data_4ROF
# 
_entry.id   4ROF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4ROF         
RCSB  RCSB087596   
WWPDB D_1000087596 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4ROH . unspecified 
PDB 4ROI . unspecified 
PDB 4ROJ . unspecified 
# 
_pdbx_database_status.entry_id                        4ROF 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-10-28 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, Y.'                              1 
'Tempel, W.'                           2 
'Bountra, C.'                          3 
'Arrowsmith, C.H.'                     4 
'Edwards, A.M.'                        5 
'Min, J.'                              6 
'Structural Genomics Consortium (SGC)' 7 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of WW3 domain of ITCH in complex with TXNIP peptide' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, Y.'                              1 
primary 'Tempel, W.'                           2 
primary 'Bountra, C.'                          3 
primary 'Arrowsmith, C.H.'                     4 
primary 'Edwards, A.M.'                        5 
primary 'Min, J.'                              6 
primary 'Structural Genomics Consortium (SGC)' 7 
# 
_cell.entry_id           4ROF 
_cell.length_a           30.171 
_cell.length_b           55.312 
_cell.length_c           59.796 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4ROF 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'E3 ubiquitin-protein ligase Itchy homolog' 5411.962 2  6.3.2.- ? 'UNP residues 436-474' ? 
2 polymer syn 'Thioredoxin-interacting protein'           1359.589 2  ?       ? 'UNP residues 327-338' ? 
3 water   nat water                                       18.015   10 ?       ? ?                      ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Itch, Atrophin-1-interacting protein 4, AIP4, NFE2-associated polypeptide 1, NAPP1' 
2 'Thioredoxin-binding protein 2, Vitamin D3 up-regulated protein 1,TXNIP peptide'     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  GRRASVELPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQ GRRASVELPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQ A,B ? 
2 'polypeptide(L)' no yes '(ACE)TPEAPPCYMDVI(NH2)'                        XTPEAPPCYMDVIX                                  C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ARG n 
1 3  ARG n 
1 4  ALA n 
1 5  SER n 
1 6  VAL n 
1 7  GLU n 
1 8  LEU n 
1 9  PRO n 
1 10 LEU n 
1 11 GLY n 
1 12 PRO n 
1 13 LEU n 
1 14 PRO n 
1 15 PRO n 
1 16 GLY n 
1 17 TRP n 
1 18 GLU n 
1 19 LYS n 
1 20 ARG n 
1 21 THR n 
1 22 ASP n 
1 23 SER n 
1 24 ASN n 
1 25 GLY n 
1 26 ARG n 
1 27 VAL n 
1 28 TYR n 
1 29 PHE n 
1 30 VAL n 
1 31 ASN n 
1 32 HIS n 
1 33 ASN n 
1 34 THR n 
1 35 ARG n 
1 36 ILE n 
1 37 THR n 
1 38 GLN n 
1 39 TRP n 
1 40 GLU n 
1 41 ASP n 
1 42 PRO n 
1 43 ARG n 
1 44 SER n 
1 45 GLN n 
1 46 GLY n 
1 47 GLN n 
2 1  ACE n 
2 2  THR n 
2 3  PRO n 
2 4  GLU n 
2 5  ALA n 
2 6  PRO n 
2 7  PRO n 
2 8  CYS n 
2 9  TYR n 
2 10 MET n 
2 11 ASP n 
2 12 VAL n 
2 13 ILE n 
2 14 NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ITCH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-V2R-pRARE2' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       custom 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ITCH_HUMAN  Q96J02 1 PLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQ 436 ? 
2 UNP TXNIP_HUMAN Q9H3M7 2 TPEAPPCYMDVI                            327 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ROF A 9 ? 47 ? Q96J02 436 ? 474 ? 436 474 
2 1 4ROF B 9 ? 47 ? Q96J02 436 ? 474 ? 436 474 
3 2 4ROF C 2 ? 13 ? Q9H3M7 327 ? 338 ? 327 338 
4 2 4ROF D 2 ? 13 ? Q9H3M7 327 ? 338 ? 327 338 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ROF GLY A 1  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 428 1  
1 4ROF ARG A 2  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 429 2  
1 4ROF ARG A 3  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 430 3  
1 4ROF ALA A 4  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 431 4  
1 4ROF SER A 5  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 432 5  
1 4ROF VAL A 6  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 433 6  
1 4ROF GLU A 7  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 434 7  
1 4ROF LEU A 8  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 435 8  
2 4ROF GLY B 1  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 428 9  
2 4ROF ARG B 2  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 429 10 
2 4ROF ARG B 3  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 430 11 
2 4ROF ALA B 4  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 431 12 
2 4ROF SER B 5  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 432 13 
2 4ROF VAL B 6  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 433 14 
2 4ROF GLU B 7  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 434 15 
2 4ROF LEU B 8  ? UNP Q96J02 ? ? 'EXPRESSION TAG' 435 16 
3 4ROF ACE C 1  ? UNP Q9H3M7 ? ? ACETYLATION      326 17 
3 4ROF NH2 C 14 ? UNP Q9H3M7 ? ? AMIDATION        339 18 
4 4ROF ACE D 1  ? UNP Q9H3M7 ? ? ACETYLATION      326 19 
4 4ROF NH2 D 14 ? UNP Q9H3M7 ? ? AMIDATION        339 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NH2 non-polymer         . 'AMINO GROUP'   ? 'H2 N'           16.023  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          4ROF 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_percent_sol   33.23 
_exptl_crystal.density_Matthews      1.84 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.pdbx_details    
'1.8 M ammonium sulfate, 0.2 M sodium acetate, 0.1 M sodium cacodylate pH 5.5, vapor diffusion, sitting drop, temperature 293K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS' 
_diffrn_detector.pdbx_collection_date   2013-05-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU FR-E DW' 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
# 
_reflns.entry_id                     4ROF 
_reflns.d_resolution_high            2.030 
_reflns.d_resolution_low             40.000 
_reflns.number_obs                   6898 
_reflns.pdbx_Rmerge_I_obs            0.103 
_reflns.pdbx_netI_over_sigmaI        7.900 
_reflns.pdbx_chi_squared             1.728 
_reflns.pdbx_redundancy              6.500 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.030 2.070  ? ? ? 0.997 ? ? 1.009 5.700 ? 316 99.700  1  1 
2.070 2.100  ? ? ? 0.882 ? ? 1.104 6.200 ? 337 100.000 2  1 
2.100 2.140  ? ? ? 0.761 ? ? 1.125 6.400 ? 338 100.000 3  1 
2.140 2.190  ? ? ? 0.743 ? ? 1.231 6.600 ? 332 100.000 4  1 
2.190 2.230  ? ? ? 0.877 ? ? 1.253 6.500 ? 339 100.000 5  1 
2.230 2.290  ? ? ? 0.462 ? ? 1.916 6.400 ? 333 100.000 6  1 
2.290 2.340  ? ? ? 0.491 ? ? 1.275 6.700 ? 350 100.000 7  1 
2.340 2.410  ? ? ? 0.366 ? ? 1.233 6.700 ? 329 100.000 8  1 
2.410 2.480  ? ? ? 0.358 ? ? 1.319 6.800 ? 342 100.000 9  1 
2.480 2.560  ? ? ? 0.304 ? ? 1.409 6.700 ? 341 100.000 10 1 
2.560 2.650  ? ? ? 0.265 ? ? 1.483 6.700 ? 339 100.000 11 1 
2.650 2.750  ? ? ? 0.211 ? ? 1.624 6.700 ? 352 100.000 12 1 
2.750 2.880  ? ? ? 0.180 ? ? 1.640 6.800 ? 330 100.000 13 1 
2.880 3.030  ? ? ? 0.149 ? ? 1.766 6.700 ? 356 100.000 14 1 
3.030 3.220  ? ? ? 0.109 ? ? 1.852 6.800 ? 338 100.000 15 1 
3.220 3.470  ? ? ? 0.084 ? ? 2.260 6.600 ? 351 100.000 16 1 
3.470 3.820  ? ? ? 0.062 ? ? 2.538 6.300 ? 353 100.000 17 1 
3.820 4.370  ? ? ? 0.062 ? ? 2.731 6.400 ? 357 100.000 18 1 
4.370 5.510  ? ? ? 0.052 ? ? 2.510 6.400 ? 361 99.400  19 1 
5.510 40.000 ? ? ? 0.056 ? ? 3.062 5.700 ? 404 99.300  20 1 
# 
_refine.entry_id                                 4ROF 
_refine.ls_d_res_high                            2.0300 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.6600 
_refine.ls_number_reflns_obs                     6841 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            'THIN SHELLS (SFTOOLS)' 
_refine.details                                  
;DIFFRACTION IMAGES SHOWED MUTLIPLE PATTERNS AND ICE RINGS. FOR INTEGRATION, DIFFRACTION IMAGES WERE SEPARATED INTO RANGES (PHI 0 THROUGH 63 DEGREES, 63 THROUGH 180 DEGREES, RESPECTIVELY). MOSAICITY AND CRYSTAL-TO-DETECTOR DISTANCE WERE CONSTRAINED DURING INTEGRATION. NO-MERGE-ORIGINAL-INDEX REFLECTIONS FROM SCALEPACK WERE MERGED WITH AIMLESS (ONLYMERGE). ARP/WARP WAS USED FOR AUTOMATED MODEL BUILDING AND MAP IMPROVEMENT. PARROT WAS USED FOR PHASE IMPROVEMENT. RESTRAINTS FOR THE C-TERMINAL AMIDE PROTECTION OF THE PEPTIDE LIGAND WERE PREPARED WITH JLIGAND. COOT WAS USED FOR INTERACTIVE MODEL BUILDING. MODEL GEOMETRY WAS EVALUATED WITH MOLPROBITY.
;
_refine.ls_R_factor_obs                          0.2463 
_refine.ls_R_factor_R_work                       0.2389 
_refine.ls_wR_factor_R_work                      0.2257 
_refine.ls_R_factor_R_free                       0.2975 
_refine.ls_wR_factor_R_free                      0.2734 
_refine.ls_percent_reflns_R_free                 13.8000 
_refine.ls_number_reflns_R_free                  943 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               38.9429 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -0.9800 
_refine.aniso_B[2][2]                            2.3200 
_refine.aniso_B[3][3]                            -1.3400 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9360 
_refine.correlation_coeff_Fo_to_Fc_free          0.8940 
_refine.overall_SU_R_Cruickshank_DPI             0.2659 
_refine.overall_SU_R_free                        0.2292 
_refine.pdbx_overall_ESU_R                       0.2660 
_refine.pdbx_overall_ESU_R_Free                  0.2290 
_refine.overall_SU_ML                            0.1880 
_refine.overall_SU_B                             14.9840 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2F21' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7465 
_refine.B_iso_max                                81.680 
_refine.B_iso_min                                23.940 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        744 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             10 
_refine_hist.number_atoms_total               754 
_refine_hist.d_res_high                       2.0300 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       783  0.012  0.020  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         710  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1074 1.351  1.939  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      1625 0.819  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 92   6.004  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 40   22.115 23.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 108  13.959 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 8    20.673 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         108  0.079  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   893  0.008  0.022  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     187  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            376  2.108  2.705  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         374  2.112  2.708  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           466  2.851  4.035  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.0300 
_refine_ls_shell.d_res_low                        2.0830 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.5300 
_refine_ls_shell.number_reflns_R_work             350 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2860 
_refine_ls_shell.R_factor_R_free                  0.3280 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             120 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                470 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4ROF 
_struct.title                     'Crystal Structure of WW3 domain of ITCH in complex with TXNIP peptide' 
_struct.pdbx_descriptor           'E3 ubiquitin-protein ligase Itchy homolog (E.C.6.3.2.-), Thioredoxin-interacting protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4ROF 
_struct_keywords.text            'Structural Genomics, Structural GenomicsConsortium, SGC, LIGASE, Structural Genomics Consortium' 
_struct_keywords.pdbx_keywords   LIGASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'AS PER THE AUTHORS THE BIOLOGICAL ASSEMBLY IS UNKNOWN' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 41 ? GLN A 45 ? ASP A 468 GLN A 472 5 ? 5 
HELX_P HELX_P2 2 ASP B 41 ? GLN B 45 ? ASP B 468 GLN B 472 5 ? 5 
HELX_P HELX_P3 3 CYS C 8  ? ILE C 13 ? CYS C 333 ILE C 338 1 ? 6 
HELX_P HELX_P4 4 CYS D 8  ? ILE D 13 ? CYS D 333 ILE D 338 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? C CYS 8  SG ? ? ? 1_555 D CYS 8  SG ? ? C CYS 333 D CYS 333 1_555 ? ? ? ? ? ? ? 2.049 ? 
covale1 covale ? ? C ILE 13 C  ? ? ? 1_555 C NH2 14 N  ? ? C ILE 338 C NH2 339 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale2 covale ? ? D ILE 13 C  ? ? ? 1_555 D NH2 14 N  ? ? D ILE 338 D NH2 339 1_555 ? ? ? ? ? ? ? 1.326 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 17 ? THR A 21 ? TRP A 444 THR A 448 
A 2 VAL A 27 ? ASN A 31 ? VAL A 454 ASN A 458 
A 3 ILE A 36 ? GLN A 38 ? ILE A 463 GLN A 465 
B 1 TRP B 17 ? THR B 21 ? TRP B 444 THR B 448 
B 2 VAL B 27 ? ASN B 31 ? VAL B 454 ASN B 458 
B 3 ILE B 36 ? GLN B 38 ? ILE B 463 GLN B 465 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 20 ? N ARG A 447 O TYR A 28 ? O TYR A 455 
A 2 3 N ASN A 31 ? N ASN A 458 O ILE A 36 ? O ILE A 463 
B 1 2 N GLU B 18 ? N GLU B 445 O VAL B 30 ? O VAL B 457 
B 2 3 N ASN B 31 ? N ASN B 458 O ILE B 36 ? O ILE B 463 
# 
_atom_sites.entry_id                    4ROF 
_atom_sites.fract_transf_matrix[1][1]   0.033144 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018079 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016724 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   A LEU A 1 10 ? 11.220  8.853   1.492  0.50 62.27 ? 437 LEU A N   1 
ATOM   2   N N   B LEU A 1 10 ? 12.170  10.897  0.379  0.50 67.62 ? 437 LEU A N   1 
ATOM   3   C CA  A LEU A 1 10 ? 11.773  10.241  1.402  0.50 65.66 ? 437 LEU A CA  1 
ATOM   4   C CA  B LEU A 1 10 ? 11.627  10.104  1.522  0.50 63.60 ? 437 LEU A CA  1 
ATOM   5   C C   A LEU A 1 10 ? 11.597  10.987  2.725  0.50 62.20 ? 437 LEU A C   1 
ATOM   6   C C   B LEU A 1 10 ? 11.560  10.949  2.794  0.50 61.04 ? 437 LEU A C   1 
ATOM   7   O O   A LEU A 1 10 ? 10.483  11.356  3.104  0.50 59.85 ? 437 LEU A O   1 
ATOM   8   O O   B LEU A 1 10 ? 10.475  11.366  3.207  0.50 58.55 ? 437 LEU A O   1 
ATOM   9   C CB  A LEU A 1 10 ? 11.105  11.024  0.266  0.50 66.99 ? 437 LEU A CB  1 
ATOM   10  C CB  B LEU A 1 10 ? 12.465  8.837   1.761  0.50 62.37 ? 437 LEU A CB  1 
ATOM   11  N N   . GLY A 1 11 ? 12.710  11.197  3.420  1.00 61.92 ? 438 GLY A N   1 
ATOM   12  C CA  . GLY A 1 11 ? 12.748  12.015  4.628  1.00 59.31 ? 438 GLY A CA  1 
ATOM   13  C C   . GLY A 1 11 ? 12.423  11.255  5.903  1.00 54.91 ? 438 GLY A C   1 
ATOM   14  O O   . GLY A 1 11 ? 11.682  10.295  5.883  1.00 50.35 ? 438 GLY A O   1 
ATOM   15  N N   . PRO A 1 12 ? 12.978  11.708  7.038  1.00 55.30 ? 439 PRO A N   1 
ATOM   16  C CA  . PRO A 1 12 ? 12.727  11.025  8.278  1.00 49.79 ? 439 PRO A CA  1 
ATOM   17  C C   . PRO A 1 12 ? 11.281  11.230  8.678  1.00 48.45 ? 439 PRO A C   1 
ATOM   18  O O   . PRO A 1 12 ? 10.587  12.083  8.095  1.00 43.76 ? 439 PRO A O   1 
ATOM   19  C CB  . PRO A 1 12 ? 13.668  11.731  9.260  1.00 54.17 ? 439 PRO A CB  1 
ATOM   20  C CG  . PRO A 1 12 ? 13.745  13.135  8.751  1.00 56.50 ? 439 PRO A CG  1 
ATOM   21  C CD  . PRO A 1 12 ? 13.602  13.032  7.252  1.00 58.95 ? 439 PRO A CD  1 
ATOM   22  N N   . LEU A 1 13 ? 10.806  10.436  9.636  1.00 44.83 ? 440 LEU A N   1 
ATOM   23  C CA  . LEU A 1 13 ? 9.489   10.671  10.152 1.00 41.49 ? 440 LEU A CA  1 
ATOM   24  C C   . LEU A 1 13 ? 9.546   11.954  10.962 1.00 39.71 ? 440 LEU A C   1 
ATOM   25  O O   . LEU A 1 13 ? 10.594  12.300  11.504 1.00 41.67 ? 440 LEU A O   1 
ATOM   26  C CB  . LEU A 1 13 ? 8.985   9.498   11.000 1.00 40.94 ? 440 LEU A CB  1 
ATOM   27  C CG  . LEU A 1 13 ? 8.489   8.307   10.182 1.00 41.86 ? 440 LEU A CG  1 
ATOM   28  C CD1 . LEU A 1 13 ? 8.595   7.041   10.997 1.00 40.02 ? 440 LEU A CD1 1 
ATOM   29  C CD2 . LEU A 1 13 ? 7.054   8.509   9.686  1.00 40.02 ? 440 LEU A CD2 1 
ATOM   30  N N   . PRO A 1 14 ? 8.422   12.685  11.028 1.00 37.57 ? 441 PRO A N   1 
ATOM   31  C CA  . PRO A 1 14 ? 8.396   13.802  11.981 1.00 38.51 ? 441 PRO A CA  1 
ATOM   32  C C   . PRO A 1 14 ? 8.564   13.336  13.440 1.00 37.14 ? 441 PRO A C   1 
ATOM   33  O O   . PRO A 1 14 ? 8.210   12.194  13.790 1.00 33.60 ? 441 PRO A O   1 
ATOM   34  C CB  . PRO A 1 14 ? 7.023   14.465  11.750 1.00 38.24 ? 441 PRO A CB  1 
ATOM   35  C CG  . PRO A 1 14 ? 6.444   13.835  10.522 1.00 37.92 ? 441 PRO A CG  1 
ATOM   36  C CD  . PRO A 1 14 ? 7.156   12.530  10.288 1.00 37.05 ? 441 PRO A CD  1 
ATOM   37  N N   . PRO A 1 15 ? 9.113   14.208  14.292 1.00 39.54 ? 442 PRO A N   1 
ATOM   38  C CA  . PRO A 1 15 ? 9.344   13.782  15.669 1.00 38.61 ? 442 PRO A CA  1 
ATOM   39  C C   . PRO A 1 15 ? 8.064   13.272  16.320 1.00 35.08 ? 442 PRO A C   1 
ATOM   40  O O   . PRO A 1 15 ? 6.979   13.796  16.062 1.00 30.78 ? 442 PRO A O   1 
ATOM   41  C CB  . PRO A 1 15 ? 9.856   15.058  16.360 1.00 42.21 ? 442 PRO A CB  1 
ATOM   42  C CG  . PRO A 1 15 ? 9.411   16.190  15.511 1.00 43.26 ? 442 PRO A CG  1 
ATOM   43  C CD  . PRO A 1 15 ? 9.270   15.663  14.111 1.00 43.05 ? 442 PRO A CD  1 
ATOM   44  N N   . GLY A 1 16 ? 8.179   12.208  17.116 1.00 34.06 ? 443 GLY A N   1 
ATOM   45  C CA  . GLY A 1 16 ? 6.998   11.638  17.755 1.00 32.10 ? 443 GLY A CA  1 
ATOM   46  C C   . GLY A 1 16 ? 6.473   10.404  17.052 1.00 30.01 ? 443 GLY A C   1 
ATOM   47  O O   . GLY A 1 16 ? 5.772   9.583   17.664 1.00 25.58 ? 443 GLY A O   1 
ATOM   48  N N   . TRP A 1 17 ? 6.820   10.263  15.776 1.00 29.72 ? 444 TRP A N   1 
ATOM   49  C CA  . TRP A 1 17 ? 6.213   9.236   14.934 1.00 28.01 ? 444 TRP A CA  1 
ATOM   50  C C   . TRP A 1 17 ? 7.099   8.027   14.849 1.00 29.28 ? 444 TRP A C   1 
ATOM   51  O O   . TRP A 1 17 ? 8.327   8.139   14.904 1.00 30.81 ? 444 TRP A O   1 
ATOM   52  C CB  . TRP A 1 17 ? 5.961   9.772   13.522 1.00 28.06 ? 444 TRP A CB  1 
ATOM   53  C CG  . TRP A 1 17 ? 4.843   10.752  13.435 1.00 29.86 ? 444 TRP A CG  1 
ATOM   54  C CD1 . TRP A 1 17 ? 4.921   12.097  13.643 1.00 36.19 ? 444 TRP A CD1 1 
ATOM   55  C CD2 . TRP A 1 17 ? 3.467   10.486  13.102 1.00 31.64 ? 444 TRP A CD2 1 
ATOM   56  N NE1 . TRP A 1 17 ? 3.685   12.680  13.496 1.00 35.25 ? 444 TRP A NE1 1 
ATOM   57  C CE2 . TRP A 1 17 ? 2.778   11.719  13.152 1.00 34.19 ? 444 TRP A CE2 1 
ATOM   58  C CE3 . TRP A 1 17 ? 2.746   9.325   12.804 1.00 34.11 ? 444 TRP A CE3 1 
ATOM   59  C CZ2 . TRP A 1 17 ? 1.411   11.829  12.880 1.00 37.22 ? 444 TRP A CZ2 1 
ATOM   60  C CZ3 . TRP A 1 17 ? 1.386   9.436   12.534 1.00 36.06 ? 444 TRP A CZ3 1 
ATOM   61  C CH2 . TRP A 1 17 ? 0.733   10.679  12.581 1.00 35.34 ? 444 TRP A CH2 1 
ATOM   62  N N   . GLU A 1 18 ? 6.472   6.875   14.673 1.00 27.52 ? 445 GLU A N   1 
ATOM   63  C CA  . GLU A 1 18 ? 7.188   5.616   14.578 1.00 28.54 ? 445 GLU A CA  1 
ATOM   64  C C   . GLU A 1 18 ? 6.402   4.704   13.648 1.00 27.27 ? 445 GLU A C   1 
ATOM   65  O O   . GLU A 1 18 ? 5.167   4.677   13.693 1.00 25.36 ? 445 GLU A O   1 
ATOM   66  C CB  . GLU A 1 18 ? 7.263   4.978   15.960 1.00 27.30 ? 445 GLU A CB  1 
ATOM   67  C CG  . GLU A 1 18 ? 8.189   3.813   16.087 1.00 29.00 ? 445 GLU A CG  1 
ATOM   68  C CD  . GLU A 1 18 ? 7.869   2.888   17.277 1.00 33.12 ? 445 GLU A CD  1 
ATOM   69  O OE1 . GLU A 1 18 ? 7.135   3.251   18.195 1.00 28.50 ? 445 GLU A OE1 1 
ATOM   70  O OE2 . GLU A 1 18 ? 8.351   1.739   17.288 1.00 39.95 ? 445 GLU A OE2 1 
ATOM   71  N N   . LYS A 1 19 ? 7.124   3.956   12.817 1.00 26.45 ? 446 LYS A N   1 
ATOM   72  C CA  . LYS A 1 19 ? 6.544   2.977   11.906 1.00 28.39 ? 446 LYS A CA  1 
ATOM   73  C C   . LYS A 1 19 ? 6.499   1.638   12.601 1.00 28.96 ? 446 LYS A C   1 
ATOM   74  O O   . LYS A 1 19 ? 7.484   1.238   13.214 1.00 27.63 ? 446 LYS A O   1 
ATOM   75  C CB  . LYS A 1 19 ? 7.429   2.834   10.655 1.00 33.08 ? 446 LYS A CB  1 
ATOM   76  C CG  . LYS A 1 19 ? 6.759   2.089   9.497  1.00 35.76 ? 446 LYS A CG  1 
ATOM   77  C CD  . LYS A 1 19 ? 7.579   2.124   8.216  1.00 41.45 ? 446 LYS A CD  1 
ATOM   78  C CE  . LYS A 1 19 ? 8.401   0.855   8.040  1.00 44.25 ? 446 LYS A CE  1 
ATOM   79  N NZ  . LYS A 1 19 ? 9.578   1.151   7.191  1.00 48.39 ? 446 LYS A NZ  1 
ATOM   80  N N   . ARG A 1 20 ? 5.368   0.945   12.492 1.00 28.91 ? 447 ARG A N   1 
ATOM   81  C CA  . ARG A 1 20 ? 5.253   -0.423  12.980 1.00 32.68 ? 447 ARG A CA  1 
ATOM   82  C C   . ARG A 1 20 ? 4.500   -1.304  12.019 1.00 34.29 ? 447 ARG A C   1 
ATOM   83  O O   . ARG A 1 20 ? 3.930   -0.841  11.023 1.00 30.87 ? 447 ARG A O   1 
ATOM   84  C CB  . ARG A 1 20 ? 4.539   -0.433  14.341 1.00 33.85 ? 447 ARG A CB  1 
ATOM   85  C CG  . ARG A 1 20 ? 5.347   0.213   15.428 1.00 35.28 ? 447 ARG A CG  1 
ATOM   86  C CD  . ARG A 1 20 ? 4.960   -0.293  16.790 1.00 40.39 ? 447 ARG A CD  1 
ATOM   87  N NE  . ARG A 1 20 ? 5.491   0.580   17.818 1.00 44.87 ? 447 ARG A NE  1 
ATOM   88  C CZ  . ARG A 1 20 ? 5.370   0.352   19.120 1.00 43.41 ? 447 ARG A CZ  1 
ATOM   89  N NH1 . ARG A 1 20 ? 4.710   -0.719  19.539 1.00 39.89 ? 447 ARG A NH1 1 
ATOM   90  N NH2 . ARG A 1 20 ? 5.903   1.215   20.005 1.00 38.73 ? 447 ARG A NH2 1 
ATOM   91  N N   . THR A 1 21 ? 4.454   -2.575  12.388 1.00 36.94 ? 448 THR A N   1 
ATOM   92  C CA  . THR A 1 21 ? 3.730   -3.597  11.669 1.00 37.08 ? 448 THR A CA  1 
ATOM   93  C C   . THR A 1 21 ? 2.792   -4.323  12.634 1.00 37.01 ? 448 THR A C   1 
ATOM   94  O O   . THR A 1 21 ? 3.217   -4.803  13.680 1.00 41.23 ? 448 THR A O   1 
ATOM   95  C CB  . THR A 1 21 ? 4.729   -4.566  11.019 1.00 38.78 ? 448 THR A CB  1 
ATOM   96  O OG1 . THR A 1 21 ? 5.665   -3.815  10.239 1.00 33.88 ? 448 THR A OG1 1 
ATOM   97  C CG2 . THR A 1 21 ? 4.016   -5.564  10.094 1.00 40.53 ? 448 THR A CG2 1 
ATOM   98  N N   . ASP A 1 22 ? 1.510   -4.394  12.297 1.00 35.70 ? 449 ASP A N   1 
ATOM   99  C CA  . ASP A 1 22 ? 0.562   -5.138  13.135 1.00 35.13 ? 449 ASP A CA  1 
ATOM   100 C C   . ASP A 1 22 ? 0.765   -6.647  13.058 1.00 40.31 ? 449 ASP A C   1 
ATOM   101 O O   . ASP A 1 22 ? 1.673   -7.155  12.376 1.00 39.70 ? 449 ASP A O   1 
ATOM   102 C CB  . ASP A 1 22 ? -0.887  -4.716  12.841 1.00 36.50 ? 449 ASP A CB  1 
ATOM   103 C CG  . ASP A 1 22 ? -1.464  -5.274  11.529 1.00 37.93 ? 449 ASP A CG  1 
ATOM   104 O OD1 . ASP A 1 22 ? -0.866  -6.135  10.853 1.00 41.05 ? 449 ASP A OD1 1 
ATOM   105 O OD2 . ASP A 1 22 ? -2.596  -4.836  11.188 1.00 39.74 ? 449 ASP A OD2 1 
ATOM   106 N N   . SER A 1 23 ? -0.090  -7.369  13.759 1.00 43.47 ? 450 SER A N   1 
ATOM   107 C CA  . SER A 1 23 ? 0.073   -8.806  13.915 1.00 49.67 ? 450 SER A CA  1 
ATOM   108 C C   . SER A 1 23 ? -0.240  -9.559  12.637 1.00 47.27 ? 450 SER A C   1 
ATOM   109 O O   . SER A 1 23 ? 0.127   -10.690 12.527 1.00 50.43 ? 450 SER A O   1 
ATOM   110 C CB  . SER A 1 23 ? -0.824  -9.312  15.041 1.00 50.72 ? 450 SER A CB  1 
ATOM   111 O OG  . SER A 1 23 ? -2.179  -9.110  14.702 1.00 50.65 ? 450 SER A OG  1 
ATOM   112 N N   . ASN A 1 24 ? -0.924  -8.924  11.682 1.00 47.06 ? 451 ASN A N   1 
ATOM   113 C CA  . ASN A 1 24 ? -1.150  -9.525  10.353 1.00 48.66 ? 451 ASN A CA  1 
ATOM   114 C C   . ASN A 1 24 ? -0.136  -9.142  9.286  1.00 44.56 ? 451 ASN A C   1 
ATOM   115 O O   . ASN A 1 24 ? -0.277  -9.575  8.163  1.00 42.30 ? 451 ASN A O   1 
ATOM   116 C CB  . ASN A 1 24 ? -2.529  -9.148  9.823  1.00 49.83 ? 451 ASN A CB  1 
ATOM   117 C CG  . ASN A 1 24 ? -3.628  -9.874  10.528 1.00 55.16 ? 451 ASN A CG  1 
ATOM   118 O OD1 . ASN A 1 24 ? -3.415  -10.939 11.124 1.00 59.72 ? 451 ASN A OD1 1 
ATOM   119 N ND2 . ASN A 1 24 ? -4.820  -9.317  10.460 1.00 55.86 ? 451 ASN A ND2 1 
ATOM   120 N N   . GLY A 1 25 ? 0.853   -8.311  9.625  1.00 41.84 ? 452 GLY A N   1 
ATOM   121 C CA  . GLY A 1 25 ? 1.803   -7.809  8.647  1.00 41.71 ? 452 GLY A CA  1 
ATOM   122 C C   . GLY A 1 25 ? 1.505   -6.456  7.999  1.00 40.26 ? 452 GLY A C   1 
ATOM   123 O O   . GLY A 1 25 ? 2.285   -6.000  7.154  1.00 41.74 ? 452 GLY A O   1 
ATOM   124 N N   . ARG A 1 26 ? 0.426   -5.783  8.405  1.00 39.17 ? 453 ARG A N   1 
ATOM   125 C CA  . ARG A 1 26 ? 0.080   -4.461  7.821  1.00 36.76 ? 453 ARG A CA  1 
ATOM   126 C C   . ARG A 1 26 ? 0.832   -3.341  8.500  1.00 34.27 ? 453 ARG A C   1 
ATOM   127 O O   . ARG A 1 26 ? 0.816   -3.192  9.741  1.00 34.85 ? 453 ARG A O   1 
ATOM   128 C CB  . ARG A 1 26 ? -1.428  -4.185  7.871  1.00 41.18 ? 453 ARG A CB  1 
ATOM   129 C CG  . ARG A 1 26 ? -2.296  -5.308  7.317  1.00 50.83 ? 453 ARG A CG  1 
ATOM   130 C CD  . ARG A 1 26 ? -3.783  -5.037  7.544  1.00 61.04 ? 453 ARG A CD  1 
ATOM   131 N NE  . ARG A 1 26 ? -4.335  -5.687  8.741  1.00 65.31 ? 453 ARG A NE  1 
ATOM   132 C CZ  . ARG A 1 26 ? -5.549  -5.437  9.241  1.00 76.69 ? 453 ARG A CZ  1 
ATOM   133 N NH1 . ARG A 1 26 ? -6.356  -4.534  8.679  1.00 80.11 ? 453 ARG A NH1 1 
ATOM   134 N NH2 . ARG A 1 26 ? -5.963  -6.086  10.322 1.00 81.68 ? 453 ARG A NH2 1 
ATOM   135 N N   . VAL A 1 27 ? 1.498   -2.540  7.683  1.00 31.94 ? 454 VAL A N   1 
ATOM   136 C CA  . VAL A 1 27 ? 2.282   -1.437  8.161  1.00 29.00 ? 454 VAL A CA  1 
ATOM   137 C C   . VAL A 1 27 ? 1.352   -0.313  8.639  1.00 29.85 ? 454 VAL A C   1 
ATOM   138 O O   . VAL A 1 27 ? 0.326   -0.047  8.022  1.00 28.25 ? 454 VAL A O   1 
ATOM   139 C CB  . VAL A 1 27 ? 3.221   -0.938  7.053  1.00 31.81 ? 454 VAL A CB  1 
ATOM   140 C CG1 . VAL A 1 27 ? 4.009   0.297   7.509  1.00 31.37 ? 454 VAL A CG1 1 
ATOM   141 C CG2 . VAL A 1 27 ? 4.179   -2.068  6.631  1.00 34.74 ? 454 VAL A CG2 1 
ATOM   142 N N   . TYR A 1 28 ? 1.681   0.294   9.771  1.00 27.24 ? 455 TYR A N   1 
ATOM   143 C CA  . TYR A 1 28 ? 0.993   1.511   10.223 1.00 28.90 ? 455 TYR A CA  1 
ATOM   144 C C   . TYR A 1 28 ? 1.968   2.478   10.904 1.00 30.33 ? 455 TYR A C   1 
ATOM   145 O O   . TYR A 1 28 ? 3.185   2.203   11.041 1.00 27.64 ? 455 TYR A O   1 
ATOM   146 C CB  . TYR A 1 28 ? -0.166  1.169   11.140 1.00 27.72 ? 455 TYR A CB  1 
ATOM   147 C CG  . TYR A 1 28 ? 0.247   0.533   12.460 1.00 30.18 ? 455 TYR A CG  1 
ATOM   148 C CD1 . TYR A 1 28 ? 0.552   -0.819  12.545 1.00 29.53 ? 455 TYR A CD1 1 
ATOM   149 C CD2 . TYR A 1 28 ? 0.321   1.294   13.626 1.00 28.67 ? 455 TYR A CD2 1 
ATOM   150 C CE1 . TYR A 1 28 ? 0.901   -1.399  13.757 1.00 30.40 ? 455 TYR A CE1 1 
ATOM   151 C CE2 . TYR A 1 28 ? 0.694   0.724   14.826 1.00 30.55 ? 455 TYR A CE2 1 
ATOM   152 C CZ  . TYR A 1 28 ? 0.956   -0.609  14.891 1.00 30.32 ? 455 TYR A CZ  1 
ATOM   153 O OH  . TYR A 1 28 ? 1.313   -1.141  16.090 1.00 29.24 ? 455 TYR A OH  1 
ATOM   154 N N   . PHE A 1 29 ? 1.438   3.628   11.295 1.00 26.84 ? 456 PHE A N   1 
ATOM   155 C CA  . PHE A 1 29 ? 2.248   4.643   11.877 1.00 27.74 ? 456 PHE A CA  1 
ATOM   156 C C   . PHE A 1 29 ? 1.612   5.153   13.177 1.00 29.80 ? 456 PHE A C   1 
ATOM   157 O O   . PHE A 1 29 ? 0.394   5.304   13.276 1.00 29.53 ? 456 PHE A O   1 
ATOM   158 C CB  . PHE A 1 29 ? 2.455   5.758   10.869 1.00 29.38 ? 456 PHE A CB  1 
ATOM   159 C CG  . PHE A 1 29 ? 3.068   5.289   9.566  1.00 27.62 ? 456 PHE A CG  1 
ATOM   160 C CD1 . PHE A 1 29 ? 2.262   4.739   8.560  1.00 30.57 ? 456 PHE A CD1 1 
ATOM   161 C CD2 . PHE A 1 29 ? 4.416   5.438   9.324  1.00 31.36 ? 456 PHE A CD2 1 
ATOM   162 C CE1 . PHE A 1 29 ? 2.800   4.322   7.371  1.00 29.74 ? 456 PHE A CE1 1 
ATOM   163 C CE2 . PHE A 1 29 ? 4.959   5.014   8.124  1.00 33.71 ? 456 PHE A CE2 1 
ATOM   164 C CZ  . PHE A 1 29 ? 4.148   4.463   7.148  1.00 30.67 ? 456 PHE A CZ  1 
ATOM   165 N N   . VAL A 1 30 ? 2.456   5.391   14.182 1.00 31.07 ? 457 VAL A N   1 
ATOM   166 C CA  . VAL A 1 30 ? 1.976   5.744   15.504 1.00 32.42 ? 457 VAL A CA  1 
ATOM   167 C C   . VAL A 1 30 ? 2.555   7.098   15.851 1.00 31.10 ? 457 VAL A C   1 
ATOM   168 O O   . VAL A 1 30 ? 3.731   7.330   15.651 1.00 26.51 ? 457 VAL A O   1 
ATOM   169 C CB  . VAL A 1 30 ? 2.460   4.760   16.584 1.00 35.58 ? 457 VAL A CB  1 
ATOM   170 C CG1 . VAL A 1 30 ? 1.874   5.137   17.939 1.00 40.09 ? 457 VAL A CG1 1 
ATOM   171 C CG2 . VAL A 1 30 ? 2.110   3.345   16.239 1.00 37.13 ? 457 VAL A CG2 1 
ATOM   172 N N   . ASN A 1 31 ? 1.719   7.981   16.382 1.00 32.45 ? 458 ASN A N   1 
ATOM   173 C CA  . ASN A 1 31 ? 2.215   9.246   16.854 1.00 31.67 ? 458 ASN A CA  1 
ATOM   174 C C   . ASN A 1 31 ? 2.119   9.253   18.360 1.00 30.35 ? 458 ASN A C   1 
ATOM   175 O O   . ASN A 1 31 ? 0.988   9.303   18.928 1.00 29.76 ? 458 ASN A O   1 
ATOM   176 C CB  . ASN A 1 31 ? 1.426   10.399  16.283 1.00 31.21 ? 458 ASN A CB  1 
ATOM   177 C CG  . ASN A 1 31 ? 1.929   11.727  16.800 1.00 35.52 ? 458 ASN A CG  1 
ATOM   178 O OD1 . ASN A 1 31 ? 2.736   11.772  17.719 1.00 35.81 ? 458 ASN A OD1 1 
ATOM   179 N ND2 . ASN A 1 31 ? 1.466   12.799  16.218 1.00 39.45 ? 458 ASN A ND2 1 
ATOM   180 N N   . HIS A 1 32 ? 3.297   9.240   18.992 1.00 27.66 ? 459 HIS A N   1 
ATOM   181 C CA  . HIS A 1 32 ? 3.437   9.039   20.428 1.00 29.68 ? 459 HIS A CA  1 
ATOM   182 C C   . HIS A 1 32 ? 3.042   10.278  21.239 1.00 32.87 ? 459 HIS A C   1 
ATOM   183 O O   . HIS A 1 32 ? 2.826   10.194  22.440 1.00 35.58 ? 459 HIS A O   1 
ATOM   184 C CB  . HIS A 1 32 ? 4.873   8.578   20.771 1.00 28.36 ? 459 HIS A CB  1 
ATOM   185 C CG  . HIS A 1 32 ? 5.159   7.158   20.379 1.00 27.93 ? 459 HIS A CG  1 
ATOM   186 N ND1 . HIS A 1 32 ? 4.782   6.084   21.155 1.00 28.71 ? 459 HIS A ND1 1 
ATOM   187 C CD2 . HIS A 1 32 ? 5.785   6.633   19.295 1.00 27.70 ? 459 HIS A CD2 1 
ATOM   188 C CE1 . HIS A 1 32 ? 5.169   4.956   20.572 1.00 27.98 ? 459 HIS A CE1 1 
ATOM   189 N NE2 . HIS A 1 32 ? 5.800   5.262   19.453 1.00 25.71 ? 459 HIS A NE2 1 
ATOM   190 N N   . ASN A 1 33 ? 2.941   11.421  20.567 1.00 32.31 ? 460 ASN A N   1 
ATOM   191 C CA  . ASN A 1 33 ? 2.455   12.647  21.198 1.00 35.60 ? 460 ASN A CA  1 
ATOM   192 C C   . ASN A 1 33 ? 0.954   12.631  21.376 1.00 36.08 ? 460 ASN A C   1 
ATOM   193 O O   . ASN A 1 33 ? 0.477   12.957  22.446 1.00 40.56 ? 460 ASN A O   1 
ATOM   194 C CB  . ASN A 1 33 ? 2.864   13.868  20.359 1.00 34.98 ? 460 ASN A CB  1 
ATOM   195 C CG  . ASN A 1 33 ? 4.362   14.061  20.350 1.00 35.66 ? 460 ASN A CG  1 
ATOM   196 O OD1 . ASN A 1 33 ? 4.981   14.046  21.394 1.00 43.10 ? 460 ASN A OD1 1 
ATOM   197 N ND2 . ASN A 1 33 ? 4.951   14.201  19.192 1.00 34.45 ? 460 ASN A ND2 1 
ATOM   198 N N   . THR A 1 34 ? 0.220   12.247  20.319 1.00 35.70 ? 461 THR A N   1 
ATOM   199 C CA  . THR A 1 34 ? -1.252  12.313  20.298 1.00 36.89 ? 461 THR A CA  1 
ATOM   200 C C   . THR A 1 34 ? -1.870  10.962  20.592 1.00 38.02 ? 461 THR A C   1 
ATOM   201 O O   . THR A 1 34 ? -3.093  10.857  20.802 1.00 39.23 ? 461 THR A O   1 
ATOM   202 C CB  . THR A 1 34 ? -1.773  12.787  18.930 1.00 36.83 ? 461 THR A CB  1 
ATOM   203 O OG1 . THR A 1 34 ? -1.242  11.948  17.896 1.00 34.33 ? 461 THR A OG1 1 
ATOM   204 C CG2 . THR A 1 34 ? -1.355  14.233  18.665 1.00 37.77 ? 461 THR A CG2 1 
ATOM   205 N N   . ARG A 1 35 ? -1.017  9.936   20.621 1.00 38.17 ? 462 ARG A N   1 
ATOM   206 C CA  . ARG A 1 35 ? -1.418  8.557   20.868 1.00 40.89 ? 462 ARG A CA  1 
ATOM   207 C C   . ARG A 1 35 ? -2.360  8.064   19.817 1.00 42.60 ? 462 ARG A C   1 
ATOM   208 O O   . ARG A 1 35 ? -3.228  7.253   20.106 1.00 48.07 ? 462 ARG A O   1 
ATOM   209 C CB  . ARG A 1 35 ? -2.078  8.398   22.247 1.00 48.65 ? 462 ARG A CB  1 
ATOM   210 C CG  . ARG A 1 35 ? -1.160  8.660   23.406 1.00 51.73 ? 462 ARG A CG  1 
ATOM   211 C CD  . ARG A 1 35 ? -1.970  8.741   24.690 1.00 61.21 ? 462 ARG A CD  1 
ATOM   212 N NE  . ARG A 1 35 ? -1.116  8.790   25.873 1.00 63.23 ? 462 ARG A NE  1 
ATOM   213 C CZ  . ARG A 1 35 ? -1.006  7.818   26.783 1.00 72.59 ? 462 ARG A CZ  1 
ATOM   214 N NH1 . ARG A 1 35 ? -0.188  7.980   27.821 1.00 74.05 ? 462 ARG A NH1 1 
ATOM   215 N NH2 . ARG A 1 35 ? -1.701  6.683   26.676 1.00 75.47 ? 462 ARG A NH2 1 
ATOM   216 N N   . ILE A 1 36 ? -2.215  8.565   18.603 1.00 40.19 ? 463 ILE A N   1 
ATOM   217 C CA  . ILE A 1 36 ? -3.022  8.073   17.490 1.00 43.43 ? 463 ILE A CA  1 
ATOM   218 C C   . ILE A 1 36 ? -2.164  7.158   16.622 1.00 37.45 ? 463 ILE A C   1 
ATOM   219 O O   . ILE A 1 36 ? -0.969  7.359   16.503 1.00 34.46 ? 463 ILE A O   1 
ATOM   220 C CB  . ILE A 1 36 ? -3.624  9.219   16.651 1.00 46.83 ? 463 ILE A CB  1 
ATOM   221 C CG1 . ILE A 1 36 ? -2.543  9.927   15.806 1.00 50.51 ? 463 ILE A CG1 1 
ATOM   222 C CG2 . ILE A 1 36 ? -4.364  10.197  17.560 1.00 49.46 ? 463 ILE A CG2 1 
ATOM   223 C CD1 . ILE A 1 36 ? -2.940  11.315  15.306 1.00 56.83 ? 463 ILE A CD1 1 
ATOM   224 N N   . THR A 1 37 ? -2.801  6.124   16.084 1.00 37.60 ? 464 THR A N   1 
ATOM   225 C CA  . THR A 1 37 ? -2.218  5.228   15.105 1.00 34.73 ? 464 THR A CA  1 
ATOM   226 C C   . THR A 1 37 ? -3.024  5.384   13.825 1.00 36.68 ? 464 THR A C   1 
ATOM   227 O O   . THR A 1 37 ? -4.254  5.604   13.881 1.00 36.64 ? 464 THR A O   1 
ATOM   228 C CB  . THR A 1 37 ? -2.341  3.769   15.574 1.00 35.83 ? 464 THR A CB  1 
ATOM   229 O OG1 . THR A 1 37 ? -3.706  3.484   15.868 1.00 36.95 ? 464 THR A OG1 1 
ATOM   230 C CG2 . THR A 1 37 ? -1.531  3.533   16.833 1.00 34.46 ? 464 THR A CG2 1 
ATOM   231 N N   . GLN A 1 38 ? -2.355  5.279   12.679 1.00 32.40 ? 465 GLN A N   1 
ATOM   232 C CA  . GLN A 1 38 ? -3.026  5.440   11.386 1.00 32.48 ? 465 GLN A CA  1 
ATOM   233 C C   . GLN A 1 38 ? -2.261  4.682   10.304 1.00 30.99 ? 465 GLN A C   1 
ATOM   234 O O   . GLN A 1 38 ? -1.055  4.455   10.406 1.00 28.75 ? 465 GLN A O   1 
ATOM   235 C CB  . GLN A 1 38 ? -3.152  6.926   11.010 1.00 33.25 ? 465 GLN A CB  1 
ATOM   236 C CG  . GLN A 1 38 ? -1.790  7.586   10.776 1.00 31.32 ? 465 GLN A CG  1 
ATOM   237 C CD  . GLN A 1 38 ? -1.876  9.069   10.490 1.00 33.80 ? 465 GLN A CD  1 
ATOM   238 O OE1 . GLN A 1 38 ? -2.684  9.767   11.074 1.00 36.82 ? 465 GLN A OE1 1 
ATOM   239 N NE2 . GLN A 1 38 ? -1.008  9.561   9.620  1.00 33.08 ? 465 GLN A NE2 1 
ATOM   240 N N   . TRP A 1 39 ? -2.970  4.314   9.251  1.00 32.04 ? 466 TRP A N   1 
ATOM   241 C CA  . TRP A 1 39 ? -2.379  3.550   8.182  1.00 34.07 ? 466 TRP A CA  1 
ATOM   242 C C   . TRP A 1 39 ? -1.466  4.447   7.344  1.00 33.65 ? 466 TRP A C   1 
ATOM   243 O O   . TRP A 1 39 ? -0.519  3.970   6.746  1.00 37.49 ? 466 TRP A O   1 
ATOM   244 C CB  . TRP A 1 39 ? -3.474  2.944   7.296  1.00 36.50 ? 466 TRP A CB  1 
ATOM   245 C CG  . TRP A 1 39 ? -4.439  1.934   7.938  1.00 35.62 ? 466 TRP A CG  1 
ATOM   246 C CD1 . TRP A 1 39 ? -5.807  1.978   7.905  1.00 38.20 ? 466 TRP A CD1 1 
ATOM   247 C CD2 . TRP A 1 39 ? -4.103  0.691   8.580  1.00 34.94 ? 466 TRP A CD2 1 
ATOM   248 N NE1 . TRP A 1 39 ? -6.341  0.865   8.519  1.00 36.86 ? 466 TRP A NE1 1 
ATOM   249 C CE2 . TRP A 1 39 ? -5.320  0.062   8.945  1.00 34.84 ? 466 TRP A CE2 1 
ATOM   250 C CE3 . TRP A 1 39 ? -2.899  0.059   8.892  1.00 32.84 ? 466 TRP A CE3 1 
ATOM   251 C CZ2 . TRP A 1 39 ? -5.361  -1.157  9.612  1.00 36.46 ? 466 TRP A CZ2 1 
ATOM   252 C CZ3 . TRP A 1 39 ? -2.943  -1.171  9.568  1.00 36.19 ? 466 TRP A CZ3 1 
ATOM   253 C CH2 . TRP A 1 39 ? -4.168  -1.758  9.919  1.00 36.20 ? 466 TRP A CH2 1 
ATOM   254 N N   . GLU A 1 40 ? -1.761  5.746   7.320  1.00 35.00 ? 467 GLU A N   1 
ATOM   255 C CA  . GLU A 1 40 ? -1.173  6.656   6.370  1.00 35.49 ? 467 GLU A CA  1 
ATOM   256 C C   . GLU A 1 40 ? 0.154   7.152   6.850  1.00 35.35 ? 467 GLU A C   1 
ATOM   257 O O   . GLU A 1 40 ? 0.323   7.519   8.000  1.00 35.70 ? 467 GLU A O   1 
ATOM   258 C CB  . GLU A 1 40 ? -2.093  7.840   6.117  1.00 38.82 ? 467 GLU A CB  1 
ATOM   259 C CG  . GLU A 1 40 ? -3.405  7.455   5.442  1.00 43.70 ? 467 GLU A CG  1 
ATOM   260 C CD  . GLU A 1 40 ? -4.458  6.902   6.414  1.00 46.78 ? 467 GLU A CD  1 
ATOM   261 O OE1 . GLU A 1 40 ? -4.308  7.070   7.658  1.00 42.18 ? 467 GLU A OE1 1 
ATOM   262 O OE2 . GLU A 1 40 ? -5.443  6.311   5.923  1.00 46.19 ? 467 GLU A OE2 1 
ATOM   263 N N   . ASP A 1 41 ? 1.108   7.179   5.943  1.00 38.77 ? 468 ASP A N   1 
ATOM   264 C CA  . ASP A 1 41 ? 2.424   7.691   6.255  1.00 35.13 ? 468 ASP A CA  1 
ATOM   265 C C   . ASP A 1 41 ? 2.245   9.193   6.460  1.00 36.37 ? 468 ASP A C   1 
ATOM   266 O O   . ASP A 1 41 ? 1.709   9.865   5.586  1.00 39.80 ? 468 ASP A O   1 
ATOM   267 C CB  . ASP A 1 41 ? 3.375   7.381   5.112  1.00 34.49 ? 468 ASP A CB  1 
ATOM   268 C CG  . ASP A 1 41 ? 4.789   7.677   5.444  1.00 34.76 ? 468 ASP A CG  1 
ATOM   269 O OD1 . ASP A 1 41 ? 5.036   8.616   6.222  1.00 31.09 ? 468 ASP A OD1 1 
ATOM   270 O OD2 . ASP A 1 41 ? 5.669   6.959   4.922  1.00 37.74 ? 468 ASP A OD2 1 
ATOM   271 N N   . PRO A 1 42 ? 2.637   9.719   7.648  1.00 38.74 ? 469 PRO A N   1 
ATOM   272 C CA  . PRO A 1 42 ? 2.537   11.162  7.896  1.00 37.68 ? 469 PRO A CA  1 
ATOM   273 C C   . PRO A 1 42 ? 3.361   11.965  6.899  1.00 44.32 ? 469 PRO A C   1 
ATOM   274 O O   . PRO A 1 42 ? 3.006   13.109  6.602  1.00 48.00 ? 469 PRO A O   1 
ATOM   275 C CB  . PRO A 1 42 ? 3.098   11.317  9.310  1.00 36.46 ? 469 PRO A CB  1 
ATOM   276 C CG  . PRO A 1 42 ? 4.000   10.134  9.503  1.00 33.77 ? 469 PRO A CG  1 
ATOM   277 C CD  . PRO A 1 42 ? 3.257   9.022   8.792  1.00 32.70 ? 469 PRO A CD  1 
ATOM   278 N N   . ARG A 1 43 ? 4.441   11.380  6.370  1.00 41.17 ? 470 ARG A N   1 
ATOM   279 C CA  . ARG A 1 43 ? 5.272   12.085  5.392  1.00 47.10 ? 470 ARG A CA  1 
ATOM   280 C C   . ARG A 1 43 ? 4.556   12.310  4.065  1.00 51.71 ? 470 ARG A C   1 
ATOM   281 O O   . ARG A 1 43 ? 4.923   13.202  3.310  1.00 53.49 ? 470 ARG A O   1 
ATOM   282 C CB  . ARG A 1 43 ? 6.570   11.343  5.153  1.00 45.92 ? 470 ARG A CB  1 
ATOM   283 C CG  . ARG A 1 43 ? 7.459   11.287  6.381  1.00 42.87 ? 470 ARG A CG  1 
ATOM   284 C CD  . ARG A 1 43 ? 8.542   10.247  6.203  1.00 44.13 ? 470 ARG A CD  1 
ATOM   285 N NE  . ARG A 1 43 ? 7.984   8.899   6.131  1.00 43.54 ? 470 ARG A NE  1 
ATOM   286 C CZ  . ARG A 1 43 ? 8.710   7.790   6.060  1.00 45.76 ? 470 ARG A CZ  1 
ATOM   287 N NH1 . ARG A 1 43 ? 10.046  7.845   6.044  1.00 48.91 ? 470 ARG A NH1 1 
ATOM   288 N NH2 . ARG A 1 43 ? 8.104   6.621   6.001  1.00 45.55 ? 470 ARG A NH2 1 
ATOM   289 N N   . SER A 1 44 ? 3.532   11.504  3.789  1.00 55.01 ? 471 SER A N   1 
ATOM   290 C CA  . SER A 1 44 ? 2.644   11.749  2.662  1.00 60.73 ? 471 SER A CA  1 
ATOM   291 C C   . SER A 1 44 ? 1.646   12.889  2.946  1.00 66.33 ? 471 SER A C   1 
ATOM   292 O O   . SER A 1 44 ? 0.899   13.277  2.059  1.00 72.38 ? 471 SER A O   1 
ATOM   293 C CB  . SER A 1 44 ? 1.883   10.473  2.283  1.00 60.09 ? 471 SER A CB  1 
ATOM   294 O OG  . SER A 1 44 ? 2.763   9.448   1.856  1.00 60.21 ? 471 SER A OG  1 
ATOM   295 N N   . GLN A 1 45 ? 1.655   13.438  4.162  1.00 67.71 ? 472 GLN A N   1 
ATOM   296 C CA  . GLN A 1 45 ? 0.697   14.465  4.577  1.00 68.73 ? 472 GLN A CA  1 
ATOM   297 C C   . GLN A 1 45 ? 1.419   15.699  5.108  1.00 70.60 ? 472 GLN A C   1 
ATOM   298 O O   . GLN A 1 45 ? 0.798   16.738  5.346  1.00 67.67 ? 472 GLN A O   1 
ATOM   299 C CB  . GLN A 1 45 ? -0.220  13.904  5.663  1.00 68.78 ? 472 GLN A CB  1 
ATOM   300 C CG  . GLN A 1 45 ? -0.853  12.557  5.310  1.00 67.66 ? 472 GLN A CG  1 
ATOM   301 C CD  . GLN A 1 45 ? -1.539  11.878  6.496  1.00 67.68 ? 472 GLN A CD  1 
ATOM   302 O OE1 . GLN A 1 45 ? -1.206  12.128  7.653  1.00 64.03 ? 472 GLN A OE1 1 
ATOM   303 N NE2 . GLN A 1 45 ? -2.495  11.003  6.203  1.00 67.53 ? 472 GLN A NE2 1 
ATOM   304 N N   A LEU B 1 10 ? -29.971 7.926   39.808 0.50 52.46 ? 437 LEU B N   1 
ATOM   305 N N   B LEU B 1 10 ? -27.472 7.892   39.339 0.50 50.43 ? 437 LEU B N   1 
ATOM   306 C CA  A LEU B 1 10 ? -28.795 7.876   38.879 0.50 49.67 ? 437 LEU B CA  1 
ATOM   307 C CA  B LEU B 1 10 ? -28.897 7.937   38.924 0.50 51.43 ? 437 LEU B CA  1 
ATOM   308 C C   . LEU B 1 10 ? -29.057 8.640   37.571 1.00 50.37 ? 437 LEU B C   1 
ATOM   309 O O   . LEU B 1 10 ? -28.262 9.516   37.187 1.00 50.11 ? 437 LEU B O   1 
ATOM   310 C CB  A LEU B 1 10 ? -28.410 6.426   38.556 0.50 47.11 ? 437 LEU B CB  1 
ATOM   311 C CB  B LEU B 1 10 ? -29.759 8.649   39.983 0.50 54.26 ? 437 LEU B CB  1 
ATOM   312 N N   . GLY B 1 11 ? -30.123 8.275   36.876 1.00 48.09 ? 438 GLY B N   1 
ATOM   313 C CA  . GLY B 1 11 ? -30.508 8.934   35.656 1.00 46.45 ? 438 GLY B CA  1 
ATOM   314 C C   . GLY B 1 11 ? -29.856 8.371   34.409 1.00 45.20 ? 438 GLY B C   1 
ATOM   315 O O   . GLY B 1 11 ? -28.925 7.548   34.486 1.00 39.61 ? 438 GLY B O   1 
ATOM   316 N N   . PRO B 1 12 ? -30.339 8.824   33.238 1.00 45.55 ? 439 PRO B N   1 
ATOM   317 C CA  . PRO B 1 12 ? -29.733 8.407   31.995 1.00 45.34 ? 439 PRO B CA  1 
ATOM   318 C C   . PRO B 1 12 ? -28.391 9.113   31.760 1.00 39.56 ? 439 PRO B C   1 
ATOM   319 O O   . PRO B 1 12 ? -28.110 10.175  32.345 1.00 37.35 ? 439 PRO B O   1 
ATOM   320 C CB  . PRO B 1 12 ? -30.787 8.801   30.942 1.00 47.44 ? 439 PRO B CB  1 
ATOM   321 C CG  . PRO B 1 12 ? -31.540 9.929   31.543 1.00 49.66 ? 439 PRO B CG  1 
ATOM   322 C CD  . PRO B 1 12 ? -31.503 9.714   33.033 1.00 50.51 ? 439 PRO B CD  1 
ATOM   323 N N   . LEU B 1 13 ? -27.564 8.506   30.918 1.00 37.49 ? 440 LEU B N   1 
ATOM   324 C CA  . LEU B 1 13 ? -26.321 9.131   30.509 1.00 33.06 ? 440 LEU B CA  1 
ATOM   325 C C   . LEU B 1 13 ? -26.638 10.437  29.795 1.00 31.38 ? 440 LEU B C   1 
ATOM   326 O O   . LEU B 1 13 ? -27.731 10.608  29.276 1.00 30.03 ? 440 LEU B O   1 
ATOM   327 C CB  . LEU B 1 13 ? -25.535 8.215   29.584 1.00 37.23 ? 440 LEU B CB  1 
ATOM   328 C CG  . LEU B 1 13 ? -25.033 6.918   30.221 1.00 36.69 ? 440 LEU B CG  1 
ATOM   329 C CD1 . LEU B 1 13 ? -24.672 5.924   29.126 1.00 36.31 ? 440 LEU B CD1 1 
ATOM   330 C CD2 . LEU B 1 13 ? -23.853 7.189   31.141 1.00 36.52 ? 440 LEU B CD2 1 
ATOM   331 N N   . PRO B 1 14 ? -25.685 11.368  29.765 1.00 31.60 ? 441 PRO B N   1 
ATOM   332 C CA  . PRO B 1 14 ? -25.933 12.594  29.021 1.00 30.99 ? 441 PRO B CA  1 
ATOM   333 C C   . PRO B 1 14 ? -26.031 12.384  27.488 1.00 32.38 ? 441 PRO B C   1 
ATOM   334 O O   . PRO B 1 14 ? -25.498 11.375  26.955 1.00 27.81 ? 441 PRO B O   1 
ATOM   335 C CB  . PRO B 1 14 ? -24.731 13.460  29.391 1.00 33.46 ? 441 PRO B CB  1 
ATOM   336 C CG  . PRO B 1 14 ? -24.345 12.979  30.773 1.00 35.65 ? 441 PRO B CG  1 
ATOM   337 C CD  . PRO B 1 14 ? -24.526 11.495  30.669 1.00 33.78 ? 441 PRO B CD  1 
ATOM   338 N N   . PRO B 1 15 ? -26.721 13.297  26.783 1.00 33.70 ? 442 PRO B N   1 
ATOM   339 C CA  . PRO B 1 15 ? -26.762 13.229  25.312 1.00 36.08 ? 442 PRO B CA  1 
ATOM   340 C C   . PRO B 1 15 ? -25.378 12.917  24.712 1.00 32.23 ? 442 PRO B C   1 
ATOM   341 O O   . PRO B 1 15 ? -24.388 13.513  25.118 1.00 33.90 ? 442 PRO B O   1 
ATOM   342 C CB  . PRO B 1 15 ? -27.236 14.635  24.906 1.00 39.38 ? 442 PRO B CB  1 
ATOM   343 C CG  . PRO B 1 15 ? -28.041 15.135  26.074 1.00 40.44 ? 442 PRO B CG  1 
ATOM   344 C CD  . PRO B 1 15 ? -27.466 14.459  27.306 1.00 39.31 ? 442 PRO B CD  1 
ATOM   345 N N   . GLY B 1 16 ? -25.321 11.926  23.820 1.00 32.27 ? 443 GLY B N   1 
ATOM   346 C CA  . GLY B 1 16 ? -24.105 11.573  23.079 1.00 30.87 ? 443 GLY B CA  1 
ATOM   347 C C   . GLY B 1 16 ? -23.295 10.412  23.624 1.00 31.56 ? 443 GLY B C   1 
ATOM   348 O O   . GLY B 1 16 ? -22.412 9.900   22.926 1.00 33.11 ? 443 GLY B O   1 
ATOM   349 N N   . TRP B 1 17 ? -23.591 9.976   24.863 1.00 29.54 ? 444 TRP B N   1 
ATOM   350 C CA  . TRP B 1 17 ? -22.753 9.002   25.563 1.00 27.95 ? 444 TRP B CA  1 
ATOM   351 C C   . TRP B 1 17 ? -23.307 7.603   25.541 1.00 25.99 ? 444 TRP B C   1 
ATOM   352 O O   . TRP B 1 17 ? -24.511 7.406   25.506 1.00 25.60 ? 444 TRP B O   1 
ATOM   353 C CB  . TRP B 1 17 ? -22.614 9.390   27.031 1.00 29.77 ? 444 TRP B CB  1 
ATOM   354 C CG  . TRP B 1 17 ? -21.663 10.499  27.285 1.00 28.92 ? 444 TRP B CG  1 
ATOM   355 C CD1 . TRP B 1 17 ? -21.954 11.819  27.363 1.00 31.43 ? 444 TRP B CD1 1 
ATOM   356 C CD2 . TRP B 1 17 ? -20.277 10.372  27.516 1.00 29.01 ? 444 TRP B CD2 1 
ATOM   357 N NE1 . TRP B 1 17 ? -20.819 12.546  27.649 1.00 32.35 ? 444 TRP B NE1 1 
ATOM   358 C CE2 . TRP B 1 17 ? -19.764 11.684  27.727 1.00 32.39 ? 444 TRP B CE2 1 
ATOM   359 C CE3 . TRP B 1 17 ? -19.396 9.281   27.568 1.00 31.02 ? 444 TRP B CE3 1 
ATOM   360 C CZ2 . TRP B 1 17 ? -18.426 11.927  27.987 1.00 32.81 ? 444 TRP B CZ2 1 
ATOM   361 C CZ3 . TRP B 1 17 ? -18.058 9.523   27.823 1.00 31.23 ? 444 TRP B CZ3 1 
ATOM   362 C CH2 . TRP B 1 17 ? -17.582 10.849  28.024 1.00 34.57 ? 444 TRP B CH2 1 
ATOM   363 N N   . GLU B 1 18 ? -22.424 6.613   25.600 1.00 26.77 ? 445 GLU B N   1 
ATOM   364 C CA  . GLU B 1 18 ? -22.890 5.223   25.666 1.00 30.70 ? 445 GLU B CA  1 
ATOM   365 C C   . GLU B 1 18 ? -22.032 4.477   26.660 1.00 26.86 ? 445 GLU B C   1 
ATOM   366 O O   . GLU B 1 18 ? -20.882 4.786   26.763 1.00 26.53 ? 445 GLU B O   1 
ATOM   367 C CB  . GLU B 1 18 ? -22.842 4.587   24.264 1.00 31.17 ? 445 GLU B CB  1 
ATOM   368 C CG  . GLU B 1 18 ? -23.431 3.178   24.130 1.00 29.70 ? 445 GLU B CG  1 
ATOM   369 C CD  . GLU B 1 18 ? -23.020 2.498   22.802 1.00 28.47 ? 445 GLU B CD  1 
ATOM   370 O OE1 . GLU B 1 18 ? -22.426 3.169   21.929 1.00 23.94 ? 445 GLU B OE1 1 
ATOM   371 O OE2 . GLU B 1 18 ? -23.259 1.275   22.642 1.00 29.47 ? 445 GLU B OE2 1 
ATOM   372 N N   . LYS B 1 19 ? -22.637 3.536   27.406 1.00 27.78 ? 446 LYS B N   1 
ATOM   373 C CA  . LYS B 1 19 ? -21.946 2.716   28.364 1.00 29.84 ? 446 LYS B CA  1 
ATOM   374 C C   . LYS B 1 19 ? -21.663 1.428   27.676 1.00 31.42 ? 446 LYS B C   1 
ATOM   375 O O   . LYS B 1 19 ? -22.571 0.854   27.051 1.00 32.36 ? 446 LYS B O   1 
ATOM   376 C CB  . LYS B 1 19 ? -22.834 2.426   29.618 1.00 35.11 ? 446 LYS B CB  1 
ATOM   377 C CG  . LYS B 1 19 ? -22.153 1.549   30.671 1.00 36.16 ? 446 LYS B CG  1 
ATOM   378 C CD  . LYS B 1 19 ? -23.026 1.228   31.882 1.00 38.30 ? 446 LYS B CD  1 
ATOM   379 C CE  . LYS B 1 19 ? -23.551 -0.196  31.814 1.00 47.79 ? 446 LYS B CE  1 
ATOM   380 N NZ  . LYS B 1 19 ? -24.641 -0.445  32.806 1.00 49.75 ? 446 LYS B NZ  1 
ATOM   381 N N   . ARG B 1 20 ? -20.438 0.936   27.825 1.00 28.36 ? 447 ARG B N   1 
ATOM   382 C CA  . ARG B 1 20 ? -20.067 -0.389  27.333 1.00 31.94 ? 447 ARG B CA  1 
ATOM   383 C C   . ARG B 1 20 ? -19.267 -1.166  28.383 1.00 31.12 ? 447 ARG B C   1 
ATOM   384 O O   . ARG B 1 20 ? -18.787 -0.609  29.351 1.00 27.01 ? 447 ARG B O   1 
ATOM   385 C CB  . ARG B 1 20 ? -19.168 -0.259  26.097 1.00 36.20 ? 447 ARG B CB  1 
ATOM   386 C CG  . ARG B 1 20 ? -19.782 0.383   24.881 1.00 39.78 ? 447 ARG B CG  1 
ATOM   387 C CD  . ARG B 1 20 ? -20.478 -0.616  24.016 1.00 44.37 ? 447 ARG B CD  1 
ATOM   388 N NE  . ARG B 1 20 ? -20.235 -0.334  22.605 1.00 48.53 ? 447 ARG B NE  1 
ATOM   389 C CZ  . ARG B 1 20 ? -19.565 -1.122  21.761 1.00 49.41 ? 447 ARG B CZ  1 
ATOM   390 N NH1 . ARG B 1 20 ? -19.025 -2.285  22.142 1.00 46.65 ? 447 ARG B NH1 1 
ATOM   391 N NH2 . ARG B 1 20 ? -19.435 -0.740  20.502 1.00 51.18 ? 447 ARG B NH2 1 
ATOM   392 N N   . THR B 1 21 ? -19.112 -2.457  28.136 1.00 31.54 ? 448 THR B N   1 
ATOM   393 C CA  . THR B 1 21 ? -18.190 -3.336  28.864 1.00 32.92 ? 448 THR B CA  1 
ATOM   394 C C   . THR B 1 21 ? -17.157 -3.892  27.885 1.00 34.41 ? 448 THR B C   1 
ATOM   395 O O   . THR B 1 21 ? -17.502 -4.220  26.742 1.00 33.66 ? 448 THR B O   1 
ATOM   396 C CB  . THR B 1 21 ? -18.968 -4.518  29.497 1.00 36.17 ? 448 THR B CB  1 
ATOM   397 O OG1 . THR B 1 21 ? -19.939 -4.010  30.394 1.00 33.19 ? 448 THR B OG1 1 
ATOM   398 C CG2 . THR B 1 21 ? -18.061 -5.409  30.286 1.00 44.17 ? 448 THR B CG2 1 
ATOM   399 N N   . ASP B 1 22 ? -15.891 -3.978  28.304 1.00 33.99 ? 449 ASP B N   1 
ATOM   400 C CA  . ASP B 1 22 ? -14.871 -4.654  27.483 1.00 37.50 ? 449 ASP B CA  1 
ATOM   401 C C   . ASP B 1 22 ? -14.876 -6.182  27.649 1.00 40.20 ? 449 ASP B C   1 
ATOM   402 O O   . ASP B 1 22 ? -15.636 -6.742  28.440 1.00 43.87 ? 449 ASP B O   1 
ATOM   403 C CB  . ASP B 1 22 ? -13.459 -4.029  27.660 1.00 36.37 ? 449 ASP B CB  1 
ATOM   404 C CG  . ASP B 1 22 ? -12.819 -4.249  29.057 1.00 37.23 ? 449 ASP B CG  1 
ATOM   405 O OD1 . ASP B 1 22 ? -13.160 -5.199  29.806 1.00 40.56 ? 449 ASP B OD1 1 
ATOM   406 O OD2 . ASP B 1 22 ? -11.891 -3.460  29.353 1.00 33.00 ? 449 ASP B OD2 1 
ATOM   407 N N   . SER B 1 23 ? -14.058 -6.861  26.867 1.00 45.84 ? 450 SER B N   1 
ATOM   408 C CA  . SER B 1 23 ? -14.029 -8.327  26.886 1.00 49.00 ? 450 SER B CA  1 
ATOM   409 C C   . SER B 1 23 ? -13.651 -8.853  28.282 1.00 52.53 ? 450 SER B C   1 
ATOM   410 O O   . SER B 1 23 ? -14.168 -9.877  28.716 1.00 51.15 ? 450 SER B O   1 
ATOM   411 C CB  . SER B 1 23 ? -13.079 -8.872  25.800 1.00 50.79 ? 450 SER B CB  1 
ATOM   412 O OG  . SER B 1 23 ? -12.007 -7.982  25.545 1.00 47.37 ? 450 SER B OG  1 
ATOM   413 N N   . ASN B 1 24 ? -12.784 -8.108  28.977 1.00 53.13 ? 451 ASN B N   1 
ATOM   414 C CA  . ASN B 1 24 ? -12.415 -8.385  30.377 1.00 55.64 ? 451 ASN B CA  1 
ATOM   415 C C   . ASN B 1 24 ? -13.502 -8.125  31.415 1.00 51.60 ? 451 ASN B C   1 
ATOM   416 O O   . ASN B 1 24 ? -13.333 -8.524  32.557 1.00 48.93 ? 451 ASN B O   1 
ATOM   417 C CB  . ASN B 1 24 ? -11.172 -7.562  30.793 1.00 55.78 ? 451 ASN B CB  1 
ATOM   418 C CG  . ASN B 1 24 ? -9.895  -8.078  30.174 1.00 60.02 ? 451 ASN B CG  1 
ATOM   419 O OD1 . ASN B 1 24 ? -9.775  -9.253  29.872 1.00 65.41 ? 451 ASN B OD1 1 
ATOM   420 N ND2 . ASN B 1 24 ? -8.930  -7.195  29.992 1.00 60.12 ? 451 ASN B ND2 1 
ATOM   421 N N   . GLY B 1 25 ? -14.576 -7.424  31.042 1.00 48.01 ? 452 GLY B N   1 
ATOM   422 C CA  . GLY B 1 25 ? -15.677 -7.148  31.963 1.00 45.16 ? 452 GLY B CA  1 
ATOM   423 C C   . GLY B 1 25 ? -15.662 -5.737  32.536 1.00 40.77 ? 452 GLY B C   1 
ATOM   424 O O   . GLY B 1 25 ? -16.538 -5.391  33.317 1.00 40.67 ? 452 GLY B O   1 
ATOM   425 N N   . ARG B 1 26 ? -14.685 -4.910  32.148 1.00 40.74 ? 453 ARG B N   1 
ATOM   426 C CA  . ARG B 1 26 ? -14.554 -3.591  32.729 1.00 35.70 ? 453 ARG B CA  1 
ATOM   427 C C   . ARG B 1 26 ? -15.478 -2.582  32.019 1.00 35.98 ? 453 ARG B C   1 
ATOM   428 O O   . ARG B 1 26 ? -15.471 -2.465  30.783 1.00 31.83 ? 453 ARG B O   1 
ATOM   429 C CB  . ARG B 1 26 ? -13.075 -3.097  32.754 1.00 39.90 ? 453 ARG B CB  1 
ATOM   430 C CG  . ARG B 1 26 ? -12.918 -1.811  33.616 1.00 41.25 ? 453 ARG B CG  1 
ATOM   431 C CD  . ARG B 1 26 ? -11.507 -1.301  33.968 1.00 42.00 ? 453 ARG B CD  1 
ATOM   432 N NE  . ARG B 1 26 ? -11.672 -0.060  34.738 1.00 42.35 ? 453 ARG B NE  1 
ATOM   433 C CZ  . ARG B 1 26 ? -10.706 0.716   35.214 1.00 39.28 ? 453 ARG B CZ  1 
ATOM   434 N NH1 . ARG B 1 26 ? -9.456  0.416   35.009 1.00 44.50 ? 453 ARG B NH1 1 
ATOM   435 N NH2 . ARG B 1 26 ? -11.015 1.816   35.894 1.00 38.35 ? 453 ARG B NH2 1 
ATOM   436 N N   . VAL B 1 27 ? -16.260 -1.846  32.808 1.00 31.10 ? 454 VAL B N   1 
ATOM   437 C CA  . VAL B 1 27 ? -17.220 -0.885  32.283 1.00 27.32 ? 454 VAL B CA  1 
ATOM   438 C C   . VAL B 1 27 ? -16.531 0.367   31.803 1.00 27.65 ? 454 VAL B C   1 
ATOM   439 O O   . VAL B 1 27 ? -15.738 0.956   32.533 1.00 26.66 ? 454 VAL B O   1 
ATOM   440 C CB  . VAL B 1 27 ? -18.276 -0.474  33.368 1.00 27.56 ? 454 VAL B CB  1 
ATOM   441 C CG1 . VAL B 1 27 ? -19.301 0.504   32.796 1.00 27.34 ? 454 VAL B CG1 1 
ATOM   442 C CG2 . VAL B 1 27 ? -19.004 -1.691  33.880 1.00 29.10 ? 454 VAL B CG2 1 
ATOM   443 N N   . TYR B 1 28 ? -16.873 0.835   30.601 1.00 27.67 ? 455 TYR B N   1 
ATOM   444 C CA  . TYR B 1 28 ? -16.371 2.124   30.156 1.00 25.74 ? 455 TYR B CA  1 
ATOM   445 C C   . TYR B 1 28 ? -17.451 2.885   29.452 1.00 28.46 ? 455 TYR B C   1 
ATOM   446 O O   . TYR B 1 28 ? -18.588 2.389   29.292 1.00 26.62 ? 455 TYR B O   1 
ATOM   447 C CB  . TYR B 1 28 ? -15.141 1.945   29.271 1.00 27.82 ? 455 TYR B CB  1 
ATOM   448 C CG  . TYR B 1 28 ? -15.409 1.265   27.949 1.00 25.01 ? 455 TYR B CG  1 
ATOM   449 C CD1 . TYR B 1 28 ? -15.553 -0.111  27.874 1.00 24.83 ? 455 TYR B CD1 1 
ATOM   450 C CD2 . TYR B 1 28 ? -15.546 2.014   26.777 1.00 26.82 ? 455 TYR B CD2 1 
ATOM   451 C CE1 . TYR B 1 28 ? -15.776 -0.742  26.655 1.00 26.89 ? 455 TYR B CE1 1 
ATOM   452 C CE2 . TYR B 1 28 ? -15.776 1.397   25.545 1.00 26.45 ? 455 TYR B CE2 1 
ATOM   453 C CZ  . TYR B 1 28 ? -15.885 0.021   25.493 1.00 26.29 ? 455 TYR B CZ  1 
ATOM   454 O OH  . TYR B 1 28 ? -16.109 -0.591  24.298 1.00 27.43 ? 455 TYR B OH  1 
ATOM   455 N N   . PHE B 1 29 ? -17.118 4.125   29.081 1.00 26.37 ? 456 PHE B N   1 
ATOM   456 C CA  . PHE B 1 29 ? -18.090 5.035   28.551 1.00 26.80 ? 456 PHE B CA  1 
ATOM   457 C C   . PHE B 1 29 ? -17.589 5.618   27.230 1.00 28.49 ? 456 PHE B C   1 
ATOM   458 O O   . PHE B 1 29 ? -16.403 5.917   27.105 1.00 28.08 ? 456 PHE B O   1 
ATOM   459 C CB  . PHE B 1 29 ? -18.400 6.087   29.608 1.00 29.12 ? 456 PHE B CB  1 
ATOM   460 C CG  . PHE B 1 29 ? -18.991 5.501   30.841 1.00 29.32 ? 456 PHE B CG  1 
ATOM   461 C CD1 . PHE B 1 29 ? -18.161 5.046   31.876 1.00 30.21 ? 456 PHE B CD1 1 
ATOM   462 C CD2 . PHE B 1 29 ? -20.370 5.362   30.966 1.00 29.05 ? 456 PHE B CD2 1 
ATOM   463 C CE1 . PHE B 1 29 ? -18.693 4.467   32.995 1.00 31.23 ? 456 PHE B CE1 1 
ATOM   464 C CE2 . PHE B 1 29 ? -20.914 4.782   32.117 1.00 30.96 ? 456 PHE B CE2 1 
ATOM   465 C CZ  . PHE B 1 29 ? -20.069 4.325   33.118 1.00 30.74 ? 456 PHE B CZ  1 
ATOM   466 N N   . VAL B 1 30 ? -18.487 5.686   26.223 1.00 27.28 ? 457 VAL B N   1 
ATOM   467 C CA  . VAL B 1 30 ? -18.126 6.179   24.890 1.00 28.96 ? 457 VAL B CA  1 
ATOM   468 C C   . VAL B 1 30 ? -18.832 7.513   24.636 1.00 28.66 ? 457 VAL B C   1 
ATOM   469 O O   . VAL B 1 30 ? -20.062 7.627   24.800 1.00 30.25 ? 457 VAL B O   1 
ATOM   470 C CB  . VAL B 1 30 ? -18.532 5.177   23.783 1.00 29.75 ? 457 VAL B CB  1 
ATOM   471 C CG1 . VAL B 1 30 ? -17.992 5.633   22.437 1.00 31.22 ? 457 VAL B CG1 1 
ATOM   472 C CG2 . VAL B 1 30 ? -18.041 3.757   24.097 1.00 27.68 ? 457 VAL B CG2 1 
ATOM   473 N N   . ASN B 1 31 ? -18.076 8.519   24.223 1.00 30.15 ? 458 ASN B N   1 
ATOM   474 C CA  . ASN B 1 31 ? -18.684 9.792   23.808 1.00 29.45 ? 458 ASN B CA  1 
ATOM   475 C C   . ASN B 1 31 ? -18.678 9.855   22.296 1.00 29.81 ? 458 ASN B C   1 
ATOM   476 O O   . ASN B 1 31 ? -17.626 10.056  21.661 1.00 25.38 ? 458 ASN B O   1 
ATOM   477 C CB  . ASN B 1 31 ? -17.935 11.013  24.404 1.00 31.05 ? 458 ASN B CB  1 
ATOM   478 C CG  . ASN B 1 31 ? -18.639 12.335  24.086 1.00 35.74 ? 458 ASN B CG  1 
ATOM   479 O OD1 . ASN B 1 31 ? -19.374 12.445  23.090 1.00 30.28 ? 458 ASN B OD1 1 
ATOM   480 N ND2 . ASN B 1 31 ? -18.428 13.339  24.940 1.00 35.17 ? 458 ASN B ND2 1 
ATOM   481 N N   . HIS B 1 32 ? -19.865 9.724   21.713 1.00 32.14 ? 459 HIS B N   1 
ATOM   482 C CA  . HIS B 1 32 ? -19.975 9.614   20.263 1.00 33.40 ? 459 HIS B CA  1 
ATOM   483 C C   . HIS B 1 32 ? -19.883 10.965  19.555 1.00 35.10 ? 459 HIS B C   1 
ATOM   484 O O   . HIS B 1 32 ? -19.673 10.995  18.372 1.00 37.72 ? 459 HIS B O   1 
ATOM   485 C CB  . HIS B 1 32 ? -21.238 8.859   19.855 1.00 31.40 ? 459 HIS B CB  1 
ATOM   486 C CG  . HIS B 1 32 ? -21.160 7.389   20.124 1.00 28.98 ? 459 HIS B CG  1 
ATOM   487 N ND1 . HIS B 1 32 ? -20.464 6.524   19.315 1.00 28.75 ? 459 HIS B ND1 1 
ATOM   488 C CD2 . HIS B 1 32 ? -21.669 6.632   21.129 1.00 29.75 ? 459 HIS B CD2 1 
ATOM   489 C CE1 . HIS B 1 32 ? -20.565 5.291   19.789 1.00 28.79 ? 459 HIS B CE1 1 
ATOM   490 N NE2 . HIS B 1 32 ? -21.284 5.330   20.896 1.00 30.71 ? 459 HIS B NE2 1 
ATOM   491 N N   . ASN B 1 33 ? -20.036 12.066  20.283 1.00 36.56 ? 460 ASN B N   1 
ATOM   492 C CA  . ASN B 1 33 ? -19.780 13.416  19.727 1.00 38.68 ? 460 ASN B CA  1 
ATOM   493 C C   . ASN B 1 33 ? -18.302 13.705  19.525 1.00 37.45 ? 460 ASN B C   1 
ATOM   494 O O   . ASN B 1 33 ? -17.914 14.152  18.476 1.00 41.74 ? 460 ASN B O   1 
ATOM   495 C CB  . ASN B 1 33 ? -20.343 14.492  20.650 1.00 39.44 ? 460 ASN B CB  1 
ATOM   496 C CG  . ASN B 1 33 ? -21.834 14.551  20.610 1.00 38.99 ? 460 ASN B CG  1 
ATOM   497 O OD1 . ASN B 1 33 ? -22.438 14.484  19.530 1.00 40.67 ? 460 ASN B OD1 1 
ATOM   498 N ND2 . ASN B 1 33 ? -22.456 14.659  21.779 1.00 38.87 ? 460 ASN B ND2 1 
ATOM   499 N N   . THR B 1 34 ? -17.482 13.478  20.545 1.00 36.24 ? 461 THR B N   1 
ATOM   500 C CA  . THR B 1 34 ? -16.033 13.743  20.431 1.00 38.31 ? 461 THR B CA  1 
ATOM   501 C C   . THR B 1 34 ? -15.242 12.515  19.992 1.00 37.42 ? 461 THR B C   1 
ATOM   502 O O   . THR B 1 34 ? -14.057 12.615  19.681 1.00 37.14 ? 461 THR B O   1 
ATOM   503 C CB  . THR B 1 34 ? -15.435 14.248  21.757 1.00 37.99 ? 461 THR B CB  1 
ATOM   504 O OG1 . THR B 1 34 ? -15.790 13.359  22.814 1.00 36.18 ? 461 THR B OG1 1 
ATOM   505 C CG2 . THR B 1 34 ? -15.970 15.639  22.088 1.00 40.33 ? 461 THR B CG2 1 
ATOM   506 N N   . ARG B 1 35 ? -15.901 11.366  19.957 1.00 31.65 ? 462 ARG B N   1 
ATOM   507 C CA  . ARG B 1 35 ? -15.253 10.097  19.600 1.00 35.13 ? 462 ARG B CA  1 
ATOM   508 C C   . ARG B 1 35 ? -14.134 9.719   20.544 1.00 35.54 ? 462 ARG B C   1 
ATOM   509 O O   . ARG B 1 35 ? -13.067 9.383   20.123 1.00 35.51 ? 462 ARG B O   1 
ATOM   510 C CB  . ARG B 1 35 ? -14.808 10.063  18.108 1.00 38.49 ? 462 ARG B CB  1 
ATOM   511 C CG  . ARG B 1 35 ? -16.015 10.239  17.192 1.00 39.97 ? 462 ARG B CG  1 
ATOM   512 C CD  . ARG B 1 35 ? -15.848 10.034  15.692 1.00 46.92 ? 462 ARG B CD  1 
ATOM   513 N NE  . ARG B 1 35 ? -17.214 10.139  15.112 1.00 51.05 ? 462 ARG B NE  1 
ATOM   514 C CZ  . ARG B 1 35 ? -17.567 10.765  13.981 1.00 54.41 ? 462 ARG B CZ  1 
ATOM   515 N NH1 . ARG B 1 35 ? -16.666 11.351  13.192 1.00 59.71 ? 462 ARG B NH1 1 
ATOM   516 N NH2 . ARG B 1 35 ? -18.859 10.790  13.625 1.00 54.06 ? 462 ARG B NH2 1 
ATOM   517 N N   . ILE B 1 36 ? -14.421 9.730   21.836 1.00 34.78 ? 463 ILE B N   1 
ATOM   518 C CA  . ILE B 1 36 ? -13.463 9.241   22.814 1.00 38.02 ? 463 ILE B CA  1 
ATOM   519 C C   . ILE B 1 36 ? -14.093 8.203   23.738 1.00 33.77 ? 463 ILE B C   1 
ATOM   520 O O   . ILE B 1 36 ? -15.292 8.004   23.735 1.00 35.54 ? 463 ILE B O   1 
ATOM   521 C CB  . ILE B 1 36 ? -12.863 10.387  23.669 1.00 41.31 ? 463 ILE B CB  1 
ATOM   522 C CG1 . ILE B 1 36 ? -13.958 11.043  24.532 1.00 46.81 ? 463 ILE B CG1 1 
ATOM   523 C CG2 . ILE B 1 36 ? -12.170 11.398  22.774 1.00 42.11 ? 463 ILE B CG2 1 
ATOM   524 C CD1 . ILE B 1 36 ? -13.436 12.052  25.523 1.00 52.13 ? 463 ILE B CD1 1 
ATOM   525 N N   . THR B 1 37 ? -13.235 7.556   24.505 1.00 31.97 ? 464 THR B N   1 
ATOM   526 C CA  . THR B 1 37 ? -13.611 6.597   25.506 1.00 33.00 ? 464 THR B CA  1 
ATOM   527 C C   . THR B 1 37 ? -12.890 6.939   26.787 1.00 31.64 ? 464 THR B C   1 
ATOM   528 O O   . THR B 1 37 ? -11.828 7.550   26.761 1.00 35.52 ? 464 THR B O   1 
ATOM   529 C CB  . THR B 1 37 ? -13.284 5.135   25.088 1.00 35.42 ? 464 THR B CB  1 
ATOM   530 O OG1 . THR B 1 37 ? -11.872 4.925   25.012 1.00 34.85 ? 464 THR B OG1 1 
ATOM   531 C CG2 . THR B 1 37 ? -13.924 4.810   23.751 1.00 39.49 ? 464 THR B CG2 1 
ATOM   532 N N   . GLN B 1 38 ? -13.498 6.582   27.911 1.00 28.52 ? 465 GLN B N   1 
ATOM   533 C CA  . GLN B 1 38 ? -12.912 6.812   29.235 1.00 28.89 ? 465 GLN B CA  1 
ATOM   534 C C   . GLN B 1 38 ? -13.561 5.852   30.270 1.00 26.20 ? 465 GLN B C   1 
ATOM   535 O O   . GLN B 1 38 ? -14.653 5.343   30.032 1.00 24.43 ? 465 GLN B O   1 
ATOM   536 C CB  . GLN B 1 38 ? -13.126 8.274   29.652 1.00 27.45 ? 465 GLN B CB  1 
ATOM   537 C CG  . GLN B 1 38 ? -14.575 8.603   29.948 1.00 27.45 ? 465 GLN B CG  1 
ATOM   538 C CD  . GLN B 1 38 ? -14.792 10.082  30.223 1.00 30.32 ? 465 GLN B CD  1 
ATOM   539 O OE1 . GLN B 1 38 ? -14.152 10.907  29.607 1.00 30.53 ? 465 GLN B OE1 1 
ATOM   540 N NE2 . GLN B 1 38 ? -15.727 10.413  31.145 1.00 31.07 ? 465 GLN B NE2 1 
ATOM   541 N N   . TRP B 1 39 ? -12.914 5.677   31.425 1.00 26.98 ? 466 TRP B N   1 
ATOM   542 C CA  . TRP B 1 39 ? -13.433 4.843   32.496 1.00 27.59 ? 466 TRP B CA  1 
ATOM   543 C C   . TRP B 1 39 ? -14.508 5.573   33.327 1.00 28.88 ? 466 TRP B C   1 
ATOM   544 O O   . TRP B 1 39 ? -15.371 4.948   33.927 1.00 32.33 ? 466 TRP B O   1 
ATOM   545 C CB  . TRP B 1 39 ? -12.295 4.412   33.410 1.00 31.88 ? 466 TRP B CB  1 
ATOM   546 C CG  . TRP B 1 39 ? -11.219 3.536   32.797 1.00 31.45 ? 466 TRP B CG  1 
ATOM   547 C CD1 . TRP B 1 39 ? -9.876  3.784   32.797 1.00 31.02 ? 466 TRP B CD1 1 
ATOM   548 C CD2 . TRP B 1 39 ? -11.389 2.274   32.141 1.00 30.80 ? 466 TRP B CD2 1 
ATOM   549 N NE1 . TRP B 1 39 ? -9.206  2.751   32.215 1.00 33.23 ? 466 TRP B NE1 1 
ATOM   550 C CE2 . TRP B 1 39 ? -10.106 1.822   31.774 1.00 33.99 ? 466 TRP B CE2 1 
ATOM   551 C CE3 . TRP B 1 39 ? -12.498 1.481   31.832 1.00 31.93 ? 466 TRP B CE3 1 
ATOM   552 C CZ2 . TRP B 1 39 ? -9.903  0.617   31.115 1.00 33.17 ? 466 TRP B CZ2 1 
ATOM   553 C CZ3 . TRP B 1 39 ? -12.301 0.298   31.171 1.00 30.06 ? 466 TRP B CZ3 1 
ATOM   554 C CH2 . TRP B 1 39 ? -11.021 -0.119  30.801 1.00 31.30 ? 466 TRP B CH2 1 
ATOM   555 N N   . GLU B 1 40 ? -14.471 6.899   33.326 1.00 28.92 ? 467 GLU B N   1 
ATOM   556 C CA  . GLU B 1 40 ? -15.328 7.712   34.188 1.00 31.45 ? 467 GLU B CA  1 
ATOM   557 C C   . GLU B 1 40 ? -16.761 7.838   33.688 1.00 28.80 ? 467 GLU B C   1 
ATOM   558 O O   . GLU B 1 40 ? -16.982 8.173   32.543 1.00 30.62 ? 467 GLU B O   1 
ATOM   559 C CB  . GLU B 1 40 ? -14.742 9.128   34.339 1.00 34.96 ? 467 GLU B CB  1 
ATOM   560 C CG  . GLU B 1 40 ? -13.437 9.197   35.112 1.00 39.78 ? 467 GLU B CG  1 
ATOM   561 C CD  . GLU B 1 40 ? -12.245 8.681   34.327 1.00 42.37 ? 467 GLU B CD  1 
ATOM   562 O OE1 . GLU B 1 40 ? -12.275 8.715   33.076 1.00 34.31 ? 467 GLU B OE1 1 
ATOM   563 O OE2 . GLU B 1 40 ? -11.278 8.236   34.984 1.00 42.22 ? 467 GLU B OE2 1 
ATOM   564 N N   . ASP B 1 41 ? -17.730 7.581   34.563 1.00 28.62 ? 468 ASP B N   1 
ATOM   565 C CA  . ASP B 1 41 ? -19.133 7.795   34.252 1.00 27.74 ? 468 ASP B CA  1 
ATOM   566 C C   . ASP B 1 41 ? -19.370 9.317   34.156 1.00 29.27 ? 468 ASP B C   1 
ATOM   567 O O   . ASP B 1 41 ? -19.120 10.032  35.119 1.00 31.72 ? 468 ASP B O   1 
ATOM   568 C CB  . ASP B 1 41 ? -19.970 7.184   35.378 1.00 29.23 ? 468 ASP B CB  1 
ATOM   569 C CG  . ASP B 1 41 ? -21.482 7.183   35.113 1.00 27.54 ? 468 ASP B CG  1 
ATOM   570 O OD1 . ASP B 1 41 ? -22.059 7.974   34.327 1.00 28.13 ? 468 ASP B OD1 1 
ATOM   571 O OD2 . ASP B 1 41 ? -22.135 6.366   35.770 1.00 31.54 ? 468 ASP B OD2 1 
ATOM   572 N N   . PRO B 1 42 ? -19.870 9.807   33.005 1.00 28.99 ? 469 PRO B N   1 
ATOM   573 C CA  . PRO B 1 42 ? -20.160 11.229  32.826 1.00 31.35 ? 469 PRO B CA  1 
ATOM   574 C C   . PRO B 1 42 ? -21.146 11.753  33.855 1.00 33.28 ? 469 PRO B C   1 
ATOM   575 O O   . PRO B 1 42 ? -21.068 12.921  34.256 1.00 33.97 ? 469 PRO B O   1 
ATOM   576 C CB  . PRO B 1 42 ? -20.761 11.308  31.391 1.00 28.70 ? 469 PRO B CB  1 
ATOM   577 C CG  . PRO B 1 42 ? -20.421 10.060  30.753 1.00 31.14 ? 469 PRO B CG  1 
ATOM   578 C CD  . PRO B 1 42 ? -20.247 9.021   31.815 1.00 27.88 ? 469 PRO B CD  1 
ATOM   579 N N   . ARG B 1 43 ? -22.047 10.888  34.321 1.00 33.84 ? 470 ARG B N   1 
ATOM   580 C CA  . ARG B 1 43 ? -23.025 11.299  35.323 1.00 36.59 ? 470 ARG B CA  1 
ATOM   581 C C   . ARG B 1 43 ? -22.424 11.651  36.695 1.00 39.13 ? 470 ARG B C   1 
ATOM   582 O O   . ARG B 1 43 ? -23.085 12.327  37.493 1.00 38.54 ? 470 ARG B O   1 
ATOM   583 C CB  . ARG B 1 43 ? -24.089 10.243  35.485 1.00 34.51 ? 470 ARG B CB  1 
ATOM   584 C CG  . ARG B 1 43 ? -24.869 10.015  34.214 1.00 32.47 ? 470 ARG B CG  1 
ATOM   585 C CD  . ARG B 1 43 ? -25.742 8.804   34.361 1.00 33.40 ? 470 ARG B CD  1 
ATOM   586 N NE  . ARG B 1 43 ? -24.951 7.585   34.394 1.00 31.65 ? 470 ARG B NE  1 
ATOM   587 C CZ  . ARG B 1 43 ? -25.435 6.386   34.100 1.00 36.89 ? 470 ARG B CZ  1 
ATOM   588 N NH1 . ARG B 1 43 ? -26.720 6.212   33.742 1.00 40.56 ? 470 ARG B NH1 1 
ATOM   589 N NH2 . ARG B 1 43 ? -24.634 5.350   34.159 1.00 36.45 ? 470 ARG B NH2 1 
ATOM   590 N N   . SER B 1 44 ? -21.188 11.201  36.962 1.00 39.08 ? 471 SER B N   1 
ATOM   591 C CA  . SER B 1 44 ? -20.439 11.620  38.160 1.00 43.93 ? 471 SER B CA  1 
ATOM   592 C C   . SER B 1 44 ? -19.901 13.078  38.082 1.00 45.14 ? 471 SER B C   1 
ATOM   593 O O   . SER B 1 44 ? -19.392 13.595  39.082 1.00 44.64 ? 471 SER B O   1 
ATOM   594 C CB  . SER B 1 44 ? -19.276 10.659  38.439 1.00 42.95 ? 471 SER B CB  1 
ATOM   595 O OG  . SER B 1 44 ? -19.764 9.381   38.755 1.00 42.32 ? 471 SER B OG  1 
ATOM   596 N N   . GLN B 1 45 ? -19.953 13.669  36.883 1.00 43.19 ? 472 GLN B N   1 
ATOM   597 C CA  . GLN B 1 45 ? -19.778 15.095  36.652 1.00 50.71 ? 472 GLN B CA  1 
ATOM   598 C C   . GLN B 1 45 ? -21.156 15.736  36.494 1.00 51.89 ? 472 GLN B C   1 
ATOM   599 O O   . GLN B 1 45 ? -21.260 16.941  36.280 1.00 57.86 ? 472 GLN B O   1 
ATOM   600 C CB  . GLN B 1 45 ? -18.961 15.361  35.366 1.00 52.43 ? 472 GLN B CB  1 
ATOM   601 C CG  . GLN B 1 45 ? -17.526 14.824  35.365 1.00 55.04 ? 472 GLN B CG  1 
ATOM   602 C CD  . GLN B 1 45 ? -16.613 15.546  34.363 1.00 58.77 ? 472 GLN B CD  1 
ATOM   603 O OE1 . GLN B 1 45 ? -17.070 16.026  33.321 1.00 65.39 ? 472 GLN B OE1 1 
ATOM   604 N NE2 . GLN B 1 45 ? -15.324 15.632  34.681 1.00 56.44 ? 472 GLN B NE2 1 
ATOM   605 N N   A GLU C 2 4  ? -10.940 -1.149  7.829  0.50 50.28 ? 329 GLU C N   1 
ATOM   606 N N   B GLU C 2 4  ? -9.779  -2.757  9.506  0.50 50.98 ? 329 GLU C N   1 
ATOM   607 C CA  A GLU C 2 4  ? -10.455 -1.427  9.205  0.50 50.58 ? 329 GLU C CA  1 
ATOM   608 C CA  B GLU C 2 4  ? -10.446 -1.456  9.205  0.50 49.80 ? 329 GLU C CA  1 
ATOM   609 C C   . GLU C 2 4  ? -9.566  -0.290  9.684  1.00 49.70 ? 329 GLU C C   1 
ATOM   610 O O   . GLU C 2 4  ? -9.156  0.595   8.892  1.00 51.73 ? 329 GLU C O   1 
ATOM   611 C CB  A GLU C 2 4  ? -9.676  -2.742  9.249  0.50 52.19 ? 329 GLU C CB  1 
ATOM   612 C CB  B GLU C 2 4  ? -11.832 -1.412  9.869  0.50 46.75 ? 329 GLU C CB  1 
ATOM   613 N N   . ALA C 2 5  ? -9.271  -0.285  10.969 1.00 44.33 ? 330 ALA C N   1 
ATOM   614 C CA  . ALA C 2 5  ? -8.369  0.718   11.510 1.00 42.24 ? 330 ALA C CA  1 
ATOM   615 C C   . ALA C 2 5  ? -7.168  0.003   12.105 1.00 39.02 ? 330 ALA C C   1 
ATOM   616 O O   . ALA C 2 5  ? -7.232  -1.209  12.377 1.00 38.06 ? 330 ALA C O   1 
ATOM   617 C CB  . ALA C 2 5  ? -9.072  1.565   12.542 1.00 46.33 ? 330 ALA C CB  1 
ATOM   618 N N   . PRO C 2 6  ? -6.048  0.726   12.259 1.00 36.16 ? 331 PRO C N   1 
ATOM   619 C CA  . PRO C 2 6  ? -4.867  0.178   12.926 1.00 35.43 ? 331 PRO C CA  1 
ATOM   620 C C   . PRO C 2 6  ? -5.131  -0.046  14.405 1.00 34.18 ? 331 PRO C C   1 
ATOM   621 O O   . PRO C 2 6  ? -6.144  0.410   14.909 1.00 34.55 ? 331 PRO C O   1 
ATOM   622 C CB  . PRO C 2 6  ? -3.797  1.260   12.739 1.00 35.47 ? 331 PRO C CB  1 
ATOM   623 C CG  . PRO C 2 6  ? -4.487  2.459   12.205 1.00 36.22 ? 331 PRO C CG  1 
ATOM   624 C CD  . PRO C 2 6  ? -5.824  2.069   11.688 1.00 36.72 ? 331 PRO C CD  1 
ATOM   625 N N   . PRO C 2 7  ? -4.211  -0.720  15.108 1.00 36.49 ? 332 PRO C N   1 
ATOM   626 C CA  . PRO C 2 7  ? -4.507  -1.019  16.514 1.00 36.50 ? 332 PRO C CA  1 
ATOM   627 C C   . PRO C 2 7  ? -4.630  0.246   17.369 1.00 33.21 ? 332 PRO C C   1 
ATOM   628 O O   . PRO C 2 7  ? -4.089  1.275   16.991 1.00 35.69 ? 332 PRO C O   1 
ATOM   629 C CB  . PRO C 2 7  ? -3.313  -1.879  16.961 1.00 38.44 ? 332 PRO C CB  1 
ATOM   630 C CG  . PRO C 2 7  ? -2.666  -2.370  15.702 1.00 40.47 ? 332 PRO C CG  1 
ATOM   631 C CD  . PRO C 2 7  ? -2.943  -1.325  14.652 1.00 37.24 ? 332 PRO C CD  1 
ATOM   632 N N   . CYS C 2 8  ? -5.375  0.179   18.478 1.00 34.27 ? 333 CYS C N   1 
ATOM   633 C CA  . CYS C 2 8  ? -5.384  1.268   19.468 1.00 34.03 ? 333 CYS C CA  1 
ATOM   634 C C   . CYS C 2 8  ? -3.959  1.398   20.022 1.00 34.56 ? 333 CYS C C   1 
ATOM   635 O O   . CYS C 2 8  ? -3.281  0.399   20.302 1.00 31.08 ? 333 CYS C O   1 
ATOM   636 C CB  . CYS C 2 8  ? -6.380  1.022   20.643 1.00 36.57 ? 333 CYS C CB  1 
ATOM   637 S SG  . CYS C 2 8  ? -8.100  0.684   20.136 1.00 42.86 ? 333 CYS C SG  1 
ATOM   638 N N   . TYR C 2 9  ? -3.506  2.624   20.126 1.00 30.09 ? 334 TYR C N   1 
ATOM   639 C CA  . TYR C 2 9  ? -2.277  2.935   20.762 1.00 36.69 ? 334 TYR C CA  1 
ATOM   640 C C   . TYR C 2 9  ? -2.037  2.111   22.018 1.00 35.57 ? 334 TYR C C   1 
ATOM   641 O O   . TYR C 2 9  ? -0.962  1.570   22.213 1.00 31.71 ? 334 TYR C O   1 
ATOM   642 C CB  . TYR C 2 9  ? -2.268  4.415   21.155 1.00 36.14 ? 334 TYR C CB  1 
ATOM   643 C CG  . TYR C 2 9  ? -0.931  4.867   21.694 1.00 35.45 ? 334 TYR C CG  1 
ATOM   644 C CD1 . TYR C 2 9  ? 0.087   5.231   20.830 1.00 36.37 ? 334 TYR C CD1 1 
ATOM   645 C CD2 . TYR C 2 9  ? -0.689  4.920   23.072 1.00 35.58 ? 334 TYR C CD2 1 
ATOM   646 C CE1 . TYR C 2 9  ? 1.305   5.664   21.308 1.00 36.57 ? 334 TYR C CE1 1 
ATOM   647 C CE2 . TYR C 2 9  ? 0.529   5.332   23.568 1.00 36.13 ? 334 TYR C CE2 1 
ATOM   648 C CZ  . TYR C 2 9  ? 1.517   5.714   22.685 1.00 37.13 ? 334 TYR C CZ  1 
ATOM   649 O OH  . TYR C 2 9  ? 2.725   6.117   23.172 1.00 40.33 ? 334 TYR C OH  1 
ATOM   650 N N   . MET C 2 10 ? -3.029  2.038   22.884 1.00 41.99 ? 335 MET C N   1 
ATOM   651 C CA  . MET C 2 10 ? -2.830  1.361   24.151 1.00 46.38 ? 335 MET C CA  1 
ATOM   652 C C   . MET C 2 10 ? -2.686  -0.155  23.991 1.00 45.41 ? 335 MET C C   1 
ATOM   653 O O   . MET C 2 10 ? -2.212  -0.811  24.907 1.00 48.99 ? 335 MET C O   1 
ATOM   654 C CB  . MET C 2 10 ? -3.931  1.751   25.125 1.00 55.72 ? 335 MET C CB  1 
ATOM   655 C CG  . MET C 2 10 ? -3.874  3.238   25.476 1.00 62.20 ? 335 MET C CG  1 
ATOM   656 S SD  . MET C 2 10 ? -2.412  3.747   26.420 1.00 69.44 ? 335 MET C SD  1 
ATOM   657 C CE  . MET C 2 10 ? -2.387  2.476   27.695 1.00 65.13 ? 335 MET C CE  1 
ATOM   658 N N   . ASP C 2 11 ? -3.061  -0.691  22.824 1.00 42.03 ? 336 ASP C N   1 
ATOM   659 C CA  . ASP C 2 11 ? -2.676  -2.050  22.390 1.00 48.13 ? 336 ASP C CA  1 
ATOM   660 C C   . ASP C 2 11 ? -1.256  -2.070  21.786 1.00 48.79 ? 336 ASP C C   1 
ATOM   661 O O   . ASP C 2 11 ? -0.501  -3.001  22.003 1.00 51.16 ? 336 ASP C O   1 
ATOM   662 C CB  . ASP C 2 11 ? -3.637  -2.590  21.322 1.00 53.42 ? 336 ASP C CB  1 
ATOM   663 C CG  . ASP C 2 11 ? -5.108  -2.509  21.733 1.00 60.16 ? 336 ASP C CG  1 
ATOM   664 O OD1 . ASP C 2 11 ? -5.424  -2.625  22.929 1.00 64.23 ? 336 ASP C OD1 1 
ATOM   665 O OD2 . ASP C 2 11 ? -5.960  -2.350  20.832 1.00 73.95 ? 336 ASP C OD2 1 
ATOM   666 N N   . VAL C 2 12 ? -0.924  -1.048  20.998 1.00 54.10 ? 337 VAL C N   1 
ATOM   667 C CA  . VAL C 2 12 ? 0.429   -0.863  20.428 1.00 57.11 ? 337 VAL C CA  1 
ATOM   668 C C   . VAL C 2 12 ? 1.481   -0.927  21.532 1.00 57.85 ? 337 VAL C C   1 
ATOM   669 O O   . VAL C 2 12 ? 2.248   -1.882  21.596 1.00 58.02 ? 337 VAL C O   1 
ATOM   670 C CB  . VAL C 2 12 ? 0.553   0.500   19.670 1.00 59.70 ? 337 VAL C CB  1 
ATOM   671 C CG1 . VAL C 2 12 ? 2.012   0.902   19.434 1.00 62.19 ? 337 VAL C CG1 1 
ATOM   672 C CG2 . VAL C 2 12 ? -0.223  0.464   18.355 1.00 58.03 ? 337 VAL C CG2 1 
ATOM   673 N N   . ILE C 2 13 ? 1.499   0.080   22.408 1.00 53.90 ? 338 ILE C N   1 
ATOM   674 C CA  . ILE C 2 13 ? 2.489   0.137   23.509 1.00 57.05 ? 338 ILE C CA  1 
ATOM   675 C C   . ILE C 2 13 ? 2.270   -0.946  24.559 1.00 60.87 ? 338 ILE C C   1 
ATOM   676 O O   . ILE C 2 13 ? 3.074   -1.076  25.461 1.00 64.17 ? 338 ILE C O   1 
ATOM   677 C CB  . ILE C 2 13 ? 2.535   1.515   24.220 1.00 49.93 ? 338 ILE C CB  1 
ATOM   678 C CG1 . ILE C 2 13 ? 1.185   1.851   24.899 1.00 50.39 ? 338 ILE C CG1 1 
ATOM   679 C CG2 . ILE C 2 13 ? 2.986   2.589   23.244 1.00 47.23 ? 338 ILE C CG2 1 
ATOM   680 C CD1 . ILE C 2 13 ? 1.069   1.403   26.341 1.00 54.35 ? 338 ILE C CD1 1 
HETATM 681 N N   . NH2 C 2 14 ? 1.196   -1.739  24.462 1.00 63.06 ? 339 NH2 C N   1 
ATOM   682 N N   A GLU D 2 4  ? -4.340  1.094   32.883 0.50 54.00 ? 329 GLU D N   1 
ATOM   683 N N   B GLU D 2 4  ? -4.946  -0.781  30.924 0.50 52.11 ? 329 GLU D N   1 
ATOM   684 C CA  A GLU D 2 4  ? -4.948  0.557   31.625 0.50 50.92 ? 329 GLU D CA  1 
ATOM   685 C CA  B GLU D 2 4  ? -4.989  0.525   31.659 0.50 51.02 ? 329 GLU D CA  1 
ATOM   686 C C   . GLU D 2 4  ? -5.883  1.583   30.998 1.00 46.10 ? 329 GLU D C   1 
ATOM   687 O O   . GLU D 2 4  ? -6.384  2.491   31.668 1.00 43.98 ? 329 GLU D O   1 
ATOM   688 C CB  A GLU D 2 4  ? -5.706  -0.742  31.908 0.50 52.51 ? 329 GLU D CB  1 
ATOM   689 C CB  B GLU D 2 4  ? -3.575  1.085   31.834 0.50 53.71 ? 329 GLU D CB  1 
ATOM   690 N N   . ALA D 2 5  ? -6.096  1.469   29.700 1.00 44.19 ? 330 ALA D N   1 
ATOM   691 C CA  . ALA D 2 5  ? -7.024  2.342   29.038 1.00 41.76 ? 330 ALA D CA  1 
ATOM   692 C C   . ALA D 2 5  ? -8.150  1.510   28.487 1.00 39.11 ? 330 ALA D C   1 
ATOM   693 O O   . ALA D 2 5  ? -7.961  0.351   28.166 1.00 40.19 ? 330 ALA D O   1 
ATOM   694 C CB  . ALA D 2 5  ? -6.344  3.091   27.923 1.00 43.18 ? 330 ALA D CB  1 
ATOM   695 N N   . PRO D 2 6  ? -9.340  2.109   28.382 1.00 37.35 ? 331 PRO D N   1 
ATOM   696 C CA  . PRO D 2 6  ? -10.443 1.448   27.724 1.00 35.90 ? 331 PRO D CA  1 
ATOM   697 C C   . PRO D 2 6  ? -10.251 1.406   26.234 1.00 36.73 ? 331 PRO D C   1 
ATOM   698 O O   . PRO D 2 6  ? -9.454  2.204   25.702 1.00 36.46 ? 331 PRO D O   1 
ATOM   699 C CB  . PRO D 2 6  ? -11.619 2.324   28.074 1.00 36.01 ? 331 PRO D CB  1 
ATOM   700 C CG  . PRO D 2 6  ? -11.042 3.690   28.199 1.00 34.08 ? 331 PRO D CG  1 
ATOM   701 C CD  . PRO D 2 6  ? -9.647  3.511   28.707 1.00 34.35 ? 331 PRO D CD  1 
ATOM   702 N N   . PRO D 2 7  ? -10.976 0.499   25.545 1.00 38.31 ? 332 PRO D N   1 
ATOM   703 C CA  . PRO D 2 7  ? -10.799 0.395   24.110 1.00 39.47 ? 332 PRO D CA  1 
ATOM   704 C C   . PRO D 2 7  ? -10.952 1.726   23.409 1.00 36.05 ? 332 PRO D C   1 
ATOM   705 O O   . PRO D 2 7  ? -11.791 2.553   23.809 1.00 38.62 ? 332 PRO D O   1 
ATOM   706 C CB  . PRO D 2 7  ? -11.896 -0.597  23.694 1.00 41.62 ? 332 PRO D CB  1 
ATOM   707 C CG  . PRO D 2 7  ? -12.008 -1.502  24.890 1.00 43.91 ? 332 PRO D CG  1 
ATOM   708 C CD  . PRO D 2 7  ? -11.854 -0.574  26.064 1.00 40.69 ? 332 PRO D CD  1 
ATOM   709 N N   . CYS D 2 8  ? -10.126 1.963   22.395 1.00 34.07 ? 333 CYS D N   1 
ATOM   710 C CA  . CYS D 2 8  ? -10.247 3.218   21.660 1.00 35.19 ? 333 CYS D CA  1 
ATOM   711 C C   . CYS D 2 8  ? -11.518 3.188   20.796 1.00 34.47 ? 333 CYS D C   1 
ATOM   712 O O   . CYS D 2 8  ? -12.044 2.107   20.463 1.00 32.10 ? 333 CYS D O   1 
ATOM   713 C CB  . CYS D 2 8  ? -9.008  3.517   20.828 1.00 37.68 ? 333 CYS D CB  1 
ATOM   714 S SG  . CYS D 2 8  ? -8.816  2.453   19.390 1.00 42.72 ? 333 CYS D SG  1 
ATOM   715 N N   . TYR D 2 9  ? -11.985 4.379   20.440 1.00 33.56 ? 334 TYR D N   1 
ATOM   716 C CA  . TYR D 2 9  ? -13.230 4.546   19.745 1.00 35.23 ? 334 TYR D CA  1 
ATOM   717 C C   . TYR D 2 9  ? -13.295 3.713   18.474 1.00 41.08 ? 334 TYR D C   1 
ATOM   718 O O   . TYR D 2 9  ? -14.353 3.176   18.175 1.00 44.88 ? 334 TYR D O   1 
ATOM   719 C CB  . TYR D 2 9  ? -13.501 6.015   19.466 1.00 36.26 ? 334 TYR D CB  1 
ATOM   720 C CG  . TYR D 2 9  ? -14.896 6.259   18.942 1.00 37.81 ? 334 TYR D CG  1 
ATOM   721 C CD1 . TYR D 2 9  ? -15.968 6.405   19.811 1.00 35.32 ? 334 TYR D CD1 1 
ATOM   722 C CD2 . TYR D 2 9  ? -15.144 6.306   17.563 1.00 38.79 ? 334 TYR D CD2 1 
ATOM   723 C CE1 . TYR D 2 9  ? -17.245 6.606   19.325 1.00 36.79 ? 334 TYR D CE1 1 
ATOM   724 C CE2 . TYR D 2 9  ? -16.416 6.507   17.068 1.00 40.01 ? 334 TYR D CE2 1 
ATOM   725 C CZ  . TYR D 2 9  ? -17.456 6.657   17.959 1.00 39.42 ? 334 TYR D CZ  1 
ATOM   726 O OH  . TYR D 2 9  ? -18.709 6.847   17.489 1.00 41.25 ? 334 TYR D OH  1 
ATOM   727 N N   . MET D 2 10 ? -12.175 3.569   17.753 1.00 42.59 ? 335 MET D N   1 
ATOM   728 C CA  . MET D 2 10 ? -12.171 2.849   16.478 1.00 47.66 ? 335 MET D CA  1 
ATOM   729 C C   . MET D 2 10 ? -12.367 1.343   16.657 1.00 47.65 ? 335 MET D C   1 
ATOM   730 O O   . MET D 2 10 ? -12.758 0.660   15.724 1.00 46.39 ? 335 MET D O   1 
ATOM   731 C CB  . MET D 2 10 ? -10.896 3.132   15.655 1.00 53.44 ? 335 MET D CB  1 
ATOM   732 C CG  . MET D 2 10 ? -10.935 4.383   14.770 1.00 59.08 ? 335 MET D CG  1 
ATOM   733 S SD  . MET D 2 10 ? -12.404 4.632   13.719 1.00 72.56 ? 335 MET D SD  1 
ATOM   734 C CE  . MET D 2 10 ? -12.251 3.400   12.426 1.00 66.91 ? 335 MET D CE  1 
ATOM   735 N N   . ASP D 2 11 ? -12.079 0.815   17.843 1.00 49.23 ? 336 ASP D N   1 
ATOM   736 C CA  . ASP D 2 11 ? -12.361 -0.607  18.128 1.00 51.33 ? 336 ASP D CA  1 
ATOM   737 C C   . ASP D 2 11 ? -13.804 -0.790  18.623 1.00 51.26 ? 336 ASP D C   1 
ATOM   738 O O   . ASP D 2 11 ? -14.430 -1.823  18.373 1.00 51.44 ? 336 ASP D O   1 
ATOM   739 C CB  . ASP D 2 11 ? -11.357 -1.152  19.133 1.00 54.45 ? 336 ASP D CB  1 
ATOM   740 C CG  . ASP D 2 11 ? -10.004 -1.405  18.500 1.00 58.27 ? 336 ASP D CG  1 
ATOM   741 O OD1 . ASP D 2 11 ? -9.590  -0.594  17.654 1.00 59.38 ? 336 ASP D OD1 1 
ATOM   742 O OD2 . ASP D 2 11 ? -9.369  -2.420  18.828 1.00 59.88 ? 336 ASP D OD2 1 
ATOM   743 N N   . VAL D 2 12 ? -14.331 0.231   19.299 1.00 45.93 ? 337 VAL D N   1 
ATOM   744 C CA  . VAL D 2 12 ? -15.721 0.240   19.759 1.00 47.41 ? 337 VAL D CA  1 
ATOM   745 C C   . VAL D 2 12 ? -16.618 0.033   18.543 1.00 48.48 ? 337 VAL D C   1 
ATOM   746 O O   . VAL D 2 12 ? -17.236 -1.028  18.395 1.00 49.81 ? 337 VAL D O   1 
ATOM   747 C CB  . VAL D 2 12 ? -16.066 1.567   20.494 1.00 48.71 ? 337 VAL D CB  1 
ATOM   748 C CG1 . VAL D 2 12 ? -17.576 1.772   20.663 1.00 51.05 ? 337 VAL D CG1 1 
ATOM   749 C CG2 . VAL D 2 12 ? -15.359 1.618   21.848 1.00 48.16 ? 337 VAL D CG2 1 
ATOM   750 N N   . ILE D 2 13 ? -16.631 1.026   17.653 1.00 44.41 ? 338 ILE D N   1 
ATOM   751 C CA  . ILE D 2 13 ? -17.508 1.007   16.475 1.00 47.53 ? 338 ILE D CA  1 
ATOM   752 C C   . ILE D 2 13 ? -17.027 -0.003  15.435 1.00 49.08 ? 338 ILE D C   1 
ATOM   753 O O   . ILE D 2 13 ? -17.777 -0.387  14.564 1.00 53.58 ? 338 ILE D O   1 
ATOM   754 C CB  . ILE D 2 13 ? -17.624 2.411   15.818 1.00 47.57 ? 338 ILE D CB  1 
ATOM   755 C CG1 . ILE D 2 13 ? -16.245 2.922   15.344 1.00 45.59 ? 338 ILE D CG1 1 
ATOM   756 C CG2 . ILE D 2 13 ? -18.255 3.397   16.798 1.00 45.97 ? 338 ILE D CG2 1 
ATOM   757 C CD1 . ILE D 2 13 ? -16.290 3.872   14.172 1.00 46.73 ? 338 ILE D CD1 1 
HETATM 758 N N   . NH2 D 2 14 ? -15.783 -0.457  15.493 1.00 48.08 ? 339 NH2 D N   1 
HETATM 759 O O   . HOH E 3 .  ? 10.413  3.704   5.872  1.00 46.05 ? 501 HOH A O   1 
HETATM 760 O O   . HOH F 3 .  ? -26.672 5.544   25.571 1.00 29.92 ? 501 HOH B O   1 
HETATM 761 O O   . HOH F 3 .  ? -25.400 3.244   27.246 1.00 27.20 ? 502 HOH B O   1 
HETATM 762 O O   . HOH F 3 .  ? -28.496 5.744   30.139 1.00 36.28 ? 503 HOH B O   1 
HETATM 763 O O   . HOH F 3 .  ? -9.685  -2.644  27.541 1.00 39.67 ? 504 HOH B O   1 
HETATM 764 O O   . HOH F 3 .  ? -21.545 14.224  24.068 1.00 37.53 ? 505 HOH B O   1 
HETATM 765 O O   . HOH F 3 .  ? -10.431 7.228   31.546 1.00 30.60 ? 506 HOH B O   1 
HETATM 766 O O   . HOH F 3 .  ? -10.673 10.100  31.657 1.00 38.44 ? 507 HOH B O   1 
HETATM 767 O O   . HOH F 3 .  ? -12.475 -5.002  24.701 1.00 52.09 ? 508 HOH B O   1 
HETATM 768 O O   . HOH G 3 .  ? -10.531 6.516   21.497 1.00 34.19 ? 501 HOH D O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   A LEU A 10 ? 0.8277 0.9373 0.6008 -0.1990 0.1949  0.0606  437 LEU A N   
2   N N   B LEU A 10 ? 0.9531 1.0003 0.6158 -0.2827 0.2292  0.1121  437 LEU A N   
3   C CA  A LEU A 10 ? 0.8952 0.9665 0.6327 -0.2412 0.2012  0.0931  437 LEU A CA  
4   C CA  B LEU A 10 ? 0.8667 0.9391 0.6107 -0.2330 0.1956  0.0901  437 LEU A CA  
5   C C   A LEU A 10 ? 0.8486 0.8875 0.6270 -0.2314 0.1619  0.1075  437 LEU A C   
6   C C   B LEU A 10 ? 0.8325 0.8721 0.6146 -0.2287 0.1598  0.1065  437 LEU A C   
7   O O   A LEU A 10 ? 0.8494 0.8313 0.5931 -0.2060 0.1205  0.1196  437 LEU A O   
8   O O   B LEU A 10 ? 0.8313 0.8132 0.5799 -0.2044 0.1184  0.1193  437 LEU A O   
9   C CB  A LEU A 10 ? 0.9818 0.9750 0.5885 -0.2603 0.1943  0.1233  437 LEU A CB  
10  C CB  B LEU A 10 ? 0.7874 0.9521 0.6300 -0.2198 0.2250  0.0499  437 LEU A CB  
11  N N   . GLY A 11 ? 0.8059 0.8852 0.6614 -0.2510 0.1748  0.1022  438 GLY A N   
12  C CA  . GLY A 11 ? 0.7736 0.8194 0.6603 -0.2502 0.1407  0.1146  438 GLY A CA  
13  C C   . GLY A 11 ? 0.6879 0.7561 0.6423 -0.2080 0.1120  0.0935  438 GLY A C   
14  O O   . GLY A 11 ? 0.6264 0.7063 0.5801 -0.1746 0.1057  0.0782  438 GLY A O   
15  N N   . PRO A 12 ? 0.6755 0.7433 0.6822 -0.2131 0.0927  0.0935  439 PRO A N   
16  C CA  . PRO A 12 ? 0.5857 0.6650 0.6409 -0.1781 0.0654  0.0765  439 PRO A CA  
17  C C   . PRO A 12 ? 0.6078 0.6263 0.6066 -0.1486 0.0361  0.0841  439 PRO A C   
18  O O   . PRO A 12 ? 0.5886 0.5532 0.5208 -0.1540 0.0292  0.1029  439 PRO A O   
19  C CB  . PRO A 12 ? 0.6247 0.7044 0.7288 -0.1979 0.0489  0.0784  439 PRO A CB  
20  C CG  . PRO A 12 ? 0.6899 0.7160 0.7406 -0.2351 0.0516  0.1048  439 PRO A CG  
21  C CD  . PRO A 12 ? 0.7361 0.7682 0.7353 -0.2517 0.0871  0.1141  439 PRO A CD  
22  N N   . LEU A 13 ? 0.5508 0.5771 0.5752 -0.1179 0.0189  0.0688  440 LEU A N   
23  C CA  . LEU A 13 ? 0.5373 0.5173 0.5216 -0.0934 -0.0037 0.0712  440 LEU A CA  
24  C C   . LEU A 13 ? 0.5376 0.4655 0.5053 -0.1017 -0.0268 0.0822  440 LEU A C   
25  O O   . LEU A 13 ? 0.5496 0.4840 0.5497 -0.1212 -0.0312 0.0828  440 LEU A O   
26  C CB  . LEU A 13 ? 0.5160 0.5145 0.5249 -0.0665 -0.0105 0.0534  440 LEU A CB  
27  C CG  . LEU A 13 ? 0.5167 0.5467 0.5269 -0.0538 0.0054  0.0417  440 LEU A CG  
28  C CD1 . LEU A 13 ? 0.4747 0.5244 0.5212 -0.0387 0.0016  0.0260  440 LEU A CD1 
29  C CD2 . LEU A 13 ? 0.5163 0.5223 0.4819 -0.0397 -0.0011 0.0439  440 LEU A CD2 
30  N N   . PRO A 14 ? 0.5434 0.4196 0.4645 -0.0859 -0.0443 0.0876  441 PRO A N   
31  C CA  . PRO A 14 ? 0.5778 0.4004 0.4848 -0.0867 -0.0687 0.0904  441 PRO A CA  
32  C C   . PRO A 14 ? 0.5477 0.3806 0.4826 -0.0754 -0.0789 0.0733  441 PRO A C   
33  O O   . PRO A 14 ? 0.4859 0.3528 0.4377 -0.0585 -0.0714 0.0605  441 PRO A O   
34  C CB  . PRO A 14 ? 0.6054 0.3801 0.4673 -0.0617 -0.0852 0.0916  441 PRO A CB  
35  C CG  . PRO A 14 ? 0.5975 0.3976 0.4454 -0.0545 -0.0729 0.0949  441 PRO A CG  
36  C CD  . PRO A 14 ? 0.5516 0.4180 0.4381 -0.0644 -0.0464 0.0871  441 PRO A CD  
37  N N   . PRO A 15 ? 0.5912 0.3874 0.5234 -0.0873 -0.0983 0.0738  442 PRO A N   
38  C CA  . PRO A 15 ? 0.5746 0.3728 0.5195 -0.0791 -0.1118 0.0588  442 PRO A CA  
39  C C   . PRO A 15 ? 0.5409 0.3319 0.4598 -0.0488 -0.1095 0.0441  442 PRO A C   
40  O O   . PRO A 15 ? 0.5031 0.2707 0.3956 -0.0319 -0.1086 0.0409  442 PRO A O   
41  C CB  . PRO A 15 ? 0.6435 0.3873 0.5728 -0.0949 -0.1369 0.0600  442 PRO A CB  
42  C CG  . PRO A 15 ? 0.6835 0.3805 0.5795 -0.1003 -0.1386 0.0734  442 PRO A CG  
43  C CD  . PRO A 15 ? 0.6664 0.4011 0.5682 -0.1043 -0.1140 0.0867  442 PRO A CD  
44  N N   . GLY A 16 ? 0.5176 0.3301 0.4461 -0.0426 -0.1085 0.0350  443 GLY A N   
45  C CA  . GLY A 16 ? 0.5029 0.3115 0.4052 -0.0224 -0.0995 0.0219  443 GLY A CA  
46  C C   . GLY A 16 ? 0.4555 0.3077 0.3768 -0.0152 -0.0788 0.0215  443 GLY A C   
47  O O   . GLY A 16 ? 0.4025 0.2586 0.3107 -0.0075 -0.0698 0.0125  443 GLY A O   
48  N N   . TRP A 17 ? 0.4335 0.3149 0.3805 -0.0211 -0.0700 0.0306  444 TRP A N   
49  C CA  . TRP A 17 ? 0.3958 0.3129 0.3554 -0.0135 -0.0525 0.0273  444 TRP A CA  
50  C C   . TRP A 17 ? 0.3914 0.3384 0.3824 -0.0188 -0.0482 0.0263  444 TRP A C   
51  O O   . TRP A 17 ? 0.3992 0.3552 0.4162 -0.0298 -0.0556 0.0302  444 TRP A O   
52  C CB  . TRP A 17 ? 0.3955 0.3199 0.3507 -0.0147 -0.0466 0.0352  444 TRP A CB  
53  C CG  . TRP A 17 ? 0.4368 0.3321 0.3654 -0.0005 -0.0560 0.0332  444 TRP A CG  
54  C CD1 . TRP A 17 ? 0.5395 0.3893 0.4463 -0.0013 -0.0723 0.0394  444 TRP A CD1 
55  C CD2 . TRP A 17 ? 0.4550 0.3642 0.3829 0.0188  -0.0536 0.0215  444 TRP A CD2 
56  N NE1 . TRP A 17 ? 0.5380 0.3703 0.4308 0.0211  -0.0817 0.0310  444 TRP A NE1 
57  C CE2 . TRP A 17 ? 0.5049 0.3788 0.4150 0.0336  -0.0705 0.0193  444 TRP A CE2 
58  C CE3 . TRP A 17 ? 0.4677 0.4153 0.4131 0.0248  -0.0415 0.0102  444 TRP A CE3 
59  C CZ2 . TRP A 17 ? 0.5370 0.4219 0.4549 0.0574  -0.0765 0.0045  444 TRP A CZ2 
60  C CZ3 . TRP A 17 ? 0.4862 0.4459 0.4379 0.0427  -0.0456 -0.0031 444 TRP A CZ3 
61  C CH2 . TRP A 17 ? 0.4891 0.4221 0.4315 0.0605  -0.0633 -0.0069 444 TRP A CH2 
62  N N   . GLU A 18 ? 0.3624 0.3261 0.3569 -0.0107 -0.0376 0.0188  445 GLU A N   
63  C CA  . GLU A 18 ? 0.3593 0.3428 0.3822 -0.0103 -0.0367 0.0146  445 GLU A CA  
64  C C   . GLU A 18 ? 0.3351 0.3399 0.3611 -0.0046 -0.0209 0.0063  445 GLU A C   
65  O O   . GLU A 18 ? 0.3192 0.3187 0.3257 -0.0011 -0.0154 0.0024  445 GLU A O   
66  C CB  . GLU A 18 ? 0.3590 0.3119 0.3663 -0.0085 -0.0517 0.0140  445 GLU A CB  
67  C CG  . GLU A 18 ? 0.3693 0.3272 0.4052 -0.0041 -0.0634 0.0110  445 GLU A CG  
68  C CD  . GLU A 18 ? 0.4485 0.3613 0.4483 -0.0030 -0.0775 0.0136  445 GLU A CD  
69  O OE1 . GLU A 18 ? 0.4174 0.2971 0.3681 -0.0094 -0.0765 0.0176  445 GLU A OE1 
70  O OE2 . GLU A 18 ? 0.5319 0.4376 0.5482 0.0039  -0.0891 0.0109  445 GLU A OE2 
71  N N   . LYS A 19 ? 0.3060 0.3379 0.3609 -0.0035 -0.0139 0.0000  446 LYS A N   
72  C CA  . LYS A 19 ? 0.3244 0.3727 0.3813 0.0014  -0.0019 -0.0116 446 LYS A CA  
73  C C   . LYS A 19 ? 0.3352 0.3657 0.3993 0.0066  -0.0096 -0.0187 446 LYS A C   
74  O O   . LYS A 19 ? 0.3146 0.3363 0.3988 0.0108  -0.0230 -0.0185 446 LYS A O   
75  C CB  . LYS A 19 ? 0.3649 0.4479 0.4439 0.0000  0.0123  -0.0194 446 LYS A CB  
76  C CG  . LYS A 19 ? 0.3986 0.4948 0.4653 0.0039  0.0244  -0.0331 446 LYS A CG  
77  C CD  . LYS A 19 ? 0.4581 0.5863 0.5304 -0.0004 0.0445  -0.0420 446 LYS A CD  
78  C CE  . LYS A 19 ? 0.4730 0.6217 0.5864 0.0105  0.0512  -0.0653 446 LYS A CE  
79  N NZ  . LYS A 19 ? 0.5039 0.6946 0.6399 0.0034  0.0755  -0.0747 446 LYS A NZ  
80  N N   . ARG A 20 ? 0.3424 0.3648 0.3911 0.0053  -0.0045 -0.0249 447 ARG A N   
81  C CA  . ARG A 20 ? 0.3992 0.3950 0.4472 0.0053  -0.0108 -0.0303 447 ARG A CA  
82  C C   . ARG A 20 ? 0.4150 0.4212 0.4665 0.0042  -0.0019 -0.0455 447 ARG A C   
83  O O   . ARG A 20 ? 0.3624 0.3976 0.4125 0.0041  0.0072  -0.0518 447 ARG A O   
84  C CB  . ARG A 20 ? 0.4379 0.3961 0.4520 -0.0059 -0.0148 -0.0197 447 ARG A CB  
85  C CG  . ARG A 20 ? 0.4683 0.4032 0.4690 -0.0049 -0.0301 -0.0071 447 ARG A CG  
86  C CD  . ARG A 20 ? 0.5657 0.4483 0.5206 -0.0164 -0.0372 0.0021  447 ARG A CD  
87  N NE  . ARG A 20 ? 0.6381 0.4986 0.5679 -0.0170 -0.0511 0.0117  447 ARG A NE  
88  C CZ  . ARG A 20 ? 0.6555 0.4633 0.5305 -0.0275 -0.0607 0.0214  447 ARG A CZ  
89  N NH1 . ARG A 20 ? 0.6348 0.4062 0.4746 -0.0417 -0.0542 0.0255  447 ARG A NH1 
90  N NH2 . ARG A 20 ? 0.6120 0.3986 0.4607 -0.0271 -0.0768 0.0272  447 ARG A NH2 
91  N N   . THR A 21 ? 0.4600 0.4335 0.5098 0.0023  -0.0094 -0.0504 448 THR A N   
92  C CA  . THR A 21 ? 0.4624 0.4328 0.5137 -0.0023 -0.0054 -0.0662 448 THR A CA  
93  C C   . THR A 21 ? 0.4831 0.4121 0.5108 -0.0228 -0.0069 -0.0593 448 THR A C   
94  O O   . THR A 21 ? 0.5594 0.4396 0.5673 -0.0265 -0.0189 -0.0467 448 THR A O   
95  C CB  . THR A 21 ? 0.4787 0.4422 0.5524 0.0141  -0.0125 -0.0832 448 THR A CB  
96  O OG1 . THR A 21 ? 0.3947 0.4024 0.4901 0.0272  -0.0035 -0.0892 448 THR A OG1 
97  C CG2 . THR A 21 ? 0.5029 0.4618 0.5750 0.0101  -0.0095 -0.1045 448 THR A CG2 
98  N N   . ASP A 22 ? 0.4600 0.4080 0.4883 -0.0385 0.0043  -0.0675 449 ASP A N   
99  C CA  . ASP A 22 ? 0.4694 0.3854 0.4800 -0.0659 0.0101  -0.0635 449 ASP A CA  
100 C C   . ASP A 22 ? 0.5557 0.4175 0.5582 -0.0735 -0.0019 -0.0687 449 ASP A C   
101 O O   . ASP A 22 ? 0.5473 0.3984 0.5628 -0.0520 -0.0157 -0.0794 449 ASP A O   
102 C CB  . ASP A 22 ? 0.4642 0.4287 0.4939 -0.0814 0.0259  -0.0749 449 ASP A CB  
103 C CG  . ASP A 22 ? 0.4646 0.4557 0.5206 -0.0821 0.0207  -0.0976 449 ASP A CG  
104 O OD1 . ASP A 22 ? 0.5129 0.4796 0.5668 -0.0744 0.0094  -0.1070 449 ASP A OD1 
105 O OD2 . ASP A 22 ? 0.4633 0.5019 0.5444 -0.0896 0.0263  -0.1095 449 ASP A OD2 
106 N N   . SER A 23 ? 0.6148 0.4407 0.5960 -0.1053 0.0048  -0.0630 450 SER A N   
107 C CA  . SER A 23 ? 0.7245 0.4773 0.6853 -0.1176 -0.0100 -0.0622 450 SER A CA  
108 C C   . SER A 23 ? 0.6801 0.4454 0.6705 -0.1152 -0.0155 -0.0892 450 SER A C   
109 O O   . SER A 23 ? 0.7440 0.4484 0.7237 -0.1146 -0.0329 -0.0944 450 SER A O   
110 C CB  . SER A 23 ? 0.7668 0.4732 0.6870 -0.1617 0.0033  -0.0456 450 SER A CB  
111 O OG  . SER A 23 ? 0.7364 0.5013 0.6868 -0.1884 0.0283  -0.0603 450 SER A OG  
112 N N   . ASN A 24 ? 0.6424 0.4803 0.6654 -0.1126 -0.0047 -0.1072 451 ASN A N   
113 C CA  . ASN A 24 ? 0.6513 0.5030 0.6944 -0.1070 -0.0136 -0.1358 451 ASN A CA  
114 C C   . ASN A 24 ? 0.5877 0.4662 0.6389 -0.0693 -0.0197 -0.1502 451 ASN A C   
115 O O   . ASN A 24 ? 0.5539 0.4426 0.6107 -0.0637 -0.0253 -0.1755 451 ASN A O   
116 C CB  . ASN A 24 ? 0.6370 0.5489 0.7071 -0.1268 -0.0051 -0.1500 451 ASN A CB  
117 C CG  . ASN A 24 ? 0.7096 0.6019 0.7842 -0.1710 0.0038  -0.1482 451 ASN A CG  
118 O OD1 . ASN A 24 ? 0.8012 0.6189 0.8487 -0.1904 -0.0005 -0.1392 451 ASN A OD1 
119 N ND2 . ASN A 24 ? 0.6848 0.6423 0.7951 -0.1885 0.0157  -0.1575 451 ASN A ND2 
120 N N   . GLY A 25 ? 0.5493 0.4410 0.5991 -0.0473 -0.0167 -0.1356 452 GLY A N   
121 C CA  . GLY A 25 ? 0.5329 0.4595 0.5922 -0.0188 -0.0144 -0.1480 452 GLY A CA  
122 C C   . GLY A 25 ? 0.4948 0.4817 0.5532 -0.0150 -0.0037 -0.1447 452 GLY A C   
123 O O   . GLY A 25 ? 0.5058 0.5181 0.5622 0.0019  0.0023  -0.1523 452 GLY A O   
124 N N   . ARG A 26 ? 0.4738 0.4815 0.5327 -0.0304 -0.0008 -0.1338 453 ARG A N   
125 C CA  . ARG A 26 ? 0.4290 0.4827 0.4849 -0.0231 0.0014  -0.1298 453 ARG A CA  
126 C C   . ARG A 26 ? 0.3975 0.4554 0.4492 -0.0139 0.0073  -0.1077 453 ARG A C   
127 O O   . ARG A 26 ? 0.4102 0.4508 0.4630 -0.0208 0.0097  -0.0928 453 ARG A O   
128 C CB  . ARG A 26 ? 0.4709 0.5518 0.5419 -0.0373 -0.0023 -0.1347 453 ARG A CB  
129 C CG  . ARG A 26 ? 0.5897 0.6686 0.6729 -0.0532 -0.0108 -0.1577 453 ARG A CG  
130 C CD  . ARG A 26 ? 0.6949 0.8126 0.8115 -0.0698 -0.0132 -0.1650 453 ARG A CD  
131 N NE  . ARG A 26 ? 0.7481 0.8513 0.8820 -0.0985 0.0015  -0.1607 453 ARG A NE  
132 C CZ  . ARG A 26 ? 0.8662 1.0100 1.0375 -0.1171 0.0103  -0.1674 453 ARG A CZ  
133 N NH1 . ARG A 26 ? 0.8791 1.0813 1.0832 -0.1038 -0.0008 -0.1801 453 ARG A NH1 
134 N NH2 . ARG A 26 ? 0.9341 1.0594 1.1098 -0.1495 0.0302  -0.1623 453 ARG A NH2 
135 N N   . VAL A 27 ? 0.3654 0.4424 0.4057 -0.0015 0.0098  -0.1057 454 VAL A N   
136 C CA  . VAL A 27 ? 0.3280 0.4083 0.3654 0.0039  0.0139  -0.0865 454 VAL A CA  
137 C C   . VAL A 27 ? 0.3374 0.4262 0.3704 0.0015  0.0093  -0.0746 454 VAL A C   
138 O O   . VAL A 27 ? 0.3123 0.4181 0.3428 0.0022  0.0018  -0.0821 454 VAL A O   
139 C CB  . VAL A 27 ? 0.3625 0.4597 0.3862 0.0104  0.0222  -0.0884 454 VAL A CB  
140 C CG1 . VAL A 27 ? 0.3564 0.4562 0.3793 0.0099  0.0258  -0.0677 454 VAL A CG1 
141 C CG2 . VAL A 27 ? 0.3949 0.4915 0.4336 0.0170  0.0304  -0.1079 454 VAL A CG2 
142 N N   . TYR A 28 ? 0.3083 0.3841 0.3425 0.0008  0.0106  -0.0597 455 TYR A N   
143 C CA  . TYR A 28 ? 0.3290 0.4101 0.3587 0.0035  0.0072  -0.0520 455 TYR A CA  
144 C C   . TYR A 28 ? 0.3563 0.4199 0.3760 0.0060  0.0061  -0.0354 455 TYR A C   
145 O O   . TYR A 28 ? 0.3239 0.3788 0.3475 0.0045  0.0072  -0.0300 455 TYR A O   
146 C CB  . TYR A 28 ? 0.3086 0.3934 0.3511 -0.0047 0.0123  -0.0596 455 TYR A CB  
147 C CG  . TYR A 28 ? 0.3534 0.4070 0.3860 -0.0166 0.0198  -0.0522 455 TYR A CG  
148 C CD1 . TYR A 28 ? 0.3531 0.3845 0.3843 -0.0264 0.0200  -0.0545 455 TYR A CD1 
149 C CD2 . TYR A 28 ? 0.3450 0.3825 0.3616 -0.0175 0.0229  -0.0434 455 TYR A CD2 
150 C CE1 . TYR A 28 ? 0.3851 0.3747 0.3951 -0.0374 0.0204  -0.0442 455 TYR A CE1 
151 C CE2 . TYR A 28 ? 0.3894 0.3895 0.3817 -0.0296 0.0256  -0.0349 455 TYR A CE2 
152 C CZ  . TYR A 28 ? 0.3967 0.3713 0.3838 -0.0399 0.0232  -0.0335 455 TYR A CZ  
153 O OH  . TYR A 28 ? 0.4113 0.3367 0.3628 -0.0516 0.0198  -0.0216 455 TYR A OH  
154 N N   . PHE A 29 ? 0.3157 0.3759 0.3282 0.0110  0.0012  -0.0308 456 PHE A N   
155 C CA  . PHE A 29 ? 0.3381 0.3771 0.3386 0.0116  -0.0033 -0.0173 456 PHE A CA  
156 C C   . PHE A 29 ? 0.3711 0.3955 0.3655 0.0135  -0.0029 -0.0203 456 PHE A C   
157 O O   . PHE A 29 ? 0.3596 0.3993 0.3629 0.0194  0.0002  -0.0329 456 PHE A O   
158 C CB  . PHE A 29 ? 0.3652 0.4007 0.3502 0.0157  -0.0114 -0.0081 456 PHE A CB  
159 C CG  . PHE A 29 ? 0.3401 0.3899 0.3192 0.0102  -0.0053 -0.0072 456 PHE A CG  
160 C CD1 . PHE A 29 ? 0.3742 0.4400 0.3472 0.0145  -0.0073 -0.0183 456 PHE A CD1 
161 C CD2 . PHE A 29 ? 0.3869 0.4375 0.3672 0.0000  0.0029  0.0012  456 PHE A CD2 
162 C CE1 . PHE A 29 ? 0.3660 0.4411 0.3225 0.0093  0.0002  -0.0208 456 PHE A CE1 
163 C CE2 . PHE A 29 ? 0.4129 0.4816 0.3860 -0.0060 0.0156  -0.0027 456 PHE A CE2 
164 C CZ  . PHE A 29 ? 0.3777 0.4549 0.3325 -0.0009 0.0149  -0.0136 456 PHE A CZ  
165 N N   . VAL A 30 ? 0.4004 0.3984 0.3815 0.0083  -0.0061 -0.0120 457 VAL A N   
166 C CA  . VAL A 30 ? 0.4306 0.4085 0.3926 0.0074  -0.0030 -0.0169 457 VAL A CA  
167 C C   . VAL A 30 ? 0.4278 0.3793 0.3743 0.0121  -0.0164 -0.0106 457 VAL A C   
168 O O   . VAL A 30 ? 0.3724 0.3137 0.3211 0.0064  -0.0273 0.0013  457 VAL A O   
169 C CB  . VAL A 30 ? 0.4853 0.4386 0.4277 -0.0051 -0.0014 -0.0125 457 VAL A CB  
170 C CG1 . VAL A 30 ? 0.5622 0.4916 0.4691 -0.0098 0.0066  -0.0189 457 VAL A CG1 
171 C CG2 . VAL A 30 ? 0.4975 0.4620 0.4512 -0.0130 0.0074  -0.0158 457 VAL A CG2 
172 N N   . ASN A 31 ? 0.4515 0.3939 0.3873 0.0218  -0.0151 -0.0219 458 ASN A N   
173 C CA  . ASN A 31 ? 0.4605 0.3666 0.3762 0.0258  -0.0299 -0.0191 458 ASN A CA  
174 C C   . ASN A 31 ? 0.4633 0.3435 0.3462 0.0216  -0.0245 -0.0290 458 ASN A C   
175 O O   . ASN A 31 ? 0.4543 0.3445 0.3317 0.0286  -0.0071 -0.0488 458 ASN A O   
176 C CB  . ASN A 31 ? 0.4540 0.3559 0.3758 0.0447  -0.0385 -0.0268 458 ASN A CB  
177 C CG  . ASN A 31 ? 0.5334 0.3858 0.4305 0.0478  -0.0563 -0.0250 458 ASN A CG  
178 O OD1 . ASN A 31 ? 0.5526 0.3795 0.4286 0.0355  -0.0604 -0.0221 458 ASN A OD1 
179 N ND2 . ASN A 31 ? 0.5898 0.4222 0.4868 0.0642  -0.0717 -0.0271 458 ASN A ND2 
180 N N   . HIS A 32 ? 0.4464 0.2962 0.3084 0.0098  -0.0396 -0.0177 459 HIS A N   
181 C CA  . HIS A 32 ? 0.4988 0.3144 0.3145 0.0017  -0.0405 -0.0226 459 HIS A CA  
182 C C   . HIS A 32 ? 0.5611 0.3440 0.3436 0.0103  -0.0429 -0.0397 459 HIS A C   
183 O O   . HIS A 32 ? 0.6211 0.3766 0.3541 0.0049  -0.0360 -0.0503 459 HIS A O   
184 C CB  . HIS A 32 ? 0.4907 0.2856 0.3010 -0.0103 -0.0654 -0.0065 459 HIS A CB  
185 C CG  . HIS A 32 ? 0.4717 0.2869 0.3027 -0.0155 -0.0625 0.0032  459 HIS A CG  
186 N ND1 . HIS A 32 ? 0.5002 0.2957 0.2949 -0.0235 -0.0552 0.0042  459 HIS A ND1 
187 C CD2 . HIS A 32 ? 0.4415 0.2894 0.3214 -0.0142 -0.0656 0.0108  459 HIS A CD2 
188 C CE1 . HIS A 32 ? 0.4766 0.2866 0.2997 -0.0244 -0.0587 0.0123  459 HIS A CE1 
189 N NE2 . HIS A 32 ? 0.4181 0.2635 0.2953 -0.0171 -0.0641 0.0139  459 HIS A NE2 
190 N N   . ASN A 33 ? 0.5484 0.3275 0.3514 0.0233  -0.0532 -0.0428 460 ASN A N   
191 C CA  . ASN A 33 ? 0.6098 0.3548 0.3880 0.0376  -0.0574 -0.0637 460 ASN A CA  
192 C C   . ASN A 33 ? 0.6027 0.3774 0.3905 0.0556  -0.0297 -0.0911 460 ASN A C   
193 O O   . ASN A 33 ? 0.6767 0.4339 0.4302 0.0602  -0.0167 -0.1150 460 ASN A O   
194 C CB  . ASN A 33 ? 0.6049 0.3244 0.3995 0.0447  -0.0825 -0.0553 460 ASN A CB  
195 C CG  . ASN A 33 ? 0.6236 0.3173 0.4138 0.0221  -0.1065 -0.0342 460 ASN A CG  
196 O OD1 . ASN A 33 ? 0.7371 0.4032 0.4971 0.0114  -0.1177 -0.0378 460 ASN A OD1 
197 N ND2 . ASN A 33 ? 0.5944 0.2999 0.4146 0.0127  -0.1140 -0.0136 460 ASN A ND2 
198 N N   . THR A 34 ? 0.5657 0.3886 0.4021 0.0651  -0.0207 -0.0906 461 THR A N   
199 C CA  . THR A 34 ? 0.5561 0.4210 0.4244 0.0849  0.0008  -0.1202 461 THR A CA  
200 C C   . THR A 34 ? 0.5518 0.4634 0.4292 0.0671  0.0343  -0.1252 461 THR A C   
201 O O   . THR A 34 ? 0.5423 0.4987 0.4495 0.0753  0.0604  -0.1536 461 THR A O   
202 C CB  . THR A 34 ? 0.5318 0.4183 0.4490 0.1074  -0.0177 -0.1188 461 THR A CB  
203 O OG1 . THR A 34 ? 0.4897 0.3946 0.4198 0.0917  -0.0236 -0.0914 461 THR A OG1 
204 C CG2 . THR A 34 ? 0.5682 0.3969 0.4699 0.1247  -0.0510 -0.1149 461 THR A CG2 
205 N N   . ARG A 35 ? 0.5646 0.4653 0.4202 0.0421  0.0328  -0.0995 462 ARG A N   
206 C CA  . ARG A 35 ? 0.5912 0.5174 0.4449 0.0200  0.0585  -0.0974 462 ARG A CA  
207 C C   . ARG A 35 ? 0.5723 0.5580 0.4882 0.0254  0.0678  -0.1055 462 ARG A C   
208 O O   . ARG A 35 ? 0.6262 0.6455 0.5548 0.0105  0.0965  -0.1180 462 ARG A O   
209 C CB  . ARG A 35 ? 0.7064 0.6256 0.5166 0.0066  0.0915  -0.1174 462 ARG A CB  
210 C CG  . ARG A 35 ? 0.7933 0.6464 0.5255 -0.0036 0.0803  -0.1089 462 ARG A CG  
211 C CD  . ARG A 35 ? 0.9324 0.7791 0.6138 -0.0142 0.1174  -0.1349 462 ARG A CD  
212 N NE  . ARG A 35 ? 1.0128 0.7880 0.6015 -0.0291 0.1050  -0.1252 462 ARG A NE  
213 C CZ  . ARG A 35 ? 1.1680 0.9073 0.6826 -0.0597 0.1186  -0.1125 462 ARG A CZ  
214 N NH1 . ARG A 35 ? 1.2397 0.9079 0.6656 -0.0693 0.0975  -0.1040 462 ARG A NH1 
215 N NH2 . ARG A 35 ? 1.1926 0.9593 0.7155 -0.0829 0.1495  -0.1072 462 ARG A NH2 
216 N N   . ILE A 36 ? 0.5267 0.5229 0.4773 0.0437  0.0432  -0.0988 463 ILE A N   
217 C CA  . ILE A 36 ? 0.5333 0.5804 0.5364 0.0493  0.0433  -0.1052 463 ILE A CA  
218 C C   . ILE A 36 ? 0.4611 0.5018 0.4600 0.0354  0.0320  -0.0804 463 ILE A C   
219 O O   . ILE A 36 ? 0.4435 0.4490 0.4167 0.0323  0.0166  -0.0600 463 ILE A O   
220 C CB  . ILE A 36 ? 0.5607 0.6205 0.5981 0.0814  0.0203  -0.1173 463 ILE A CB  
221 C CG1 . ILE A 36 ? 0.6311 0.6454 0.6425 0.0875  -0.0115 -0.0905 463 ILE A CG1 
222 C CG2 . ILE A 36 ? 0.5911 0.6525 0.6358 0.1013  0.0294  -0.1469 463 ILE A CG2 
223 C CD1 . ILE A 36 ? 0.7157 0.7092 0.7342 0.1176  -0.0394 -0.0971 463 ILE A CD1 
224 N N   . THR A 37 ? 0.4406 0.5187 0.4692 0.0257  0.0417  -0.0865 464 THR A N   
225 C CA  . THR A 37 ? 0.4032 0.4817 0.4346 0.0172  0.0321  -0.0721 464 THR A CA  
226 C C   . THR A 37 ? 0.4029 0.5190 0.4715 0.0316  0.0183  -0.0831 464 THR A C   
227 O O   . THR A 37 ? 0.3765 0.5319 0.4836 0.0402  0.0224  -0.1057 464 THR A O   
228 C CB  . THR A 37 ? 0.4184 0.4972 0.4455 -0.0084 0.0506  -0.0720 464 THR A CB  
229 O OG1 . THR A 37 ? 0.4086 0.5281 0.4669 -0.0172 0.0713  -0.0941 464 THR A OG1 
230 C CG2 . THR A 37 ? 0.4332 0.4640 0.4120 -0.0223 0.0566  -0.0584 464 THR A CG2 
231 N N   . GLN A 38 ? 0.3554 0.4622 0.4134 0.0345  0.0016  -0.0697 465 GLN A N   
232 C CA  . GLN A 38 ? 0.3426 0.4733 0.4180 0.0474  -0.0176 -0.0773 465 GLN A CA  
233 C C   . GLN A 38 ? 0.3331 0.4560 0.3882 0.0383  -0.0221 -0.0670 465 GLN A C   
234 O O   . GLN A 38 ? 0.3206 0.4192 0.3523 0.0293  -0.0146 -0.0522 465 GLN A O   
235 C CB  . GLN A 38 ? 0.3622 0.4743 0.4268 0.0712  -0.0417 -0.0729 465 GLN A CB  
236 C CG  . GLN A 38 ? 0.3693 0.4335 0.3872 0.0668  -0.0478 -0.0465 465 GLN A CG  
237 C CD  . GLN A 38 ? 0.4191 0.4483 0.4169 0.0852  -0.0727 -0.0387 465 GLN A CD  
238 O OE1 . GLN A 38 ? 0.4498 0.4807 0.4683 0.1044  -0.0804 -0.0540 465 GLN A OE1 
239 N NE2 . GLN A 38 ? 0.4357 0.4296 0.3915 0.0780  -0.0837 -0.0157 465 GLN A NE2 
240 N N   . TRP A 39 ? 0.3348 0.4809 0.4015 0.0422  -0.0358 -0.0784 466 TRP A N   
241 C CA  . TRP A 39 ? 0.3703 0.5103 0.4137 0.0344  -0.0380 -0.0755 466 TRP A CA  
242 C C   . TRP A 39 ? 0.3906 0.5011 0.3866 0.0400  -0.0474 -0.0560 466 TRP A C   
243 O O   . TRP A 39 ? 0.4502 0.5520 0.4220 0.0306  -0.0373 -0.0508 466 TRP A O   
244 C CB  . TRP A 39 ? 0.3845 0.5544 0.4477 0.0358  -0.0541 -0.0960 466 TRP A CB  
245 C CG  . TRP A 39 ? 0.3453 0.5488 0.4592 0.0216  -0.0428 -0.1171 466 TRP A CG  
246 C CD1 . TRP A 39 ? 0.3466 0.5940 0.5105 0.0251  -0.0543 -0.1390 466 TRP A CD1 
247 C CD2 . TRP A 39 ? 0.3383 0.5319 0.4572 -0.0008 -0.0203 -0.1189 466 TRP A CD2 
248 N NE1 . TRP A 39 ? 0.3105 0.5795 0.5103 0.0003  -0.0344 -0.1535 466 TRP A NE1 
249 C CE2 . TRP A 39 ? 0.3096 0.5383 0.4756 -0.0160 -0.0149 -0.1392 466 TRP A CE2 
250 C CE3 . TRP A 39 ? 0.3330 0.4904 0.4243 -0.0091 -0.0068 -0.1061 466 TRP A CE3 
251 C CZ2 . TRP A 39 ? 0.3320 0.5486 0.5046 -0.0435 0.0046  -0.1423 466 TRP A CZ2 
252 C CZ3 . TRP A 39 ? 0.3773 0.5204 0.4773 -0.0298 0.0066  -0.1104 466 TRP A CZ3 
253 C CH2 . TRP A 39 ? 0.3581 0.5252 0.4920 -0.0489 0.0128  -0.1261 466 TRP A CH2 
254 N N   . GLU A 40 ? 0.4175 0.5111 0.4010 0.0540  -0.0655 -0.0470 467 GLU A N   
255 C CA  . GLU A 40 ? 0.4535 0.5114 0.3834 0.0553  -0.0792 -0.0272 467 GLU A CA  
256 C C   . GLU A 40 ? 0.4664 0.4985 0.3781 0.0421  -0.0618 -0.0077 467 GLU A C   
257 O O   . GLU A 40 ? 0.4658 0.4918 0.3985 0.0434  -0.0560 -0.0062 467 GLU A O   
258 C CB  . GLU A 40 ? 0.5049 0.5434 0.4265 0.0773  -0.1136 -0.0252 467 GLU A CB  
259 C CG  . GLU A 40 ? 0.5494 0.6175 0.4932 0.0925  -0.1402 -0.0459 467 GLU A CG  
260 C CD  . GLU A 40 ? 0.5442 0.6663 0.5666 0.0990  -0.1320 -0.0743 467 GLU A CD  
261 O OE1 . GLU A 40 ? 0.4757 0.6025 0.5243 0.0968  -0.1095 -0.0765 467 GLU A OE1 
262 O OE2 . GLU A 40 ? 0.5134 0.6728 0.5686 0.1036  -0.1477 -0.0954 467 GLU A OE2 
263 N N   . ASP A 41 ? 0.5276 0.5461 0.3992 0.0275  -0.0528 0.0052  468 ASP A N   
264 C CA  . ASP A 41 ? 0.4900 0.4922 0.3524 0.0108  -0.0362 0.0221  468 ASP A CA  
265 C C   . ASP A 41 ? 0.5298 0.4859 0.3660 0.0153  -0.0576 0.0400  468 ASP A C   
266 O O   . ASP A 41 ? 0.5984 0.5232 0.3903 0.0213  -0.0800 0.0498  468 ASP A O   
267 C CB  . ASP A 41 ? 0.4915 0.4987 0.3201 -0.0080 -0.0166 0.0273  468 ASP A CB  
268 C CG  . ASP A 41 ? 0.4897 0.5001 0.3305 -0.0281 0.0056  0.0376  468 ASP A CG  
269 O OD1 . ASP A 41 ? 0.4493 0.4355 0.2964 -0.0316 -0.0031 0.0509  468 ASP A OD1 
270 O OD2 . ASP A 41 ? 0.5149 0.5550 0.3639 -0.0401 0.0316  0.0287  468 ASP A OD2 
271 N N   . PRO A 42 ? 0.5560 0.5002 0.4155 0.0142  -0.0558 0.0431  469 PRO A N   
272 C CA  . PRO A 42 ? 0.5686 0.4604 0.4026 0.0185  -0.0774 0.0574  469 PRO A CA  
273 C C   . PRO A 42 ? 0.6851 0.5354 0.4635 -0.0050 -0.0782 0.0839  469 PRO A C   
274 O O   . PRO A 42 ? 0.7647 0.5572 0.5017 0.0000  -0.1045 0.0990  469 PRO A O   
275 C CB  . PRO A 42 ? 0.5429 0.4341 0.4082 0.0145  -0.0695 0.0529  469 PRO A CB  
276 C CG  . PRO A 42 ? 0.4847 0.4189 0.3795 -0.0007 -0.0441 0.0475  469 PRO A CG  
277 C CD  . PRO A 42 ? 0.4571 0.4263 0.3589 0.0085  -0.0381 0.0340  469 PRO A CD  
278 N N   . ARG A 43 ? 0.6370 0.5140 0.4131 -0.0312 -0.0492 0.0886  470 ARG A N   
279 C CA  . ARG A 43 ? 0.7414 0.5856 0.4623 -0.0620 -0.0399 0.1129  470 ARG A CA  
280 C C   . ARG A 43 ? 0.8362 0.6451 0.4835 -0.0588 -0.0564 0.1243  470 ARG A C   
281 O O   . ARG A 43 ? 0.8997 0.6540 0.4787 -0.0820 -0.0601 0.1506  470 ARG A O   
282 C CB  . ARG A 43 ? 0.7004 0.5958 0.4483 -0.0890 0.0002  0.1075  470 ARG A CB  
283 C CG  . ARG A 43 ? 0.6310 0.5524 0.4454 -0.0955 0.0084  0.1004  470 ARG A CG  
284 C CD  . ARG A 43 ? 0.6091 0.5960 0.4717 -0.1083 0.0420  0.0846  470 ARG A CD  
285 N NE  . ARG A 43 ? 0.5821 0.6054 0.4668 -0.0835 0.0456  0.0614  470 ARG A NE  
286 C CZ  . ARG A 43 ? 0.5773 0.6527 0.5084 -0.0828 0.0677  0.0411  470 ARG A CZ  
287 N NH1 . ARG A 43 ? 0.5923 0.7026 0.5633 -0.1035 0.0901  0.0380  470 ARG A NH1 
288 N NH2 . ARG A 43 ? 0.5647 0.6579 0.5078 -0.0613 0.0661  0.0216  470 ARG A NH2 
289 N N   . SER A 44 ? 0.8658 0.7011 0.5228 -0.0327 -0.0689 0.1052  471 SER A N   
290 C CA  . SER A 44 ? 0.9724 0.7712 0.5637 -0.0220 -0.0985 0.1125  471 SER A CA  
291 C C   . SER A 44 ? 1.0665 0.8085 0.6451 0.0051  -0.1472 0.1210  471 SER A C   
292 O O   . SER A 44 ? 1.1758 0.8758 0.6984 0.0179  -0.1832 0.1297  471 SER A O   
293 C CB  . SER A 44 ? 0.9391 0.7894 0.5544 -0.0046 -0.0993 0.0851  471 SER A CB  
294 O OG  . SER A 44 ? 0.9260 0.8178 0.5438 -0.0254 -0.0590 0.0747  471 SER A OG  
295 N N   . GLN A 45 ? 1.0696 0.8064 0.6966 0.0156  -0.1510 0.1166  472 GLN A N   
296 C CA  . GLN A 45 ? 1.0972 0.7872 0.7270 0.0476  -0.1944 0.1153  472 GLN A CA  
297 C C   . GLN A 45 ? 1.1506 0.7747 0.7569 0.0330  -0.1994 0.1360  472 GLN A C   
298 O O   . GLN A 45 ? 1.1371 0.7025 0.7315 0.0573  -0.2377 0.1381  472 GLN A O   
299 C CB  . GLN A 45 ? 1.0488 0.7994 0.7651 0.0791  -0.1939 0.0797  472 GLN A CB  
300 C CG  . GLN A 45 ? 0.9993 0.8203 0.7509 0.0860  -0.1837 0.0569  472 GLN A CG  
301 C CD  . GLN A 45 ? 0.9513 0.8345 0.7858 0.1025  -0.1695 0.0249  472 GLN A CD  
302 O OE1 . GLN A 45 ? 0.8962 0.7795 0.7569 0.1009  -0.1537 0.0203  472 GLN A OE1 
303 N NE2 . GLN A 45 ? 0.9204 0.8543 0.7911 0.1146  -0.1745 0.0024  472 GLN A NE2 
304 N N   A LEU B 10 ? 0.5832 0.8340 0.5758 0.1501  0.1258  -0.0694 437 LEU B N   
305 N N   B LEU B 10 ? 0.6118 0.7473 0.5568 0.1180  0.0919  -0.0625 437 LEU B N   
306 C CA  A LEU B 10 ? 0.5726 0.7568 0.5578 0.1285  0.1015  -0.0652 437 LEU B CA  
307 C CA  B LEU B 10 ? 0.5935 0.7814 0.5790 0.1313  0.1025  -0.0665 437 LEU B CA  
308 C C   . LEU B 10 ? 0.5829 0.7450 0.5859 0.1381  0.0807  -0.0765 437 LEU B C   
309 O O   . LEU B 10 ? 0.6097 0.7108 0.5831 0.1432  0.0591  -0.0863 437 LEU B O   
310 C CB  A LEU B 10 ? 0.5301 0.7201 0.5394 0.0914  0.1079  -0.0397 437 LEU B CB  
311 C CB  B LEU B 10 ? 0.6228 0.8483 0.5905 0.1669  0.1180  -0.0829 437 LEU B CB  
312 N N   . GLY B 11 ? 0.5215 0.7337 0.5717 0.1368  0.0857  -0.0724 438 GLY B N   
313 C CA  . GLY B 11 ? 0.4985 0.7000 0.5661 0.1484  0.0663  -0.0806 438 GLY B CA  
314 C C   . GLY B 11 ? 0.4887 0.6597 0.5689 0.1183  0.0507  -0.0696 438 GLY B C   
315 O O   . GLY B 11 ? 0.4288 0.5763 0.4998 0.0914  0.0533  -0.0576 438 GLY B O   
316 N N   . PRO B 12 ? 0.4866 0.6590 0.5851 0.1265  0.0341  -0.0738 439 PRO B N   
317 C CA  . PRO B 12 ? 0.4918 0.6357 0.5950 0.1023  0.0189  -0.0659 439 PRO B CA  
318 C C   . PRO B 12 ? 0.4572 0.5286 0.5172 0.1000  0.0034  -0.0661 439 PRO B C   
319 O O   . PRO B 12 ? 0.4519 0.4880 0.4790 0.1196  -0.0024 -0.0752 439 PRO B O   
320 C CB  . PRO B 12 ? 0.4980 0.6742 0.6302 0.1165  0.0056  -0.0705 439 PRO B CB  
321 C CG  . PRO B 12 ? 0.5237 0.7135 0.6495 0.1581  0.0062  -0.0830 439 PRO B CG  
322 C CD  . PRO B 12 ? 0.5329 0.7390 0.6473 0.1622  0.0292  -0.0856 439 PRO B CD  
323 N N   . LEU B 13 ? 0.4379 0.4889 0.4973 0.0751  -0.0030 -0.0565 440 LEU B N   
324 C CA  . LEU B 13 ? 0.4109 0.4080 0.4373 0.0685  -0.0174 -0.0531 440 LEU B CA  
325 C C   . LEU B 13 ? 0.4039 0.3725 0.4158 0.0873  -0.0369 -0.0581 440 LEU B C   
326 O O   . LEU B 13 ? 0.3708 0.3664 0.4037 0.1034  -0.0411 -0.0622 440 LEU B O   
327 C CB  . LEU B 13 ? 0.4628 0.4565 0.4951 0.0440  -0.0188 -0.0426 440 LEU B CB  
328 C CG  . LEU B 13 ? 0.4495 0.4555 0.4887 0.0280  -0.0023 -0.0355 440 LEU B CG  
329 C CD1 . LEU B 13 ? 0.4416 0.4475 0.4906 0.0118  -0.0034 -0.0305 440 LEU B CD1 
330 C CD2 . LEU B 13 ? 0.4643 0.4474 0.4759 0.0258  -0.0010 -0.0311 440 LEU B CD2 
331 N N   . PRO B 14 ? 0.4369 0.3509 0.4128 0.0843  -0.0503 -0.0563 441 PRO B N   
332 C CA  . PRO B 14 ? 0.4488 0.3230 0.4054 0.0998  -0.0705 -0.0569 441 PRO B CA  
333 C C   . PRO B 14 ? 0.4593 0.3431 0.4277 0.0909  -0.0808 -0.0454 441 PRO B C   
334 O O   . PRO B 14 ? 0.3893 0.2963 0.3709 0.0674  -0.0741 -0.0376 441 PRO B O   
335 C CB  . PRO B 14 ? 0.5147 0.3270 0.4296 0.0868  -0.0818 -0.0544 441 PRO B CB  
336 C CG  . PRO B 14 ? 0.5389 0.3653 0.4502 0.0821  -0.0672 -0.0620 441 PRO B CG  
337 C CD  . PRO B 14 ? 0.4827 0.3689 0.4316 0.0708  -0.0486 -0.0552 441 PRO B CD  
338 N N   . PRO B 15 ? 0.4847 0.3505 0.4451 0.1126  -0.0974 -0.0450 442 PRO B N   
339 C CA  . PRO B 15 ? 0.5124 0.3837 0.4747 0.1051  -0.1100 -0.0327 442 PRO B CA  
340 C C   . PRO B 15 ? 0.4756 0.3288 0.4200 0.0715  -0.1097 -0.0183 442 PRO B C   
341 O O   . PRO B 15 ? 0.5199 0.3305 0.4373 0.0586  -0.1127 -0.0124 442 PRO B O   
342 C CB  . PRO B 15 ? 0.5788 0.4028 0.5144 0.1327  -0.1312 -0.0295 442 PRO B CB  
343 C CG  . PRO B 15 ? 0.5918 0.4142 0.5304 0.1660  -0.1265 -0.0471 442 PRO B CG  
344 C CD  . PRO B 15 ? 0.5712 0.4071 0.5151 0.1487  -0.1062 -0.0558 442 PRO B CD  
345 N N   . GLY B 16 ? 0.4581 0.3489 0.4188 0.0574  -0.1053 -0.0146 443 GLY B N   
346 C CA  . GLY B 16 ? 0.4473 0.3332 0.3923 0.0321  -0.1034 -0.0018 443 GLY B CA  
347 C C   . GLY B 16 ? 0.4441 0.3527 0.4021 0.0153  -0.0847 -0.0049 443 GLY B C   
348 O O   . GLY B 16 ? 0.4629 0.3812 0.4136 0.0004  -0.0805 0.0027  443 GLY B O   
349 N N   . TRP B 17 ? 0.4094 0.3284 0.3845 0.0203  -0.0729 -0.0151 444 TRP B N   
350 C CA  . TRP B 17 ? 0.3828 0.3145 0.3646 0.0077  -0.0571 -0.0146 444 TRP B CA  
351 C C   . TRP B 17 ? 0.3393 0.3016 0.3465 0.0060  -0.0447 -0.0220 444 TRP B C   
352 O O   . TRP B 17 ? 0.3214 0.3028 0.3485 0.0133  -0.0454 -0.0301 444 TRP B O   
353 C CB  . TRP B 17 ? 0.4117 0.3310 0.3883 0.0122  -0.0523 -0.0184 444 TRP B CB  
354 C CG  . TRP B 17 ? 0.4222 0.3060 0.3704 0.0042  -0.0633 -0.0117 444 TRP B CG  
355 C CD1 . TRP B 17 ? 0.4750 0.3181 0.4011 0.0124  -0.0785 -0.0139 444 TRP B CD1 
356 C CD2 . TRP B 17 ? 0.4261 0.3112 0.3649 -0.0148 -0.0616 -0.0017 444 TRP B CD2 
357 N NE1 . TRP B 17 ? 0.5052 0.3174 0.4063 -0.0059 -0.0875 -0.0062 444 TRP B NE1 
358 C CE2 . TRP B 17 ? 0.4913 0.3363 0.4029 -0.0240 -0.0774 0.0022  444 TRP B CE2 
359 C CE3 . TRP B 17 ? 0.4371 0.3537 0.3876 -0.0239 -0.0494 0.0045  444 TRP B CE3 
360 C CZ2 . TRP B 17 ? 0.5003 0.3452 0.4009 -0.0473 -0.0816 0.0128  444 TRP B CZ2 
361 C CZ3 . TRP B 17 ? 0.4413 0.3630 0.3821 -0.0403 -0.0524 0.0153  444 TRP B CZ3 
362 C CH2 . TRP B 17 ? 0.5016 0.3921 0.4198 -0.0548 -0.0688 0.0198  444 TRP B CH2 
363 N N   . GLU B 18 ? 0.3477 0.3147 0.3546 -0.0037 -0.0338 -0.0186 445 GLU B N   
364 C CA  . GLU B 18 ? 0.3868 0.3674 0.4119 -0.0073 -0.0229 -0.0251 445 GLU B CA  
365 C C   . GLU B 18 ? 0.3404 0.3166 0.3632 -0.0096 -0.0093 -0.0191 445 GLU B C   
366 O O   . GLU B 18 ? 0.3424 0.3145 0.3510 -0.0100 -0.0096 -0.0111 445 GLU B O   
367 C CB  . GLU B 18 ? 0.3936 0.3765 0.4140 -0.0119 -0.0275 -0.0299 445 GLU B CB  
368 C CG  . GLU B 18 ? 0.3699 0.3546 0.4039 -0.0193 -0.0213 -0.0399 445 GLU B CG  
369 C CD  . GLU B 18 ? 0.3626 0.3397 0.3793 -0.0212 -0.0252 -0.0478 445 GLU B CD  
370 O OE1 . GLU B 18 ? 0.3105 0.2914 0.3078 -0.0166 -0.0317 -0.0438 445 GLU B OE1 
371 O OE2 . GLU B 18 ? 0.3790 0.3432 0.3976 -0.0277 -0.0214 -0.0578 445 GLU B OE2 
372 N N   . LYS B 19 ? 0.3458 0.3261 0.3833 -0.0120 0.0017  -0.0209 446 LYS B N   
373 C CA  . LYS B 19 ? 0.3758 0.3489 0.4088 -0.0120 0.0140  -0.0126 446 LYS B CA  
374 C C   . LYS B 19 ? 0.4013 0.3595 0.4329 -0.0151 0.0182  -0.0146 446 LYS B C   
375 O O   . LYS B 19 ? 0.4109 0.3656 0.4529 -0.0237 0.0160  -0.0237 446 LYS B O   
376 C CB  . LYS B 19 ? 0.4353 0.4181 0.4803 -0.0140 0.0247  -0.0100 446 LYS B CB  
377 C CG  . LYS B 19 ? 0.4551 0.4280 0.4907 -0.0132 0.0368  0.0024  446 LYS B CG  
378 C CD  . LYS B 19 ? 0.4754 0.4610 0.5185 -0.0171 0.0494  0.0086  446 LYS B CD  
379 C CE  . LYS B 19 ? 0.5967 0.5684 0.6504 -0.0315 0.0585  0.0148  446 LYS B CE  
380 N NZ  . LYS B 19 ? 0.6093 0.6044 0.6764 -0.0415 0.0717  0.0227  446 LYS B NZ  
381 N N   . ARG B 20 ? 0.3699 0.3195 0.3880 -0.0071 0.0233  -0.0071 447 ARG B N   
382 C CA  . ARG B 20 ? 0.4256 0.3517 0.4362 -0.0027 0.0288  -0.0099 447 ARG B CA  
383 C C   . ARG B 20 ? 0.4217 0.3358 0.4248 0.0077  0.0388  0.0037  447 ARG B C   
384 O O   . ARG B 20 ? 0.3640 0.2961 0.3661 0.0112  0.0400  0.0149  447 ARG B O   
385 C CB  . ARG B 20 ? 0.4818 0.4145 0.4789 0.0066  0.0247  -0.0152 447 ARG B CB  
386 C CG  . ARG B 20 ? 0.5246 0.4662 0.5207 -0.0006 0.0139  -0.0264 447 ARG B CG  
387 C CD  . ARG B 20 ? 0.5919 0.5105 0.5834 -0.0048 0.0114  -0.0427 447 ARG B CD  
388 N NE  . ARG B 20 ? 0.6470 0.5752 0.6215 -0.0007 0.0041  -0.0521 447 ARG B NE  
389 C CZ  . ARG B 20 ? 0.6699 0.5856 0.6219 0.0116  0.0078  -0.0621 447 ARG B CZ  
390 N NH1 . ARG B 20 ? 0.6476 0.5337 0.5908 0.0242  0.0177  -0.0648 447 ARG B NH1 
391 N NH2 . ARG B 20 ? 0.6931 0.6244 0.6270 0.0145  0.0016  -0.0696 447 ARG B NH2 
392 N N   . THR B 21 ? 0.4415 0.3214 0.4353 0.0140  0.0440  0.0018  448 THR B N   
393 C CA  . THR B 21 ? 0.4692 0.3310 0.4504 0.0319  0.0517  0.0152  448 THR B CA  
394 C C   . THR B 21 ? 0.4957 0.3495 0.4622 0.0549  0.0522  0.0078  448 THR B C   
395 O O   . THR B 21 ? 0.4951 0.3297 0.4542 0.0529  0.0492  -0.0098 448 THR B O   
396 C CB  . THR B 21 ? 0.5273 0.3420 0.5048 0.0223  0.0580  0.0213  448 THR B CB  
397 O OG1 . THR B 21 ? 0.4782 0.3123 0.4704 0.0026  0.0606  0.0288  448 THR B OG1 
398 C CG2 . THR B 21 ? 0.6426 0.4324 0.6030 0.0437  0.0645  0.0385  448 THR B CG2 
399 N N   . ASP B 22 ? 0.4850 0.3598 0.4466 0.0781  0.0558  0.0203  449 ASP B N   
400 C CA  . ASP B 22 ? 0.5348 0.4073 0.4827 0.1076  0.0596  0.0142  449 ASP B CA  
401 C C   . ASP B 22 ? 0.5981 0.4039 0.5254 0.1272  0.0647  0.0132  449 ASP B C   
402 O O   . ASP B 22 ? 0.6602 0.4219 0.5846 0.1136  0.0655  0.0211  449 ASP B O   
403 C CB  . ASP B 22 ? 0.4956 0.4341 0.4520 0.1252  0.0604  0.0274  449 ASP B CB  
404 C CG  . ASP B 22 ? 0.5011 0.4527 0.4606 0.1376  0.0610  0.0492  449 ASP B CG  
405 O OD1 . ASP B 22 ? 0.5634 0.4662 0.5113 0.1453  0.0642  0.0568  449 ASP B OD1 
406 O OD2 . ASP B 22 ? 0.4226 0.4366 0.3947 0.1391  0.0572  0.0602  449 ASP B OD2 
407 N N   . SER B 23 ? 0.6786 0.4741 0.5888 0.1593  0.0686  0.0033  450 SER B N   
408 C CA  . SER B 23 ? 0.7537 0.4712 0.6367 0.1824  0.0716  -0.0012 450 SER B CA  
409 C C   . SER B 23 ? 0.8046 0.5052 0.6858 0.1963  0.0742  0.0258  450 SER B C   
410 O O   . SER B 23 ? 0.8193 0.4427 0.6814 0.1943  0.0744  0.0306  450 SER B O   
411 C CB  . SER B 23 ? 0.7836 0.5005 0.6454 0.2239  0.0765  -0.0186 450 SER B CB  
412 O OG  . SER B 23 ? 0.7033 0.5131 0.5833 0.2393  0.0807  -0.0117 450 SER B OG  
413 N N   . ASN B 24 ? 0.7820 0.5553 0.6814 0.2062  0.0746  0.0445  451 ASN B N   
414 C CA  . ASN B 24 ? 0.8139 0.5880 0.7120 0.2168  0.0745  0.0721  451 ASN B CA  
415 C C   . ASN B 24 ? 0.7675 0.5234 0.6694 0.1795  0.0733  0.0849  451 ASN B C   
416 O O   . ASN B 24 ? 0.7407 0.4850 0.6332 0.1875  0.0740  0.1082  451 ASN B O   
417 C CB  . ASN B 24 ? 0.7781 0.6455 0.6958 0.2332  0.0718  0.0862  451 ASN B CB  
418 C CG  . ASN B 24 ? 0.8232 0.7190 0.7381 0.2807  0.0757  0.0839  451 ASN B CG  
419 O OD1 . ASN B 24 ? 0.9202 0.7540 0.8111 0.3135  0.0800  0.0786  451 ASN B OD1 
420 N ND2 . ASN B 24 ? 0.7850 0.7753 0.7240 0.2849  0.0740  0.0882  451 ASN B ND2 
421 N N   . GLY B 25 ? 0.7158 0.4771 0.6310 0.1422  0.0717  0.0713  452 GLY B N   
422 C CA  . GLY B 25 ? 0.6800 0.4345 0.6013 0.1095  0.0730  0.0813  452 GLY B CA  
423 C C   . GLY B 25 ? 0.5957 0.4189 0.5345 0.0950  0.0694  0.0847  452 GLY B C   
424 O O   . GLY B 25 ? 0.5919 0.4188 0.5345 0.0730  0.0718  0.0907  452 GLY B O   
425 N N   . ARG B 26 ? 0.5742 0.4514 0.5221 0.1064  0.0638  0.0804  453 ARG B N   
426 C CA  . ARG B 26 ? 0.4891 0.4197 0.4474 0.0921  0.0574  0.0832  453 ARG B CA  
427 C C   . ARG B 26 ? 0.4861 0.4242 0.4567 0.0665  0.0537  0.0653  453 ARG B C   
428 O O   . ARG B 26 ? 0.4320 0.3700 0.4074 0.0659  0.0518  0.0514  453 ARG B O   
429 C CB  . ARG B 26 ? 0.5213 0.5094 0.4851 0.1088  0.0506  0.0904  453 ARG B CB  
430 C CG  . ARG B 26 ? 0.5228 0.5540 0.4901 0.0904  0.0407  0.0944  453 ARG B CG  
431 C CD  . ARG B 26 ? 0.5097 0.6029 0.4832 0.0981  0.0305  0.1051  453 ARG B CD  
432 N NE  . ARG B 26 ? 0.5090 0.6215 0.4784 0.0736  0.0192  0.1025  453 ARG B NE  
433 C CZ  . ARG B 26 ? 0.4527 0.6148 0.4249 0.0659  0.0054  0.1082  453 ARG B CZ  
434 N NH1 . ARG B 26 ? 0.4975 0.7100 0.4832 0.0806  0.0018  0.1195  453 ARG B NH1 
435 N NH2 . ARG B 26 ? 0.4448 0.6067 0.4055 0.0432  -0.0057 0.1011  453 ARG B NH2 
436 N N   . VAL B 27 ? 0.4208 0.3671 0.3936 0.0490  0.0525  0.0658  454 VAL B N   
437 C CA  . VAL B 27 ? 0.3675 0.3194 0.3509 0.0305  0.0484  0.0506  454 VAL B CA  
438 C C   . VAL B 27 ? 0.3604 0.3436 0.3462 0.0273  0.0372  0.0453  454 VAL B C   
439 O O   . VAL B 27 ? 0.3418 0.3494 0.3218 0.0282  0.0312  0.0529  454 VAL B O   
440 C CB  . VAL B 27 ? 0.3699 0.3244 0.3529 0.0191  0.0523  0.0522  454 VAL B CB  
441 C CG1 . VAL B 27 ? 0.3603 0.3226 0.3555 0.0071  0.0475  0.0362  454 VAL B CG1 
442 C CG2 . VAL B 27 ? 0.3988 0.3264 0.3803 0.0154  0.0645  0.0623  454 VAL B CG2 
443 N N   . TYR B 28 ? 0.3590 0.3410 0.3513 0.0202  0.0326  0.0333  455 TYR B N   
444 C CA  . TYR B 28 ? 0.3273 0.3314 0.3189 0.0118  0.0215  0.0315  455 TYR B CA  
445 C C   . TYR B 28 ? 0.3648 0.3566 0.3596 0.0016  0.0156  0.0197  455 TYR B C   
446 O O   . TYR B 28 ? 0.3443 0.3204 0.3465 0.0007  0.0199  0.0119  455 TYR B O   
447 C CB  . TYR B 28 ? 0.3453 0.3739 0.3375 0.0187  0.0213  0.0366  455 TYR B CB  
448 C CG  . TYR B 28 ? 0.3142 0.3303 0.3057 0.0254  0.0263  0.0269  455 TYR B CG  
449 C CD1 . TYR B 28 ? 0.3216 0.3122 0.3095 0.0404  0.0355  0.0231  455 TYR B CD1 
450 C CD2 . TYR B 28 ? 0.3353 0.3592 0.3244 0.0162  0.0202  0.0214  455 TYR B CD2 
451 C CE1 . TYR B 28 ? 0.3557 0.3294 0.3365 0.0466  0.0380  0.0100  455 TYR B CE1 
452 C CE2 . TYR B 28 ? 0.3358 0.3507 0.3183 0.0231  0.0235  0.0106  455 TYR B CE2 
453 C CZ  . TYR B 28 ? 0.3437 0.3334 0.3216 0.0383  0.0320  0.0029  455 TYR B CZ  
454 O OH  . TYR B 28 ? 0.3672 0.3423 0.3326 0.0449  0.0333  -0.0117 455 TYR B OH  
455 N N   . PHE B 29 ? 0.3376 0.3370 0.3270 -0.0073 0.0042  0.0201  456 PHE B N   
456 C CA  . PHE B 29 ? 0.3484 0.3332 0.3367 -0.0128 -0.0043 0.0116  456 PHE B CA  
457 C C   . PHE B 29 ? 0.3700 0.3603 0.3521 -0.0197 -0.0122 0.0151  456 PHE B C   
458 O O   . PHE B 29 ? 0.3603 0.3689 0.3375 -0.0266 -0.0144 0.0258  456 PHE B O   
459 C CB  . PHE B 29 ? 0.3845 0.3582 0.3636 -0.0151 -0.0115 0.0089  456 PHE B CB  
460 C CG  . PHE B 29 ? 0.3857 0.3606 0.3678 -0.0074 -0.0012 0.0063  456 PHE B CG  
461 C CD1 . PHE B 29 ? 0.3958 0.3813 0.3707 -0.0059 0.0032  0.0149  456 PHE B CD1 
462 C CD2 . PHE B 29 ? 0.3794 0.3521 0.3722 -0.0019 0.0043  -0.0021 456 PHE B CD2 
463 C CE1 . PHE B 29 ? 0.4086 0.3959 0.3818 0.0005  0.0138  0.0162  456 PHE B CE1 
464 C CE2 . PHE B 29 ? 0.4001 0.3809 0.3954 0.0023  0.0167  -0.0009 456 PHE B CE2 
465 C CZ  . PHE B 29 ? 0.4001 0.3848 0.3830 0.0033  0.0219  0.0090  456 PHE B CZ  
466 N N   . VAL B 30 ? 0.3573 0.3386 0.3405 -0.0183 -0.0159 0.0077  457 VAL B N   
467 C CA  . VAL B 30 ? 0.3804 0.3673 0.3526 -0.0238 -0.0227 0.0126  457 VAL B CA  
468 C C   . VAL B 30 ? 0.3871 0.3520 0.3496 -0.0279 -0.0379 0.0135  457 VAL B C   
469 O O   . VAL B 30 ? 0.4086 0.3622 0.3784 -0.0193 -0.0417 0.0034  457 VAL B O   
470 C CB  . VAL B 30 ? 0.3883 0.3806 0.3612 -0.0168 -0.0178 0.0033  457 VAL B CB  
471 C CG1 . VAL B 30 ? 0.4084 0.4136 0.3641 -0.0209 -0.0224 0.0102  457 VAL B CG1 
472 C CG2 . VAL B 30 ? 0.3586 0.3558 0.3371 -0.0075 -0.0038 -0.0008 457 VAL B CG2 
473 N N   . ASN B 31 ? 0.4131 0.3729 0.3594 -0.0406 -0.0469 0.0270  458 ASN B N   
474 C CA  . ASN B 31 ? 0.4204 0.3479 0.3504 -0.0427 -0.0633 0.0307  458 ASN B CA  
475 C C   . ASN B 31 ? 0.4260 0.3627 0.3439 -0.0452 -0.0670 0.0391  458 ASN B C   
476 O O   . ASN B 31 ? 0.3685 0.3212 0.2746 -0.0600 -0.0652 0.0549  458 ASN B O   
477 C CB  . ASN B 31 ? 0.4556 0.3558 0.3681 -0.0597 -0.0745 0.0417  458 ASN B CB  
478 C CG  . ASN B 31 ? 0.5392 0.3892 0.4293 -0.0573 -0.0930 0.0445  458 ASN B CG  
479 O OD1 . ASN B 31 ? 0.4729 0.3190 0.3584 -0.0470 -0.0982 0.0463  458 ASN B OD1 
480 N ND2 . ASN B 31 ? 0.5519 0.3598 0.4246 -0.0649 -0.1045 0.0441  458 ASN B ND2 
481 N N   . HIS B 32 ? 0.4561 0.3887 0.3764 -0.0314 -0.0727 0.0296  459 HIS B N   
482 C CA  . HIS B 32 ? 0.4725 0.4181 0.3784 -0.0311 -0.0769 0.0344  459 HIS B CA  
483 C C   . HIS B 32 ? 0.5121 0.4315 0.3899 -0.0382 -0.0927 0.0543  459 HIS B C   
484 O O   . HIS B 32 ? 0.5472 0.4797 0.4060 -0.0420 -0.0949 0.0646  459 HIS B O   
485 C CB  . HIS B 32 ? 0.4386 0.3965 0.3579 -0.0168 -0.0795 0.0164  459 HIS B CB  
486 C CG  . HIS B 32 ? 0.3953 0.3734 0.3322 -0.0157 -0.0645 0.0009  459 HIS B CG  
487 N ND1 . HIS B 32 ? 0.3907 0.3858 0.3158 -0.0171 -0.0558 -0.0019 459 HIS B ND1 
488 C CD2 . HIS B 32 ? 0.3965 0.3757 0.3580 -0.0125 -0.0564 -0.0115 459 HIS B CD2 
489 C CE1 . HIS B 32 ? 0.3855 0.3824 0.3256 -0.0137 -0.0450 -0.0167 459 HIS B CE1 
490 N NE2 . HIS B 32 ? 0.4054 0.3932 0.3682 -0.0134 -0.0450 -0.0205 459 HIS B NE2 
491 N N   . ASN B 33 ? 0.5469 0.4247 0.4174 -0.0394 -0.1040 0.0596  460 ASN B N   
492 C CA  . ASN B 33 ? 0.5982 0.4350 0.4362 -0.0503 -0.1202 0.0821  460 ASN B CA  
493 C C   . ASN B 33 ? 0.5841 0.4299 0.4089 -0.0816 -0.1151 0.1041  460 ASN B C   
494 O O   . ASN B 33 ? 0.6458 0.4927 0.4472 -0.0946 -0.1192 0.1258  460 ASN B O   
495 C CB  . ASN B 33 ? 0.6301 0.4087 0.4595 -0.0406 -0.1347 0.0778  460 ASN B CB  
496 C CG  . ASN B 33 ? 0.6234 0.3962 0.4616 -0.0077 -0.1431 0.0631  460 ASN B CG  
497 O OD1 . ASN B 33 ? 0.6416 0.4287 0.4748 0.0027  -0.1505 0.0682  460 ASN B OD1 
498 N ND2 . ASN B 33 ? 0.6217 0.3816 0.4736 0.0097  -0.1419 0.0449  460 ASN B ND2 
499 N N   . THR B 34 ? 0.5599 0.4171 0.3997 -0.0946 -0.1067 0.1004  461 THR B N   
500 C CA  . THR B 34 ? 0.5802 0.4602 0.4149 -0.1267 -0.1024 0.1220  461 THR B CA  
501 C C   . THR B 34 ? 0.5382 0.4918 0.3915 -0.1252 -0.0811 0.1215  461 THR B C   
502 O O   . THR B 34 ? 0.5219 0.5142 0.3750 -0.1477 -0.0744 0.1408  461 THR B O   
503 C CB  . THR B 34 ? 0.5820 0.4404 0.4210 -0.1442 -0.1085 0.1199  461 THR B CB  
504 O OG1 . THR B 34 ? 0.5457 0.4202 0.4087 -0.1233 -0.0989 0.0957  461 THR B OG1 
505 C CG2 . THR B 34 ? 0.6490 0.4244 0.4587 -0.1491 -0.1313 0.1224  461 THR B CG2 
506 N N   . ARG B 35 ? 0.4537 0.4265 0.3224 -0.0986 -0.0708 0.0997  462 ARG B N   
507 C CA  . ARG B 35 ? 0.4746 0.5037 0.3563 -0.0895 -0.0513 0.0938  462 ARG B CA  
508 C C   . ARG B 35 ? 0.4620 0.5242 0.3641 -0.0968 -0.0413 0.0967  462 ARG B C   
509 O O   . ARG B 35 ? 0.4432 0.5568 0.3492 -0.1019 -0.0296 0.1078  462 ARG B O   
510 C CB  . ARG B 35 ? 0.5130 0.5757 0.3736 -0.0932 -0.0454 0.1078  462 ARG B CB  
511 C CG  . ARG B 35 ? 0.5479 0.5828 0.3879 -0.0810 -0.0568 0.1017  462 ARG B CG  
512 C CD  . ARG B 35 ? 0.6349 0.7003 0.4475 -0.0781 -0.0521 0.1093  462 ARG B CD  
513 N NE  . ARG B 35 ? 0.7016 0.7375 0.5004 -0.0637 -0.0680 0.0985  462 ARG B NE  
514 C CZ  . ARG B 35 ? 0.7569 0.7871 0.5232 -0.0651 -0.0794 0.1134  462 ARG B CZ  
515 N NH1 . ARG B 35 ? 0.8264 0.8764 0.5657 -0.0826 -0.0747 0.1420  462 ARG B NH1 
516 N NH2 . ARG B 35 ? 0.7611 0.7707 0.5220 -0.0491 -0.0960 0.1012  462 ARG B NH2 
517 N N   . ILE B 36 ? 0.4562 0.4942 0.3711 -0.0939 -0.0458 0.0860  463 ILE B N   
518 C CA  . ILE B 36 ? 0.4799 0.5511 0.4136 -0.0962 -0.0381 0.0870  463 ILE B CA  
519 C C   . ILE B 36 ? 0.4247 0.4856 0.3727 -0.0725 -0.0309 0.0670  463 ILE B C   
520 O O   . ILE B 36 ? 0.4584 0.4870 0.4047 -0.0597 -0.0328 0.0527  463 ILE B O   
521 C CB  . ILE B 36 ? 0.5275 0.5845 0.4575 -0.1243 -0.0527 0.0989  463 ILE B CB  
522 C CG1 . ILE B 36 ? 0.6227 0.6142 0.5413 -0.1195 -0.0665 0.0844  463 ILE B CG1 
523 C CG2 . ILE B 36 ? 0.5396 0.6049 0.4554 -0.1548 -0.0599 0.1234  463 ILE B CG2 
524 C CD1 . ILE B 36 ? 0.7017 0.6686 0.6102 -0.1434 -0.0822 0.0885  463 ILE B CD1 
525 N N   . THR B 37 ? 0.3862 0.4798 0.3487 -0.0681 -0.0229 0.0691  464 THR B N   
526 C CA  . THR B 37 ? 0.3986 0.4835 0.3715 -0.0491 -0.0160 0.0568  464 THR B CA  
527 C C   . THR B 37 ? 0.3756 0.4732 0.3533 -0.0588 -0.0220 0.0635  464 THR B C   
528 O O   . THR B 37 ? 0.4131 0.5433 0.3932 -0.0778 -0.0281 0.0777  464 THR B O   
529 C CB  . THR B 37 ? 0.4187 0.5277 0.3991 -0.0251 0.0004  0.0520  464 THR B CB  
530 O OG1 . THR B 37 ? 0.3902 0.5545 0.3792 -0.0231 0.0066  0.0654  464 THR B OG1 
531 C CG2 . THR B 37 ? 0.4778 0.5750 0.4475 -0.0178 0.0039  0.0426  464 THR B CG2 
532 N N   . GLN B 38 ? 0.3435 0.4184 0.3215 -0.0484 -0.0213 0.0540  465 GLN B N   
533 C CA  . GLN B 38 ? 0.3450 0.4307 0.3220 -0.0544 -0.0278 0.0578  465 GLN B CA  
534 C C   . GLN B 38 ? 0.3154 0.3868 0.2930 -0.0339 -0.0186 0.0502  465 GLN B C   
535 O O   . GLN B 38 ? 0.3016 0.3464 0.2802 -0.0228 -0.0105 0.0407  465 GLN B O   
536 C CB  . GLN B 38 ? 0.3435 0.3965 0.3028 -0.0767 -0.0459 0.0548  465 GLN B CB  
537 C CG  . GLN B 38 ? 0.3645 0.3665 0.3117 -0.0661 -0.0472 0.0387  465 GLN B CG  
538 C CD  . GLN B 38 ? 0.4231 0.3820 0.3469 -0.0818 -0.0658 0.0335  465 GLN B CD  
539 O OE1 . GLN B 38 ? 0.4298 0.3839 0.3463 -0.1042 -0.0774 0.0438  465 GLN B OE1 
540 N NE2 . GLN B 38 ? 0.4486 0.3738 0.3580 -0.0690 -0.0680 0.0176  465 GLN B NE2 
541 N N   . TRP B 39 ? 0.3195 0.4103 0.2951 -0.0322 -0.0213 0.0559  466 TRP B N   
542 C CA  . TRP B 39 ? 0.3328 0.4117 0.3036 -0.0155 -0.0130 0.0539  466 TRP B CA  
543 C C   . TRP B 39 ? 0.3662 0.4107 0.3202 -0.0200 -0.0173 0.0414  466 TRP B C   
544 O O   . TRP B 39 ? 0.4154 0.4460 0.3669 -0.0082 -0.0065 0.0383  466 TRP B O   
545 C CB  . TRP B 39 ? 0.3742 0.4915 0.3454 -0.0095 -0.0160 0.0667  466 TRP B CB  
546 C CG  . TRP B 39 ? 0.3491 0.5081 0.3377 0.0051  -0.0095 0.0793  466 TRP B CG  
547 C CD1 . TRP B 39 ? 0.3206 0.5373 0.3208 0.0000  -0.0178 0.0914  466 TRP B CD1 
548 C CD2 . TRP B 39 ? 0.3423 0.4905 0.3373 0.0294  0.0060  0.0799  466 TRP B CD2 
549 N NE1 . TRP B 39 ? 0.3333 0.5811 0.3479 0.0249  -0.0063 0.0997  466 TRP B NE1 
550 C CE2 . TRP B 39 ? 0.3610 0.5609 0.3693 0.0440  0.0078  0.0913  466 TRP B CE2 
551 C CE3 . TRP B 39 ? 0.3741 0.4746 0.3645 0.0393  0.0175  0.0712  466 TRP B CE3 
552 C CZ2 . TRP B 39 ? 0.3508 0.5471 0.3622 0.0733  0.0212  0.0917  466 TRP B CZ2 
553 C CZ3 . TRP B 39 ? 0.3525 0.4444 0.3452 0.0614  0.0284  0.0717  466 TRP B CZ3 
554 C CH2 . TRP B 39 ? 0.3512 0.4862 0.3516 0.0807  0.0305  0.0804  466 TRP B CH2 
555 N N   . GLU B 40 ? 0.3759 0.4056 0.3170 -0.0366 -0.0325 0.0346  467 GLU B N   
556 C CA  . GLU B 40 ? 0.4262 0.4232 0.3454 -0.0357 -0.0382 0.0200  467 GLU B CA  
557 C C   . GLU B 40 ? 0.4004 0.3698 0.3237 -0.0249 -0.0308 0.0086  467 GLU B C   
558 O O   . GLU B 40 ? 0.4244 0.3831 0.3557 -0.0292 -0.0343 0.0083  467 GLU B O   
559 C CB  . GLU B 40 ? 0.4838 0.4622 0.3820 -0.0570 -0.0602 0.0151  467 GLU B CB  
560 C CG  . GLU B 40 ? 0.5364 0.5465 0.4282 -0.0717 -0.0722 0.0231  467 GLU B CG  
561 C CD  . GLU B 40 ? 0.5434 0.6041 0.4620 -0.0811 -0.0710 0.0423  467 GLU B CD  
562 O OE1 . GLU B 40 ? 0.4364 0.4975 0.3696 -0.0852 -0.0665 0.0477  467 GLU B OE1 
563 O OE2 . GLU B 40 ? 0.5251 0.6301 0.4489 -0.0818 -0.0746 0.0522  467 GLU B OE2 
564 N N   . ASP B 41 ? 0.4017 0.3664 0.3194 -0.0109 -0.0208 0.0006  468 ASP B N   
565 C CA  . ASP B 41 ? 0.3925 0.3438 0.3173 0.0003  -0.0148 -0.0106 468 ASP B CA  
566 C C   . ASP B 41 ? 0.4311 0.3468 0.3341 0.0007  -0.0316 -0.0242 468 ASP B C   
567 O O   . ASP B 41 ? 0.4771 0.3759 0.3519 0.0013  -0.0400 -0.0332 468 ASP B O   
568 C CB  . ASP B 41 ? 0.4069 0.3732 0.3303 0.0133  0.0014  -0.0129 468 ASP B CB  
569 C CG  . ASP B 41 ? 0.3778 0.3501 0.3182 0.0248  0.0112  -0.0218 468 ASP B CG  
570 O OD1 . ASP B 41 ? 0.3881 0.3470 0.3334 0.0300  0.0024  -0.0313 468 ASP B OD1 
571 O OD2 . ASP B 41 ? 0.4178 0.4131 0.3672 0.0290  0.0282  -0.0172 468 ASP B OD2 
572 N N   . PRO B 42 ? 0.4302 0.3294 0.3417 0.0017  -0.0380 -0.0261 469 PRO B N   
573 C CA  . PRO B 42 ? 0.4828 0.3375 0.3708 0.0055  -0.0550 -0.0365 469 PRO B CA  
574 C C   . PRO B 42 ? 0.5174 0.3587 0.3882 0.0297  -0.0519 -0.0553 469 PRO B C   
575 O O   . PRO B 42 ? 0.5529 0.3480 0.3898 0.0341  -0.0670 -0.0678 469 PRO B O   
576 C CB  . PRO B 42 ? 0.4444 0.2963 0.3496 0.0087  -0.0579 -0.0319 469 PRO B CB  
577 C CG  . PRO B 42 ? 0.4538 0.3437 0.3854 -0.0005 -0.0462 -0.0201 469 PRO B CG  
578 C CD  . PRO B 42 ? 0.4007 0.3185 0.3401 0.0012  -0.0307 -0.0191 469 PRO B CD  
579 N N   . ARG B 43 ? 0.5046 0.3852 0.3959 0.0449  -0.0322 -0.0575 470 ARG B N   
580 C CA  . ARG B 43 ? 0.5431 0.4265 0.4207 0.0707  -0.0245 -0.0744 470 ARG B CA  
581 C C   . ARG B 43 ? 0.5931 0.4620 0.4315 0.0715  -0.0268 -0.0839 470 ARG B C   
582 O O   . ARG B 43 ? 0.5980 0.4550 0.4111 0.0956  -0.0251 -0.1028 470 ARG B O   
583 C CB  . ARG B 43 ? 0.4868 0.4254 0.3988 0.0801  -0.0016 -0.0701 470 ARG B CB  
584 C CG  . ARG B 43 ? 0.4438 0.3986 0.3911 0.0813  -0.0025 -0.0660 470 ARG B CG  
585 C CD  . ARG B 43 ? 0.4251 0.4352 0.4087 0.0786  0.0181  -0.0589 470 ARG B CD  
586 N NE  . ARG B 43 ? 0.3985 0.4146 0.3892 0.0549  0.0259  -0.0430 470 ARG B NE  
587 C CZ  . ARG B 43 ? 0.4454 0.4900 0.4660 0.0423  0.0380  -0.0331 470 ARG B CZ  
588 N NH1 . ARG B 43 ? 0.4696 0.5501 0.5214 0.0459  0.0437  -0.0366 470 ARG B NH1 
589 N NH2 . ARG B 43 ? 0.4429 0.4797 0.4622 0.0261  0.0432  -0.0198 470 ARG B NH2 
590 N N   . SER B 44 ? 0.5929 0.4667 0.4250 0.0481  -0.0314 -0.0719 471 SER B N   
591 C CA  . SER B 44 ? 0.6724 0.5321 0.4644 0.0438  -0.0403 -0.0805 471 SER B CA  
592 C C   . SER B 44 ? 0.7216 0.5178 0.4756 0.0350  -0.0679 -0.0957 471 SER B C   
593 O O   . SER B 44 ? 0.7351 0.5112 0.4496 0.0313  -0.0794 -0.1087 471 SER B O   
594 C CB  . SER B 44 ? 0.6461 0.5389 0.4469 0.0233  -0.0388 -0.0609 471 SER B CB  
595 O OG  . SER B 44 ? 0.6165 0.5519 0.4394 0.0321  -0.0154 -0.0480 471 SER B OG  
596 N N   . GLN B 45 ? 0.7041 0.4684 0.4683 0.0283  -0.0794 -0.0918 472 GLN B N   
597 C CA  . GLN B 45 ? 0.8357 0.5271 0.5638 0.0236  -0.1042 -0.1044 472 GLN B CA  
598 C C   . GLN B 45 ? 0.8632 0.5252 0.5830 0.0617  -0.1010 -0.1215 472 GLN B C   
599 O O   . GLN B 45 ? 0.9737 0.5646 0.6601 0.0677  -0.1206 -0.1334 472 GLN B O   
600 C CB  . GLN B 45 ? 0.8581 0.5337 0.6002 -0.0078 -0.1187 -0.0839 472 GLN B CB  
601 C CG  . GLN B 45 ? 0.8743 0.5875 0.6294 -0.0442 -0.1229 -0.0653 472 GLN B CG  
602 C CD  . GLN B 45 ? 0.9313 0.6175 0.6840 -0.0792 -0.1423 -0.0493 472 GLN B CD  
603 O OE1 . GLN B 45 ? 1.0249 0.6801 0.7794 -0.0763 -0.1461 -0.0432 472 GLN B OE1 
604 N NE2 . GLN B 45 ? 0.8975 0.6007 0.6462 -0.1134 -0.1549 -0.0404 472 GLN B NE2 
605 N N   A GLU C 4  ? 0.6352 0.6659 0.6091 -0.0977 -0.0396 -0.0020 329 GLU C N   
606 N N   B GLU C 4  ? 0.6526 0.6445 0.6396 -0.0687 -0.0231 -0.0281 329 GLU C N   
607 C CA  A GLU C 4  ? 0.6373 0.6538 0.6307 -0.0771 -0.0282 -0.0064 329 GLU C CA  
608 C CA  B GLU C 4  ? 0.6277 0.6437 0.6207 -0.0770 -0.0281 -0.0069 329 GLU C CA  
609 C C   . GLU C 4  ? 0.6212 0.6458 0.6210 -0.0665 -0.0222 -0.0002 329 GLU C C   
610 O O   . GLU C 4  ? 0.6475 0.6847 0.6332 -0.0785 -0.0274 0.0077  329 GLU C O   
611 C CB  A GLU C 4  ? 0.6685 0.6632 0.6512 -0.0701 -0.0228 -0.0312 329 GLU C CB  
612 C CB  B GLU C 4  ? 0.5784 0.6018 0.5960 -0.0789 -0.0362 0.0086  329 GLU C CB  
613 N N   . ALA C 5  ? 0.5499 0.5673 0.5669 -0.0502 -0.0148 -0.0005 330 ALA C N   
614 C CA  . ALA C 5  ? 0.5207 0.5416 0.5425 -0.0416 -0.0112 0.0027  330 ALA C CA  
615 C C   . ALA C 5  ? 0.4814 0.4993 0.5019 -0.0306 0.0007  -0.0110 330 ALA C C   
616 O O   . ALA C 5  ? 0.4740 0.4768 0.4951 -0.0254 0.0013  -0.0202 330 ALA C O   
617 C CB  . ALA C 5  ? 0.5645 0.5863 0.6093 -0.0295 -0.0166 0.0102  330 ALA C CB  
618 N N   . PRO C 6  ? 0.4413 0.4715 0.4609 -0.0290 0.0050  -0.0114 331 PRO C N   
619 C CA  . PRO C 6  ? 0.4281 0.4635 0.4545 -0.0153 0.0131  -0.0239 331 PRO C CA  
620 C C   . PRO C 6  ? 0.4145 0.4311 0.4528 -0.0033 0.0115  -0.0173 331 PRO C C   
621 O O   . PRO C 6  ? 0.4192 0.4319 0.4616 -0.0056 0.0084  -0.0072 331 PRO C O   
622 C CB  . PRO C 6  ? 0.4209 0.4828 0.4440 -0.0249 0.0153  -0.0194 331 PRO C CB  
623 C CG  . PRO C 6  ? 0.4365 0.4898 0.4499 -0.0435 0.0024  0.0003  331 PRO C CG  
624 C CD  . PRO C 6  ? 0.4482 0.4874 0.4595 -0.0447 -0.0036 0.0028  331 PRO C CD  
625 N N   . PRO C 7  ? 0.4426 0.4559 0.4877 0.0089  0.0118  -0.0241 332 PRO C N   
626 C CA  . PRO C 7  ? 0.4465 0.4455 0.4946 0.0120  0.0072  -0.0125 332 PRO C CA  
627 C C   . PRO C 7  ? 0.3997 0.4134 0.4486 0.0103  0.0108  -0.0057 332 PRO C C   
628 O O   . PRO C 7  ? 0.4280 0.4506 0.4774 0.0089  0.0117  -0.0083 332 PRO C O   
629 C CB  . PRO C 7  ? 0.4710 0.4619 0.5275 0.0261  -0.0001 -0.0196 332 PRO C CB  
630 C CG  . PRO C 7  ? 0.4913 0.4921 0.5542 0.0359  0.0012  -0.0435 332 PRO C CG  
631 C CD  . PRO C 7  ? 0.4445 0.4736 0.4968 0.0207  0.0135  -0.0440 332 PRO C CD  
632 N N   . CYS C 8  ? 0.4120 0.4309 0.4590 0.0072  0.0106  0.0014  333 CYS C N   
633 C CA  . CYS C 8  ? 0.4030 0.4394 0.4504 0.0106  0.0131  -0.0026 333 CYS C CA  
634 C C   . CYS C 8  ? 0.4116 0.4451 0.4563 0.0145  0.0102  -0.0028 333 CYS C C   
635 O O   . CYS C 8  ? 0.3701 0.3964 0.4142 0.0157  0.0052  0.0036  333 CYS C O   
636 C CB  . CYS C 8  ? 0.4272 0.4919 0.4703 0.0036  0.0170  0.0000  333 CYS C CB  
637 S SG  . CYS C 8  ? 0.4954 0.5846 0.5481 -0.0054 0.0201  0.0018  333 CYS C SG  
638 N N   . TYR C 9  ? 0.3539 0.3896 0.3996 0.0164  0.0080  -0.0099 334 TYR C N   
639 C CA  . TYR C 9  ? 0.4366 0.4771 0.4802 0.0159  0.0038  -0.0101 334 TYR C CA  
640 C C   . TYR C 9  ? 0.4220 0.4715 0.4580 0.0156  0.0019  -0.0032 334 TYR C C   
641 O O   . TYR C 9  ? 0.3708 0.4221 0.4117 0.0180  -0.0046 0.0024  334 TYR C O   
642 C CB  . TYR C 9  ? 0.4328 0.4670 0.4732 0.0148  -0.0038 -0.0201 334 TYR C CB  
643 C CG  . TYR C 9  ? 0.4237 0.4624 0.4607 0.0081  -0.0113 -0.0190 334 TYR C CG  
644 C CD1 . TYR C 9  ? 0.4320 0.4750 0.4745 -0.0039 -0.0162 -0.0117 334 TYR C CD1 
645 C CD2 . TYR C 9  ? 0.4252 0.4746 0.4518 0.0090  -0.0137 -0.0243 334 TYR C CD2 
646 C CE1 . TYR C 9  ? 0.4299 0.4869 0.4725 -0.0143 -0.0242 -0.0092 334 TYR C CE1 
647 C CE2 . TYR C 9  ? 0.4310 0.4866 0.4549 0.0008  -0.0232 -0.0225 334 TYR C CE2 
648 C CZ  . TYR C 9  ? 0.4391 0.4981 0.4736 -0.0104 -0.0288 -0.0148 334 TYR C CZ  
649 O OH  . TYR C 9  ? 0.4739 0.5490 0.5091 -0.0224 -0.0391 -0.0117 334 TYR C OH  
650 N N   . MET C 10 ? 0.5026 0.5653 0.5272 0.0108  0.0054  -0.0034 335 MET C N   
651 C CA  . MET C 10 ? 0.5590 0.6357 0.5673 0.0005  0.0002  0.0090  335 MET C CA  
652 C C   . MET C 10 ? 0.5540 0.6086 0.5626 -0.0050 -0.0117 0.0313  335 MET C C   
653 O O   . MET C 10 ? 0.6040 0.6565 0.6009 -0.0143 -0.0264 0.0490  335 MET C O   
654 C CB  . MET C 10 ? 0.6692 0.7856 0.6622 -0.0087 0.0093  0.0000  335 MET C CB  
655 C CG  . MET C 10 ? 0.7467 0.8750 0.7413 0.0034  0.0120  -0.0302 335 MET C CG  
656 S SD  . MET C 10 ? 0.8449 0.9688 0.8245 -0.0004 0.0003  -0.0319 335 MET C SD  
657 C CE  . MET C 10 ? 0.7893 0.9447 0.7404 -0.0245 -0.0034 -0.0048 335 MET C CE  
658 N N   . ASP C 11 ? 0.5143 0.5472 0.5353 0.0004  -0.0108 0.0300  336 ASP C N   
659 C CA  . ASP C 11 ? 0.6010 0.5982 0.6294 0.0044  -0.0285 0.0399  336 ASP C CA  
660 C C   . ASP C 11 ? 0.6028 0.5965 0.6544 0.0275  -0.0336 0.0249  336 ASP C C   
661 O O   . ASP C 11 ? 0.6356 0.6095 0.6986 0.0386  -0.0548 0.0289  336 ASP C O   
662 C CB  . ASP C 11 ? 0.6732 0.6522 0.7043 0.0012  -0.0263 0.0370  336 ASP C CB  
663 C CG  . ASP C 11 ? 0.7560 0.7571 0.7725 -0.0220 -0.0186 0.0484  336 ASP C CG  
664 O OD1 . ASP C 11 ? 0.8057 0.8293 0.8052 -0.0413 -0.0215 0.0647  336 ASP C OD1 
665 O OD2 . ASP C 11 ? 0.9272 0.9326 0.9499 -0.0229 -0.0102 0.0405  336 ASP C OD2 
666 N N   . VAL C 12 ? 0.6594 0.6766 0.7196 0.0330  -0.0174 0.0080  337 VAL C N   
667 C CA  . VAL C 12 ? 0.6824 0.7235 0.7641 0.0465  -0.0170 -0.0066 337 VAL C CA  
668 C C   . VAL C 12 ? 0.6853 0.7379 0.7746 0.0513  -0.0308 0.0004  337 VAL C C   
669 O O   . VAL C 12 ? 0.6815 0.7306 0.7921 0.0693  -0.0479 -0.0031 337 VAL C O   
670 C CB  . VAL C 12 ? 0.7073 0.7747 0.7861 0.0354  -0.0020 -0.0138 337 VAL C CB  
671 C CG1 . VAL C 12 ? 0.7186 0.8292 0.8150 0.0364  -0.0017 -0.0218 337 VAL C CG1 
672 C CG2 . VAL C 12 ? 0.6891 0.7519 0.7635 0.0311  0.0066  -0.0203 337 VAL C CG2 
673 N N   . ILE C 13 ? 0.6366 0.7013 0.7100 0.0373  -0.0275 0.0077  338 ILE C N   
674 C CA  . ILE C 13 ? 0.6707 0.7505 0.7464 0.0368  -0.0419 0.0156  338 ILE C CA  
675 C C   . ILE C 13 ? 0.7308 0.7869 0.7950 0.0346  -0.0631 0.0365  338 ILE C C   
676 O O   . ILE C 13 ? 0.7690 0.8346 0.8344 0.0337  -0.0809 0.0472  338 ILE C O   
677 C CB  . ILE C 13 ? 0.5823 0.6763 0.6385 0.0202  -0.0365 0.0137  338 ILE C CB  
678 C CG1 . ILE C 13 ? 0.6020 0.6840 0.6286 0.0093  -0.0291 0.0142  338 ILE C CG1 
679 C CG2 . ILE C 13 ? 0.5395 0.6488 0.6059 0.0147  -0.0277 0.0021  338 ILE C CG2 
680 C CD1 . ILE C 13 ? 0.6572 0.7481 0.6598 -0.0024 -0.0396 0.0281  338 ILE C CD1 
681 N N   . NH2 C 14 ? 0.7729 0.7988 0.8240 0.0284  -0.0658 0.0469  339 NH2 C N   
682 N N   A GLU D 4  ? 0.7819 0.8108 0.4589 0.4008  -0.1520 -0.1237 329 GLU D N   
683 N N   B GLU D 4  ? 0.7806 0.7377 0.4613 0.3650  -0.1405 -0.0886 329 GLU D N   
684 C CA  A GLU D 4  ? 0.7401 0.7498 0.4446 0.3539  -0.1285 -0.0953 329 GLU D CA  
685 C CA  B GLU D 4  ? 0.7442 0.7492 0.4449 0.3546  -0.1281 -0.0931 329 GLU D CA  
686 C C   . GLU D 4  ? 0.6532 0.6875 0.4108 0.2891  -0.0918 -0.0693 329 GLU D C   
687 O O   . GLU D 4  ? 0.6270 0.6636 0.3800 0.2818  -0.0812 -0.0579 329 GLU D O   
688 C CB  A GLU D 4  ? 0.8268 0.7192 0.4488 0.3695  -0.1264 -0.0476 329 GLU D CB  
689 C CB  B GLU D 4  ? 0.7298 0.8311 0.4795 0.3823  -0.1583 -0.1612 329 GLU D CB  
690 N N   . ALA D 5  ? 0.6086 0.6607 0.4096 0.2511  -0.0784 -0.0655 330 ALA D N   
691 C CA  . ALA D 5  ? 0.5641 0.6237 0.3988 0.2002  -0.0510 -0.0420 330 ALA D CA  
692 C C   . ALA D 5  ? 0.5542 0.5560 0.3758 0.1843  -0.0387 -0.0079 330 ALA D C   
693 O O   . ALA D 5  ? 0.5843 0.5530 0.3896 0.2015  -0.0531 -0.0105 330 ALA D O   
694 C CB  . ALA D 5  ? 0.5397 0.6695 0.4314 0.1685  -0.0450 -0.0672 330 ALA D CB  
695 N N   . PRO D 6  ? 0.5316 0.5222 0.3653 0.1540  -0.0178 0.0175  331 PRO D N   
696 C CA  . PRO D 6  ? 0.5210 0.4761 0.3667 0.1327  -0.0087 0.0388  331 PRO D CA  
697 C C   . PRO D 6  ? 0.5141 0.4914 0.3898 0.1203  -0.0167 0.0196  331 PRO D C   
698 O O   . PRO D 6  ? 0.4907 0.5166 0.3779 0.1156  -0.0165 0.0000  331 PRO D O   
699 C CB  . PRO D 6  ? 0.5154 0.4795 0.3734 0.1131  0.0112  0.0562  331 PRO D CB  
700 C CG  . PRO D 6  ? 0.4771 0.4793 0.3385 0.1151  0.0058  0.0372  331 PRO D CG  
701 C CD  . PRO D 6  ? 0.4802 0.4981 0.3268 0.1402  -0.0096 0.0162  331 PRO D CD  
702 N N   . PRO D 7  ? 0.5415 0.4842 0.4298 0.1137  -0.0233 0.0246  332 PRO D N   
703 C CA  . PRO D 7  ? 0.5439 0.5078 0.4479 0.1147  -0.0355 0.0019  332 PRO D CA  
704 C C   . PRO D 7  ? 0.4860 0.4878 0.3956 0.0969  -0.0223 -0.0002 332 PRO D C   
705 O O   . PRO D 7  ? 0.5192 0.5139 0.4340 0.0812  -0.0118 0.0143  332 PRO D O   
706 C CB  . PRO D 7  ? 0.5802 0.4947 0.5064 0.1073  -0.0483 0.0063  332 PRO D CB  
707 C CG  . PRO D 7  ? 0.6345 0.4902 0.5434 0.1082  -0.0472 0.0302  332 PRO D CG  
708 C CD  . PRO D 7  ? 0.5932 0.4731 0.4797 0.1067  -0.0223 0.0487  332 PRO D CD  
709 N N   . CYS D 8  ? 0.4510 0.4912 0.3520 0.1018  -0.0225 -0.0179 333 CYS D N   
710 C CA  . CYS D 8  ? 0.4655 0.5188 0.3525 0.0823  -0.0084 -0.0111 333 CYS D CA  
711 C C   . CYS D 8  ? 0.4698 0.4889 0.3509 0.0865  -0.0204 -0.0100 333 CYS D C   
712 O O   . CYS D 8  ? 0.4391 0.4424 0.3379 0.1023  -0.0396 -0.0230 333 CYS D O   
713 C CB  . CYS D 8  ? 0.4829 0.5915 0.3572 0.0794  0.0055  -0.0232 333 CYS D CB  
714 S SG  . CYS D 8  ? 0.5445 0.6778 0.4008 0.1132  -0.0066 -0.0479 333 CYS D SG  
715 N N   . TYR D 9  ? 0.4722 0.4744 0.3286 0.0750  -0.0153 0.0007  334 TYR D N   
716 C CA  . TYR D 9  ? 0.5059 0.4782 0.3543 0.0871  -0.0331 -0.0054 334 TYR D CA  
717 C C   . TYR D 9  ? 0.5830 0.5587 0.4189 0.1135  -0.0507 -0.0265 334 TYR D C   
718 O O   . TYR D 9  ? 0.6261 0.5883 0.4905 0.1282  -0.0757 -0.0456 334 TYR D O   
719 C CB  . TYR D 9  ? 0.5461 0.4847 0.3467 0.0806  -0.0320 0.0074  334 TYR D CB  
720 C CG  . TYR D 9  ? 0.5777 0.4874 0.3712 0.1040  -0.0593 -0.0076 334 TYR D CG  
721 C CD1 . TYR D 9  ? 0.5285 0.4457 0.3675 0.1058  -0.0691 -0.0173 334 TYR D CD1 
722 C CD2 . TYR D 9  ? 0.6159 0.5013 0.3566 0.1310  -0.0765 -0.0182 334 TYR D CD2 
723 C CE1 . TYR D 9  ? 0.5467 0.4573 0.3937 0.1312  -0.0976 -0.0429 334 TYR D CE1 
724 C CE2 . TYR D 9  ? 0.6400 0.5037 0.3764 0.1621  -0.1105 -0.0429 334 TYR D CE2 
725 C CZ  . TYR D 9  ? 0.6063 0.4875 0.4037 0.1607  -0.1219 -0.0581 334 TYR D CZ  
726 O OH  . TYR D 9  ? 0.6268 0.5058 0.4345 0.1944  -0.1580 -0.0930 334 TYR D OH  
727 N N   . MET D 10 ? 0.6043 0.6084 0.4053 0.1213  -0.0390 -0.0291 335 MET D N   
728 C CA  . MET D 10 ? 0.6740 0.6877 0.4490 0.1579  -0.0577 -0.0540 335 MET D CA  
729 C C   . MET D 10 ? 0.6562 0.6703 0.4839 0.1784  -0.0882 -0.0831 335 MET D C   
730 O O   . MET D 10 ? 0.6441 0.6513 0.4669 0.2128  -0.1195 -0.1131 335 MET D O   
731 C CB  . MET D 10 ? 0.7493 0.8111 0.4698 0.1627  -0.0297 -0.0497 335 MET D CB  
732 C CG  . MET D 10 ? 0.8571 0.8928 0.4947 0.1553  -0.0086 -0.0231 335 MET D CG  
733 S SD  . MET D 10 ? 1.0719 1.0362 0.6488 0.1992  -0.0483 -0.0344 335 MET D SD  
734 C CE  . MET D 10 ? 0.9961 0.9995 0.5464 0.2624  -0.0742 -0.0775 335 MET D CE  
735 N N   . ASP D 11 ? 0.6630 0.6745 0.5330 0.1608  -0.0836 -0.0753 336 ASP D N   
736 C CA  . ASP D 11 ? 0.6862 0.6669 0.5972 0.1733  -0.1146 -0.0940 336 ASP D CA  
737 C C   . ASP D 11 ? 0.6808 0.6209 0.6457 0.1493  -0.1244 -0.0874 336 ASP D C   
738 O O   . ASP D 11 ? 0.6803 0.5881 0.6860 0.1546  -0.1559 -0.1085 336 ASP D O   
739 C CB  . ASP D 11 ? 0.7243 0.7077 0.6367 0.1729  -0.1080 -0.0874 336 ASP D CB  
740 C CG  . ASP D 11 ? 0.7639 0.8037 0.6461 0.2068  -0.1109 -0.1142 336 ASP D CG  
741 O OD1 . ASP D 11 ? 0.7697 0.8635 0.6229 0.2084  -0.0895 -0.1159 336 ASP D OD1 
742 O OD2 . ASP D 11 ? 0.7871 0.8173 0.6706 0.2336  -0.1346 -0.1340 336 ASP D OD2 
743 N N   . VAL D 12 ? 0.6087 0.5568 0.5795 0.1229  -0.0988 -0.0631 337 VAL D N   
744 C CA  . VAL D 12 ? 0.6113 0.5510 0.6390 0.1012  -0.1006 -0.0617 337 VAL D CA  
745 C C   . VAL D 12 ? 0.6167 0.5565 0.6687 0.1220  -0.1367 -0.1001 337 VAL D C   
746 O O   . VAL D 12 ? 0.6189 0.5418 0.7318 0.1168  -0.1620 -0.1217 337 VAL D O   
747 C CB  . VAL D 12 ? 0.6247 0.5850 0.6410 0.0863  -0.0743 -0.0408 337 VAL D CB  
748 C CG1 . VAL D 12 ? 0.6284 0.6076 0.7036 0.0763  -0.0796 -0.0541 337 VAL D CG1 
749 C CG2 . VAL D 12 ? 0.6220 0.5824 0.6254 0.0707  -0.0461 -0.0106 337 VAL D CG2 
750 N N   . ILE D 13 ? 0.5798 0.5293 0.5780 0.1476  -0.1428 -0.1094 338 ILE D N   
751 C CA  . ILE D 13 ? 0.6185 0.5662 0.6211 0.1813  -0.1827 -0.1503 338 ILE D CA  
752 C C   . ILE D 13 ? 0.6465 0.5849 0.6332 0.2172  -0.2152 -0.1816 338 ILE D C   
753 O O   . ILE D 13 ? 0.6972 0.6322 0.7060 0.2481  -0.2585 -0.2254 338 ILE D O   
754 C CB  . ILE D 13 ? 0.6497 0.5881 0.5697 0.2067  -0.1825 -0.1457 338 ILE D CB  
755 C CG1 . ILE D 13 ? 0.6604 0.5895 0.4821 0.2136  -0.1560 -0.1166 338 ILE D CG1 
756 C CG2 . ILE D 13 ? 0.6210 0.5652 0.5602 0.1833  -0.1654 -0.1286 338 ILE D CG2 
757 C CD1 . ILE D 13 ? 0.7197 0.6178 0.4378 0.2492  -0.1650 -0.1158 338 ILE D CD1 
758 N N   . NH2 D 14 ? 0.6450 0.5858 0.5959 0.2215  -0.2012 -0.1687 339 NH2 D N   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  428 ?   ?   ?   A . n 
A 1 2  ARG 2  429 ?   ?   ?   A . n 
A 1 3  ARG 3  430 ?   ?   ?   A . n 
A 1 4  ALA 4  431 ?   ?   ?   A . n 
A 1 5  SER 5  432 ?   ?   ?   A . n 
A 1 6  VAL 6  433 ?   ?   ?   A . n 
A 1 7  GLU 7  434 ?   ?   ?   A . n 
A 1 8  LEU 8  435 ?   ?   ?   A . n 
A 1 9  PRO 9  436 ?   ?   ?   A . n 
A 1 10 LEU 10 437 437 LEU LEU A . n 
A 1 11 GLY 11 438 438 GLY GLY A . n 
A 1 12 PRO 12 439 439 PRO PRO A . n 
A 1 13 LEU 13 440 440 LEU LEU A . n 
A 1 14 PRO 14 441 441 PRO PRO A . n 
A 1 15 PRO 15 442 442 PRO PRO A . n 
A 1 16 GLY 16 443 443 GLY GLY A . n 
A 1 17 TRP 17 444 444 TRP TRP A . n 
A 1 18 GLU 18 445 445 GLU GLU A . n 
A 1 19 LYS 19 446 446 LYS LYS A . n 
A 1 20 ARG 20 447 447 ARG ARG A . n 
A 1 21 THR 21 448 448 THR THR A . n 
A 1 22 ASP 22 449 449 ASP ASP A . n 
A 1 23 SER 23 450 450 SER SER A . n 
A 1 24 ASN 24 451 451 ASN ASN A . n 
A 1 25 GLY 25 452 452 GLY GLY A . n 
A 1 26 ARG 26 453 453 ARG ARG A . n 
A 1 27 VAL 27 454 454 VAL VAL A . n 
A 1 28 TYR 28 455 455 TYR TYR A . n 
A 1 29 PHE 29 456 456 PHE PHE A . n 
A 1 30 VAL 30 457 457 VAL VAL A . n 
A 1 31 ASN 31 458 458 ASN ASN A . n 
A 1 32 HIS 32 459 459 HIS HIS A . n 
A 1 33 ASN 33 460 460 ASN ASN A . n 
A 1 34 THR 34 461 461 THR THR A . n 
A 1 35 ARG 35 462 462 ARG ARG A . n 
A 1 36 ILE 36 463 463 ILE ILE A . n 
A 1 37 THR 37 464 464 THR THR A . n 
A 1 38 GLN 38 465 465 GLN GLN A . n 
A 1 39 TRP 39 466 466 TRP TRP A . n 
A 1 40 GLU 40 467 467 GLU GLU A . n 
A 1 41 ASP 41 468 468 ASP ASP A . n 
A 1 42 PRO 42 469 469 PRO PRO A . n 
A 1 43 ARG 43 470 470 ARG ARG A . n 
A 1 44 SER 44 471 471 SER SER A . n 
A 1 45 GLN 45 472 472 GLN GLN A . n 
A 1 46 GLY 46 473 ?   ?   ?   A . n 
A 1 47 GLN 47 474 ?   ?   ?   A . n 
B 1 1  GLY 1  428 ?   ?   ?   B . n 
B 1 2  ARG 2  429 ?   ?   ?   B . n 
B 1 3  ARG 3  430 ?   ?   ?   B . n 
B 1 4  ALA 4  431 ?   ?   ?   B . n 
B 1 5  SER 5  432 ?   ?   ?   B . n 
B 1 6  VAL 6  433 ?   ?   ?   B . n 
B 1 7  GLU 7  434 ?   ?   ?   B . n 
B 1 8  LEU 8  435 ?   ?   ?   B . n 
B 1 9  PRO 9  436 ?   ?   ?   B . n 
B 1 10 LEU 10 437 437 LEU LEU B . n 
B 1 11 GLY 11 438 438 GLY GLY B . n 
B 1 12 PRO 12 439 439 PRO PRO B . n 
B 1 13 LEU 13 440 440 LEU LEU B . n 
B 1 14 PRO 14 441 441 PRO PRO B . n 
B 1 15 PRO 15 442 442 PRO PRO B . n 
B 1 16 GLY 16 443 443 GLY GLY B . n 
B 1 17 TRP 17 444 444 TRP TRP B . n 
B 1 18 GLU 18 445 445 GLU GLU B . n 
B 1 19 LYS 19 446 446 LYS LYS B . n 
B 1 20 ARG 20 447 447 ARG ARG B . n 
B 1 21 THR 21 448 448 THR THR B . n 
B 1 22 ASP 22 449 449 ASP ASP B . n 
B 1 23 SER 23 450 450 SER SER B . n 
B 1 24 ASN 24 451 451 ASN ASN B . n 
B 1 25 GLY 25 452 452 GLY GLY B . n 
B 1 26 ARG 26 453 453 ARG ARG B . n 
B 1 27 VAL 27 454 454 VAL VAL B . n 
B 1 28 TYR 28 455 455 TYR TYR B . n 
B 1 29 PHE 29 456 456 PHE PHE B . n 
B 1 30 VAL 30 457 457 VAL VAL B . n 
B 1 31 ASN 31 458 458 ASN ASN B . n 
B 1 32 HIS 32 459 459 HIS HIS B . n 
B 1 33 ASN 33 460 460 ASN ASN B . n 
B 1 34 THR 34 461 461 THR THR B . n 
B 1 35 ARG 35 462 462 ARG ARG B . n 
B 1 36 ILE 36 463 463 ILE ILE B . n 
B 1 37 THR 37 464 464 THR THR B . n 
B 1 38 GLN 38 465 465 GLN GLN B . n 
B 1 39 TRP 39 466 466 TRP TRP B . n 
B 1 40 GLU 40 467 467 GLU GLU B . n 
B 1 41 ASP 41 468 468 ASP ASP B . n 
B 1 42 PRO 42 469 469 PRO PRO B . n 
B 1 43 ARG 43 470 470 ARG ARG B . n 
B 1 44 SER 44 471 471 SER SER B . n 
B 1 45 GLN 45 472 472 GLN GLN B . n 
B 1 46 GLY 46 473 ?   ?   ?   B . n 
B 1 47 GLN 47 474 ?   ?   ?   B . n 
C 2 1  ACE 1  326 ?   ?   ?   C . n 
C 2 2  THR 2  327 ?   ?   ?   C . n 
C 2 3  PRO 3  328 ?   ?   ?   C . n 
C 2 4  GLU 4  329 329 GLU GLU C . n 
C 2 5  ALA 5  330 330 ALA ALA C . n 
C 2 6  PRO 6  331 331 PRO PRO C . n 
C 2 7  PRO 7  332 332 PRO PRO C . n 
C 2 8  CYS 8  333 333 CYS CYS C . n 
C 2 9  TYR 9  334 334 TYR TYR C . n 
C 2 10 MET 10 335 335 MET MET C . n 
C 2 11 ASP 11 336 336 ASP ASP C . n 
C 2 12 VAL 12 337 337 VAL VAL C . n 
C 2 13 ILE 13 338 338 ILE ILE C . n 
C 2 14 NH2 14 339 339 NH2 NH2 C . n 
D 2 1  ACE 1  326 ?   ?   ?   D . n 
D 2 2  THR 2  327 ?   ?   ?   D . n 
D 2 3  PRO 3  328 ?   ?   ?   D . n 
D 2 4  GLU 4  329 329 GLU GLU D . n 
D 2 5  ALA 5  330 330 ALA ALA D . n 
D 2 6  PRO 6  331 331 PRO PRO D . n 
D 2 7  PRO 7  332 332 PRO PRO D . n 
D 2 8  CYS 8  333 333 CYS CYS D . n 
D 2 9  TYR 9  334 334 TYR TYR D . n 
D 2 10 MET 10 335 335 MET MET D . n 
D 2 11 ASP 11 336 336 ASP ASP D . n 
D 2 12 VAL 12 337 337 VAL VAL D . n 
D 2 13 ILE 13 338 338 ILE ILE D . n 
D 2 14 NH2 14 339 339 NH2 NH2 D . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1 501 10 HOH HOH A . 
F 3 HOH 1 501 1  HOH HOH B . 
F 3 HOH 2 502 2  HOH HOH B . 
F 3 HOH 3 503 3  HOH HOH B . 
F 3 HOH 4 504 4  HOH HOH B . 
F 3 HOH 5 505 5  HOH HOH B . 
F 3 HOH 6 506 6  HOH HOH B . 
F 3 HOH 7 507 7  HOH HOH B . 
F 3 HOH 8 508 8  HOH HOH B . 
G 3 HOH 1 501 9  HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA dimeric 2 
2 software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E   
2 1 B,D,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 930  ? 
1 MORE         -4   ? 
1 'SSA (A^2)'  3290 ? 
2 'ABSA (A^2)' 880  ? 
2 MORE         -4   ? 
2 'SSA (A^2)'  3480 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-12-10 
2 'Structure model' 1 1 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Refinement description' 
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    2 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 2.770   5.589 12.011 0.0284 0.0526 0.0188 0.0122  -0.0092 -0.0076 4.5163 8.2312 6.4829  1.1796  
2.0404 2.5225  -0.1048 -0.1702 0.2749  0.3467  0.0291  0.0044  -0.0102 -0.3361 -0.1774 
'X-RAY DIFFRACTION' 2 ? refined -18.994 5.928 28.644 0.0415 0.0123 0.0275 -0.0138 -0.0118 0.0047  4.4350 3.0992 7.4780  -0.5201 
0.9956 -0.6787 -0.2195 -0.1043 0.3238  -0.0242 -0.0060 0.1687  0.0431  -0.2439 0.2005  
'X-RAY DIFFRACTION' 3 ? refined -3.017  0.808 19.116 0.0724 0.0984 0.1230 0.0180  0.0085  -0.0043 8.6880 3.5786 8.5239  2.8936  
5.3514 1.0447  0.0424  0.0513  -0.0937 -0.1404 -0.2449 -0.1157 0.0940  0.2197  0.1297  
'X-RAY DIFFRACTION' 4 ? refined -12.270 2.205 21.408 0.2026 0.1968 0.1157 0.0914  -0.0328 -0.0107 8.4101 8.7593 11.7707 -4.9860 
4.0570 5.0632  0.3718  -0.1001 -0.2717 0.4476  -0.6629 0.4463  -0.3069 0.2647  0.5726  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 437 A 472 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 437 B 472 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 C 329 C 338 ? . . . . ? 
'X-RAY DIFFRACTION' 4 3 C 339 C 339 ? . . . . ? 
'X-RAY DIFFRACTION' 5 4 D 329 D 338 ? . . . . ? 
'X-RAY DIFFRACTION' 6 4 D 339 D 339 ? . . . . ? 
# 
_phasing.method   MR 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 DENZO       .    ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data reduction'  
http://www.hkl-xray.com/                     ?          ? 
2 SCALEPACK   .    ?               package 'Zbyszek Otwinowski' hkl@hkl-xray.com            'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
3 PHASER      .    ?               program 'Randy J. Read'      cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/  ?          ? 
4 REFMAC      .    ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk       refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
5 PDB_EXTRACT 3.14 'Dec. 10, 2013' package PDB                  deposit@deposit.rcsb.org    'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              468 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              468 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              468 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                124.08 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.78 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 437 ? CG  ? A LEU 10 CG  
2  1 Y 1 A LEU 437 ? CD1 ? A LEU 10 CD1 
3  1 Y 1 A LEU 437 ? CD2 ? A LEU 10 CD2 
4  1 Y 1 B LEU 437 ? CG  ? B LEU 10 CG  
5  1 Y 1 B LEU 437 ? CD1 ? B LEU 10 CD1 
6  1 Y 1 B LEU 437 ? CD2 ? B LEU 10 CD2 
7  1 Y 1 C GLU 329 ? CG  ? C GLU 4  CG  
8  1 Y 1 C GLU 329 ? CD  ? C GLU 4  CD  
9  1 Y 1 C GLU 329 ? OE1 ? C GLU 4  OE1 
10 1 Y 1 C GLU 329 ? OE2 ? C GLU 4  OE2 
11 1 Y 1 D GLU 329 ? CG  ? D GLU 4  CG  
12 1 Y 1 D GLU 329 ? CD  ? D GLU 4  CD  
13 1 Y 1 D GLU 329 ? OE1 ? D GLU 4  OE1 
14 1 Y 1 D GLU 329 ? OE2 ? D GLU 4  OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 428 ? A GLY 1  
2  1 Y 1 A ARG 429 ? A ARG 2  
3  1 Y 1 A ARG 430 ? A ARG 3  
4  1 Y 1 A ALA 431 ? A ALA 4  
5  1 Y 1 A SER 432 ? A SER 5  
6  1 Y 1 A VAL 433 ? A VAL 6  
7  1 Y 1 A GLU 434 ? A GLU 7  
8  1 Y 1 A LEU 435 ? A LEU 8  
9  1 Y 1 A PRO 436 ? A PRO 9  
10 1 Y 1 A GLY 473 ? A GLY 46 
11 1 Y 1 A GLN 474 ? A GLN 47 
12 1 Y 1 B GLY 428 ? B GLY 1  
13 1 Y 1 B ARG 429 ? B ARG 2  
14 1 Y 1 B ARG 430 ? B ARG 3  
15 1 Y 1 B ALA 431 ? B ALA 4  
16 1 Y 1 B SER 432 ? B SER 5  
17 1 Y 1 B VAL 433 ? B VAL 6  
18 1 Y 1 B GLU 434 ? B GLU 7  
19 1 Y 1 B LEU 435 ? B LEU 8  
20 1 Y 1 B PRO 436 ? B PRO 9  
21 1 Y 1 B GLY 473 ? B GLY 46 
22 1 Y 1 B GLN 474 ? B GLN 47 
23 1 Y 1 C ACE 326 ? C ACE 1  
24 1 Y 1 C THR 327 ? C THR 2  
25 1 Y 1 C PRO 328 ? C PRO 3  
26 1 Y 1 D ACE 326 ? D ACE 1  
27 1 Y 1 D THR 327 ? D THR 2  
28 1 Y 1 D PRO 328 ? D PRO 3  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#