA  . LEU B 408 ? 2.8294 1.7204 2.4639 -0.3950 -0.0486 0.2167  678 LEU B CA  
5608 C C   . LEU B 408 ? 2.9438 1.7233 2.5619 -0.3920 -0.0661 0.2576  678 LEU B C   
5609 O O   . LEU B 408 ? 3.0115 1.7686 2.6559 -0.3582 -0.1035 0.2934  678 LEU B O   
5610 C CB  . LEU B 408 ? 2.6867 1.6245 2.3951 -0.3697 -0.0230 0.1771  678 LEU B CB  
5611 N N   . CYS B 409 ? 2.9997 1.7095 2.5765 -0.4269 -0.0389 0.2519  679 CYS B N   
5612 C CA  . CYS B 409 ? 3.0259 1.6152 2.5704 -0.4274 -0.0513 0.2958  679 CYS B CA  
5613 C C   . CYS B 409 ? 3.0805 1.6354 2.5441 -0.4362 -0.0828 0.3459  679 CYS B C   
5614 O O   . CYS B 409 ? 3.1323 1.6100 2.5771 -0.4128 -0.1144 0.3933  679 CYS B O   
5615 C CB  . CYS B 409 ? 3.0500 1.5681 2.5741 -0.4677 -0.0081 0.2754  679 CYS B CB  
5616 S SG  . CYS B 409 ? 3.6006 2.1440 3.2142 -0.4549 0.0254  0.2120  679 CYS B SG  
5617 N N   . HIS B 410 ? 3.1612 1.7752 2.5741 -0.4660 -0.0754 0.3337  680 HIS B N   
5618 C CA  . HIS B 410 ? 3.2738 1.8710 2.6079 -0.4706 -0.1066 0.3741  680 HIS B CA  
5619 C C   . HIS B 410 ? 3.3206 1.9472 2.6906 -0.4231 -0.1617 0.3976  680 HIS B C   
5620 O O   . HIS B 410 ? 3.4872 2.0624 2.8088 -0.4087 -0.2000 0.4421  680 HIS B O   
5621 C CB  . HIS B 410 ? 3.2916 1.9606 2.5753 -0.5069 -0.0862 0.3468  680 HIS B CB  
5622 C CG  . HIS B 410 ? 3.4219 2.0616 2.6064 -0.5213 -0.1055 0.3833  680 HIS B CG  
5623 N ND1 . HIS B 410 ? 3.4900 2.1061 2.6511 -0.4880 -0.1589 0.4244  680 HIS B ND1 
5624 C CD2 . HIS B 410 ? 3.4536 2.0902 2.5559 -0.5639 -0.0780 0.3821  680 HIS B CD2 
5625 C CE1 . HIS B 410 ? 3.5363 2.1323 2.5978 -0.5075 -0.1647 0.4472  680 HIS B CE1 
5626 N NE2 . HIS B 410 ? 3.5270 2.1346 2.5510 -0.5538 -0.1139 0.4238  680 HIS B NE2 
5627 N N   . ILE B 411 ? 3.1153 1.8271 2.5683 -0.3997 -0.1651 0.3674  681 ILE B N   
5628 C CA  . ILE B 411 ? 3.0204 1.7703 2.5268 -0.3592 -0.2124 0.3838  681 ILE B CA  
5629 C C   . ILE B 411 ? 3.0806 1.7557 2.6020 -0.3254 -0.2485 0.4258  681 ILE B C   
5630 O O   . ILE B 411 ? 3.0404 1.7097 2.5459 -0.3051 -0.2977 0.4562  681 ILE B O   
5631 C CB  . ILE B 411 ? 3.0076 1.8430 2.6133 -0.3376 -0.1987 0.3493  681 ILE B CB  
5632 N N   . GLY B 412 ? 3.2072 1.8262 2.7600 -0.3170 -0.2253 0.4240  682 GLY B N   
5633 C CA  . GLY B 412 ? 3.3965 1.9382 2.9663 -0.2801 -0.2553 0.4615  682 GLY B CA  
5634 C C   . GLY B 412 ? 3.5968 2.0443 3.0641 -0.2861 -0.2802 0.5113  682 GLY B C   
5635 O O   . GLY B 412 ? 3.7219 2.1327 3.1921 -0.2466 -0.3273 0.5487  682 GLY B O   
5636 N N   . VAL B 413 ? 3.5578 1.9700 2.9335 -0.3336 -0.2482 0.5123  683 VAL B N   
5637 C CA  . VAL B 413 ? 3.5568 1.8760 2.8226 -0.3419 -0.2635 0.5630  683 VAL B CA  
5638 C C   . VAL B 413 ? 3.5241 1.8892 2.7403 -0.3303 -0.3126 0.5817  683 VAL B C   
5639 O O   . VAL B 413 ? 3.5682 1.8700 2.7124 -0.3111 -0.3491 0.6290  683 VAL B O   
5640 C CB  . VAL B 413 ? 3.5581 1.8290 2.7445 -0.4008 -0.2072 0.5579  683 VAL B CB  
5641 N N   . VAL B 414 ? 3.4400 1.9129 2.6923 -0.3396 -0.3147 0.5437  684 VAL B N   
5642 C CA  . VAL B 414 ? 3.3984 1.9210 2.6188 -0.3275 -0.3635 0.5518  684 VAL B CA  
5643 C C   . VAL B 414 ? 3.3978 1.9464 2.7000 -0.2755 -0.4216 0.5634  684 VAL B C   
5644 O O   . VAL B 414 ? 3.3779 1.9064 2.6378 -0.2502 -0.4751 0.5945  684 VAL B O   
5645 C CB  . VAL B 414 ? 3.2843 1.9063 2.5180 -0.3541 -0.3454 0.5062  684 VAL B CB  
5646 N N   . GLN B 415 ? 3.4272 2.0277 2.8476 -0.2593 -0.4098 0.5359  685 GLN B N   
5647 C CA  . GLN B 415 ? 3.4673 2.0982 2.9872 -0.2112 -0.4542 0.5430  685 GLN B CA  
5648 C C   . GLN B 415 ? 3.6064 2.1537 3.0993 -0.1725 -0.4951 0.5894  685 GLN B C   
5649 O O   . GLN B 415 ? 3.6652 2.2399 3.1954 -0.1347 -0.5535 0.6034  685 GLN B O   
5650 C CB  . GLN B 415 ? 3.4003 2.0741 3.0350 -0.2013 -0.4180 0.5120  685 GLN B CB  
5651 N N   . HIS B 416 ? 3.6473 2.0924 3.0770 -0.1816 -0.4645 0.6120  686 HIS B N   
5652 C CA  . HIS B 416 ? 3.7873 2.1338 3.1772 -0.1437 -0.4969 0.6611  686 HIS B CA  
5653 C C   . HIS B 416 ? 3.9990 2.3112 3.2760 -0.1347 -0.5453 0.7018  686 HIS B C   
5654 O O   . HIS B 416 ? 4.1585 2.4425 3.4333 -0.0853 -0.6009 0.7350  686 HIS B O   
5655 C CB  . HIS B 416 ? 3.7585 1.9943 3.1065 -0.1626 -0.4441 0.6736  686 HIS B CB  
5656 N N   . ALA B 417 ? 2.5818 3.1219 3.9241 -0.0744 -1.1750 1.1707  687 ALA B N   
5657 C CA  . ALA B 417 ? 2.5930 3.1416 3.8573 -0.0839 -1.2142 1.1731  687 ALA B CA  
5658 C C   . ALA B 417 ? 2.5489 3.1950 3.7885 -0.0945 -1.2315 1.1469  687 ALA B C   
5659 O O   . ALA B 417 ? 2.5697 3.2698 3.7738 -0.0620 -1.2540 1.1933  687 ALA B O   
5660 C CB  . ALA B 417 ? 2.4795 2.9274 3.6967 -0.1575 -1.2427 1.1056  687 ALA B CB  
5661 N N   . THR B 427 ? 3.8581 2.6074 5.4654 0.9756  0.8408  1.6762  697 THR B N   
5662 C CA  . THR B 427 ? 3.8440 2.5962 5.4902 0.9004  0.7654  1.5892  697 THR B CA  
5663 C C   . THR B 427 ? 3.8881 2.3826 5.4516 0.8176  0.8386  1.4495  697 THR B C   
5664 O O   . THR B 427 ? 3.7870 2.2275 5.3348 0.7429  0.8479  1.3299  697 THR B O   
5665 C CB  . THR B 427 ? 3.5532 2.5646 5.2855 0.8515  0.5428  1.6168  697 THR B CB  
5666 N N   . LEU B 428 ? 4.0169 2.3982 5.5015 0.8099  0.8799  1.4335  698 LEU B N   
5667 C CA  . LEU B 428 ? 4.1476 2.2958 5.5353 0.7230  0.9461  1.2940  698 LEU B CA  
5668 C C   . LEU B 428 ? 4.3694 2.3043 5.6866 0.6848  1.0986  1.1685  698 LEU B C   
5669 O O   . LEU B 428 ? 4.3731 2.2260 5.6176 0.5642  1.0867  1.0066  698 LEU B O   
5670 C CB  . LEU B 428 ? 4.2740 2.3349 5.5840 0.7550  1.0114  1.3161  698 LEU B CB  
5671 N N   . ASN B 429 ? 4.5239 2.4282 5.8402 0.7701  1.2223  1.2205  699 ASN B N   
5672 C CA  . ASN B 429 ? 4.6400 2.3616 5.8921 0.7425  1.3645  1.1118  699 ASN B CA  
5673 C C   . ASN B 429 ? 4.4652 2.3400 5.7743 0.6991  1.2750  1.0701  699 ASN B C   
5674 O O   . ASN B 429 ? 4.5362 2.3293 5.7755 0.6026  1.3079  0.9149  699 ASN B O   
5675 C CB  . ASN B 429 ? 4.7309 2.3734 5.8373 0.8103  1.3971  1.1206  699 ASN B CB  
5676 N N   . LYS B 430 ? 4.2036 2.3178 5.6355 0.7675  1.1616  1.2054  700 LYS B N   
5677 C CA  . LYS B 430 ? 4.0008 2.3045 5.5038 0.7410  1.0680  1.1847  700 LYS B CA  
5678 C C   . LYS B 430 ? 3.9096 2.2512 5.3720 0.5824  0.9725  1.0026  700 LYS B C   
5679 O O   . LYS B 430 ? 3.9643 2.2289 5.3693 0.5237  1.0391  0.8824  700 LYS B O   
5680 C CB  . LYS B 430 ? 3.8334 2.4179 5.4839 0.8095  0.9104  1.3467  700 LYS B CB  
5681 N N   . ALA B 431 ? 3.8004 2.2661 5.2936 0.5137  0.8172  0.9877  701 ALA B N   
5682 C CA  . ALA B 431 ? 3.6509 2.1944 5.1314 0.3671  0.7057  0.8398  701 ALA B CA  
5683 C C   . ALA B 431 ? 3.8279 2.1309 5.1685 0.2672  0.8177  0.6719  701 ALA B C   
5684 O O   . ALA B 431 ? 3.7721 2.1152 5.0917 0.1463  0.7640  0.5403  701 ALA B O   
5685 C CB  . ALA B 431 ? 3.4824 2.1857 5.0203 0.3264  0.5321  0.8735  701 ALA B CB  
5686 N N   . ILE B 432 ? 4.0591 2.1180 5.3105 0.3179  0.9755  0.6813  702 ILE B N   
5687 C CA  . ILE B 432 ? 4.2823 2.0913 5.4007 0.2339  1.1009  0.5303  702 ILE B CA  
5688 C C   . ILE B 432 ? 4.4641 2.2001 5.5348 0.2095  1.2039  0.4411  702 ILE B C   
5689 O O   . ILE B 432 ? 4.5396 2.1917 5.5305 0.0898  1.2260  0.2863  702 ILE B O   
5690 C CB  . ILE B 432 ? 4.5605 2.1271 5.6082 0.3057  1.2523  0.5741  702 ILE B CB  
5691 N N   . VAL B 433 ? 4.6252 2.3959 5.7438 0.3234  1.2673  0.5436  703 VAL B N   
5692 C CA  . VAL B 433 ? 4.8228 2.5409 5.9016 0.3163  1.3628  0.4761  703 VAL B CA  
5693 C C   . VAL B 433 ? 4.5878 2.5413 5.7281 0.2272  1.2152  0.4099  703 VAL B C   
5694 O O   . VAL B 433 ? 4.6481 2.5473 5.7175 0.1329  1.2543  0.2707  703 VAL B O   
5695 C CB  . VAL B 433 ? 4.9852 2.6900 6.1097 0.4725  1.4667  0.6213  703 VAL B CB  
5696 N N   . ILE B 434 ? 4.3286 2.5474 5.6041 0.2571  1.0480  0.5123  704 ILE B N   
5697 C CA  . ILE B 434 ? 4.0218 2.4794 5.3728 0.1655  0.8920  0.4540  704 ILE B CA  
5698 C C   . ILE B 434 ? 3.9574 2.3797 5.2421 0.0047  0.8393  0.2963  704 ILE B C   
5699 O O   . ILE B 434 ? 3.8821 2.3959 5.1687 -0.0928 0.7957  0.1929  704 ILE B O   
5700 C CB  . ILE B 434 ? 3.8242 2.5568 5.3318 0.2172  0.7157  0.5903  704 ILE B CB  
5701 N N   . ASP B 435 ? 4.0105 2.3076 5.2414 -0.0204 0.8438  0.2853  705 ASP B N   
5702 C CA  . ASP B 435 ? 3.9334 2.1744 5.0980 -0.1658 0.8036  0.1487  705 ASP B CA  
5703 C C   . ASP B 435 ? 3.9918 2.0814 5.0430 -0.2680 0.9079  -0.0110 705 ASP B C   
5704 O O   . ASP B 435 ? 3.9276 2.0303 4.9462 -0.4025 0.8527  -0.1250 705 ASP B O   
5705 C CB  . ASP B 435 ? 4.0043 2.0782 5.1099 -0.1513 0.8380  0.1711  705 ASP B CB  
5706 N N   . PRO B 436 ? 4.0691 2.0163 5.0591 -0.2082 1.0589  -0.0183 706 PRO B N   
5707 C CA  . PRO B 436 ? 4.1652 2.0066 5.0539 -0.3092 1.1436  -0.1709 706 PRO B CA  
5708 C C   . PRO B 436 ? 4.0041 2.1043 4.9703 -0.3837 1.0205  -0.2144 706 PRO B C   
5709 O O   . PRO B 436 ? 3.9184 2.0814 4.8716 -0.5197 0.9467  -0.3190 706 PRO B O   
5710 C CB  . PRO B 436 ? 4.4348 2.0946 5.2613 -0.2021 1.3232  -0.1377 706 PRO B CB  
5711 N N   . LYS B 437 ? 3.9943 2.2633 5.0592 -0.2879 0.9871  -0.115