data_4RTL
# 
_entry.id   4RTL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
NDB   NA3304       
RCSB  RCSB087779   
PDB   4RTL         
WWPDB D_1000087779 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
2G1P PDB 'Structure of E. coli DNA adenine methyltransferase (DAM) with Cognate Sequence' unspecified 
2ORE PDB 'Binary structure of E.coli DAM'                                                 unspecified 
4RTJ PDB .                                                                                unspecified 
4RTK PDB .                                                                                unspecified 
4RTM PDB .                                                                                unspecified 
4RTN PDB .                                                                                unspecified 
4RTO PDB .                                                                                unspecified 
4RTP PDB .                                                                                unspecified 
4RTQ PDB .                                                                                unspecified 
4RTR PDB .                                                                                unspecified 
4RTS PDB .                                                                                unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4RTL 
_pdbx_database_status.recvd_initial_deposition_date   2014-11-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Horton, J.R.' 1 
'Cheng, X.'    2 
# 
_citation.id                        primary 
_citation.title                     
;Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            43 
_citation.page_first                4296 
_citation.page_last                 4308 
_citation.year                      2015 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25845600 
_citation.pdbx_database_id_DOI      10.1093/nar/gkv251 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Horton, J.R.'     1 
primary 'Zhang, X.'        2 
primary 'Blumenthal, R.M.' 3 
primary 'Cheng, X.'        4 
# 
_cell.entry_id           4RTL 
_cell.length_a           38.333 
_cell.length_b           66.296 
_cell.length_c           149.241 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RTL 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA adenine methylase'                           34330.961 1  ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*TP*CP*TP*AP*AP*AP*GP*AP*TP*CP*G)-3')
;
3357.223  1  ? ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*CP*GP*AP*TP*CP*TP*TP*TP*AP*G)-3')
;
3348.209  1  ? ? ? ? 
4 non-polymer syn SINEFUNGIN                                        381.387   1  ? ? ? ? 
5 water       nat water                                             18.015    88 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLI
SLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKK
PYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERH
IPVLISNHDTMLTREWYQRAKLHVVKVRRSISSNGGTRKKVDELLALYKPGVVSPAKK
;
;MGSSHHHHHHSSGLVPRGSHMKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLI
SLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKK
PYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERH
IPVLISNHDTMLTREWYQRAKLHVVKVRRSISSNGGTRKKVDELLALYKPGVVSPAKK
;
A ? 
2 polydeoxyribonucleotide no no '(DT)(DC)(DT)(DA)(DA)(DA)(DG)(DA)(DT)(DC)(DG)' TCTAAAGATCG F ? 
3 polydeoxyribonucleotide no no '(DA)(DC)(DG)(DA)(DT)(DC)(DT)(DT)(DT)(DA)(DG)' ACGATCTTTAG G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  LYS n 
1 23  LYS n 
1 24  ASN n 
1 25  ARG n 
1 26  ALA n 
1 27  PHE n 
1 28  LEU n 
1 29  LYS n 
1 30  TRP n 
1 31  ALA n 
1 32  GLY n 
1 33  GLY n 
1 34  LYS n 
1 35  TYR n 
1 36  PRO n 
1 37  LEU n 
1 38  LEU n 
1 39  ASP n 
1 40  ASP n 
1 41  ILE n 
1 42  LYS n 
1 43  ARG n 
1 44  HIS n 
1 45  LEU n 
1 46  PRO n 
1 47  LYS n 
1 48  GLY n 
1 49  GLU n 
1 50  CYS n 
1 51  LEU n 
1 52  VAL n 
1 53  GLU n 
1 54  PRO n 
1 55  PHE n 
1 56  VAL n 
1 57  GLY n 
1 58  ALA n 
1 59  GLY n 
1 60  SER n 
1 61  VAL n 
1 62  PHE n 
1 63  LEU n 
1 64  ASN n 
1 65  THR n 
1 66  ASP n 
1 67  PHE n 
1 68  SER n 
1 69  ARG n 
1 70  TYR n 
1 71  ILE n 
1 72  LEU n 
1 73  ALA n 
1 74  ASP n 
1 75  ILE n 
1 76  ASN n 
1 77  SER n 
1 78  ASP n 
1 79  LEU n 
1 80  ILE n 
1 81  SER n 
1 82  LEU n 
1 83  TYR n 
1 84  ASN n 
1 85  ILE n 
1 86  VAL n 
1 87  LYS n 
1 88  MET n 
1 89  ARG n 
1 90  THR n 
1 91  ASP n 
1 92  GLU n 
1 93  TYR n 
1 94  VAL n 
1 95  GLN n 
1 96  ALA n 
1 97  ALA n 
1 98  ARG n 
1 99  GLU n 
1 100 LEU n 
1 101 PHE n 
1 102 VAL n 
1 103 PRO n 
1 104 GLU n 
1 105 THR n 
1 106 ASN n 
1 107 CYS n 
1 108 ALA n 
1 109 GLU n 
1 110 VAL n 
1 111 TYR n 
1 112 TYR n 
1 113 GLN n 
1 114 PHE n 
1 115 ARG n 
1 116 GLU n 
1 117 GLU n 
1 118 PHE n 
1 119 ASN n 
1 120 LYS n 
1 121 SER n 
1 122 GLN n 
1 123 ASP n 
1 124 PRO n 
1 125 PHE n 
1 126 ARG n 
1 127 ARG n 
1 128 ALA n 
1 129 VAL n 
1 130 LEU n 
1 131 PHE n 
1 132 LEU n 
1 133 TYR n 
1 134 LEU n 
1 135 ASN n 
1 136 ARG n 
1 137 TYR n 
1 138 GLY n 
1 139 TYR n 
1 140 ASN n 
1 141 GLY n 
1 142 LEU n 
1 143 CYS n 
1 144 ARG n 
1 145 TYR n 
1 146 ASN n 
1 147 LEU n 
1 148 ARG n 
1 149 GLY n 
1 150 GLU n 
1 151 PHE n 
1 152 ASN n 
1 153 VAL n 
1 154 PRO n 
1 155 PHE n 
1 156 GLY n 
1 157 ARG n 
1 158 TYR n 
1 159 LYS n 
1 160 LYS n 
1 161 PRO n 
1 162 TYR n 
1 163 PHE n 
1 164 PRO n 
1 165 GLU n 
1 166 ALA n 
1 167 GLU n 
1 168 LEU n 
1 169 TYR n 
1 170 HIS n 
1 171 PHE n 
1 172 ALA n 
1 173 GLU n 
1 174 LYS n 
1 175 ALA n 
1 176 GLN n 
1 177 ASN n 
1 178 ALA n 
1 179 PHE n 
1 180 PHE n 
1 181 TYR n 
1 182 CYS n 
1 183 GLU n 
1 184 SER n 
1 185 TYR n 
1 186 ALA n 
1 187 ASP n 
1 188 SER n 
1 189 MET n 
1 190 ALA n 
1 191 ARG n 
1 192 ALA n 
1 193 ASP n 
1 194 ASP n 
1 195 SER n 
1 196 SER n 
1 197 VAL n 
1 198 VAL n 
1 199 TYR n 
1 200 CYS n 
1 201 ASP n 
1 202 PRO n 
1 203 PRO n 
1 204 TYR n 
1 205 ALA n 
1 206 PRO n 
1 207 LEU n 
1 208 SER n 
1 209 ALA n 
1 210 THR n 
1 211 ALA n 
1 212 ASN n 
1 213 PHE n 
1 214 THR n 
1 215 ALA n 
1 216 TYR n 
1 217 HIS n 
1 218 THR n 
1 219 ASN n 
1 220 SER n 
1 221 PHE n 
1 222 THR n 
1 223 LEU n 
1 224 GLU n 
1 225 GLN n 
1 226 GLN n 
1 227 ALA n 
1 228 HIS n 
1 229 LEU n 
1 230 ALA n 
1 231 GLU n 
1 232 ILE n 
1 233 ALA n 
1 234 GLU n 
1 235 GLY n 
1 236 LEU n 
1 237 VAL n 
1 238 GLU n 
1 239 ARG n 
1 240 HIS n 
1 241 ILE n 
1 242 PRO n 
1 243 VAL n 
1 244 LEU n 
1 245 ILE n 
1 246 SER n 
1 247 ASN n 
1 248 HIS n 
1 249 ASP n 
1 250 THR n 
1 251 MET n 
1 252 LEU n 
1 253 THR n 
1 254 ARG n 
1 255 GLU n 
1 256 TRP n 
1 257 TYR n 
1 258 GLN n 
1 259 ARG n 
1 260 ALA n 
1 261 LYS n 
1 262 LEU n 
1 263 HIS n 
1 264 VAL n 
1 265 VAL n 
1 266 LYS n 
1 267 VAL n 
1 268 ARG n 
1 269 ARG n 
1 270 SER n 
1 271 ILE n 
1 272 SER n 
1 273 SER n 
1 274 ASN n 
1 275 GLY n 
1 276 GLY n 
1 277 THR n 
1 278 ARG n 
1 279 LYS n 
1 280 LYS n 
1 281 VAL n 
1 282 ASP n 
1 283 GLU n 
1 284 LEU n 
1 285 LEU n 
1 286 ALA n 
1 287 LEU n 
1 288 TYR n 
1 289 LYS n 
1 290 PRO n 
1 291 GLY n 
1 292 VAL n 
1 293 VAL n 
1 294 SER n 
1 295 PRO n 
1 296 ALA n 
1 297 LYS n 
1 298 LYS n 
2 1   DT  n 
2 2   DC  n 
2 3   DT  n 
2 4   DA  n 
2 5   DA  n 
2 6   DA  n 
2 7   DG  n 
2 8   DA  n 
2 9   DT  n 
2 10  DC  n 
2 11  DG  n 
3 1   DA  n 
3 2   DC  n 
3 3   DG  n 
3 4   DA  n 
3 5   DT  n 
3 6   DC  n 
3 7   DT  n 
3 8   DT  n 
3 9   DT  n 
3 10  DA  n 
3 11  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dam, ECMDS42_2833' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'K-12 substr. MDS42' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1110693 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'HMS174(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'synthetic construct' ? 32630 ? 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H0Q7C9_ECOLI H0Q7C9 1 
;MKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAAREL
FVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFF
YCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRA
KLHVVKVRRSISSNGGTRKKVDELLALYKPGVVSPAKK
;
1 ? 
2 PDB 4RTL         4RTL   2 ? ? ? 
3 PDB 4RTL         4RTL   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4RTL A 21 ? 298 ? H0Q7C9 1 ? 278 ? 1 278 
2 2 4RTL F 1  ? 11  ? 4RTL   1 ? 11  ? 1 11  
3 3 4RTL G 1  ? 11  ? 4RTL   1 ? 11  ? 1 11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4RTL MET A 1   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -19 1  
1 4RTL GLY A 2   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -18 2  
1 4RTL SER A 3   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -17 3  
1 4RTL SER A 4   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -16 4  
1 4RTL HIS A 5   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -15 5  
1 4RTL HIS A 6   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -14 6  
1 4RTL HIS A 7   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -13 7  
1 4RTL HIS A 8   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -12 8  
1 4RTL HIS A 9   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -11 9  
1 4RTL HIS A 10  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -10 10 
1 4RTL SER A 11  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -9  11 
1 4RTL SER A 12  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -8  12 
1 4RTL GLY A 13  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -7  13 
1 4RTL LEU A 14  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -6  14 
1 4RTL VAL A 15  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -5  15 
1 4RTL PRO A 16  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -4  16 
1 4RTL ARG A 17  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -3  17 
1 4RTL GLY A 18  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -2  18 
1 4RTL SER A 19  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -1  19 
1 4RTL HIS A 20  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' 0   20 
1 4RTL SER A 195 ? UNP H0Q7C9 ALA 175 'SEE REMARK 999' 175 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                  'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                  'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                  'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                  'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                  'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                  'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                  'C3 H7 N O3'      105.093 
SFG non-polymer         . SINEFUNGIN                           ADENOSYL-ORNITHINE 'C15 H23 N7 O5'   381.387 
THR 'L-peptide linking' y THREONINE                            ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                  'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4RTL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.77 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pdbx_details    
'24% PEG200, 100mM KCl, 10mM MgSO4, 100mM MES buffer, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2006-12-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
# 
_reflns.entry_id                     4RTL 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             27.606 
_reflns.d_resolution_high            2.19 
_reflns.number_obs                   20122 
_reflns.number_all                   20122 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.4 
_reflns.B_iso_Wilson_estimate        39.2 
_reflns.pdbx_redundancy              8.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.19 
_reflns_shell.d_res_low              2.27 
_reflns_shell.percent_possible_all   98.5 
_reflns_shell.Rmerge_I_obs           0.287 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.7 
_reflns_shell.pdbx_redundancy        7.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1955 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4RTL 
_refine.ls_number_reflns_obs                     20061 
_refine.ls_number_reflns_all                     20061 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.6 
_refine.ls_d_res_high                            2.193 
_refine.ls_percent_reflns_obs                    98.98 
_refine.ls_R_factor_obs                          0.2062 
_refine.ls_R_factor_R_work                       0.2038 
_refine.ls_R_factor_R_free                       0.2526 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.00 
_refine.ls_number_reflns_R_free                  1003 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 2G1P' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.30 
_refine.pdbx_overall_phase_error                 27.24 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2032 
_refine_hist.pdbx_number_atoms_nucleic_acid   445 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             88 
_refine_hist.number_atoms_total               2592 
_refine_hist.d_res_high                       2.193 
_refine_hist.d_res_low                        27.6 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.011  ? ? 2627 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.079  ? ? 3665 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 18.615 ? ? 966  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.048  ? ? 394  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 400  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.193  2.3087  2606 0.2437 97.00  0.3091 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 2.3087 2.4532  2659 0.2411 98.00  0.3017 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 2.4532 2.6425  2671 0.2477 99.00  0.3282 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 2.6425 2.9082  2711 0.2558 99.00  0.3394 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 2.9082 3.3284  2745 0.2554 100.00 0.3097 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 3.3284 4.1910  2777 0.1822 100.00 0.2211 . . 147 . . . . 'X-RAY DIFFRACTION' 
. 4.1910 27.6085 2889 0.1619 99.00  0.1955 . . 151 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4RTL 
_struct.title                     
'Complex of Escherichia coli DNA Adenine Methyltransferase (DAM) with Sinefungin and with DNA Containing Distal Pap Regulon Sequence' 
_struct.pdbx_descriptor           'DNA adenine methylase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4RTL 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            
;DAM METHYLATION, GATC RECOGNITION, BASE FLIPPING, BACTERIAL VIRULENCE, methylation-independent transcriptional repressor, Transferase-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 34  ? PRO A 36  ? LYS A 14  PRO A 16  5 ? 3  
HELX_P HELX_P2  2  LEU A 37  ? LEU A 45  ? LEU A 17  LEU A 25  1 ? 9  
HELX_P HELX_P3  3  VAL A 61  ? THR A 65  ? VAL A 41  THR A 45  5 ? 5  
HELX_P HELX_P4  4  ASN A 76  ? ARG A 89  ? ASN A 56  ARG A 69  1 ? 14 
HELX_P HELX_P5  5  ARG A 89  ? GLU A 99  ? ARG A 69  GLU A 79  1 ? 11 
HELX_P HELX_P6  6  LEU A 100 ? PHE A 101 ? LEU A 80  PHE A 81  5 ? 2  
HELX_P HELX_P7  7  VAL A 102 ? ASN A 106 ? VAL A 82  ASN A 86  5 ? 5  
HELX_P HELX_P8  8  CYS A 107 ? SER A 121 ? CYS A 87  SER A 101 1 ? 15 
HELX_P HELX_P9  9  ASP A 123 ? GLY A 138 ? ASP A 103 GLY A 118 1 ? 16 
HELX_P HELX_P10 10 TYR A 139 ? LEU A 142 ? TYR A 119 LEU A 122 5 ? 4  
HELX_P HELX_P11 11 PRO A 164 ? ALA A 175 ? PRO A 144 ALA A 155 1 ? 12 
HELX_P HELX_P12 12 SER A 184 ? ALA A 190 ? SER A 164 ALA A 170 1 ? 7  
HELX_P HELX_P13 13 THR A 222 ? GLU A 238 ? THR A 202 GLU A 218 1 ? 17 
HELX_P HELX_P14 14 THR A 250 ? TYR A 257 ? THR A 230 TYR A 237 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DC 2  N3 ? ? ? 1_555 C DG 11 N1 ? ? F DC 2  G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DC 2  N4 ? ? ? 1_555 C DG 11 O6 ? ? F DC 2  G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DC 2  O2 ? ? ? 1_555 C DG 11 N2 ? ? F DC 2  G DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DT 3  N3 ? ? ? 1_555 C DA 10 N1 ? ? F DT 3  G DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DT 3  O4 ? ? ? 1_555 C DA 10 N6 ? ? F DT 3  G DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DA 4  N1 ? ? ? 1_555 C DT 9  N3 ? ? F DA 4  G DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DA 4  N6 ? ? ? 1_555 C DT 9  O4 ? ? F DA 4  G DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DA 5  N1 ? ? ? 1_555 C DT 8  N3 ? ? F DA 5  G DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DA 5  N6 ? ? ? 1_555 C DT 8  O4 ? ? F DA 5  G DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DA 6  N1 ? ? ? 1_555 C DT 7  N3 ? ? F DA 6  G DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DA 6  N6 ? ? ? 1_555 C DT 7  O4 ? ? F DA 6  G DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DG 7  N1 ? ? ? 1_555 C DC 6  N3 ? ? F DG 7  G DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DG 7  N2 ? ? ? 1_555 C DC 6  O2 ? ? F DG 7  G DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DG 7  O6 ? ? ? 1_555 C DC 6  N4 ? ? F DG 7  G DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DA 8  N1 ? ? ? 1_555 C DT 5  N3 ? ? F DA 8  G DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DA 8  N6 ? ? ? 1_555 C DT 5  O4 ? ? F DA 8  G DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? B DT 9  N3 ? ? ? 1_555 C DA 4  N1 ? ? F DT 9  G DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DT 9  O4 ? ? ? 1_555 C DA 4  N6 ? ? F DT 9  G DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DC 10 O2 ? ? ? 1_555 C DG 3  N2 ? ? F DC 10 G DG 3  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog20 hydrog ? ? B DG 11 N1 ? ? ? 1_555 C DC 2  N3 ? ? F DG 11 G DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DG 11 N2 ? ? ? 1_555 C DC 2  O2 ? ? F DG 11 G DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DG 11 O6 ? ? ? 1_555 C DC 2  N4 ? ? F DG 11 G DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 178 ? CYS A 182 ? ALA A 158 CYS A 162 
A 2 ARG A 69  ? ASP A 74  ? ARG A 49  ASP A 54  
A 3 CYS A 50  ? GLU A 53  ? CYS A 30  GLU A 33  
A 4 SER A 196 ? CYS A 200 ? SER A 176 CYS A 180 
A 5 VAL A 243 ? HIS A 248 ? VAL A 223 HIS A 228 
A 6 VAL A 281 ? TYR A 288 ? VAL A 261 TYR A 268 
A 7 LYS A 261 ? ARG A 269 ? LYS A 241 ARG A 249 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 179 ? O PHE A 159 N LEU A 72  ? N LEU A 52  
A 2 3 O ILE A 71  ? O ILE A 51  N LEU A 51  ? N LEU A 31  
A 3 4 N VAL A 52  ? N VAL A 32  O VAL A 197 ? O VAL A 177 
A 4 5 N VAL A 198 ? N VAL A 178 O LEU A 244 ? O LEU A 224 
A 5 6 N VAL A 243 ? N VAL A 223 O TYR A 288 ? O TYR A 268 
A 6 7 O GLU A 283 ? O GLU A 263 N VAL A 265 ? N VAL A 245 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'BINDING SITE FOR RESIDUE SFG A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 TRP A 30  ? TRP A 10  . ? 1_555 ? 
2  AC1 12 ALA A 31  ? ALA A 11  . ? 1_555 ? 
3  AC1 12 GLY A 32  ? GLY A 12  . ? 1_555 ? 
4  AC1 12 LYS A 34  ? LYS A 14  . ? 1_555 ? 
5  AC1 12 PRO A 54  ? PRO A 34  . ? 1_555 ? 
6  AC1 12 PHE A 55  ? PHE A 35  . ? 1_555 ? 
7  AC1 12 VAL A 56  ? VAL A 36  . ? 1_555 ? 
8  AC1 12 ALA A 58  ? ALA A 38  . ? 1_555 ? 
9  AC1 12 ASP A 74  ? ASP A 54  . ? 1_555 ? 
10 AC1 12 SER A 184 ? SER A 164 . ? 1_555 ? 
11 AC1 12 TYR A 185 ? TYR A 165 . ? 1_555 ? 
12 AC1 12 ASP A 201 ? ASP A 181 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4RTL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4RTL 
_atom_sites.fract_transf_matrix[1][1]   0.026087 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015084 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006701 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 23  ? -5.528 -1.833  170.709 1.00 67.22  ? 3   LYS A N     1 
ATOM   2    C CA    . LYS A 1 23  ? -4.305 -1.084  170.424 1.00 75.41  ? 3   LYS A CA    1 
ATOM   3    C C     . LYS A 1 23  ? -3.632 -0.571  171.704 1.00 75.06  ? 3   LYS A C     1 
ATOM   4    O O     . LYS A 1 23  ? -4.209 0.240   172.432 1.00 78.19  ? 3   LYS A O     1 
ATOM   5    C CB    . LYS A 1 23  ? -4.612 0.092   169.494 1.00 79.65  ? 3   LYS A CB    1 
ATOM   6    C CG    . LYS A 1 23  ? -3.815 0.108   168.198 1.00 78.09  ? 3   LYS A CG    1 
ATOM   7    C CD    . LYS A 1 23  ? -4.411 -0.840  167.171 1.00 82.34  ? 3   LYS A CD    1 
ATOM   8    C CE    . LYS A 1 23  ? -3.836 -0.581  165.785 1.00 83.10  ? 3   LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 23  ? -4.528 -1.377  164.728 1.00 80.73  ? 3   LYS A NZ    1 
ATOM   10   N N     . ASN A 1 24  ? -2.411 -1.036  171.967 1.00 65.71  ? 4   ASN A N     1 
ATOM   11   C CA    . ASN A 1 24  ? -1.681 -0.657  173.179 1.00 60.57  ? 4   ASN A CA    1 
ATOM   12   C C     . ASN A 1 24  ? -0.427 0.166   172.888 1.00 54.53  ? 4   ASN A C     1 
ATOM   13   O O     . ASN A 1 24  ? 0.281  -0.087  171.911 1.00 43.55  ? 4   ASN A O     1 
ATOM   14   C CB    . ASN A 1 24  ? -1.305 -1.905  173.984 1.00 62.72  ? 4   ASN A CB    1 
ATOM   15   C CG    . ASN A 1 24  ? -2.510 -2.578  174.607 1.00 74.68  ? 4   ASN A CG    1 
ATOM   16   O OD1   . ASN A 1 24  ? -2.845 -3.717  174.275 1.00 78.37  ? 4   ASN A OD1   1 
ATOM   17   N ND2   . ASN A 1 24  ? -3.173 -1.874  175.516 1.00 78.37  ? 4   ASN A ND2   1 
ATOM   18   N N     . ARG A 1 25  ? -0.151 1.136   173.757 1.00 54.09  ? 5   ARG A N     1 
ATOM   19   C CA    . ARG A 1 25  ? 0.937  2.094   173.552 1.00 49.25  ? 5   ARG A CA    1 
ATOM   20   C C     . ARG A 1 25  ? 2.167  1.811   174.423 1.00 38.44  ? 5   ARG A C     1 
ATOM   21   O O     . ARG A 1 25  ? 2.034  1.420   175.580 1.00 32.36  ? 5   ARG A O     1 
ATOM   22   C CB    . ARG A 1 25  ? 0.434  3.509   173.844 1.00 53.70  ? 5   ARG A CB    1 
ATOM   23   C CG    . ARG A 1 25  ? -0.950 3.808   173.294 1.00 66.38  ? 5   ARG A CG    1 
ATOM   24   C CD    . ARG A 1 25  ? -0.858 4.529   171.965 1.00 72.76  ? 5   ARG A CD    1 
ATOM   25   N NE    . ARG A 1 25  ? -0.313 5.874   172.123 1.00 77.15  ? 5   ARG A NE    1 
ATOM   26   C CZ    . ARG A 1 25  ? 0.079  6.647   171.115 1.00 82.72  ? 5   ARG A CZ    1 
ATOM   27   N NH1   . ARG A 1 25  ? -0.005 6.207   169.866 1.00 80.33  ? 5   ARG A NH1   1 
ATOM   28   N NH2   . ARG A 1 25  ? 0.561  7.860   171.355 1.00 88.54  ? 5   ARG A NH2   1 
ATOM   29   N N     . ALA A 1 26  ? 3.358  2.031   173.868 1.00 34.55  ? 6   ALA A N     1 
ATOM   30   C CA    . ALA A 1 26  ? 4.607  1.951   174.635 1.00 29.74  ? 6   ALA A CA    1 
ATOM   31   C C     . ALA A 1 26  ? 4.679  3.096   175.659 1.00 36.89  ? 6   ALA A C     1 
ATOM   32   O O     . ALA A 1 26  ? 3.914  4.060   175.551 1.00 31.82  ? 6   ALA A O     1 
ATOM   33   C CB    . ALA A 1 26  ? 5.801  1.997   173.696 1.00 35.27  ? 6   ALA A CB    1 
ATOM   34   N N     . PHE A 1 27  ? 5.575  3.009   176.651 1.00 33.80  ? 7   PHE A N     1 
ATOM   35   C CA    . PHE A 1 27  ? 5.716  4.131   177.591 1.00 31.88  ? 7   PHE A CA    1 
ATOM   36   C C     . PHE A 1 27  ? 6.932  5.042   177.287 1.00 34.26  ? 7   PHE A C     1 
ATOM   37   O O     . PHE A 1 27  ? 7.101  6.074   177.946 1.00 34.17  ? 7   PHE A O     1 
ATOM   38   C CB    . PHE A 1 27  ? 5.743  3.632   179.066 1.00 29.39  ? 7   PHE A CB    1 
ATOM   39   C CG    . PHE A 1 27  ? 6.939  2.773   179.443 1.00 27.12  ? 7   PHE A CG    1 
ATOM   40   C CD1   . PHE A 1 27  ? 8.089  3.347   179.974 1.00 28.24  ? 7   PHE A CD1   1 
ATOM   41   C CD2   . PHE A 1 27  ? 6.884  1.388   179.333 1.00 32.00  ? 7   PHE A CD2   1 
ATOM   42   C CE1   . PHE A 1 27  ? 9.197  2.558   180.341 1.00 29.45  ? 7   PHE A CE1   1 
ATOM   43   C CE2   . PHE A 1 27  ? 7.975  0.587   179.704 1.00 28.94  ? 7   PHE A CE2   1 
ATOM   44   C CZ    . PHE A 1 27  ? 9.135  1.175   180.207 1.00 31.54  ? 7   PHE A CZ    1 
ATOM   45   N N     . LEU A 1 28  ? 7.732  4.690   176.271 1.00 27.02  ? 8   LEU A N     1 
ATOM   46   C CA    . LEU A 1 28  ? 8.884  5.506   175.816 1.00 25.97  ? 8   LEU A CA    1 
ATOM   47   C C     . LEU A 1 28  ? 8.712  6.111   174.397 1.00 38.58  ? 8   LEU A C     1 
ATOM   48   O O     . LEU A 1 28  ? 8.202  5.435   173.495 1.00 31.55  ? 8   LEU A O     1 
ATOM   49   C CB    . LEU A 1 28  ? 10.177 4.657   175.839 1.00 22.60  ? 8   LEU A CB    1 
ATOM   50   C CG    . LEU A 1 28  ? 10.775 4.171   177.175 1.00 33.26  ? 8   LEU A CG    1 
ATOM   51   C CD1   . LEU A 1 28  ? 11.844 3.079   176.972 1.00 31.80  ? 8   LEU A CD1   1 
ATOM   52   C CD2   . LEU A 1 28  ? 11.362 5.323   177.969 1.00 22.74  ? 8   LEU A CD2   1 
ATOM   53   N N     . LYS A 1 29  ? 9.131  7.371   174.204 1.00 37.17  ? 9   LYS A N     1 
ATOM   54   C CA    . LYS A 1 29  ? 9.326  7.942   172.854 1.00 33.45  ? 9   LYS A CA    1 
ATOM   55   C C     . LYS A 1 29  ? 10.560 7.273   172.191 1.00 32.15  ? 9   LYS A C     1 
ATOM   56   O O     . LYS A 1 29  ? 11.568 7.080   172.864 1.00 31.42  ? 9   LYS A O     1 
ATOM   57   C CB    . LYS A 1 29  ? 9.528  9.474   172.908 1.00 39.41  ? 9   LYS A CB    1 
ATOM   58   C CG    . LYS A 1 29  ? 8.402  10.333  173.536 1.00 30.98  ? 9   LYS A CG    1 
ATOM   59   C CD    . LYS A 1 29  ? 8.742  11.851  173.461 1.00 33.16  ? 9   LYS A CD    1 
ATOM   60   C CE    . LYS A 1 29  ? 7.727  12.732  174.223 1.00 35.82  ? 9   LYS A CE    1 
ATOM   61   N NZ    . LYS A 1 29  ? 7.914  14.235  174.080 1.00 38.59  ? 9   LYS A NZ    1 
ATOM   62   N N     . TRP A 1 30  ? 10.506 6.921   170.899 1.00 32.71  ? 10  TRP A N     1 
ATOM   63   C CA    . TRP A 1 30  ? 11.626 6.173   170.265 1.00 38.99  ? 10  TRP A CA    1 
ATOM   64   C C     . TRP A 1 30  ? 11.699 6.272   168.721 1.00 46.60  ? 10  TRP A C     1 
ATOM   65   O O     . TRP A 1 30  ? 10.682 6.449   168.049 1.00 45.48  ? 10  TRP A O     1 
ATOM   66   C CB    . TRP A 1 30  ? 11.548 4.690   170.663 1.00 32.68  ? 10  TRP A CB    1 
ATOM   67   C CG    . TRP A 1 30  ? 12.877 3.946   170.729 1.00 39.53  ? 10  TRP A CG    1 
ATOM   68   C CD1   . TRP A 1 30  ? 13.386 3.084   169.790 1.00 43.67  ? 10  TRP A CD1   1 
ATOM   69   C CD2   . TRP A 1 30  ? 13.835 3.972   171.805 1.00 33.32  ? 10  TRP A CD2   1 
ATOM   70   N NE1   . TRP A 1 30  ? 14.599 2.582   170.212 1.00 40.64  ? 10  TRP A NE1   1 
ATOM   71   C CE2   . TRP A 1 30  ? 14.902 3.112   171.442 1.00 35.14  ? 10  TRP A CE2   1 
ATOM   72   C CE3   . TRP A 1 30  ? 13.900 4.642   173.036 1.00 25.03  ? 10  TRP A CE3   1 
ATOM   73   C CZ2   . TRP A 1 30  ? 16.020 2.910   172.259 1.00 37.48  ? 10  TRP A CZ2   1 
ATOM   74   C CZ3   . TRP A 1 30  ? 15.013 4.437   173.856 1.00 31.20  ? 10  TRP A CZ3   1 
ATOM   75   C CH2   . TRP A 1 30  ? 16.056 3.574   173.460 1.00 37.27  ? 10  TRP A CH2   1 
ATOM   76   N N     . ALA A 1 31  ? 12.906 6.130   168.166 1.00 42.07  ? 11  ALA A N     1 
ATOM   77   C CA    . ALA A 1 31  ? 13.114 6.236   166.716 1.00 40.42  ? 11  ALA A CA    1 
ATOM   78   C C     . ALA A 1 31  ? 12.730 4.960   165.956 1.00 43.45  ? 11  ALA A C     1 
ATOM   79   O O     . ALA A 1 31  ? 13.102 3.843   166.345 1.00 36.09  ? 11  ALA A O     1 
ATOM   80   C CB    . ALA A 1 31  ? 14.562 6.601   166.419 1.00 43.47  ? 11  ALA A CB    1 
ATOM   81   N N     . GLY A 1 32  ? 11.987 5.133   164.866 1.00 42.18  ? 12  GLY A N     1 
ATOM   82   C CA    . GLY A 1 32  ? 11.555 4.012   164.050 1.00 38.97  ? 12  GLY A CA    1 
ATOM   83   C C     . GLY A 1 32  ? 10.530 3.092   164.702 1.00 44.39  ? 12  GLY A C     1 
ATOM   84   O O     . GLY A 1 32  ? 10.473 1.908   164.369 1.00 48.47  ? 12  GLY A O     1 
ATOM   85   N N     . GLY A 1 33  ? 9.723  3.626   165.623 1.00 45.10  ? 13  GLY A N     1 
ATOM   86   C CA    . GLY A 1 33  ? 8.661  2.855   166.267 1.00 37.78  ? 13  GLY A CA    1 
ATOM   87   C C     . GLY A 1 33  ? 7.617  2.410   165.250 1.00 35.76  ? 13  GLY A C     1 
ATOM   88   O O     . GLY A 1 33  ? 7.362  3.128   164.289 1.00 35.12  ? 13  GLY A O     1 
ATOM   89   N N     . LYS A 1 34  ? 7.006  1.245   165.464 1.00 36.95  ? 14  LYS A N     1 
ATOM   90   C CA    . LYS A 1 34  ? 6.198  0.596   164.421 1.00 43.56  ? 14  LYS A CA    1 
ATOM   91   C C     . LYS A 1 34  ? 4.670  0.616   164.635 1.00 52.58  ? 14  LYS A C     1 
ATOM   92   O O     . LYS A 1 34  ? 3.922  -0.029  163.886 1.00 44.10  ? 14  LYS A O     1 
ATOM   93   C CB    . LYS A 1 34  ? 6.670  -0.857  164.252 1.00 43.62  ? 14  LYS A CB    1 
ATOM   94   C CG    . LYS A 1 34  ? 8.006  -0.990  163.517 1.00 40.24  ? 14  LYS A CG    1 
ATOM   95   C CD    . LYS A 1 34  ? 7.854  -0.560  162.056 1.00 44.92  ? 14  LYS A CD    1 
ATOM   96   C CE    . LYS A 1 34  ? 9.169  -0.633  161.294 1.00 44.44  ? 14  LYS A CE    1 
ATOM   97   N NZ    . LYS A 1 34  ? 10.158 0.396   161.729 1.00 46.50  ? 14  LYS A NZ    1 
ATOM   98   N N     . TYR A 1 35  ? 4.212  1.365   165.636 1.00 52.33  ? 15  TYR A N     1 
ATOM   99   C CA    . TYR A 1 35  ? 2.775  1.517   165.913 1.00 55.44  ? 15  TYR A CA    1 
ATOM   100  C C     . TYR A 1 35  ? 1.883  1.767   164.665 1.00 57.27  ? 15  TYR A C     1 
ATOM   101  O O     . TYR A 1 35  ? 0.829  1.141   164.536 1.00 54.87  ? 15  TYR A O     1 
ATOM   102  C CB    . TYR A 1 35  ? 2.579  2.642   166.949 1.00 52.86  ? 15  TYR A CB    1 
ATOM   103  C CG    . TYR A 1 35  ? 1.146  2.944   167.347 1.00 58.91  ? 15  TYR A CG    1 
ATOM   104  C CD1   . TYR A 1 35  ? 0.523  2.244   168.377 1.00 59.47  ? 15  TYR A CD1   1 
ATOM   105  C CD2   . TYR A 1 35  ? 0.425  3.952   166.713 1.00 63.84  ? 15  TYR A CD2   1 
ATOM   106  C CE1   . TYR A 1 35  ? -0.787 2.524   168.753 1.00 62.31  ? 15  TYR A CE1   1 
ATOM   107  C CE2   . TYR A 1 35  ? -0.883 4.241   167.081 1.00 71.40  ? 15  TYR A CE2   1 
ATOM   108  C CZ    . TYR A 1 35  ? -1.483 3.525   168.102 1.00 70.00  ? 15  TYR A CZ    1 
ATOM   109  O OH    . TYR A 1 35  ? -2.778 3.817   168.468 1.00 71.88  ? 15  TYR A OH    1 
ATOM   110  N N     . PRO A 1 36  ? 2.296  2.658   163.736 1.00 56.92  ? 16  PRO A N     1 
ATOM   111  C CA    . PRO A 1 36  ? 1.396  2.899   162.591 1.00 50.70  ? 16  PRO A CA    1 
ATOM   112  C C     . PRO A 1 36  ? 1.346  1.807   161.504 1.00 54.94  ? 16  PRO A C     1 
ATOM   113  O O     . PRO A 1 36  ? 0.520  1.930   160.596 1.00 55.94  ? 16  PRO A O     1 
ATOM   114  C CB    . PRO A 1 36  ? 1.949  4.198   161.980 1.00 45.43  ? 16  PRO A CB    1 
ATOM   115  C CG    . PRO A 1 36  ? 2.783  4.814   163.037 1.00 48.74  ? 16  PRO A CG    1 
ATOM   116  C CD    . PRO A 1 36  ? 3.369  3.667   163.794 1.00 52.92  ? 16  PRO A CD    1 
ATOM   117  N N     . LEU A 1 37  ? 2.194  0.783   161.580 1.00 52.50  ? 17  LEU A N     1 
ATOM   118  C CA    . LEU A 1 37  ? 2.244  -0.257  160.542 1.00 50.72  ? 17  LEU A CA    1 
ATOM   119  C C     . LEU A 1 37  ? 1.782  -1.636  161.021 1.00 52.15  ? 17  LEU A C     1 
ATOM   120  O O     . LEU A 1 37  ? 1.964  -2.636  160.314 1.00 41.53  ? 17  LEU A O     1 
ATOM   121  C CB    . LEU A 1 37  ? 3.669  -0.401  159.993 1.00 52.02  ? 17  LEU A CB    1 
ATOM   122  C CG    . LEU A 1 37  ? 4.342  0.727   159.210 1.00 56.86  ? 17  LEU A CG    1 
ATOM   123  C CD1   . LEU A 1 37  ? 5.552  0.174   158.475 1.00 63.57  ? 17  LEU A CD1   1 
ATOM   124  C CD2   . LEU A 1 37  ? 3.386  1.402   158.245 1.00 51.33  ? 17  LEU A CD2   1 
ATOM   125  N N     . LEU A 1 38  ? 1.203  -1.692  162.216 1.00 38.53  ? 18  LEU A N     1 
ATOM   126  C CA    . LEU A 1 38  ? 0.887  -2.963  162.861 1.00 45.45  ? 18  LEU A CA    1 
ATOM   127  C C     . LEU A 1 38  ? -0.068 -3.845  162.035 1.00 52.65  ? 18  LEU A C     1 
ATOM   128  O O     . LEU A 1 38  ? 0.091  -5.067  161.995 1.00 48.92  ? 18  LEU A O     1 
ATOM   129  C CB    . LEU A 1 38  ? 0.302  -2.702  164.257 1.00 41.08  ? 18  LEU A CB    1 
ATOM   130  C CG    . LEU A 1 38  ? 1.279  -2.097  165.274 1.00 44.66  ? 18  LEU A CG    1 
ATOM   131  C CD1   . LEU A 1 38  ? 0.564  -1.591  166.528 1.00 48.58  ? 18  LEU A CD1   1 
ATOM   132  C CD2   . LEU A 1 38  ? 2.352  -3.113  165.643 1.00 45.08  ? 18  LEU A CD2   1 
ATOM   133  N N     . ASP A 1 39  ? -1.037 -3.228  161.363 1.00 43.67  ? 19  ASP A N     1 
ATOM   134  C CA    . ASP A 1 39  ? -2.010 -3.984  160.573 1.00 54.26  ? 19  ASP A CA    1 
ATOM   135  C C     . ASP A 1 39  ? -1.373 -4.765  159.412 1.00 59.52  ? 19  ASP A C     1 
ATOM   136  O O     . ASP A 1 39  ? -1.773 -5.892  159.116 1.00 53.40  ? 19  ASP A O     1 
ATOM   137  C CB    . ASP A 1 39  ? -3.093 -3.044  160.038 1.00 64.74  ? 19  ASP A CB    1 
ATOM   138  C CG    . ASP A 1 39  ? -4.011 -2.531  161.134 1.00 79.18  ? 19  ASP A CG    1 
ATOM   139  O OD1   . ASP A 1 39  ? -4.170 -3.237  162.152 1.00 83.47  ? 19  ASP A OD1   1 
ATOM   140  O OD2   . ASP A 1 39  ? -4.573 -1.426  160.979 1.00 85.56  ? 19  ASP A OD2   1 
ATOM   141  N N     . ASP A 1 40  ? -0.381 -4.171  158.759 1.00 60.73  ? 20  ASP A N     1 
ATOM   142  C CA    . ASP A 1 40  ? 0.301  -4.841  157.654 1.00 60.68  ? 20  ASP A CA    1 
ATOM   143  C C     . ASP A 1 40  ? 1.258  -5.939  158.145 1.00 51.20  ? 20  ASP A C     1 
ATOM   144  O O     . ASP A 1 40  ? 1.395  -6.980  157.501 1.00 49.99  ? 20  ASP A O     1 
ATOM   145  C CB    . ASP A 1 40  ? 1.063  -3.820  156.798 1.00 61.52  ? 20  ASP A CB    1 
ATOM   146  C CG    . ASP A 1 40  ? 0.141  -2.802  156.135 1.00 69.10  ? 20  ASP A CG    1 
ATOM   147  O OD1   . ASP A 1 40  ? -0.251 -3.010  154.964 1.00 63.16  ? 20  ASP A OD1   1 
ATOM   148  O OD2   . ASP A 1 40  ? -0.187 -1.790  156.789 1.00 75.54  ? 20  ASP A OD2   1 
ATOM   149  N N     . ILE A 1 41  ? 1.914  -5.711  159.279 1.00 49.78  ? 21  ILE A N     1 
ATOM   150  C CA    . ILE A 1 41  ? 2.820  -6.714  159.851 1.00 50.05  ? 21  ILE A CA    1 
ATOM   151  C C     . ILE A 1 41  ? 2.055  -7.980  160.264 1.00 53.71  ? 21  ILE A C     1 
ATOM   152  O O     . ILE A 1 41  ? 2.473  -9.101  159.964 1.00 58.56  ? 21  ILE A O     1 
ATOM   153  C CB    . ILE A 1 41  ? 3.590  -6.155  161.076 1.00 46.45  ? 21  ILE A CB    1 
ATOM   154  C CG1   . ILE A 1 41  ? 4.572  -5.064  160.654 1.00 40.24  ? 21  ILE A CG1   1 
ATOM   155  C CG2   . ILE A 1 41  ? 4.356  -7.262  161.804 1.00 44.64  ? 21  ILE A CG2   1 
ATOM   156  C CD1   . ILE A 1 41  ? 5.199  -4.341  161.831 1.00 41.75  ? 21  ILE A CD1   1 
ATOM   157  N N     . LYS A 1 42  ? 0.923  -7.793  160.939 1.00 46.27  ? 22  LYS A N     1 
ATOM   158  C CA    . LYS A 1 42  ? 0.148  -8.913  161.465 1.00 48.08  ? 22  LYS A CA    1 
ATOM   159  C C     . LYS A 1 42  ? -0.539 -9.719  160.364 1.00 54.05  ? 22  LYS A C     1 
ATOM   160  O O     . LYS A 1 42  ? -0.990 -10.839 160.597 1.00 56.01  ? 22  LYS A O     1 
ATOM   161  C CB    . LYS A 1 42  ? -0.893 -8.415  162.475 1.00 49.31  ? 22  LYS A CB    1 
ATOM   162  C CG    . LYS A 1 42  ? -0.289 -7.780  163.724 1.00 50.13  ? 22  LYS A CG    1 
ATOM   163  C CD    . LYS A 1 42  ? -1.029 -8.192  164.998 1.00 57.37  ? 22  LYS A CD    1 
ATOM   164  C CE    . LYS A 1 42  ? -2.211 -7.290  165.293 1.00 61.02  ? 22  LYS A CE    1 
ATOM   165  N NZ    . LYS A 1 42  ? -2.858 -7.644  166.588 1.00 63.66  ? 22  LYS A NZ    1 
ATOM   166  N N     . ARG A 1 43  ? -0.620 -9.149  159.167 1.00 53.09  ? 23  ARG A N     1 
ATOM   167  C CA    . ARG A 1 43  ? -1.197 -9.863  158.037 1.00 55.83  ? 23  ARG A CA    1 
ATOM   168  C C     . ARG A 1 43  ? -0.255 -10.954 157.527 1.00 58.54  ? 23  ARG A C     1 
ATOM   169  O O     . ARG A 1 43  ? -0.704 -11.981 157.026 1.00 57.99  ? 23  ARG A O     1 
ATOM   170  C CB    . ARG A 1 43  ? -1.539 -8.894  156.901 1.00 54.23  ? 23  ARG A CB    1 
ATOM   171  N N     . HIS A 1 44  ? 1.050  -10.746 157.668 1.00 54.26  ? 24  HIS A N     1 
ATOM   172  C CA    . HIS A 1 44  ? 2.010  -11.680 157.086 1.00 55.30  ? 24  HIS A CA    1 
ATOM   173  C C     . HIS A 1 44  ? 2.842  -12.485 158.106 1.00 59.13  ? 24  HIS A C     1 
ATOM   174  O O     . HIS A 1 44  ? 3.592  -13.377 157.714 1.00 59.84  ? 24  HIS A O     1 
ATOM   175  C CB    . HIS A 1 44  ? 2.942  -10.923 156.129 1.00 52.96  ? 24  HIS A CB    1 
ATOM   176  C CG    . HIS A 1 44  ? 2.251  -10.395 154.906 1.00 62.20  ? 24  HIS A CG    1 
ATOM   177  N ND1   . HIS A 1 44  ? 2.006  -9.053  154.708 1.00 62.89  ? 24  HIS A ND1   1 
ATOM   178  C CD2   . HIS A 1 44  ? 1.740  -11.033 153.825 1.00 65.10  ? 24  HIS A CD2   1 
ATOM   179  C CE1   . HIS A 1 44  ? 1.381  -8.886  153.554 1.00 62.59  ? 24  HIS A CE1   1 
ATOM   180  N NE2   . HIS A 1 44  ? 1.204  -10.071 153.000 1.00 55.96  ? 24  HIS A NE2   1 
ATOM   181  N N     . LEU A 1 45  ? 2.700  -12.197 159.400 1.00 57.77  ? 25  LEU A N     1 
ATOM   182  C CA    . LEU A 1 45  ? 3.491  -12.891 160.430 1.00 53.73  ? 25  LEU A CA    1 
ATOM   183  C C     . LEU A 1 45  ? 2.908  -14.264 160.802 1.00 52.25  ? 25  LEU A C     1 
ATOM   184  O O     . LEU A 1 45  ? 1.767  -14.350 161.256 1.00 54.21  ? 25  LEU A O     1 
ATOM   185  C CB    . LEU A 1 45  ? 3.606  -12.022 161.689 1.00 48.04  ? 25  LEU A CB    1 
ATOM   186  C CG    . LEU A 1 45  ? 4.592  -12.460 162.780 1.00 48.25  ? 25  LEU A CG    1 
ATOM   187  C CD1   . LEU A 1 45  ? 6.046  -12.285 162.326 1.00 41.10  ? 25  LEU A CD1   1 
ATOM   188  C CD2   . LEU A 1 45  ? 4.340  -11.710 164.085 1.00 44.86  ? 25  LEU A CD2   1 
ATOM   189  N N     . PRO A 1 46  ? 3.698  -15.341 160.614 1.00 51.62  ? 26  PRO A N     1 
ATOM   190  C CA    . PRO A 1 46  ? 3.338  -16.749 160.877 1.00 56.38  ? 26  PRO A CA    1 
ATOM   191  C C     . PRO A 1 46  ? 3.062  -17.078 162.352 1.00 56.66  ? 26  PRO A C     1 
ATOM   192  O O     . PRO A 1 46  ? 3.424  -16.293 163.230 1.00 53.05  ? 26  PRO A O     1 
ATOM   193  C CB    . PRO A 1 46  ? 4.572  -17.524 160.394 1.00 50.59  ? 26  PRO A CB    1 
ATOM   194  C CG    . PRO A 1 46  ? 5.261  -16.605 159.455 1.00 51.13  ? 26  PRO A CG    1 
ATOM   195  C CD    . PRO A 1 46  ? 5.027  -15.229 159.989 1.00 49.50  ? 26  PRO A CD    1 
ATOM   196  N N     . LYS A 1 47  ? 2.449  -18.234 162.610 1.00 57.72  ? 27  LYS A N     1 
ATOM   197  C CA    . LYS A 1 47  ? 2.088  -18.643 163.972 1.00 64.16  ? 27  LYS A CA    1 
ATOM   198  C C     . LYS A 1 47  ? 3.061  -19.664 164.572 1.00 66.29  ? 27  LYS A C     1 
ATOM   199  O O     . LYS A 1 47  ? 3.752  -20.373 163.841 1.00 70.54  ? 27  LYS A O     1 
ATOM   200  C CB    . LYS A 1 47  ? 0.665  -19.220 163.998 1.00 70.33  ? 27  LYS A CB    1 
ATOM   201  C CG    . LYS A 1 47  ? -0.443 -18.175 164.081 1.00 71.54  ? 27  LYS A CG    1 
ATOM   202  C CD    . LYS A 1 47  ? -0.195 -17.204 165.236 1.00 75.49  ? 27  LYS A CD    1 
ATOM   203  C CE    . LYS A 1 47  ? -0.183 -17.918 166.584 1.00 75.55  ? 27  LYS A CE    1 
ATOM   204  N NZ    . LYS A 1 47  ? 0.287  -17.022 167.673 1.00 70.59  ? 27  LYS A NZ    1 
ATOM   205  N N     . GLY A 1 48  ? 3.098  -19.740 165.904 1.00 60.43  ? 28  GLY A N     1 
ATOM   206  C CA    . GLY A 1 48  ? 3.997  -20.641 166.613 1.00 57.56  ? 28  GLY A CA    1 
ATOM   207  C C     . GLY A 1 48  ? 4.027  -20.414 168.120 1.00 58.31  ? 28  GLY A C     1 
ATOM   208  O O     . GLY A 1 48  ? 3.298  -19.561 168.636 1.00 53.78  ? 28  GLY A O     1 
ATOM   209  N N     . GLU A 1 49  ? 4.875  -21.171 168.822 1.00 55.15  ? 29  GLU A N     1 
ATOM   210  C CA    . GLU A 1 49  ? 4.977  -21.104 170.288 1.00 55.84  ? 29  GLU A CA    1 
ATOM   211  C C     . GLU A 1 49  ? 5.748  -19.897 170.843 1.00 54.50  ? 29  GLU A C     1 
ATOM   212  O O     . GLU A 1 49  ? 5.361  -19.352 171.879 1.00 49.90  ? 29  GLU A O     1 
ATOM   213  C CB    . GLU A 1 49  ? 5.642  -22.371 170.841 1.00 59.42  ? 29  GLU A CB    1 
ATOM   214  C CG    . GLU A 1 49  ? 4.765  -23.603 170.949 1.00 69.57  ? 29  GLU A CG    1 
ATOM   215  C CD    . GLU A 1 49  ? 5.441  -24.714 171.748 1.00 84.88  ? 29  GLU A CD    1 
ATOM   216  O OE1   . GLU A 1 49  ? 6.144  -24.398 172.732 1.00 87.22  ? 29  GLU A OE1   1 
ATOM   217  O OE2   . GLU A 1 49  ? 5.281  -25.902 171.391 1.00 89.84  ? 29  GLU A OE2   1 
ATOM   218  N N     . CYS A 1 50  ? 6.843  -19.508 170.182 1.00 47.99  ? 30  CYS A N     1 
ATOM   219  C CA    . CYS A 1 50  ? 7.747  -18.471 170.705 1.00 43.77  ? 30  CYS A CA    1 
ATOM   220  C C     . CYS A 1 50  ? 8.163  -17.437 169.638 1.00 47.83  ? 30  CYS A C     1 
ATOM   221  O O     . CYS A 1 50  ? 8.473  -17.803 168.501 1.00 55.37  ? 30  CYS A O     1 
ATOM   222  C CB    . CYS A 1 50  ? 8.998  -19.131 171.317 1.00 41.86  ? 30  CYS A CB    1 
ATOM   223  S SG    . CYS A 1 50  ? 10.309 -17.998 171.961 1.00 45.65  ? 30  CYS A SG    1 
ATOM   224  N N     . LEU A 1 51  ? 8.161  -16.153 170.012 1.00 41.16  ? 31  LEU A N     1 
ATOM   225  C CA    . LEU A 1 51  ? 8.608  -15.066 169.124 1.00 41.26  ? 31  LEU A CA    1 
ATOM   226  C C     . LEU A 1 51  ? 9.946  -14.447 169.566 1.00 40.41  ? 31  LEU A C     1 
ATOM   227  O O     . LEU A 1 51  ? 10.127 -14.118 170.742 1.00 40.06  ? 31  LEU A O     1 
ATOM   228  C CB    . LEU A 1 51  ? 7.546  -13.962 169.042 1.00 34.05  ? 31  LEU A CB    1 
ATOM   229  C CG    . LEU A 1 51  ? 7.944  -12.741 168.201 1.00 43.15  ? 31  LEU A CG    1 
ATOM   230  C CD1   . LEU A 1 51  ? 8.090  -13.129 166.732 1.00 44.13  ? 31  LEU A CD1   1 
ATOM   231  C CD2   . LEU A 1 51  ? 6.958  -11.580 168.361 1.00 41.95  ? 31  LEU A CD2   1 
ATOM   232  N N     . VAL A 1 52  ? 10.865 -14.273 168.612 1.00 42.69  ? 32  VAL A N     1 
ATOM   233  C CA    . VAL A 1 52  ? 12.191 -13.695 168.873 1.00 38.18  ? 32  VAL A CA    1 
ATOM   234  C C     . VAL A 1 52  ? 12.377 -12.330 168.169 1.00 33.75  ? 32  VAL A C     1 
ATOM   235  O O     . VAL A 1 52  ? 12.166 -12.228 166.955 1.00 35.25  ? 32  VAL A O     1 
ATOM   236  C CB    . VAL A 1 52  ? 13.314 -14.674 168.412 1.00 39.43  ? 32  VAL A CB    1 
ATOM   237  C CG1   . VAL A 1 52  ? 14.691 -14.140 168.769 1.00 33.65  ? 32  VAL A CG1   1 
ATOM   238  C CG2   . VAL A 1 52  ? 13.114 -16.050 169.015 1.00 38.74  ? 32  VAL A CG2   1 
ATOM   239  N N     . GLU A 1 53  ? 12.761 -11.293 168.924 1.00 28.74  ? 33  GLU A N     1 
ATOM   240  C CA    . GLU A 1 53  ? 13.041 -9.948  168.364 1.00 23.80  ? 33  GLU A CA    1 
ATOM   241  C C     . GLU A 1 53  ? 14.491 -9.477  168.650 1.00 33.99  ? 33  GLU A C     1 
ATOM   242  O O     . GLU A 1 53  ? 14.810 -9.042  169.766 1.00 27.84  ? 33  GLU A O     1 
ATOM   243  C CB    . GLU A 1 53  ? 12.051 -8.890  168.917 1.00 35.22  ? 33  GLU A CB    1 
ATOM   244  C CG    . GLU A 1 53  ? 10.573 -9.020  168.482 1.00 32.28  ? 33  GLU A CG    1 
ATOM   245  C CD    . GLU A 1 53  ? 9.698  -7.816  168.896 1.00 40.43  ? 33  GLU A CD    1 
ATOM   246  O OE1   . GLU A 1 53  ? 8.670  -8.015  169.579 1.00 44.04  ? 33  GLU A OE1   1 
ATOM   247  O OE2   . GLU A 1 53  ? 10.019 -6.666  168.524 1.00 35.49  ? 33  GLU A OE2   1 
ATOM   248  N N     . PRO A 1 54  ? 15.376 -9.557  167.642 1.00 31.51  ? 34  PRO A N     1 
ATOM   249  C CA    . PRO A 1 54  ? 16.777 -9.138  167.833 1.00 24.68  ? 34  PRO A CA    1 
ATOM   250  C C     . PRO A 1 54  ? 17.019 -7.610  167.911 1.00 29.67  ? 34  PRO A C     1 
ATOM   251  O O     . PRO A 1 54  ? 18.099 -7.207  168.359 1.00 24.84  ? 34  PRO A O     1 
ATOM   252  C CB    . PRO A 1 54  ? 17.488 -9.733  166.603 1.00 29.87  ? 34  PRO A CB    1 
ATOM   253  C CG    . PRO A 1 54  ? 16.566 -10.851 166.123 1.00 27.58  ? 34  PRO A CG    1 
ATOM   254  C CD    . PRO A 1 54  ? 15.191 -10.336 166.402 1.00 26.60  ? 34  PRO A CD    1 
ATOM   255  N N     . PHE A 1 55  ? 16.057 -6.784  167.492 1.00 20.84  ? 35  PHE A N     1 
ATOM   256  C CA    . PHE A 1 55  ? 16.164 -5.327  167.637 1.00 26.08  ? 35  PHE A CA    1 
ATOM   257  C C     . PHE A 1 55  ? 14.909 -4.761  168.337 1.00 30.62  ? 35  PHE A C     1 
ATOM   258  O O     . PHE A 1 55  ? 14.124 -4.055  167.690 1.00 22.36  ? 35  PHE A O     1 
ATOM   259  C CB    . PHE A 1 55  ? 16.316 -4.614  166.267 1.00 35.31  ? 35  PHE A CB    1 
ATOM   260  C CG    . PHE A 1 55  ? 17.401 -5.174  165.348 1.00 25.75  ? 35  PHE A CG    1 
ATOM   261  C CD1   . PHE A 1 55  ? 17.164 -6.295  164.559 1.00 30.85  ? 35  PHE A CD1   1 
ATOM   262  C CD2   . PHE A 1 55  ? 18.626 -4.527  165.218 1.00 33.66  ? 35  PHE A CD2   1 
ATOM   263  C CE1   . PHE A 1 55  ? 18.145 -6.789  163.684 1.00 31.43  ? 35  PHE A CE1   1 
ATOM   264  C CE2   . PHE A 1 55  ? 19.619 -5.015  164.348 1.00 31.58  ? 35  PHE A CE2   1 
ATOM   265  C CZ    . PHE A 1 55  ? 19.376 -6.147  163.581 1.00 31.17  ? 35  PHE A CZ    1 
ATOM   266  N N     . VAL A 1 56  ? 14.711 -5.036  169.634 1.00 29.11  ? 36  VAL A N     1 
ATOM   267  C CA    . VAL A 1 56  ? 13.383 -4.807  170.234 1.00 27.18  ? 36  VAL A CA    1 
ATOM   268  C C     . VAL A 1 56  ? 12.976 -3.323  170.388 1.00 26.93  ? 36  VAL A C     1 
ATOM   269  O O     . VAL A 1 56  ? 11.819 -2.969  170.125 1.00 23.81  ? 36  VAL A O     1 
ATOM   270  C CB    . VAL A 1 56  ? 13.240 -5.525  171.617 1.00 33.70  ? 36  VAL A CB    1 
ATOM   271  C CG1   . VAL A 1 56  ? 14.210 -4.981  172.659 1.00 26.89  ? 36  VAL A CG1   1 
ATOM   272  C CG2   . VAL A 1 56  ? 11.791 -5.437  172.121 1.00 29.79  ? 36  VAL A CG2   1 
ATOM   273  N N     . GLY A 1 57  ? 13.902 -2.451  170.778 1.00 25.00  ? 37  GLY A N     1 
ATOM   274  C CA    . GLY A 1 57  ? 13.554 -1.039  170.953 1.00 26.71  ? 37  GLY A CA    1 
ATOM   275  C C     . GLY A 1 57  ? 12.442 -0.829  171.984 1.00 28.49  ? 37  GLY A C     1 
ATOM   276  O O     . GLY A 1 57  ? 12.493 -1.421  173.066 1.00 20.98  ? 37  GLY A O     1 
ATOM   277  N N     . ALA A 1 58  ? 11.436 -0.010  171.648 1.00 28.44  ? 38  ALA A N     1 
ATOM   278  C CA    . ALA A 1 58  ? 10.367 0.344   172.592 1.00 25.27  ? 38  ALA A CA    1 
ATOM   279  C C     . ALA A 1 58  ? 9.241  -0.710  172.701 1.00 27.54  ? 38  ALA A C     1 
ATOM   280  O O     . ALA A 1 58  ? 8.343  -0.577  173.540 1.00 30.68  ? 38  ALA A O     1 
ATOM   281  C CB    . ALA A 1 58  ? 9.774  1.694   172.219 1.00 32.82  ? 38  ALA A CB    1 
ATOM   282  N N     . GLY A 1 59  ? 9.268  -1.729  171.843 1.00 30.18  ? 39  GLY A N     1 
ATOM   283  C CA    . GLY A 1 59  ? 8.409  -2.903  172.002 1.00 30.45  ? 39  GLY A CA    1 
ATOM   284  C C     . GLY A 1 59  ? 6.972  -2.902  171.479 1.00 34.10  ? 39  GLY A C     1 
ATOM   285  O O     . GLY A 1 59  ? 6.122  -3.603  172.041 1.00 29.83  ? 39  GLY A O     1 
ATOM   286  N N     . SER A 1 60  ? 6.687  -2.158  170.405 1.00 32.86  ? 40  SER A N     1 
ATOM   287  C CA    . SER A 1 60  ? 5.307  -2.039  169.901 1.00 31.25  ? 40  SER A CA    1 
ATOM   288  C C     . SER A 1 60  ? 4.679  -3.354  169.381 1.00 37.28  ? 40  SER A C     1 
ATOM   289  O O     . SER A 1 60  ? 3.457  -3.533  169.449 1.00 34.26  ? 40  SER A O     1 
ATOM   290  C CB    . SER A 1 60  ? 5.240  -0.987  168.784 1.00 47.43  ? 40  SER A CB    1 
ATOM   291  O OG    . SER A 1 60  ? 5.107  0.325   169.309 1.00 49.95  ? 40  SER A OG    1 
ATOM   292  N N     . VAL A 1 61  ? 5.497  -4.259  168.848 1.00 29.38  ? 41  VAL A N     1 
ATOM   293  C CA    . VAL A 1 61  ? 4.995  -5.542  168.333 1.00 35.61  ? 41  VAL A CA    1 
ATOM   294  C C     . VAL A 1 61  ? 4.724  -6.553  169.470 1.00 36.22  ? 41  VAL A C     1 
ATOM   295  O O     . VAL A 1 61  ? 3.688  -7.226  169.490 1.00 35.99  ? 41  VAL A O     1 
ATOM   296  C CB    . VAL A 1 61  ? 5.986  -6.156  167.310 1.00 40.71  ? 41  VAL A CB    1 
ATOM   297  C CG1   . VAL A 1 61  ? 5.563  -7.562  166.917 1.00 39.53  ? 41  VAL A CG1   1 
ATOM   298  C CG2   . VAL A 1 61  ? 6.100  -5.265  166.070 1.00 43.07  ? 41  VAL A CG2   1 
ATOM   299  N N     . PHE A 1 62  ? 5.664  -6.646  170.404 1.00 30.42  ? 42  PHE A N     1 
ATOM   300  C CA    . PHE A 1 62  ? 5.522  -7.467  171.619 1.00 27.72  ? 42  PHE A CA    1 
ATOM   301  C C     . PHE A 1 62  ? 4.217  -7.126  172.348 1.00 38.64  ? 42  PHE A C     1 
ATOM   302  O O     . PHE A 1 62  ? 3.478  -8.016  172.791 1.00 43.09  ? 42  PHE A O     1 
ATOM   303  C CB    . PHE A 1 62  ? 6.775  -7.251  172.510 1.00 28.79  ? 42  PHE A CB    1 
ATOM   304  C CG    . PHE A 1 62  ? 6.581  -7.533  173.988 1.00 33.03  ? 42  PHE A CG    1 
ATOM   305  C CD1   . PHE A 1 62  ? 6.175  -8.779  174.440 1.00 34.88  ? 42  PHE A CD1   1 
ATOM   306  C CD2   . PHE A 1 62  ? 6.884  -6.552  174.932 1.00 32.87  ? 42  PHE A CD2   1 
ATOM   307  C CE1   . PHE A 1 62  ? 6.023  -9.036  175.808 1.00 38.27  ? 42  PHE A CE1   1 
ATOM   308  C CE2   . PHE A 1 62  ? 6.740  -6.797  176.298 1.00 32.49  ? 42  PHE A CE2   1 
ATOM   309  C CZ    . PHE A 1 62  ? 6.307  -8.044  176.735 1.00 39.00  ? 42  PHE A CZ    1 
ATOM   310  N N     . LEU A 1 63  ? 3.917  -5.832  172.416 1.00 39.01  ? 43  LEU A N     1 
ATOM   311  C CA    . LEU A 1 63  ? 2.755  -5.328  173.141 1.00 40.17  ? 43  LEU A CA    1 
ATOM   312  C C     . LEU A 1 63  ? 1.416  -5.571  172.430 1.00 39.35  ? 43  LEU A C     1 
ATOM   313  O O     . LEU A 1 63  ? 0.357  -5.444  173.055 1.00 40.47  ? 43  LEU A O     1 
ATOM   314  C CB    . LEU A 1 63  ? 2.924  -3.825  173.414 1.00 36.61  ? 43  LEU A CB    1 
ATOM   315  C CG    . LEU A 1 63  ? 3.965  -3.438  174.480 1.00 38.40  ? 43  LEU A CG    1 
ATOM   316  C CD1   . LEU A 1 63  ? 4.291  -1.942  174.425 1.00 38.49  ? 43  LEU A CD1   1 
ATOM   317  C CD2   . LEU A 1 63  ? 3.482  -3.816  175.871 1.00 42.00  ? 43  LEU A CD2   1 
ATOM   318  N N     . ASN A 1 64  ? 1.450  -5.928  171.145 1.00 33.40  ? 44  ASN A N     1 
ATOM   319  C CA    . ASN A 1 64  ? 0.205  -6.074  170.374 1.00 44.57  ? 44  ASN A CA    1 
ATOM   320  C C     . ASN A 1 64  ? 0.045  -7.431  169.658 1.00 44.65  ? 44  ASN A C     1 
ATOM   321  O O     . ASN A 1 64  ? -0.634 -7.532  168.631 1.00 38.92  ? 44  ASN A O     1 
ATOM   322  C CB    . ASN A 1 64  ? 0.085  -4.933  169.348 1.00 44.02  ? 44  ASN A CB    1 
ATOM   323  C CG    . ASN A 1 64  ? -0.203 -3.574  169.996 1.00 43.24  ? 44  ASN A CG    1 
ATOM   324  O OD1   . ASN A 1 64  ? -1.355 -3.208  170.214 1.00 38.29  ? 44  ASN A OD1   1 
ATOM   325  N ND2   . ASN A 1 64  ? 0.851  -2.817  170.286 1.00 35.92  ? 44  ASN A ND2   1 
ATOM   326  N N     . THR A 1 65  ? 0.662  -8.471  170.209 1.00 36.73  ? 45  THR A N     1 
ATOM   327  C CA    . THR A 1 65  ? 0.525  -9.829  169.687 1.00 39.01  ? 45  THR A CA    1 
ATOM   328  C C     . THR A 1 65  ? 0.133  -10.789 170.812 1.00 48.79  ? 45  THR A C     1 
ATOM   329  O O     . THR A 1 65  ? -0.059 -10.357 171.952 1.00 43.94  ? 45  THR A O     1 
ATOM   330  C CB    . THR A 1 65  ? 1.824  -10.321 169.022 1.00 39.31  ? 45  THR A CB    1 
ATOM   331  O OG1   . THR A 1 65  ? 2.941  -10.072 169.892 1.00 34.17  ? 45  THR A OG1   1 
ATOM   332  C CG2   . THR A 1 65  ? 2.050  -9.596  167.693 1.00 38.97  ? 45  THR A CG2   1 
ATOM   333  N N     . ASP A 1 66  ? 0.024  -12.082 170.500 1.00 50.79  ? 46  ASP A N     1 
ATOM   334  C CA    . ASP A 1 66  ? -0.404 -13.076 171.490 1.00 54.31  ? 46  ASP A CA    1 
ATOM   335  C C     . ASP A 1 66  ? 0.319  -14.436 171.383 1.00 57.76  ? 46  ASP A C     1 
ATOM   336  O O     . ASP A 1 66  ? -0.303 -15.452 171.091 1.00 60.73  ? 46  ASP A O     1 
ATOM   337  C CB    . ASP A 1 66  ? -1.922 -13.283 171.387 1.00 68.44  ? 46  ASP A CB    1 
ATOM   338  C CG    . ASP A 1 66  ? -2.485 -14.106 172.538 1.00 83.00  ? 46  ASP A CG    1 
ATOM   339  O OD1   . ASP A 1 66  ? -2.516 -13.602 173.682 1.00 84.87  ? 46  ASP A OD1   1 
ATOM   340  O OD2   . ASP A 1 66  ? -2.907 -15.256 172.297 1.00 93.99  ? 46  ASP A OD2   1 
ATOM   341  N N     . PHE A 1 67  ? 1.630  -14.448 171.633 1.00 55.97  ? 47  PHE A N     1 
ATOM   342  C CA    . PHE A 1 67  ? 2.410  -15.691 171.715 1.00 56.56  ? 47  PHE A CA    1 
ATOM   343  C C     . PHE A 1 67  ? 2.488  -16.171 173.170 1.00 54.37  ? 47  PHE A C     1 
ATOM   344  O O     . PHE A 1 67  ? 2.252  -15.385 174.089 1.00 50.42  ? 47  PHE A O     1 
ATOM   345  C CB    . PHE A 1 67  ? 3.830  -15.486 171.165 1.00 56.13  ? 47  PHE A CB    1 
ATOM   346  C CG    . PHE A 1 67  ? 3.900  -15.318 169.668 1.00 57.69  ? 47  PHE A CG    1 
ATOM   347  C CD1   . PHE A 1 67  ? 4.326  -16.365 168.860 1.00 59.66  ? 47  PHE A CD1   1 
ATOM   348  C CD2   . PHE A 1 67  ? 3.557  -14.110 169.068 1.00 54.97  ? 47  PHE A CD2   1 
ATOM   349  C CE1   . PHE A 1 67  ? 4.401  -16.218 167.479 1.00 61.49  ? 47  PHE A CE1   1 
ATOM   350  C CE2   . PHE A 1 67  ? 3.631  -13.953 167.686 1.00 57.10  ? 47  PHE A CE2   1 
ATOM   351  C CZ    . PHE A 1 67  ? 4.053  -15.008 166.890 1.00 58.26  ? 47  PHE A CZ    1 
ATOM   352  N N     . SER A 1 68  ? 2.851  -17.435 173.393 1.00 55.09  ? 48  SER A N     1 
ATOM   353  C CA    . SER A 1 68  ? 2.924  -17.955 174.766 1.00 55.79  ? 48  SER A CA    1 
ATOM   354  C C     . SER A 1 68  ? 4.308  -17.783 175.421 1.00 52.97  ? 48  SER A C     1 
ATOM   355  O O     . SER A 1 68  ? 4.454  -18.022 176.619 1.00 50.13  ? 48  SER A O     1 
ATOM   356  C CB    . SER A 1 68  ? 2.512  -19.434 174.808 1.00 58.10  ? 48  SER A CB    1 
ATOM   357  O OG    . SER A 1 68  ? 3.406  -20.257 174.080 1.00 60.36  ? 48  SER A OG    1 
ATOM   358  N N     . ARG A 1 69  ? 5.303  -17.358 174.640 1.00 49.35  ? 49  ARG A N     1 
ATOM   359  C CA    . ARG A 1 69  ? 6.668  -17.107 175.134 1.00 42.66  ? 49  ARG A CA    1 
ATOM   360  C C     . ARG A 1 69  ? 7.389  -16.072 174.269 1.00 44.70  ? 49  ARG A C     1 
ATOM   361  O O     . ARG A 1 69  ? 7.131  -15.996 173.071 1.00 48.63  ? 49  ARG A O     1 
ATOM   362  C CB    . ARG A 1 69  ? 7.484  -18.401 175.150 1.00 49.83  ? 49  ARG A CB    1 
ATOM   363  C CG    . ARG A 1 69  ? 7.588  -19.090 176.492 1.00 53.76  ? 49  ARG A CG    1 
ATOM   364  C CD    . ARG A 1 69  ? 8.033  -20.538 176.300 1.00 66.68  ? 49  ARG A CD    1 
ATOM   365  N NE    . ARG A 1 69  ? 9.190  -20.643 175.410 1.00 73.72  ? 49  ARG A NE    1 
ATOM   366  C CZ    . ARG A 1 69  ? 9.346  -21.592 174.489 1.00 76.36  ? 49  ARG A CZ    1 
ATOM   367  N NH1   . ARG A 1 69  ? 8.417  -22.528 174.328 1.00 75.63  ? 49  ARG A NH1   1 
ATOM   368  N NH2   . ARG A 1 69  ? 10.434 -21.605 173.725 1.00 74.19  ? 49  ARG A NH2   1 
ATOM   369  N N     . TYR A 1 70  ? 8.298  -15.295 174.867 1.00 35.69  ? 50  TYR A N     1 
ATOM   370  C CA    . TYR A 1 70  ? 9.080  -14.293 174.127 1.00 36.25  ? 50  TYR A CA    1 
ATOM   371  C C     . TYR A 1 70  ? 10.573 -14.290 174.519 1.00 40.47  ? 50  TYR A C     1 
ATOM   372  O O     . TYR A 1 70  ? 10.919 -14.498 175.688 1.00 32.79  ? 50  TYR A O     1 
ATOM   373  C CB    . TYR A 1 70  ? 8.505  -12.880 174.347 1.00 33.82  ? 50  TYR A CB    1 
ATOM   374  C CG    . TYR A 1 70  ? 7.115  -12.626 173.781 1.00 37.04  ? 50  TYR A CG    1 
ATOM   375  C CD1   . TYR A 1 70  ? 6.941  -12.157 172.478 1.00 39.67  ? 50  TYR A CD1   1 
ATOM   376  C CD2   . TYR A 1 70  ? 5.979  -12.837 174.555 1.00 39.72  ? 50  TYR A CD2   1 
ATOM   377  C CE1   . TYR A 1 70  ? 5.670  -11.919 171.961 1.00 37.69  ? 50  TYR A CE1   1 
ATOM   378  C CE2   . TYR A 1 70  ? 4.703  -12.603 174.048 1.00 37.98  ? 50  TYR A CE2   1 
ATOM   379  C CZ    . TYR A 1 70  ? 4.554  -12.145 172.754 1.00 47.02  ? 50  TYR A CZ    1 
ATOM   380  O OH    . TYR A 1 70  ? 3.285  -11.915 172.259 1.00 53.03  ? 50  TYR A OH    1 
ATOM   381  N N     . ILE A 1 71  ? 11.442 -14.043 173.536 1.00 38.57  ? 51  ILE A N     1 
ATOM   382  C CA    . ILE A 1 71  ? 12.860 -13.740 173.780 1.00 34.72  ? 51  ILE A CA    1 
ATOM   383  C C     . ILE A 1 71  ? 13.202 -12.375 173.155 1.00 34.56  ? 51  ILE A C     1 
ATOM   384  O O     . ILE A 1 71  ? 13.110 -12.225 171.936 1.00 36.05  ? 51  ILE A O     1 
ATOM   385  C CB    . ILE A 1 71  ? 13.799 -14.834 173.193 1.00 34.05  ? 51  ILE A CB    1 
ATOM   386  C CG1   . ILE A 1 71  ? 13.479 -16.204 173.793 1.00 37.26  ? 51  ILE A CG1   1 
ATOM   387  C CG2   . ILE A 1 71  ? 15.253 -14.469 173.430 1.00 36.96  ? 51  ILE A CG2   1 
ATOM   388  C CD1   . ILE A 1 71  ? 14.346 -17.344 173.257 1.00 39.43  ? 51  ILE A CD1   1 
ATOM   389  N N     . LEU A 1 72  ? 13.587 -11.391 173.979 1.00 28.34  ? 52  LEU A N     1 
ATOM   390  C CA    . LEU A 1 72  ? 13.759 -9.991  173.532 1.00 22.88  ? 52  LEU A CA    1 
ATOM   391  C C     . LEU A 1 72  ? 15.174 -9.406  173.793 1.00 32.84  ? 52  LEU A C     1 
ATOM   392  O O     . LEU A 1 72  ? 15.678 -9.492  174.919 1.00 27.12  ? 52  LEU A O     1 
ATOM   393  C CB    . LEU A 1 72  ? 12.703 -9.113  174.215 1.00 25.82  ? 52  LEU A CB    1 
ATOM   394  C CG    . LEU A 1 72  ? 11.238 -9.596  174.119 1.00 33.44  ? 52  LEU A CG    1 
ATOM   395  C CD1   . LEU A 1 72  ? 10.297 -8.829  175.046 1.00 32.71  ? 52  LEU A CD1   1 
ATOM   396  C CD2   . LEU A 1 72  ? 10.727 -9.524  172.686 1.00 27.97  ? 52  LEU A CD2   1 
ATOM   397  N N     . ALA A 1 73  ? 15.800 -8.799  172.772 1.00 22.28  ? 53  ALA A N     1 
ATOM   398  C CA    . ALA A 1 73  ? 17.219 -8.353  172.854 1.00 20.31  ? 53  ALA A CA    1 
ATOM   399  C C     . ALA A 1 73  ? 17.553 -7.012  172.122 1.00 33.70  ? 53  ALA A C     1 
ATOM   400  O O     . ALA A 1 73  ? 16.839 -6.622  171.189 1.00 36.47  ? 53  ALA A O     1 
ATOM   401  C CB    . ALA A 1 73  ? 18.133 -9.474  172.319 1.00 21.53  ? 53  ALA A CB    1 
ATOM   402  N N     . ASP A 1 74  ? 18.643 -6.336  172.538 1.00 30.08  ? 54  ASP A N     1 
ATOM   403  C CA    . ASP A 1 74  ? 19.086 -5.017  171.984 1.00 28.44  ? 54  ASP A CA    1 
ATOM   404  C C     . ASP A 1 74  ? 20.554 -4.726  172.390 1.00 41.89  ? 54  ASP A C     1 
ATOM   405  O O     . ASP A 1 74  ? 21.044 -5.268  173.394 1.00 28.05  ? 54  ASP A O     1 
ATOM   406  C CB    . ASP A 1 74  ? 18.155 -3.875  172.468 1.00 17.99  ? 54  ASP A CB    1 
ATOM   407  C CG    . ASP A 1 74  ? 18.151 -2.644  171.539 1.00 27.96  ? 54  ASP A CG    1 
ATOM   408  O OD1   . ASP A 1 74  ? 19.126 -1.853  171.561 1.00 21.94  ? 54  ASP A OD1   1 
ATOM   409  O OD2   . ASP A 1 74  ? 17.147 -2.435  170.808 1.00 25.03  ? 54  ASP A OD2   1 
ATOM   410  N N     . ILE A 1 75  ? 21.258 -3.874  171.636 1.00 31.95  ? 55  ILE A N     1 
ATOM   411  C CA    . ILE A 1 75  ? 22.660 -3.539  171.979 1.00 22.73  ? 55  ILE A CA    1 
ATOM   412  C C     . ILE A 1 75  ? 22.786 -2.457  173.097 1.00 23.51  ? 55  ILE A C     1 
ATOM   413  O O     . ILE A 1 75  ? 23.844 -2.321  173.712 1.00 24.97  ? 55  ILE A O     1 
ATOM   414  C CB    . ILE A 1 75  ? 23.463 -3.081  170.708 1.00 35.12  ? 55  ILE A CB    1 
ATOM   415  C CG1   . ILE A 1 75  ? 24.978 -3.207  170.916 1.00 41.72  ? 55  ILE A CG1   1 
ATOM   416  C CG2   . ILE A 1 75  ? 23.135 -1.647  170.314 1.00 29.30  ? 55  ILE A CG2   1 
ATOM   417  C CD1   . ILE A 1 75  ? 25.515 -4.608  170.766 1.00 38.99  ? 55  ILE A CD1   1 
ATOM   418  N N     . ASN A 1 76  ? 21.705 -1.720  173.372 1.00 19.17  ? 56  ASN A N     1 
ATOM   419  C CA    . ASN A 1 76  ? 21.683 -0.630  174.374 1.00 23.01  ? 56  ASN A CA    1 
ATOM   420  C C     . ASN A 1 76  ? 21.505 -1.142  175.825 1.00 32.79  ? 56  ASN A C     1 
ATOM   421  O O     . ASN A 1 76  ? 20.432 -1.629  176.192 1.00 27.13  ? 56  ASN A O     1 
ATOM   422  C CB    . ASN A 1 76  ? 20.559 0.359   174.003 1.00 20.61  ? 56  ASN A CB    1 
ATOM   423  C CG    . ASN A 1 76  ? 20.514 1.627   174.899 1.00 36.99  ? 56  ASN A CG    1 
ATOM   424  O OD1   . ASN A 1 76  ? 20.667 1.571   176.119 1.00 22.78  ? 56  ASN A OD1   1 
ATOM   425  N ND2   . ASN A 1 76  ? 20.261 2.775   174.270 1.00 29.79  ? 56  ASN A ND2   1 
ATOM   426  N N     . SER A 1 77  ? 22.543 -1.015  176.653 1.00 21.29  ? 57  SER A N     1 
ATOM   427  C CA    . SER A 1 77  ? 22.526 -1.627  177.992 1.00 23.28  ? 57  SER A CA    1 
ATOM   428  C C     . SER A 1 77  ? 21.721 -0.826  179.038 1.00 29.89  ? 57  SER A C     1 
ATOM   429  O O     . SER A 1 77  ? 21.232 -1.404  180.014 1.00 25.01  ? 57  SER A O     1 
ATOM   430  C CB    . SER A 1 77  ? 23.960 -1.849  178.499 1.00 34.75  ? 57  SER A CB    1 
ATOM   431  O OG    . SER A 1 77  ? 24.656 -0.621  178.650 1.00 36.05  ? 57  SER A OG    1 
ATOM   432  N N     . ASP A 1 78  ? 21.565 0.484   178.848 1.00 22.49  ? 58  ASP A N     1 
ATOM   433  C CA    . ASP A 1 78  ? 20.701 1.252   179.760 1.00 29.90  ? 58  ASP A CA    1 
ATOM   434  C C     . ASP A 1 78  ? 19.225 0.835   179.599 1.00 32.14  ? 58  ASP A C     1 
ATOM   435  O O     . ASP A 1 78  ? 18.468 0.812   180.576 1.00 25.03  ? 58  ASP A O     1 
ATOM   436  C CB    . ASP A 1 78  ? 20.863 2.770   179.539 1.00 35.56  ? 58  ASP A CB    1 
ATOM   437  C CG    . ASP A 1 78  ? 22.237 3.307   180.006 1.00 35.83  ? 58  ASP A CG    1 
ATOM   438  O OD1   . ASP A 1 78  ? 22.778 4.224   179.342 1.00 30.23  ? 58  ASP A OD1   1 
ATOM   439  O OD2   . ASP A 1 78  ? 22.766 2.829   181.038 1.00 27.98  ? 58  ASP A OD2   1 
ATOM   440  N N     . LEU A 1 79  ? 18.828 0.490   178.372 1.00 21.49  ? 59  LEU A N     1 
ATOM   441  C CA    . LEU A 1 79  ? 17.436 0.089   178.075 1.00 18.67  ? 59  LEU A CA    1 
ATOM   442  C C     . LEU A 1 79  ? 17.075 -1.280  178.674 1.00 26.46  ? 59  LEU A C     1 
ATOM   443  O O     . LEU A 1 79  ? 16.011 -1.436  179.281 1.00 24.37  ? 59  LEU A O     1 
ATOM   444  C CB    . LEU A 1 79  ? 17.197 0.066   176.563 1.00 22.63  ? 59  LEU A CB    1 
ATOM   445  C CG    . LEU A 1 79  ? 15.884 -0.501  175.993 1.00 31.91  ? 59  LEU A CG    1 
ATOM   446  C CD1   . LEU A 1 79  ? 14.724 0.450   176.223 1.00 31.81  ? 59  LEU A CD1   1 
ATOM   447  C CD2   . LEU A 1 79  ? 16.027 -0.788  174.500 1.00 32.13  ? 59  LEU A CD2   1 
ATOM   448  N N     . ILE A 1 80  ? 17.954 -2.267  178.494 1.00 23.13  ? 60  ILE A N     1 
ATOM   449  C CA    . ILE A 1 80  ? 17.729 -3.623  179.039 1.00 21.96  ? 60  ILE A CA    1 
ATOM   450  C C     . ILE A 1 80  ? 17.686 -3.647  180.595 1.00 26.49  ? 60  ILE A C     1 
ATOM   451  O O     . ILE A 1 80  ? 16.895 -4.387  181.191 1.00 27.61  ? 60  ILE A O     1 
ATOM   452  C CB    . ILE A 1 80  ? 18.820 -4.615  178.533 1.00 25.43  ? 60  ILE A CB    1 
ATOM   453  C CG1   . ILE A 1 80  ? 18.789 -4.749  177.000 1.00 26.00  ? 60  ILE A CG1   1 
ATOM   454  C CG2   . ILE A 1 80  ? 18.680 -6.003  179.194 1.00 27.78  ? 60  ILE A CG2   1 
ATOM   455  C CD1   . ILE A 1 80  ? 17.527 -5.382  176.444 1.00 28.02  ? 60  ILE A CD1   1 
ATOM   456  N N     . SER A 1 81  ? 18.528 -2.846  181.250 1.00 26.80  ? 61  SER A N     1 
ATOM   457  C CA    . SER A 1 81  ? 18.530 -2.759  182.724 1.00 25.05  ? 61  SER A CA    1 
ATOM   458  C C     . SER A 1 81  ? 17.220 -2.151  183.266 1.00 33.29  ? 61  SER A C     1 
ATOM   459  O O     . SER A 1 81  ? 16.692 -2.616  184.291 1.00 30.69  ? 61  SER A O     1 
ATOM   460  C CB    . SER A 1 81  ? 19.741 -1.944  183.221 1.00 29.49  ? 61  SER A CB    1 
ATOM   461  O OG    . SER A 1 81  ? 19.678 -1.687  184.622 1.00 26.37  ? 61  SER A OG    1 
ATOM   462  N N     . LEU A 1 82  ? 16.703 -1.121  182.584 1.00 26.87  ? 62  LEU A N     1 
ATOM   463  C CA    . LEU A 1 82  ? 15.414 -0.502  182.943 1.00 27.17  ? 62  LEU A CA    1 
ATOM   464  C C     . LEU A 1 82  ? 14.236 -1.499  182.840 1.00 31.65  ? 62  LEU A C     1 
ATOM   465  O O     . LEU A 1 82  ? 13.349 -1.504  183.696 1.00 31.40  ? 62  LEU A O     1 
ATOM   466  C CB    . LEU A 1 82  ? 15.139 0.728   182.057 1.00 22.49  ? 62  LEU A CB    1 
ATOM   467  C CG    . LEU A 1 82  ? 13.691 1.249   181.974 1.00 24.20  ? 62  LEU A CG    1 
ATOM   468  C CD1   . LEU A 1 82  ? 13.306 2.047   183.214 1.00 21.39  ? 62  LEU A CD1   1 
ATOM   469  C CD2   . LEU A 1 82  ? 13.456 2.070   180.711 1.00 33.34  ? 62  LEU A CD2   1 
ATOM   470  N N     . TYR A 1 83  ? 14.233 -2.346  181.808 1.00 25.34  ? 63  TYR A N     1 
ATOM   471  C CA    . TYR A 1 83  ? 13.163 -3.343  181.637 1.00 23.46  ? 63  TYR A CA    1 
ATOM   472  C C     . TYR A 1 83  ? 13.163 -4.417  182.777 1.00 27.35  ? 63  TYR A C     1 
ATOM   473  O O     . TYR A 1 83  ? 12.104 -4.901  183.196 1.00 28.61  ? 63  TYR A O     1 
ATOM   474  C CB    . TYR A 1 83  ? 13.284 -4.017  180.250 1.00 23.15  ? 63  TYR A CB    1 
ATOM   475  C CG    . TYR A 1 83  ? 12.792 -3.201  179.030 1.00 25.52  ? 63  TYR A CG    1 
ATOM   476  C CD1   . TYR A 1 83  ? 12.005 -2.060  179.184 1.00 24.62  ? 63  TYR A CD1   1 
ATOM   477  C CD2   . TYR A 1 83  ? 13.095 -3.607  177.716 1.00 24.86  ? 63  TYR A CD2   1 
ATOM   478  C CE1   . TYR A 1 83  ? 11.532 -1.323  178.057 1.00 26.03  ? 63  TYR A CE1   1 
ATOM   479  C CE2   . TYR A 1 83  ? 12.628 -2.874  176.578 1.00 20.62  ? 63  TYR A CE2   1 
ATOM   480  C CZ    . TYR A 1 83  ? 11.845 -1.737  176.769 1.00 34.53  ? 63  TYR A CZ    1 
ATOM   481  O OH    . TYR A 1 83  ? 11.378 -1.010  175.681 1.00 31.82  ? 63  TYR A OH    1 
ATOM   482  N N     . ASN A 1 84  ? 14.340 -4.792  183.272 1.00 27.88  ? 64  ASN A N     1 
ATOM   483  C CA    . ASN A 1 84  ? 14.443 -5.723  184.415 1.00 29.95  ? 64  ASN A CA    1 
ATOM   484  C C     . ASN A 1 84  ? 13.901 -5.146  185.750 1.00 34.99  ? 64  ASN A C     1 
ATOM   485  O O     . ASN A 1 84  ? 13.216 -5.845  186.505 1.00 33.23  ? 64  ASN A O     1 
ATOM   486  C CB    . ASN A 1 84  ? 15.906 -6.169  184.602 1.00 38.41  ? 64  ASN A CB    1 
ATOM   487  C CG    . ASN A 1 84  ? 16.313 -7.305  183.657 1.00 46.02  ? 64  ASN A CG    1 
ATOM   488  O OD1   . ASN A 1 84  ? 15.567 -8.271  183.462 1.00 54.45  ? 64  ASN A OD1   1 
ATOM   489  N ND2   . ASN A 1 84  ? 17.509 -7.193  183.075 1.00 34.75  ? 64  ASN A ND2   1 
ATOM   490  N N     . ILE A 1 85  ? 14.226 -3.884  186.039 1.00 27.43  ? 65  ILE A N     1 
ATOM   491  C CA    . ILE A 1 85  ? 13.703 -3.182  187.224 1.00 26.58  ? 65  ILE A CA    1 
ATOM   492  C C     . ILE A 1 85  ? 12.166 -3.046  187.207 1.00 33.20  ? 65  ILE A C     1 
ATOM   493  O O     . ILE A 1 85  ? 11.500 -3.308  188.214 1.00 29.84  ? 65  ILE A O     1 
ATOM   494  C CB    . ILE A 1 85  ? 14.327 -1.761  187.355 1.00 40.09  ? 65  ILE A CB    1 
ATOM   495  C CG1   . ILE A 1 85  ? 15.856 -1.835  187.461 1.00 44.09  ? 65  ILE A CG1   1 
ATOM   496  C CG2   . ILE A 1 85  ? 13.725 -0.989  188.540 1.00 37.29  ? 65  ILE A CG2   1 
ATOM   497  C CD1   . ILE A 1 85  ? 16.362 -2.446  188.744 1.00 48.72  ? 65  ILE A CD1   1 
ATOM   498  N N     . VAL A 1 86  ? 11.606 -2.627  186.068 1.00 30.23  ? 66  VAL A N     1 
ATOM   499  C CA    . VAL A 1 86  ? 10.157 -2.455  185.950 1.00 28.15  ? 66  VAL A CA    1 
ATOM   500  C C     . VAL A 1 86  ? 9.396  -3.775  186.153 1.00 29.80  ? 66  VAL A C     1 
ATOM   501  O O     . VAL A 1 86  ? 8.297  -3.793  186.724 1.00 36.07  ? 66  VAL A O     1 
ATOM   502  C CB    . VAL A 1 86  ? 9.762  -1.852  184.569 1.00 29.26  ? 66  VAL A CB    1 
ATOM   503  C CG1   . VAL A 1 86  ? 8.262  -1.951  184.341 1.00 25.34  ? 66  VAL A CG1   1 
ATOM   504  C CG2   . VAL A 1 86  ? 10.221 -0.392  184.459 1.00 33.29  ? 66  VAL A CG2   1 
ATOM   505  N N     . LYS A 1 87  ? 9.979  -4.879  185.694 1.00 27.89  ? 67  LYS A N     1 
ATOM   506  C CA    . LYS A 1 87  ? 9.329  -6.189  185.832 1.00 34.43  ? 67  LYS A CA    1 
ATOM   507  C C     . LYS A 1 87  ? 9.318  -6.718  187.267 1.00 33.92  ? 67  LYS A C     1 
ATOM   508  O O     . LYS A 1 87  ? 8.302  -7.252  187.723 1.00 34.67  ? 67  LYS A O     1 
ATOM   509  C CB    . LYS A 1 87  ? 10.003 -7.234  184.926 1.00 37.53  ? 67  LYS A CB    1 
ATOM   510  C CG    . LYS A 1 87  ? 9.464  -8.667  185.112 1.00 47.16  ? 67  LYS A CG    1 
ATOM   511  C CD    . LYS A 1 87  ? 10.166 -9.698  184.217 1.00 45.96  ? 67  LYS A CD    1 
ATOM   512  C CE    . LYS A 1 87  ? 9.704  -11.118 184.553 1.00 47.32  ? 67  LYS A CE    1 
ATOM   513  N NZ    . LYS A 1 87  ? 10.223 -12.168 183.624 1.00 34.84  ? 67  LYS A NZ    1 
ATOM   514  N N     . MET A 1 88  ? 10.435 -6.572  187.982 1.00 33.10  ? 68  MET A N     1 
ATOM   515  C CA    A MET A 1 88  ? 10.615 -7.216  189.292 0.50 37.84  ? 68  MET A CA    1 
ATOM   516  C CA    B MET A 1 88  ? 10.590 -7.228  189.290 0.50 38.09  ? 68  MET A CA    1 
ATOM   517  C C     . MET A 1 88  ? 10.294 -6.338  190.514 1.00 38.73  ? 68  MET A C     1 
ATOM   518  O O     . MET A 1 88  ? 10.084 -6.856  191.610 1.00 34.37  ? 68  MET A O     1 
ATOM   519  C CB    A MET A 1 88  ? 12.060 -7.726  189.426 0.50 35.26  ? 68  MET A CB    1 
ATOM   520  C CB    B MET A 1 88  ? 12.012 -7.797  189.430 0.50 36.20  ? 68  MET A CB    1 
ATOM   521  C CG    A MET A 1 88  ? 12.500 -8.672  188.316 0.50 37.32  ? 68  MET A CG    1 
ATOM   522  C CG    B MET A 1 88  ? 12.416 -8.835  188.374 0.50 37.66  ? 68  MET A CG    1 
ATOM   523  S SD    A MET A 1 88  ? 14.188 -9.281  188.511 0.50 61.72  ? 68  MET A SD    1 
ATOM   524  S SD    B MET A 1 88  ? 11.799 -10.517 188.640 0.50 40.99  ? 68  MET A SD    1 
ATOM   525  C CE    A MET A 1 88  ? 15.146 -7.772  188.343 0.50 26.96  ? 68  MET A CE    1 
ATOM   526  C CE    B MET A 1 88  ? 12.892 -11.455 187.565 0.50 31.26  ? 68  MET A CE    1 
ATOM   527  N N     . ARG A 1 89  ? 10.286 -5.012  190.347 1.00 35.87  ? 69  ARG A N     1 
ATOM   528  C CA    . ARG A 1 89  ? 10.058 -4.098  191.483 1.00 32.07  ? 69  ARG A CA    1 
ATOM   529  C C     . ARG A 1 89  ? 8.998  -3.023  191.177 1.00 35.38  ? 69  ARG A C     1 
ATOM   530  O O     . ARG A 1 89  ? 9.235  -1.829  191.388 1.00 29.95  ? 69  ARG A O     1 
ATOM   531  C CB    . ARG A 1 89  ? 11.385 -3.426  191.905 1.00 31.27  ? 69  ARG A CB    1 
ATOM   532  C CG    . ARG A 1 89  ? 12.402 -4.349  192.618 1.00 36.99  ? 69  ARG A CG    1 
ATOM   533  C CD    . ARG A 1 89  ? 13.861 -3.802  192.595 1.00 42.37  ? 69  ARG A CD    1 
ATOM   534  N NE    . ARG A 1 89  ? 14.124 -2.752  193.585 1.00 39.11  ? 69  ARG A NE    1 
ATOM   535  C CZ    . ARG A 1 89  ? 15.321 -2.209  193.821 1.00 40.96  ? 69  ARG A CZ    1 
ATOM   536  N NH1   . ARG A 1 89  ? 16.392 -2.603  193.141 1.00 38.59  ? 69  ARG A NH1   1 
ATOM   537  N NH2   . ARG A 1 89  ? 15.455 -1.260  194.744 1.00 36.01  ? 69  ARG A NH2   1 
ATOM   538  N N     . THR A 1 90  ? 7.822  -3.453  190.717 1.00 38.94  ? 70  THR A N     1 
ATOM   539  C CA    . THR A 1 90  ? 6.857  -2.553  190.058 1.00 44.80  ? 70  THR A CA    1 
ATOM   540  C C     . THR A 1 90  ? 6.293  -1.410  190.928 1.00 42.34  ? 70  THR A C     1 
ATOM   541  O O     . THR A 1 90  ? 6.369  -0.240  190.542 1.00 38.17  ? 70  THR A O     1 
ATOM   542  C CB    . THR A 1 90  ? 5.658  -3.354  189.482 1.00 38.86  ? 70  THR A CB    1 
ATOM   543  O OG1   . THR A 1 90  ? 6.136  -4.499  188.765 1.00 39.90  ? 70  THR A OG1   1 
ATOM   544  C CG2   . THR A 1 90  ? 4.841  -2.488  188.527 1.00 35.25  ? 70  THR A CG2   1 
ATOM   545  N N     . ASP A 1 91  ? 5.718  -1.741  192.080 1.00 39.39  ? 71  ASP A N     1 
ATOM   546  C CA    . ASP A 1 91  ? 5.103  -0.729  192.944 1.00 44.37  ? 71  ASP A CA    1 
ATOM   547  C C     . ASP A 1 91  ? 6.101  0.304   193.476 1.00 44.67  ? 71  ASP A C     1 
ATOM   548  O O     . ASP A 1 91  ? 5.810  1.500   193.516 1.00 43.64  ? 71  ASP A O     1 
ATOM   549  C CB    . ASP A 1 91  ? 4.391  -1.400  194.117 1.00 51.47  ? 71  ASP A CB    1 
ATOM   550  C CG    . ASP A 1 91  ? 3.030  -1.943  193.733 1.00 62.74  ? 71  ASP A CG    1 
ATOM   551  O OD1   . ASP A 1 91  ? 2.379  -1.341  192.852 1.00 65.24  ? 71  ASP A OD1   1 
ATOM   552  O OD2   . ASP A 1 91  ? 2.614  -2.970  194.306 1.00 68.19  ? 71  ASP A OD2   1 
ATOM   553  N N     . GLU A 1 92  ? 7.266  -0.174  193.899 1.00 40.32  ? 72  GLU A N     1 
ATOM   554  C CA    . GLU A 1 92  ? 8.354  0.695   194.331 1.00 44.41  ? 72  GLU A CA    1 
ATOM   555  C C     . GLU A 1 92  ? 8.821  1.655   193.210 1.00 42.04  ? 72  GLU A C     1 
ATOM   556  O O     . GLU A 1 92  ? 9.054  2.840   193.458 1.00 36.45  ? 72  GLU A O     1 
ATOM   557  C CB    . GLU A 1 92  ? 9.525  -0.159  194.831 1.00 39.42  ? 72  GLU A CB    1 
ATOM   558  C CG    . GLU A 1 92  ? 10.722 0.639   195.317 1.00 41.81  ? 72  GLU A CG    1 
ATOM   559  C CD    . GLU A 1 92  ? 11.935 -0.234  195.616 1.00 48.28  ? 72  GLU A CD    1 
ATOM   560  O OE1   . GLU A 1 92  ? 11.944 -1.420  195.216 1.00 45.19  ? 72  GLU A OE1   1 
ATOM   561  O OE2   . GLU A 1 92  ? 12.885 0.271   196.249 1.00 46.38  ? 72  GLU A OE2   1 
ATOM   562  N N     . TYR A 1 93  ? 8.946  1.157   191.982 1.00 37.48  ? 73  TYR A N     1 
ATOM   563  C CA    . TYR A 1 93  ? 9.378  2.015   190.870 1.00 32.65  ? 73  TYR A CA    1 
ATOM   564  C C     . TYR A 1 93  ? 8.379  3.145   190.537 1.00 36.91  ? 73  TYR A C     1 
ATOM   565  O O     . TYR A 1 93  ? 8.786  4.296   190.331 1.00 37.16  ? 73  TYR A O     1 
ATOM   566  C CB    . TYR A 1 93  ? 9.650  1.182   189.608 1.00 29.43  ? 73  TYR A CB    1 
ATOM   567  C CG    . TYR A 1 93  ? 10.157 2.025   188.445 1.00 29.73  ? 73  TYR A CG    1 
ATOM   568  C CD1   . TYR A 1 93  ? 11.487 2.427   188.379 1.00 29.76  ? 73  TYR A CD1   1 
ATOM   569  C CD2   . TYR A 1 93  ? 9.299  2.436   187.426 1.00 31.65  ? 73  TYR A CD2   1 
ATOM   570  C CE1   . TYR A 1 93  ? 11.959 3.213   187.326 1.00 29.28  ? 73  TYR A CE1   1 
ATOM   571  C CE2   . TYR A 1 93  ? 9.757  3.229   186.365 1.00 32.56  ? 73  TYR A CE2   1 
ATOM   572  C CZ    . TYR A 1 93  ? 11.088 3.612   186.324 1.00 34.56  ? 73  TYR A CZ    1 
ATOM   573  O OH    . TYR A 1 93  ? 11.557 4.393   185.281 1.00 28.42  ? 73  TYR A OH    1 
ATOM   574  N N     . VAL A 1 94  ? 7.087  2.828   190.477 1.00 33.46  ? 74  VAL A N     1 
ATOM   575  C CA    . VAL A 1 94  ? 6.078  3.814   190.067 1.00 31.74  ? 74  VAL A CA    1 
ATOM   576  C C     . VAL A 1 94  ? 5.989  4.988   191.058 1.00 40.54  ? 74  VAL A C     1 
ATOM   577  O O     . VAL A 1 94  ? 6.012  6.146   190.647 1.00 41.15  ? 74  VAL A O     1 
ATOM   578  C CB    . VAL A 1 94  ? 4.677  3.152   189.900 1.00 41.22  ? 74  VAL A CB    1 
ATOM   579  C CG1   . VAL A 1 94  ? 3.578  4.199   189.659 1.00 41.30  ? 74  VAL A CG1   1 
ATOM   580  C CG2   . VAL A 1 94  ? 4.698  2.153   188.765 1.00 32.59  ? 74  VAL A CG2   1 
ATOM   581  N N     . GLN A 1 95  ? 5.899  4.687   192.355 1.00 34.91  ? 75  GLN A N     1 
ATOM   582  C CA    . GLN A 1 95  ? 5.821  5.724   193.390 1.00 38.12  ? 75  GLN A CA    1 
ATOM   583  C C     . GLN A 1 95  ? 7.007  6.706   193.374 1.00 46.35  ? 75  GLN A C     1 
ATOM   584  O O     . GLN A 1 95  ? 6.837  7.894   193.653 1.00 48.36  ? 75  GLN A O     1 
ATOM   585  C CB    . GLN A 1 95  ? 5.715  5.082   194.780 1.00 42.82  ? 75  GLN A CB    1 
ATOM   586  N N     . ALA A 1 96  ? 8.201  6.218   193.050 1.00 43.73  ? 76  ALA A N     1 
ATOM   587  C CA    . ALA A 1 96  ? 9.395  7.063   193.062 1.00 39.18  ? 76  ALA A CA    1 
ATOM   588  C C     . ALA A 1 96  ? 9.496  7.953   191.815 1.00 41.33  ? 76  ALA A C     1 
ATOM   589  O O     . ALA A 1 96  ? 9.905  9.116   191.896 1.00 41.98  ? 76  ALA A O     1 
ATOM   590  C CB    . ALA A 1 96  ? 10.640 6.201   193.192 1.00 40.78  ? 76  ALA A CB    1 
ATOM   591  N N     . ALA A 1 97  ? 9.129  7.404   190.662 1.00 34.41  ? 77  ALA A N     1 
ATOM   592  C CA    . ALA A 1 97  ? 9.196  8.150   189.405 1.00 32.78  ? 77  ALA A CA    1 
ATOM   593  C C     . ALA A 1 97  ? 8.129  9.248   189.303 1.00 41.71  ? 77  ALA A C     1 
ATOM   594  O O     . ALA A 1 97  ? 8.339  10.247  188.621 1.00 39.00  ? 77  ALA A O     1 
ATOM   595  C CB    . ALA A 1 97  ? 9.073  7.203   188.229 1.00 26.86  ? 77  ALA A CB    1 
ATOM   596  N N     . ARG A 1 98  ? 6.990  9.061   189.970 1.00 31.52  ? 78  ARG A N     1 
ATOM   597  C CA    . ARG A 1 98  ? 5.899  10.035  189.898 1.00 40.95  ? 78  ARG A CA    1 
ATOM   598  C C     . ARG A 1 98  ? 6.314  11.395  190.464 1.00 42.34  ? 78  ARG A C     1 
ATOM   599  O O     . ARG A 1 98  ? 5.843  12.437  190.001 1.00 39.51  ? 78  ARG A O     1 
ATOM   600  C CB    . ARG A 1 98  ? 4.650  9.512   190.635 1.00 39.04  ? 78  ARG A CB    1 
ATOM   601  C CG    . ARG A 1 98  ? 3.366  10.277  190.304 1.00 46.88  ? 78  ARG A CG    1 
ATOM   602  C CD    . ARG A 1 98  ? 2.122  9.423   190.560 1.00 58.52  ? 78  ARG A CD    1 
ATOM   603  N NE    . ARG A 1 98  ? 2.237  8.665   191.803 1.00 64.81  ? 78  ARG A NE    1 
ATOM   604  C CZ    . ARG A 1 98  ? 1.575  7.542   192.064 1.00 63.60  ? 78  ARG A CZ    1 
ATOM   605  N NH1   . ARG A 1 98  ? 0.734  7.038   191.171 1.00 67.96  ? 78  ARG A NH1   1 
ATOM   606  N NH2   . ARG A 1 98  ? 1.757  6.918   193.219 1.00 57.09  ? 78  ARG A NH2   1 
ATOM   607  N N     . GLU A 1 99  ? 7.210  11.380  191.450 1.00 44.81  ? 79  GLU A N     1 
ATOM   608  C CA    . GLU A 1 99  ? 7.658  12.605  192.118 1.00 46.74  ? 79  GLU A CA    1 
ATOM   609  C C     . GLU A 1 99  ? 8.447  13.579  191.233 1.00 49.99  ? 79  GLU A C     1 
ATOM   610  O O     . GLU A 1 99  ? 8.583  14.753  191.588 1.00 35.68  ? 79  GLU A O     1 
ATOM   611  C CB    . GLU A 1 99  ? 8.511  12.255  193.336 1.00 40.01  ? 79  GLU A CB    1 
ATOM   612  C CG    . GLU A 1 99  ? 7.733  11.672  194.490 1.00 52.28  ? 79  GLU A CG    1 
ATOM   613  C CD    . GLU A 1 99  ? 8.579  11.558  195.738 1.00 70.52  ? 79  GLU A CD    1 
ATOM   614  O OE1   . GLU A 1 99  ? 9.683  10.979  195.654 1.00 72.17  ? 79  GLU A OE1   1 
ATOM   615  O OE2   . GLU A 1 99  ? 8.144  12.060  196.797 1.00 82.77  ? 79  GLU A OE2   1 
ATOM   616  N N     . LEU A 1 100 ? 8.974  13.104  190.105 1.00 37.95  ? 80  LEU A N     1 
ATOM   617  C CA    . LEU A 1 100 ? 9.732  13.977  189.193 1.00 41.43  ? 80  LEU A CA    1 
ATOM   618  C C     . LEU A 1 100 ? 8.871  14.693  188.128 1.00 46.50  ? 80  LEU A C     1 
ATOM   619  O O     . LEU A 1 100 ? 9.372  15.560  187.391 1.00 38.99  ? 80  LEU A O     1 
ATOM   620  C CB    . LEU A 1 100 ? 10.834 13.179  188.486 1.00 36.21  ? 80  LEU A CB    1 
ATOM   621  C CG    . LEU A 1 100 ? 11.958 12.591  189.354 1.00 42.33  ? 80  LEU A CG    1 
ATOM   622  C CD1   . LEU A 1 100 ? 12.994 11.885  188.508 1.00 41.64  ? 80  LEU A CD1   1 
ATOM   623  C CD2   . LEU A 1 100 ? 12.617 13.675  190.178 1.00 52.19  ? 80  LEU A CD2   1 
ATOM   624  N N     . PHE A 1 101 ? 7.607  14.332  188.015 1.00 31.93  ? 81  PHE A N     1 
ATOM   625  C CA    . PHE A 1 101 ? 6.714  14.934  187.044 1.00 37.40  ? 81  PHE A CA    1 
ATOM   626  C C     . PHE A 1 101 ? 5.803  16.008  187.674 1.00 45.29  ? 81  PHE A C     1 
ATOM   627  O O     . PHE A 1 101 ? 4.616  15.862  187.714 1.00 49.37  ? 81  PHE A O     1 
ATOM   628  C CB    . PHE A 1 101 ? 5.876  13.867  186.325 1.00 35.14  ? 81  PHE A CB    1 
ATOM   629  C CG    . PHE A 1 101 ? 6.617  13.105  185.254 1.00 30.91  ? 81  PHE A CG    1 
ATOM   630  C CD1   . PHE A 1 101 ? 6.212  13.149  183.953 1.00 29.04  ? 81  PHE A CD1   1 
ATOM   631  C CD2   . PHE A 1 101 ? 7.706  12.326  185.572 1.00 27.67  ? 81  PHE A CD2   1 
ATOM   632  C CE1   . PHE A 1 101 ? 6.889  12.458  182.983 1.00 35.46  ? 81  PHE A CE1   1 
ATOM   633  C CE2   . PHE A 1 101 ? 8.379  11.633  184.614 1.00 31.62  ? 81  PHE A CE2   1 
ATOM   634  C CZ    . PHE A 1 101 ? 7.984  11.705  183.308 1.00 32.52  ? 81  PHE A CZ    1 
ATOM   635  N N     . VAL A 1 102 ? 6.392  17.080  188.165 1.00 48.85  ? 82  VAL A N     1 
ATOM   636  C CA    . VAL A 1 102 ? 5.645  18.175  188.784 1.00 53.60  ? 82  VAL A CA    1 
ATOM   637  C C     . VAL A 1 102 ? 6.037  19.511  188.135 1.00 53.84  ? 82  VAL A C     1 
ATOM   638  O O     . VAL A 1 102 ? 7.049  19.579  187.438 1.00 49.12  ? 82  VAL A O     1 
ATOM   639  C CB    . VAL A 1 102 ? 5.887  18.218  190.314 1.00 59.64  ? 82  VAL A CB    1 
ATOM   640  C CG1   . VAL A 1 102 ? 5.230  17.019  190.985 1.00 58.19  ? 82  VAL A CG1   1 
ATOM   641  C CG2   . VAL A 1 102 ? 7.372  18.263  190.622 1.00 63.60  ? 82  VAL A CG2   1 
ATOM   642  N N     . PRO A 1 103 ? 5.220  20.571  188.330 1.00 55.96  ? 83  PRO A N     1 
ATOM   643  C CA    . PRO A 1 103 ? 5.512  21.870  187.703 1.00 49.25  ? 83  PRO A CA    1 
ATOM   644  C C     . PRO A 1 103 ? 6.908  22.429  188.005 1.00 49.90  ? 83  PRO A C     1 
ATOM   645  O O     . PRO A 1 103 ? 7.506  23.044  187.121 1.00 49.20  ? 83  PRO A O     1 
ATOM   646  C CB    . PRO A 1 103 ? 4.431  22.784  188.291 1.00 55.73  ? 83  PRO A CB    1 
ATOM   647  C CG    . PRO A 1 103 ? 3.289  21.880  188.531 1.00 57.84  ? 83  PRO A CG    1 
ATOM   648  C CD    . PRO A 1 103 ? 3.891  20.572  188.973 1.00 55.08  ? 83  PRO A CD    1 
ATOM   649  N N     . GLU A 1 104 ? 7.415  22.206  189.217 1.00 43.16  ? 84  GLU A N     1 
ATOM   650  C CA    . GLU A 1 104 ? 8.709  22.751  189.644 1.00 44.64  ? 84  GLU A CA    1 
ATOM   651  C C     . GLU A 1 104 ? 9.916  22.286  188.810 1.00 51.16  ? 84  GLU A C     1 
ATOM   652  O O     . GLU A 1 104 ? 10.926 22.991  188.748 1.00 45.61  ? 84  GLU A O     1 
ATOM   653  C CB    . GLU A 1 104 ? 8.976  22.402  191.115 1.00 49.56  ? 84  GLU A CB    1 
ATOM   654  C CG    . GLU A 1 104 ? 8.131  23.153  192.121 1.00 67.39  ? 84  GLU A CG    1 
ATOM   655  C CD    . GLU A 1 104 ? 6.712  22.622  192.212 1.00 74.79  ? 84  GLU A CD    1 
ATOM   656  O OE1   . GLU A 1 104 ? 6.527  21.388  192.129 1.00 64.05  ? 84  GLU A OE1   1 
ATOM   657  O OE2   . GLU A 1 104 ? 5.783  23.444  192.363 1.00 81.52  ? 84  GLU A OE2   1 
ATOM   658  N N     . THR A 1 105 ? 9.826  21.113  188.179 1.00 36.80  ? 85  THR A N     1 
ATOM   659  C CA    . THR A 1 105 ? 10.974 20.555  187.455 1.00 33.81  ? 85  THR A CA    1 
ATOM   660  C C     . THR A 1 105 ? 11.046 20.906  185.959 1.00 39.67  ? 85  THR A C     1 
ATOM   661  O O     . THR A 1 105 ? 11.988 20.483  185.269 1.00 30.40  ? 85  THR A O     1 
ATOM   662  C CB    . THR A 1 105 ? 11.010 19.007  187.564 1.00 32.53  ? 85  THR A CB    1 
ATOM   663  O OG1   . THR A 1 105 ? 9.894  18.450  186.858 1.00 33.20  ? 85  THR A OG1   1 
ATOM   664  C CG2   . THR A 1 105 ? 10.985 18.548  189.036 1.00 33.21  ? 85  THR A CG2   1 
ATOM   665  N N     . ASN A 1 106 ? 10.061 21.643  185.451 1.00 34.25  ? 86  ASN A N     1 
ATOM   666  C CA    . ASN A 1 106 ? 10.029 22.022  184.028 1.00 33.54  ? 86  ASN A CA    1 
ATOM   667  C C     . ASN A 1 106 ? 10.796 23.327  183.804 1.00 38.08  ? 86  ASN A C     1 
ATOM   668  O O     . ASN A 1 106 ? 10.202 24.379  183.549 1.00 40.80  ? 86  ASN A O     1 
ATOM   669  C CB    . ASN A 1 106 ? 8.578  22.160  183.532 1.00 38.29  ? 86  ASN A CB    1 
ATOM   670  C CG    . ASN A 1 106 ? 8.460  22.077  182.002 1.00 45.04  ? 86  ASN A CG    1 
ATOM   671  O OD1   . ASN A 1 106 ? 9.434  21.792  181.304 1.00 42.31  ? 86  ASN A OD1   1 
ATOM   672  N ND2   . ASN A 1 106 ? 7.261  22.319  181.485 1.00 43.84  ? 86  ASN A ND2   1 
ATOM   673  N N     . CYS A 1 107 ? 12.119 23.241  183.904 1.00 32.88  ? 87  CYS A N     1 
ATOM   674  C CA    . CYS A 1 107 ? 13.005 24.408  183.994 1.00 46.06  ? 87  CYS A CA    1 
ATOM   675  C C     . CYS A 1 107 ? 14.439 23.994  183.613 1.00 41.50  ? 87  CYS A C     1 
ATOM   676  O O     . CYS A 1 107 ? 14.892 22.911  183.991 1.00 32.13  ? 87  CYS A O     1 
ATOM   677  C CB    . CYS A 1 107 ? 12.954 24.997  185.414 1.00 46.81  ? 87  CYS A CB    1 
ATOM   678  S SG    . CYS A 1 107 ? 14.308 26.102  185.884 1.00 68.23  ? 87  CYS A SG    1 
ATOM   679  N N     . ALA A 1 108 ? 15.138 24.845  182.862 1.00 37.00  ? 88  ALA A N     1 
ATOM   680  C CA    . ALA A 1 108 ? 16.419 24.474  182.243 1.00 38.41  ? 88  ALA A CA    1 
ATOM   681  C C     . ALA A 1 108 ? 17.554 24.220  183.245 1.00 45.60  ? 88  ALA A C     1 
ATOM   682  O O     . ALA A 1 108 ? 18.326 23.261  183.103 1.00 32.74  ? 88  ALA A O     1 
ATOM   683  C CB    . ALA A 1 108 ? 16.842 25.548  181.256 1.00 41.27  ? 88  ALA A CB    1 
ATOM   684  N N     . GLU A 1 109 ? 17.671 25.092  184.242 1.00 31.98  ? 89  GLU A N     1 
ATOM   685  C CA    . GLU A 1 109 ? 18.701 24.939  185.269 1.00 37.33  ? 89  GLU A CA    1 
ATOM   686  C C     . GLU A 1 109 ? 18.525 23.628  186.055 1.00 38.60  ? 89  GLU A C     1 
ATOM   687  O O     . GLU A 1 109 ? 19.511 22.948  186.351 1.00 38.61  ? 89  GLU A O     1 
ATOM   688  C CB    . GLU A 1 109 ? 18.697 26.148  186.216 1.00 48.34  ? 89  GLU A CB    1 
ATOM   689  C CG    . GLU A 1 109 ? 19.265 27.440  185.604 1.00 54.31  ? 89  GLU A CG    1 
ATOM   690  C CD    . GLU A 1 109 ? 18.354 28.060  184.544 1.00 65.63  ? 89  GLU A CD    1 
ATOM   691  O OE1   . GLU A 1 109 ? 17.153 28.254  184.828 1.00 73.69  ? 89  GLU A OE1   1 
ATOM   692  O OE2   . GLU A 1 109 ? 18.836 28.350  183.426 1.00 53.94  ? 89  GLU A OE2   1 
ATOM   693  N N     . VAL A 1 110 ? 17.283 23.260  186.374 1.00 31.36  ? 90  VAL A N     1 
ATOM   694  C CA    . VAL A 1 110 ? 17.011 21.959  187.016 1.00 37.31  ? 90  VAL A CA    1 
ATOM   695  C C     . VAL A 1 110 ? 17.306 20.732  186.106 1.00 32.28  ? 90  VAL A C     1 
ATOM   696  O O     . VAL A 1 110 ? 17.833 19.714  186.583 1.00 32.48  ? 90  VAL A O     1 
ATOM   697  C CB    . VAL A 1 110 ? 15.540 21.872  187.503 1.00 31.59  ? 90  VAL A CB    1 
ATOM   698  C CG1   . VAL A 1 110 ? 15.272 20.535  188.184 1.00 36.31  ? 90  VAL A CG1   1 
ATOM   699  C CG2   . VAL A 1 110 ? 15.223 23.020  188.449 1.00 39.09  ? 90  VAL A CG2   1 
ATOM   700  N N     . TYR A 1 111 ? 16.973 20.826  184.815 1.00 31.00  ? 91  TYR A N     1 
ATOM   701  C CA    . TYR A 1 111 ? 17.222 19.726  183.848 1.00 26.41  ? 91  TYR A CA    1 
ATOM   702  C C     . TYR A 1 111 ? 18.717 19.338  183.766 1.00 36.56  ? 91  TYR A C     1 
ATOM   703  O O     . TYR A 1 111 ? 19.063 18.152  183.813 1.00 22.54  ? 91  TYR A O     1 
ATOM   704  C CB    . TYR A 1 111 ? 16.687 20.106  182.436 1.00 24.48  ? 91  TYR A CB    1 
ATOM   705  C CG    . TYR A 1 111 ? 16.995 19.095  181.320 1.00 29.72  ? 91  TYR A CG    1 
ATOM   706  C CD1   . TYR A 1 111 ? 16.106 18.062  181.013 1.00 27.13  ? 91  TYR A CD1   1 
ATOM   707  C CD2   . TYR A 1 111 ? 18.174 19.178  180.575 1.00 30.14  ? 91  TYR A CD2   1 
ATOM   708  C CE1   . TYR A 1 111 ? 16.388 17.129  179.982 1.00 24.26  ? 91  TYR A CE1   1 
ATOM   709  C CE2   . TYR A 1 111 ? 18.469 18.250  179.554 1.00 28.45  ? 91  TYR A CE2   1 
ATOM   710  C CZ    . TYR A 1 111 ? 17.573 17.231  179.265 1.00 29.89  ? 91  TYR A CZ    1 
ATOM   711  O OH    . TYR A 1 111 ? 17.862 16.319  178.262 1.00 28.92  ? 91  TYR A OH    1 
ATOM   712  N N     . TYR A 1 112 ? 19.600 20.328  183.649 1.00 30.25  ? 92  TYR A N     1 
ATOM   713  C CA    . TYR A 1 112 ? 21.031 20.046  183.501 1.00 35.13  ? 92  TYR A CA    1 
ATOM   714  C C     . TYR A 1 112 ? 21.690 19.460  184.779 1.00 37.44  ? 92  TYR A C     1 
ATOM   715  O O     . TYR A 1 112 ? 22.670 18.713  184.673 1.00 27.78  ? 92  TYR A O     1 
ATOM   716  C CB    . TYR A 1 112 ? 21.764 21.320  183.017 1.00 25.31  ? 92  TYR A CB    1 
ATOM   717  C CG    . TYR A 1 112 ? 21.427 21.678  181.554 1.00 24.94  ? 92  TYR A CG    1 
ATOM   718  C CD1   . TYR A 1 112 ? 21.505 20.718  180.543 1.00 30.52  ? 92  TYR A CD1   1 
ATOM   719  C CD2   . TYR A 1 112 ? 20.999 22.958  181.198 1.00 26.45  ? 92  TYR A CD2   1 
ATOM   720  C CE1   . TYR A 1 112 ? 21.179 21.030  179.209 1.00 31.14  ? 92  TYR A CE1   1 
ATOM   721  C CE2   . TYR A 1 112 ? 20.672 23.279  179.868 1.00 36.07  ? 92  TYR A CE2   1 
ATOM   722  C CZ    . TYR A 1 112 ? 20.766 22.309  178.883 1.00 36.98  ? 92  TYR A CZ    1 
ATOM   723  O OH    . TYR A 1 112 ? 20.445 22.615  177.575 1.00 33.20  ? 92  TYR A OH    1 
ATOM   724  N N     . GLN A 1 113 ? 21.154 19.754  185.972 1.00 29.86  ? 93  GLN A N     1 
ATOM   725  C CA    . GLN A 1 113 ? 21.675 19.110  187.195 1.00 31.42  ? 93  GLN A CA    1 
ATOM   726  C C     . GLN A 1 113 ? 21.255 17.623  187.299 1.00 32.88  ? 93  GLN A C     1 
ATOM   727  O O     . GLN A 1 113 ? 22.073 16.783  187.685 1.00 28.00  ? 93  GLN A O     1 
ATOM   728  C CB    . GLN A 1 113 ? 21.259 19.873  188.482 1.00 32.48  ? 93  GLN A CB    1 
ATOM   729  C CG    . GLN A 1 113 ? 21.831 19.246  189.792 1.00 29.21  ? 93  GLN A CG    1 
ATOM   730  C CD    . GLN A 1 113 ? 21.724 20.146  191.047 1.00 44.65  ? 93  GLN A CD    1 
ATOM   731  O OE1   . GLN A 1 113 ? 20.756 20.064  191.816 1.00 42.42  ? 93  GLN A OE1   1 
ATOM   732  N NE2   . GLN A 1 113 ? 22.740 20.979  191.269 1.00 33.27  ? 93  GLN A NE2   1 
ATOM   733  N N     . PHE A 1 114 ? 20.006 17.289  186.958 1.00 30.27  ? 94  PHE A N     1 
ATOM   734  C CA    . PHE A 1 114 ? 19.583 15.871  186.916 1.00 29.80  ? 94  PHE A CA    1 
ATOM   735  C C     . PHE A 1 114 ? 20.364 15.032  185.876 1.00 31.38  ? 94  PHE A C     1 
ATOM   736  O O     . PHE A 1 114 ? 20.666 13.859  186.137 1.00 28.46  ? 94  PHE A O     1 
ATOM   737  C CB    . PHE A 1 114 ? 18.070 15.745  186.636 1.00 30.66  ? 94  PHE A CB    1 
ATOM   738  C CG    . PHE A 1 114 ? 17.189 15.900  187.866 1.00 33.09  ? 94  PHE A CG    1 
ATOM   739  C CD1   . PHE A 1 114 ? 17.486 15.236  189.049 1.00 30.24  ? 94  PHE A CD1   1 
ATOM   740  C CD2   . PHE A 1 114 ? 16.058 16.710  187.827 1.00 32.97  ? 94  PHE A CD2   1 
ATOM   741  C CE1   . PHE A 1 114 ? 16.670 15.377  190.182 1.00 33.18  ? 94  PHE A CE1   1 
ATOM   742  C CE2   . PHE A 1 114 ? 15.237 16.855  188.942 1.00 37.29  ? 94  PHE A CE2   1 
ATOM   743  C CZ    . PHE A 1 114 ? 15.543 16.191  190.123 1.00 41.55  ? 94  PHE A CZ    1 
ATOM   744  N N     . ARG A 1 115 ? 20.663 15.614  184.703 1.00 25.50  ? 95  ARG A N     1 
ATOM   745  C CA    . ARG A 1 115 ? 21.483 14.934  183.672 1.00 20.85  ? 95  ARG A CA    1 
ATOM   746  C C     . ARG A 1 115 ? 22.876 14.616  184.239 1.00 28.43  ? 95  ARG A C     1 
ATOM   747  O O     . ARG A 1 115 ? 23.408 13.524  184.013 1.00 28.55  ? 95  ARG A O     1 
ATOM   748  C CB    . ARG A 1 115 ? 21.596 15.799  182.388 1.00 22.38  ? 95  ARG A CB    1 
ATOM   749  C CG    . ARG A 1 115 ? 22.299 15.122  181.174 1.00 31.51  ? 95  ARG A CG    1 
ATOM   750  C CD    . ARG A 1 115 ? 22.365 16.035  179.889 1.00 21.76  ? 95  ARG A CD    1 
ATOM   751  N NE    . ARG A 1 115 ? 23.398 17.083  179.983 1.00 20.34  ? 95  ARG A NE    1 
ATOM   752  C CZ    . ARG A 1 115 ? 23.714 17.964  179.026 1.00 32.14  ? 95  ARG A CZ    1 
ATOM   753  N NH1   . ARG A 1 115 ? 23.086 17.973  177.854 1.00 23.20  ? 95  ARG A NH1   1 
ATOM   754  N NH2   . ARG A 1 115 ? 24.678 18.854  179.242 1.00 25.02  ? 95  ARG A NH2   1 
ATOM   755  N N     . GLU A 1 116 ? 23.446 15.562  184.994 1.00 26.75  ? 96  GLU A N     1 
ATOM   756  C CA    . GLU A 1 116 ? 24.733 15.348  185.678 1.00 30.18  ? 96  GLU A CA    1 
ATOM   757  C C     . GLU A 1 116 ? 24.681 14.268  186.774 1.00 30.03  ? 96  GLU A C     1 
ATOM   758  O O     . GLU A 1 116 ? 25.640 13.503  186.913 1.00 28.70  ? 96  GLU A O     1 
ATOM   759  C CB    . GLU A 1 116 ? 25.259 16.661  186.286 1.00 30.21  ? 96  GLU A CB    1 
ATOM   760  C CG    . GLU A 1 116 ? 26.590 16.511  187.056 1.00 36.87  ? 96  GLU A CG    1 
ATOM   761  C CD    . GLU A 1 116 ? 27.172 17.848  187.515 1.00 46.40  ? 96  GLU A CD    1 
ATOM   762  O OE1   . GLU A 1 116 ? 27.808 17.905  188.595 1.00 38.77  ? 96  GLU A OE1   1 
ATOM   763  O OE2   . GLU A 1 116 ? 27.008 18.848  186.785 1.00 58.26  ? 96  GLU A OE2   1 
ATOM   764  N N     . GLU A 1 117 ? 23.592 14.206  187.549 1.00 33.09  ? 97  GLU A N     1 
ATOM   765  C CA    . GLU A 1 117 ? 23.443 13.159  188.581 1.00 29.74  ? 97  GLU A CA    1 
ATOM   766  C C     . GLU A 1 117 ? 23.418 11.767  187.925 1.00 32.57  ? 97  GLU A C     1 
ATOM   767  O O     . GLU A 1 117 ? 24.015 10.823  188.449 1.00 27.96  ? 97  GLU A O     1 
ATOM   768  C CB    . GLU A 1 117 ? 22.164 13.356  189.440 1.00 29.66  ? 97  GLU A CB    1 
ATOM   769  C CG    . GLU A 1 117 ? 22.094 12.393  190.675 1.00 27.26  ? 97  GLU A CG    1 
ATOM   770  C CD    . GLU A 1 117 ? 20.801 12.485  191.525 1.00 39.97  ? 97  GLU A CD    1 
ATOM   771  O OE1   . GLU A 1 117 ? 19.947 13.367  191.293 1.00 35.38  ? 97  GLU A OE1   1 
ATOM   772  O OE2   . GLU A 1 117 ? 20.641 11.658  192.454 1.00 35.63  ? 97  GLU A OE2   1 
ATOM   773  N N     . PHE A 1 118 ? 22.728 11.654  186.786 1.00 31.63  ? 98  PHE A N     1 
ATOM   774  C CA    . PHE A 1 118 ? 22.575 10.375  186.064 1.00 30.35  ? 98  PHE A CA    1 
ATOM   775  C C     . PHE A 1 118 ? 23.957 9.848   185.656 1.00 31.17  ? 98  PHE A C     1 
ATOM   776  O O     . PHE A 1 118 ? 24.343 8.734   186.036 1.00 28.07  ? 98  PHE A O     1 
ATOM   777  C CB    . PHE A 1 118 ? 21.626 10.545  184.835 1.00 18.27  ? 98  PHE A CB    1 
ATOM   778  C CG    . PHE A 1 118 ? 21.624 9.367   183.867 1.00 20.72  ? 98  PHE A CG    1 
ATOM   779  C CD1   . PHE A 1 118 ? 22.445 9.364   182.743 1.00 22.50  ? 98  PHE A CD1   1 
ATOM   780  C CD2   . PHE A 1 118 ? 20.803 8.264   184.087 1.00 23.34  ? 98  PHE A CD2   1 
ATOM   781  C CE1   . PHE A 1 118 ? 22.456 8.276   181.859 1.00 29.50  ? 98  PHE A CE1   1 
ATOM   782  C CE2   . PHE A 1 118 ? 20.804 7.180   183.207 1.00 32.99  ? 98  PHE A CE2   1 
ATOM   783  C CZ    . PHE A 1 118 ? 21.639 7.187   182.091 1.00 31.13  ? 98  PHE A CZ    1 
ATOM   784  N N     . ASN A 1 119 ? 24.718 10.680  184.941 1.00 30.05  ? 99  ASN A N     1 
ATOM   785  C CA    . ASN A 1 119 ? 26.037 10.300  184.429 1.00 31.49  ? 99  ASN A CA    1 
ATOM   786  C C     . ASN A 1 119 ? 27.074 9.935   185.513 1.00 36.00  ? 99  ASN A C     1 
ATOM   787  O O     . ASN A 1 119 ? 28.030 9.214   185.227 1.00 43.09  ? 99  ASN A O     1 
ATOM   788  C CB    . ASN A 1 119 ? 26.601 11.426  183.534 1.00 32.47  ? 99  ASN A CB    1 
ATOM   789  C CG    . ASN A 1 119 ? 26.001 11.423  182.112 1.00 35.02  ? 99  ASN A CG    1 
ATOM   790  O OD1   . ASN A 1 119 ? 25.734 10.365  181.532 1.00 25.23  ? 99  ASN A OD1   1 
ATOM   791  N ND2   . ASN A 1 119 ? 25.798 12.619  181.548 1.00 24.05  ? 99  ASN A ND2   1 
ATOM   792  N N     . LYS A 1 120 ? 26.891 10.408  186.746 1.00 32.89  ? 100 LYS A N     1 
ATOM   793  C CA    . LYS A 1 120 ? 27.845 10.114  187.833 1.00 28.37  ? 100 LYS A CA    1 
ATOM   794  C C     . LYS A 1 120 ? 27.436 8.946   188.755 1.00 31.22  ? 100 LYS A C     1 
ATOM   795  O O     . LYS A 1 120 ? 28.270 8.419   189.499 1.00 35.83  ? 100 LYS A O     1 
ATOM   796  C CB    . LYS A 1 120 ? 28.073 11.366  188.699 1.00 31.41  ? 100 LYS A CB    1 
ATOM   797  C CG    . LYS A 1 120 ? 29.046 12.378  188.107 1.00 30.39  ? 100 LYS A CG    1 
ATOM   798  C CD    . LYS A 1 120 ? 29.101 13.654  188.937 1.00 40.05  ? 100 LYS A CD    1 
ATOM   799  C CE    . LYS A 1 120 ? 30.356 14.446  188.629 1.00 47.97  ? 100 LYS A CE    1 
ATOM   800  N NZ    . LYS A 1 120 ? 30.130 15.917  188.601 1.00 51.66  ? 100 LYS A NZ    1 
ATOM   801  N N     . SER A 1 121 ? 26.164 8.553   188.721 1.00 33.71  ? 101 SER A N     1 
ATOM   802  C CA    . SER A 1 121 ? 25.649 7.506   189.613 1.00 31.87  ? 101 SER A CA    1 
ATOM   803  C C     . SER A 1 121 ? 26.124 6.101   189.248 1.00 37.59  ? 101 SER A C     1 
ATOM   804  O O     . SER A 1 121 ? 26.359 5.798   188.077 1.00 36.92  ? 101 SER A O     1 
ATOM   805  C CB    . SER A 1 121 ? 24.114 7.520   189.623 1.00 33.66  ? 101 SER A CB    1 
ATOM   806  O OG    . SER A 1 121 ? 23.588 6.388   190.308 1.00 31.11  ? 101 SER A OG    1 
ATOM   807  N N     . GLN A 1 122 ? 26.234 5.236   190.254 1.00 41.70  ? 102 GLN A N     1 
ATOM   808  C CA    . GLN A 1 122 ? 26.520 3.823   190.006 1.00 49.29  ? 102 GLN A CA    1 
ATOM   809  C C     . GLN A 1 122 ? 25.499 2.875   190.641 1.00 44.58  ? 102 GLN A C     1 
ATOM   810  O O     . GLN A 1 122 ? 25.831 1.739   190.955 1.00 44.42  ? 102 GLN A O     1 
ATOM   811  C CB    . GLN A 1 122 ? 27.925 3.476   190.496 1.00 60.47  ? 102 GLN A CB    1 
ATOM   812  C CG    . GLN A 1 122 ? 29.000 3.782   189.467 1.00 75.14  ? 102 GLN A CG    1 
ATOM   813  C CD    . GLN A 1 122 ? 30.371 3.971   190.080 1.00 87.84  ? 102 GLN A CD    1 
ATOM   814  O OE1   . GLN A 1 122 ? 30.536 3.902   191.299 1.00 93.03  ? 102 GLN A OE1   1 
ATOM   815  N NE2   . GLN A 1 122 ? 31.367 4.218   189.234 1.00 90.69  ? 102 GLN A NE2   1 
ATOM   816  N N     . ASP A 1 123 ? 24.262 3.343   190.810 1.00 40.49  ? 103 ASP A N     1 
ATOM   817  C CA    . ASP A 1 123 ? 23.163 2.530   191.351 1.00 33.85  ? 103 ASP A CA    1 
ATOM   818  C C     . ASP A 1 123 ? 22.078 2.288   190.296 1.00 37.31  ? 103 ASP A C     1 
ATOM   819  O O     . ASP A 1 123 ? 21.440 3.239   189.843 1.00 42.92  ? 103 ASP A O     1 
ATOM   820  C CB    . ASP A 1 123 ? 22.549 3.216   192.582 1.00 37.06  ? 103 ASP A CB    1 
ATOM   821  C CG    . ASP A 1 123 ? 21.247 2.557   193.040 1.00 45.14  ? 103 ASP A CG    1 
ATOM   822  O OD1   . ASP A 1 123 ? 21.136 1.317   192.983 1.00 51.79  ? 103 ASP A OD1   1 
ATOM   823  O OD2   . ASP A 1 123 ? 20.330 3.285   193.464 1.00 49.27  ? 103 ASP A OD2   1 
ATOM   824  N N     . PRO A 1 124 ? 21.859 1.016   189.907 1.00 28.27  ? 104 PRO A N     1 
ATOM   825  C CA    . PRO A 1 124 ? 20.900 0.676   188.841 1.00 30.15  ? 104 PRO A CA    1 
ATOM   826  C C     . PRO A 1 124 ? 19.466 1.207   189.054 1.00 33.48  ? 104 PRO A C     1 
ATOM   827  O O     . PRO A 1 124 ? 18.836 1.658   188.094 1.00 24.93  ? 104 PRO A O     1 
ATOM   828  C CB    . PRO A 1 124 ? 20.910 -0.854  188.845 1.00 34.22  ? 104 PRO A CB    1 
ATOM   829  C CG    . PRO A 1 124 ? 22.263 -1.216  189.332 1.00 35.00  ? 104 PRO A CG    1 
ATOM   830  C CD    . PRO A 1 124 ? 22.659 -0.149  190.324 1.00 29.16  ? 104 PRO A CD    1 
ATOM   831  N N     . PHE A 1 125 ? 18.956 1.156   190.280 1.00 22.52  ? 105 PHE A N     1 
ATOM   832  C CA    . PHE A 1 125 ? 17.592 1.641   190.551 1.00 22.81  ? 105 PHE A CA    1 
ATOM   833  C C     . PHE A 1 125 ? 17.490 3.173   190.341 1.00 31.10  ? 105 PHE A C     1 
ATOM   834  O O     . PHE A 1 125 ? 16.583 3.640   189.644 1.00 29.80  ? 105 PHE A O     1 
ATOM   835  C CB    . PHE A 1 125 ? 17.136 1.243   191.970 1.00 24.72  ? 105 PHE A CB    1 
ATOM   836  C CG    . PHE A 1 125 ? 15.716 1.677   192.302 1.00 40.21  ? 105 PHE A CG    1 
ATOM   837  C CD1   . PHE A 1 125 ? 14.628 0.860   191.997 1.00 30.56  ? 105 PHE A CD1   1 
ATOM   838  C CD2   . PHE A 1 125 ? 15.473 2.904   192.908 1.00 36.32  ? 105 PHE A CD2   1 
ATOM   839  C CE1   . PHE A 1 125 ? 13.328 1.257   192.287 1.00 36.75  ? 105 PHE A CE1   1 
ATOM   840  C CE2   . PHE A 1 125 ? 14.174 3.313   193.202 1.00 39.39  ? 105 PHE A CE2   1 
ATOM   841  C CZ    . PHE A 1 125 ? 13.099 2.489   192.895 1.00 40.68  ? 105 PHE A CZ    1 
ATOM   842  N N     . ARG A 1 126 ? 18.416 3.954   190.904 1.00 34.32  ? 106 ARG A N     1 
ATOM   843  C CA    . ARG A 1 126 ? 18.384 5.416   190.699 1.00 32.51  ? 106 ARG A CA    1 
ATOM   844  C C     . ARG A 1 126 ? 18.567 5.825   189.217 1.00 30.53  ? 106 ARG A C     1 
ATOM   845  O O     . ARG A 1 126 ? 17.875 6.735   188.748 1.00 32.50  ? 106 ARG A O     1 
ATOM   846  C CB    . ARG A 1 126 ? 19.436 6.117   191.577 1.00 28.87  ? 106 ARG A CB    1 
ATOM   847  C CG    . ARG A 1 126 ? 19.362 7.679   191.584 1.00 25.64  ? 106 ARG A CG    1 
ATOM   848  C CD    . ARG A 1 126 ? 18.022 8.268   192.116 1.00 33.42  ? 106 ARG A CD    1 
ATOM   849  N NE    . ARG A 1 126 ? 18.042 9.743   192.173 1.00 37.87  ? 106 ARG A NE    1 
ATOM   850  C CZ    . ARG A 1 126 ? 16.967 10.531  192.293 1.00 42.17  ? 106 ARG A CZ    1 
ATOM   851  N NH1   . ARG A 1 126 ? 15.745 10.010  192.369 1.00 29.97  ? 106 ARG A NH1   1 
ATOM   852  N NH2   . ARG A 1 126 ? 17.113 11.855  192.336 1.00 44.31  ? 106 ARG A NH2   1 
ATOM   853  N N     . ARG A 1 127 ? 19.465 5.160   188.477 1.00 26.71  ? 107 ARG A N     1 
ATOM   854  C CA    . ARG A 1 127 ? 19.671 5.478   187.048 1.00 26.36  ? 107 ARG A CA    1 
ATOM   855  C C     . ARG A 1 127 ? 18.406 5.214   186.223 1.00 34.40  ? 107 ARG A C     1 
ATOM   856  O O     . ARG A 1 127 ? 18.118 5.954   185.271 1.00 27.06  ? 107 ARG A O     1 
ATOM   857  C CB    . ARG A 1 127 ? 20.852 4.680   186.443 1.00 27.12  ? 107 ARG A CB    1 
ATOM   858  C CG    . ARG A 1 127 ? 22.253 5.179   186.846 1.00 25.69  ? 107 ARG A CG    1 
ATOM   859  C CD    . ARG A 1 127 ? 23.406 4.309   186.278 1.00 35.44  ? 107 ARG A CD    1 
ATOM   860  N NE    . ARG A 1 127 ? 23.528 4.357   184.812 1.00 33.35  ? 107 ARG A NE    1 
ATOM   861  C CZ    . ARG A 1 127 ? 24.378 5.129   184.132 1.00 36.03  ? 107 ARG A CZ    1 
ATOM   862  N NH1   . ARG A 1 127 ? 25.211 5.950   184.768 1.00 31.52  ? 107 ARG A NH1   1 
ATOM   863  N NH2   . ARG A 1 127 ? 24.398 5.078   182.798 1.00 34.14  ? 107 ARG A NH2   1 
ATOM   864  N N     . ALA A 1 128 ? 17.650 4.172   186.585 1.00 27.85  ? 108 ALA A N     1 
ATOM   865  C CA    . ALA A 1 128 ? 16.420 3.833   185.848 1.00 30.21  ? 108 ALA A CA    1 
ATOM   866  C C     . ALA A 1 128 ? 15.306 4.875   186.043 1.00 32.42  ? 108 ALA A C     1 
ATOM   867  O O     . ALA A 1 128 ? 14.565 5.198   185.091 1.00 25.83  ? 108 ALA A O     1 
ATOM   868  C CB    . ALA A 1 128 ? 15.917 2.445   186.250 1.00 24.51  ? 108 ALA A CB    1 
ATOM   869  N N     . VAL A 1 129 ? 15.179 5.382   187.273 1.00 25.14  ? 109 VAL A N     1 
ATOM   870  C CA    . VAL A 1 129 ? 14.202 6.433   187.598 1.00 27.44  ? 109 VAL A CA    1 
ATOM   871  C C     . VAL A 1 129 ? 14.469 7.694   186.775 1.00 33.20  ? 109 VAL A C     1 
ATOM   872  O O     . VAL A 1 129 ? 13.554 8.268   186.169 1.00 26.47  ? 109 VAL A O     1 
ATOM   873  C CB    . VAL A 1 129 ? 14.223 6.785   189.117 1.00 35.54  ? 109 VAL A CB    1 
ATOM   874  C CG1   . VAL A 1 129 ? 13.381 8.030   189.412 1.00 32.71  ? 109 VAL A CG1   1 
ATOM   875  C CG2   . VAL A 1 129 ? 13.720 5.617   189.946 1.00 34.31  ? 109 VAL A CG2   1 
ATOM   876  N N     . LEU A 1 130 ? 15.732 8.110   186.736 1.00 24.80  ? 110 LEU A N     1 
ATOM   877  C CA    . LEU A 1 130 ? 16.110 9.333   186.024 1.00 23.86  ? 110 LEU A CA    1 
ATOM   878  C C     . LEU A 1 130 ? 16.040 9.205   184.492 1.00 30.25  ? 110 LEU A C     1 
ATOM   879  O O     . LEU A 1 130 ? 15.800 10.199  183.795 1.00 26.00  ? 110 LEU A O     1 
ATOM   880  C CB    . LEU A 1 130 ? 17.516 9.759   186.447 1.00 24.15  ? 110 LEU A CB    1 
ATOM   881  C CG    . LEU A 1 130 ? 17.650 10.168  187.919 1.00 32.24  ? 110 LEU A CG    1 
ATOM   882  C CD1   . LEU A 1 130 ? 19.117 10.236  188.328 1.00 38.44  ? 110 LEU A CD1   1 
ATOM   883  C CD2   . LEU A 1 130 ? 16.970 11.507  188.158 1.00 37.47  ? 110 LEU A CD2   1 
ATOM   884  N N     . PHE A 1 131 ? 16.252 7.993   183.974 1.00 28.15  ? 111 PHE A N     1 
ATOM   885  C CA    . PHE A 1 131 ? 16.187 7.742   182.523 1.00 30.09  ? 111 PHE A CA    1 
ATOM   886  C C     . PHE A 1 131 ? 14.829 8.153   181.914 1.00 29.12  ? 111 PHE A C     1 
ATOM   887  O O     . PHE A 1 131 ? 14.785 8.749   180.829 1.00 26.29  ? 111 PHE A O     1 
ATOM   888  C CB    . PHE A 1 131 ? 16.476 6.259   182.222 1.00 31.68  ? 111 PHE A CB    1 
ATOM   889  C CG    . PHE A 1 131 ? 16.771 5.959   180.757 1.00 36.65  ? 111 PHE A CG    1 
ATOM   890  C CD1   . PHE A 1 131 ? 18.031 6.203   180.219 1.00 38.69  ? 111 PHE A CD1   1 
ATOM   891  C CD2   . PHE A 1 131 ? 15.797 5.404   179.933 1.00 38.50  ? 111 PHE A CD2   1 
ATOM   892  C CE1   . PHE A 1 131 ? 18.309 5.919   178.882 1.00 40.58  ? 111 PHE A CE1   1 
ATOM   893  C CE2   . PHE A 1 131 ? 16.066 5.119   178.594 1.00 41.57  ? 111 PHE A CE2   1 
ATOM   894  C CZ    . PHE A 1 131 ? 17.324 5.378   178.070 1.00 40.46  ? 111 PHE A CZ    1 
ATOM   895  N N     . LEU A 1 132 ? 13.731 7.841   182.607 1.00 23.63  ? 112 LEU A N     1 
ATOM   896  C CA    . LEU A 1 132 ? 12.382 8.184   182.124 1.00 24.90  ? 112 LEU A CA    1 
ATOM   897  C C     . LEU A 1 132 ? 12.128 9.711   182.109 1.00 26.00  ? 112 LEU A C     1 
ATOM   898  O O     . LEU A 1 132 ? 11.532 10.235  181.162 1.00 26.28  ? 112 LEU A O     1 
ATOM   899  C CB    . LEU A 1 132 ? 11.312 7.466   182.977 1.00 23.18  ? 112 LEU A CB    1 
ATOM   900  C CG    . LEU A 1 132 ? 9.816  7.635   182.651 1.00 30.02  ? 112 LEU A CG    1 
ATOM   901  C CD1   . LEU A 1 132 ? 9.440  7.096   181.269 1.00 30.65  ? 112 LEU A CD1   1 
ATOM   902  C CD2   . LEU A 1 132 ? 8.915  7.006   183.710 1.00 31.28  ? 112 LEU A CD2   1 
ATOM   903  N N     . TYR A 1 133 ? 12.576 10.424  183.146 1.00 30.94  ? 113 TYR A N     1 
ATOM   904  C CA    . TYR A 1 133 ? 12.492 11.897  183.165 1.00 31.10  ? 113 TYR A CA    1 
ATOM   905  C C     . TYR A 1 133 ? 13.168 12.514  181.914 1.00 27.58  ? 113 TYR A C     1 
ATOM   906  O O     . TYR A 1 133 ? 12.579 13.371  181.235 1.00 24.18  ? 113 TYR A O     1 
ATOM   907  C CB    . TYR A 1 133 ? 13.123 12.454  184.463 1.00 26.82  ? 113 TYR A CB    1 
ATOM   908  C CG    . TYR A 1 133 ? 13.303 13.967  184.499 1.00 28.94  ? 113 TYR A CG    1 
ATOM   909  C CD1   . TYR A 1 133 ? 12.263 14.810  184.884 1.00 29.25  ? 113 TYR A CD1   1 
ATOM   910  C CD2   . TYR A 1 133 ? 14.518 14.552  184.147 1.00 31.88  ? 113 TYR A CD2   1 
ATOM   911  C CE1   . TYR A 1 133 ? 12.426 16.199  184.915 1.00 24.99  ? 113 TYR A CE1   1 
ATOM   912  C CE2   . TYR A 1 133 ? 14.690 15.932  184.173 1.00 30.63  ? 113 TYR A CE2   1 
ATOM   913  C CZ    . TYR A 1 133 ? 13.647 16.747  184.562 1.00 35.12  ? 113 TYR A CZ    1 
ATOM   914  O OH    . TYR A 1 133 ? 13.833 18.106  184.579 1.00 36.30  ? 113 TYR A OH    1 
ATOM   915  N N     . LEU A 1 134 ? 14.380 12.051  181.596 1.00 26.58  ? 114 LEU A N     1 
ATOM   916  C CA    . LEU A 1 134 ? 15.142 12.591  180.459 1.00 23.07  ? 114 LEU A CA    1 
ATOM   917  C C     . LEU A 1 134 ? 14.489 12.304  179.081 1.00 33.97  ? 114 LEU A C     1 
ATOM   918  O O     . LEU A 1 134 ? 14.562 13.145  178.167 1.00 26.25  ? 114 LEU A O     1 
ATOM   919  C CB    . LEU A 1 134 ? 16.587 12.058  180.487 1.00 19.74  ? 114 LEU A CB    1 
ATOM   920  C CG    . LEU A 1 134 ? 17.464 12.492  181.685 1.00 25.92  ? 114 LEU A CG    1 
ATOM   921  C CD1   . LEU A 1 134 ? 18.709 11.623  181.834 1.00 25.19  ? 114 LEU A CD1   1 
ATOM   922  C CD2   . LEU A 1 134 ? 17.873 13.972  181.584 1.00 25.50  ? 114 LEU A CD2   1 
ATOM   923  N N     . ASN A 1 135 ? 13.855 11.136  178.935 1.00 24.31  ? 115 ASN A N     1 
ATOM   924  C CA    . ASN A 1 135 ? 13.149 10.779  177.695 1.00 24.67  ? 115 ASN A CA    1 
ATOM   925  C C     . ASN A 1 135 ? 11.947 11.700  177.392 1.00 27.63  ? 115 ASN A C     1 
ATOM   926  O O     . ASN A 1 135 ? 11.641 11.951  176.224 1.00 25.72  ? 115 ASN A O     1 
ATOM   927  C CB    . ASN A 1 135 ? 12.678 9.306   177.749 1.00 20.15  ? 115 ASN A CB    1 
ATOM   928  C CG    . ASN A 1 135 ? 11.917 8.866   176.474 1.00 28.38  ? 115 ASN A CG    1 
ATOM   929  O OD1   . ASN A 1 135 ? 10.680 8.892   176.423 1.00 26.01  ? 115 ASN A OD1   1 
ATOM   930  N ND2   . ASN A 1 135 ? 12.661 8.459   175.449 1.00 22.86  ? 115 ASN A ND2   1 
ATOM   931  N N     . ARG A 1 136 ? 11.287 12.207  178.439 1.00 23.08  ? 116 ARG A N     1 
ATOM   932  C CA    . ARG A 1 136 ? 10.056 13.000  178.288 1.00 27.25  ? 116 ARG A CA    1 
ATOM   933  C C     . ARG A 1 136 ? 10.182 14.539  178.440 1.00 28.10  ? 116 ARG A C     1 
ATOM   934  O O     . ARG A 1 136 ? 9.216  15.261  178.168 1.00 25.63  ? 116 ARG A O     1 
ATOM   935  C CB    . ARG A 1 136 ? 9.004  12.502  179.293 1.00 28.69  ? 116 ARG A CB    1 
ATOM   936  C CG    . ARG A 1 136 ? 8.490  11.085  179.031 1.00 29.80  ? 116 ARG A CG    1 
ATOM   937  C CD    . ARG A 1 136 ? 7.080  11.151  178.458 1.00 50.18  ? 116 ARG A CD    1 
ATOM   938  N NE    . ARG A 1 136 ? 6.649  9.863   177.932 1.00 51.93  ? 116 ARG A NE    1 
ATOM   939  C CZ    . ARG A 1 136 ? 5.672  9.703   177.049 1.00 44.69  ? 116 ARG A CZ    1 
ATOM   940  N NH1   . ARG A 1 136 ? 5.001  10.752  176.586 1.00 48.96  ? 116 ARG A NH1   1 
ATOM   941  N NH2   . ARG A 1 136 ? 5.366  8.488   176.628 1.00 38.55  ? 116 ARG A NH2   1 
ATOM   942  N N     . TYR A 1 137 ? 11.341 15.032  178.885 1.00 25.99  ? 117 TYR A N     1 
ATOM   943  C CA    . TYR A 1 137 ? 11.574 16.480  179.025 1.00 28.71  ? 117 TYR A CA    1 
ATOM   944  C C     . TYR A 1 137 ? 12.679 16.984  178.060 1.00 27.14  ? 117 TYR A C     1 
ATOM   945  O O     . TYR A 1 137 ? 12.863 18.194  177.895 1.00 28.36  ? 117 TYR A O     1 
ATOM   946  C CB    . TYR A 1 137 ? 11.962 16.848  180.481 1.00 23.35  ? 117 TYR A CB    1 
ATOM   947  C CG    . TYR A 1 137 ? 10.821 16.898  181.505 1.00 38.64  ? 117 TYR A CG    1 
ATOM   948  C CD1   . TYR A 1 137 ? 10.217 15.731  181.969 1.00 24.75  ? 117 TYR A CD1   1 
ATOM   949  C CD2   . TYR A 1 137 ? 10.385 18.115  182.043 1.00 38.49  ? 117 TYR A CD2   1 
ATOM   950  C CE1   . TYR A 1 137 ? 9.191  15.770  182.917 1.00 26.68  ? 117 TYR A CE1   1 
ATOM   951  C CE2   . TYR A 1 137 ? 9.352  18.166  182.993 1.00 35.21  ? 117 TYR A CE2   1 
ATOM   952  C CZ    . TYR A 1 137 ? 8.760  16.986  183.423 1.00 34.60  ? 117 TYR A CZ    1 
ATOM   953  O OH    . TYR A 1 137 ? 7.739  17.009  184.356 1.00 42.32  ? 117 TYR A OH    1 
ATOM   954  N N     . GLY A 1 138 ? 13.415 16.059  177.442 1.00 25.11  ? 118 GLY A N     1 
ATOM   955  C CA    . GLY A 1 138 ? 14.517 16.393  176.541 1.00 24.40  ? 118 GLY A CA    1 
ATOM   956  C C     . GLY A 1 138 ? 14.146 16.714  175.084 1.00 27.39  ? 118 GLY A C     1 
ATOM   957  O O     . GLY A 1 138 ? 13.040 16.419  174.622 1.00 30.14  ? 118 GLY A O     1 
ATOM   958  N N     . TYR A 1 139 ? 15.075 17.311  174.365 1.00 26.35  ? 119 TYR A N     1 
ATOM   959  C CA    . TYR A 1 139 ? 14.893 17.809  173.010 1.00 35.43  ? 119 TYR A CA    1 
ATOM   960  C C     . TYR A 1 139 ? 14.417 16.799  171.949 1.00 30.47  ? 119 TYR A C     1 
ATOM   961  O O     . TYR A 1 139 ? 15.122 15.889  171.614 1.00 32.01  ? 119 TYR A O     1 
ATOM   962  C CB    . TYR A 1 139 ? 16.177 18.485  172.547 1.00 36.04  ? 119 TYR A CB    1 
ATOM   963  C CG    . TYR A 1 139 ? 16.058 19.230  171.256 1.00 43.24  ? 119 TYR A CG    1 
ATOM   964  C CD1   . TYR A 1 139 ? 15.643 20.526  171.228 1.00 50.36  ? 119 TYR A CD1   1 
ATOM   965  C CD2   . TYR A 1 139 ? 16.364 18.628  170.066 1.00 52.03  ? 119 TYR A CD2   1 
ATOM   966  C CE1   . TYR A 1 139 ? 15.529 21.212  170.041 1.00 59.58  ? 119 TYR A CE1   1 
ATOM   967  C CE2   . TYR A 1 139 ? 16.251 19.302  168.872 1.00 55.25  ? 119 TYR A CE2   1 
ATOM   968  C CZ    . TYR A 1 139 ? 15.827 20.588  168.870 1.00 58.72  ? 119 TYR A CZ    1 
ATOM   969  O OH    . TYR A 1 139 ? 15.719 21.253  167.701 1.00 61.19  ? 119 TYR A OH    1 
ATOM   970  N N     . ASN A 1 140 ? 13.220 17.014  171.416 1.00 35.24  ? 120 ASN A N     1 
ATOM   971  C CA    . ASN A 1 140 ? 12.586 16.158  170.393 1.00 38.70  ? 120 ASN A CA    1 
ATOM   972  C C     . ASN A 1 140 ? 12.483 14.659  170.773 1.00 36.89  ? 120 ASN A C     1 
ATOM   973  O O     . ASN A 1 140 ? 12.326 13.830  169.929 1.00 37.35  ? 120 ASN A O     1 
ATOM   974  C CB    . ASN A 1 140 ? 13.293 16.290  169.029 1.00 33.36  ? 120 ASN A CB    1 
ATOM   975  C CG    . ASN A 1 140 ? 12.903 17.542  168.246 1.00 44.08  ? 120 ASN A CG    1 
ATOM   976  O OD1   . ASN A 1 140 ? 11.959 18.211  168.571 1.00 49.86  ? 120 ASN A OD1   1 
ATOM   977  N ND2   . ASN A 1 140 ? 13.657 17.847  167.202 1.00 35.70  ? 120 ASN A ND2   1 
ATOM   978  N N     . GLY A 1 141 ? 12.620 14.329  172.045 1.00 34.10  ? 121 GLY A N     1 
ATOM   979  C CA    . GLY A 1 141 ? 12.722 12.950  172.494 1.00 28.08  ? 121 GLY A CA    1 
ATOM   980  C C     . GLY A 1 141 ? 13.890 12.079  172.020 1.00 39.56  ? 121 GLY A C     1 
ATOM   981  O O     . GLY A 1 141 ? 13.734 10.909  171.872 1.00 35.02  ? 121 GLY A O     1 
ATOM   982  N N     . LEU A 1 142 ? 15.055 12.660  171.806 1.00 33.26  ? 122 LEU A N     1 
ATOM   983  C CA    . LEU A 1 142 ? 16.236 11.931  171.308 1.00 37.04  ? 122 LEU A CA    1 
ATOM   984  C C     . LEU A 1 142 ? 16.978 11.078  172.335 1.00 36.60  ? 122 LEU A C     1 
ATOM   985  O O     . LEU A 1 142 ? 16.774 11.224  173.546 1.00 27.88  ? 122 LEU A O     1 
ATOM   986  C CB    . LEU A 1 142 ? 17.251 12.907  170.715 1.00 28.15  ? 122 LEU A CB    1 
ATOM   987  C CG    . LEU A 1 142 ? 16.805 13.742  169.520 1.00 46.66  ? 122 LEU A CG    1 
ATOM   988  C CD1   . LEU A 1 142 ? 17.988 14.537  168.974 1.00 47.61  ? 122 LEU A CD1   1 
ATOM   989  C CD2   . LEU A 1 142 ? 16.183 12.854  168.454 1.00 51.24  ? 122 LEU A CD2   1 
ATOM   990  N N     . CYS A 1 143 ? 17.852 10.208  171.815 1.00 37.73  ? 123 CYS A N     1 
ATOM   991  C CA    . CYS A 1 143 ? 18.825 9.409   172.589 1.00 42.00  ? 123 CYS A CA    1 
ATOM   992  C C     . CYS A 1 143 ? 20.197 9.524   171.894 1.00 37.86  ? 123 CYS A C     1 
ATOM   993  O O     . CYS A 1 143 ? 20.326 9.117   170.738 1.00 33.59  ? 123 CYS A O     1 
ATOM   994  C CB    . CYS A 1 143 ? 18.376 7.936   172.679 1.00 48.89  ? 123 CYS A CB    1 
ATOM   995  S SG    . CYS A 1 143 ? 19.275 6.813   173.843 1.00 52.45  ? 123 CYS A SG    1 
ATOM   996  N N     . ARG A 1 144 ? 21.198 10.100  172.572 1.00 30.35  ? 124 ARG A N     1 
ATOM   997  C CA    . ARG A 1 144 ? 22.540 10.343  171.985 1.00 26.23  ? 124 ARG A CA    1 
ATOM   998  C C     . ARG A 1 144 ? 23.642 10.333  173.074 1.00 26.80  ? 124 ARG A C     1 
ATOM   999  O O     . ARG A 1 144 ? 23.402 10.827  174.182 1.00 21.91  ? 124 ARG A O     1 
ATOM   1000 C CB    . ARG A 1 144 ? 22.547 11.687  171.215 1.00 27.04  ? 124 ARG A CB    1 
ATOM   1001 C CG    . ARG A 1 144 ? 23.903 12.152  170.673 1.00 35.34  ? 124 ARG A CG    1 
ATOM   1002 C CD    . ARG A 1 144 ? 23.827 13.523  169.934 1.00 37.58  ? 124 ARG A CD    1 
ATOM   1003 N NE    . ARG A 1 144 ? 23.857 14.689  170.827 1.00 28.78  ? 124 ARG A NE    1 
ATOM   1004 C CZ    . ARG A 1 144 ? 23.781 15.958  170.416 1.00 33.48  ? 124 ARG A CZ    1 
ATOM   1005 N NH1   . ARG A 1 144 ? 23.669 16.241  169.122 1.00 27.33  ? 124 ARG A NH1   1 
ATOM   1006 N NH2   . ARG A 1 144 ? 23.819 16.955  171.298 1.00 27.72  ? 124 ARG A NH2   1 
ATOM   1007 N N     . TYR A 1 145 ? 24.820 9.760   172.767 1.00 26.68  ? 125 TYR A N     1 
ATOM   1008 C CA    . TYR A 1 145 ? 25.967 9.664   173.712 1.00 29.78  ? 125 TYR A CA    1 
ATOM   1009 C C     . TYR A 1 145 ? 27.314 10.130  173.104 1.00 33.57  ? 125 TYR A C     1 
ATOM   1010 O O     . TYR A 1 145 ? 27.445 10.175  171.888 1.00 32.42  ? 125 TYR A O     1 
ATOM   1011 C CB    . TYR A 1 145 ? 26.169 8.216   174.205 1.00 29.33  ? 125 TYR A CB    1 
ATOM   1012 C CG    . TYR A 1 145 ? 24.989 7.517   174.881 1.00 32.69  ? 125 TYR A CG    1 
ATOM   1013 C CD1   . TYR A 1 145 ? 23.984 6.909   174.126 1.00 29.71  ? 125 TYR A CD1   1 
ATOM   1014 C CD2   . TYR A 1 145 ? 24.918 7.405   176.270 1.00 38.09  ? 125 TYR A CD2   1 
ATOM   1015 C CE1   . TYR A 1 145 ? 22.918 6.248   174.739 1.00 35.46  ? 125 TYR A CE1   1 
ATOM   1016 C CE2   . TYR A 1 145 ? 23.851 6.738   176.895 1.00 31.33  ? 125 TYR A CE2   1 
ATOM   1017 C CZ    . TYR A 1 145 ? 22.859 6.163   176.118 1.00 37.42  ? 125 TYR A CZ    1 
ATOM   1018 O OH    . TYR A 1 145 ? 21.810 5.502   176.712 1.00 42.99  ? 125 TYR A OH    1 
ATOM   1019 N N     . ASN A 1 146 ? 28.320 10.435  173.938 1.00 25.99  ? 126 ASN A N     1 
ATOM   1020 C CA    . ASN A 1 146 ? 29.696 10.660  173.439 1.00 29.96  ? 126 ASN A CA    1 
ATOM   1021 C C     . ASN A 1 146 ? 30.565 9.403   173.584 1.00 36.11  ? 126 ASN A C     1 
ATOM   1022 O O     . ASN A 1 146 ? 30.103 8.390   174.114 1.00 27.69  ? 126 ASN A O     1 
ATOM   1023 C CB    . ASN A 1 146 ? 30.377 11.869  174.136 1.00 26.49  ? 126 ASN A CB    1 
ATOM   1024 C CG    . ASN A 1 146 ? 30.633 11.663  175.645 1.00 31.05  ? 126 ASN A CG    1 
ATOM   1025 O OD1   . ASN A 1 146 ? 30.689 10.539  176.156 1.00 34.53  ? 126 ASN A OD1   1 
ATOM   1026 N ND2   . ASN A 1 146 ? 30.811 12.775  176.356 1.00 31.78  ? 126 ASN A ND2   1 
ATOM   1027 N N     . LEU A 1 147 ? 31.822 9.472   173.133 1.00 35.05  ? 127 LEU A N     1 
ATOM   1028 C CA    . LEU A 1 147 ? 32.703 8.290   173.112 1.00 46.55  ? 127 LEU A CA    1 
ATOM   1029 C C     . LEU A 1 147 ? 33.124 7.803   174.500 1.00 52.65  ? 127 LEU A C     1 
ATOM   1030 O O     . LEU A 1 147 ? 33.775 6.765   174.631 1.00 54.44  ? 127 LEU A O     1 
ATOM   1031 C CB    . LEU A 1 147 ? 33.960 8.571   172.280 1.00 43.45  ? 127 LEU A CB    1 
ATOM   1032 C CG    . LEU A 1 147 ? 33.779 8.519   170.766 1.00 43.01  ? 127 LEU A CG    1 
ATOM   1033 C CD1   . LEU A 1 147 ? 35.049 8.950   170.041 1.00 39.72  ? 127 LEU A CD1   1 
ATOM   1034 C CD2   . LEU A 1 147 ? 33.363 7.123   170.334 1.00 46.73  ? 127 LEU A CD2   1 
ATOM   1035 N N     . ARG A 1 148 ? 32.755 8.555   175.530 1.00 54.42  ? 128 ARG A N     1 
ATOM   1036 C CA    . ARG A 1 148 ? 33.039 8.162   176.902 1.00 48.39  ? 128 ARG A CA    1 
ATOM   1037 C C     . ARG A 1 148 ? 31.834 7.511   177.579 1.00 47.50  ? 128 ARG A C     1 
ATOM   1038 O O     . ARG A 1 148 ? 31.948 7.007   178.691 1.00 51.12  ? 128 ARG A O     1 
ATOM   1039 C CB    . ARG A 1 148 ? 33.504 9.372   177.710 1.00 44.76  ? 128 ARG A CB    1 
ATOM   1040 C CG    . ARG A 1 148 ? 34.947 9.756   177.446 1.00 59.23  ? 128 ARG A CG    1 
ATOM   1041 C CD    . ARG A 1 148 ? 35.127 11.256  177.494 1.00 75.03  ? 128 ARG A CD    1 
ATOM   1042 N NE    . ARG A 1 148 ? 34.618 11.817  178.740 1.00 88.84  ? 128 ARG A NE    1 
ATOM   1043 C CZ    . ARG A 1 148 ? 34.478 13.117  178.969 1.00 96.85  ? 128 ARG A CZ    1 
ATOM   1044 N NH1   . ARG A 1 148 ? 34.803 13.993  178.028 1.00 103.57 ? 128 ARG A NH1   1 
ATOM   1045 N NH2   . ARG A 1 148 ? 34.009 13.541  180.134 1.00 97.21  ? 128 ARG A NH2   1 
ATOM   1046 N N     . GLY A 1 149 ? 30.681 7.526   176.917 1.00 43.33  ? 129 GLY A N     1 
ATOM   1047 C CA    . GLY A 1 149 ? 29.480 6.924   177.484 1.00 45.75  ? 129 GLY A CA    1 
ATOM   1048 C C     . GLY A 1 149 ? 28.570 7.841   178.296 1.00 41.61  ? 129 GLY A C     1 
ATOM   1049 O O     . GLY A 1 149 ? 27.738 7.365   179.078 1.00 34.33  ? 129 GLY A O     1 
ATOM   1050 N N     . GLU A 1 150 ? 28.721 9.152   178.116 1.00 29.39  ? 130 GLU A N     1 
ATOM   1051 C CA    . GLU A 1 150 ? 27.868 10.130  178.791 1.00 30.64  ? 130 GLU A CA    1 
ATOM   1052 C C     . GLU A 1 150 ? 26.715 10.581  177.884 1.00 31.73  ? 130 GLU A C     1 
ATOM   1053 O O     . GLU A 1 150 ? 26.918 10.811  176.695 1.00 33.39  ? 130 GLU A O     1 
ATOM   1054 C CB    . GLU A 1 150 ? 28.705 11.337  179.243 1.00 39.39  ? 130 GLU A CB    1 
ATOM   1055 C CG    . GLU A 1 150 ? 29.894 10.945  180.123 1.00 49.42  ? 130 GLU A CG    1 
ATOM   1056 C CD    . GLU A 1 150 ? 30.835 12.106  180.428 1.00 59.64  ? 130 GLU A CD    1 
ATOM   1057 O OE1   . GLU A 1 150 ? 31.372 12.140  181.556 1.00 67.65  ? 130 GLU A OE1   1 
ATOM   1058 O OE2   . GLU A 1 150 ? 31.052 12.971  179.549 1.00 47.89  ? 130 GLU A OE2   1 
ATOM   1059 N N     . PHE A 1 151 ? 25.514 10.689  178.453 1.00 27.86  ? 131 PHE A N     1 
ATOM   1060 C CA    . PHE A 1 151 ? 24.307 11.151  177.748 1.00 23.17  ? 131 PHE A CA    1 
ATOM   1061 C C     . PHE A 1 151 ? 24.388 12.680  177.544 1.00 29.45  ? 131 PHE A C     1 
ATOM   1062 O O     . PHE A 1 151 ? 24.658 13.387  178.512 1.00 28.28  ? 131 PHE A O     1 
ATOM   1063 C CB    . PHE A 1 151 ? 23.072 10.736  178.582 1.00 26.48  ? 131 PHE A CB    1 
ATOM   1064 C CG    . PHE A 1 151 ? 21.727 11.072  177.957 1.00 29.78  ? 131 PHE A CG    1 
ATOM   1065 C CD1   . PHE A 1 151 ? 21.085 10.169  177.112 1.00 23.96  ? 131 PHE A CD1   1 
ATOM   1066 C CD2   . PHE A 1 151 ? 21.080 12.264  178.266 1.00 27.89  ? 131 PHE A CD2   1 
ATOM   1067 C CE1   . PHE A 1 151 ? 19.836 10.465  176.558 1.00 26.89  ? 131 PHE A CE1   1 
ATOM   1068 C CE2   . PHE A 1 151 ? 19.833 12.570  177.706 1.00 26.33  ? 131 PHE A CE2   1 
ATOM   1069 C CZ    . PHE A 1 151 ? 19.210 11.667  176.859 1.00 30.64  ? 131 PHE A CZ    1 
ATOM   1070 N N     . ASN A 1 152 ? 24.198 13.200  176.318 1.00 24.88  ? 132 ASN A N     1 
ATOM   1071 C CA    . ASN A 1 152 ? 24.374 14.657  176.088 1.00 20.28  ? 132 ASN A CA    1 
ATOM   1072 C C     . ASN A 1 152 ? 23.333 15.412  175.215 1.00 28.36  ? 132 ASN A C     1 
ATOM   1073 O O     . ASN A 1 152 ? 23.689 16.375  174.507 1.00 23.47  ? 132 ASN A O     1 
ATOM   1074 C CB    . ASN A 1 152 ? 25.782 14.930  175.498 1.00 23.11  ? 132 ASN A CB    1 
ATOM   1075 C CG    . ASN A 1 152 ? 25.968 14.393  174.071 1.00 26.28  ? 132 ASN A CG    1 
ATOM   1076 O OD1   . ASN A 1 152 ? 25.054 13.821  173.472 1.00 24.83  ? 132 ASN A OD1   1 
ATOM   1077 N ND2   . ASN A 1 152 ? 27.169 14.595  173.520 1.00 27.75  ? 132 ASN A ND2   1 
ATOM   1078 N N     . VAL A 1 153 ? 22.065 14.999  175.284 1.00 21.60  ? 133 VAL A N     1 
ATOM   1079 C CA    . VAL A 1 153 ? 20.926 15.732  174.674 1.00 25.67  ? 133 VAL A CA    1 
ATOM   1080 C C     . VAL A 1 153 ? 20.495 16.968  175.516 1.00 30.60  ? 133 VAL A C     1 
ATOM   1081 O O     . VAL A 1 153 ? 20.386 16.856  176.735 1.00 22.69  ? 133 VAL A O     1 
ATOM   1082 C CB    . VAL A 1 153 ? 19.693 14.783  174.506 1.00 28.63  ? 133 VAL A CB    1 
ATOM   1083 C CG1   . VAL A 1 153 ? 18.486 15.524  173.953 1.00 25.70  ? 133 VAL A CG1   1 
ATOM   1084 C CG2   . VAL A 1 153 ? 20.044 13.542  173.639 1.00 19.12  ? 133 VAL A CG2   1 
ATOM   1085 N N     . PRO A 1 154 ? 20.240 18.138  174.875 1.00 22.46  ? 134 PRO A N     1 
ATOM   1086 C CA    . PRO A 1 154 ? 19.861 19.367  175.616 1.00 26.53  ? 134 PRO A CA    1 
ATOM   1087 C C     . PRO A 1 154 ? 18.360 19.503  175.989 1.00 31.42  ? 134 PRO A C     1 
ATOM   1088 O O     . PRO A 1 154 ? 17.567 18.632  175.637 1.00 27.04  ? 134 PRO A O     1 
ATOM   1089 C CB    . PRO A 1 154 ? 20.261 20.488  174.645 1.00 27.63  ? 134 PRO A CB    1 
ATOM   1090 C CG    . PRO A 1 154 ? 20.076 19.871  173.287 1.00 29.54  ? 134 PRO A CG    1 
ATOM   1091 C CD    . PRO A 1 154 ? 20.450 18.411  173.439 1.00 23.60  ? 134 PRO A CD    1 
ATOM   1092 N N     . PHE A 1 155 ? 17.997 20.588  176.687 1.00 28.86  ? 135 PHE A N     1 
ATOM   1093 C CA    . PHE A 1 155 ? 16.632 20.811  177.216 1.00 28.39  ? 135 PHE A CA    1 
ATOM   1094 C C     . PHE A 1 155 ? 15.597 20.959  176.093 1.00 30.82  ? 135 PHE A C     1 
ATOM   1095 O O     . PHE A 1 155 ? 15.908 21.532  175.055 1.00 29.40  ? 135 PHE A O     1 
ATOM   1096 C CB    . PHE A 1 155 ? 16.624 22.057  178.125 1.00 36.72  ? 135 PHE A CB    1 
ATOM   1097 C CG    . PHE A 1 155 ? 15.295 22.343  178.804 1.00 37.26  ? 135 PHE A CG    1 
ATOM   1098 C CD1   . PHE A 1 155 ? 14.693 21.404  179.632 1.00 34.79  ? 135 PHE A CD1   1 
ATOM   1099 C CD2   . PHE A 1 155 ? 14.680 23.583  178.657 1.00 37.47  ? 135 PHE A CD2   1 
ATOM   1100 C CE1   . PHE A 1 155 ? 13.476 21.685  180.273 1.00 35.44  ? 135 PHE A CE1   1 
ATOM   1101 C CE2   . PHE A 1 155 ? 13.464 23.871  179.294 1.00 37.88  ? 135 PHE A CE2   1 
ATOM   1102 C CZ    . PHE A 1 155 ? 12.865 22.921  180.105 1.00 37.06  ? 135 PHE A CZ    1 
ATOM   1103 N N     . GLY A 1 156 ? 14.375 20.450  176.300 1.00 30.57  ? 136 GLY A N     1 
ATOM   1104 C CA    . GLY A 1 156 ? 13.359 20.421  175.245 1.00 28.42  ? 136 GLY A CA    1 
ATOM   1105 C C     . GLY A 1 156 ? 12.260 21.490  175.211 1.00 37.52  ? 136 GLY A C     1 
ATOM   1106 O O     . GLY A 1 156 ? 11.705 21.779  174.145 1.00 37.76  ? 136 GLY A O     1 
ATOM   1107 N N     . ARG A 1 157 ? 11.920 22.052  176.370 1.00 40.40  ? 137 ARG A N     1 
ATOM   1108 C CA    . ARG A 1 157 ? 10.901 23.114  176.484 1.00 51.74  ? 137 ARG A CA    1 
ATOM   1109 C C     . ARG A 1 157 ? 9.475  22.789  175.976 1.00 51.35  ? 137 ARG A C     1 
ATOM   1110 O O     . ARG A 1 157 ? 8.906  23.563  175.201 1.00 55.58  ? 137 ARG A O     1 
ATOM   1111 C CB    . ARG A 1 157 ? 11.390 24.378  175.762 1.00 51.40  ? 137 ARG A CB    1 
ATOM   1112 N N     . TYR A 1 158 ? 8.893  21.677  176.390 1.00 41.67  ? 138 TYR A N     1 
ATOM   1113 C CA    . TYR A 1 158 ? 7.499  21.341  176.132 1.00 40.73  ? 138 TYR A CA    1 
ATOM   1114 C C     . TYR A 1 158 ? 6.562  22.101  177.098 1.00 46.94  ? 138 TYR A C     1 
ATOM   1115 O O     . TYR A 1 158 ? 7.003  22.689  178.057 1.00 45.30  ? 138 TYR A O     1 
ATOM   1116 C CB    . TYR A 1 158 ? 7.275  19.816  176.217 1.00 40.08  ? 138 TYR A CB    1 
ATOM   1117 C CG    . TYR A 1 158 ? 7.940  18.997  175.116 1.00 40.30  ? 138 TYR A CG    1 
ATOM   1118 C CD1   . TYR A 1 158 ? 9.247  18.613  175.212 1.00 43.88  ? 138 TYR A CD1   1 
ATOM   1119 C CD2   . TYR A 1 158 ? 7.271  18.663  173.977 1.00 43.85  ? 138 TYR A CD2   1 
ATOM   1120 C CE1   . TYR A 1 158 ? 9.866  17.921  174.208 1.00 37.65  ? 138 TYR A CE1   1 
ATOM   1121 C CE2   . TYR A 1 158 ? 7.881  17.960  172.969 1.00 41.02  ? 138 TYR A CE2   1 
ATOM   1122 C CZ    . TYR A 1 158 ? 9.188  17.591  173.100 1.00 42.24  ? 138 TYR A CZ    1 
ATOM   1123 O OH    . TYR A 1 158 ? 9.797  16.891  172.123 1.00 37.44  ? 138 TYR A OH    1 
ATOM   1124 N N     . LYS A 1 159 ? 5.271  22.098  176.834 1.00 43.56  ? 139 LYS A N     1 
ATOM   1125 C CA    . LYS A 1 159 ? 4.331  22.823  177.663 1.00 46.61  ? 139 LYS A CA    1 
ATOM   1126 C C     . LYS A 1 159 ? 3.856  22.076  178.899 1.00 50.58  ? 139 LYS A C     1 
ATOM   1127 O O     . LYS A 1 159 ? 3.864  22.639  179.967 1.00 41.40  ? 139 LYS A O     1 
ATOM   1128 C CB    . LYS A 1 159 ? 3.125  23.281  176.845 1.00 50.12  ? 139 LYS A CB    1 
ATOM   1129 N N     . LYS A 1 160 ? 3.416  20.836  178.734 1.00 38.73  ? 140 LYS A N     1 
ATOM   1130 C CA    . LYS A 1 160 ? 3.002  19.976  179.836 1.00 45.61  ? 140 LYS A CA    1 
ATOM   1131 C C     . LYS A 1 160 ? 3.168  18.469  179.584 1.00 40.16  ? 140 LYS A C     1 
ATOM   1132 O O     . LYS A 1 160 ? 2.306  17.814  179.060 1.00 44.89  ? 140 LYS A O     1 
ATOM   1133 C CB    . LYS A 1 160 ? 1.578  20.294  180.302 1.00 49.21  ? 140 LYS A CB    1 
ATOM   1134 N N     . PRO A 1 161 ? 4.400  17.942  180.010 1.00 40.00  ? 141 PRO A N     1 
ATOM   1135 C CA    . PRO A 1 161 ? 4.580  16.503  179.706 1.00 32.01  ? 141 PRO A CA    1 
ATOM   1136 C C     . PRO A 1 161 ? 3.708  15.499  180.481 1.00 43.55  ? 141 PRO A C     1 
ATOM   1137 O O     . PRO A 1 161 ? 3.326  15.787  181.574 1.00 42.07  ? 141 PRO A O     1 
ATOM   1138 C CB    . PRO A 1 161 ? 6.040  16.242  180.038 1.00 42.23  ? 141 PRO A CB    1 
ATOM   1139 C CG    . PRO A 1 161 ? 6.718  17.539  180.051 1.00 41.32  ? 141 PRO A CG    1 
ATOM   1140 C CD    . PRO A 1 161 ? 5.723  18.447  180.629 1.00 33.03  ? 141 PRO A CD    1 
ATOM   1141 N N     . TYR A 1 162 ? 3.462  14.331  179.904 1.00 40.94  ? 142 TYR A N     1 
ATOM   1142 C CA    . TYR A 1 162 ? 2.529  13.322  180.432 1.00 43.17  ? 142 TYR A CA    1 
ATOM   1143 C C     . TYR A 1 162 ? 3.248  12.165  181.170 1.00 41.90  ? 142 TYR A C     1 
ATOM   1144 O O     . TYR A 1 162 ? 4.280  11.662  180.702 1.00 33.22  ? 142 TYR A O     1 
ATOM   1145 C CB    . TYR A 1 162 ? 1.678  12.785  179.264 1.00 42.79  ? 142 TYR A CB    1 
ATOM   1146 C CG    . TYR A 1 162 ? 0.912  11.492  179.494 1.00 44.90  ? 142 TYR A CG    1 
ATOM   1147 C CD1   . TYR A 1 162 ? -0.247 11.469  180.268 1.00 43.59  ? 142 TYR A CD1   1 
ATOM   1148 C CD2   . TYR A 1 162 ? 1.320  10.303  178.895 1.00 42.22  ? 142 TYR A CD2   1 
ATOM   1149 C CE1   . TYR A 1 162 ? -0.958 10.291  180.464 1.00 48.60  ? 142 TYR A CE1   1 
ATOM   1150 C CE2   . TYR A 1 162 ? 0.616  9.122   179.084 1.00 47.21  ? 142 TYR A CE2   1 
ATOM   1151 C CZ    . TYR A 1 162 ? -0.523 9.122   179.870 1.00 51.87  ? 142 TYR A CZ    1 
ATOM   1152 O OH    . TYR A 1 162 ? -1.230 7.954   180.068 1.00 49.99  ? 142 TYR A OH    1 
ATOM   1153 N N     . PHE A 1 163 ? 2.721  11.757  182.328 1.00 38.04  ? 143 PHE A N     1 
ATOM   1154 C CA    . PHE A 1 163 ? 3.289  10.622  183.079 1.00 35.73  ? 143 PHE A CA    1 
ATOM   1155 C C     . PHE A 1 163 ? 2.530  9.325   182.766 1.00 35.95  ? 143 PHE A C     1 
ATOM   1156 O O     . PHE A 1 163 ? 1.358  9.189   183.111 1.00 40.44  ? 143 PHE A O     1 
ATOM   1157 C CB    . PHE A 1 163 ? 3.280  10.899  184.591 1.00 37.76  ? 143 PHE A CB    1 
ATOM   1158 C CG    . PHE A 1 163 ? 3.838  9.761   185.427 1.00 31.94  ? 143 PHE A CG    1 
ATOM   1159 C CD1   . PHE A 1 163 ? 5.196  9.464   185.406 1.00 29.52  ? 143 PHE A CD1   1 
ATOM   1160 C CD2   . PHE A 1 163 ? 3.000  8.993   186.237 1.00 37.39  ? 143 PHE A CD2   1 
ATOM   1161 C CE1   . PHE A 1 163 ? 5.711  8.409   186.172 1.00 35.66  ? 143 PHE A CE1   1 
ATOM   1162 C CE2   . PHE A 1 163 ? 3.511  7.937   187.009 1.00 37.05  ? 143 PHE A CE2   1 
ATOM   1163 C CZ    . PHE A 1 163 ? 4.865  7.650   186.974 1.00 36.15  ? 143 PHE A CZ    1 
ATOM   1164 N N     . PRO A 1 164 ? 3.204  8.369   182.101 1.00 30.07  ? 144 PRO A N     1 
ATOM   1165 C CA    . PRO A 1 164 ? 2.570  7.155   181.556 1.00 36.37  ? 144 PRO A CA    1 
ATOM   1166 C C     . PRO A 1 164 ? 2.268  6.039   182.574 1.00 41.52  ? 144 PRO A C     1 
ATOM   1167 O O     . PRO A 1 164 ? 2.850  4.954   182.470 1.00 33.77  ? 144 PRO A O     1 
ATOM   1168 C CB    . PRO A 1 164 ? 3.607  6.661   180.541 1.00 35.66  ? 144 PRO A CB    1 
ATOM   1169 C CG    . PRO A 1 164 ? 4.930  7.102   181.123 1.00 26.39  ? 144 PRO A CG    1 
ATOM   1170 C CD    . PRO A 1 164 ? 4.639  8.448   181.756 1.00 37.50  ? 144 PRO A CD    1 
ATOM   1171 N N     . GLU A 1 165 ? 1.350  6.271   183.508 1.00 36.52  ? 145 GLU A N     1 
ATOM   1172 C CA    . GLU A 1 165 ? 1.135  5.305   184.582 1.00 42.27  ? 145 GLU A CA    1 
ATOM   1173 C C     . GLU A 1 165 ? 0.440  4.031   184.098 1.00 45.65  ? 145 GLU A C     1 
ATOM   1174 O O     . GLU A 1 165 ? 0.915  2.925   184.366 1.00 39.25  ? 145 GLU A O     1 
ATOM   1175 C CB    . GLU A 1 165 ? 0.334  5.933   185.728 1.00 49.87  ? 145 GLU A CB    1 
ATOM   1176 C CG    . GLU A 1 165 ? 0.103  4.970   186.891 1.00 53.13  ? 145 GLU A CG    1 
ATOM   1177 C CD    . GLU A 1 165 ? -0.291 5.675   188.175 1.00 62.83  ? 145 GLU A CD    1 
ATOM   1178 O OE1   . GLU A 1 165 ? 0.119  6.841   188.375 1.00 69.79  ? 145 GLU A OE1   1 
ATOM   1179 O OE2   . GLU A 1 165 ? -1.014 5.062   188.985 1.00 65.94  ? 145 GLU A OE2   1 
ATOM   1180 N N     . ALA A 1 166 ? -0.676 4.183   183.389 1.00 37.23  ? 146 ALA A N     1 
ATOM   1181 C CA    . ALA A 1 166 ? -1.398 3.033   182.849 1.00 45.72  ? 146 ALA A CA    1 
ATOM   1182 C C     . ALA A 1 166 ? -0.495 2.134   181.983 1.00 44.83  ? 146 ALA A C     1 
ATOM   1183 O O     . ALA A 1 166 ? -0.490 0.909   182.138 1.00 42.13  ? 146 ALA A O     1 
ATOM   1184 C CB    . ALA A 1 166 ? -2.599 3.498   182.052 1.00 48.22  ? 146 ALA A CB    1 
ATOM   1185 N N     . GLU A 1 167 ? 0.283  2.751   181.098 1.00 35.64  ? 147 GLU A N     1 
ATOM   1186 C CA    . GLU A 1 167 ? 1.162  2.013   180.191 1.00 37.07  ? 147 GLU A CA    1 
ATOM   1187 C C     . GLU A 1 167 ? 2.269  1.226   180.915 1.00 36.25  ? 147 GLU A C     1 
ATOM   1188 O O     . GLU A 1 167 ? 2.703  0.178   180.441 1.00 36.92  ? 147 GLU A O     1 
ATOM   1189 C CB    . GLU A 1 167 ? 1.789  2.974   179.170 1.00 43.95  ? 147 GLU A CB    1 
ATOM   1190 C CG    . GLU A 1 167 ? 0.808  3.563   178.149 1.00 47.50  ? 147 GLU A CG    1 
ATOM   1191 C CD    . GLU A 1 167 ? 0.042  4.775   178.675 1.00 57.84  ? 147 GLU A CD    1 
ATOM   1192 O OE1   . GLU A 1 167 ? 0.203  5.117   179.866 1.00 58.16  ? 147 GLU A OE1   1 
ATOM   1193 O OE2   . GLU A 1 167 ? -0.719 5.391   177.895 1.00 59.30  ? 147 GLU A OE2   1 
ATOM   1194 N N     . LEU A 1 168 ? 2.726  1.727   182.058 1.00 33.57  ? 148 LEU A N     1 
ATOM   1195 C CA    . LEU A 1 168 ? 3.755  1.030   182.830 1.00 36.39  ? 148 LEU A CA    1 
ATOM   1196 C C     . LEU A 1 168 ? 3.239  -0.271  183.486 1.00 38.54  ? 148 LEU A C     1 
ATOM   1197 O O     . LEU A 1 168 ? 3.924  -1.294  183.456 1.00 36.59  ? 148 LEU A O     1 
ATOM   1198 C CB    . LEU A 1 168 ? 4.341  1.961   183.901 1.00 31.98  ? 148 LEU A CB    1 
ATOM   1199 C CG    . LEU A 1 168 ? 5.471  2.921   183.511 1.00 35.39  ? 148 LEU A CG    1 
ATOM   1200 C CD1   . LEU A 1 168 ? 5.728  3.930   184.635 1.00 32.92  ? 148 LEU A CD1   1 
ATOM   1201 C CD2   . LEU A 1 168 ? 6.763  2.170   183.158 1.00 33.63  ? 148 LEU A CD2   1 
ATOM   1202 N N     . TYR A 1 169 ? 2.046  -0.240  184.080 1.00 40.14  ? 149 TYR A N     1 
ATOM   1203 C CA    . TYR A 1 169 ? 1.489  -1.449  184.703 1.00 39.66  ? 149 TYR A CA    1 
ATOM   1204 C C     . TYR A 1 169 ? 1.191  -2.557  183.682 1.00 40.57  ? 149 TYR A C     1 
ATOM   1205 O O     . TYR A 1 169 ? 1.440  -3.735  183.950 1.00 40.04  ? 149 TYR A O     1 
ATOM   1206 C CB    . TYR A 1 169 ? 0.213  -1.127  185.498 1.00 43.68  ? 149 TYR A CB    1 
ATOM   1207 C CG    . TYR A 1 169 ? 0.467  -0.575  186.883 1.00 45.90  ? 149 TYR A CG    1 
ATOM   1208 C CD1   . TYR A 1 169 ? 0.133  0.733   187.203 1.00 52.30  ? 149 TYR A CD1   1 
ATOM   1209 C CD2   . TYR A 1 169 ? 1.049  -1.361  187.872 1.00 50.43  ? 149 TYR A CD2   1 
ATOM   1210 C CE1   . TYR A 1 169 ? 0.366  1.244   188.476 1.00 55.71  ? 149 TYR A CE1   1 
ATOM   1211 C CE2   . TYR A 1 169 ? 1.290  -0.857  189.146 1.00 49.94  ? 149 TYR A CE2   1 
ATOM   1212 C CZ    . TYR A 1 169 ? 0.945  0.447   189.439 1.00 55.07  ? 149 TYR A CZ    1 
ATOM   1213 O OH    . TYR A 1 169 ? 1.176  0.956   190.696 1.00 56.07  ? 149 TYR A OH    1 
ATOM   1214 N N     . HIS A 1 170 ? 0.652  -2.181  182.524 1.00 37.09  ? 150 HIS A N     1 
ATOM   1215 C CA    . HIS A 1 170 ? 0.374  -3.148  181.454 1.00 40.40  ? 150 HIS A CA    1 
ATOM   1216 C C     . HIS A 1 170 ? 1.664  -3.800  180.916 1.00 34.49  ? 150 HIS A C     1 
ATOM   1217 O O     . HIS A 1 170 ? 1.660  -4.982  180.569 1.00 41.03  ? 150 HIS A O     1 
ATOM   1218 C CB    . HIS A 1 170 ? -0.406 -2.474  180.315 1.00 48.96  ? 150 HIS A CB    1 
ATOM   1219 C CG    . HIS A 1 170 ? -0.577 -3.330  179.095 1.00 59.75  ? 150 HIS A CG    1 
ATOM   1220 N ND1   . HIS A 1 170 ? -1.456 -4.393  179.043 1.00 66.44  ? 150 HIS A ND1   1 
ATOM   1221 C CD2   . HIS A 1 170 ? 0.008  -3.269  177.874 1.00 59.03  ? 150 HIS A CD2   1 
ATOM   1222 C CE1   . HIS A 1 170 ? -1.398 -4.953  177.848 1.00 64.82  ? 150 HIS A CE1   1 
ATOM   1223 N NE2   . HIS A 1 170 ? -0.517 -4.289  177.118 1.00 64.14  ? 150 HIS A NE2   1 
ATOM   1224 N N     . PHE A 1 171 ? 2.762  -3.047  180.871 1.00 31.11  ? 151 PHE A N     1 
ATOM   1225 C CA    . PHE A 1 171 ? 4.044  -3.594  180.397 1.00 32.25  ? 151 PHE A CA    1 
ATOM   1226 C C     . PHE A 1 171 ? 4.545  -4.659  181.380 1.00 34.34  ? 151 PHE A C     1 
ATOM   1227 O O     . PHE A 1 171 ? 5.021  -5.716  180.970 1.00 35.99  ? 151 PHE A O     1 
ATOM   1228 C CB    . PHE A 1 171 ? 5.092  -2.475  180.214 1.00 27.20  ? 151 PHE A CB    1 
ATOM   1229 C CG    . PHE A 1 171 ? 6.427  -2.950  179.647 1.00 30.28  ? 151 PHE A CG    1 
ATOM   1230 C CD1   . PHE A 1 171 ? 6.767  -2.693  178.324 1.00 40.92  ? 151 PHE A CD1   1 
ATOM   1231 C CD2   . PHE A 1 171 ? 7.344  -3.632  180.441 1.00 35.11  ? 151 PHE A CD2   1 
ATOM   1232 C CE1   . PHE A 1 171 ? 7.993  -3.116  177.793 1.00 35.19  ? 151 PHE A CE1   1 
ATOM   1233 C CE2   . PHE A 1 171 ? 8.569  -4.064  179.923 1.00 36.09  ? 151 PHE A CE2   1 
ATOM   1234 C CZ    . PHE A 1 171 ? 8.892  -3.803  178.594 1.00 34.42  ? 151 PHE A CZ    1 
ATOM   1235 N N     . ALA A 1 172 ? 4.417  -4.383  182.677 1.00 35.87  ? 152 ALA A N     1 
ATOM   1236 C CA    . ALA A 1 172 ? 4.882  -5.313  183.712 1.00 34.58  ? 152 ALA A CA    1 
ATOM   1237 C C     . ALA A 1 172 ? 4.118  -6.628  183.669 1.00 32.41  ? 152 ALA A C     1 
ATOM   1238 O O     . ALA A 1 172 ? 4.683  -7.694  183.905 1.00 35.13  ? 152 ALA A O     1 
ATOM   1239 C CB    . ALA A 1 172 ? 4.760  -4.679  185.101 1.00 30.90  ? 152 ALA A CB    1 
ATOM   1240 N N     . GLU A 1 173 ? 2.827  -6.537  183.369 1.00 34.16  ? 153 GLU A N     1 
ATOM   1241 C CA    . GLU A 1 173 ? 1.941  -7.696  183.354 1.00 48.02  ? 153 GLU A CA    1 
ATOM   1242 C C     . GLU A 1 173 ? 2.280  -8.662  182.215 1.00 48.46  ? 153 GLU A C     1 
ATOM   1243 O O     . GLU A 1 173 ? 2.375  -9.870  182.430 1.00 51.15  ? 153 GLU A O     1 
ATOM   1244 C CB    . GLU A 1 173 ? 0.486  -7.226  183.255 1.00 53.66  ? 153 GLU A CB    1 
ATOM   1245 C CG    . GLU A 1 173 ? -0.560 -8.316  183.198 1.00 63.13  ? 153 GLU A CG    1 
ATOM   1246 C CD    . GLU A 1 173 ? -1.964 -7.746  182.996 1.00 70.79  ? 153 GLU A CD    1 
ATOM   1247 O OE1   . GLU A 1 173 ? -2.592 -7.319  183.994 1.00 65.92  ? 153 GLU A OE1   1 
ATOM   1248 O OE2   . GLU A 1 173 ? -2.433 -7.717  181.834 1.00 65.41  ? 153 GLU A OE2   1 
ATOM   1249 N N     . LYS A 1 174 ? 2.476  -8.127  181.009 1.00 42.09  ? 154 LYS A N     1 
ATOM   1250 C CA    . LYS A 1 174 ? 2.818  -8.963  179.857 1.00 40.60  ? 154 LYS A CA    1 
ATOM   1251 C C     . LYS A 1 174 ? 4.230  -9.553  179.952 1.00 38.76  ? 154 LYS A C     1 
ATOM   1252 O O     . LYS A 1 174 ? 4.488  -10.627 179.408 1.00 39.80  ? 154 LYS A O     1 
ATOM   1253 C CB    . LYS A 1 174 ? 2.677  -8.173  178.552 1.00 52.90  ? 154 LYS A CB    1 
ATOM   1254 C CG    . LYS A 1 174 ? 2.232  -9.041  177.377 1.00 64.47  ? 154 LYS A CG    1 
ATOM   1255 C CD    . LYS A 1 174 ? 1.805  -8.219  176.170 1.00 57.59  ? 154 LYS A CD    1 
ATOM   1256 C CE    . LYS A 1 174 ? 1.075  -9.075  175.136 1.00 53.20  ? 154 LYS A CE    1 
ATOM   1257 N NZ    . LYS A 1 174 ? 1.882  -10.223 174.638 1.00 43.81  ? 154 LYS A NZ    1 
ATOM   1258 N N     . ALA A 1 175 ? 5.136  -8.861  180.647 1.00 32.84  ? 155 ALA A N     1 
ATOM   1259 C CA    . ALA A 1 175 ? 6.530  -9.308  180.757 1.00 39.99  ? 155 ALA A CA    1 
ATOM   1260 C C     . ALA A 1 175 ? 6.745  -10.553 181.641 1.00 42.60  ? 155 ALA A C     1 
ATOM   1261 O O     . ALA A 1 175 ? 7.850  -11.098 181.688 1.00 37.27  ? 155 ALA A O     1 
ATOM   1262 C CB    . ALA A 1 175 ? 7.398  -8.171  181.268 1.00 38.03  ? 155 ALA A CB    1 
ATOM   1263 N N     . GLN A 1 176 ? 5.707  -11.014 182.333 1.00 38.62  ? 156 GLN A N     1 
ATOM   1264 C CA    . GLN A 1 176 ? 5.863  -12.196 183.176 1.00 48.03  ? 156 GLN A CA    1 
ATOM   1265 C C     . GLN A 1 176 ? 6.209  -13.439 182.344 1.00 46.75  ? 156 GLN A C     1 
ATOM   1266 O O     . GLN A 1 176 ? 6.724  -14.413 182.876 1.00 41.84  ? 156 GLN A O     1 
ATOM   1267 C CB    . GLN A 1 176 ? 4.600  -12.445 184.011 1.00 48.73  ? 156 GLN A CB    1 
ATOM   1268 C CG    . GLN A 1 176 ? 4.298  -11.345 185.019 1.00 53.66  ? 156 GLN A CG    1 
ATOM   1269 C CD    . GLN A 1 176 ? 5.475  -11.033 185.941 1.00 65.18  ? 156 GLN A CD    1 
ATOM   1270 O OE1   . GLN A 1 176 ? 6.121  -11.936 186.478 1.00 63.62  ? 156 GLN A OE1   1 
ATOM   1271 N NE2   . GLN A 1 176 ? 5.757  -9.745  186.126 1.00 66.02  ? 156 GLN A NE2   1 
ATOM   1272 N N     . ASN A 1 177 ? 5.948  -13.389 181.040 1.00 36.68  ? 157 ASN A N     1 
ATOM   1273 C CA    . ASN A 1 177 ? 6.291  -14.490 180.138 1.00 46.36  ? 157 ASN A CA    1 
ATOM   1274 C C     . ASN A 1 177 ? 7.450  -14.219 179.157 1.00 45.53  ? 157 ASN A C     1 
ATOM   1275 O O     . ASN A 1 177 ? 7.500  -14.828 178.085 1.00 45.46  ? 157 ASN A O     1 
ATOM   1276 C CB    . ASN A 1 177 ? 5.054  -14.891 179.326 1.00 55.99  ? 157 ASN A CB    1 
ATOM   1277 C CG    . ASN A 1 177 ? 3.980  -15.546 180.179 1.00 72.55  ? 157 ASN A CG    1 
ATOM   1278 O OD1   . ASN A 1 177 ? 2.895  -14.993 180.361 1.00 74.34  ? 157 ASN A OD1   1 
ATOM   1279 N ND2   . ASN A 1 177 ? 4.276  -16.734 180.698 1.00 77.06  ? 157 ASN A ND2   1 
ATOM   1280 N N     . ALA A 1 178 ? 8.375  -13.325 179.508 1.00 34.18  ? 158 ALA A N     1 
ATOM   1281 C CA    . ALA A 1 178 ? 9.525  -13.036 178.637 1.00 32.98  ? 158 ALA A CA    1 
ATOM   1282 C C     . ALA A 1 178 ? 10.893 -13.049 179.348 1.00 36.93  ? 158 ALA A C     1 
ATOM   1283 O O     . ALA A 1 178 ? 10.978 -12.786 180.548 1.00 35.57  ? 158 ALA A O     1 
ATOM   1284 C CB    . ALA A 1 178 ? 9.323  -11.689 177.959 1.00 31.38  ? 158 ALA A CB    1 
ATOM   1285 N N     . PHE A 1 179 ? 11.954 -13.342 178.589 1.00 38.52  ? 159 PHE A N     1 
ATOM   1286 C CA    . PHE A 1 179 ? 13.346 -13.137 179.033 1.00 36.90  ? 159 PHE A CA    1 
ATOM   1287 C C     . PHE A 1 179 ? 14.030 -12.024 178.195 1.00 40.68  ? 159 PHE A C     1 
ATOM   1288 O O     . PHE A 1 179 ? 13.756 -11.901 176.992 1.00 29.74  ? 159 PHE A O     1 
ATOM   1289 C CB    . PHE A 1 179 ? 14.165 -14.438 178.930 1.00 32.96  ? 159 PHE A CB    1 
ATOM   1290 C CG    . PHE A 1 179 ? 13.743 -15.524 179.898 1.00 34.68  ? 159 PHE A CG    1 
ATOM   1291 C CD1   . PHE A 1 179 ? 13.735 -16.858 179.501 1.00 40.77  ? 159 PHE A CD1   1 
ATOM   1292 C CD2   . PHE A 1 179 ? 13.373 -15.221 181.198 1.00 40.68  ? 159 PHE A CD2   1 
ATOM   1293 C CE1   . PHE A 1 179 ? 13.351 -17.868 180.379 1.00 47.73  ? 159 PHE A CE1   1 
ATOM   1294 C CE2   . PHE A 1 179 ? 12.986 -16.233 182.085 1.00 48.23  ? 159 PHE A CE2   1 
ATOM   1295 C CZ    . PHE A 1 179 ? 12.978 -17.554 181.673 1.00 43.98  ? 159 PHE A CZ    1 
ATOM   1296 N N     . PHE A 1 180 ? 14.916 -11.243 178.832 1.00 28.06  ? 160 PHE A N     1 
ATOM   1297 C CA    . PHE A 1 180 ? 15.639 -10.095 178.217 1.00 34.18  ? 160 PHE A CA    1 
ATOM   1298 C C     . PHE A 1 180 ? 17.190 -10.277 178.156 1.00 40.33  ? 160 PHE A C     1 
ATOM   1299 O O     . PHE A 1 180 ? 17.790 -10.752 179.125 1.00 36.76  ? 160 PHE A O     1 
ATOM   1300 C CB    . PHE A 1 180 ? 15.349 -8.791  178.995 1.00 24.83  ? 160 PHE A CB    1 
ATOM   1301 C CG    . PHE A 1 180 ? 13.894 -8.363  178.998 1.00 35.40  ? 160 PHE A CG    1 
ATOM   1302 C CD1   . PHE A 1 180 ? 13.036 -8.776  180.005 1.00 32.30  ? 160 PHE A CD1   1 
ATOM   1303 C CD2   . PHE A 1 180 ? 13.395 -7.517  178.013 1.00 26.15  ? 160 PHE A CD2   1 
ATOM   1304 C CE1   . PHE A 1 180 ? 11.700 -8.377  180.018 1.00 38.56  ? 160 PHE A CE1   1 
ATOM   1305 C CE2   . PHE A 1 180 ? 12.058 -7.114  178.019 1.00 30.96  ? 160 PHE A CE2   1 
ATOM   1306 C CZ    . PHE A 1 180 ? 11.212 -7.542  179.022 1.00 33.66  ? 160 PHE A CZ    1 
ATOM   1307 N N     . TYR A 1 181 ? 17.836 -9.876  177.049 1.00 27.00  ? 161 TYR A N     1 
ATOM   1308 C CA    . TYR A 1 181 ? 19.313 -9.962  176.916 1.00 27.26  ? 161 TYR A CA    1 
ATOM   1309 C C     . TYR A 1 181 ? 20.013 -8.744  176.229 1.00 38.20  ? 161 TYR A C     1 
ATOM   1310 O O     . TYR A 1 181 ? 19.487 -8.172  175.254 1.00 25.79  ? 161 TYR A O     1 
ATOM   1311 C CB    . TYR A 1 181 ? 19.690 -11.248 176.148 1.00 29.57  ? 161 TYR A CB    1 
ATOM   1312 C CG    . TYR A 1 181 ? 19.145 -12.537 176.743 1.00 35.44  ? 161 TYR A CG    1 
ATOM   1313 C CD1   . TYR A 1 181 ? 17.994 -13.135 176.231 1.00 38.37  ? 161 TYR A CD1   1 
ATOM   1314 C CD2   . TYR A 1 181 ? 19.790 -13.167 177.805 1.00 38.71  ? 161 TYR A CD2   1 
ATOM   1315 C CE1   . TYR A 1 181 ? 17.492 -14.330 176.768 1.00 39.20  ? 161 TYR A CE1   1 
ATOM   1316 C CE2   . TYR A 1 181 ? 19.298 -14.363 178.349 1.00 38.59  ? 161 TYR A CE2   1 
ATOM   1317 C CZ    . TYR A 1 181 ? 18.147 -14.935 177.829 1.00 44.92  ? 161 TYR A CZ    1 
ATOM   1318 O OH    . TYR A 1 181 ? 17.659 -16.109 178.373 1.00 36.01  ? 161 TYR A OH    1 
ATOM   1319 N N     . CYS A 1 182 ? 21.205 -8.364  176.721 1.00 27.32  ? 162 CYS A N     1 
ATOM   1320 C CA    . CYS A 1 182 ? 22.036 -7.321  176.063 1.00 25.51  ? 162 CYS A CA    1 
ATOM   1321 C C     . CYS A 1 182 ? 23.149 -7.943  175.200 1.00 34.05  ? 162 CYS A C     1 
ATOM   1322 O O     . CYS A 1 182 ? 24.192 -8.359  175.723 1.00 28.91  ? 162 CYS A O     1 
ATOM   1323 C CB    . CYS A 1 182 ? 22.655 -6.365  177.099 1.00 30.60  ? 162 CYS A CB    1 
ATOM   1324 S SG    . CYS A 1 182 ? 23.560 -4.882  176.421 1.00 39.46  ? 162 CYS A SG    1 
ATOM   1325 N N     . GLU A 1 183 ? 22.925 -8.010  173.883 1.00 33.59  ? 163 GLU A N     1 
ATOM   1326 C CA    . GLU A 1 183 ? 23.859 -8.679  172.957 1.00 34.56  ? 163 GLU A CA    1 
ATOM   1327 C C     . GLU A 1 183 ? 23.539 -8.296  171.495 1.00 32.92  ? 163 GLU A C     1 
ATOM   1328 O O     . GLU A 1 183 ? 22.512 -7.671  171.235 1.00 31.05  ? 163 GLU A O     1 
ATOM   1329 C CB    . GLU A 1 183 ? 23.815 -10.217 173.153 1.00 36.03  ? 163 GLU A CB    1 
ATOM   1330 C CG    . GLU A 1 183 ? 22.450 -10.881 172.824 1.00 34.82  ? 163 GLU A CG    1 
ATOM   1331 C CD    . GLU A 1 183 ? 22.298 -12.317 173.357 1.00 46.51  ? 163 GLU A CD    1 
ATOM   1332 O OE1   . GLU A 1 183 ? 23.069 -12.730 174.256 1.00 44.00  ? 163 GLU A OE1   1 
ATOM   1333 O OE2   . GLU A 1 183 ? 21.394 -13.041 172.877 1.00 36.58  ? 163 GLU A OE2   1 
ATOM   1334 N N     . SER A 1 184 ? 24.422 -8.645  170.555 1.00 33.99  ? 164 SER A N     1 
ATOM   1335 C CA    . SER A 1 184 ? 24.267 -8.262  169.142 1.00 44.08  ? 164 SER A CA    1 
ATOM   1336 C C     . SER A 1 184 ? 23.468 -9.304  168.340 1.00 43.16  ? 164 SER A C     1 
ATOM   1337 O O     . SER A 1 184 ? 23.281 -10.429 168.809 1.00 33.65  ? 164 SER A O     1 
ATOM   1338 C CB    . SER A 1 184 ? 25.645 -8.044  168.501 1.00 50.00  ? 164 SER A CB    1 
ATOM   1339 O OG    . SER A 1 184 ? 25.535 -7.526  167.182 1.00 46.39  ? 164 SER A OG    1 
ATOM   1340 N N     . TYR A 1 185 ? 23.031 -8.939  167.127 1.00 31.84  ? 165 TYR A N     1 
ATOM   1341 C CA    . TYR A 1 185 ? 22.025 -9.722  166.378 1.00 31.47  ? 165 TYR A CA    1 
ATOM   1342 C C     . TYR A 1 185 ? 22.449 -11.164 166.006 1.00 33.66  ? 165 TYR A C     1 
ATOM   1343 O O     . TYR A 1 185 ? 21.599 -12.052 165.941 1.00 35.78  ? 165 TYR A O     1 
ATOM   1344 C CB    . TYR A 1 185 ? 21.590 -8.966  165.095 1.00 38.01  ? 165 TYR A CB    1 
ATOM   1345 C CG    . TYR A 1 185 ? 22.676 -8.810  164.046 1.00 41.14  ? 165 TYR A CG    1 
ATOM   1346 C CD1   . TYR A 1 185 ? 22.809 -9.729  163.006 1.00 36.11  ? 165 TYR A CD1   1 
ATOM   1347 C CD2   . TYR A 1 185 ? 23.576 -7.750  164.101 1.00 45.09  ? 165 TYR A CD2   1 
ATOM   1348 C CE1   . TYR A 1 185 ? 23.821 -9.597  162.056 1.00 45.17  ? 165 TYR A CE1   1 
ATOM   1349 C CE2   . TYR A 1 185 ? 24.590 -7.606  163.155 1.00 45.13  ? 165 TYR A CE2   1 
ATOM   1350 C CZ    . TYR A 1 185 ? 24.705 -8.529  162.136 1.00 48.16  ? 165 TYR A CZ    1 
ATOM   1351 O OH    . TYR A 1 185 ? 25.706 -8.387  161.200 1.00 49.81  ? 165 TYR A OH    1 
ATOM   1352 N N     . ALA A 1 186 ? 23.736 -11.418 165.774 1.00 35.69  ? 166 ALA A N     1 
ATOM   1353 C CA    . ALA A 1 186 ? 24.160 -12.789 165.450 1.00 47.12  ? 166 ALA A CA    1 
ATOM   1354 C C     . ALA A 1 186 ? 23.980 -13.746 166.642 1.00 54.28  ? 166 ALA A C     1 
ATOM   1355 O O     . ALA A 1 186 ? 23.636 -14.921 166.468 1.00 40.68  ? 166 ALA A O     1 
ATOM   1356 C CB    . ALA A 1 186 ? 25.611 -12.804 164.974 1.00 43.80  ? 166 ALA A CB    1 
ATOM   1357 N N     . ASP A 1 187 ? 24.202 -13.238 167.852 1.00 42.26  ? 167 ASP A N     1 
ATOM   1358 C CA    . ASP A 1 187 ? 24.151 -14.074 169.049 1.00 45.04  ? 167 ASP A CA    1 
ATOM   1359 C C     . ASP A 1 187 ? 22.721 -14.378 169.521 1.00 44.38  ? 167 ASP A C     1 
ATOM   1360 O O     . ASP A 1 187 ? 22.450 -15.462 170.032 1.00 40.29  ? 167 ASP A O     1 
ATOM   1361 C CB    . ASP A 1 187 ? 24.944 -13.418 170.180 1.00 47.21  ? 167 ASP A CB    1 
ATOM   1362 C CG    . ASP A 1 187 ? 26.440 -13.374 169.897 1.00 62.94  ? 167 ASP A CG    1 
ATOM   1363 O OD1   . ASP A 1 187 ? 26.956 -14.307 169.243 1.00 69.58  ? 167 ASP A OD1   1 
ATOM   1364 O OD2   . ASP A 1 187 ? 27.100 -12.406 170.335 1.00 65.41  ? 167 ASP A OD2   1 
ATOM   1365 N N     . SER A 1 188 ? 21.805 -13.430 169.353 1.00 38.04  ? 168 SER A N     1 
ATOM   1366 C CA    . SER A 1 188 ? 20.423 -13.664 169.772 1.00 36.74  ? 168 SER A CA    1 
ATOM   1367 C C     . SER A 1 188 ? 19.671 -14.565 168.777 1.00 41.64  ? 168 SER A C     1 
ATOM   1368 O O     . SER A 1 188 ? 18.848 -15.387 169.187 1.00 39.68  ? 168 SER A O     1 
ATOM   1369 C CB    . SER A 1 188 ? 19.681 -12.332 169.971 1.00 32.64  ? 168 SER A CB    1 
ATOM   1370 O OG    . SER A 1 188 ? 19.702 -11.528 168.804 1.00 31.31  ? 168 SER A OG    1 
ATOM   1371 N N     . MET A 1 189 ? 19.961 -14.426 167.482 1.00 41.63  ? 169 MET A N     1 
ATOM   1372 C CA    . MET A 1 189 ? 19.300 -15.250 166.455 1.00 41.26  ? 169 MET A CA    1 
ATOM   1373 C C     . MET A 1 189 ? 19.687 -16.733 166.582 1.00 45.82  ? 169 MET A C     1 
ATOM   1374 O O     . MET A 1 189 ? 18.951 -17.611 166.132 1.00 41.70  ? 169 MET A O     1 
ATOM   1375 C CB    . MET A 1 189 ? 19.614 -14.719 165.033 1.00 36.67  ? 169 MET A CB    1 
ATOM   1376 C CG    . MET A 1 189 ? 18.998 -13.322 164.718 1.00 34.00  ? 169 MET A CG    1 
ATOM   1377 S SD    . MET A 1 189 ? 19.376 -12.557 163.094 1.00 42.05  ? 169 MET A SD    1 
ATOM   1378 C CE    . MET A 1 189 ? 18.314 -13.486 161.986 1.00 42.26  ? 169 MET A CE    1 
ATOM   1379 N N     . ALA A 1 190 ? 20.819 -17.011 167.229 1.00 45.94  ? 170 ALA A N     1 
ATOM   1380 C CA    . ALA A 1 190 ? 21.280 -18.386 167.431 1.00 54.31  ? 170 ALA A CA    1 
ATOM   1381 C C     . ALA A 1 190 ? 20.570 -19.110 168.580 1.00 57.86  ? 170 ALA A C     1 
ATOM   1382 O O     . ALA A 1 190 ? 20.868 -20.279 168.851 1.00 53.46  ? 170 ALA A O     1 
ATOM   1383 C CB    . ALA A 1 190 ? 22.786 -18.405 167.673 1.00 56.59  ? 170 ALA A CB    1 
ATOM   1384 N N     . ARG A 1 191 ? 19.646 -18.423 169.252 1.00 52.59  ? 171 ARG A N     1 
ATOM   1385 C CA    . ARG A 1 191 ? 18.885 -19.020 170.355 1.00 48.09  ? 171 ARG A CA    1 
ATOM   1386 C C     . ARG A 1 191 ? 17.603 -19.718 169.863 1.00 51.90  ? 171 ARG A C     1 
ATOM   1387 O O     . ARG A 1 191 ? 16.998 -20.499 170.598 1.00 51.75  ? 171 ARG A O     1 
ATOM   1388 C CB    . ARG A 1 191 ? 18.534 -17.952 171.410 1.00 50.00  ? 171 ARG A CB    1 
ATOM   1389 C CG    . ARG A 1 191 ? 19.731 -17.386 172.210 1.00 49.50  ? 171 ARG A CG    1 
ATOM   1390 C CD    . ARG A 1 191 ? 19.291 -16.379 173.293 1.00 47.52  ? 171 ARG A CD    1 
ATOM   1391 N NE    . ARG A 1 191 ? 20.417 -15.772 174.010 1.00 41.20  ? 171 ARG A NE    1 
ATOM   1392 C CZ    . ARG A 1 191 ? 20.895 -16.196 175.182 1.00 57.69  ? 171 ARG A CZ    1 
ATOM   1393 N NH1   . ARG A 1 191 ? 20.352 -17.243 175.803 1.00 49.42  ? 171 ARG A NH1   1 
ATOM   1394 N NH2   . ARG A 1 191 ? 21.921 -15.564 175.744 1.00 56.61  ? 171 ARG A NH2   1 
ATOM   1395 N N     . ALA A 1 192 ? 17.241 -19.462 168.620 1.00 45.04  ? 172 ALA A N     1 
ATOM   1396 C CA    . ALA A 1 192 ? 16.070 -20.050 167.994 1.00 48.00  ? 172 ALA A CA    1 
ATOM   1397 C C     . ALA A 1 192 ? 16.123 -21.561 167.744 1.00 56.84  ? 172 ALA A C     1 
ATOM   1398 O O     . ALA A 1 192 ? 17.129 -22.084 167.356 1.00 52.07  ? 172 ALA A O     1 
ATOM   1399 C CB    . ALA A 1 192 ? 15.792 -19.338 166.688 1.00 47.46  ? 172 ALA A CB    1 
ATOM   1400 N N     . ASP A 1 193 ? 14.993 -22.221 167.948 1.00 58.23  ? 173 ASP A N     1 
ATOM   1401 C CA    . ASP A 1 193 ? 14.838 -23.644 167.653 1.00 63.36  ? 173 ASP A CA    1 
ATOM   1402 C C     . ASP A 1 193 ? 13.634 -23.965 166.782 1.00 63.81  ? 173 ASP A C     1 
ATOM   1403 O O     . ASP A 1 193 ? 13.012 -23.092 166.233 1.00 59.68  ? 173 ASP A O     1 
ATOM   1404 C CB    . ASP A 1 193 ? 14.796 -24.470 168.930 1.00 69.15  ? 173 ASP A CB    1 
ATOM   1405 C CG    . ASP A 1 193 ? 13.501 -24.320 169.712 1.00 76.13  ? 173 ASP A CG    1 
ATOM   1406 O OD1   . ASP A 1 193 ? 12.494 -23.789 169.228 1.00 75.66  ? 173 ASP A OD1   1 
ATOM   1407 O OD2   . ASP A 1 193 ? 13.500 -24.779 170.846 1.00 78.28  ? 173 ASP A OD2   1 
ATOM   1408 N N     . ASP A 1 194 ? 13.323 -25.244 166.646 1.00 68.91  ? 174 ASP A N     1 
ATOM   1409 C CA    A ASP A 1 194 ? 12.294 -25.742 165.732 0.50 67.42  ? 174 ASP A CA    1 
ATOM   1410 C CA    B ASP A 1 194 ? 12.119 -25.859 165.807 0.50 67.43  ? 174 ASP A CA    1 
ATOM   1411 C C     . ASP A 1 194 ? 10.668 -25.327 166.046 1.00 67.96  ? 174 ASP A C     1 
ATOM   1412 O O     . ASP A 1 194 ? 9.799  -25.432 165.218 1.00 75.73  ? 174 ASP A O     1 
ATOM   1413 C CB    A ASP A 1 194 ? 12.349 -27.278 165.708 0.50 73.21  ? 174 ASP A CB    1 
ATOM   1414 C CB    B ASP A 1 194 ? 12.258 -27.392 165.892 0.50 73.23  ? 174 ASP A CB    1 
ATOM   1415 C CG    A ASP A 1 194 ? 11.055 -27.925 166.164 0.50 78.09  ? 174 ASP A CG    1 
ATOM   1416 C CG    B ASP A 1 194 ? 13.638 -27.882 165.465 0.50 75.57  ? 174 ASP A CG    1 
ATOM   1417 O OD1   A ASP A 1 194 ? 10.285 -28.382 165.294 0.50 86.95  ? 174 ASP A OD1   1 
ATOM   1418 O OD1   B ASP A 1 194 ? 13.877 -28.178 164.285 0.50 78.00  ? 174 ASP A OD1   1 
ATOM   1419 O OD2   A ASP A 1 194 ? 10.807 -27.978 167.387 0.50 75.49  ? 174 ASP A OD2   1 
ATOM   1420 O OD2   B ASP A 1 194 ? 14.497 -28.006 166.334 0.50 76.94  ? 174 ASP A OD2   1 
ATOM   1421 N N     . SER A 1 195 ? 10.491 -24.644 167.156 1.00 66.02  ? 175 SER A N     1 
ATOM   1422 C CA    . SER A 1 195 ? 9.209  -24.049 167.464 1.00 68.20  ? 175 SER A CA    1 
ATOM   1423 C C     . SER A 1 195 ? 9.168  -22.515 167.503 1.00 64.78  ? 175 SER A C     1 
ATOM   1424 O O     . SER A 1 195 ? 8.272  -21.973 168.111 1.00 60.91  ? 175 SER A O     1 
ATOM   1425 C CB    . SER A 1 195 ? 8.718  -24.617 168.783 1.00 81.89  ? 175 SER A CB    1 
ATOM   1426 O OG    . SER A 1 195 ? 7.709  -23.827 169.359 1.00 89.67  ? 175 SER A OG    1 
ATOM   1427 N N     . SER A 1 196 ? 10.098 -21.831 166.835 1.00 60.87  ? 176 SER A N     1 
ATOM   1428 C CA    . SER A 1 196 ? 10.189 -20.374 166.952 1.00 49.09  ? 176 SER A CA    1 
ATOM   1429 C C     . SER A 1 196 ? 9.814  -19.620 165.671 1.00 50.22  ? 176 SER A C     1 
ATOM   1430 O O     . SER A 1 196 ? 9.728  -20.221 164.598 1.00 51.92  ? 176 SER A O     1 
ATOM   1431 C CB    . SER A 1 196 ? 11.607 -19.987 167.373 1.00 49.20  ? 176 SER A CB    1 
ATOM   1432 O OG    . SER A 1 196 ? 11.999 -20.689 168.546 1.00 48.84  ? 176 SER A OG    1 
ATOM   1433 N N     . VAL A 1 197 ? 9.590  -18.306 165.808 1.00 50.88  ? 177 VAL A N     1 
ATOM   1434 C CA    . VAL A 1 197 ? 9.363  -17.372 164.692 1.00 47.42  ? 177 VAL A CA    1 
ATOM   1435 C C     . VAL A 1 197 ? 10.166 -16.074 164.930 1.00 47.62  ? 177 VAL A C     1 
ATOM   1436 O O     . VAL A 1 197 ? 10.196 -15.574 166.059 1.00 39.18  ? 177 VAL A O     1 
ATOM   1437 C CB    . VAL A 1 197 ? 7.856  -17.021 164.526 1.00 50.57  ? 177 VAL A CB    1 
ATOM   1438 C CG1   . VAL A 1 197 ? 7.656  -15.934 163.467 1.00 43.59  ? 177 VAL A CG1   1 
ATOM   1439 C CG2   . VAL A 1 197 ? 7.038  -18.256 164.180 1.00 52.67  ? 177 VAL A CG2   1 
ATOM   1440 N N     . VAL A 1 198 ? 10.807 -15.530 163.889 1.00 38.08  ? 178 VAL A N     1 
ATOM   1441 C CA    . VAL A 1 198 ? 11.702 -14.366 164.060 1.00 44.46  ? 178 VAL A CA    1 
ATOM   1442 C C     . VAL A 1 198 ? 11.331 -13.104 163.234 1.00 39.66  ? 178 VAL A C     1 
ATOM   1443 O O     . VAL A 1 198 ? 11.175 -13.181 162.014 1.00 38.66  ? 178 VAL A O     1 
ATOM   1444 C CB    . VAL A 1 198 ? 13.161 -14.747 163.706 1.00 43.52  ? 178 VAL A CB    1 
ATOM   1445 C CG1   . VAL A 1 198 ? 14.128 -13.654 164.151 1.00 33.38  ? 178 VAL A CG1   1 
ATOM   1446 C CG2   . VAL A 1 198 ? 13.541 -16.093 164.330 1.00 47.61  ? 178 VAL A CG2   1 
ATOM   1447 N N     . TYR A 1 199 ? 11.215 -11.948 163.902 1.00 34.48  ? 179 TYR A N     1 
ATOM   1448 C CA    . TYR A 1 199 ? 10.961 -10.662 163.224 1.00 35.81  ? 179 TYR A CA    1 
ATOM   1449 C C     . TYR A 1 199 ? 12.108 -9.654  163.443 1.00 38.44  ? 179 TYR A C     1 
ATOM   1450 O O     . TYR A 1 199 ? 12.460 -9.345  164.589 1.00 32.15  ? 179 TYR A O     1 
ATOM   1451 C CB    . TYR A 1 199 ? 9.622  -10.050 163.693 1.00 30.07  ? 179 TYR A CB    1 
ATOM   1452 C CG    . TYR A 1 199 ? 9.424  -8.594  163.276 1.00 36.95  ? 179 TYR A CG    1 
ATOM   1453 C CD1   . TYR A 1 199 ? 9.052  -8.264  161.973 1.00 34.21  ? 179 TYR A CD1   1 
ATOM   1454 C CD2   . TYR A 1 199 ? 9.622  -7.547  164.186 1.00 37.69  ? 179 TYR A CD2   1 
ATOM   1455 C CE1   . TYR A 1 199 ? 8.879  -6.931  161.582 1.00 41.32  ? 179 TYR A CE1   1 
ATOM   1456 C CE2   . TYR A 1 199 ? 9.455  -6.210  163.802 1.00 41.42  ? 179 TYR A CE2   1 
ATOM   1457 C CZ    . TYR A 1 199 ? 9.083  -5.908  162.498 1.00 42.22  ? 179 TYR A CZ    1 
ATOM   1458 O OH    . TYR A 1 199 ? 8.922  -4.590  162.109 1.00 33.10  ? 179 TYR A OH    1 
ATOM   1459 N N     . CYS A 1 200 ? 12.678 -9.141  162.346 1.00 38.22  ? 180 CYS A N     1 
ATOM   1460 C CA    . CYS A 1 200 ? 13.809 -8.197  162.401 1.00 32.02  ? 180 CYS A CA    1 
ATOM   1461 C C     . CYS A 1 200 ? 13.437 -6.773  161.919 1.00 37.75  ? 180 CYS A C     1 
ATOM   1462 O O     . CYS A 1 200 ? 12.847 -6.613  160.845 1.00 33.33  ? 180 CYS A O     1 
ATOM   1463 C CB    . CYS A 1 200 ? 14.989 -8.724  161.558 1.00 34.30  ? 180 CYS A CB    1 
ATOM   1464 S SG    . CYS A 1 200 ? 15.520 -10.470 161.834 1.00 39.47  ? 180 CYS A SG    1 
ATOM   1465 N N     . ASP A 1 201 ? 13.795 -5.747  162.701 1.00 33.17  ? 181 ASP A N     1 
ATOM   1466 C CA    . ASP A 1 201 ? 13.599 -4.335  162.312 1.00 25.06  ? 181 ASP A CA    1 
ATOM   1467 C C     . ASP A 1 201 ? 14.871 -3.470  162.493 1.00 42.79  ? 181 ASP A C     1 
ATOM   1468 O O     . ASP A 1 201 ? 14.942 -2.656  163.414 1.00 32.91  ? 181 ASP A O     1 
ATOM   1469 C CB    . ASP A 1 201 ? 12.441 -3.717  163.124 1.00 24.53  ? 181 ASP A CB    1 
ATOM   1470 C CG    . ASP A 1 201 ? 12.185 -2.239  162.777 1.00 41.45  ? 181 ASP A CG    1 
ATOM   1471 O OD1   . ASP A 1 201 ? 12.615 -1.791  161.685 1.00 34.31  ? 181 ASP A OD1   1 
ATOM   1472 O OD2   . ASP A 1 201 ? 11.556 -1.525  163.599 1.00 41.94  ? 181 ASP A OD2   1 
ATOM   1473 N N     . PRO A 1 202 ? 15.870 -3.623  161.601 1.00 37.77  ? 182 PRO A N     1 
ATOM   1474 C CA    . PRO A 1 202 ? 17.160 -2.918  161.746 1.00 26.05  ? 182 PRO A CA    1 
ATOM   1475 C C     . PRO A 1 202 ? 17.081 -1.394  161.489 1.00 26.28  ? 182 PRO A C     1 
ATOM   1476 O O     . PRO A 1 202 ? 16.076 -0.921  160.967 1.00 28.00  ? 182 PRO A O     1 
ATOM   1477 C CB    . PRO A 1 202 ? 18.039 -3.596  160.686 1.00 37.52  ? 182 PRO A CB    1 
ATOM   1478 C CG    . PRO A 1 202 ? 17.061 -4.009  159.620 1.00 39.06  ? 182 PRO A CG    1 
ATOM   1479 C CD    . PRO A 1 202 ? 15.804 -4.417  160.357 1.00 28.33  ? 182 PRO A CD    1 
ATOM   1480 N N     . PRO A 1 203 ? 18.126 -0.631  161.864 1.00 29.38  ? 183 PRO A N     1 
ATOM   1481 C CA    . PRO A 1 203 ? 18.167 0.791   161.468 1.00 29.50  ? 183 PRO A CA    1 
ATOM   1482 C C     . PRO A 1 203 ? 18.042 0.973   159.932 1.00 29.07  ? 183 PRO A C     1 
ATOM   1483 O O     . PRO A 1 203 ? 18.551 0.121   159.198 1.00 35.56  ? 183 PRO A O     1 
ATOM   1484 C CB    . PRO A 1 203 ? 19.541 1.258   161.969 1.00 35.80  ? 183 PRO A CB    1 
ATOM   1485 C CG    . PRO A 1 203 ? 19.915 0.287   163.074 1.00 29.36  ? 183 PRO A CG    1 
ATOM   1486 C CD    . PRO A 1 203 ? 19.292 -1.028  162.680 1.00 27.95  ? 183 PRO A CD    1 
ATOM   1487 N N     . TYR A 1 204 ? 17.388 2.050   159.475 1.00 29.75  ? 184 TYR A N     1 
ATOM   1488 C CA    . TYR A 1 204 ? 17.074 2.274   158.041 1.00 41.92  ? 184 TYR A CA    1 
ATOM   1489 C C     . TYR A 1 204 ? 18.284 2.287   157.087 1.00 33.47  ? 184 TYR A C     1 
ATOM   1490 O O     . TYR A 1 204 ? 19.356 2.785   157.431 1.00 34.28  ? 184 TYR A O     1 
ATOM   1491 C CB    . TYR A 1 204 ? 16.331 3.613   157.851 1.00 40.76  ? 184 TYR A CB    1 
ATOM   1492 C CG    . TYR A 1 204 ? 14.881 3.664   158.307 1.00 40.66  ? 184 TYR A CG    1 
ATOM   1493 C CD1   . TYR A 1 204 ? 14.441 4.675   159.158 1.00 32.97  ? 184 TYR A CD1   1 
ATOM   1494 C CD2   . TYR A 1 204 ? 13.948 2.735   157.860 1.00 38.67  ? 184 TYR A CD2   1 
ATOM   1495 C CE1   . TYR A 1 204 ? 13.118 4.747   159.577 1.00 39.92  ? 184 TYR A CE1   1 
ATOM   1496 C CE2   . TYR A 1 204 ? 12.617 2.798   158.276 1.00 46.63  ? 184 TYR A CE2   1 
ATOM   1497 C CZ    . TYR A 1 204 ? 12.211 3.807   159.134 1.00 45.00  ? 184 TYR A CZ    1 
ATOM   1498 O OH    . TYR A 1 204 ? 10.897 3.883   159.545 1.00 40.93  ? 184 TYR A OH    1 
ATOM   1499 N N     . ALA A 1 205 ? 18.091 1.781   155.871 1.00 38.03  ? 185 ALA A N     1 
ATOM   1500 C CA    . ALA A 1 205 ? 19.100 1.923   154.816 1.00 41.99  ? 185 ALA A CA    1 
ATOM   1501 C C     . ALA A 1 205 ? 19.183 3.376   154.311 1.00 44.42  ? 185 ALA A C     1 
ATOM   1502 O O     . ALA A 1 205 ? 18.193 4.104   154.363 1.00 39.23  ? 185 ALA A O     1 
ATOM   1503 C CB    . ALA A 1 205 ? 18.789 0.976   153.662 1.00 41.01  ? 185 ALA A CB    1 
ATOM   1504 N N     . PRO A 1 206 ? 20.366 3.801   153.821 1.00 42.01  ? 186 PRO A N     1 
ATOM   1505 C CA    . PRO A 1 206 ? 20.575 5.179   153.340 1.00 44.58  ? 186 PRO A CA    1 
ATOM   1506 C C     . PRO A 1 206 ? 19.939 5.478   151.975 1.00 50.69  ? 186 PRO A C     1 
ATOM   1507 O O     . PRO A 1 206 ? 19.846 4.584   151.134 1.00 47.73  ? 186 PRO A O     1 
ATOM   1508 C CB    . PRO A 1 206 ? 22.102 5.281   153.240 1.00 48.44  ? 186 PRO A CB    1 
ATOM   1509 C CG    . PRO A 1 206 ? 22.544 3.881   152.977 1.00 46.52  ? 186 PRO A CG    1 
ATOM   1510 C CD    . PRO A 1 206 ? 21.617 3.018   153.790 1.00 42.90  ? 186 PRO A CD    1 
ATOM   1511 N N     . LEU A 1 207 ? 19.524 6.726   151.761 1.00 49.30  ? 187 LEU A N     1 
ATOM   1512 C CA    . LEU A 1 207 ? 18.896 7.122   150.500 1.00 57.79  ? 187 LEU A CA    1 
ATOM   1513 C C     . LEU A 1 207 ? 19.878 7.842   149.564 1.00 65.82  ? 187 LEU A C     1 
ATOM   1514 O O     . LEU A 1 207 ? 19.510 8.226   148.451 1.00 71.73  ? 187 LEU A O     1 
ATOM   1515 C CB    . LEU A 1 207 ? 17.677 8.016   150.763 1.00 59.18  ? 187 LEU A CB    1 
ATOM   1516 C CG    . LEU A 1 207 ? 16.560 7.484   151.671 1.00 53.50  ? 187 LEU A CG    1 
ATOM   1517 C CD1   . LEU A 1 207 ? 15.409 8.471   151.738 1.00 48.87  ? 187 LEU A CD1   1 
ATOM   1518 C CD2   . LEU A 1 207 ? 16.059 6.128   151.208 1.00 50.55  ? 187 LEU A CD2   1 
ATOM   1519 N N     . SER A 1 208 ? 21.118 8.023   150.022 1.00 69.12  ? 188 SER A N     1 
ATOM   1520 C CA    . SER A 1 208 ? 22.178 8.634   149.211 1.00 77.15  ? 188 SER A CA    1 
ATOM   1521 C C     . SER A 1 208 ? 23.553 8.450   149.855 1.00 80.55  ? 188 SER A C     1 
ATOM   1522 O O     . SER A 1 208 ? 23.658 8.245   151.064 1.00 71.96  ? 188 SER A O     1 
ATOM   1523 C CB    . SER A 1 208 ? 21.914 10.126  148.994 1.00 80.79  ? 188 SER A CB    1 
ATOM   1524 O OG    . SER A 1 208 ? 22.075 10.855  150.198 1.00 78.94  ? 188 SER A OG    1 
ATOM   1525 N N     . ALA A 1 209 ? 24.603 8.538   149.042 1.00 87.11  ? 189 ALA A N     1 
ATOM   1526 C CA    . ALA A 1 209 ? 25.971 8.356   149.526 1.00 90.17  ? 189 ALA A CA    1 
ATOM   1527 C C     . ALA A 1 209 ? 26.412 9.521   150.409 1.00 95.57  ? 189 ALA A C     1 
ATOM   1528 O O     . ALA A 1 209 ? 26.805 9.328   151.562 1.00 97.96  ? 189 ALA A O     1 
ATOM   1529 C CB    . ALA A 1 209 ? 26.932 8.185   148.353 1.00 92.15  ? 189 ALA A CB    1 
ATOM   1530 N N     . ASN A 1 219 ? 31.068 3.742   162.506 1.00 130.01 ? 199 ASN A N     1 
ATOM   1531 C CA    . ASN A 1 219 ? 30.167 4.337   163.488 1.00 127.69 ? 199 ASN A CA    1 
ATOM   1532 C C     . ASN A 1 219 ? 28.858 3.555   163.610 1.00 120.49 ? 199 ASN A C     1 
ATOM   1533 O O     . ASN A 1 219 ? 28.726 2.677   164.465 1.00 120.53 ? 199 ASN A O     1 
ATOM   1534 C CB    . ASN A 1 219 ? 29.881 5.798   163.125 1.00 130.16 ? 199 ASN A CB    1 
ATOM   1535 C CG    . ASN A 1 219 ? 29.275 6.585   164.278 1.00 128.32 ? 199 ASN A CG    1 
ATOM   1536 O OD1   . ASN A 1 219 ? 28.460 6.070   165.045 1.00 126.90 ? 199 ASN A OD1   1 
ATOM   1537 N ND2   . ASN A 1 219 ? 29.675 7.846   164.401 1.00 128.52 ? 199 ASN A ND2   1 
ATOM   1538 N N     . SER A 1 220 ? 27.896 3.877   162.749 1.00 113.83 ? 200 SER A N     1 
ATOM   1539 C CA    . SER A 1 220 ? 26.571 3.267   162.808 1.00 106.01 ? 200 SER A CA    1 
ATOM   1540 C C     . SER A 1 220 ? 26.487 1.966   162.007 1.00 92.69  ? 200 SER A C     1 
ATOM   1541 O O     . SER A 1 220 ? 27.502 1.445   161.543 1.00 95.81  ? 200 SER A O     1 
ATOM   1542 C CB    . SER A 1 220 ? 25.514 4.259   162.313 1.00 112.03 ? 200 SER A CB    1 
ATOM   1543 O OG    . SER A 1 220 ? 25.937 4.899   161.122 1.00 119.74 ? 200 SER A OG    1 
ATOM   1544 N N     . PHE A 1 221 ? 25.269 1.448   161.875 1.00 74.23  ? 201 PHE A N     1 
ATOM   1545 C CA    . PHE A 1 221 ? 25.026 0.224   161.126 1.00 60.20  ? 201 PHE A CA    1 
ATOM   1546 C C     . PHE A 1 221 ? 25.596 0.362   159.724 1.00 59.96  ? 201 PHE A C     1 
ATOM   1547 O O     . PHE A 1 221 ? 25.167 1.218   158.951 1.00 62.39  ? 201 PHE A O     1 
ATOM   1548 C CB    . PHE A 1 221 ? 23.528 -0.078  161.060 1.00 51.35  ? 201 PHE A CB    1 
ATOM   1549 C CG    . PHE A 1 221 ? 23.201 -1.543  161.116 1.00 44.97  ? 201 PHE A CG    1 
ATOM   1550 C CD1   . PHE A 1 221 ? 23.536 -2.299  162.226 1.00 36.28  ? 201 PHE A CD1   1 
ATOM   1551 C CD2   . PHE A 1 221 ? 22.560 -2.164  160.057 1.00 44.51  ? 201 PHE A CD2   1 
ATOM   1552 C CE1   . PHE A 1 221 ? 23.237 -3.648  162.280 1.00 33.96  ? 201 PHE A CE1   1 
ATOM   1553 C CE2   . PHE A 1 221 ? 22.258 -3.511  160.104 1.00 46.36  ? 201 PHE A CE2   1 
ATOM   1554 C CZ    . PHE A 1 221 ? 22.597 -4.255  161.218 1.00 44.98  ? 201 PHE A CZ    1 
ATOM   1555 N N     . THR A 1 222 ? 26.570 -0.480  159.404 1.00 52.71  ? 202 THR A N     1 
ATOM   1556 C CA    . THR A 1 222 ? 27.260 -0.387  158.116 1.00 47.38  ? 202 THR A CA    1 
ATOM   1557 C C     . THR A 1 222 ? 26.572 -1.152  156.980 1.00 50.32  ? 202 THR A C     1 
ATOM   1558 O O     . THR A 1 222 ? 25.734 -2.022  157.215 1.00 41.21  ? 202 THR A O     1 
ATOM   1559 C CB    . THR A 1 222 ? 28.718 -0.905  158.228 1.00 59.57  ? 202 THR A CB    1 
ATOM   1560 O OG1   . THR A 1 222 ? 28.712 -2.300  158.562 1.00 55.56  ? 202 THR A OG1   1 
ATOM   1561 C CG2   . THR A 1 222 ? 29.482 -0.140  159.299 1.00 59.09  ? 202 THR A CG2   1 
ATOM   1562 N N     . LEU A 1 223 ? 26.949 -0.829  155.743 1.00 46.89  ? 203 LEU A N     1 
ATOM   1563 C CA    . LEU A 1 223 ? 26.450 -1.554  154.573 1.00 54.87  ? 203 LEU A CA    1 
ATOM   1564 C C     . LEU A 1 223 ? 26.806 -3.037  154.657 1.00 56.91  ? 203 LEU A C     1 
ATOM   1565 O O     . LEU A 1 223 ? 26.005 -3.902  154.291 1.00 53.33  ? 203 LEU A O     1 
ATOM   1566 C CB    . LEU A 1 223 ? 27.012 -0.950  153.285 1.00 54.20  ? 203 LEU A CB    1 
ATOM   1567 C CG    . LEU A 1 223 ? 26.539 0.475   153.005 1.00 54.78  ? 203 LEU A CG    1 
ATOM   1568 C CD1   . LEU A 1 223 ? 27.305 1.061   151.854 1.00 58.24  ? 203 LEU A CD1   1 
ATOM   1569 C CD2   . LEU A 1 223 ? 25.035 0.497   152.729 1.00 56.61  ? 203 LEU A CD2   1 
ATOM   1570 N N     . GLU A 1 224 ? 28.014 -3.312  155.145 1.00 51.41  ? 204 GLU A N     1 
ATOM   1571 C CA    . GLU A 1 224 ? 28.494 -4.674  155.344 1.00 55.99  ? 204 GLU A CA    1 
ATOM   1572 C C     . GLU A 1 224 ? 27.575 -5.459  156.288 1.00 51.71  ? 204 GLU A C     1 
ATOM   1573 O O     . GLU A 1 224 ? 27.299 -6.636  156.053 1.00 47.06  ? 204 GLU A O     1 
ATOM   1574 C CB    . GLU A 1 224 ? 29.928 -4.646  155.886 1.00 69.33  ? 204 GLU A CB    1 
ATOM   1575 C CG    . GLU A 1 224 ? 30.624 -6.002  155.925 1.00 83.54  ? 204 GLU A CG    1 
ATOM   1576 C CD    . GLU A 1 224 ? 32.020 -5.937  156.542 1.00 93.82  ? 204 GLU A CD    1 
ATOM   1577 O OE1   . GLU A 1 224 ? 32.687 -4.887  156.417 1.00 99.95  ? 204 GLU A OE1   1 
ATOM   1578 O OE2   . GLU A 1 224 ? 32.449 -6.939  157.155 1.00 90.12  ? 204 GLU A OE2   1 
ATOM   1579 N N     . GLN A 1 225 ? 27.089 -4.795  157.339 1.00 44.75  ? 205 GLN A N     1 
ATOM   1580 C CA    . GLN A 1 225 ? 26.190 -5.429  158.306 1.00 48.89  ? 205 GLN A CA    1 
ATOM   1581 C C     . GLN A 1 225 ? 24.783 -5.687  157.737 1.00 47.79  ? 205 GLN A C     1 
ATOM   1582 O O     . GLN A 1 225 ? 24.167 -6.700  158.074 1.00 40.17  ? 205 GLN A O     1 
ATOM   1583 C CB    . GLN A 1 225 ? 26.087 -4.582  159.589 1.00 46.63  ? 205 GLN A CB    1 
ATOM   1584 C CG    . GLN A 1 225 ? 27.276 -4.703  160.557 1.00 50.51  ? 205 GLN A CG    1 
ATOM   1585 C CD    . GLN A 1 225 ? 27.146 -3.778  161.776 1.00 60.83  ? 205 GLN A CD    1 
ATOM   1586 O OE1   . GLN A 1 225 ? 26.826 -2.595  161.644 1.00 62.49  ? 205 GLN A OE1   1 
ATOM   1587 N NE2   . GLN A 1 225 ? 27.388 -4.323  162.966 1.00 57.28  ? 205 GLN A NE2   1 
ATOM   1588 N N     . GLN A 1 226 ? 24.273 -4.788  156.889 1.00 47.34  ? 206 GLN A N     1 
ATOM   1589 C CA    . GLN A 1 226 ? 22.931 -4.969  156.309 1.00 39.67  ? 206 GLN A CA    1 
ATOM   1590 C C     . GLN A 1 226 ? 22.886 -6.259  155.469 1.00 44.51  ? 206 GLN A C     1 
ATOM   1591 O O     . GLN A 1 226 ? 21.895 -6.996  155.495 1.00 39.47  ? 206 GLN A O     1 
ATOM   1592 C CB    . GLN A 1 226 ? 22.510 -3.752  155.451 1.00 38.94  ? 206 GLN A CB    1 
ATOM   1593 C CG    . GLN A 1 226 ? 22.376 -2.398  156.207 1.00 38.00  ? 206 GLN A CG    1 
ATOM   1594 C CD    . GLN A 1 226 ? 20.958 -2.088  156.725 1.00 39.32  ? 206 GLN A CD    1 
ATOM   1595 O OE1   . GLN A 1 226 ? 20.071 -2.939  156.713 1.00 41.85  ? 206 GLN A OE1   1 
ATOM   1596 N NE2   . GLN A 1 226 ? 20.753 -0.856  157.186 1.00 34.16  ? 206 GLN A NE2   1 
ATOM   1597 N N     . ALA A 1 227 ? 23.968 -6.539  154.746 1.00 43.37  ? 207 ALA A N     1 
ATOM   1598 C CA    . ALA A 1 227 ? 24.041 -7.726  153.884 1.00 45.97  ? 207 ALA A CA    1 
ATOM   1599 C C     . ALA A 1 227 ? 24.235 -9.034  154.666 1.00 48.47  ? 207 ALA A C     1 
ATOM   1600 O O     . ALA A 1 227 ? 23.683 -10.067 154.288 1.00 46.85  ? 207 ALA A O     1 
ATOM   1601 C CB    . ALA A 1 227 ? 25.157 -7.564  152.860 1.00 49.73  ? 207 ALA A CB    1 
ATOM   1602 N N     . HIS A 1 228 ? 25.020 -8.994  155.743 1.00 51.71  ? 208 HIS A N     1 
ATOM   1603 C CA    . HIS A 1 228 ? 25.259 -10.179 156.582 1.00 45.39  ? 208 HIS A CA    1 
ATOM   1604 C C     . HIS A 1 228 ? 23.967 -10.669 157.256 1.00 48.44  ? 208 HIS A C     1 
ATOM   1605 O O     . HIS A 1 228 ? 23.761 -11.875 157.407 1.00 43.89  ? 208 HIS A O     1 
ATOM   1606 C CB    . HIS A 1 228 ? 26.335 -9.875  157.637 1.00 45.32  ? 208 HIS A CB    1 
ATOM   1607 C CG    . HIS A 1 228 ? 26.724 -11.053 158.482 1.00 52.12  ? 208 HIS A CG    1 
ATOM   1608 N ND1   . HIS A 1 228 ? 26.592 -11.060 159.855 1.00 46.33  ? 208 HIS A ND1   1 
ATOM   1609 C CD2   . HIS A 1 228 ? 27.258 -12.254 158.151 1.00 49.23  ? 208 HIS A CD2   1 
ATOM   1610 C CE1   . HIS A 1 228 ? 27.019 -12.216 160.333 1.00 46.74  ? 208 HIS A CE1   1 
ATOM   1611 N NE2   . HIS A 1 228 ? 27.427 -12.960 159.319 1.00 49.84  ? 208 HIS A NE2   1 
ATOM   1612 N N     . LEU A 1 229 ? 23.100 -9.734  157.652 1.00 41.07  ? 209 LEU A N     1 
ATOM   1613 C CA    . LEU A 1 229 ? 21.803 -10.085 158.248 1.00 37.92  ? 209 LEU A CA    1 
ATOM   1614 C C     . LEU A 1 229 ? 20.962 -10.955 157.300 1.00 49.10  ? 209 LEU A C     1 
ATOM   1615 O O     . LEU A 1 229 ? 20.382 -11.954 157.727 1.00 44.93  ? 209 LEU A O     1 
ATOM   1616 C CB    . LEU A 1 229 ? 21.022 -8.822  158.639 1.00 35.24  ? 209 LEU A CB    1 
ATOM   1617 C CG    . LEU A 1 229 ? 19.596 -8.969  159.190 1.00 35.02  ? 209 LEU A CG    1 
ATOM   1618 C CD1   . LEU A 1 229 ? 19.571 -9.746  160.506 1.00 34.46  ? 209 LEU A CD1   1 
ATOM   1619 C CD2   . LEU A 1 229 ? 18.936 -7.597  159.376 1.00 35.08  ? 209 LEU A CD2   1 
ATOM   1620 N N     . ALA A 1 230 ? 20.911 -10.584 156.019 1.00 40.89  ? 210 ALA A N     1 
ATOM   1621 C CA    . ALA A 1 230 ? 20.172 -11.365 155.020 1.00 45.41  ? 210 ALA A CA    1 
ATOM   1622 C C     . ALA A 1 230 ? 20.741 -12.776 154.848 1.00 52.16  ? 210 ALA A C     1 
ATOM   1623 O O     . ALA A 1 230 ? 20.002 -13.727 154.584 1.00 58.52  ? 210 ALA A O     1 
ATOM   1624 C CB    . ALA A 1 230 ? 20.165 -10.647 153.682 1.00 50.43  ? 210 ALA A CB    1 
ATOM   1625 N N     . GLU A 1 231 ? 22.055 -12.906 154.993 1.00 47.21  ? 211 GLU A N     1 
ATOM   1626 C CA    . GLU A 1 231 ? 22.716 -14.204 154.877 1.00 58.88  ? 211 GLU A CA    1 
ATOM   1627 C C     . GLU A 1 231 ? 22.321 -15.159 156.018 1.00 57.53  ? 211 GLU A C     1 
ATOM   1628 O O     . GLU A 1 231 ? 22.092 -16.349 155.787 1.00 52.12  ? 211 GLU A O     1 
ATOM   1629 C CB    . GLU A 1 231 ? 24.234 -14.010 154.837 1.00 64.68  ? 211 GLU A CB    1 
ATOM   1630 C CG    . GLU A 1 231 ? 25.031 -15.272 154.599 1.00 77.76  ? 211 GLU A CG    1 
ATOM   1631 C CD    . GLU A 1 231 ? 26.515 -14.992 154.469 1.00 91.68  ? 211 GLU A CD    1 
ATOM   1632 O OE1   . GLU A 1 231 ? 27.310 -15.639 155.185 1.00 91.58  ? 211 GLU A OE1   1 
ATOM   1633 O OE2   . GLU A 1 231 ? 26.884 -14.121 153.650 1.00 98.95  ? 211 GLU A OE2   1 
ATOM   1634 N N     . ILE A 1 232 ? 22.235 -14.637 157.241 1.00 46.84  ? 212 ILE A N     1 
ATOM   1635 C CA    . ILE A 1 232 ? 21.805 -15.442 158.386 1.00 53.77  ? 212 ILE A CA    1 
ATOM   1636 C C     . ILE A 1 232 ? 20.360 -15.945 158.220 1.00 55.25  ? 212 ILE A C     1 
ATOM   1637 O O     . ILE A 1 232 ? 20.065 -17.101 158.531 1.00 52.55  ? 212 ILE A O     1 
ATOM   1638 C CB    . ILE A 1 232 ? 21.934 -14.650 159.718 1.00 57.82  ? 212 ILE A CB    1 
ATOM   1639 C CG1   . ILE A 1 232 ? 23.410 -14.448 160.084 1.00 55.28  ? 212 ILE A CG1   1 
ATOM   1640 C CG2   . ILE A 1 232 ? 21.218 -15.368 160.863 1.00 53.24  ? 212 ILE A CG2   1 
ATOM   1641 C CD1   . ILE A 1 232 ? 23.623 -13.833 161.462 1.00 42.66  ? 212 ILE A CD1   1 
ATOM   1642 N N     . ALA A 1 233 ? 19.470 -15.091 157.713 1.00 45.59  ? 213 ALA A N     1 
ATOM   1643 C CA    . ALA A 1 233 ? 18.082 -15.496 157.466 1.00 48.25  ? 213 ALA A CA    1 
ATOM   1644 C C     . ALA A 1 233 ? 17.978 -16.681 156.486 1.00 56.47  ? 213 ALA A C     1 
ATOM   1645 O O     . ALA A 1 233 ? 17.182 -17.600 156.696 1.00 64.07  ? 213 ALA A O     1 
ATOM   1646 C CB    . ALA A 1 233 ? 17.264 -14.313 156.950 1.00 42.39  ? 213 ALA A CB    1 
ATOM   1647 N N     . GLU A 1 234 ? 18.780 -16.665 155.424 1.00 55.15  ? 214 GLU A N     1 
ATOM   1648 C CA    . GLU A 1 234 ? 18.734 -17.737 154.430 1.00 54.68  ? 214 GLU A CA    1 
ATOM   1649 C C     . GLU A 1 234 ? 19.155 -19.083 155.028 1.00 57.11  ? 214 GLU A C     1 
ATOM   1650 O O     . GLU A 1 234 ? 18.730 -20.136 154.555 1.00 63.16  ? 214 GLU A O     1 
ATOM   1651 C CB    . GLU A 1 234 ? 19.616 -17.397 153.219 1.00 59.99  ? 214 GLU A CB    1 
ATOM   1652 C CG    . GLU A 1 234 ? 19.146 -16.179 152.420 1.00 59.28  ? 214 GLU A CG    1 
ATOM   1653 C CD    . GLU A 1 234 ? 20.045 -15.860 151.230 1.00 65.46  ? 214 GLU A CD    1 
ATOM   1654 O OE1   . GLU A 1 234 ? 21.048 -16.573 151.030 1.00 73.19  ? 214 GLU A OE1   1 
ATOM   1655 O OE2   . GLU A 1 234 ? 19.750 -14.895 150.493 1.00 61.38  ? 214 GLU A OE2   1 
ATOM   1656 N N     . GLY A 1 235 ? 19.979 -19.047 156.070 1.00 55.78  ? 215 GLY A N     1 
ATOM   1657 C CA    . GLY A 1 235 ? 20.421 -20.259 156.744 1.00 63.20  ? 215 GLY A CA    1 
ATOM   1658 C C     . GLY A 1 235 ? 19.413 -20.843 157.723 1.00 63.36  ? 215 GLY A C     1 
ATOM   1659 O O     . GLY A 1 235 ? 19.363 -22.061 157.932 1.00 60.62  ? 215 GLY A O     1 
ATOM   1660 N N     . LEU A 1 236 ? 18.611 -19.975 158.333 1.00 56.21  ? 216 LEU A N     1 
ATOM   1661 C CA    . LEU A 1 236 ? 17.565 -20.412 159.253 1.00 56.49  ? 216 LEU A CA    1 
ATOM   1662 C C     . LEU A 1 236 ? 16.422 -21.118 158.511 1.00 60.72  ? 216 LEU A C     1 
ATOM   1663 O O     . LEU A 1 236 ? 15.908 -22.142 158.972 1.00 60.73  ? 216 LEU A O     1 
ATOM   1664 C CB    . LEU A 1 236 ? 17.016 -19.222 160.050 1.00 50.49  ? 216 LEU A CB    1 
ATOM   1665 C CG    . LEU A 1 236 ? 17.842 -18.707 161.232 1.00 49.93  ? 216 LEU A CG    1 
ATOM   1666 C CD1   . LEU A 1 236 ? 17.203 -17.468 161.836 1.00 53.77  ? 216 LEU A CD1   1 
ATOM   1667 C CD2   . LEU A 1 236 ? 17.993 -19.788 162.287 1.00 50.98  ? 216 LEU A CD2   1 
ATOM   1668 N N     . VAL A 1 237 ? 16.036 -20.574 157.359 1.00 60.01  ? 217 VAL A N     1 
ATOM   1669 C CA    . VAL A 1 237 ? 14.892 -21.095 156.615 1.00 58.29  ? 217 VAL A CA    1 
ATOM   1670 C C     . VAL A 1 237 ? 15.175 -22.497 156.051 1.00 71.48  ? 217 VAL A C     1 
ATOM   1671 O O     . VAL A 1 237 ? 14.248 -23.265 155.796 1.00 66.28  ? 217 VAL A O     1 
ATOM   1672 C CB    . VAL A 1 237 ? 14.476 -20.122 155.473 1.00 61.06  ? 217 VAL A CB    1 
ATOM   1673 C CG1   . VAL A 1 237 ? 15.475 -20.156 154.325 1.00 63.97  ? 217 VAL A CG1   1 
ATOM   1674 C CG2   . VAL A 1 237 ? 13.065 -20.429 154.979 1.00 59.39  ? 217 VAL A CG2   1 
ATOM   1675 N N     . GLU A 1 238 ? 16.452 -22.836 155.883 1.00 74.68  ? 218 GLU A N     1 
ATOM   1676 C CA    . GLU A 1 238 ? 16.843 -24.184 155.473 1.00 81.77  ? 218 GLU A CA    1 
ATOM   1677 C C     . GLU A 1 238 ? 16.487 -25.195 156.558 1.00 83.71  ? 218 GLU A C     1 
ATOM   1678 O O     . GLU A 1 238 ? 16.214 -26.362 156.275 1.00 76.17  ? 218 GLU A O     1 
ATOM   1679 C CB    . GLU A 1 238 ? 18.343 -24.261 155.181 1.00 89.67  ? 218 GLU A CB    1 
ATOM   1680 C CG    . GLU A 1 238 ? 18.844 -23.329 154.093 1.00 97.13  ? 218 GLU A CG    1 
ATOM   1681 C CD    . GLU A 1 238 ? 20.343 -23.460 153.873 1.00 106.94 ? 218 GLU A CD    1 
ATOM   1682 O OE1   . GLU A 1 238 ? 20.969 -24.316 154.533 1.00 107.89 ? 218 GLU A OE1   1 
ATOM   1683 O OE2   . GLU A 1 238 ? 20.895 -22.710 153.040 1.00 112.47 ? 218 GLU A OE2   1 
ATOM   1684 N N     . ARG A 1 239 ? 16.503 -24.726 157.802 1.00 75.90  ? 219 ARG A N     1 
ATOM   1685 C CA    . ARG A 1 239 ? 16.222 -25.558 158.969 1.00 77.06  ? 219 ARG A CA    1 
ATOM   1686 C C     . ARG A 1 239 ? 14.748 -25.527 159.369 1.00 77.19  ? 219 ARG A C     1 
ATOM   1687 O O     . ARG A 1 239 ? 14.407 -25.851 160.511 1.00 71.30  ? 219 ARG A O     1 
ATOM   1688 C CB    . ARG A 1 239 ? 17.071 -25.100 160.154 1.00 76.46  ? 219 ARG A CB    1 
ATOM   1689 C CG    . ARG A 1 239 ? 18.322 -25.913 160.397 1.00 83.62  ? 219 ARG A CG    1 
ATOM   1690 C CD    . ARG A 1 239 ? 18.999 -25.462 161.686 1.00 85.73  ? 219 ARG A CD    1 
ATOM   1691 N NE    . ARG A 1 239 ? 19.686 -24.184 161.526 1.00 83.01  ? 219 ARG A NE    1 
ATOM   1692 C CZ    . ARG A 1 239 ? 19.855 -23.296 162.501 1.00 72.73  ? 219 ARG A CZ    1 
ATOM   1693 N NH1   . ARG A 1 239 ? 19.378 -23.537 163.715 1.00 76.80  ? 219 ARG A NH1   1 
ATOM   1694 N NH2   . ARG A 1 239 ? 20.498 -22.163 162.259 1.00 59.40  ? 219 ARG A NH2   1 
ATOM   1695 N N     . HIS A 1 240 ? 13.892 -25.126 158.430 1.00 68.46  ? 220 HIS A N     1 
ATOM   1696 C CA    . HIS A 1 240 ? 12.452 -24.975 158.662 1.00 71.98  ? 220 HIS A CA    1 
ATOM   1697 C C     . HIS A 1 240 ? 12.123 -24.007 159.801 1.00 68.67  ? 220 HIS A C     1 
ATOM   1698 O O     . HIS A 1 240 ? 11.210 -24.266 160.587 1.00 63.94  ? 220 HIS A O     1 
ATOM   1699 C CB    . HIS A 1 240 ? 11.800 -26.328 158.952 1.00 72.79  ? 220 HIS A CB    1 
ATOM   1700 C CG    . HIS A 1 240 ? 12.005 -27.346 157.877 1.00 83.98  ? 220 HIS A CG    1 
ATOM   1701 N ND1   . HIS A 1 240 ? 13.191 -28.031 157.717 1.00 86.83  ? 220 HIS A ND1   1 
ATOM   1702 C CD2   . HIS A 1 240 ? 11.171 -27.809 156.916 1.00 89.17  ? 220 HIS A CD2   1 
ATOM   1703 C CE1   . HIS A 1 240 ? 13.081 -28.866 156.700 1.00 91.50  ? 220 HIS A CE1   1 
ATOM   1704 N NE2   . HIS A 1 240 ? 11.864 -28.752 156.197 1.00 92.82  ? 220 HIS A NE2   1 
ATOM   1705 N N     . ILE A 1 241 ? 12.869 -22.906 159.884 1.00 59.53  ? 221 ILE A N     1 
ATOM   1706 C CA    . ILE A 1 241 ? 12.573 -21.811 160.813 1.00 57.23  ? 221 ILE A CA    1 
ATOM   1707 C C     . ILE A 1 241 ? 12.288 -20.528 160.032 1.00 56.12  ? 221 ILE A C     1 
ATOM   1708 O O     . ILE A 1 241 ? 13.192 -19.983 159.405 1.00 51.97  ? 221 ILE A O     1 
ATOM   1709 C CB    . ILE A 1 241 ? 13.741 -21.549 161.791 1.00 55.37  ? 221 ILE A CB    1 
ATOM   1710 C CG1   . ILE A 1 241 ? 14.113 -22.827 162.551 1.00 58.56  ? 221 ILE A CG1   1 
ATOM   1711 C CG2   . ILE A 1 241 ? 13.389 -20.421 162.757 1.00 49.54  ? 221 ILE A CG2   1 
ATOM   1712 C CD1   . ILE A 1 241 ? 15.365 -22.693 163.405 1.00 56.51  ? 221 ILE A CD1   1 
ATOM   1713 N N     . PRO A 1 242 ? 11.032 -20.044 160.073 1.00 59.34  ? 222 PRO A N     1 
ATOM   1714 C CA    . PRO A 1 242 ? 10.535 -18.892 159.294 1.00 61.73  ? 222 PRO A CA    1 
ATOM   1715 C C     . PRO A 1 242 ? 10.944 -17.510 159.835 1.00 51.25  ? 222 PRO A C     1 
ATOM   1716 O O     . PRO A 1 242 ? 11.118 -17.361 161.049 1.00 51.98  ? 222 PRO A O     1 
ATOM   1717 C CB    . PRO A 1 242 ? 9.015  -19.064 159.367 1.00 65.43  ? 222 PRO A CB    1 
ATOM   1718 C CG    . PRO A 1 242 ? 8.788  -19.765 160.667 1.00 64.26  ? 222 PRO A CG    1 
ATOM   1719 C CD    . PRO A 1 242 ? 9.962  -20.686 160.857 1.00 58.83  ? 222 PRO A CD    1 
ATOM   1720 N N     . VAL A 1 243 ? 11.081 -16.524 158.938 1.00 46.83  ? 223 VAL A N     1 
ATOM   1721 C CA    . VAL A 1 243 ? 11.612 -15.179 159.261 1.00 43.51  ? 223 VAL A CA    1 
ATOM   1722 C C     . VAL A 1 243 ? 10.934 -14.026 158.475 1.00 48.38  ? 223 VAL A C     1 
ATOM   1723 O O     . VAL A 1 243 ? 10.702 -14.154 157.268 1.00 48.15  ? 223 VAL A O     1 
ATOM   1724 C CB    . VAL A 1 243 ? 13.141 -15.090 158.961 1.00 43.58  ? 223 VAL A CB    1 
ATOM   1725 C CG1   . VAL A 1 243 ? 13.722 -13.790 159.496 1.00 39.85  ? 223 VAL A CG1   1 
ATOM   1726 C CG2   . VAL A 1 243 ? 13.920 -16.318 159.496 1.00 42.35  ? 223 VAL A CG2   1 
ATOM   1727 N N     . LEU A 1 244 ? 10.650 -12.899 159.141 1.00 40.02  ? 224 LEU A N     1 
ATOM   1728 C CA    . LEU A 1 244 ? 10.105 -11.697 158.468 1.00 44.33  ? 224 LEU A CA    1 
ATOM   1729 C C     . LEU A 1 244 ? 10.932 -10.417 158.741 1.00 46.30  ? 224 LEU A C     1 
ATOM   1730 O O     . LEU A 1 244 ? 11.297 -10.142 159.899 1.00 35.03  ? 224 LEU A O     1 
ATOM   1731 C CB    . LEU A 1 244 ? 8.652  -11.461 158.897 1.00 36.69  ? 224 LEU A CB    1 
ATOM   1732 C CG    . LEU A 1 244 ? 7.931  -10.271 158.252 1.00 44.53  ? 224 LEU A CG    1 
ATOM   1733 C CD1   . LEU A 1 244 ? 7.619  -10.567 156.791 1.00 42.14  ? 224 LEU A CD1   1 
ATOM   1734 C CD2   . LEU A 1 244 ? 6.659  -9.883  159.009 1.00 36.33  ? 224 LEU A CD2   1 
ATOM   1735 N N     . ILE A 1 245 ? 11.211 -9.631  157.690 1.00 34.22  ? 225 ILE A N     1 
ATOM   1736 C CA    . ILE A 1 245 ? 12.052 -8.413  157.813 1.00 35.46  ? 225 ILE A CA    1 
ATOM   1737 C C     . ILE A 1 245 ? 11.376 -7.136  157.248 1.00 43.69  ? 225 ILE A C     1 
ATOM   1738 O O     . ILE A 1 245 ? 10.620 -7.231  156.278 1.00 39.16  ? 225 ILE A O     1 
ATOM   1739 C CB    . ILE A 1 245 ? 13.420 -8.623  157.087 1.00 43.50  ? 225 ILE A CB    1 
ATOM   1740 C CG1   . ILE A 1 245 ? 14.132 -9.881  157.609 1.00 39.91  ? 225 ILE A CG1   1 
ATOM   1741 C CG2   . ILE A 1 245 ? 14.326 -7.406  157.211 1.00 32.16  ? 225 ILE A CG2   1 
ATOM   1742 C CD1   . ILE A 1 245 ? 15.566 -10.037 157.122 1.00 35.12  ? 225 ILE A CD1   1 
ATOM   1743 N N     . SER A 1 246 ? 11.682 -5.958  157.798 1.00 40.09  ? 226 SER A N     1 
ATOM   1744 C CA    . SER A 1 246 ? 11.214 -4.661  157.265 1.00 40.38  ? 226 SER A CA    1 
ATOM   1745 C C     . SER A 1 246 ? 12.277 -3.557  157.065 1.00 36.42  ? 226 SER A C     1 
ATOM   1746 O O     . SER A 1 246 ? 13.213 -3.508  157.798 1.00 35.88  ? 226 SER A O     1 
ATOM   1747 C CB    . SER A 1 246 ? 9.998  -4.151  158.052 1.00 43.07  ? 226 SER A CB    1 
ATOM   1748 O OG    . SER A 1 246 ? 10.253 -3.820  159.379 1.00 28.36  ? 226 SER A OG    1 
ATOM   1749 N N     . ASN A 1 247 ? 12.108 -2.691  156.067 1.00 38.98  ? 227 ASN A N     1 
ATOM   1750 C CA    . ASN A 1 247 ? 13.035 -1.598  155.682 1.00 33.17  ? 227 ASN A CA    1 
ATOM   1751 C C     . ASN A 1 247 ? 12.387 -0.641  154.614 1.00 53.29  ? 227 ASN A C     1 
ATOM   1752 O O     . ASN A 1 247 ? 11.258 -0.835  154.245 1.00 34.92  ? 227 ASN A O     1 
ATOM   1753 C CB    . ASN A 1 247 ? 14.331 -2.195  155.150 1.00 39.49  ? 227 ASN A CB    1 
ATOM   1754 C CG    . ASN A 1 247 ? 15.558 -1.337  155.389 1.00 44.39  ? 227 ASN A CG    1 
ATOM   1755 O OD1   . ASN A 1 247 ? 15.532 -0.141  155.318 1.00 33.46  ? 227 ASN A OD1   1 
ATOM   1756 N ND2   . ASN A 1 247 ? 16.657 -1.991  155.614 1.00 32.93  ? 227 ASN A ND2   1 
ATOM   1757 N N     . HIS A 1 248 ? 13.103 0.374   154.137 1.00 35.15  ? 228 HIS A N     1 
ATOM   1758 C CA    . HIS A 1 248 ? 12.636 1.227   153.032 1.00 44.48  ? 228 HIS A CA    1 
ATOM   1759 C C     . HIS A 1 248 ? 12.666 0.407   151.707 1.00 39.98  ? 228 HIS A C     1 
ATOM   1760 O O     . HIS A 1 248 ? 13.393 -0.542  151.597 1.00 40.77  ? 228 HIS A O     1 
ATOM   1761 C CB    . HIS A 1 248 ? 13.508 2.479   152.839 1.00 38.68  ? 228 HIS A CB    1 
ATOM   1762 C CG    . HIS A 1 248 ? 13.417 3.529   153.912 1.00 47.55  ? 228 HIS A CG    1 
ATOM   1763 N ND1   . HIS A 1 248 ? 12.259 3.871   154.558 1.00 52.00  ? 228 HIS A ND1   1 
ATOM   1764 C CD2   . HIS A 1 248 ? 14.358 4.368   154.392 1.00 39.74  ? 228 HIS A CD2   1 
ATOM   1765 C CE1   . HIS A 1 248 ? 12.494 4.850   155.403 1.00 49.87  ? 228 HIS A CE1   1 
ATOM   1766 N NE2   . HIS A 1 248 ? 13.762 5.162   155.330 1.00 41.37  ? 228 HIS A NE2   1 
ATOM   1767 N N     . ASP A 1 249 ? 11.878 0.781   150.714 1.00 43.07  ? 229 ASP A N     1 
ATOM   1768 C CA    . ASP A 1 249 ? 11.922 0.170   149.374 1.00 45.91  ? 229 ASP A CA    1 
ATOM   1769 C C     . ASP A 1 249 ? 12.870 0.941   148.433 1.00 53.67  ? 229 ASP A C     1 
ATOM   1770 O O     . ASP A 1 249 ? 12.518 2.011   147.923 1.00 49.78  ? 229 ASP A O     1 
ATOM   1771 C CB    . ASP A 1 249 ? 10.504 0.102   148.772 1.00 49.57  ? 229 ASP A CB    1 
ATOM   1772 C CG    . ASP A 1 249 ? 10.465 -0.553  147.379 1.00 55.05  ? 229 ASP A CG    1 
ATOM   1773 O OD1   . ASP A 1 249 ? 11.462 -1.175  146.956 1.00 52.46  ? 229 ASP A OD1   1 
ATOM   1774 O OD2   . ASP A 1 249 ? 9.417  -0.457  146.704 1.00 55.17  ? 229 ASP A OD2   1 
ATOM   1775 N N     . THR A 1 250 ? 14.071 0.391   148.217 1.00 48.45  ? 230 THR A N     1 
ATOM   1776 C CA    . THR A 1 250 ? 15.087 0.981   147.331 1.00 54.48  ? 230 THR A CA    1 
ATOM   1777 C C     . THR A 1 250 ? 15.722 -0.075  146.409 1.00 62.77  ? 230 THR A C     1 
ATOM   1778 O O     . THR A 1 250 ? 15.373 -1.256  146.468 1.00 58.76  ? 230 THR A O     1 
ATOM   1779 C CB    . THR A 1 250 ? 16.232 1.656   148.125 1.00 54.64  ? 230 THR A CB    1 
ATOM   1780 O OG1   . THR A 1 250 ? 17.105 0.650   148.657 1.00 54.41  ? 230 THR A OG1   1 
ATOM   1781 C CG2   . THR A 1 250 ? 15.693 2.511   149.263 1.00 52.58  ? 230 THR A CG2   1 
ATOM   1782 N N     . MET A 1 251 ? 16.671 0.350   145.575 1.00 67.64  ? 231 MET A N     1 
ATOM   1783 C CA    . MET A 1 251 ? 17.385 -0.573  144.693 1.00 69.37  ? 231 MET A CA    1 
ATOM   1784 C C     . MET A 1 251 ? 18.278 -1.540  145.477 1.00 74.35  ? 231 MET A C     1 
ATOM   1785 O O     . MET A 1 251 ? 18.428 -2.706  145.106 1.00 59.41  ? 231 MET A O     1 
ATOM   1786 C CB    . MET A 1 251 ? 18.229 0.199   143.677 1.00 64.06  ? 231 MET A CB    1 
ATOM   1787 N N     . LEU A 1 252 ? 18.866 -1.053  146.564 1.00 72.07  ? 232 LEU A N     1 
ATOM   1788 C CA    . LEU A 1 252 ? 19.776 -1.868  147.365 1.00 72.00  ? 232 LEU A CA    1 
ATOM   1789 C C     . LEU A 1 252 ? 19.055 -2.971  148.143 1.00 61.75  ? 232 LEU A C     1 
ATOM   1790 O O     . LEU A 1 252 ? 19.526 -4.110  148.194 1.00 53.77  ? 232 LEU A O     1 
ATOM   1791 C CB    . LEU A 1 252 ? 20.569 -0.984  148.333 1.00 71.68  ? 232 LEU A CB    1 
ATOM   1792 C CG    . LEU A 1 252 ? 21.952 -0.534  147.853 1.00 74.70  ? 232 LEU A CG    1 
ATOM   1793 C CD1   . LEU A 1 252 ? 22.638 0.331   148.898 1.00 70.70  ? 232 LEU A CD1   1 
ATOM   1794 C CD2   . LEU A 1 252 ? 22.810 -1.744  147.519 1.00 80.34  ? 232 LEU A CD2   1 
ATOM   1795 N N     . THR A 1 253 ? 17.916 -2.634  148.744 1.00 58.38  ? 233 THR A N     1 
ATOM   1796 C CA    . THR A 1 253 ? 17.188 -3.589  149.583 1.00 46.08  ? 233 THR A CA    1 
ATOM   1797 C C     . THR A 1 253 ? 16.569 -4.720  148.752 1.00 49.67  ? 233 THR A C     1 
ATOM   1798 O O     . THR A 1 253 ? 16.524 -5.866  149.198 1.00 47.93  ? 233 THR A O     1 
ATOM   1799 C CB    . THR A 1 253 ? 16.087 -2.888  150.414 1.00 43.34  ? 233 THR A CB    1 
ATOM   1800 O OG1   . THR A 1 253 ? 15.388 -1.940  149.596 1.00 44.95  ? 233 THR A OG1   1 
ATOM   1801 C CG2   . THR A 1 253 ? 16.701 -2.156  151.595 1.00 40.86  ? 233 THR A CG2   1 
ATOM   1802 N N     . ARG A 1 254 ? 16.110 -4.402  147.543 1.00 51.17  ? 234 ARG A N     1 
ATOM   1803 C CA    . ARG A 1 254 ? 15.576 -5.417  146.636 1.00 58.20  ? 234 ARG A CA    1 
ATOM   1804 C C     . ARG A 1 254 ? 16.633 -6.453  146.242 1.00 63.09  ? 234 ARG A C     1 
ATOM   1805 O O     . ARG A 1 254 ? 16.303 -7.594  145.928 1.00 62.40  ? 234 ARG A O     1 
ATOM   1806 C CB    . ARG A 1 254 ? 14.999 -4.765  145.374 1.00 59.36  ? 234 ARG A CB    1 
ATOM   1807 C CG    . ARG A 1 254 ? 13.652 -4.085  145.579 1.00 59.96  ? 234 ARG A CG    1 
ATOM   1808 C CD    . ARG A 1 254 ? 13.127 -3.478  144.280 1.00 64.06  ? 234 ARG A CD    1 
ATOM   1809 N NE    . ARG A 1 254 ? 11.809 -2.869  144.444 1.00 67.20  ? 234 ARG A NE    1 
ATOM   1810 C CZ    . ARG A 1 254 ? 10.665 -3.450  144.094 1.00 83.51  ? 234 ARG A CZ    1 
ATOM   1811 N NH1   . ARG A 1 254 ? 10.671 -4.660  143.550 1.00 87.75  ? 234 ARG A NH1   1 
ATOM   1812 N NH2   . ARG A 1 254 ? 9.513  -2.817  144.280 1.00 86.27  ? 234 ARG A NH2   1 
ATOM   1813 N N     . GLU A 1 255 ? 17.900 -6.048  146.260 1.00 61.69  ? 235 GLU A N     1 
ATOM   1814 C CA    . GLU A 1 255 ? 19.002 -6.947  145.927 1.00 66.38  ? 235 GLU A CA    1 
ATOM   1815 C C     . GLU A 1 255 ? 19.426 -7.822  147.115 1.00 63.23  ? 235 GLU A C     1 
ATOM   1816 O O     . GLU A 1 255 ? 19.726 -9.005  146.945 1.00 61.20  ? 235 GLU A O     1 
ATOM   1817 C CB    . GLU A 1 255 ? 20.198 -6.141  145.413 1.00 61.44  ? 235 GLU A CB    1 
ATOM   1818 C CG    . GLU A 1 255 ? 21.453 -6.962  145.183 1.00 78.59  ? 235 GLU A CG    1 
ATOM   1819 C CD    . GLU A 1 255 ? 22.591 -6.140  144.599 1.00 86.81  ? 235 GLU A CD    1 
ATOM   1820 O OE1   . GLU A 1 255 ? 23.272 -5.426  145.368 1.00 91.35  ? 235 GLU A OE1   1 
ATOM   1821 O OE2   . GLU A 1 255 ? 22.803 -6.210  143.369 1.00 91.10  ? 235 GLU A OE2   1 
ATOM   1822 N N     . TRP A 1 256 ? 19.459 -7.237  148.312 1.00 57.00  ? 236 TRP A N     1 
ATOM   1823 C CA    . TRP A 1 256 ? 19.812 -7.979  149.523 1.00 58.17  ? 236 TRP A CA    1 
ATOM   1824 C C     . TRP A 1 256 ? 18.796 -9.085  149.809 1.00 58.23  ? 236 TRP A C     1 
ATOM   1825 O O     . TRP A 1 256 ? 19.163 -10.191 150.220 1.00 50.79  ? 236 TRP A O     1 
ATOM   1826 C CB    . TRP A 1 256 ? 19.906 -7.035  150.733 1.00 54.43  ? 236 TRP A CB    1 
ATOM   1827 C CG    . TRP A 1 256 ? 21.079 -6.083  150.700 1.00 54.97  ? 236 TRP A CG    1 
ATOM   1828 C CD1   . TRP A 1 256 ? 22.287 -6.282  150.084 1.00 50.90  ? 236 TRP A CD1   1 
ATOM   1829 C CD2   . TRP A 1 256 ? 21.145 -4.777  151.297 1.00 45.83  ? 236 TRP A CD2   1 
ATOM   1830 N NE1   . TRP A 1 256 ? 23.100 -5.187  150.271 1.00 51.00  ? 236 TRP A NE1   1 
ATOM   1831 C CE2   . TRP A 1 256 ? 22.423 -4.250  151.010 1.00 55.09  ? 236 TRP A CE2   1 
ATOM   1832 C CE3   . TRP A 1 256 ? 20.248 -4.005  152.049 1.00 47.64  ? 236 TRP A CE3   1 
ATOM   1833 C CZ2   . TRP A 1 256 ? 22.828 -2.987  151.451 1.00 47.24  ? 236 TRP A CZ2   1 
ATOM   1834 C CZ3   . TRP A 1 256 ? 20.652 -2.749  152.485 1.00 43.83  ? 236 TRP A CZ3   1 
ATOM   1835 C CH2   . TRP A 1 256 ? 21.934 -2.254  152.182 1.00 44.37  ? 236 TRP A CH2   1 
ATOM   1836 N N     . TYR A 1 257 ? 17.523 -8.776  149.578 1.00 49.63  ? 237 TYR A N     1 
ATOM   1837 C CA    . TYR A 1 257 ? 16.425 -9.680  149.904 1.00 49.26  ? 237 TYR A CA    1 
ATOM   1838 C C     . TYR A 1 257 ? 15.861 -10.400 148.674 1.00 60.00  ? 237 TYR A C     1 
ATOM   1839 O O     . TYR A 1 257 ? 14.654 -10.617 148.585 1.00 63.76  ? 237 TYR A O     1 
ATOM   1840 C CB    . TYR A 1 257 ? 15.289 -8.912  150.591 1.00 46.34  ? 237 TYR A CB    1 
ATOM   1841 C CG    . TYR A 1 257 ? 15.696 -8.023  151.772 1.00 49.59  ? 237 TYR A CG    1 
ATOM   1842 C CD1   . TYR A 1 257 ? 15.044 -6.812  152.001 1.00 41.16  ? 237 TYR A CD1   1 
ATOM   1843 C CD2   . TYR A 1 257 ? 16.712 -8.398  152.659 1.00 43.99  ? 237 TYR A CD2   1 
ATOM   1844 C CE1   . TYR A 1 257 ? 15.391 -5.989  153.076 1.00 43.74  ? 237 TYR A CE1   1 
ATOM   1845 C CE2   . TYR A 1 257 ? 17.071 -7.574  153.752 1.00 38.92  ? 237 TYR A CE2   1 
ATOM   1846 C CZ    . TYR A 1 257 ? 16.402 -6.371  153.948 1.00 40.87  ? 237 TYR A CZ    1 
ATOM   1847 O OH    . TYR A 1 257 ? 16.734 -5.537  155.006 1.00 35.60  ? 237 TYR A OH    1 
ATOM   1848 N N     . GLN A 1 258 ? 16.713 -10.775 147.729 1.00 56.54  ? 238 GLN A N     1 
ATOM   1849 C CA    . GLN A 1 258 ? 16.206 -11.339 146.472 1.00 64.39  ? 238 GLN A CA    1 
ATOM   1850 C C     . GLN A 1 258 ? 15.566 -12.731 146.616 1.00 63.95  ? 238 GLN A C     1 
ATOM   1851 O O     . GLN A 1 258 ? 14.669 -13.076 145.849 1.00 68.84  ? 238 GLN A O     1 
ATOM   1852 C CB    . GLN A 1 258 ? 17.323 -11.388 145.416 1.00 70.65  ? 238 GLN A CB    1 
ATOM   1853 C CG    . GLN A 1 258 ? 18.539 -12.219 145.806 1.00 76.74  ? 238 GLN A CG    1 
ATOM   1854 C CD    . GLN A 1 258 ? 19.759 -11.924 144.943 1.00 83.60  ? 238 GLN A CD    1 
ATOM   1855 O OE1   . GLN A 1 258 ? 20.828 -11.591 145.457 1.00 86.54  ? 238 GLN A OE1   1 
ATOM   1856 N NE2   . GLN A 1 258 ? 19.604 -12.051 143.627 1.00 88.03  ? 238 GLN A NE2   1 
ATOM   1857 N N     . ARG A 1 259 ? 16.004 -13.521 147.595 1.00 60.95  ? 239 ARG A N     1 
ATOM   1858 C CA    . ARG A 1 259 ? 15.506 -14.894 147.737 1.00 67.45  ? 239 ARG A CA    1 
ATOM   1859 C C     . ARG A 1 259 ? 14.194 -15.010 148.536 1.00 66.52  ? 239 ARG A C     1 
ATOM   1860 O O     . ARG A 1 259 ? 13.751 -16.118 148.847 1.00 65.58  ? 239 ARG A O     1 
ATOM   1861 C CB    . ARG A 1 259 ? 16.585 -15.779 148.379 1.00 63.36  ? 239 ARG A CB    1 
ATOM   1862 N N     . ALA A 1 260 ? 13.574 -13.873 148.853 1.00 59.38  ? 240 ALA A N     1 
ATOM   1863 C CA    . ALA A 1 260 ? 12.317 -13.853 149.606 1.00 55.96  ? 240 ALA A CA    1 
ATOM   1864 C C     . ALA A 1 260 ? 11.144 -13.397 148.738 1.00 63.40  ? 240 ALA A C     1 
ATOM   1865 O O     . ALA A 1 260 ? 11.334 -12.986 147.594 1.00 63.55  ? 240 ALA A O     1 
ATOM   1866 C CB    . ALA A 1 260 ? 12.448 -12.947 150.830 1.00 51.32  ? 240 ALA A CB    1 
ATOM   1867 N N     . LYS A 1 261 ? 9.931  -13.474 149.281 1.00 68.41  ? 241 LYS A N     1 
ATOM   1868 C CA    . LYS A 1 261 ? 8.748  -12.927 148.609 1.00 73.53  ? 241 LYS A CA    1 
ATOM   1869 C C     . LYS A 1 261 ? 8.467  -11.520 149.143 1.00 69.65  ? 241 LYS A C     1 
ATOM   1870 O O     . LYS A 1 261 ? 8.503  -11.294 150.354 1.00 64.01  ? 241 LYS A O     1 
ATOM   1871 C CB    . LYS A 1 261 ? 7.534  -13.837 148.807 1.00 70.64  ? 241 LYS A CB    1 
ATOM   1872 N N     . LEU A 1 262 ? 8.182  -10.581 148.240 1.00 67.57  ? 242 LEU A N     1 
ATOM   1873 C CA    . LEU A 1 262 ? 8.193  -9.155  148.582 1.00 61.09  ? 242 LEU A CA    1 
ATOM   1874 C C     . LEU A 1 262 ? 6.834  -8.455  148.447 1.00 62.61  ? 242 LEU A C     1 
ATOM   1875 O O     . LEU A 1 262 ? 6.122  -8.652  147.465 1.00 57.86  ? 242 LEU A O     1 
ATOM   1876 C CB    . LEU A 1 262 ? 9.224  -8.435  147.705 1.00 57.40  ? 242 LEU A CB    1 
ATOM   1877 C CG    . LEU A 1 262 ? 10.643 -9.012  147.686 1.00 57.23  ? 242 LEU A CG    1 
ATOM   1878 C CD1   . LEU A 1 262 ? 11.539 -8.232  146.731 1.00 55.83  ? 242 LEU A CD1   1 
ATOM   1879 C CD2   . LEU A 1 262 ? 11.235 -9.023  149.090 1.00 50.79  ? 242 LEU A CD2   1 
ATOM   1880 N N     . HIS A 1 263 ? 6.499  -7.618  149.430 1.00 58.16  ? 243 HIS A N     1 
ATOM   1881 C CA    . HIS A 1 263 ? 5.240  -6.860  149.438 1.00 57.75  ? 243 HIS A CA    1 
ATOM   1882 C C     . HIS A 1 263 ? 5.461  -5.347  149.626 1.00 56.23  ? 243 HIS A C     1 
ATOM   1883 O O     . HIS A 1 263 ? 6.113  -4.920  150.581 1.00 48.86  ? 243 HIS A O     1 
ATOM   1884 C CB    . HIS A 1 263 ? 4.315  -7.381  150.543 1.00 52.28  ? 243 HIS A CB    1 
ATOM   1885 C CG    . HIS A 1 263 ? 3.876  -8.799  150.348 1.00 65.89  ? 243 HIS A CG    1 
ATOM   1886 N ND1   . HIS A 1 263 ? 3.693  -9.672  151.397 1.00 71.01  ? 243 HIS A ND1   1 
ATOM   1887 C CD2   . HIS A 1 263 ? 3.575  -9.492  149.225 1.00 75.45  ? 243 HIS A CD2   1 
ATOM   1888 C CE1   . HIS A 1 263 ? 3.303  -10.846 150.929 1.00 77.40  ? 243 HIS A CE1   1 
ATOM   1889 N NE2   . HIS A 1 263 ? 3.222  -10.762 149.614 1.00 81.34  ? 243 HIS A NE2   1 
ATOM   1890 N N     . VAL A 1 264 ? 4.900  -4.544  148.725 1.00 52.48  ? 244 VAL A N     1 
ATOM   1891 C CA    . VAL A 1 264 ? 5.068  -3.087  148.760 1.00 58.82  ? 244 VAL A CA    1 
ATOM   1892 C C     . VAL A 1 264 ? 3.977  -2.387  149.588 1.00 58.54  ? 244 VAL A C     1 
ATOM   1893 O O     . VAL A 1 264 ? 2.787  -2.610  149.374 1.00 59.94  ? 244 VAL A O     1 
ATOM   1894 C CB    . VAL A 1 264 ? 5.072  -2.494  147.322 1.00 64.18  ? 244 VAL A CB    1 
ATOM   1895 C CG1   . VAL A 1 264 ? 5.183  -0.970  147.351 1.00 56.55  ? 244 VAL A CG1   1 
ATOM   1896 C CG2   . VAL A 1 264 ? 6.195  -3.102  146.491 1.00 64.58  ? 244 VAL A CG2   1 
ATOM   1897 N N     . VAL A 1 265 ? 4.386  -1.539  150.530 1.00 49.96  ? 245 VAL A N     1 
ATOM   1898 C CA    . VAL A 1 265 ? 3.438  -0.784  151.350 1.00 52.88  ? 245 VAL A CA    1 
ATOM   1899 C C     . VAL A 1 265 ? 3.481  0.704   151.008 1.00 56.90  ? 245 VAL A C     1 
ATOM   1900 O O     . VAL A 1 265 ? 4.470  1.384   151.292 1.00 49.58  ? 245 VAL A O     1 
ATOM   1901 C CB    . VAL A 1 265 ? 3.723  -0.953  152.861 1.00 57.15  ? 245 VAL A CB    1 
ATOM   1902 C CG1   . VAL A 1 265 ? 2.575  -0.375  153.684 1.00 58.95  ? 245 VAL A CG1   1 
ATOM   1903 C CG2   . VAL A 1 265 ? 3.949  -2.414  153.205 1.00 51.28  ? 245 VAL A CG2   1 
ATOM   1904 N N     . LYS A 1 266 ? 2.408  1.209   150.404 1.00 64.58  ? 246 LYS A N     1 
ATOM   1905 C CA    . LYS A 1 266 ? 2.361  2.604   149.976 1.00 76.99  ? 246 LYS A CA    1 
ATOM   1906 C C     . LYS A 1 266 ? 2.251  3.555   151.167 1.00 88.28  ? 246 LYS A C     1 
ATOM   1907 O O     . LYS A 1 266 ? 1.351  3.427   151.996 1.00 96.44  ? 246 LYS A O     1 
ATOM   1908 C CB    . LYS A 1 266 ? 1.194  2.833   149.010 1.00 74.06  ? 246 LYS A CB    1 
ATOM   1909 N N     . VAL A 1 267 ? 3.181  4.501   151.246 1.00 84.56  ? 247 VAL A N     1 
ATOM   1910 C CA    . VAL A 1 267 ? 3.168  5.522   152.287 1.00 74.32  ? 247 VAL A CA    1 
ATOM   1911 C C     . VAL A 1 267 ? 3.316  6.908   151.656 1.00 74.91  ? 247 VAL A C     1 
ATOM   1912 O O     . VAL A 1 267 ? 2.604  7.848   152.024 1.00 76.64  ? 247 VAL A O     1 
ATOM   1913 C CB    . VAL A 1 267 ? 4.289  5.286   153.325 1.00 65.26  ? 247 VAL A CB    1 
ATOM   1914 C CG1   . VAL A 1 267 ? 4.532  6.536   154.162 1.00 62.96  ? 247 VAL A CG1   1 
ATOM   1915 C CG2   . VAL A 1 267 ? 3.947  4.100   154.211 1.00 60.75  ? 247 VAL A CG2   1 
ATOM   1916 N N     . ARG A 1 268 ? 4.236  7.013   150.698 1.00 70.34  ? 248 ARG A N     1 
ATOM   1917 C CA    . ARG A 1 268 ? 4.487  8.252   149.962 1.00 68.27  ? 248 ARG A CA    1 
ATOM   1918 C C     . ARG A 1 268 ? 4.819  9.437   150.876 1.00 74.95  ? 248 ARG A C     1 
ATOM   1919 O O     . ARG A 1 268 ? 4.210  10.502  150.763 1.00 71.91  ? 248 ARG A O     1 
ATOM   1920 C CB    . ARG A 1 268 ? 3.283  8.599   149.077 1.00 63.77  ? 248 ARG A CB    1 
ATOM   1921 N N     . ARG A 1 269 ? 5.787  9.249   151.772 1.00 84.18  ? 249 ARG A N     1 
ATOM   1922 C CA    . ARG A 1 269 ? 6.233  10.321  152.664 1.00 82.04  ? 249 ARG A CA    1 
ATOM   1923 C C     . ARG A 1 269 ? 7.155  11.295  151.923 1.00 78.61  ? 249 ARG A C     1 
ATOM   1924 O O     . ARG A 1 269 ? 8.096  10.877  151.245 1.00 76.22  ? 249 ARG A O     1 
ATOM   1925 C CB    . ARG A 1 269 ? 6.950  9.743   153.893 1.00 78.81  ? 249 ARG A CB    1 
ATOM   1926 C CG    . ARG A 1 269 ? 7.230  10.768  154.992 1.00 80.59  ? 249 ARG A CG    1 
ATOM   1927 C CD    . ARG A 1 269 ? 8.310  10.294  155.966 1.00 81.87  ? 249 ARG A CD    1 
ATOM   1928 N NE    . ARG A 1 269 ? 7.876  9.178   156.807 1.00 78.89  ? 249 ARG A NE    1 
ATOM   1929 C CZ    . ARG A 1 269 ? 7.350  9.317   158.020 1.00 81.03  ? 249 ARG A CZ    1 
ATOM   1930 N NH1   . ARG A 1 269 ? 7.188  10.527  158.540 1.00 82.91  ? 249 ARG A NH1   1 
ATOM   1931 N NH2   . ARG A 1 269 ? 6.987  8.246   158.715 1.00 82.30  ? 249 ARG A NH2   1 
ATOM   1932 N N     . SER A 1 270 ? 6.885  12.591  152.052 1.00 73.87  ? 250 SER A N     1 
ATOM   1933 C CA    . SER A 1 270 ? 7.687  13.602  151.370 1.00 77.19  ? 250 SER A CA    1 
ATOM   1934 C C     . SER A 1 270 ? 9.082  13.758  151.975 1.00 95.71  ? 250 SER A C     1 
ATOM   1935 O O     . SER A 1 270 ? 9.269  13.587  153.181 1.00 97.09  ? 250 SER A O     1 
ATOM   1936 C CB    . SER A 1 270 ? 6.972  14.951  151.388 1.00 71.15  ? 250 SER A CB    1 
ATOM   1937 O OG    . SER A 1 270 ? 7.762  15.939  150.751 1.00 71.11  ? 250 SER A OG    1 
ATOM   1938 N N     . ILE A 1 271 ? 10.047 14.094  151.119 1.00 109.66 ? 251 ILE A N     1 
ATOM   1939 C CA    . ILE A 1 271 ? 11.444 14.293  151.509 1.00 109.56 ? 251 ILE A CA    1 
ATOM   1940 C C     . ILE A 1 271 ? 12.012 13.085  152.243 1.00 101.53 ? 251 ILE A C     1 
ATOM   1941 O O     . ILE A 1 271 ? 13.203 12.797  152.144 1.00 101.43 ? 251 ILE A O     1 
ATOM   1942 C CB    . ILE A 1 271 ? 11.616 15.542  152.396 1.00 113.64 ? 251 ILE A CB    1 
ATOM   1943 N N     . ARG A 1 278 ? 12.923 16.889  147.204 1.00 112.23 ? 258 ARG A N     1 
ATOM   1944 C CA    . ARG A 1 278 ? 11.767 16.216  147.787 1.00 109.47 ? 258 ARG A CA    1 
ATOM   1945 C C     . ARG A 1 278 ? 11.247 15.107  146.870 1.00 112.40 ? 258 ARG A C     1 
ATOM   1946 O O     . ARG A 1 278 ? 11.112 15.306  145.662 1.00 120.61 ? 258 ARG A O     1 
ATOM   1947 C CB    . ARG A 1 278 ? 10.653 17.225  148.077 1.00 108.36 ? 258 ARG A CB    1 
ATOM   1948 N N     . LYS A 1 279 ? 11.022 13.935  147.454 1.00 106.45 ? 259 LYS A N     1 
ATOM   1949 C CA    . LYS A 1 279 ? 10.420 12.797  146.780 1.00 102.42 ? 259 LYS A CA    1 
ATOM   1950 C C     . LYS A 1 279 ? 9.743  11.864  147.736 1.00 83.04  ? 259 LYS A C     1 
ATOM   1951 O O     . LYS A 1 279 ? 10.063 11.841  148.905 1.00 82.98  ? 259 LYS A O     1 
ATOM   1952 C CB    . LYS A 1 279 ? 11.444 11.982  146.015 1.00 112.93 ? 259 LYS A CB    1 
ATOM   1953 C CG    . LYS A 1 279 ? 10.844 10.733  145.361 1.00 113.71 ? 259 LYS A CG    1 
ATOM   1954 C CD    . LYS A 1 279 ? 11.417 10.493  143.981 1.00 115.62 ? 259 LYS A CD    1 
ATOM   1955 C CE    . LYS A 1 279 ? 11.708 9.024   143.725 1.00 108.83 ? 259 LYS A CE    1 
ATOM   1956 N NZ    . LYS A 1 279 ? 10.495 8.188   143.644 1.00 102.52 ? 259 LYS A NZ    1 
ATOM   1957 N N     . LYS A 1 280 ? 8.844  11.062  147.193 1.00 72.25  ? 260 LYS A N     1 
ATOM   1958 C CA    . LYS A 1 280 ? 8.130  10.047  147.923 1.00 72.56  ? 260 LYS A CA    1 
ATOM   1959 C C     . LYS A 1 280 ? 8.899  8.736   148.044 1.00 69.92  ? 260 LYS A C     1 
ATOM   1960 O O     . LYS A 1 280 ? 9.483  8.287   147.075 1.00 71.88  ? 260 LYS A O     1 
ATOM   1961 C CB    . LYS A 1 280 ? 6.822  9.773   147.205 1.00 78.68  ? 260 LYS A CB    1 
ATOM   1962 N N     . VAL A 1 281 ? 8.883  8.132   149.236 1.00 66.64  ? 261 VAL A N     1 
ATOM   1963 C CA    . VAL A 1 281 ? 9.414  6.784   149.481 1.00 63.46  ? 261 VAL A CA    1 
ATOM   1964 C C     . VAL A 1 281 ? 8.392  5.857   150.129 1.00 58.76  ? 261 VAL A C     1 
ATOM   1965 O O     . VAL A 1 281 ? 7.805  6.206   151.116 1.00 55.30  ? 261 VAL A O     1 
ATOM   1966 C CB    . VAL A 1 281 ? 10.620 6.822   150.419 1.00 64.35  ? 261 VAL A CB    1 
ATOM   1967 C CG1   . VAL A 1 281 ? 11.239 5.449   150.575 1.00 68.35  ? 261 VAL A CG1   1 
ATOM   1968 C CG2   . VAL A 1 281 ? 11.638 7.818   149.952 1.00 58.26  ? 261 VAL A CG2   1 
ATOM   1969 N N     . ASP A 1 282 ? 8.198  4.682   149.561 1.00 57.84  ? 262 ASP A N     1 
ATOM   1970 C CA    . ASP A 1 282 ? 7.390  3.615   150.146 1.00 55.34  ? 262 ASP A CA    1 
ATOM   1971 C C     . ASP A 1 282 ? 8.176  2.654   151.090 1.00 46.58  ? 262 ASP A C     1 
ATOM   1972 O O     . ASP A 1 282 ? 9.376  2.720   151.143 1.00 43.38  ? 262 ASP A O     1 
ATOM   1973 C CB    . ASP A 1 282 ? 6.668  2.820   149.060 1.00 55.82  ? 262 ASP A CB    1 
ATOM   1974 C CG    . ASP A 1 282 ? 6.061  3.703   147.960 1.00 67.95  ? 262 ASP A CG    1 
ATOM   1975 O OD1   . ASP A 1 282 ? 5.436  4.734   148.238 1.00 69.89  ? 262 ASP A OD1   1 
ATOM   1976 O OD2   . ASP A 1 282 ? 6.204  3.336   146.800 1.00 71.58  ? 262 ASP A OD2   1 
ATOM   1977 N N     . GLU A 1 283 ? 7.482  1.775   151.812 1.00 44.00  ? 263 GLU A N     1 
ATOM   1978 C CA    . GLU A 1 283 ? 8.123  0.772   152.669 1.00 41.12  ? 263 GLU A CA    1 
ATOM   1979 C C     . GLU A 1 283 ? 8.037  -0.630  152.063 1.00 42.73  ? 263 GLU A C     1 
ATOM   1980 O O     . GLU A 1 283 ? 7.314  -0.848  151.084 1.00 47.87  ? 263 GLU A O     1 
ATOM   1981 C CB    . GLU A 1 283 ? 7.492  0.775   154.066 1.00 47.24  ? 263 GLU A CB    1 
ATOM   1982 C CG    . GLU A 1 283 ? 7.502  2.134   154.762 1.00 52.96  ? 263 GLU A CG    1 
ATOM   1983 C CD    . GLU A 1 283 ? 8.906  2.644   155.063 1.00 55.23  ? 263 GLU A CD    1 
ATOM   1984 O OE1   . GLU A 1 283 ? 9.762  1.844   155.490 1.00 52.18  ? 263 GLU A OE1   1 
ATOM   1985 O OE2   . GLU A 1 283 ? 9.153  3.852   154.871 1.00 61.32  ? 263 GLU A OE2   1 
ATOM   1986 N N     . LEU A 1 284 ? 8.765  -1.576  152.660 1.00 39.11  ? 264 LEU A N     1 
ATOM   1987 C CA    . LEU A 1 284 ? 8.878  -2.936  152.131 1.00 42.45  ? 264 LEU A CA    1 
ATOM   1988 C C     . LEU A 1 284 ? 8.898  -4.030  153.219 1.00 47.54  ? 264 LEU A C     1 
ATOM   1989 O O     . LEU A 1 284 ? 9.469  -3.841  154.301 1.00 38.91  ? 264 LEU A O     1 
ATOM   1990 C CB    . LEU A 1 284 ? 10.143 -3.043  151.272 1.00 50.39  ? 264 LEU A CB    1 
ATOM   1991 C CG    . LEU A 1 284 ? 10.559 -4.413  150.729 1.00 53.06  ? 264 LEU A CG    1 
ATOM   1992 C CD1   . LEU A 1 284 ? 9.535  -4.919  149.726 1.00 58.22  ? 264 LEU A CD1   1 
ATOM   1993 C CD2   . LEU A 1 284 ? 11.950 -4.350  150.108 1.00 46.09  ? 264 LEU A CD2   1 
ATOM   1994 N N     . LEU A 1 285 ? 8.267  -5.166  152.913 1.00 41.92  ? 265 LEU A N     1 
ATOM   1995 C CA    . LEU A 1 285 ? 8.288  -6.358  153.770 1.00 45.04  ? 265 LEU A CA    1 
ATOM   1996 C C     . LEU A 1 285 ? 8.793  -7.583  153.000 1.00 46.68  ? 265 LEU A C     1 
ATOM   1997 O O     . LEU A 1 285 ? 8.347  -7.836  151.877 1.00 47.90  ? 265 LEU A O     1 
ATOM   1998 C CB    . LEU A 1 285 ? 6.892  -6.652  154.332 1.00 39.57  ? 265 LEU A CB    1 
ATOM   1999 C CG    . LEU A 1 285 ? 6.297  -5.687  155.355 1.00 49.34  ? 265 LEU A CG    1 
ATOM   2000 C CD1   . LEU A 1 285 ? 4.827  -5.995  155.593 1.00 50.51  ? 265 LEU A CD1   1 
ATOM   2001 C CD2   . LEU A 1 285 ? 7.076  -5.745  156.667 1.00 51.31  ? 265 LEU A CD2   1 
ATOM   2002 N N     . ALA A 1 286 ? 9.702  -8.348  153.604 1.00 40.22  ? 266 ALA A N     1 
ATOM   2003 C CA    . ALA A 1 286 ? 10.243 -9.563  152.975 1.00 54.66  ? 266 ALA A CA    1 
ATOM   2004 C C     . ALA A 1 286 ? 10.023 -10.831 153.824 1.00 63.10  ? 266 ALA A C     1 
ATOM   2005 O O     . ALA A 1 286 ? 10.367 -10.862 155.008 1.00 64.50  ? 266 ALA A O     1 
ATOM   2006 C CB    . ALA A 1 286 ? 11.729 -9.377  152.683 1.00 42.28  ? 266 ALA A CB    1 
ATOM   2007 N N     . LEU A 1 287 ? 9.472  -11.879 153.211 1.00 59.57  ? 267 LEU A N     1 
ATOM   2008 C CA    . LEU A 1 287 ? 9.112  -13.103 153.941 1.00 52.69  ? 267 LEU A CA    1 
ATOM   2009 C C     . LEU A 1 287 ? 9.832  -14.369 153.449 1.00 52.65  ? 267 LEU A C     1 
ATOM   2010 O O     . LEU A 1 287 ? 9.672  -14.775 152.298 1.00 52.62  ? 267 LEU A O     1 
ATOM   2011 C CB    . LEU A 1 287 ? 7.595  -13.320 153.861 1.00 48.38  ? 267 LEU A CB    1 
ATOM   2012 C CG    . LEU A 1 287 ? 7.011  -14.636 154.387 1.00 51.09  ? 267 LEU A CG    1 
ATOM   2013 C CD1   . LEU A 1 287 ? 6.832  -14.609 155.897 1.00 53.24  ? 267 LEU A CD1   1 
ATOM   2014 C CD2   . LEU A 1 287 ? 5.694  -14.962 153.691 1.00 58.13  ? 267 LEU A CD2   1 
ATOM   2015 N N     . TYR A 1 288 ? 10.609 -14.992 154.333 1.00 53.05  ? 268 TYR A N     1 
ATOM   2016 C CA    . TYR A 1 288 ? 11.268 -16.271 154.051 1.00 60.56  ? 268 TYR A CA    1 
ATOM   2017 C C     . TYR A 1 288 ? 10.458 -17.441 154.614 1.00 67.82  ? 268 TYR A C     1 
ATOM   2018 O O     . TYR A 1 288 ? 10.401 -17.627 155.830 1.00 65.84  ? 268 TYR A O     1 
ATOM   2019 C CB    . TYR A 1 288 ? 12.683 -16.310 154.650 1.00 61.53  ? 268 TYR A CB    1 
ATOM   2020 C CG    . TYR A 1 288 ? 13.653 -15.294 154.092 1.00 59.68  ? 268 TYR A CG    1 
ATOM   2021 C CD1   . TYR A 1 288 ? 13.696 -13.996 154.588 1.00 51.21  ? 268 TYR A CD1   1 
ATOM   2022 C CD2   . TYR A 1 288 ? 14.541 -15.638 153.079 1.00 60.80  ? 268 TYR A CD2   1 
ATOM   2023 C CE1   . TYR A 1 288 ? 14.586 -13.063 154.081 1.00 49.43  ? 268 TYR A CE1   1 
ATOM   2024 C CE2   . TYR A 1 288 ? 15.434 -14.712 152.563 1.00 58.68  ? 268 TYR A CE2   1 
ATOM   2025 C CZ    . TYR A 1 288 ? 15.454 -13.428 153.068 1.00 54.64  ? 268 TYR A CZ    1 
ATOM   2026 O OH    . TYR A 1 288 ? 16.341 -12.504 152.558 1.00 54.48  ? 268 TYR A OH    1 
ATOM   2027 N N     . LYS A 1 289 ? 9.848  -18.236 153.738 1.00 69.96  ? 269 LYS A N     1 
ATOM   2028 C CA    . LYS A 1 289 ? 9.039  -19.375 154.175 1.00 72.53  ? 269 LYS A CA    1 
ATOM   2029 C C     . LYS A 1 289 ? 9.564  -20.708 153.628 1.00 74.10  ? 269 LYS A C     1 
ATOM   2030 O O     . LYS A 1 289 ? 9.895  -20.814 152.446 1.00 72.34  ? 269 LYS A O     1 
ATOM   2031 C CB    . LYS A 1 289 ? 7.579  -19.181 153.756 1.00 77.25  ? 269 LYS A CB    1 
ATOM   2032 N N     . PRO A 1 290 ? 9.635  -21.734 154.494 1.00 77.48  ? 270 PRO A N     1 
ATOM   2033 C CA    . PRO A 1 290 ? 10.174 -23.053 154.132 1.00 78.45  ? 270 PRO A CA    1 
ATOM   2034 C C     . PRO A 1 290 ? 9.175  -23.936 153.394 1.00 83.65  ? 270 PRO A C     1 
ATOM   2035 O O     . PRO A 1 290 ? 8.016  -23.555 153.226 1.00 80.92  ? 270 PRO A O     1 
ATOM   2036 C CB    . PRO A 1 290 ? 10.523 -23.665 155.487 1.00 76.58  ? 270 PRO A CB    1 
ATOM   2037 C CG    . PRO A 1 290 ? 9.512  -23.082 156.405 1.00 81.32  ? 270 PRO A CG    1 
ATOM   2038 C CD    . PRO A 1 290 ? 9.278  -21.667 155.923 1.00 77.89  ? 270 PRO A CD    1 
ATOM   2039 N N     . GLY A 1 291 ? 9.628  -25.111 152.968 1.00 89.67  ? 271 GLY A N     1 
ATOM   2040 C CA    . GLY A 1 291 ? 8.786  -26.038 152.233 1.00 94.58  ? 271 GLY A CA    1 
ATOM   2041 C C     . GLY A 1 291 ? 8.366  -27.245 153.052 1.00 93.49  ? 271 GLY A C     1 
ATOM   2042 O O     . GLY A 1 291 ? 7.492  -28.012 152.645 1.00 99.77  ? 271 GLY A O     1 
ATOM   2043 O "O5'" . DT  B 2 1   ? 20.644 15.774  156.906 1.00 71.49  ? 1   DT  F "O5'" 1 
ATOM   2044 C "C5'" . DT  B 2 1   ? 19.843 16.699  156.165 1.00 73.65  ? 1   DT  F "C5'" 1 
ATOM   2045 C "C4'" . DT  B 2 1   ? 19.792 18.046  156.867 1.00 71.76  ? 1   DT  F "C4'" 1 
ATOM   2046 O "O4'" . DT  B 2 1   ? 19.141 17.885  158.147 1.00 70.42  ? 1   DT  F "O4'" 1 
ATOM   2047 C "C3'" . DT  B 2 1   ? 21.161 18.677  157.131 1.00 67.21  ? 1   DT  F "C3'" 1 
ATOM   2048 O "O3'" . DT  B 2 1   ? 21.286 19.906  156.433 1.00 74.67  ? 1   DT  F "O3'" 1 
ATOM   2049 C "C2'" . DT  B 2 1   ? 21.234 18.892  158.643 1.00 58.65  ? 1   DT  F "C2'" 1 
ATOM   2050 C "C1'" . DT  B 2 1   ? 19.823 18.600  159.148 1.00 63.43  ? 1   DT  F "C1'" 1 
ATOM   2051 N N1    . DT  B 2 1   ? 19.836 17.773  160.384 1.00 62.17  ? 1   DT  F N1    1 
ATOM   2052 C C2    . DT  B 2 1   ? 19.906 18.396  161.606 1.00 58.34  ? 1   DT  F C2    1 
ATOM   2053 O O2    . DT  B 2 1   ? 19.931 19.605  161.735 1.00 63.28  ? 1   DT  F O2    1 
ATOM   2054 N N3    . DT  B 2 1   ? 19.942 17.552  162.678 1.00 51.91  ? 1   DT  F N3    1 
ATOM   2055 C C4    . DT  B 2 1   ? 19.914 16.173  162.654 1.00 63.53  ? 1   DT  F C4    1 
ATOM   2056 O O4    . DT  B 2 1   ? 19.942 15.501  163.679 1.00 65.84  ? 1   DT  F O4    1 
ATOM   2057 C C5    . DT  B 2 1   ? 19.846 15.578  161.336 1.00 68.37  ? 1   DT  F C5    1 
ATOM   2058 C C7    . DT  B 2 1   ? 19.814 14.087  161.179 1.00 68.98  ? 1   DT  F C7    1 
ATOM   2059 C C6    . DT  B 2 1   ? 19.818 16.399  160.277 1.00 65.75  ? 1   DT  F C6    1 
ATOM   2060 P P     . DC  B 2 2   ? 22.730 20.600  156.284 1.00 85.36  ? 2   DC  F P     1 
ATOM   2061 O OP1   . DC  B 2 2   ? 22.655 21.534  155.136 1.00 76.82  ? 2   DC  F OP1   1 
ATOM   2062 O OP2   . DC  B 2 2   ? 23.753 19.530  156.318 1.00 79.69  ? 2   DC  F OP2   1 
ATOM   2063 O "O5'" . DC  B 2 2   ? 22.891 21.451  157.623 1.00 65.44  ? 2   DC  F "O5'" 1 
ATOM   2064 C "C5'" . DC  B 2 2   ? 21.976 22.493  157.909 1.00 62.75  ? 2   DC  F "C5'" 1 
ATOM   2065 C "C4'" . DC  B 2 2   ? 22.415 23.245  159.143 1.00 61.29  ? 2   DC  F "C4'" 1 
ATOM   2066 O "O4'" . DC  B 2 2   ? 22.215 22.410  160.300 1.00 56.77  ? 2   DC  F "O4'" 1 
ATOM   2067 C "C3'" . DC  B 2 2   ? 23.899 23.631  159.154 1.00 61.39  ? 2   DC  F "C3'" 1 
ATOM   2068 O "O3'" . DC  B 2 2   ? 24.036 25.043  159.042 1.00 66.34  ? 2   DC  F "O3'" 1 
ATOM   2069 C "C2'" . DC  B 2 2   ? 24.436 23.108  160.501 1.00 58.96  ? 2   DC  F "C2'" 1 
ATOM   2070 C "C1'" . DC  B 2 2   ? 23.168 22.756  161.269 1.00 54.80  ? 2   DC  F "C1'" 1 
ATOM   2071 N N1    . DC  B 2 2   ? 23.323 21.605  162.213 1.00 53.40  ? 2   DC  F N1    1 
ATOM   2072 C C2    . DC  B 2 2   ? 23.523 21.850  163.577 1.00 47.04  ? 2   DC  F C2    1 
ATOM   2073 O O2    . DC  B 2 2   ? 23.590 23.017  163.972 1.00 41.19  ? 2   DC  F O2    1 
ATOM   2074 N N3    . DC  B 2 2   ? 23.645 20.795  164.429 1.00 44.17  ? 2   DC  F N3    1 
ATOM   2075 C C4    . DC  B 2 2   ? 23.568 19.549  163.962 1.00 44.14  ? 2   DC  F C4    1 
ATOM   2076 N N4    . DC  B 2 2   ? 23.696 18.544  164.836 1.00 40.35  ? 2   DC  F N4    1 
ATOM   2077 C C5    . DC  B 2 2   ? 23.360 19.279  162.573 1.00 53.55  ? 2   DC  F C5    1 
ATOM   2078 C C6    . DC  B 2 2   ? 23.240 20.327  161.744 1.00 54.85  ? 2   DC  F C6    1 
ATOM   2079 P P     . DT  B 2 3   ? 25.345 25.689  158.363 1.00 76.16  ? 3   DT  F P     1 
ATOM   2080 O OP1   . DT  B 2 3   ? 24.881 26.940  157.723 1.00 77.88  ? 3   DT  F OP1   1 
ATOM   2081 O OP2   . DT  B 2 3   ? 26.024 24.657  157.548 1.00 71.45  ? 3   DT  F OP2   1 
ATOM   2082 O "O5'" . DT  B 2 3   ? 26.319 26.016  159.601 1.00 60.19  ? 3   DT  F "O5'" 1 
ATOM   2083 C "C5'" . DT  B 2 3   ? 25.898 26.907  160.634 1.00 57.62  ? 3   DT  F "C5'" 1 
ATOM   2084 C "C4'" . DT  B 2 3   ? 26.888 26.927  161.796 1.00 57.69  ? 3   DT  F "C4'" 1 
ATOM   2085 O "O4'" . DT  B 2 3   ? 26.700 25.757  162.648 1.00 56.27  ? 3   DT  F "O4'" 1 
ATOM   2086 C "C3'" . DT  B 2 3   ? 28.370 26.930  161.419 1.00 59.32  ? 3   DT  F "C3'" 1 
ATOM   2087 O "O3'" . DT  B 2 3   ? 29.067 27.776  162.324 1.00 71.06  ? 3   DT  F "O3'" 1 
ATOM   2088 C "C2'" . DT  B 2 3   ? 28.764 25.468  161.644 1.00 64.74  ? 3   DT  F "C2'" 1 
ATOM   2089 C "C1'" . DT  B 2 3   ? 27.959 25.171  162.896 1.00 57.64  ? 3   DT  F "C1'" 1 
ATOM   2090 N N1    . DT  B 2 3   ? 27.766 23.709  163.200 1.00 52.03  ? 3   DT  F N1    1 
ATOM   2091 C C2    . DT  B 2 3   ? 27.792 23.280  164.522 1.00 49.32  ? 3   DT  F C2    1 
ATOM   2092 O O2    . DT  B 2 3   ? 27.974 24.024  165.467 1.00 57.32  ? 3   DT  F O2    1 
ATOM   2093 N N3    . DT  B 2 3   ? 27.597 21.944  164.697 1.00 48.16  ? 3   DT  F N3    1 
ATOM   2094 C C4    . DT  B 2 3   ? 27.380 20.998  163.719 1.00 53.26  ? 3   DT  F C4    1 
ATOM   2095 O O4    . DT  B 2 3   ? 27.210 19.813  163.987 1.00 52.77  ? 3   DT  F O4    1 
ATOM   2096 C C5    . DT  B 2 3   ? 27.362 21.503  162.358 1.00 53.55  ? 3   DT  F C5    1 
ATOM   2097 C C7    . DT  B 2 3   ? 27.134 20.562  161.210 1.00 58.10  ? 3   DT  F C7    1 
ATOM   2098 C C6    . DT  B 2 3   ? 27.553 22.822  162.167 1.00 44.85  ? 3   DT  F C6    1 
ATOM   2099 P P     . DA  B 2 4   ? 30.040 28.946  161.803 1.00 75.23  ? 4   DA  F P     1 
ATOM   2100 O OP1   . DA  B 2 4   ? 29.180 30.118  161.530 1.00 63.71  ? 4   DA  F OP1   1 
ATOM   2101 O OP2   . DA  B 2 4   ? 30.928 28.389  160.755 1.00 76.77  ? 4   DA  F OP2   1 
ATOM   2102 O "O5'" . DA  B 2 4   ? 30.950 29.274  163.083 1.00 68.08  ? 4   DA  F "O5'" 1 
ATOM   2103 C "C5'" . DA  B 2 4   ? 30.391 29.995  164.184 1.00 63.33  ? 4   DA  F "C5'" 1 
ATOM   2104 C "C4'" . DA  B 2 4   ? 31.015 29.574  165.510 1.00 60.80  ? 4   DA  F "C4'" 1 
ATOM   2105 O "O4'" . DA  B 2 4   ? 30.750 28.166  165.760 1.00 57.26  ? 4   DA  F "O4'" 1 
ATOM   2106 C "C3'" . DA  B 2 4   ? 32.530 29.750  165.623 1.00 61.62  ? 4   DA  F "C3'" 1 
ATOM   2107 O "O3'" . DA  B 2 4   ? 32.861 30.163  166.966 1.00 66.43  ? 4   DA  F "O3'" 1 
ATOM   2108 C "C2'" . DA  B 2 4   ? 33.056 28.344  165.297 1.00 59.77  ? 4   DA  F "C2'" 1 
ATOM   2109 C "C1'" . DA  B 2 4   ? 31.968 27.453  165.893 1.00 57.93  ? 4   DA  F "C1'" 1 
ATOM   2110 N N9    . DA  B 2 4   ? 31.801 26.152  165.229 1.00 58.93  ? 4   DA  F N9    1 
ATOM   2111 C C8    . DA  B 2 4   ? 31.796 25.900  163.883 1.00 63.06  ? 4   DA  F C8    1 
ATOM   2112 N N7    . DA  B 2 4   ? 31.592 24.634  163.578 1.00 62.85  ? 4   DA  F N7    1 
ATOM   2113 C C5    . DA  B 2 4   ? 31.437 24.014  164.810 1.00 57.93  ? 4   DA  F C5    1 
ATOM   2114 C C6    . DA  B 2 4   ? 31.192 22.666  165.181 1.00 58.80  ? 4   DA  F C6    1 
ATOM   2115 N N6    . DA  B 2 4   ? 31.057 21.670  164.298 1.00 57.83  ? 4   DA  F N6    1 
ATOM   2116 N N1    . DA  B 2 4   ? 31.093 22.386  166.501 1.00 50.10  ? 4   DA  F N1    1 
ATOM   2117 C C2    . DA  B 2 4   ? 31.231 23.386  167.384 1.00 48.36  ? 4   DA  F C2    1 
ATOM   2118 N N3    . DA  B 2 4   ? 31.464 24.683  167.158 1.00 50.16  ? 4   DA  F N3    1 
ATOM   2119 C C4    . DA  B 2 4   ? 31.558 24.934  165.838 1.00 52.34  ? 4   DA  F C4    1 
ATOM   2120 P P     . DA  B 2 5   ? 34.328 30.707  167.346 1.00 76.91  ? 5   DA  F P     1 
ATOM   2121 O OP1   . DA  B 2 5   ? 34.189 32.062  167.912 1.00 80.78  ? 5   DA  F OP1   1 
ATOM   2122 O OP2   . DA  B 2 5   ? 35.245 30.478  166.209 1.00 85.38  ? 5   DA  F OP2   1 
ATOM   2123 O "O5'" . DA  B 2 5   ? 34.790 29.741  168.524 1.00 66.19  ? 5   DA  F "O5'" 1 
ATOM   2124 C "C5'" . DA  B 2 5   ? 35.070 28.398  168.245 1.00 64.61  ? 5   DA  F "C5'" 1 
ATOM   2125 C "C4'" . DA  B 2 5   ? 35.226 27.600  169.518 1.00 58.56  ? 5   DA  F "C4'" 1 
ATOM   2126 O "O4'" . DA  B 2 5   ? 34.673 26.290  169.295 1.00 54.77  ? 5   DA  F "O4'" 1 
ATOM   2127 C "C3'" . DA  B 2 5   ? 36.669 27.347  169.933 1.00 55.10  ? 5   DA  F "C3'" 1 
ATOM   2128 O "O3'" . DA  B 2 5   ? 36.748 27.033  171.316 1.00 58.23  ? 5   DA  F "O3'" 1 
ATOM   2129 C "C2'" . DA  B 2 5   ? 37.041 26.145  169.079 1.00 54.47  ? 5   DA  F "C2'" 1 
ATOM   2130 C "C1'" . DA  B 2 5   ? 35.715 25.381  168.979 1.00 59.84  ? 5   DA  F "C1'" 1 
ATOM   2131 N N9    . DA  B 2 5   ? 35.477 24.837  167.645 1.00 62.38  ? 5   DA  F N9    1 
ATOM   2132 C C8    . DA  B 2 5   ? 35.579 25.505  166.456 1.00 63.40  ? 5   DA  F C8    1 
ATOM   2133 N N7    . DA  B 2 5   ? 35.324 24.761  165.407 1.00 66.26  ? 5   DA  F N7    1 
ATOM   2134 C C5    . DA  B 2 5   ? 35.039 23.515  165.945 1.00 60.86  ? 5   DA  F C5    1 
ATOM   2135 C C6    . DA  B 2 5   ? 34.689 22.285  165.355 1.00 59.92  ? 5   DA  F C6    1 
ATOM   2136 N N6    . DA  B 2 5   ? 34.562 22.116  164.035 1.00 63.19  ? 5   DA  F N6    1 
ATOM   2137 N N1    . DA  B 2 5   ? 34.469 21.234  166.176 1.00 59.23  ? 5   DA  F N1    1 
ATOM   2138 C C2    . DA  B 2 5   ? 34.594 21.411  167.497 1.00 55.43  ? 5   DA  F C2    1 
ATOM   2139 N N3    . DA  B 2 5   ? 34.918 22.519  168.168 1.00 50.39  ? 5   DA  F N3    1 
ATOM   2140 C C4    . DA  B 2 5   ? 35.131 23.543  167.324 1.00 55.87  ? 5   DA  F C4    1 
ATOM   2141 P P     . DA  B 2 6   ? 38.183 26.924  172.042 1.00 77.75  ? 6   DA  F P     1 
ATOM   2142 O OP1   . DA  B 2 6   ? 37.956 27.251  173.470 1.00 72.71  ? 6   DA  F OP1   1 
ATOM   2143 O OP2   . DA  B 2 6   ? 39.140 27.717  171.242 1.00 76.26  ? 6   DA  F OP2   1 
ATOM   2144 O "O5'" . DA  B 2 6   ? 38.614 25.371  171.899 1.00 60.35  ? 6   DA  F "O5'" 1 
ATOM   2145 C "C5'" . DA  B 2 6   ? 38.208 24.416  172.895 1.00 58.63  ? 6   DA  F "C5'" 1 
ATOM   2146 C "C4'" . DA  B 2 6   ? 38.463 22.972  172.458 1.00 54.61  ? 6   DA  F "C4'" 1 
ATOM   2147 O "O4'" . DA  B 2 6   ? 37.943 22.755  171.128 1.00 53.13  ? 6   DA  F "O4'" 1 
ATOM   2148 C "C3'" . DA  B 2 6   ? 39.938 22.535  172.421 1.00 51.96  ? 6   DA  F "C3'" 1 
ATOM   2149 O "O3'" . DA  B 2 6   ? 40.190 21.557  173.433 1.00 57.15  ? 6   DA  F "O3'" 1 
ATOM   2150 C "C2'" . DA  B 2 6   ? 40.139 21.953  171.016 1.00 47.41  ? 6   DA  F "C2'" 1 
ATOM   2151 C "C1'" . DA  B 2 6   ? 38.719 21.770  170.492 1.00 49.18  ? 6   DA  F "C1'" 1 
ATOM   2152 N N9    . DA  B 2 6   ? 38.612 21.974  169.047 1.00 53.49  ? 6   DA  F N9    1 
ATOM   2153 C C8    . DA  B 2 6   ? 38.805 23.147  168.370 1.00 51.87  ? 6   DA  F C8    1 
ATOM   2154 N N7    . DA  B 2 6   ? 38.644 23.044  167.072 1.00 54.04  ? 6   DA  F N7    1 
ATOM   2155 C C5    . DA  B 2 6   ? 38.320 21.711  166.880 1.00 51.16  ? 6   DA  F C5    1 
ATOM   2156 C C6    . DA  B 2 6   ? 38.029 20.968  165.722 1.00 53.84  ? 6   DA  F C6    1 
ATOM   2157 N N6    . DA  B 2 6   ? 38.021 21.502  164.494 1.00 46.87  ? 6   DA  F N6    1 
ATOM   2158 N N1    . DA  B 2 6   ? 37.746 19.649  165.872 1.00 55.75  ? 6   DA  F N1    1 
ATOM   2159 C C2    . DA  B 2 6   ? 37.759 19.124  167.106 1.00 52.01  ? 6   DA  F C2    1 
ATOM   2160 N N3    . DA  B 2 6   ? 38.016 19.729  168.271 1.00 48.42  ? 6   DA  F N3    1 
ATOM   2161 C C4    . DA  B 2 6   ? 38.294 21.032  168.085 1.00 51.25  ? 6   DA  F C4    1 
ATOM   2162 P P     . DG  B 2 7   ? 41.636 20.849  173.555 1.00 54.34  ? 7   DG  F P     1 
ATOM   2163 O OP1   . DG  B 2 7   ? 41.759 20.410  174.962 1.00 41.91  ? 7   DG  F OP1   1 
ATOM   2164 O OP2   . DG  B 2 7   ? 42.673 21.744  172.992 1.00 52.28  ? 7   DG  F OP2   1 
ATOM   2165 O "O5'" . DG  B 2 7   ? 41.532 19.576  172.573 1.00 41.20  ? 7   DG  F "O5'" 1 
ATOM   2166 C "C5'" . DG  B 2 7   ? 40.836 18.398  172.975 1.00 40.60  ? 7   DG  F "C5'" 1 
ATOM   2167 C "C4'" . DG  B 2 7   ? 40.918 17.310  171.903 1.00 42.02  ? 7   DG  F "C4'" 1 
ATOM   2168 O "O4'" . DG  B 2 7   ? 40.595 17.870  170.597 1.00 34.27  ? 7   DG  F "O4'" 1 
ATOM   2169 C "C3'" . DG  B 2 7   ? 42.285 16.611  171.745 1.00 37.16  ? 7   DG  F "C3'" 1 
ATOM   2170 O "O3'" . DG  B 2 7   ? 42.087 15.193  171.638 1.00 32.09  ? 7   DG  F "O3'" 1 
ATOM   2171 C "C2'" . DG  B 2 7   ? 42.824 17.196  170.444 1.00 36.76  ? 7   DG  F "C2'" 1 
ATOM   2172 C "C1'" . DG  B 2 7   ? 41.539 17.416  169.654 1.00 34.19  ? 7   DG  F "C1'" 1 
ATOM   2173 N N9    . DG  B 2 7   ? 41.666 18.430  168.613 1.00 31.63  ? 7   DG  F N9    1 
ATOM   2174 C C8    . DG  B 2 7   ? 42.008 19.757  168.788 1.00 39.58  ? 7   DG  F C8    1 
ATOM   2175 N N7    . DG  B 2 7   ? 42.044 20.438  167.673 1.00 44.18  ? 7   DG  F N7    1 
ATOM   2176 C C5    . DG  B 2 7   ? 41.701 19.508  166.699 1.00 38.50  ? 7   DG  F C5    1 
ATOM   2177 C C6    . DG  B 2 7   ? 41.566 19.665  165.303 1.00 40.22  ? 7   DG  F C6    1 
ATOM   2178 O O6    . DG  B 2 7   ? 41.735 20.692  164.625 1.00 45.71  ? 7   DG  F O6    1 
ATOM   2179 N N1    . DG  B 2 7   ? 41.204 18.472  164.683 1.00 45.13  ? 7   DG  F N1    1 
ATOM   2180 C C2    . DG  B 2 7   ? 40.990 17.275  165.334 1.00 49.76  ? 7   DG  F C2    1 
ATOM   2181 N N2    . DG  B 2 7   ? 40.642 16.228  164.562 1.00 59.23  ? 7   DG  F N2    1 
ATOM   2182 N N3    . DG  B 2 7   ? 41.108 17.113  166.646 1.00 32.72  ? 7   DG  F N3    1 
ATOM   2183 C C4    . DG  B 2 7   ? 41.462 18.266  167.263 1.00 35.28  ? 7   DG  F C4    1 
ATOM   2184 P P     . DA  B 2 8   ? 43.317 14.164  171.499 1.00 31.59  ? 8   DA  F P     1 
ATOM   2185 O OP1   . DA  B 2 8   ? 42.952 12.970  172.270 1.00 31.91  ? 8   DA  F OP1   1 
ATOM   2186 O OP2   . DA  B 2 8   ? 44.573 14.859  171.832 1.00 31.23  ? 8   DA  F OP2   1 
ATOM   2187 O "O5'" . DA  B 2 8   ? 43.317 13.742  169.933 1.00 27.61  ? 8   DA  F "O5'" 1 
ATOM   2188 C "C5'" . DA  B 2 8   ? 42.313 12.837  169.430 1.00 34.43  ? 8   DA  F "C5'" 1 
ATOM   2189 C "C4'" . DA  B 2 8   ? 42.532 12.461  167.954 1.00 31.90  ? 8   DA  F "C4'" 1 
ATOM   2190 O "O4'" . DA  B 2 8   ? 42.596 13.651  167.117 1.00 29.49  ? 8   DA  F "O4'" 1 
ATOM   2191 C "C3'" . DA  B 2 8   ? 43.784 11.636  167.635 1.00 31.19  ? 8   DA  F "C3'" 1 
ATOM   2192 O "O3'" . DA  B 2 8   ? 43.421 10.544  166.744 1.00 37.84  ? 8   DA  F "O3'" 1 
ATOM   2193 C "C2'" . DA  B 2 8   ? 44.725 12.658  166.957 1.00 26.18  ? 8   DA  F "C2'" 1 
ATOM   2194 C "C1'" . DA  B 2 8   ? 43.726 13.589  166.266 1.00 31.70  ? 8   DA  F "C1'" 1 
ATOM   2195 N N9    . DA  B 2 8   ? 44.178 14.969  166.062 1.00 38.76  ? 8   DA  F N9    1 
ATOM   2196 C C8    . DA  B 2 8   ? 44.563 15.861  167.025 1.00 35.91  ? 8   DA  F C8    1 
ATOM   2197 N N7    . DA  B 2 8   ? 44.861 17.054  166.558 1.00 41.04  ? 8   DA  F N7    1 
ATOM   2198 C C5    . DA  B 2 8   ? 44.628 16.945  165.195 1.00 42.09  ? 8   DA  F C5    1 
ATOM   2199 C C6    . DA  B 2 8   ? 44.746 17.868  164.134 1.00 46.44  ? 8   DA  F C6    1 
ATOM   2200 N N6    . DA  B 2 8   ? 45.149 19.131  164.302 1.00 44.18  ? 8   DA  F N6    1 
ATOM   2201 N N1    . DA  B 2 8   ? 44.436 17.437  162.888 1.00 53.02  ? 8   DA  F N1    1 
ATOM   2202 C C2    . DA  B 2 8   ? 44.029 16.170  162.732 1.00 46.55  ? 8   DA  F C2    1 
ATOM   2203 N N3    . DA  B 2 8   ? 43.877 15.216  163.657 1.00 30.05  ? 8   DA  F N3    1 
ATOM   2204 C C4    . DA  B 2 8   ? 44.197 15.671  164.872 1.00 36.54  ? 8   DA  F C4    1 
ATOM   2205 P P     . DT  B 2 9   ? 44.350 9.244   166.558 1.00 42.07  ? 9   DT  F P     1 
ATOM   2206 O OP1   . DT  B 2 9   ? 43.499 8.141   166.211 1.00 38.79  ? 9   DT  F OP1   1 
ATOM   2207 O OP2   . DT  B 2 9   ? 45.208 9.123   167.699 1.00 40.44  ? 9   DT  F OP2   1 
ATOM   2208 O "O5'" . DT  B 2 9   ? 45.277 9.628   165.326 1.00 35.81  ? 9   DT  F "O5'" 1 
ATOM   2209 C "C5'" . DT  B 2 9   ? 44.792 9.590   163.977 1.00 36.01  ? 9   DT  F "C5'" 1 
ATOM   2210 C "C4'" . DT  B 2 9   ? 45.754 10.218  162.990 1.00 42.81  ? 9   DT  F "C4'" 1 
ATOM   2211 O "O4'" . DT  B 2 9   ? 45.816 11.649  163.129 1.00 29.31  ? 9   DT  F "O4'" 1 
ATOM   2212 C "C3'" . DT  B 2 9   ? 47.209 9.741   163.001 1.00 35.83  ? 9   DT  F "C3'" 1 
ATOM   2213 O "O3'" . DT  B 2 9   ? 47.340 8.607   162.123 1.00 42.06  ? 9   DT  F "O3'" 1 
ATOM   2214 C "C2'" . DT  B 2 9   ? 47.987 10.991  162.602 1.00 34.11  ? 9   DT  F "C2'" 1 
ATOM   2215 C "C1'" . DT  B 2 9   ? 46.920 12.067  162.383 1.00 36.13  ? 9   DT  F "C1'" 1 
ATOM   2216 N N1    . DT  B 2 9   ? 47.241 13.457  162.775 1.00 33.03  ? 9   DT  F N1    1 
ATOM   2217 C C2    . DT  B 2 9   ? 47.136 14.439  161.819 1.00 38.15  ? 9   DT  F C2    1 
ATOM   2218 O O2    . DT  B 2 9   ? 46.801 14.220  160.673 1.00 39.53  ? 9   DT  F O2    1 
ATOM   2219 N N3    . DT  B 2 9   ? 47.420 15.702  162.264 1.00 39.87  ? 9   DT  F N3    1 
ATOM   2220 C C4    . DT  B 2 9   ? 47.804 16.073  163.531 1.00 39.17  ? 9   DT  F C4    1 
ATOM   2221 O O4    . DT  B 2 9   ? 48.019 17.248  163.781 1.00 34.16  ? 9   DT  F O4    1 
ATOM   2222 C C5    . DT  B 2 9   ? 47.890 14.995  164.485 1.00 35.07  ? 9   DT  F C5    1 
ATOM   2223 C C7    . DT  B 2 9   ? 48.293 15.305  165.890 1.00 32.22  ? 9   DT  F C7    1 
ATOM   2224 C C6    . DT  B 2 9   ? 47.599 13.759  164.067 1.00 29.85  ? 9   DT  F C6    1 
ATOM   2225 P P     . DC  B 2 10  ? 48.711 7.751   161.968 1.00 44.24  ? 10  DC  F P     1 
ATOM   2226 O OP1   . DC  B 2 10  ? 48.364 6.455   161.469 1.00 36.06  ? 10  DC  F OP1   1 
ATOM   2227 O OP2   . DC  B 2 10  ? 49.459 7.828   163.196 1.00 33.64  ? 10  DC  F OP2   1 
ATOM   2228 O "O5'" . DC  B 2 10  ? 49.559 8.579   160.907 1.00 39.79  ? 10  DC  F "O5'" 1 
ATOM   2229 C "C5'" . DC  B 2 10  ? 49.309 8.557   159.487 1.00 38.56  ? 10  DC  F "C5'" 1 
ATOM   2230 C "C4'" . DC  B 2 10  ? 50.006 9.679   158.741 1.00 40.32  ? 10  DC  F "C4'" 1 
ATOM   2231 O "O4'" . DC  B 2 10  ? 49.629 10.973  159.246 1.00 47.82  ? 10  DC  F "O4'" 1 
ATOM   2232 C "C3'" . DC  B 2 10  ? 51.534 9.691   158.729 1.00 42.19  ? 10  DC  F "C3'" 1 
ATOM   2233 O "O3'" . DC  B 2 10  ? 52.079 8.826   157.718 1.00 45.34  ? 10  DC  F "O3'" 1 
ATOM   2234 C "C2'" . DC  B 2 10  ? 51.853 11.153  158.463 1.00 51.14  ? 10  DC  F "C2'" 1 
ATOM   2235 C "C1'" . DC  B 2 10  ? 50.586 11.926  158.845 1.00 49.46  ? 10  DC  F "C1'" 1 
ATOM   2236 N N1    . DC  B 2 10  ? 50.763 12.907  159.936 1.00 48.11  ? 10  DC  F N1    1 
ATOM   2237 C C2    . DC  B 2 10  ? 50.684 14.267  159.634 1.00 56.56  ? 10  DC  F C2    1 
ATOM   2238 O O2    . DC  B 2 10  ? 50.403 14.606  158.485 1.00 66.37  ? 10  DC  F O2    1 
ATOM   2239 N N3    . DC  B 2 10  ? 50.887 15.175  160.608 1.00 52.65  ? 10  DC  F N3    1 
ATOM   2240 C C4    . DC  B 2 10  ? 51.197 14.771  161.839 1.00 48.54  ? 10  DC  F C4    1 
ATOM   2241 N N4    . DC  B 2 10  ? 51.385 15.704  162.771 1.00 39.57  ? 10  DC  F N4    1 
ATOM   2242 C C5    . DC  B 2 10  ? 51.310 13.392  162.172 1.00 43.79  ? 10  DC  F C5    1 
ATOM   2243 C C6    . DC  B 2 10  ? 51.092 12.502  161.197 1.00 42.87  ? 10  DC  F C6    1 
ATOM   2244 P P     . DG  B 2 11  ? 53.641 8.526   157.616 1.00 47.93  ? 11  DG  F P     1 
ATOM   2245 O OP1   . DG  B 2 11  ? 53.822 7.358   156.803 1.00 50.76  ? 11  DG  F OP1   1 
ATOM   2246 O OP2   . DG  B 2 11  ? 54.212 8.549   158.935 1.00 48.49  ? 11  DG  F OP2   1 
ATOM   2247 O "O5'" . DG  B 2 11  ? 54.213 9.809   156.893 1.00 61.15  ? 11  DG  F "O5'" 1 
ATOM   2248 C "C5'" . DG  B 2 11  ? 54.098 10.006  155.481 1.00 58.80  ? 11  DG  F "C5'" 1 
ATOM   2249 C "C4'" . DG  B 2 11  ? 54.563 11.389  155.093 1.00 62.29  ? 11  DG  F "C4'" 1 
ATOM   2250 O "O4'" . DG  B 2 11  ? 53.921 12.372  155.917 1.00 62.94  ? 11  DG  F "O4'" 1 
ATOM   2251 C "C3'" . DG  B 2 11  ? 56.054 11.652  155.251 1.00 67.13  ? 11  DG  F "C3'" 1 
ATOM   2252 O "O3'" . DG  B 2 11  ? 56.754 11.306  154.058 1.00 63.54  ? 11  DG  F "O3'" 1 
ATOM   2253 C "C2'" . DG  B 2 11  ? 56.108 13.148  155.474 1.00 67.39  ? 11  DG  F "C2'" 1 
ATOM   2254 C "C1'" . DG  B 2 11  ? 54.776 13.473  156.134 1.00 68.78  ? 11  DG  F "C1'" 1 
ATOM   2255 N N9    . DG  B 2 11  ? 54.860 13.694  157.569 1.00 70.09  ? 11  DG  F N9    1 
ATOM   2256 C C8    . DG  B 2 11  ? 55.164 12.765  158.530 1.00 63.53  ? 11  DG  F C8    1 
ATOM   2257 N N7    . DG  B 2 11  ? 55.174 13.261  159.735 1.00 59.67  ? 11  DG  F N7    1 
ATOM   2258 C C5    . DG  B 2 11  ? 54.869 14.601  159.557 1.00 63.28  ? 11  DG  F C5    1 
ATOM   2259 C C6    . DG  B 2 11  ? 54.750 15.648  160.501 1.00 59.47  ? 11  DG  F C6    1 
ATOM   2260 O O6    . DG  B 2 11  ? 54.880 15.600  161.723 1.00 53.23  ? 11  DG  F O6    1 
ATOM   2261 N N1    . DG  B 2 11  ? 54.440 16.852  159.888 1.00 65.39  ? 11  DG  F N1    1 
ATOM   2262 C C2    . DG  B 2 11  ? 54.265 17.030  158.542 1.00 65.81  ? 11  DG  F C2    1 
ATOM   2263 N N2    . DG  B 2 11  ? 53.974 18.272  158.148 1.00 60.09  ? 11  DG  F N2    1 
ATOM   2264 N N3    . DG  B 2 11  ? 54.373 16.065  157.651 1.00 69.98  ? 11  DG  F N3    1 
ATOM   2265 C C4    . DG  B 2 11  ? 54.685 14.886  158.223 1.00 69.95  ? 11  DG  F C4    1 
ATOM   2266 O "O5'" . DA  C 3 1   ? 57.834 23.289  170.117 1.00 49.87  ? 1   DA  G "O5'" 1 
ATOM   2267 C "C5'" . DA  C 3 1   ? 58.765 24.292  169.695 1.00 50.28  ? 1   DA  G "C5'" 1 
ATOM   2268 C "C4'" . DA  C 3 1   ? 58.619 24.571  168.210 1.00 57.33  ? 1   DA  G "C4'" 1 
ATOM   2269 O "O4'" . DA  C 3 1   ? 59.175 23.457  167.453 1.00 55.86  ? 1   DA  G "O4'" 1 
ATOM   2270 C "C3'" . DA  C 3 1   ? 57.165 24.736  167.729 1.00 58.03  ? 1   DA  G "C3'" 1 
ATOM   2271 O "O3'" . DA  C 3 1   ? 57.029 25.857  166.854 1.00 52.02  ? 1   DA  G "O3'" 1 
ATOM   2272 C "C2'" . DA  C 3 1   ? 56.889 23.436  166.990 1.00 60.86  ? 1   DA  G "C2'" 1 
ATOM   2273 C "C1'" . DA  C 3 1   ? 58.265 23.096  166.440 1.00 60.35  ? 1   DA  G "C1'" 1 
ATOM   2274 N N9    . DA  C 3 1   ? 58.397 21.678  166.146 1.00 55.64  ? 1   DA  G N9    1 
ATOM   2275 C C8    . DA  C 3 1   ? 58.492 21.101  164.908 1.00 47.15  ? 1   DA  G C8    1 
ATOM   2276 N N7    . DA  C 3 1   ? 58.548 19.792  164.941 1.00 48.78  ? 1   DA  G N7    1 
ATOM   2277 C C5    . DA  C 3 1   ? 58.466 19.487  166.290 1.00 53.94  ? 1   DA  G C5    1 
ATOM   2278 C C6    . DA  C 3 1   ? 58.472 18.263  166.990 1.00 49.02  ? 1   DA  G C6    1 
ATOM   2279 N N6    . DA  C 3 1   ? 58.573 17.073  166.391 1.00 44.88  ? 1   DA  G N6    1 
ATOM   2280 N N1    . DA  C 3 1   ? 58.374 18.311  168.338 1.00 51.44  ? 1   DA  G N1    1 
ATOM   2281 C C2    . DA  C 3 1   ? 58.276 19.507  168.935 1.00 54.45  ? 1   DA  G C2    1 
ATOM   2282 N N3    . DA  C 3 1   ? 58.258 20.723  168.384 1.00 56.09  ? 1   DA  G N3    1 
ATOM   2283 C C4    . DA  C 3 1   ? 58.360 20.641  167.047 1.00 56.06  ? 1   DA  G C4    1 
ATOM   2284 P P     . DC  C 3 2   ? 55.579 26.236  166.263 1.00 71.09  ? 2   DC  G P     1 
ATOM   2285 O OP1   . DC  C 3 2   ? 55.562 27.697  166.041 1.00 75.13  ? 2   DC  G OP1   1 
ATOM   2286 O OP2   . DC  C 3 2   ? 54.560 25.602  167.131 1.00 64.18  ? 2   DC  G OP2   1 
ATOM   2287 O "O5'" . DC  C 3 2   ? 55.522 25.500  164.837 1.00 58.59  ? 2   DC  G "O5'" 1 
ATOM   2288 C "C5'" . DC  C 3 2   ? 56.431 25.884  163.796 1.00 60.99  ? 2   DC  G "C5'" 1 
ATOM   2289 C "C4'" . DC  C 3 2   ? 56.018 25.293  162.454 1.00 60.03  ? 2   DC  G "C4'" 1 
ATOM   2290 O "O4'" . DC  C 3 2   ? 56.274 23.874  162.451 1.00 58.96  ? 2   DC  G "O4'" 1 
ATOM   2291 C "C3'" . DC  C 3 2   ? 54.543 25.474  162.104 1.00 64.63  ? 2   DC  G "C3'" 1 
ATOM   2292 O "O3'" . DC  C 3 2   ? 54.406 26.453  161.074 1.00 77.97  ? 2   DC  G "O3'" 1 
ATOM   2293 C "C2'" . DC  C 3 2   ? 54.063 24.090  161.638 1.00 55.06  ? 2   DC  G "C2'" 1 
ATOM   2294 C "C1'" . DC  C 3 2   ? 55.316 23.214  161.659 1.00 56.09  ? 2   DC  G "C1'" 1 
ATOM   2295 N N1    . DC  C 3 2   ? 55.080 21.850  162.248 1.00 58.94  ? 2   DC  G N1    1 
ATOM   2296 C C2    . DC  C 3 2   ? 54.936 20.739  161.405 1.00 52.73  ? 2   DC  G C2    1 
ATOM   2297 O O2    . DC  C 3 2   ? 55.003 20.898  160.182 1.00 51.40  ? 2   DC  G O2    1 
ATOM   2298 N N3    . DC  C 3 2   ? 54.725 19.516  161.959 1.00 41.66  ? 2   DC  G N3    1 
ATOM   2299 C C4    . DC  C 3 2   ? 54.655 19.384  163.285 1.00 46.43  ? 2   DC  G C4    1 
ATOM   2300 N N4    . DC  C 3 2   ? 54.453 18.158  163.782 1.00 35.91  ? 2   DC  G N4    1 
ATOM   2301 C C5    . DC  C 3 2   ? 54.794 20.503  164.161 1.00 46.17  ? 2   DC  G C5    1 
ATOM   2302 C C6    . DC  C 3 2   ? 55.003 21.703  163.606 1.00 53.57  ? 2   DC  G C6    1 
ATOM   2303 P P     . DG  C 3 3   ? 52.979 27.138  160.784 1.00 98.53  ? 3   DG  G P     1 
ATOM   2304 O OP1   . DG  C 3 3   ? 53.258 28.397  160.054 1.00 88.73  ? 3   DG  G OP1   1 
ATOM   2305 O OP2   . DG  C 3 3   ? 52.218 27.174  162.053 1.00 98.44  ? 3   DG  G OP2   1 
ATOM   2306 O "O5'" . DG  C 3 3   ? 52.226 26.095  159.821 1.00 89.77  ? 3   DG  G "O5'" 1 
ATOM   2307 C "C5'" . DG  C 3 3   ? 52.720 25.840  158.504 1.00 91.19  ? 3   DG  G "C5'" 1 
ATOM   2308 C "C4'" . DG  C 3 3   ? 51.843 24.832  157.766 1.00 95.08  ? 3   DG  G "C4'" 1 
ATOM   2309 O "O4'" . DG  C 3 3   ? 51.960 23.523  158.387 1.00 93.52  ? 3   DG  G "O4'" 1 
ATOM   2310 C "C3'" . DG  C 3 3   ? 50.350 25.156  157.728 1.00 96.59  ? 3   DG  G "C3'" 1 
ATOM   2311 O "O3'" . DG  C 3 3   ? 49.813 24.817  156.450 1.00 104.93 ? 3   DG  G "O3'" 1 
ATOM   2312 C "C2'" . DG  C 3 3   ? 49.770 24.273  158.834 1.00 87.97  ? 3   DG  G "C2'" 1 
ATOM   2313 C "C1'" . DG  C 3 3   ? 50.685 23.052  158.789 1.00 86.97  ? 3   DG  G "C1'" 1 
ATOM   2314 N N9    . DG  C 3 3   ? 50.841 22.395  160.086 1.00 82.42  ? 3   DG  G N9    1 
ATOM   2315 C C8    . DG  C 3 3   ? 50.977 23.012  161.305 1.00 86.70  ? 3   DG  G C8    1 
ATOM   2316 N N7    . DG  C 3 3   ? 51.117 22.182  162.300 1.00 81.16  ? 3   DG  G N7    1 
ATOM   2317 C C5    . DG  C 3 3   ? 51.072 20.929  161.706 1.00 69.23  ? 3   DG  G C5    1 
ATOM   2318 C C6    . DG  C 3 3   ? 51.171 19.647  162.291 1.00 55.92  ? 3   DG  G C6    1 
ATOM   2319 O O6    . DG  C 3 3   ? 51.322 19.364  163.487 1.00 51.93  ? 3   DG  G O6    1 
ATOM   2320 N N1    . DG  C 3 3   ? 51.078 18.636  161.339 1.00 58.29  ? 3   DG  G N1    1 
ATOM   2321 C C2    . DG  C 3 3   ? 50.911 18.842  159.989 1.00 69.59  ? 3   DG  G C2    1 
ATOM   2322 N N2    . DG  C 3 3   ? 50.844 17.740  159.226 1.00 76.67  ? 3   DG  G N2    1 
ATOM   2323 N N3    . DG  C 3 3   ? 50.817 20.044  159.424 1.00 68.06  ? 3   DG  G N3    1 
ATOM   2324 C C4    . DG  C 3 3   ? 50.905 21.038  160.342 1.00 70.97  ? 3   DG  G C4    1 
ATOM   2325 P P     . DA  C 3 4   ? 48.508 25.564  155.875 1.00 102.59 ? 4   DA  G P     1 
ATOM   2326 O OP1   . DA  C 3 4   ? 48.978 26.529  154.853 1.00 95.70  ? 4   DA  G OP1   1 
ATOM   2327 O OP2   . DA  C 3 4   ? 47.676 26.021  157.013 1.00 101.48 ? 4   DA  G OP2   1 
ATOM   2328 O "O5'" . DA  C 3 4   ? 47.688 24.387  155.160 1.00 92.81  ? 4   DA  G "O5'" 1 
ATOM   2329 C "C5'" . DA  C 3 4   ? 48.328 23.559  154.193 1.00 83.08  ? 4   DA  G "C5'" 1 
ATOM   2330 C "C4'" . DA  C 3 4   ? 47.640 22.204  154.083 1.00 68.78  ? 4   DA  G "C4'" 1 
ATOM   2331 O "O4'" . DA  C 3 4   ? 47.912 21.413  155.272 1.00 57.55  ? 4   DA  G "O4'" 1 
ATOM   2332 C "C3'" . DA  C 3 4   ? 46.120 22.245  153.922 1.00 58.41  ? 4   DA  G "C3'" 1 
ATOM   2333 O "O3'" . DA  C 3 4   ? 45.723 21.289  152.931 1.00 60.35  ? 4   DA  G "O3'" 1 
ATOM   2334 C "C2'" . DA  C 3 4   ? 45.605 21.878  155.320 1.00 53.07  ? 4   DA  G "C2'" 1 
ATOM   2335 C "C1'" . DA  C 3 4   ? 46.705 20.956  155.843 1.00 55.78  ? 4   DA  G "C1'" 1 
ATOM   2336 N N9    . DA  C 3 4   ? 46.864 20.967  157.308 1.00 64.20  ? 4   DA  G N9    1 
ATOM   2337 C C8    . DA  C 3 4   ? 46.949 22.065  158.123 1.00 66.33  ? 4   DA  G C8    1 
ATOM   2338 N N7    . DA  C 3 4   ? 47.111 21.774  159.394 1.00 61.90  ? 4   DA  G N7    1 
ATOM   2339 C C5    . DA  C 3 4   ? 47.145 20.390  159.419 1.00 55.88  ? 4   DA  G C5    1 
ATOM   2340 C C6    . DA  C 3 4   ? 47.299 19.460  160.473 1.00 48.50  ? 4   DA  G C6    1 
ATOM   2341 N N6    . DA  C 3 4   ? 47.453 19.816  161.750 1.00 36.36  ? 4   DA  G N6    1 
ATOM   2342 N N1    . DA  C 3 4   ? 47.289 18.147  160.157 1.00 46.43  ? 4   DA  G N1    1 
ATOM   2343 C C2    . DA  C 3 4   ? 47.139 17.797  158.874 1.00 50.82  ? 4   DA  G C2    1 
ATOM   2344 N N3    . DA  C 3 4   ? 46.988 18.577  157.801 1.00 49.32  ? 4   DA  G N3    1 
ATOM   2345 C C4    . DA  C 3 4   ? 47.000 19.873  158.144 1.00 53.54  ? 4   DA  G C4    1 
ATOM   2346 P P     . DT  C 3 5   ? 44.267 21.343  152.243 1.00 67.14  ? 5   DT  G P     1 
ATOM   2347 O OP1   . DT  C 3 5   ? 44.465 20.964  150.826 1.00 58.93  ? 5   DT  G OP1   1 
ATOM   2348 O OP2   . DT  C 3 5   ? 43.621 22.639  152.541 1.00 68.78  ? 5   DT  G OP2   1 
ATOM   2349 O "O5'" . DT  C 3 5   ? 43.457 20.185  153.013 1.00 56.13  ? 5   DT  G "O5'" 1 
ATOM   2350 C "C5'" . DT  C 3 5   ? 44.050 18.895  153.153 1.00 49.83  ? 5   DT  G "C5'" 1 
ATOM   2351 C "C4'" . DT  C 3 5   ? 43.373 18.062  154.238 1.00 49.76  ? 5   DT  G "C4'" 1 
ATOM   2352 O "O4'" . DT  C 3 5   ? 43.862 18.426  155.556 1.00 53.59  ? 5   DT  G "O4'" 1 
ATOM   2353 C "C3'" . DT  C 3 5   ? 41.840 18.146  154.316 1.00 54.26  ? 5   DT  G "C3'" 1 
ATOM   2354 O "O3'" . DT  C 3 5   ? 41.300 16.845  154.062 1.00 59.28  ? 5   DT  G "O3'" 1 
ATOM   2355 C "C2'" . DT  C 3 5   ? 41.574 18.603  155.771 1.00 53.68  ? 5   DT  G "C2'" 1 
ATOM   2356 C "C1'" . DT  C 3 5   ? 42.841 18.121  156.465 1.00 51.12  ? 5   DT  G "C1'" 1 
ATOM   2357 N N1    . DT  C 3 5   ? 43.150 18.752  157.818 1.00 52.21  ? 5   DT  G N1    1 
ATOM   2358 C C2    . DT  C 3 5   ? 43.410 17.924  158.901 1.00 53.97  ? 5   DT  G C2    1 
ATOM   2359 O O2    . DT  C 3 5   ? 43.388 16.708  158.835 1.00 53.36  ? 5   DT  G O2    1 
ATOM   2360 N N3    . DT  C 3 5   ? 43.688 18.573  160.071 1.00 53.97  ? 5   DT  G N3    1 
ATOM   2361 C C4    . DT  C 3 5   ? 43.741 19.936  160.278 1.00 57.80  ? 5   DT  G C4    1 
ATOM   2362 O O4    . DT  C 3 5   ? 44.005 20.420  161.375 1.00 56.96  ? 5   DT  G O4    1 
ATOM   2363 C C5    . DT  C 3 5   ? 43.464 20.753  159.114 1.00 57.67  ? 5   DT  G C5    1 
ATOM   2364 C C7    . DT  C 3 5   ? 43.498 22.251  159.225 1.00 56.72  ? 5   DT  G C7    1 
ATOM   2365 C C6    . DT  C 3 5   ? 43.185 20.128  157.950 1.00 50.15  ? 5   DT  G C6    1 
ATOM   2366 P P     . DC  C 3 6   ? 39.807 16.645  153.499 1.00 84.96  ? 6   DC  G P     1 
ATOM   2367 O OP1   . DC  C 3 6   ? 39.896 15.952  152.192 1.00 85.01  ? 6   DC  G OP1   1 
ATOM   2368 O OP2   . DC  C 3 6   ? 39.093 17.934  153.616 1.00 85.41  ? 6   DC  G OP2   1 
ATOM   2369 O "O5'" . DC  C 3 6   ? 39.153 15.644  154.554 1.00 79.51  ? 6   DC  G "O5'" 1 
ATOM   2370 C "C5'" . DC  C 3 6   ? 39.184 15.979  155.928 1.00 75.91  ? 6   DC  G "C5'" 1 
ATOM   2371 C "C4'" . DC  C 3 6   ? 39.523 14.775  156.780 1.00 65.25  ? 6   DC  G "C4'" 1 
ATOM   2372 O "O4'" . DC  C 3 6   ? 40.438 15.185  157.833 1.00 59.98  ? 6   DC  G "O4'" 1 
ATOM   2373 C "C3'" . DC  C 3 6   ? 38.324 14.153  157.477 1.00 63.86  ? 6   DC  G "C3'" 1 
ATOM   2374 O "O3'" . DC  C 3 6   ? 38.465 12.723  157.584 1.00 57.66  ? 6   DC  G "O3'" 1 
ATOM   2375 C "C2'" . DC  C 3 6   ? 38.310 14.851  158.842 1.00 66.65  ? 6   DC  G "C2'" 1 
ATOM   2376 C "C1'" . DC  C 3 6   ? 39.779 15.209  159.087 1.00 57.83  ? 6   DC  G "C1'" 1 
ATOM   2377 N N1    . DC  C 3 6   ? 39.971 16.578  159.732 1.00 53.53  ? 6   DC  G N1    1 
ATOM   2378 C C2    . DC  C 3 6   ? 40.368 16.674  161.085 1.00 46.58  ? 6   DC  G C2    1 
ATOM   2379 O O2    . DC  C 3 6   ? 40.566 15.647  161.734 1.00 42.86  ? 6   DC  G O2    1 
ATOM   2380 N N3    . DC  C 3 6   ? 40.523 17.898  161.642 1.00 50.09  ? 6   DC  G N3    1 
ATOM   2381 C C4    . DC  C 3 6   ? 40.305 18.993  160.917 1.00 50.49  ? 6   DC  G C4    1 
ATOM   2382 N N4    . DC  C 3 6   ? 40.478 20.175  161.514 1.00 48.55  ? 6   DC  G N4    1 
ATOM   2383 C C5    . DC  C 3 6   ? 39.899 18.924  159.545 1.00 54.49  ? 6   DC  G C5    1 
ATOM   2384 C C6    . DC  C 3 6   ? 39.745 17.710  159.000 1.00 53.83  ? 6   DC  G C6    1 
ATOM   2385 P P     . DT  C 3 7   ? 37.200 11.799  157.991 1.00 67.06  ? 7   DT  G P     1 
ATOM   2386 O OP1   . DT  C 3 7   ? 37.329 10.494  157.308 1.00 69.83  ? 7   DT  G OP1   1 
ATOM   2387 O OP2   . DT  C 3 7   ? 35.960 12.581  157.817 1.00 61.30  ? 7   DT  G OP2   1 
ATOM   2388 O "O5'" . DT  C 3 7   ? 37.399 11.552  159.558 1.00 62.24  ? 7   DT  G "O5'" 1 
ATOM   2389 C "C5'" . DT  C 3 7   ? 36.717 12.360  160.483 1.00 61.77  ? 7   DT  G "C5'" 1 
ATOM   2390 C "C4'" . DT  C 3 7   ? 37.113 12.007  161.897 1.00 59.20  ? 7   DT  G "C4'" 1 
ATOM   2391 O "O4'" . DT  C 3 7   ? 37.813 13.133  162.484 1.00 51.24  ? 7   DT  G "O4'" 1 
ATOM   2392 C "C3'" . DT  C 3 7   ? 35.934 11.740  162.814 1.00 62.80  ? 7   DT  G "C3'" 1 
ATOM   2393 O "O3'" . DT  C 3 7   ? 36.293 10.831  163.861 1.00 65.16  ? 7   DT  G "O3'" 1 
ATOM   2394 C "C2'" . DT  C 3 7   ? 35.609 13.135  163.343 1.00 54.74  ? 7   DT  G "C2'" 1 
ATOM   2395 C "C1'" . DT  C 3 7   ? 36.995 13.759  163.459 1.00 51.43  ? 7   DT  G "C1'" 1 
ATOM   2396 N N1    . DT  C 3 7   ? 37.017 15.245  163.232 1.00 48.95  ? 7   DT  G N1    1 
ATOM   2397 C C2    . DT  C 3 7   ? 37.272 16.082  164.295 1.00 48.20  ? 7   DT  G C2    1 
ATOM   2398 O O2    . DT  C 3 7   ? 37.478 15.682  165.423 1.00 47.84  ? 7   DT  G O2    1 
ATOM   2399 N N3    . DT  C 3 7   ? 37.278 17.418  163.991 1.00 48.88  ? 7   DT  G N3    1 
ATOM   2400 C C4    . DT  C 3 7   ? 37.057 17.996  162.758 1.00 43.33  ? 7   DT  G C4    1 
ATOM   2401 O O4    . DT  C 3 7   ? 37.085 19.220  162.592 1.00 41.12  ? 7   DT  G O4    1 
ATOM   2402 C C5    . DT  C 3 7   ? 36.793 17.063  161.679 1.00 44.37  ? 7   DT  G C5    1 
ATOM   2403 C C7    . DT  C 3 7   ? 36.534 17.566  160.289 1.00 46.33  ? 7   DT  G C7    1 
ATOM   2404 C C6    . DT  C 3 7   ? 36.787 15.747  161.967 1.00 47.21  ? 7   DT  G C6    1 
ATOM   2405 P P     . DT  C 3 8   ? 35.144 10.220  164.811 1.00 63.83  ? 8   DT  G P     1 
ATOM   2406 O OP1   . DT  C 3 8   ? 35.685 9.025   165.497 1.00 60.04  ? 8   DT  G OP1   1 
ATOM   2407 O OP2   . DT  C 3 8   ? 33.920 10.118  163.990 1.00 50.48  ? 8   DT  G OP2   1 
ATOM   2408 O "O5'" . DT  C 3 8   ? 34.908 11.361  165.913 1.00 49.10  ? 8   DT  G "O5'" 1 
ATOM   2409 C "C5'" . DT  C 3 8   ? 35.849 11.520  166.966 1.00 41.37  ? 8   DT  G "C5'" 1 
ATOM   2410 C "C4'" . DT  C 3 8   ? 35.496 12.694  167.869 1.00 38.64  ? 8   DT  G "C4'" 1 
ATOM   2411 O "O4'" . DT  C 3 8   ? 35.539 13.933  167.125 1.00 41.03  ? 8   DT  G "O4'" 1 
ATOM   2412 C "C3'" . DT  C 3 8   ? 34.106 12.636  168.530 1.00 38.09  ? 8   DT  G "C3'" 1 
ATOM   2413 O "O3'" . DT  C 3 8   ? 34.260 12.598  169.960 1.00 41.75  ? 8   DT  G "O3'" 1 
ATOM   2414 C "C2'" . DT  C 3 8   ? 33.405 13.926  168.053 1.00 38.11  ? 8   DT  G "C2'" 1 
ATOM   2415 C "C1'" . DT  C 3 8   ? 34.591 14.807  167.688 1.00 44.59  ? 8   DT  G "C1'" 1 
ATOM   2416 N N1    . DT  C 3 8   ? 34.305 15.907  166.705 1.00 42.79  ? 8   DT  G N1    1 
ATOM   2417 C C2    . DT  C 3 8   ? 34.476 17.213  167.104 1.00 50.57  ? 8   DT  G C2    1 
ATOM   2418 O O2    . DT  C 3 8   ? 34.812 17.527  168.231 1.00 61.94  ? 8   DT  G O2    1 
ATOM   2419 N N3    . DT  C 3 8   ? 34.227 18.148  166.139 1.00 46.86  ? 8   DT  G N3    1 
ATOM   2420 C C4    . DT  C 3 8   ? 33.844 17.920  164.836 1.00 42.57  ? 8   DT  G C4    1 
ATOM   2421 O O4    . DT  C 3 8   ? 33.646 18.837  164.046 1.00 54.69  ? 8   DT  G O4    1 
ATOM   2422 C C5    . DT  C 3 8   ? 33.692 16.530  164.469 1.00 39.52  ? 8   DT  G C5    1 
ATOM   2423 C C7    . DT  C 3 8   ? 33.271 16.162  163.077 1.00 46.30  ? 8   DT  G C7    1 
ATOM   2424 C C6    . DT  C 3 8   ? 33.936 15.597  165.410 1.00 43.84  ? 8   DT  G C6    1 
ATOM   2425 P P     . DT  C 3 9   ? 32.976 12.537  170.932 1.00 52.49  ? 9   DT  G P     1 
ATOM   2426 O OP1   . DT  C 3 9   ? 33.433 11.912  172.189 1.00 43.68  ? 9   DT  G OP1   1 
ATOM   2427 O OP2   . DT  C 3 9   ? 31.825 11.956  170.204 1.00 47.69  ? 9   DT  G OP2   1 
ATOM   2428 O "O5'" . DT  C 3 9   ? 32.604 14.077  171.191 1.00 42.69  ? 9   DT  G "O5'" 1 
ATOM   2429 C "C5'" . DT  C 3 9   ? 33.423 14.881  172.034 1.00 44.06  ? 9   DT  G "C5'" 1 
ATOM   2430 C "C4'" . DT  C 3 9   ? 32.819 16.270  172.233 1.00 38.42  ? 9   DT  G "C4'" 1 
ATOM   2431 O "O4'" . DT  C 3 9   ? 32.741 16.968  170.962 1.00 32.28  ? 9   DT  G "O4'" 1 
ATOM   2432 C "C3'" . DT  C 3 9   ? 31.408 16.302  172.838 1.00 39.26  ? 9   DT  G "C3'" 1 
ATOM   2433 O "O3'" . DT  C 3 9   ? 31.423 17.093  174.047 1.00 40.46  ? 9   DT  G "O3'" 1 
ATOM   2434 C "C2'" . DT  C 3 9   ? 30.534 16.937  171.733 1.00 38.45  ? 9   DT  G "C2'" 1 
ATOM   2435 C "C1'" . DT  C 3 9   ? 31.556 17.729  170.920 1.00 37.54  ? 9   DT  G "C1'" 1 
ATOM   2436 N N1    . DT  C 3 9   ? 31.196 17.957  169.450 1.00 37.37  ? 9   DT  G N1    1 
ATOM   2437 C C2    . DT  C 3 9   ? 31.128 19.249  168.960 1.00 40.01  ? 9   DT  G C2    1 
ATOM   2438 O O2    . DT  C 3 9   ? 31.301 20.238  169.653 1.00 41.46  ? 9   DT  G O2    1 
ATOM   2439 N N3    . DT  C 3 9   ? 30.838 19.344  167.616 1.00 36.57  ? 9   DT  G N3    1 
ATOM   2440 C C4    . DT  C 3 9   ? 30.630 18.299  166.727 1.00 42.53  ? 9   DT  G C4    1 
ATOM   2441 O O4    . DT  C 3 9   ? 30.377 18.483  165.538 1.00 40.38  ? 9   DT  G O4    1 
ATOM   2442 C C5    . DT  C 3 9   ? 30.730 16.976  167.296 1.00 35.61  ? 9   DT  G C5    1 
ATOM   2443 C C7    . DT  C 3 9   ? 30.519 15.767  166.427 1.00 33.96  ? 9   DT  G C7    1 
ATOM   2444 C C6    . DT  C 3 9   ? 31.015 16.868  168.611 1.00 37.93  ? 9   DT  G C6    1 
ATOM   2445 P P     . DA  C 3 10  ? 30.317 16.883  175.180 1.00 41.91  ? 10  DA  G P     1 
ATOM   2446 O OP1   . DA  C 3 10  ? 30.869 17.320  176.429 1.00 44.34  ? 10  DA  G OP1   1 
ATOM   2447 O OP2   . DA  C 3 10  ? 29.829 15.537  175.103 1.00 41.11  ? 10  DA  G OP2   1 
ATOM   2448 O "O5'" . DA  C 3 10  ? 29.173 17.886  174.733 1.00 37.61  ? 10  DA  G "O5'" 1 
ATOM   2449 C "C5'" . DA  C 3 10  ? 29.305 19.299  174.926 1.00 42.35  ? 10  DA  G "C5'" 1 
ATOM   2450 C "C4'" . DA  C 3 10  ? 28.187 20.095  174.287 1.00 39.09  ? 10  DA  G "C4'" 1 
ATOM   2451 O "O4'" . DA  C 3 10  ? 28.231 19.967  172.851 1.00 40.83  ? 10  DA  G "O4'" 1 
ATOM   2452 C "C3'" . DA  C 3 10  ? 26.753 19.756  174.703 1.00 36.15  ? 10  DA  G "C3'" 1 
ATOM   2453 O "O3'" . DA  C 3 10  ? 25.948 20.930  174.859 1.00 35.46  ? 10  DA  G "O3'" 1 
ATOM   2454 C "C2'" . DA  C 3 10  ? 26.229 18.996  173.505 1.00 33.56  ? 10  DA  G "C2'" 1 
ATOM   2455 C "C1'" . DA  C 3 10  ? 26.929 19.723  172.380 1.00 43.02  ? 10  DA  G "C1'" 1 
ATOM   2456 N N9    . DA  C 3 10  ? 27.020 18.981  171.129 1.00 35.70  ? 10  DA  G N9    1 
ATOM   2457 C C8    . DA  C 3 10  ? 26.954 17.625  170.958 1.00 37.84  ? 10  DA  G C8    1 
ATOM   2458 N N7    . DA  C 3 10  ? 27.014 17.247  169.709 1.00 34.62  ? 10  DA  G N7    1 
ATOM   2459 C C5    . DA  C 3 10  ? 27.124 18.434  169.008 1.00 40.48  ? 10  DA  G C5    1 
ATOM   2460 C C6    . DA  C 3 10  ? 27.239 18.714  167.642 1.00 39.68  ? 10  DA  G C6    1 
ATOM   2461 N N6    . DA  C 3 10  ? 27.257 17.781  166.697 1.00 35.32  ? 10  DA  G N6    1 
ATOM   2462 N N1    . DA  C 3 10  ? 27.328 20.007  167.273 1.00 50.29  ? 10  DA  G N1    1 
ATOM   2463 C C2    . DA  C 3 10  ? 27.309 20.945  168.223 1.00 52.19  ? 10  DA  G C2    1 
ATOM   2464 N N3    . DA  C 3 10  ? 27.212 20.807  169.537 1.00 38.31  ? 10  DA  G N3    1 
ATOM   2465 C C4    . DA  C 3 10  ? 27.123 19.512  169.870 1.00 41.50  ? 10  DA  G C4    1 
ATOM   2466 P P     . DG  C 3 11  ? 24.772 21.002  175.926 1.00 42.09  ? 11  DG  G P     1 
ATOM   2467 O OP1   . DG  C 3 11  ? 25.364 21.101  177.231 1.00 37.45  ? 11  DG  G OP1   1 
ATOM   2468 O OP2   . DG  C 3 11  ? 23.817 19.974  175.653 1.00 35.89  ? 11  DG  G OP2   1 
ATOM   2469 O "O5'" . DG  C 3 11  ? 24.072 22.374  175.567 1.00 39.64  ? 11  DG  G "O5'" 1 
ATOM   2470 C "C5'" . DG  C 3 11  ? 24.841 23.570  175.449 1.00 46.55  ? 11  DG  G "C5'" 1 
ATOM   2471 C "C4'" . DG  C 3 11  ? 24.440 24.377  174.237 1.00 43.85  ? 11  DG  G "C4'" 1 
ATOM   2472 O "O4'" . DG  C 3 11  ? 24.776 23.676  173.025 1.00 44.53  ? 11  DG  G "O4'" 1 
ATOM   2473 C "C3'" . DG  C 3 11  ? 22.954 24.718  174.150 1.00 42.54  ? 11  DG  G "C3'" 1 
ATOM   2474 O "O3'" . DG  C 3 11  ? 22.743 26.120  174.025 1.00 39.37  ? 11  DG  G "O3'" 1 
ATOM   2475 C "C2'" . DG  C 3 11  ? 22.468 23.950  172.938 1.00 36.86  ? 11  DG  G "C2'" 1 
ATOM   2476 C "C1'" . DG  C 3 11  ? 23.711 23.713  172.117 1.00 38.86  ? 11  DG  G "C1'" 1 
ATOM   2477 N N9    . DG  C 3 11  ? 23.691 22.446  171.397 1.00 40.07  ? 11  DG  G N9    1 
ATOM   2478 C C8    . DG  C 3 11  ? 23.543 21.192  171.932 1.00 36.13  ? 11  DG  G C8    1 
ATOM   2479 N N7    . DG  C 3 11  ? 23.535 20.251  171.033 1.00 34.06  ? 11  DG  G N7    1 
ATOM   2480 C C5    . DG  C 3 11  ? 23.677 20.924  169.831 1.00 34.44  ? 11  DG  G C5    1 
ATOM   2481 C C6    . DG  C 3 11  ? 23.729 20.433  168.505 1.00 35.93  ? 11  DG  G C6    1 
ATOM   2482 O O6    . DG  C 3 11  ? 23.652 19.272  168.114 1.00 34.37  ? 11  DG  G O6    1 
ATOM   2483 N N1    . DG  C 3 11  ? 23.867 21.462  167.586 1.00 40.07  ? 11  DG  G N1    1 
ATOM   2484 C C2    . DG  C 3 11  ? 23.951 22.791  167.900 1.00 45.20  ? 11  DG  G C2    1 
ATOM   2485 N N2    . DG  C 3 11  ? 24.099 23.629  166.876 1.00 43.71  ? 11  DG  G N2    1 
ATOM   2486 N N3    . DG  C 3 11  ? 23.906 23.262  169.130 1.00 46.51  ? 11  DG  G N3    1 
ATOM   2487 C C4    . DG  C 3 11  ? 23.767 22.280  170.039 1.00 42.07  ? 11  DG  G C4    1 
HETATM 2488 N N     . SFG D 4 .   ? 10.877 -1.831  166.311 1.00 36.16  ? 301 SFG A N     1 
HETATM 2489 C CA    . SFG D 4 .   ? 11.406 -1.010  167.333 1.00 41.80  ? 301 SFG A CA    1 
HETATM 2490 C C     . SFG D 4 .   ? 10.252 -0.339  168.060 1.00 49.72  ? 301 SFG A C     1 
HETATM 2491 O O     . SFG D 4 .   ? 10.440 0.503   168.982 1.00 39.72  ? 301 SFG A O     1 
HETATM 2492 O OXT   . SFG D 4 .   ? 9.042  -0.648  167.737 1.00 43.81  ? 301 SFG A OXT   1 
HETATM 2493 C CB    . SFG D 4 .   ? 12.414 -0.005  166.738 1.00 31.52  ? 301 SFG A CB    1 
HETATM 2494 C CG    . SFG D 4 .   ? 13.755 -0.672  166.397 1.00 36.92  ? 301 SFG A CG    1 
HETATM 2495 C CD    . SFG D 4 .   ? 14.821 0.351   166.166 1.00 45.02  ? 301 SFG A CD    1 
HETATM 2496 N NE    . SFG D 4 .   ? 14.472 1.120   165.009 1.00 36.50  ? 301 SFG A NE    1 
HETATM 2497 C "C5'" . SFG D 4 .   ? 16.262 -0.242  165.939 1.00 25.60  ? 301 SFG A "C5'" 1 
HETATM 2498 C "C4'" . SFG D 4 .   ? 16.998 -0.810  167.206 1.00 28.80  ? 301 SFG A "C4'" 1 
HETATM 2499 O "O4'" . SFG D 4 .   ? 18.021 -1.535  166.829 1.00 32.77  ? 301 SFG A "O4'" 1 
HETATM 2500 C "C3'" . SFG D 4 .   ? 17.603 0.284   168.098 1.00 30.84  ? 301 SFG A "C3'" 1 
HETATM 2501 O "O3'" . SFG D 4 .   ? 16.973 0.319   169.314 1.00 30.97  ? 301 SFG A "O3'" 1 
HETATM 2502 C "C2'" . SFG D 4 .   ? 19.100 -0.098  168.253 1.00 31.33  ? 301 SFG A "C2'" 1 
HETATM 2503 O "O2'" . SFG D 4 .   ? 19.576 0.165   169.671 1.00 26.49  ? 301 SFG A "O2'" 1 
HETATM 2504 C "C1'" . SFG D 4 .   ? 19.173 -1.357  167.936 1.00 21.08  ? 301 SFG A "C1'" 1 
HETATM 2505 N N9    . SFG D 4 .   ? 20.465 -1.774  167.392 1.00 23.66  ? 301 SFG A N9    1 
HETATM 2506 C C8    . SFG D 4 .   ? 21.372 -1.027  166.740 1.00 24.97  ? 301 SFG A C8    1 
HETATM 2507 N N7    . SFG D 4 .   ? 22.429 -1.819  166.403 1.00 31.51  ? 301 SFG A N7    1 
HETATM 2508 C C5    . SFG D 4 .   ? 22.173 -3.085  166.848 1.00 31.43  ? 301 SFG A C5    1 
HETATM 2509 C C6    . SFG D 4 .   ? 22.895 -4.267  166.783 1.00 37.91  ? 301 SFG A C6    1 
HETATM 2510 N N6    . SFG D 4 .   ? 24.176 -4.571  166.207 1.00 30.94  ? 301 SFG A N6    1 
HETATM 2511 N N1    . SFG D 4 .   ? 22.400 -5.407  167.326 1.00 33.85  ? 301 SFG A N1    1 
HETATM 2512 C C2    . SFG D 4 .   ? 21.193 -5.377  167.936 1.00 27.87  ? 301 SFG A C2    1 
HETATM 2513 N N3    . SFG D 4 .   ? 20.484 -4.214  168.002 1.00 27.86  ? 301 SFG A N3    1 
HETATM 2514 C C4    . SFG D 4 .   ? 20.977 -3.057  167.455 1.00 28.63  ? 301 SFG A C4    1 
HETATM 2515 O O     . HOH E 5 .   ? 14.885 13.379  175.006 1.00 25.13  ? 401 HOH A O     1 
HETATM 2516 O O     . HOH E 5 .   ? 6.700  15.651  176.538 1.00 25.34  ? 402 HOH A O     1 
HETATM 2517 O O     . HOH E 5 .   ? 26.346 7.722   181.854 1.00 28.74  ? 403 HOH A O     1 
HETATM 2518 O O     . HOH E 5 .   ? 13.539 -6.892  165.865 1.00 21.87  ? 404 HOH A O     1 
HETATM 2519 O O     . HOH E 5 .   ? 25.917 -9.561  165.437 1.00 37.09  ? 405 HOH A O     1 
HETATM 2520 O O     . HOH E 5 .   ? 19.332 -5.600  156.157 1.00 36.40  ? 406 HOH A O     1 
HETATM 2521 O O     . HOH E 5 .   ? 21.972 2.308   183.574 1.00 34.67  ? 407 HOH A O     1 
HETATM 2522 O O     . HOH E 5 .   ? 10.883 14.416  175.007 1.00 24.34  ? 408 HOH A O     1 
HETATM 2523 O O     . HOH E 5 .   ? 24.655 18.469  182.621 1.00 35.95  ? 409 HOH A O     1 
HETATM 2524 O O     . HOH E 5 .   ? 19.933 2.905   171.202 1.00 29.27  ? 410 HOH A O     1 
HETATM 2525 O O     . HOH E 5 .   ? 21.968 -4.254  180.946 1.00 27.54  ? 411 HOH A O     1 
HETATM 2526 O O     . HOH E 5 .   ? 11.592 -0.571  159.292 1.00 50.87  ? 412 HOH A O     1 
HETATM 2527 O O     . HOH E 5 .   ? 24.922 10.653  191.279 1.00 36.11  ? 413 HOH A O     1 
HETATM 2528 O O     . HOH E 5 .   ? 18.612 2.548   183.022 1.00 27.67  ? 414 HOH A O     1 
HETATM 2529 O O     . HOH E 5 .   ? 22.965 10.275  193.167 1.00 31.91  ? 415 HOH A O     1 
HETATM 2530 O O     . HOH E 5 .   ? 14.622 8.101   172.336 1.00 33.20  ? 416 HOH A O     1 
HETATM 2531 O O     . HOH E 5 .   ? 19.267 0.961   185.298 1.00 28.31  ? 417 HOH A O     1 
HETATM 2532 O O     . HOH E 5 .   ? 20.333 -8.839  169.286 1.00 38.01  ? 418 HOH A O     1 
HETATM 2533 O O     . HOH E 5 .   ? 19.184 -16.901 180.765 1.00 34.88  ? 419 HOH A O     1 
HETATM 2534 O O     . HOH E 5 .   ? 23.461 3.341   167.947 1.00 66.97  ? 420 HOH A O     1 
HETATM 2535 O O     . HOH E 5 .   ? 4.712  16.938  183.844 1.00 44.31  ? 421 HOH A O     1 
HETATM 2536 O O     . HOH E 5 .   ? 13.084 -11.865 183.715 1.00 39.95  ? 422 HOH A O     1 
HETATM 2537 O O     . HOH E 5 .   ? 10.124 20.149  178.448 1.00 37.91  ? 423 HOH A O     1 
HETATM 2538 O O     . HOH E 5 .   ? 15.879 8.995   175.399 1.00 37.67  ? 424 HOH A O     1 
HETATM 2539 O O     . HOH E 5 .   ? 7.573  4.568   170.675 1.00 31.07  ? 425 HOH A O     1 
HETATM 2540 O O     . HOH E 5 .   ? 23.981 25.468  179.356 1.00 55.71  ? 426 HOH A O     1 
HETATM 2541 O O     . HOH E 5 .   ? 14.470 10.003  167.618 1.00 44.54  ? 427 HOH A O     1 
HETATM 2542 O O     . HOH E 5 .   ? 24.807 0.744   181.167 1.00 41.99  ? 428 HOH A O     1 
HETATM 2543 O O     . HOH E 5 .   ? 16.862 9.076   168.793 1.00 33.64  ? 429 HOH A O     1 
HETATM 2544 O O     . HOH E 5 .   ? 7.681  1.945   169.418 1.00 39.77  ? 430 HOH A O     1 
HETATM 2545 O O     . HOH E 5 .   ? -2.184 1.823   175.699 1.00 57.74  ? 431 HOH A O     1 
HETATM 2546 O O     . HOH E 5 .   ? 11.946 19.822  171.789 1.00 38.83  ? 432 HOH A O     1 
HETATM 2547 O O     . HOH E 5 .   ? 11.537 -4.975  166.639 1.00 29.77  ? 433 HOH A O     1 
HETATM 2548 O O     . HOH E 5 .   ? 9.454  12.948  169.532 1.00 35.82  ? 434 HOH A O     1 
HETATM 2549 O O     . HOH E 5 .   ? 8.128  6.222   168.777 1.00 29.18  ? 435 HOH A O     1 
HETATM 2550 O O     . HOH E 5 .   ? 5.639  -4.547  192.954 1.00 48.21  ? 436 HOH A O     1 
HETATM 2551 O O     . HOH E 5 .   ? 14.932 7.525   193.257 1.00 35.20  ? 437 HOH A O     1 
HETATM 2552 O O     . HOH E 5 .   ? 4.577  13.772  177.035 1.00 36.65  ? 438 HOH A O     1 
HETATM 2553 O O     . HOH E 5 .   ? 21.468 2.546   166.249 1.00 35.03  ? 439 HOH A O     1 
HETATM 2554 O O     . HOH E 5 .   ? 21.712 5.872   195.165 1.00 51.39  ? 440 HOH A O     1 
HETATM 2555 O O     . HOH E 5 .   ? 22.990 7.262   193.161 1.00 34.82  ? 441 HOH A O     1 
HETATM 2556 O O     . HOH E 5 .   ? 22.537 3.055   170.868 1.00 62.20  ? 442 HOH A O     1 
HETATM 2557 O O     . HOH E 5 .   ? 9.606  4.191   196.125 1.00 36.59  ? 443 HOH A O     1 
HETATM 2558 O O     . HOH E 5 .   ? 28.750 5.922   185.867 1.00 55.71  ? 444 HOH A O     1 
HETATM 2559 O O     . HOH E 5 .   ? -3.024 -0.701  183.125 1.00 49.33  ? 445 HOH A O     1 
HETATM 2560 O O     . HOH E 5 .   ? 23.375 14.957  166.360 1.00 37.92  ? 446 HOH A O     1 
HETATM 2561 O O     . HOH E 5 .   ? 16.677 8.888   178.308 1.00 40.13  ? 447 HOH A O     1 
HETATM 2562 O O     . HOH E 5 .   ? 21.200 5.984   170.457 1.00 66.69  ? 448 HOH A O     1 
HETATM 2563 O O     . HOH E 5 .   ? 27.331 -6.620  174.625 1.00 51.31  ? 449 HOH A O     1 
HETATM 2564 O O     . HOH E 5 .   ? 26.568 -2.588  165.572 1.00 58.91  ? 450 HOH A O     1 
HETATM 2565 O O     . HOH E 5 .   ? 35.456 12.154  182.843 1.00 52.30  ? 451 HOH A O     1 
HETATM 2566 O O     . HOH E 5 .   ? 1.381  -4.555  149.553 1.00 52.44  ? 452 HOH A O     1 
HETATM 2567 O O     . HOH E 5 .   ? 18.249 18.417  190.481 1.00 41.99  ? 453 HOH A O     1 
HETATM 2568 O O     . HOH E 5 .   ? 9.628  0.176   157.253 1.00 32.56  ? 454 HOH A O     1 
HETATM 2569 O O     . HOH E 5 .   ? 8.759  -4.072  168.936 1.00 40.52  ? 455 HOH A O     1 
HETATM 2570 O O     . HOH E 5 .   ? 8.112  1.190   176.085 1.00 33.74  ? 456 HOH A O     1 
HETATM 2571 O O     . HOH E 5 .   ? 14.697 -0.914  158.705 1.00 40.57  ? 457 HOH A O     1 
HETATM 2572 O O     . HOH E 5 .   ? 12.224 9.504   169.381 1.00 37.25  ? 458 HOH A O     1 
HETATM 2573 O O     . HOH E 5 .   ? -1.152 9.764   184.120 1.00 47.80  ? 459 HOH A O     1 
HETATM 2574 O O     . HOH E 5 .   ? 24.927 8.243   170.499 1.00 35.26  ? 460 HOH A O     1 
HETATM 2575 O O     . HOH E 5 .   ? 5.573  3.327   167.910 1.00 59.12  ? 461 HOH A O     1 
HETATM 2576 O O     . HOH E 5 .   ? 8.772  6.480   156.943 1.00 59.25  ? 462 HOH A O     1 
HETATM 2577 O O     . HOH E 5 .   ? 13.265 12.648  167.116 1.00 43.67  ? 463 HOH A O     1 
HETATM 2578 O O     . HOH E 5 .   ? 15.604 -6.624  191.254 1.00 63.23  ? 464 HOH A O     1 
HETATM 2579 O O     . HOH E 5 .   ? 18.777 3.457   166.426 1.00 51.78  ? 465 HOH A O     1 
HETATM 2580 O O     . HOH E 5 .   ? 15.675 6.479   169.879 1.00 39.81  ? 466 HOH A O     1 
HETATM 2581 O O     . HOH E 5 .   ? 17.882 4.818   169.729 1.00 51.21  ? 467 HOH A O     1 
HETATM 2582 O O     . HOH E 5 .   ? 13.722 0.924   161.924 1.00 37.91  ? 468 HOH A O     1 
HETATM 2583 O O     . HOH E 5 .   ? 22.993 3.122   163.999 1.00 42.12  ? 469 HOH A O     1 
HETATM 2584 O O     . HOH E 5 .   ? 19.094 12.606  195.137 1.00 36.22  ? 470 HOH A O     1 
HETATM 2585 O O     . HOH E 5 .   ? 21.200 -17.972 178.940 1.00 47.72  ? 471 HOH A O     1 
HETATM 2586 O O     . HOH E 5 .   ? 13.893 13.001  193.965 1.00 57.18  ? 472 HOH A O     1 
HETATM 2587 O O     . HOH E 5 .   ? 3.319  2.317   170.361 1.00 43.17  ? 473 HOH A O     1 
HETATM 2588 O O     . HOH E 5 .   ? 7.621  -3.179  194.699 1.00 37.56  ? 474 HOH A O     1 
HETATM 2589 O O     . HOH E 5 .   ? 10.279 -3.479  195.330 1.00 44.93  ? 475 HOH A O     1 
HETATM 2590 O O     . HOH E 5 .   ? 11.436 -6.534  195.951 1.00 53.57  ? 476 HOH A O     1 
HETATM 2591 O O     . HOH E 5 .   ? 25.283 0.459   175.471 1.00 49.51  ? 477 HOH A O     1 
HETATM 2592 O O     . HOH E 5 .   ? 26.421 3.275   175.476 1.00 53.56  ? 478 HOH A O     1 
HETATM 2593 O O     . HOH E 5 .   ? -2.219 6.559   183.300 1.00 43.59  ? 479 HOH A O     1 
HETATM 2594 O O     . HOH F 5 .   ? 49.362 11.695  165.838 1.00 53.96  ? 101 HOH F O     1 
HETATM 2595 O O     . HOH F 5 .   ? 56.533 6.922   155.642 1.00 46.27  ? 102 HOH F O     1 
HETATM 2596 O O     . HOH F 5 .   ? 46.655 15.234  169.821 1.00 32.02  ? 103 HOH F O     1 
HETATM 2597 O O     . HOH F 5 .   ? 42.855 17.307  176.020 1.00 34.28  ? 104 HOH F O     1 
HETATM 2598 O O     . HOH F 5 .   ? 41.086 15.111  175.058 1.00 52.39  ? 105 HOH F O     1 
HETATM 2599 O O     . HOH F 5 .   ? 48.544 19.448  165.844 1.00 43.19  ? 106 HOH F O     1 
HETATM 2600 O O     . HOH F 5 .   ? 52.884 14.725  165.624 1.00 45.80  ? 107 HOH F O     1 
HETATM 2601 O O     . HOH F 5 .   ? 45.984 13.615  157.948 1.00 70.25  ? 108 HOH F O     1 
HETATM 2602 O O     . HOH G 5 .   ? 29.972 22.498  171.772 1.00 57.36  ? 101 HOH G O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 23  ? 0.4930 1.1169 0.9440 -0.0123 -0.1178 -0.0017 3   LYS A N     
2    C CA    . LYS A 23  ? 0.6372 1.1897 1.0383 0.0123  -0.1229 0.0102  3   LYS A CA    
3    C C     . LYS A 23  ? 0.6447 1.1764 1.0307 0.0199  -0.0957 0.0107  3   LYS A C     
4    O O     . LYS A 23  ? 0.6583 1.2320 1.0804 0.0383  -0.0857 -0.0015 3   LYS A O     
5    C CB    . LYS A 23  ? 0.6846 1.2423 1.0994 0.0500  -0.1502 0.0094  3   LYS A CB    
6    C CG    . LYS A 23  ? 0.7010 1.2001 1.0658 0.0557  -0.1732 0.0239  3   LYS A CG    
7    C CD    . LYS A 23  ? 0.7454 1.2677 1.1153 0.0363  -0.1947 0.0208  3   LYS A CD    
8    C CE    . LYS A 23  ? 0.7856 1.2626 1.1091 0.0490  -0.2206 0.0325  3   LYS A CE    
9    N NZ    . LYS A 23  ? 0.7499 1.2421 1.0754 0.0340  -0.2426 0.0244  3   LYS A NZ    
10   N N     . ASN A 24  ? 0.5645 1.0338 0.8984 0.0073  -0.0853 0.0224  4   ASN A N     
11   C CA    . ASN A 24  ? 0.5132 0.9607 0.8275 0.0120  -0.0620 0.0227  4   ASN A CA    
12   C C     . ASN A 24  ? 0.4707 0.8547 0.7466 0.0342  -0.0680 0.0301  4   ASN A C     
13   O O     . ASN A 24  ? 0.3566 0.6970 0.6011 0.0321  -0.0823 0.0403  4   ASN A O     
14   C CB    . ASN A 24  ? 0.5541 0.9865 0.8425 -0.0224 -0.0431 0.0297  4   ASN A CB    
15   C CG    . ASN A 24  ? 0.6716 1.1684 0.9977 -0.0476 -0.0291 0.0232  4   ASN A CG    
16   O OD1   . ASN A 24  ? 0.7169 1.2167 1.0442 -0.0778 -0.0326 0.0281  4   ASN A OD1   
17   N ND2   . ASN A 24  ? 0.6898 1.2396 1.0483 -0.0364 -0.0122 0.0105  4   ASN A ND2   
18   N N     . ARG A 25  ? 0.4649 0.8461 0.7441 0.0536  -0.0559 0.0231  5   ARG A N     
19   C CA    . ARG A 25  ? 0.4310 0.7574 0.6829 0.0745  -0.0611 0.0278  5   ARG A CA    
20   C C     . ARG A 25  ? 0.3205 0.6064 0.5337 0.0640  -0.0446 0.0308  5   ARG A C     
21   O O     . ARG A 25  ? 0.2363 0.5432 0.4501 0.0528  -0.0260 0.0249  5   ARG A O     
22   C CB    . ARG A 25  ? 0.4703 0.8152 0.7550 0.1068  -0.0637 0.0151  5   ARG A CB    
23   C CG    . ARG A 25  ? 0.5964 0.9957 0.9300 0.1210  -0.0787 0.0074  5   ARG A CG    
24   C CD    . ARG A 25  ? 0.6901 1.0574 1.0171 0.1418  -0.1069 0.0188  5   ARG A CD    
25   N NE    . ARG A 25  ? 0.7610 1.0876 1.0828 0.1694  -0.1101 0.0179  5   ARG A NE    
26   C CZ    . ARG A 25  ? 0.8532 1.1333 1.1566 0.1857  -0.1309 0.0324  5   ARG A CZ    
27   N NH1   . ARG A 25  ? 0.8316 1.1038 1.1167 0.1787  -0.1502 0.0481  5   ARG A NH1   
28   N NH2   . ARG A 25  ? 0.9431 1.1801 1.2407 0.2044  -0.1300 0.0324  5   ARG A NH2   
29   N N     . ALA A 26  ? 0.3006 0.5317 0.4804 0.0678  -0.0515 0.0399  6   ALA A N     
30   C CA    . ALA A 26  ? 0.2624 0.4567 0.4107 0.0629  -0.0396 0.0405  6   ALA A CA    
31   C C     . ALA A 26  ? 0.3471 0.5468 0.5077 0.0817  -0.0297 0.0269  6   ALA A C     
32   O O     . ALA A 26  ? 0.2658 0.4862 0.4572 0.1019  -0.0348 0.0184  6   ALA A O     
33   C CB    . ALA A 26  ? 0.3594 0.5034 0.4773 0.0630  -0.0491 0.0507  6   ALA A CB    
34   N N     . PHE A 27  ? 0.3217 0.5031 0.4594 0.0770  -0.0178 0.0228  7   PHE A N     
35   C CA    . PHE A 27  ? 0.2937 0.4773 0.4405 0.0949  -0.0101 0.0065  7   PHE A CA    
36   C C     . PHE A 27  ? 0.3452 0.4783 0.4780 0.1056  -0.0172 0.0065  7   PHE A C     
37   O O     . PHE A 27  ? 0.3430 0.4705 0.4849 0.1208  -0.0139 -0.0086 7   PHE A O     
38   C CB    . PHE A 27  ? 0.2591 0.4652 0.3922 0.0846  0.0080  -0.0024 7   PHE A CB    
39   C CG    . PHE A 27  ? 0.2551 0.4278 0.3476 0.0684  0.0097  0.0070  7   PHE A CG    
40   C CD1   . PHE A 27  ? 0.2849 0.4282 0.3598 0.0761  0.0095  -0.0008 7   PHE A CD1   
41   C CD2   . PHE A 27  ? 0.3229 0.4951 0.3977 0.0461  0.0104  0.0218  7   PHE A CD2   
42   C CE1   . PHE A 27  ? 0.3201 0.4373 0.3617 0.0643  0.0084  0.0062  7   PHE A CE1   
43   C CE2   . PHE A 27  ? 0.3069 0.4465 0.3462 0.0351  0.0092  0.0298  7   PHE A CE2   
44   C CZ    . PHE A 27  ? 0.3534 0.4679 0.3770 0.0454  0.0077  0.0219  7   PHE A CZ    
45   N N     . LEU A 28  ? 0.2716 0.3704 0.3846 0.0969  -0.0263 0.0215  8   LEU A N     
46   C CA    . LEU A 28  ? 0.2770 0.3312 0.3785 0.1020  -0.0315 0.0239  8   LEU A CA    
47   C C     . LEU A 28  ? 0.4423 0.4760 0.5475 0.1090  -0.0454 0.0375  8   LEU A C     
48   O O     . LEU A 28  ? 0.3508 0.3955 0.4524 0.1027  -0.0529 0.0488  8   LEU A O     
49   C CB    . LEU A 28  ? 0.2514 0.2835 0.3238 0.0857  -0.0284 0.0289  8   LEU A CB    
50   C CG    . LEU A 28  ? 0.3892 0.4266 0.4481 0.0799  -0.0191 0.0187  8   LEU A CG    
51   C CD1   . LEU A 28  ? 0.3849 0.4044 0.4190 0.0660  -0.0208 0.0260  8   LEU A CD1   
52   C CD2   . LEU A 28  ? 0.2579 0.2835 0.3226 0.0909  -0.0162 0.0029  8   LEU A CD2   
53   N N     . LYS A 29  ? 0.4335 0.4355 0.5434 0.1208  -0.0498 0.0368  9   LYS A N     
54   C CA    . LYS A 29  ? 0.4002 0.3701 0.5006 0.1229  -0.0620 0.0547  9   LYS A CA    
55   C C     . LYS A 29  ? 0.4010 0.3501 0.4704 0.1027  -0.0578 0.0654  9   LYS A C     
56   O O     . LYS A 29  ? 0.3965 0.3382 0.4590 0.0939  -0.0479 0.0565  9   LYS A O     
57   C CB    . LYS A 29  ? 0.4839 0.4175 0.5958 0.1379  -0.0671 0.0526  9   LYS A CB    
58   C CG    . LYS A 29  ? 0.3608 0.3095 0.5070 0.1632  -0.0726 0.0377  9   LYS A CG    
59   C CD    . LYS A 29  ? 0.4023 0.3007 0.5567 0.1773  -0.0804 0.0370  9   LYS A CD    
60   C CE    . LYS A 29  ? 0.4203 0.3352 0.6057 0.2006  -0.0810 0.0165  9   LYS A CE    
61   N NZ    . LYS A 29  ? 0.4713 0.3379 0.6571 0.2088  -0.0855 0.0170  9   LYS A NZ    
62   N N     . TRP A 30  ? 0.4162 0.3592 0.4675 0.0963  -0.0657 0.0819  10  TRP A N     
63   C CA    . TRP A 30  ? 0.5087 0.4402 0.5324 0.0783  -0.0598 0.0875  10  TRP A CA    
64   C C     . TRP A 30  ? 0.6185 0.5348 0.6174 0.0734  -0.0678 0.1062  10  TRP A C     
65   O O     . TRP A 30  ? 0.6017 0.5249 0.6013 0.0823  -0.0815 0.1158  10  TRP A O     
66   C CB    . TRP A 30  ? 0.4212 0.3794 0.4412 0.0686  -0.0556 0.0793  10  TRP A CB    
67   C CG    . TRP A 30  ? 0.5166 0.4656 0.5198 0.0556  -0.0467 0.0743  10  TRP A CG    
68   C CD1   . TRP A 30  ? 0.5765 0.5235 0.5593 0.0453  -0.0471 0.0776  10  TRP A CD1   
69   C CD2   . TRP A 30  ? 0.4380 0.3823 0.4459 0.0538  -0.0379 0.0621  10  TRP A CD2   
70   N NE1   . TRP A 30  ? 0.5413 0.4835 0.5195 0.0389  -0.0390 0.0679  10  TRP A NE1   
71   C CE2   . TRP A 30  ? 0.4672 0.4078 0.4603 0.0438  -0.0343 0.0593  10  TRP A CE2   
72   C CE3   . TRP A 30  ? 0.3277 0.2726 0.3508 0.0610  -0.0340 0.0511  10  TRP A CE3   
73   C CZ2   . TRP A 30  ? 0.4966 0.4352 0.4923 0.0417  -0.0288 0.0474  10  TRP A CZ2   
74   C CZ3   . TRP A 30  ? 0.4075 0.3493 0.4286 0.0570  -0.0284 0.0395  10  TRP A CZ3   
75   C CH2   . TRP A 30  ? 0.4894 0.4286 0.4982 0.0478  -0.0268 0.0385  10  TRP A CH2   
76   N N     . ALA A 31  ? 0.5739 0.4739 0.5506 0.0594  -0.0592 0.1100  11  ALA A N     
77   C CA    . ALA A 31  ? 0.5676 0.4545 0.5138 0.0521  -0.0631 0.1273  11  ALA A CA    
78   C C     . ALA A 31  ? 0.6039 0.5146 0.5325 0.0465  -0.0685 0.1258  11  ALA A C     
79   O O     . ALA A 31  ? 0.5046 0.4312 0.4354 0.0396  -0.0620 0.1114  11  ALA A O     
80   C CB    . ALA A 31  ? 0.6177 0.4847 0.5493 0.0372  -0.0486 0.1297  11  ALA A CB    
81   N N     . GLY A 32  ? 0.5939 0.5044 0.5042 0.0502  -0.0825 0.1402  12  GLY A N     
82   C CA    . GLY A 32  ? 0.5521 0.4842 0.4446 0.0448  -0.0904 0.1371  12  GLY A CA    
83   C C     . GLY A 32  ? 0.6018 0.5638 0.5209 0.0483  -0.0979 0.1237  12  GLY A C     
84   O O     . GLY A 32  ? 0.6516 0.6282 0.5616 0.0392  -0.0997 0.1142  12  GLY A O     
85   N N     . GLY A 33  ? 0.5967 0.5681 0.5488 0.0604  -0.1015 0.1217  13  GLY A N     
86   C CA    . GLY A 33  ? 0.4836 0.4885 0.4633 0.0613  -0.1063 0.1104  13  GLY A CA    
87   C C     . GLY A 33  ? 0.4520 0.4792 0.4277 0.0615  -0.1253 0.1139  13  GLY A C     
88   O O     . GLY A 33  ? 0.4519 0.4706 0.4121 0.0701  -0.1389 0.1273  13  GLY A O     
89   N N     . LYS A 34  ? 0.4536 0.5078 0.4424 0.0511  -0.1276 0.1025  14  LYS A N     
90   C CA    . LYS A 34  ? 0.5327 0.6078 0.5146 0.0462  -0.1459 0.1015  14  LYS A CA    
91   C C     . LYS A 34  ? 0.6194 0.7372 0.6411 0.0523  -0.1600 0.0973  14  LYS A C     
92   O O     . LYS A 34  ? 0.5038 0.6453 0.5266 0.0458  -0.1763 0.0930  14  LYS A O     
93   C CB    . LYS A 34  ? 0.5401 0.6116 0.5057 0.0267  -0.1411 0.0894  14  LYS A CB    
94   C CG    . LYS A 34  ? 0.5213 0.5622 0.4456 0.0223  -0.1335 0.0903  14  LYS A CG    
95   C CD    . LYS A 34  ? 0.5915 0.6318 0.4835 0.0263  -0.1483 0.0998  14  LYS A CD    
96   C CE    . LYS A 34  ? 0.6073 0.6241 0.4573 0.0203  -0.1371 0.1001  14  LYS A CE    
97   N NZ    . LYS A 34  ? 0.6422 0.6354 0.4892 0.0246  -0.1204 0.1109  14  LYS A NZ    
98   N N     . TYR A 35  ? 0.6003 0.7316 0.6564 0.0648  -0.1540 0.0960  15  TYR A N     
99   C CA    . TYR A 35  ? 0.6086 0.7881 0.7097 0.0733  -0.1649 0.0894  15  TYR A CA    
100  C C     . TYR A 35  ? 0.6247 0.8243 0.7269 0.0838  -0.1936 0.0947  15  TYR A C     
101  O O     . TYR A 35  ? 0.5698 0.8144 0.7006 0.0774  -0.2048 0.0849  15  TYR A O     
102  C CB    . TYR A 35  ? 0.5645 0.7483 0.6956 0.0930  -0.1559 0.0872  15  TYR A CB    
103  C CG    . TYR A 35  ? 0.6052 0.8441 0.7890 0.1060  -0.1640 0.0768  15  TYR A CG    
104  C CD1   . TYR A 35  ? 0.5869 0.8689 0.8039 0.0927  -0.1490 0.0625  15  TYR A CD1   
105  C CD2   . TYR A 35  ? 0.6589 0.9072 0.8597 0.1322  -0.1865 0.0815  15  TYR A CD2   
106  C CE1   . TYR A 35  ? 0.5854 0.9267 0.8554 0.1036  -0.1535 0.0504  15  TYR A CE1   
107  C CE2   . TYR A 35  ? 0.7176 1.0222 0.9730 0.1470  -0.1943 0.0687  15  TYR A CE2   
108  C CZ    . TYR A 35  ? 0.6710 1.0258 0.9629 0.1323  -0.1765 0.0517  15  TYR A CZ    
109  O OH    . TYR A 35  ? 0.6569 1.0698 1.0044 0.1435  -0.1797 0.0373  15  TYR A OH    
110  N N     . PRO A 36  ? 0.6419 0.8089 0.7118 0.0984  -0.2060 0.1106  16  PRO A N     
111  C CA    . PRO A 36  ? 0.5599 0.7438 0.6225 0.1097  -0.2268 0.1112  16  PRO A CA    
112  C C     . PRO A 36  ? 0.6205 0.8130 0.6541 0.0923  -0.2384 0.1065  16  PRO A C     
113  O O     . PRO A 36  ? 0.6265 0.8413 0.6575 0.1013  -0.2567 0.1056  16  PRO A O     
114  C CB    . PRO A 36  ? 0.5192 0.6596 0.5474 0.1266  -0.2254 0.1295  16  PRO A CB    
115  C CG    . PRO A 36  ? 0.5691 0.6784 0.6045 0.1291  -0.2064 0.1320  16  PRO A CG    
116  C CD    . PRO A 36  ? 0.6178 0.7337 0.6593 0.1071  -0.1939 0.1228  16  PRO A CD    
117  N N     . LEU A 37  ? 0.6015 0.7792 0.6141 0.0694  -0.2284 0.1029  17  LEU A N     
118  C CA    . LEU A 37  ? 0.5879 0.7690 0.5701 0.0535  -0.2383 0.0947  17  LEU A CA    
119  C C     . LEU A 37  ? 0.5867 0.7972 0.5977 0.0300  -0.2397 0.0775  17  LEU A C     
120  O O     . LEU A 37  ? 0.4615 0.6680 0.4482 0.0140  -0.2458 0.0668  17  LEU A O     
121  C CB    . LEU A 37  ? 0.6372 0.7748 0.5646 0.0455  -0.2257 0.1009  17  LEU A CB    
122  C CG    . LEU A 37  ? 0.7233 0.8278 0.6092 0.0591  -0.2211 0.1182  17  LEU A CG    
123  C CD1   . LEU A 37  ? 0.8332 0.9135 0.6687 0.0450  -0.2107 0.1169  17  LEU A CD1   
124  C CD2   . LEU A 37  ? 0.6503 0.7703 0.5298 0.0762  -0.2405 0.1247  17  LEU A CD2   
125  N N     . LEU A 38  ? 0.3896 0.6250 0.4493 0.0276  -0.2286 0.0715  18  LEU A N     
126  C CA    . LEU A 38  ? 0.4638 0.7157 0.5473 0.0024  -0.2194 0.0565  18  LEU A CA    
127  C C     . LEU A 38  ? 0.5396 0.8256 0.6351 -0.0124 -0.2423 0.0431  18  LEU A C     
128  O O     . LEU A 38  ? 0.4980 0.7739 0.5866 -0.0362 -0.2396 0.0313  18  LEU A O     
129  C CB    . LEU A 38  ? 0.3828 0.6630 0.5149 0.0031  -0.2033 0.0546  18  LEU A CB    
130  C CG    . LEU A 38  ? 0.4429 0.6897 0.5643 0.0118  -0.1789 0.0624  18  LEU A CG    
131  C CD1   . LEU A 38  ? 0.4654 0.7476 0.6327 0.0182  -0.1659 0.0588  18  LEU A CD1   
132  C CD2   . LEU A 38  ? 0.4711 0.6785 0.5632 -0.0075 -0.1628 0.0601  18  LEU A CD2   
133  N N     . ASP A 39  ? 0.4082 0.7303 0.5207 0.0029  -0.2655 0.0433  19  ASP A N     
134  C CA    . ASP A 39  ? 0.5274 0.8814 0.6529 -0.0078 -0.2849 0.0254  19  ASP A CA    
135  C C     . ASP A 39  ? 0.6220 0.9453 0.6943 -0.0181 -0.2934 0.0178  19  ASP A C     
136  O O     . ASP A 39  ? 0.5377 0.8730 0.6184 -0.0398 -0.3012 -0.0004 19  ASP A O     
137  C CB    . ASP A 39  ? 0.6415 1.0289 0.7894 0.0187  -0.3047 0.0233  19  ASP A CB    
138  C CG    . ASP A 39  ? 0.7889 1.2165 1.0029 0.0251  -0.2997 0.0213  19  ASP A CG    
139  O OD1   . ASP A 39  ? 0.8242 1.2750 1.0721 0.0020  -0.2818 0.0155  19  ASP A OD1   
140  O OD2   . ASP A 39  ? 0.8632 1.2930 1.0946 0.0473  -0.3109 0.0322  19  ASP A OD2   
141  N N     . ASP A 40  ? 0.6682 0.9524 0.6868 -0.0034 -0.2902 0.0301  20  ASP A N     
142  C CA    . ASP A 40  ? 0.6933 0.9527 0.6596 -0.0111 -0.2946 0.0213  20  ASP A CA    
143  C C     . ASP A 40  ? 0.5881 0.8156 0.5417 -0.0343 -0.2803 0.0125  20  ASP A C     
144  O O     . ASP A 40  ? 0.5817 0.8014 0.5164 -0.0487 -0.2866 -0.0065 20  ASP A O     
145  C CB    . ASP A 40  ? 0.7307 0.9628 0.6441 0.0098  -0.2921 0.0381  20  ASP A CB    
146  C CG    . ASP A 40  ? 0.8169 1.0747 0.7338 0.0333  -0.3095 0.0472  20  ASP A CG    
147  O OD1   . ASP A 40  ? 0.7445 1.0184 0.6370 0.0356  -0.3258 0.0401  20  ASP A OD1   
148  O OD2   . ASP A 40  ? 0.8876 1.1508 0.8318 0.0498  -0.3063 0.0611  20  ASP A OD2   
149  N N     . ILE A 41  ? 0.5734 0.7801 0.5379 -0.0350 -0.2594 0.0233  21  ILE A N     
150  C CA    . ILE A 41  ? 0.5917 0.7625 0.5474 -0.0504 -0.2399 0.0134  21  ILE A CA    
151  C C     . ILE A 41  ? 0.6225 0.8061 0.6120 -0.0756 -0.2450 -0.0032 21  ILE A C     
152  O O     . ILE A 41  ? 0.6983 0.8559 0.6707 -0.0905 -0.2465 -0.0195 21  ILE A O     
153  C CB    . ILE A 41  ? 0.5508 0.6990 0.5150 -0.0426 -0.2136 0.0270  21  ILE A CB    
154  C CG1   . ILE A 41  ? 0.4915 0.6176 0.4197 -0.0235 -0.2059 0.0411  21  ILE A CG1   
155  C CG2   . ILE A 41  ? 0.5398 0.6548 0.5016 -0.0576 -0.1978 0.0175  21  ILE A CG2   
156  C CD1   . ILE A 41  ? 0.5117 0.6216 0.4531 -0.0148 -0.1840 0.0530  21  ILE A CD1   
157  N N     . LYS A 42  ? 0.4986 0.7223 0.5373 -0.0809 -0.2476 0.0001  22  LYS A N     
158  C CA    . LYS A 42  ? 0.5043 0.7429 0.5795 -0.1091 -0.2486 -0.0120 22  LYS A CA    
159  C C     . LYS A 42  ? 0.5737 0.8305 0.6494 -0.1245 -0.2754 -0.0323 22  LYS A C     
160  O O     . LYS A 42  ? 0.5917 0.8475 0.6890 -0.1521 -0.2777 -0.0455 22  LYS A O     
161  C CB    . LYS A 42  ? 0.4857 0.7722 0.6158 -0.1112 -0.2412 -0.0044 22  LYS A CB    
162  C CG    . LYS A 42  ? 0.5011 0.7707 0.6331 -0.1003 -0.2140 0.0113  22  LYS A CG    
163  C CD    . LYS A 42  ? 0.5692 0.8658 0.7448 -0.1210 -0.1978 0.0123  22  LYS A CD    
164  C CE    . LYS A 42  ? 0.5764 0.9400 0.8020 -0.1103 -0.2003 0.0126  22  LYS A CE    
165  N NZ    . LYS A 42  ? 0.5866 0.9808 0.8514 -0.1312 -0.1792 0.0133  22  LYS A NZ    
166  N N     . ARG A 43  ? 0.5664 0.8349 0.6158 -0.1049 -0.2915 -0.0354 23  ARG A N     
167  C CA    . ARG A 43  ? 0.5986 0.8809 0.6417 -0.1116 -0.3103 -0.0584 23  ARG A CA    
168  C C     . ARG A 43  ? 0.6620 0.8974 0.6647 -0.1239 -0.3084 -0.0755 23  ARG A C     
169  O O     . ARG A 43  ? 0.6517 0.8901 0.6613 -0.1406 -0.3188 -0.0987 23  ARG A O     
170  C CB    . ARG A 43  ? 0.5772 0.8848 0.5986 -0.0844 -0.3267 -0.0555 23  ARG A CB    
171  N N     . HIS A 44  ? 0.6351 0.8279 0.5985 -0.1149 -0.2950 -0.0666 24  HIS A N     
172  C CA    . HIS A 44  ? 0.6753 0.8264 0.5996 -0.1200 -0.2930 -0.0862 24  HIS A CA    
173  C C     . HIS A 44  ? 0.7391 0.8407 0.6668 -0.1329 -0.2786 -0.0876 24  HIS A C     
174  O O     . HIS A 44  ? 0.7687 0.8335 0.6716 -0.1358 -0.2776 -0.1074 24  HIS A O     
175  C CB    . HIS A 44  ? 0.6666 0.8096 0.5361 -0.0974 -0.2896 -0.0818 24  HIS A CB    
176  C CG    . HIS A 44  ? 0.7760 0.9576 0.6299 -0.0856 -0.3054 -0.0840 24  HIS A CG    
177  N ND1   . HIS A 44  ? 0.7799 0.9824 0.6273 -0.0648 -0.3074 -0.0605 24  HIS A ND1   
178  C CD2   . HIS A 44  ? 0.8095 1.0117 0.6524 -0.0915 -0.3208 -0.1070 24  HIS A CD2   
179  C CE1   . HIS A 44  ? 0.7716 1.0039 0.6026 -0.0568 -0.3246 -0.0676 24  HIS A CE1   
180  N NE2   . HIS A 44  ? 0.6871 0.9240 0.5152 -0.0739 -0.3326 -0.0958 24  HIS A NE2   
181  N N     . LEU A 45  ? 0.7108 0.8128 0.6712 -0.1356 -0.2616 -0.0681 25  LEU A N     
182  C CA    . LEU A 45  ? 0.6747 0.7297 0.6370 -0.1423 -0.2432 -0.0655 25  LEU A CA    
183  C C     . LEU A 45  ? 0.6543 0.6903 0.6409 -0.1725 -0.2509 -0.0782 25  LEU A C     
184  O O     . LEU A 45  ? 0.6553 0.7234 0.6809 -0.1918 -0.2546 -0.0730 25  LEU A O     
185  C CB    . LEU A 45  ? 0.5940 0.6563 0.5751 -0.1334 -0.2222 -0.0397 25  LEU A CB    
186  C CG    . LEU A 45  ? 0.6140 0.6302 0.5890 -0.1334 -0.2033 -0.0325 25  LEU A CG    
187  C CD1   . LEU A 45  ? 0.5468 0.5315 0.4834 -0.1123 -0.1962 -0.0383 25  LEU A CD1   
188  C CD2   . LEU A 45  ? 0.5575 0.5907 0.5563 -0.1308 -0.1860 -0.0101 25  LEU A CD2   
189  N N     . PRO A 46  ? 0.6709 0.6543 0.6362 -0.1770 -0.2530 -0.0956 26  PRO A N     
190  C CA    . PRO A 46  ? 0.7375 0.6860 0.7189 -0.2042 -0.2606 -0.1088 26  PRO A CA    
191  C C     . PRO A 46  ? 0.7381 0.6684 0.7463 -0.2238 -0.2476 -0.0865 26  PRO A C     
192  O O     . PRO A 46  ? 0.6898 0.6274 0.6984 -0.2103 -0.2289 -0.0637 26  PRO A O     
193  C CB    . PRO A 46  ? 0.6936 0.5876 0.6409 -0.1903 -0.2601 -0.1294 26  PRO A CB    
194  C CG    . PRO A 46  ? 0.7047 0.6202 0.6177 -0.1643 -0.2607 -0.1357 26  PRO A CG    
195  C CD    . PRO A 46  ? 0.6671 0.6232 0.5904 -0.1532 -0.2479 -0.1063 26  PRO A CD    
196  N N     . LYS A 47  ? 0.7516 0.6614 0.7799 -0.2494 -0.2490 -0.0923 27  LYS A N     
197  C CA    . LYS A 47  ? 0.8319 0.7250 0.8811 -0.2717 -0.2351 -0.0695 27  LYS A CA    
198  C C     . LYS A 47  ? 0.8923 0.7074 0.9192 -0.2704 -0.2301 -0.0661 27  LYS A C     
199  O O     . LYS A 47  ? 0.9659 0.7416 0.9726 -0.2583 -0.2391 -0.0879 27  LYS A O     
200  C CB    . LYS A 47  ? 0.8858 0.8114 0.9749 -0.3024 -0.2362 -0.0734 27  LYS A CB    
201  C CG    . LYS A 47  ? 0.8621 0.8693 0.9866 -0.3063 -0.2338 -0.0656 27  LYS A CG    
202  C CD    . LYS A 47  ? 0.9061 0.9298 1.0326 -0.2998 -0.2163 -0.0373 27  LYS A CD    
203  C CE    . LYS A 47  ? 0.9181 0.9055 1.0468 -0.3220 -0.1974 -0.0169 27  LYS A CE    
204  N NZ    . LYS A 47  ? 0.8553 0.8509 0.9759 -0.3117 -0.1800 0.0077  27  LYS A NZ    
205  N N     . GLY A 48  ? 0.8233 0.6194 0.8535 -0.2810 -0.2156 -0.0391 28  GLY A N     
206  C CA    . GLY A 48  ? 0.8183 0.5424 0.8262 -0.2763 -0.2117 -0.0306 28  GLY A CA    
207  C C     . GLY A 48  ? 0.8313 0.5477 0.8365 -0.2843 -0.1945 0.0029  28  GLY A C     
208  O O     . GLY A 48  ? 0.7498 0.5199 0.7736 -0.2956 -0.1831 0.0180  28  GLY A O     
209  N N     . GLU A 49  ? 0.8200 0.4736 0.8017 -0.2759 -0.1928 0.0133  29  GLU A N     
210  C CA    . GLU A 49  ? 0.8366 0.4776 0.8073 -0.2815 -0.1775 0.0452  29  GLU A CA    
211  C C     . GLU A 49  ? 0.8189 0.4768 0.7751 -0.2590 -0.1694 0.0574  29  GLU A C     
212  O O     . GLU A 49  ? 0.7512 0.4357 0.7089 -0.2690 -0.1532 0.0805  29  GLU A O     
213  C CB    . GLU A 49  ? 0.9134 0.4820 0.8621 -0.2772 -0.1820 0.0525  29  GLU A CB    
214  C CG    . GLU A 49  ? 1.0460 0.5907 1.0065 -0.3079 -0.1827 0.0552  29  GLU A CG    
215  C CD    . GLU A 49  ? 1.2718 0.7458 1.2076 -0.3030 -0.1863 0.0700  29  GLU A CD    
216  O OE1   . GLU A 49  ? 1.3132 0.7751 1.2257 -0.2874 -0.1804 0.0905  29  GLU A OE1   
217  O OE2   . GLU A 49  ? 1.3476 0.7786 1.2875 -0.3139 -0.1961 0.0604  29  GLU A OE2   
218  N N     . CYS A 50  ? 0.7460 0.3893 0.6881 -0.2290 -0.1791 0.0405  30  CYS A N     
219  C CA    . CYS A 50  ? 0.6911 0.3517 0.6200 -0.1990 -0.1677 0.0488  30  CYS A CA    
220  C C     . CYS A 50  ? 0.7262 0.4316 0.6594 -0.1716 -0.1663 0.0282  30  CYS A C     
221  O O     . CYS A 50  ? 0.8266 0.5206 0.7567 -0.1635 -0.1788 0.0039  30  CYS A O     
222  C CB    . CYS A 50  ? 0.6979 0.2921 0.6004 -0.1812 -0.1753 0.0538  30  CYS A CB    
223  S SG    . CYS A 50  ? 0.7445 0.3574 0.6326 -0.1422 -0.1642 0.0591  30  CYS A SG    
224  N N     . LEU A 51  ? 0.6239 0.3780 0.5621 -0.1582 -0.1511 0.0381  31  LEU A N     
225  C CA    . LEU A 51  ? 0.6127 0.4040 0.5511 -0.1335 -0.1482 0.0248  31  LEU A CA    
226  C C     . LEU A 51  ? 0.6101 0.3920 0.5334 -0.1054 -0.1404 0.0268  31  LEU A C     
227  O O     . LEU A 51  ? 0.6069 0.3879 0.5272 -0.1033 -0.1308 0.0439  31  LEU A O     
228  C CB    . LEU A 51  ? 0.4931 0.3475 0.4530 -0.1383 -0.1397 0.0317  31  LEU A CB    
229  C CG    . LEU A 51  ? 0.5984 0.4860 0.5553 -0.1141 -0.1371 0.0240  31  LEU A CG    
230  C CD1   . LEU A 51  ? 0.6158 0.4985 0.5625 -0.1112 -0.1513 0.0025  31  LEU A CD1   
231  C CD2   . LEU A 51  ? 0.5572 0.5002 0.5364 -0.1140 -0.1298 0.0338  31  LEU A CD2   
232  N N     . VAL A 52  ? 0.6429 0.4223 0.5570 -0.0853 -0.1439 0.0080  32  VAL A N     
233  C CA    . VAL A 52  ? 0.5896 0.3662 0.4949 -0.0603 -0.1367 0.0056  32  VAL A CA    
234  C C     . VAL A 52  ? 0.5181 0.3391 0.4252 -0.0475 -0.1266 0.0024  32  VAL A C     
235  O O     . VAL A 52  ? 0.5333 0.3698 0.4363 -0.0478 -0.1306 -0.0103 32  VAL A O     
236  C CB    . VAL A 52  ? 0.6225 0.3585 0.5172 -0.0464 -0.1473 -0.0152 32  VAL A CB    
237  C CG1   . VAL A 52  ? 0.5492 0.2879 0.4413 -0.0218 -0.1403 -0.0190 32  VAL A CG1   
238  C CG2   . VAL A 52  ? 0.6330 0.3150 0.5239 -0.0585 -0.1607 -0.0112 32  VAL A CG2   
239  N N     . GLU A 53  ? 0.4475 0.2860 0.3583 -0.0374 -0.1146 0.0141  33  GLU A N     
240  C CA    . GLU A 53  ? 0.3737 0.2451 0.2855 -0.0260 -0.1050 0.0138  33  GLU A CA    
241  C C     . GLU A 53  ? 0.5053 0.3722 0.4139 -0.0084 -0.0971 0.0084  33  GLU A C     
242  O O     . GLU A 53  ? 0.4258 0.2923 0.3397 -0.0036 -0.0916 0.0176  33  GLU A O     
243  C CB    . GLU A 53  ? 0.5035 0.4057 0.4292 -0.0305 -0.0980 0.0304  33  GLU A CB    
244  C CG    . GLU A 53  ? 0.4552 0.3791 0.3923 -0.0455 -0.1048 0.0339  33  GLU A CG    
245  C CD    . GLU A 53  ? 0.5401 0.5006 0.4953 -0.0434 -0.0981 0.0458  33  GLU A CD    
246  O OE1   . GLU A 53  ? 0.5748 0.5516 0.5469 -0.0558 -0.0967 0.0526  33  GLU A OE1   
247  O OE2   . GLU A 53  ? 0.4738 0.4469 0.4276 -0.0296 -0.0939 0.0478  33  GLU A OE2   
248  N N     . PRO A 54  ? 0.4763 0.3439 0.3769 0.0004  -0.0962 -0.0083 34  PRO A N     
249  C CA    . PRO A 54  ? 0.3879 0.2587 0.2913 0.0150  -0.0878 -0.0164 34  PRO A CA    
250  C C     . PRO A 54  ? 0.4406 0.3376 0.3492 0.0177  -0.0744 -0.0065 34  PRO A C     
251  O O     . PRO A 54  ? 0.3754 0.2765 0.2920 0.0267  -0.0678 -0.0114 34  PRO A O     
252  C CB    . PRO A 54  ? 0.4568 0.3273 0.3510 0.0207  -0.0888 -0.0395 34  PRO A CB    
253  C CG    . PRO A 54  ? 0.4368 0.2879 0.3230 0.0108  -0.1028 -0.0454 34  PRO A CG    
254  C CD    . PRO A 54  ? 0.4196 0.2823 0.3089 -0.0036 -0.1043 -0.0247 34  PRO A CD    
255  N N     . PHE A 55  ? 0.3241 0.2373 0.2305 0.0106  -0.0723 0.0060  35  PHE A N     
256  C CA    . PHE A 55  ? 0.3834 0.3124 0.2953 0.0132  -0.0621 0.0170  35  PHE A CA    
257  C C     . PHE A 55  ? 0.4348 0.3712 0.3573 0.0097  -0.0646 0.0325  35  PHE A C     
258  O O     . PHE A 55  ? 0.3265 0.2756 0.2475 0.0080  -0.0663 0.0409  35  PHE A O     
259  C CB    . PHE A 55  ? 0.5010 0.4426 0.3981 0.0115  -0.0569 0.0178  35  PHE A CB    
260  C CG    . PHE A 55  ? 0.3835 0.3271 0.2679 0.0132  -0.0519 0.0000  35  PHE A CG    
261  C CD1   . PHE A 55  ? 0.4539 0.3932 0.3249 0.0113  -0.0603 -0.0138 35  PHE A CD1   
262  C CD2   . PHE A 55  ? 0.4794 0.4328 0.3669 0.0157  -0.0378 -0.0049 35  PHE A CD2   
263  C CE1   . PHE A 55  ? 0.4631 0.4084 0.3227 0.0147  -0.0543 -0.0343 35  PHE A CE1   
264  C CE2   . PHE A 55  ? 0.4524 0.4164 0.3311 0.0171  -0.0303 -0.0239 35  PHE A CE2   
265  C CZ    . PHE A 55  ? 0.4533 0.4138 0.3173 0.0181  -0.0382 -0.0394 35  PHE A CZ    
266  N N     . VAL A 56  ? 0.4143 0.3453 0.3465 0.0096  -0.0650 0.0359  36  VAL A N     
267  C CA    . VAL A 56  ? 0.3819 0.3259 0.3248 0.0041  -0.0664 0.0467  36  VAL A CA    
268  C C     . VAL A 56  ? 0.3691 0.3306 0.3237 0.0108  -0.0606 0.0540  36  VAL A C     
269  O O     . VAL A 56  ? 0.3205 0.2995 0.2848 0.0092  -0.0643 0.0599  36  VAL A O     
270  C CB    . VAL A 56  ? 0.4670 0.4019 0.4115 -0.0003 -0.0662 0.0498  36  VAL A CB    
271  C CG1   . VAL A 56  ? 0.3823 0.3126 0.3268 0.0095  -0.0601 0.0481  36  VAL A CG1   
272  C CG2   . VAL A 56  ? 0.4064 0.3623 0.3633 -0.0097 -0.0650 0.0587  36  VAL A CG2   
273  N N     . GLY A 57  ? 0.3454 0.3022 0.3021 0.0188  -0.0531 0.0520  37  GLY A N     
274  C CA    . GLY A 57  ? 0.3604 0.3257 0.3288 0.0257  -0.0491 0.0574  37  GLY A CA    
275  C C     . GLY A 57  ? 0.3721 0.3542 0.3562 0.0274  -0.0482 0.0597  37  GLY A C     
276  O O     . GLY A 57  ? 0.2771 0.2600 0.2601 0.0244  -0.0452 0.0569  37  GLY A O     
277  N N     . ALA A 58  ? 0.3620 0.3589 0.3595 0.0329  -0.0511 0.0646  38  ALA A N     
278  C CA    . ALA A 58  ? 0.3071 0.3279 0.3250 0.0371  -0.0482 0.0630  38  ALA A CA    
279  C C     . ALA A 58  ? 0.3256 0.3699 0.3509 0.0254  -0.0508 0.0646  38  ALA A C     
280  O O     . ALA A 58  ? 0.3504 0.4217 0.3936 0.0256  -0.0453 0.0621  38  ALA A O     
281  C CB    . ALA A 58  ? 0.3950 0.4225 0.4298 0.0513  -0.0520 0.0651  38  ALA A CB    
282  N N     . GLY A 59  ? 0.3657 0.4020 0.3790 0.0144  -0.0585 0.0669  39  GLY A N     
283  C CA    . GLY A 59  ? 0.3628 0.4130 0.3812 -0.0018 -0.0609 0.0676  39  GLY A CA    
284  C C     . GLY A 59  ? 0.3894 0.4748 0.4315 -0.0062 -0.0684 0.0681  39  GLY A C     
285  O O     . GLY A 59  ? 0.3235 0.4304 0.3795 -0.0207 -0.0652 0.0680  39  GLY A O     
286  N N     . SER A 60  ? 0.3697 0.4623 0.4165 0.0050  -0.0791 0.0693  40  SER A N     
287  C CA    . SER A 60  ? 0.3277 0.4587 0.4010 0.0050  -0.0899 0.0684  40  SER A CA    
288  C C     . SER A 60  ? 0.3996 0.5417 0.4751 -0.0162 -0.0989 0.0652  40  SER A C     
289  O O     . SER A 60  ? 0.3378 0.5202 0.4437 -0.0234 -0.1031 0.0619  40  SER A O     
290  C CB    . SER A 60  ? 0.5345 0.6632 0.6045 0.0229  -0.1035 0.0732  40  SER A CB    
291  O OG    . SER A 60  ? 0.5591 0.6930 0.6460 0.0425  -0.0995 0.0744  40  SER A OG    
292  N N     . VAL A 61  ? 0.3203 0.4287 0.3672 -0.0260 -0.1024 0.0637  41  VAL A N     
293  C CA    . VAL A 61  ? 0.3985 0.5088 0.4457 -0.0466 -0.1124 0.0579  41  VAL A CA    
294  C C     . VAL A 61  ? 0.4040 0.5119 0.4602 -0.0676 -0.1022 0.0590  41  VAL A C     
295  O O     . VAL A 61  ? 0.3857 0.5181 0.4636 -0.0869 -0.1062 0.0565  41  VAL A O     
296  C CB    . VAL A 61  ? 0.4869 0.5604 0.4997 -0.0473 -0.1203 0.0522  41  VAL A CB    
297  C CG1   . VAL A 61  ? 0.4741 0.5411 0.4867 -0.0688 -0.1305 0.0428  41  VAL A CG1   
298  C CG2   . VAL A 61  ? 0.5196 0.5987 0.5181 -0.0319 -0.1306 0.0534  41  VAL A CG2   
299  N N     . PHE A 62  ? 0.3461 0.4248 0.3848 -0.0651 -0.0897 0.0635  42  PHE A N     
300  C CA    . PHE A 62  ? 0.3146 0.3856 0.3531 -0.0830 -0.0792 0.0693  42  PHE A CA    
301  C C     . PHE A 62  ? 0.4248 0.5471 0.4961 -0.0920 -0.0696 0.0717  42  PHE A C     
302  O O     . PHE A 62  ? 0.4742 0.6071 0.5559 -0.1172 -0.0659 0.0750  42  PHE A O     
303  C CB    . PHE A 62  ? 0.3470 0.3857 0.3611 -0.0711 -0.0696 0.0736  42  PHE A CB    
304  C CG    . PHE A 62  ? 0.4008 0.4423 0.4119 -0.0820 -0.0561 0.0825  42  PHE A CG    
305  C CD1   . PHE A 62  ? 0.4310 0.4581 0.4361 -0.1073 -0.0557 0.0903  42  PHE A CD1   
306  C CD2   . PHE A 62  ? 0.3950 0.4493 0.4048 -0.0674 -0.0440 0.0833  42  PHE A CD2   
307  C CE1   . PHE A 62  ? 0.4771 0.5052 0.4717 -0.1190 -0.0424 0.1018  42  PHE A CE1   
308  C CE2   . PHE A 62  ? 0.3919 0.4506 0.3920 -0.0770 -0.0313 0.0909  42  PHE A CE2   
309  C CZ    . PHE A 62  ? 0.4817 0.5279 0.4721 -0.1033 -0.0299 0.1018  42  PHE A CZ    
310  N N     . LEU A 63  ? 0.4128 0.5673 0.5021 -0.0718 -0.0658 0.0689  43  LEU A N     
311  C CA    . LEU A 63  ? 0.3976 0.6067 0.5219 -0.0738 -0.0552 0.0666  43  LEU A CA    
312  C C     . LEU A 63  ? 0.3592 0.6152 0.5206 -0.0851 -0.0655 0.0605  43  LEU A C     
313  O O     . LEU A 63  ? 0.3446 0.6527 0.5405 -0.0931 -0.0554 0.0569  43  LEU A O     
314  C CB    . LEU A 63  ? 0.3449 0.5679 0.4783 -0.0445 -0.0505 0.0623  43  LEU A CB    
315  C CG    . LEU A 63  ? 0.3852 0.5804 0.4934 -0.0354 -0.0368 0.0644  43  LEU A CG    
316  C CD1   . LEU A 63  ? 0.3838 0.5796 0.4991 -0.0065 -0.0375 0.0585  43  LEU A CD1   
317  C CD2   . LEU A 63  ? 0.4216 0.6412 0.5329 -0.0504 -0.0181 0.0657  43  LEU A CD2   
318  N N     . ASN A 64  ? 0.2902 0.5328 0.4459 -0.0862 -0.0854 0.0575  44  ASN A N     
319  C CA    . ASN A 64  ? 0.4040 0.6939 0.5955 -0.0943 -0.0997 0.0496  44  ASN A CA    
320  C C     . ASN A 64  ? 0.4131 0.6860 0.5975 -0.1216 -0.1127 0.0459  44  ASN A C     
321  O O     . ASN A 64  ? 0.3267 0.6245 0.5277 -0.1236 -0.1321 0.0372  44  ASN A O     
322  C CB    . ASN A 64  ? 0.3906 0.6939 0.5880 -0.0649 -0.1172 0.0465  44  ASN A CB    
323  C CG    . ASN A 64  ? 0.3634 0.6954 0.5842 -0.0391 -0.1085 0.0460  44  ASN A CG    
324  O OD1   . ASN A 64  ? 0.2665 0.6562 0.5322 -0.0356 -0.1092 0.0384  44  ASN A OD1   
325  N ND2   . ASN A 64  ? 0.2927 0.5859 0.4861 -0.0204 -0.1011 0.0516  44  ASN A ND2   
326  N N     . THR A 65  ? 0.3358 0.5647 0.4952 -0.1415 -0.1042 0.0515  45  THR A N     
327  C CA    . THR A 65  ? 0.3746 0.5794 0.5282 -0.1690 -0.1156 0.0469  45  THR A CA    
328  C C     . THR A 65  ? 0.4977 0.6978 0.6584 -0.2019 -0.1004 0.0558  45  THR A C     
329  O O     . THR A 65  ? 0.4262 0.6486 0.5947 -0.2022 -0.0803 0.0648  45  THR A O     
330  C CB    . THR A 65  ? 0.4149 0.5546 0.5241 -0.1603 -0.1253 0.0444  45  THR A CB    
331  O OG1   . THR A 65  ? 0.3712 0.4742 0.4529 -0.1470 -0.1108 0.0544  45  THR A OG1   
332  C CG2   . THR A 65  ? 0.4113 0.5584 0.5108 -0.1368 -0.1416 0.0354  45  THR A CG2   
333  N N     . ASP A 66  ? 0.5350 0.7040 0.6906 -0.2300 -0.1097 0.0534  46  ASP A N     
334  C CA    . ASP A 66  ? 0.5818 0.7400 0.7419 -0.2664 -0.0968 0.0650  46  ASP A CA    
335  C C     . ASP A 66  ? 0.6629 0.7420 0.7898 -0.2840 -0.1065 0.0684  46  ASP A C     
336  O O     . ASP A 66  ? 0.6988 0.7688 0.8398 -0.3161 -0.1151 0.0642  46  ASP A O     
337  C CB    . ASP A 66  ? 0.7214 0.9457 0.9332 -0.2953 -0.0964 0.0582  46  ASP A CB    
338  C CG    . ASP A 66  ? 0.9027 1.1287 1.1223 -0.3358 -0.0768 0.0733  46  ASP A CG    
339  O OD1   . ASP A 66  ? 0.9202 1.1678 1.1366 -0.3333 -0.0532 0.0859  46  ASP A OD1   
340  O OD2   . ASP A 66  ? 1.0490 1.2495 1.2726 -0.3631 -0.0824 0.0702  46  ASP A OD2   
341  N N     . PHE A 67  ? 0.6729 0.6951 0.7587 -0.2626 -0.1061 0.0744  47  PHE A N     
342  C CA    . PHE A 67  ? 0.7169 0.6608 0.7713 -0.2735 -0.1151 0.0784  47  PHE A CA    
343  C C     . PHE A 67  ? 0.7041 0.6210 0.7407 -0.2921 -0.0991 0.1034  47  PHE A C     
344  O O     . PHE A 67  ? 0.6397 0.5961 0.6799 -0.2879 -0.0799 0.1148  47  PHE A O     
345  C CB    . PHE A 67  ? 0.7364 0.6373 0.7589 -0.2384 -0.1249 0.0692  47  PHE A CB    
346  C CG    . PHE A 67  ? 0.7510 0.6627 0.7783 -0.2247 -0.1419 0.0457  47  PHE A CG    
347  C CD1   . PHE A 67  ? 0.7970 0.6596 0.8102 -0.2292 -0.1596 0.0298  47  PHE A CD1   
348  C CD2   . PHE A 67  ? 0.6927 0.6610 0.7351 -0.2061 -0.1411 0.0392  47  PHE A CD2   
349  C CE1   . PHE A 67  ? 0.8165 0.6917 0.8281 -0.2170 -0.1743 0.0069  47  PHE A CE1   
350  C CE2   . PHE A 67  ? 0.7179 0.6948 0.7568 -0.1942 -0.1573 0.0204  47  PHE A CE2   
351  C CZ    . PHE A 67  ? 0.7528 0.6858 0.7749 -0.2003 -0.1730 0.0038  47  PHE A CZ    
352  N N     . SER A 68  ? 0.7440 0.5910 0.7580 -0.3109 -0.1078 0.1117  48  SER A N     
353  C CA    . SER A 68  ? 0.7701 0.5900 0.7596 -0.3212 -0.0924 0.1359  48  SER A CA    
354  C C     . SER A 68  ? 0.7641 0.5364 0.7123 -0.2932 -0.0943 0.1466  48  SER A C     
355  O O     . SER A 68  ? 0.7412 0.4986 0.6650 -0.2954 -0.0825 0.1660  48  SER A O     
356  C CB    . SER A 68  ? 0.8150 0.5908 0.8016 -0.3438 -0.0969 0.1381  48  SER A CB    
357  O OG    . SER A 68  ? 0.8716 0.5813 0.8407 -0.3288 -0.1184 0.1255  48  SER A OG    
358  N N     . ARG A 69  ? 0.7260 0.4817 0.6673 -0.2630 -0.1080 0.1310  49  ARG A N     
359  C CA    . ARG A 69  ? 0.6634 0.3844 0.5732 -0.2311 -0.1106 0.1350  49  ARG A CA    
360  C C     . ARG A 69  ? 0.6768 0.4265 0.5950 -0.1949 -0.1132 0.1131  49  ARG A C     
361  O O     . ARG A 69  ? 0.7150 0.4816 0.6512 -0.1925 -0.1214 0.0938  49  ARG A O     
362  C CB    . ARG A 69  ? 0.7874 0.4327 0.6732 -0.2252 -0.1272 0.1348  49  ARG A CB    
363  C CG    . ARG A 69  ? 0.8548 0.4728 0.7151 -0.2305 -0.1204 0.1573  49  ARG A CG    
364  C CD    . ARG A 69  ? 1.0437 0.5971 0.8927 -0.2284 -0.1371 0.1536  49  ARG A CD    
365  N NE    . ARG A 69  ? 1.1428 0.6676 0.9905 -0.1973 -0.1551 0.1309  49  ARG A NE    
366  C CZ    . ARG A 69  ? 1.1855 0.6751 1.0406 -0.1953 -0.1704 0.1123  49  ARG A CZ    
367  N NH1   . ARG A 69  ? 1.1783 0.6525 1.0428 -0.2236 -0.1715 0.1147  49  ARG A NH1   
368  N NH2   . ARG A 69  ? 1.1639 0.6365 1.0184 -0.1650 -0.1836 0.0895  49  ARG A NH2   
369  N N     . TYR A 70  ? 0.5662 0.3204 0.4693 -0.1687 -0.1070 0.1165  50  TYR A N     
370  C CA    . TYR A 70  ? 0.5636 0.3410 0.4728 -0.1373 -0.1077 0.0984  50  TYR A CA    
371  C C     . TYR A 70  ? 0.6360 0.3786 0.5231 -0.1107 -0.1134 0.0965  50  TYR A C     
372  O O     . TYR A 70  ? 0.5524 0.2738 0.4196 -0.1106 -0.1116 0.1126  50  TYR A O     
373  C CB    . TYR A 70  ? 0.5054 0.3469 0.4328 -0.1312 -0.0914 0.0995  50  TYR A CB    
374  C CG    . TYR A 70  ? 0.5202 0.4094 0.4776 -0.1487 -0.0879 0.0958  50  TYR A CG    
375  C CD1   . TYR A 70  ? 0.5406 0.4531 0.5137 -0.1389 -0.0958 0.0796  50  TYR A CD1   
376  C CD2   . TYR A 70  ? 0.5415 0.4564 0.5114 -0.1749 -0.0768 0.1085  50  TYR A CD2   
377  C CE1   . TYR A 70  ? 0.4904 0.4491 0.4925 -0.1523 -0.0965 0.0756  50  TYR A CE1   
378  C CE2   . TYR A 70  ? 0.4908 0.4569 0.4952 -0.1898 -0.0747 0.1025  50  TYR A CE2   
379  C CZ    . TYR A 70  ? 0.5927 0.5800 0.6139 -0.1770 -0.0864 0.0858  50  TYR A CZ    
380  O OH    . TYR A 70  ? 0.6394 0.6797 0.6960 -0.1896 -0.0879 0.0794  50  TYR A OH    
381  N N     . ILE A 71  ? 0.6113 0.3523 0.5019 -0.0886 -0.1201 0.0764  51  ILE A N     
382  C CA    . ILE A 71  ? 0.5703 0.2982 0.4508 -0.0613 -0.1226 0.0697  51  ILE A CA    
383  C C     . ILE A 71  ? 0.5485 0.3222 0.4423 -0.0448 -0.1124 0.0578  51  ILE A C     
384  O O     . ILE A 71  ? 0.5602 0.3474 0.4622 -0.0429 -0.1140 0.0435  51  ILE A O     
385  C CB    . ILE A 71  ? 0.5802 0.2600 0.4535 -0.0493 -0.1398 0.0543  51  ILE A CB    
386  C CG1   . ILE A 71  ? 0.6446 0.2679 0.5033 -0.0657 -0.1527 0.0678  51  ILE A CG1   
387  C CG2   . ILE A 71  ? 0.6188 0.2962 0.4893 -0.0205 -0.1420 0.0446  51  ILE A CG2   
388  C CD1   . ILE A 71  ? 0.6917 0.2610 0.5454 -0.0517 -0.1723 0.0508  51  ILE A CD1   
389  N N     . LEU A 72  ? 0.4629 0.2577 0.3563 -0.0341 -0.1027 0.0638  52  LEU A N     
390  C CA    . LEU A 72  ? 0.3761 0.2105 0.2826 -0.0225 -0.0921 0.0566  52  LEU A CA    
391  C C     . LEU A 72  ? 0.5027 0.3368 0.4081 -0.0016 -0.0908 0.0478  52  LEU A C     
392  O O     . LEU A 72  ? 0.4370 0.2600 0.3334 0.0040  -0.0927 0.0536  52  LEU A O     
393  C CB    . LEU A 72  ? 0.3991 0.2675 0.3145 -0.0311 -0.0802 0.0684  52  LEU A CB    
394  C CG    . LEU A 72  ? 0.4885 0.3694 0.4125 -0.0534 -0.0794 0.0765  52  LEU A CG    
395  C CD1   . LEU A 72  ? 0.4637 0.3813 0.3980 -0.0598 -0.0659 0.0859  52  LEU A CD1   
396  C CD2   . LEU A 72  ? 0.4100 0.3056 0.3470 -0.0561 -0.0849 0.0665  52  LEU A CD2   
397  N N     . ALA A 73  ? 0.3613 0.2101 0.2750 0.0082  -0.0876 0.0343  53  ALA A N     
398  C CA    . ALA A 73  ? 0.3339 0.1860 0.2519 0.0250  -0.0859 0.0226  53  ALA A CA    
399  C C     . ALA A 73  ? 0.4900 0.3715 0.4189 0.0288  -0.0740 0.0169  53  ALA A C     
400  O O     . ALA A 73  ? 0.5211 0.4148 0.4499 0.0218  -0.0702 0.0195  53  ALA A O     
401  C CB    . ALA A 73  ? 0.3580 0.1865 0.2735 0.0342  -0.0965 0.0071  53  ALA A CB    
402  N N     . ASP A 74  ? 0.4381 0.3290 0.3756 0.0388  -0.0696 0.0099  54  ASP A N     
403  C CA    . ASP A 74  ? 0.4064 0.3196 0.3545 0.0395  -0.0577 0.0064  54  ASP A CA    
404  C C     . ASP A 74  ? 0.5697 0.4910 0.5310 0.0491  -0.0560 -0.0072 54  ASP A C     
405  O O     . ASP A 74  ? 0.3969 0.3095 0.3591 0.0573  -0.0653 -0.0106 54  ASP A O     
406  C CB    . ASP A 74  ? 0.2695 0.1928 0.2211 0.0348  -0.0517 0.0193  54  ASP A CB    
407  C CG    . ASP A 74  ? 0.3901 0.3254 0.3467 0.0320  -0.0424 0.0217  54  ASP A CG    
408  O OD1   . ASP A 74  ? 0.3089 0.2499 0.2749 0.0340  -0.0357 0.0155  54  ASP A OD1   
409  O OD2   . ASP A 74  ? 0.3538 0.2922 0.3051 0.0271  -0.0430 0.0308  54  ASP A OD2   
410  N N     . ILE A 75  ? 0.4345 0.3735 0.4061 0.0472  -0.0449 -0.0141 55  ILE A N     
411  C CA    . ILE A 75  ? 0.3062 0.2604 0.2972 0.0533  -0.0422 -0.0292 55  ILE A CA    
412  C C     . ILE A 75  ? 0.3106 0.2701 0.3124 0.0529  -0.0410 -0.0264 55  ILE A C     
413  O O     . ILE A 75  ? 0.3197 0.2909 0.3382 0.0588  -0.0439 -0.0395 55  ILE A O     
414  C CB    . ILE A 75  ? 0.4535 0.4284 0.4525 0.0473  -0.0279 -0.0389 55  ILE A CB    
415  C CG1   . ILE A 75  ? 0.5212 0.5184 0.5455 0.0547  -0.0264 -0.0604 55  ILE A CG1   
416  C CG2   . ILE A 75  ? 0.3787 0.3578 0.3769 0.0344  -0.0153 -0.0261 55  ILE A CG2   
417  C CD1   . ILE A 75  ? 0.4860 0.4821 0.5134 0.0693  -0.0367 -0.0774 55  ILE A CD1   
418  N N     . ASN A 76  ? 0.2605 0.2131 0.2547 0.0472  -0.0381 -0.0122 56  ASN A N     
419  C CA    . ASN A 76  ? 0.3051 0.2609 0.3083 0.0473  -0.0366 -0.0123 56  ASN A CA    
420  C C     . ASN A 76  ? 0.4332 0.3845 0.4280 0.0552  -0.0474 -0.0130 56  ASN A C     
421  O O     . ASN A 76  ? 0.3698 0.3125 0.3486 0.0543  -0.0502 -0.0015 56  ASN A O     
422  C CB    . ASN A 76  ? 0.2775 0.2281 0.2775 0.0413  -0.0298 0.0009  56  ASN A CB    
423  C CG    . ASN A 76  ? 0.4810 0.4318 0.4926 0.0424  -0.0275 -0.0025 56  ASN A CG    
424  O OD1   . ASN A 76  ? 0.2997 0.2540 0.3117 0.0482  -0.0328 -0.0103 56  ASN A OD1   
425  N ND2   . ASN A 76  ? 0.3898 0.3340 0.4080 0.0373  -0.0207 0.0034  56  ASN A ND2   
426  N N     . SER A 77  ? 0.2663 0.2468 0.2958 0.0527  -0.0073 -0.0261 57  SER A N     
427  C CA    . SER A 77  ? 0.2869 0.2681 0.3295 0.0569  -0.0184 -0.0167 57  SER A CA    
428  C C     . SER A 77  ? 0.3699 0.3616 0.4043 0.0519  -0.0266 -0.0062 57  SER A C     
429  O O     . SER A 77  ? 0.3096 0.2976 0.3429 0.0512  -0.0347 0.0027  57  SER A O     
430  C CB    . SER A 77  ? 0.4195 0.4099 0.4909 0.0670  -0.0185 -0.0169 57  SER A CB    
431  O OG    . SER A 77  ? 0.4263 0.4369 0.5065 0.0661  -0.0165 -0.0162 57  SER A OG    
432  N N     . ASP A 78  ? 0.2749 0.2776 0.3018 0.0486  -0.0235 -0.0070 58  ASP A N     
433  C CA    . ASP A 78  ? 0.3698 0.3791 0.3870 0.0458  -0.0283 0.0006  58  ASP A CA    
434  C C     . ASP A 78  ? 0.4029 0.4080 0.4102 0.0405  -0.0296 0.0053  58  ASP A C     
435  O O     . ASP A 78  ? 0.3124 0.3218 0.3168 0.0394  -0.0323 0.0134  58  ASP A O     
436  C CB    . ASP A 78  ? 0.4406 0.4578 0.4526 0.0444  -0.0254 -0.0020 58  ASP A CB    
437  C CG    . ASP A 78  ? 0.4378 0.4620 0.4616 0.0469  -0.0273 -0.0035 58  ASP A CG    
438  O OD1   . ASP A 78  ? 0.3650 0.3934 0.3902 0.0443  -0.0230 -0.0075 58  ASP A OD1   
439  O OD2   . ASP A 78  ? 0.3353 0.3607 0.3671 0.0499  -0.0346 0.0008  58  ASP A OD2   
440  N N     . LEU A 79  ? 0.2726 0.2695 0.2744 0.0360  -0.0277 0.0008  59  LEU A N     
441  C CA    . LEU A 79  ? 0.2397 0.2339 0.2358 0.0285  -0.0319 0.0062  59  LEU A CA    
442  C C     . LEU A 79  ? 0.3401 0.3253 0.3401 0.0260  -0.0372 0.0123  59  LEU A C     
443  O O     . LEU A 79  ? 0.3102 0.3029 0.3127 0.0211  -0.0403 0.0224  59  LEU A O     
444  C CB    . LEU A 79  ? 0.2976 0.2809 0.2814 0.0221  -0.0318 -0.0002 59  LEU A CB    
445  C CG    . LEU A 79  ? 0.4192 0.3961 0.3970 0.0115  -0.0402 0.0048  59  LEU A CG    
446  C CD1   . LEU A 79  ? 0.4091 0.4050 0.3946 0.0092  -0.0438 0.0146  59  LEU A CD1   
447  C CD2   . LEU A 79  ? 0.4356 0.3924 0.3928 0.0046  -0.0410 -0.0045 59  LEU A CD2   
448  N N     . ILE A 80  ? 0.3025 0.2717 0.3049 0.0294  -0.0377 0.0069  60  ILE A N     
449  C CA    . ILE A 80  ? 0.2914 0.2460 0.2969 0.0271  -0.0445 0.0131  60  ILE A CA    
450  C C     . ILE A 80  ? 0.3437 0.3081 0.3547 0.0287  -0.0481 0.0255  60  ILE A C     
451  O O     . ILE A 80  ? 0.3597 0.3200 0.3693 0.0217  -0.0532 0.0363  60  ILE A O     
452  C CB    . ILE A 80  ? 0.3413 0.2741 0.3509 0.0340  -0.0435 0.0033  60  ILE A CB    
453  C CG1   . ILE A 80  ? 0.3585 0.2756 0.3538 0.0308  -0.0382 -0.0101 60  ILE A CG1   
454  C CG2   . ILE A 80  ? 0.3761 0.2894 0.3898 0.0328  -0.0527 0.0110  60  ILE A CG2   
455  C CD1   . ILE A 80  ? 0.3943 0.2955 0.3746 0.0172  -0.0465 -0.0074 60  ILE A CD1   
456  N N     . SER A 81  ? 0.3428 0.3186 0.3570 0.0361  -0.0461 0.0247  61  SER A N     
457  C CA    . SER A 81  ? 0.3198 0.3014 0.3305 0.0363  -0.0502 0.0354  61  SER A CA    
458  C C     . SER A 81  ? 0.4231 0.4182 0.4237 0.0302  -0.0453 0.0429  61  SER A C     
459  O O     . SER A 81  ? 0.3923 0.3874 0.3863 0.0256  -0.0468 0.0542  61  SER A O     
460  C CB    . SER A 81  ? 0.3726 0.3614 0.3867 0.0436  -0.0515 0.0319  61  SER A CB    
461  O OG    . SER A 81  ? 0.3362 0.3277 0.3380 0.0420  -0.0561 0.0411  61  SER A OG    
462  N N     . LEU A 82  ? 0.3379 0.3446 0.3386 0.0305  -0.0388 0.0372  62  LEU A N     
463  C CA    . LEU A 82  ? 0.3372 0.3592 0.3360 0.0274  -0.0326 0.0433  62  LEU A CA    
464  C C     . LEU A 82  ? 0.3909 0.4148 0.3969 0.0176  -0.0344 0.0535  62  LEU A C     
465  O O     . LEU A 82  ? 0.3834 0.4197 0.3899 0.0141  -0.0289 0.0636  62  LEU A O     
466  C CB    . LEU A 82  ? 0.2740 0.3049 0.2756 0.0305  -0.0285 0.0361  62  LEU A CB    
467  C CG    . LEU A 82  ? 0.2873 0.3349 0.2975 0.0286  -0.0237 0.0421  62  LEU A CG    
468  C CD1   . LEU A 82  ? 0.2498 0.3082 0.2546 0.0346  -0.0138 0.0449  62  LEU A CD1   
469  C CD2   . LEU A 82  ? 0.4006 0.4503 0.4156 0.0292  -0.0259 0.0370  62  LEU A CD2   
470  N N     . TYR A 83  ? 0.3139 0.3246 0.3243 0.0121  -0.0413 0.0509  63  TYR A N     
471  C CA    . TYR A 83  ? 0.2885 0.2973 0.3056 -0.0001 -0.0464 0.0607  63  TYR A CA    
472  C C     . TYR A 83  ? 0.3416 0.3420 0.3557 -0.0051 -0.0492 0.0727  63  TYR A C     
473  O O     . TYR A 83  ? 0.3525 0.3616 0.3729 -0.0158 -0.0489 0.0858  63  TYR A O     
474  C CB    . TYR A 83  ? 0.2922 0.2805 0.3068 -0.0055 -0.0549 0.0526  63  TYR A CB    
475  C CG    . TYR A 83  ? 0.3199 0.3153 0.3345 -0.0077 -0.0559 0.0467  63  TYR A CG    
476  C CD1   . TYR A 83  ? 0.2964 0.3176 0.3213 -0.0058 -0.0514 0.0518  63  TYR A CD1   
477  C CD2   . TYR A 83  ? 0.3231 0.2963 0.3253 -0.0120 -0.0618 0.0364  63  TYR A CD2   
478  C CE1   . TYR A 83  ? 0.3125 0.3382 0.3381 -0.0083 -0.0557 0.0489  63  TYR A CE1   
479  C CE2   . TYR A 83  ? 0.2702 0.2467 0.2667 -0.0164 -0.0652 0.0329  63  TYR A CE2   
480  C CZ    . TYR A 83  ? 0.4329 0.4362 0.4428 -0.0147 -0.0636 0.0404  63  TYR A CZ    
481  O OH    . TYR A 83  ? 0.3994 0.4047 0.4050 -0.0190 -0.0699 0.0395  63  TYR A OH    
482  N N     . ASN A 84  ? 0.3563 0.3405 0.3627 0.0016  -0.0527 0.0699  64  ASN A N     
483  C CA    . ASN A 84  ? 0.3881 0.3615 0.3885 -0.0028 -0.0577 0.0829  64  ASN A CA    
484  C C     . ASN A 84  ? 0.4491 0.4411 0.4392 -0.0050 -0.0489 0.0938  64  ASN A C     
485  O O     . ASN A 84  ? 0.4283 0.4201 0.4142 -0.0155 -0.0486 0.1088  64  ASN A O     
486  C CB    . ASN A 84  ? 0.5025 0.4557 0.5012 0.0067  -0.0659 0.0780  64  ASN A CB    
487  C CG    . ASN A 84  ? 0.6052 0.5317 0.6117 0.0071  -0.0740 0.0720  64  ASN A CG    
488  O OD1   . ASN A 84  ? 0.7168 0.6291 0.7230 -0.0037 -0.0796 0.0789  64  ASN A OD1   
489  N ND2   . ASN A 84  ? 0.4626 0.3814 0.4762 0.0194  -0.0741 0.0588  64  ASN A ND2   
490  N N     . ILE A 85  ? 0.3513 0.3564 0.3345 0.0041  -0.0410 0.0861  65  ILE A N     
491  C CA    . ILE A 85  ? 0.3407 0.3602 0.3089 0.0038  -0.0297 0.0923  65  ILE A CA    
492  C C     . ILE A 85  ? 0.4129 0.4554 0.3929 -0.0029 -0.0172 0.1001  65  ILE A C     
493  O O     . ILE A 85  ? 0.3709 0.4212 0.3419 -0.0098 -0.0085 0.1124  65  ILE A O     
494  C CB    . ILE A 85  ? 0.5135 0.5379 0.4719 0.0152  -0.0247 0.0795  65  ILE A CB    
495  C CG1   . ILE A 85  ? 0.5719 0.5793 0.5242 0.0206  -0.0374 0.0738  65  ILE A CG1   
496  C CG2   . ILE A 85  ? 0.4815 0.5159 0.4195 0.0160  -0.0108 0.0827  65  ILE A CG2   
497  C CD1   . ILE A 85  ? 0.6417 0.6356 0.5738 0.0167  -0.0455 0.0846  65  ILE A CD1   
498  N N     . VAL A 86  ? 0.3643 0.4190 0.3653 -0.0016 -0.0162 0.0942  66  VAL A N     
499  C CA    . VAL A 86  ? 0.3224 0.4032 0.3438 -0.0072 -0.0068 0.1027  66  VAL A CA    
500  C C     . VAL A 86  ? 0.3400 0.4215 0.3707 -0.0237 -0.0108 0.1192  66  VAL A C     
501  O O     . VAL A 86  ? 0.4075 0.5129 0.4501 -0.0303 0.0012  0.1316  66  VAL A O     
502  C CB    . VAL A 86  ? 0.3264 0.4165 0.3687 -0.0044 -0.0112 0.0951  66  VAL A CB    
503  C CG1   . VAL A 86  ? 0.2579 0.3754 0.3293 -0.0128 -0.0073 0.1073  66  VAL A CG1   
504  C CG2   . VAL A 86  ? 0.3784 0.4719 0.4144 0.0104  -0.0048 0.0822  66  VAL A CG2   
505  N N     . LYS A 87  ? 0.3261 0.3810 0.3526 -0.0304 -0.0266 0.1196  67  LYS A N     
506  C CA    . LYS A 87  ? 0.4088 0.4572 0.4422 -0.0477 -0.0335 0.1353  67  LYS A CA    
507  C C     . LYS A 87  ? 0.4091 0.4544 0.4252 -0.0541 -0.0277 0.1503  67  LYS A C     
508  O O     . LYS A 87  ? 0.4108 0.4701 0.4363 -0.0686 -0.0223 0.1670  67  LYS A O     
509  C CB    . LYS A 87  ? 0.4607 0.4743 0.4911 -0.0515 -0.0522 0.1295  67  LYS A CB    
510  C CG    . LYS A 87  ? 0.5872 0.5843 0.6205 -0.0700 -0.0624 0.1454  67  LYS A CG    
511  C CD    . LYS A 87  ? 0.5876 0.5436 0.6149 -0.0715 -0.0800 0.1369  67  LYS A CD    
512  C CE    . LYS A 87  ? 0.6125 0.5459 0.6395 -0.0899 -0.0915 0.1534  67  LYS A CE    
513  N NZ    . LYS A 87  ? 0.4712 0.3603 0.4921 -0.0919 -0.1082 0.1441  67  LYS A NZ    
514  N N     . MET A 88  ? 0.4130 0.4407 0.4039 -0.0450 -0.0295 0.1457  68  MET A N     
515  C CA    A MET A 88  ? 0.4850 0.5005 0.4522 -0.0526 -0.0296 0.1607  68  MET A CA    
516  C CA    B MET A 88  ? 0.4880 0.5038 0.4555 -0.0529 -0.0295 0.1610  68  MET A CA    
517  C C     . MET A 88  ? 0.4973 0.5315 0.4429 -0.0501 -0.0103 0.1642  68  MET A C     
518  O O     . MET A 88  ? 0.4509 0.4801 0.3749 -0.0606 -0.0063 0.1797  68  MET A O     
519  C CB    A MET A 88  ? 0.4687 0.4505 0.4205 -0.0458 -0.0472 0.1565  68  MET A CB    
520  C CB    B MET A 88  ? 0.4806 0.4620 0.4328 -0.0468 -0.0475 0.1575  68  MET A CB    
521  C CG    A MET A 88  ? 0.4973 0.4546 0.4660 -0.0459 -0.0639 0.1513  68  MET A CG    
522  C CG    B MET A 88  ? 0.5023 0.4579 0.4708 -0.0482 -0.0647 0.1537  68  MET A CG    
523  S SD    A MET A 88  ? 0.8207 0.7431 0.7813 -0.0346 -0.0823 0.1473  68  MET A SD    
524  S SD    B MET A 88  ? 0.5521 0.4839 0.5214 -0.0687 -0.0768 0.1752  68  MET A SD    
525  C CE    A MET A 88  ? 0.3755 0.3144 0.3347 -0.0163 -0.0757 0.1281  68  MET A CE    
526  C CE    B MET A 88  ? 0.4396 0.3302 0.4180 -0.0600 -0.0968 0.1624  68  MET A CE    
527  N N     . ARG A 89  ? 0.4548 0.5062 0.4018 -0.0366 0.0017  0.1496  69  ARG A N     
528  C CA    . ARG A 89  ? 0.4114 0.4743 0.3328 -0.0320 0.0209  0.1488  69  ARG A CA    
529  C C     . ARG A 89  ? 0.4349 0.5309 0.3784 -0.0242 0.0418  0.1423  69  ARG A C     
530  O O     . ARG A 89  ? 0.3696 0.4678 0.3005 -0.0108 0.0514  0.1287  69  ARG A O     
531  C CB    . ARG A 89  ? 0.4186 0.4597 0.3098 -0.0209 0.0126  0.1362  69  ARG A CB    
532  C CG    . ARG A 89  ? 0.5097 0.5208 0.3751 -0.0274 -0.0062 0.1458  69  ARG A CG    
533  C CD    . ARG A 89  ? 0.5878 0.5808 0.4414 -0.0164 -0.0218 0.1330  69  ARG A CD    
534  N NE    . ARG A 89  ? 0.5598 0.5496 0.3767 -0.0125 -0.0141 0.1267  69  ARG A NE    
535  C CZ    . ARG A 89  ? 0.5934 0.5678 0.3949 -0.0065 -0.0281 0.1183  69  ARG A CZ    
536  N NH1   . ARG A 89  ? 0.5587 0.5243 0.3833 -0.0021 -0.0481 0.1155  69  ARG A NH1   
537  N NH2   . ARG A 89  ? 0.5457 0.5134 0.3090 -0.0052 -0.0217 0.1122  69  ARG A NH2   
538  N N     . THR A 90  ? 0.4605 0.5812 0.4381 -0.0331 0.0478  0.1531  70  THR A N     
539  C CA    . THR A 90  ? 0.5121 0.6652 0.5250 -0.0250 0.0602  0.1479  70  THR A CA    
540  C C     . THR A 90  ? 0.4768 0.6503 0.4817 -0.0132 0.0880  0.1431  70  THR A C     
541  O O     . THR A 90  ? 0.4204 0.5982 0.4316 0.0029  0.0926  0.1284  70  THR A O     
542  C CB    . THR A 90  ? 0.4147 0.5926 0.4693 -0.0400 0.0585  0.1640  70  THR A CB    
543  O OG1   . THR A 90  ? 0.4359 0.5885 0.4917 -0.0521 0.0337  0.1678  70  THR A OG1   
544  C CG2   . THR A 90  ? 0.3453 0.5527 0.4414 -0.0313 0.0619  0.1589  70  THR A CG2   
545  N N     . ASP A 91  ? 0.4411 0.6249 0.4306 -0.0211 0.1074  0.1553  71  ASP A N     
546  C CA    . ASP A 91  ? 0.5013 0.7036 0.4809 -0.0096 0.1381  0.1499  71  ASP A CA    
547  C C     . ASP A 91  ? 0.5303 0.7034 0.4635 0.0051  0.1395  0.1304  71  ASP A C     
548  O O     . ASP A 91  ? 0.5134 0.6948 0.4498 0.0219  0.1557  0.1168  71  ASP A O     
549  C CB    . ASP A 91  ? 0.5921 0.8074 0.5563 -0.0237 0.1597  0.1675  71  ASP A CB    
550  C CG    . ASP A 91  ? 0.7018 0.9603 0.7219 -0.0345 0.1700  0.1854  71  ASP A CG    
551  O OD1   . ASP A 91  ? 0.7077 0.9941 0.7770 -0.0244 0.1716  0.1810  71  ASP A OD1   
552  O OD2   . ASP A 91  ? 0.7703 1.0345 0.7861 -0.0543 0.1746  0.2053  71  ASP A OD2   
553  N N     . GLU A 92  ? 0.5007 0.6387 0.3924 -0.0015 0.1213  0.1300  72  GLU A N     
554  C CA    . GLU A 92  ? 0.5767 0.6848 0.4260 0.0087  0.1155  0.1132  72  GLU A CA    
555  C C     . GLU A 92  ? 0.5396 0.6453 0.4125 0.0235  0.1040  0.0961  72  GLU A C     
556  O O     . GLU A 92  ? 0.4781 0.5742 0.3325 0.0363  0.1119  0.0805  72  GLU A O     
557  C CB    . GLU A 92  ? 0.5364 0.6118 0.3495 -0.0027 0.0922  0.1198  72  GLU A CB    
558  C CG    . GLU A 92  ? 0.5908 0.6358 0.3619 0.0043  0.0814  0.1053  72  GLU A CG    
559  C CD    . GLU A 92  ? 0.6894 0.7064 0.4386 -0.0055 0.0534  0.1134  72  GLU A CD    
560  O OE1   . GLU A 92  ? 0.6424 0.6608 0.4139 -0.0148 0.0406  0.1273  72  GLU A OE1   
561  O OE2   . GLU A 92  ? 0.6862 0.6788 0.3973 -0.0040 0.0428  0.1061  72  GLU A OE2   
562  N N     . TYR A 93  ? 0.4675 0.5789 0.3777 0.0206  0.0857  0.0988  73  TYR A N     
563  C CA    . TYR A 93  ? 0.4008 0.5094 0.3304 0.0321  0.0752  0.0847  73  TYR A CA    
564  C C     . TYR A 93  ? 0.4386 0.5700 0.3940 0.0455  0.0928  0.0781  73  TYR A C     
565  O O     . TYR A 93  ? 0.4481 0.5682 0.3958 0.0581  0.0926  0.0636  73  TYR A O     
566  C CB    . TYR A 93  ? 0.3504 0.4585 0.3092 0.0250  0.0541  0.0890  73  TYR A CB    
567  C CG    . TYR A 93  ? 0.3512 0.4544 0.3241 0.0345  0.0437  0.0757  73  TYR A CG    
568  C CD1   . TYR A 93  ? 0.3665 0.4461 0.3183 0.0386  0.0318  0.0647  73  TYR A CD1   
569  C CD2   . TYR A 93  ? 0.3573 0.4803 0.3650 0.0380  0.0452  0.0757  73  TYR A CD2   
570  C CE1   . TYR A 93  ? 0.3579 0.4335 0.3210 0.0452  0.0240  0.0540  73  TYR A CE1   
571  C CE2   . TYR A 93  ? 0.3685 0.4844 0.3841 0.0450  0.0354  0.0652  73  TYR A CE2   
572  C CZ    . TYR A 93  ? 0.4097 0.5017 0.4018 0.0482  0.0262  0.0543  73  TYR A CZ    
573  O OH    . TYR A 93  ? 0.3321 0.4174 0.3305 0.0531  0.0180  0.0455  73  TYR A OH    
574  N N     . VAL A 94  ? 0.3732 0.5364 0.3620 0.0428  0.1069  0.0897  74  VAL A N     
575  C CA    . VAL A 94  ? 0.3308 0.5199 0.3553 0.0567  0.1214  0.0860  74  VAL A CA    
576  C C     . VAL A 94  ? 0.4538 0.6355 0.4510 0.0727  0.1450  0.0728  74  VAL A C     
577  O O     . VAL A 94  ? 0.4607 0.6372 0.4656 0.0882  0.1461  0.0603  74  VAL A O     
578  C CB    . VAL A 94  ? 0.4215 0.6515 0.4933 0.0490  0.1318  0.1038  74  VAL A CB    
579  C CG1   . VAL A 94  ? 0.3983 0.6591 0.5118 0.0657  0.1493  0.1016  74  VAL A CG1   
580  C CG2   . VAL A 94  ? 0.3027 0.5350 0.4007 0.0339  0.1063  0.1141  74  VAL A CG2   
581  N N     . GLN A 95  ? 0.3959 0.5733 0.3574 0.0682  0.1633  0.0755  75  GLN A N     
582  C CA    . GLN A 95  ? 0.4527 0.6173 0.3782 0.0820  0.1875  0.0614  75  GLN A CA    
583  C C     . GLN A 95  ? 0.5832 0.7073 0.4705 0.0904  0.1731  0.0421  75  GLN A C     
584  O O     . GLN A 95  ? 0.6161 0.7296 0.4919 0.1068  0.1876  0.0269  75  GLN A O     
585  C CB    . GLN A 95  ? 0.5289 0.6883 0.4097 0.0710  0.2056  0.0686  75  GLN A CB    
586  N N     . ALA A 96  ? 0.5635 0.6648 0.4334 0.0795  0.1450  0.0429  76  ALA A N     
587  C CA    . ALA A 96  ? 0.5287 0.5944 0.3655 0.0839  0.1296  0.0272  76  ALA A CA    
588  C C     . ALA A 96  ? 0.5442 0.6112 0.4150 0.0947  0.1188  0.0189  76  ALA A C     
589  O O     . ALA A 96  ? 0.5663 0.6105 0.4182 0.1047  0.1185  0.0040  76  ALA A O     
590  C CB    . ALA A 96  ? 0.5637 0.6092 0.3764 0.0689  0.1044  0.0327  76  ALA A CB    
591  N N     . ALA A 97  ? 0.4333 0.5237 0.3505 0.0911  0.1087  0.0290  77  ALA A N     
592  C CA    . ALA A 97  ? 0.4025 0.4938 0.3492 0.0985  0.0968  0.0240  77  ALA A CA    
593  C C     . ALA A 97  ? 0.5033 0.6073 0.4742 0.1161  0.1142  0.0190  77  ALA A C     
594  O O     . ALA A 97  ? 0.4704 0.5623 0.4491 0.1252  0.1062  0.0110  77  ALA A O     
595  C CB    . ALA A 97  ? 0.3098 0.4188 0.2921 0.0881  0.0807  0.0360  77  ALA A CB    
596  N N     . ARG A 98  ? 0.3612 0.4900 0.3462 0.1211  0.1381  0.0247  78  ARG A N     
597  C CA    . ARG A 98  ? 0.4645 0.6102 0.4812 0.1403  0.1568  0.0211  78  ARG A CA    
598  C C     . ARG A 98  ? 0.5056 0.6164 0.4868 0.1563  0.1656  0.0011  78  ARG A C     
599  O O     . ARG A 98  ? 0.4617 0.5721 0.4676 0.1732  0.1690  -0.0049 78  ARG A O     
600  C CB    . ARG A 98  ? 0.4207 0.6029 0.4599 0.1420  0.1849  0.0313  78  ARG A CB    
601  C CG    . ARG A 98  ? 0.4913 0.7044 0.5854 0.1614  0.2018  0.0330  78  ARG A CG    
602  C CD    . ARG A 98  ? 0.6086 0.8692 0.7457 0.1548  0.2188  0.0503  78  ARG A CD    
603  N NE    . ARG A 98  ? 0.7034 0.9603 0.7988 0.1428  0.2367  0.0522  78  ARG A NE    
604  C CZ    . ARG A 98  ? 0.6711 0.9588 0.7865 0.1267  0.2436  0.0698  78  ARG A CZ    
605  N NH1   . ARG A 98  ? 0.6931 1.0182 0.8709 0.1202  0.2334  0.0863  78  ARG A NH1   
606  N NH2   . ARG A 98  ? 0.6069 0.8849 0.6774 0.1149  0.2582  0.0715  78  ARG A NH2   
607  N N     . GLU A 99  ? 0.5671 0.6459 0.4895 0.1501  0.1665  -0.0085 79  GLU A N     
608  C CA    . GLU A 99  ? 0.6191 0.6585 0.4982 0.1619  0.1734  -0.0285 79  GLU A CA    
609  C C     . GLU A 99  ? 0.6690 0.6811 0.5494 0.1655  0.1504  -0.0372 79  GLU A C     
610  O O     . GLU A 99  ? 0.5063 0.4869 0.3626 0.1780  0.1560  -0.0532 79  GLU A O     
611  C CB    . GLU A 99  ? 0.5657 0.5758 0.3787 0.1498  0.1736  -0.0343 79  GLU A CB    
612  C CG    . GLU A 99  ? 0.7229 0.7473 0.5164 0.1488  0.2025  -0.0303 79  GLU A CG    
613  C CD    . GLU A 99  ? 0.9913 0.9783 0.7099 0.1378  0.2013  -0.0378 79  GLU A CD    
614  O OE1   . GLU A 99  ? 1.0233 0.9957 0.7230 0.1212  0.1736  -0.0323 79  GLU A OE1   
615  O OE2   . GLU A 99  ? 1.1593 1.1340 0.8514 0.1390  0.2189  -0.0487 79  GLU A OE2   
616  N N     . LEU A 100 ? 0.5051 0.5264 0.4104 0.1540  0.1254  -0.0272 80  LEU A N     
617  C CA    . LEU A 100 ? 0.5562 0.5543 0.4635 0.1547  0.1044  -0.0329 80  LEU A CA    
618  C C     . LEU A 100 ? 0.6001 0.6118 0.5547 0.1681  0.1035  -0.0291 80  LEU A C     
619  O O     . LEU A 100 ? 0.5122 0.5022 0.4671 0.1698  0.0880  -0.0331 80  LEU A O     
620  C CB    . LEU A 100 ? 0.4905 0.4888 0.3967 0.1357  0.0797  -0.0253 80  LEU A CB    
621  C CG    . LEU A 100 ? 0.5879 0.5685 0.4518 0.1220  0.0721  -0.0278 80  LEU A CG    
622  C CD1   . LEU A 100 ? 0.5745 0.5586 0.4489 0.1074  0.0497  -0.0206 80  LEU A CD1   
623  C CD2   . LEU A 100 ? 0.7409 0.6821 0.5600 0.1254  0.0715  -0.0436 80  LEU A CD2   
624  N N     . PHE A 101 ? 0.3899 0.4377 0.3857 0.1764  0.1183  -0.0195 81  PHE A N     
625  C CA    . PHE A 101 ? 0.4368 0.5013 0.4828 0.1888  0.1145  -0.0128 81  PHE A CA    
626  C C     . PHE A 101 ? 0.5341 0.5952 0.5914 0.2141  0.1383  -0.0224 81  PHE A C     
627  O O     . PHE A 101 ? 0.5592 0.6555 0.6610 0.2224  0.1523  -0.0145 81  PHE A O     
628  C CB    . PHE A 101 ? 0.3771 0.4869 0.4713 0.1802  0.1102  0.0066  81  PHE A CB    
629  C CG    . PHE A 101 ? 0.3245 0.4330 0.4169 0.1597  0.0833  0.0152  81  PHE A CG    
630  C CD1   . PHE A 101 ? 0.2855 0.4055 0.4124 0.1571  0.0648  0.0260  81  PHE A CD1   
631  C CD2   . PHE A 101 ? 0.3006 0.3949 0.3558 0.1437  0.0767  0.0124  81  PHE A CD2   
632  C CE1   . PHE A 101 ? 0.3709 0.4863 0.4901 0.1387  0.0432  0.0318  81  PHE A CE1   
633  C CE2   . PHE A 101 ? 0.3516 0.4437 0.4061 0.1275  0.0556  0.0184  81  PHE A CE2   
634  C CZ    . PHE A 101 ? 0.3500 0.4517 0.4340 0.1250  0.0403  0.0270  81  PHE A CZ    
635  N N     . VAL A 102 ? 0.6071 0.6241 0.6249 0.2230  0.1404  -0.0400 82  VAL A N     
636  C CA    . VAL A 102 ? 0.6698 0.6742 0.6926 0.2386  0.1568  -0.0525 82  VAL A CA    
637  C C     . VAL A 102 ? 0.6861 0.6526 0.7070 0.2467  0.1398  -0.0600 82  VAL A C     
638  O O     . VAL A 102 ? 0.6399 0.5843 0.6420 0.2388  0.1181  -0.0579 82  VAL A O     
639  C CB    . VAL A 102 ? 0.7716 0.7540 0.7406 0.2365  0.1772  -0.0685 82  VAL A CB    
640  C CG1   . VAL A 102 ? 0.7373 0.7591 0.7146 0.2297  0.1969  -0.0593 82  VAL A CG1   
641  C CG2   . VAL A 102 ? 0.8570 0.7962 0.7632 0.2246  0.1625  -0.0779 82  VAL A CG2   
642  N N     . PRO A 103 ? 0.7083 0.6675 0.7506 0.2624  0.1491  -0.0681 83  PRO A N     
643  C CA    . PRO A 103 ? 0.6353 0.5571 0.6788 0.2700  0.1324  -0.0735 83  PRO A CA    
644  C C     . PRO A 103 ? 0.6826 0.5497 0.6637 0.2608  0.1206  -0.0866 83  PRO A C     
645  O O     . PRO A 103 ? 0.6826 0.5244 0.6623 0.2578  0.0984  -0.0831 83  PRO A O     
646  C CB    . PRO A 103 ? 0.7094 0.6312 0.7768 0.2891  0.1509  -0.0847 83  PRO A CB    
647  C CG    . PRO A 103 ? 0.7040 0.6809 0.8125 0.2920  0.1687  -0.0754 83  PRO A CG    
648  C CD    . PRO A 103 ? 0.6754 0.6660 0.7514 0.2743  0.1736  -0.0700 83  PRO A CD    
649  N N     . GLU A 104 ? 0.6200 0.4697 0.5501 0.2542  0.1331  -0.1001 84  GLU A N     
650  C CA    . GLU A 104 ? 0.6758 0.4741 0.5462 0.2430  0.1200  -0.1131 84  GLU A CA    
651  C C     . GLU A 104 ? 0.7659 0.5560 0.6220 0.2270  0.0940  -0.1043 84  GLU A C     
652  O O     . GLU A 104 ? 0.7205 0.4689 0.5438 0.2180  0.0766  -0.1116 84  GLU A O     
653  C CB    . GLU A 104 ? 0.7591 0.5459 0.5782 0.2360  0.1359  -0.1259 84  GLU A CB    
654  C CG    . GLU A 104 ? 0.9903 0.7669 0.8034 0.2495  0.1594  -0.1413 84  GLU A CG    
655  C CD    . GLU A 104 ? 1.0506 0.8777 0.9132 0.2625  0.1838  -0.1342 84  GLU A CD    
656  O OE1   . GLU A 104 ? 0.8970 0.7632 0.7735 0.2548  0.1883  -0.1205 84  GLU A OE1   
657  O OE2   . GLU A 104 ? 1.1266 0.9546 1.0160 0.2801  0.1977  -0.1423 84  GLU A OE2   
658  N N     . THR A 105 ? 0.5620 0.3923 0.4441 0.2218  0.0909  -0.0889 85  THR A N     
659  C CA    . THR A 105 ? 0.5247 0.3589 0.4012 0.1968  0.0656  -0.0789 85  THR A CA    
660  C C     . THR A 105 ? 0.5859 0.4250 0.4963 0.1926  0.0450  -0.0659 85  THR A C     
661  O O     . THR A 105 ? 0.4684 0.3113 0.3753 0.1727  0.0269  -0.0580 85  THR A O     
662  C CB    . THR A 105 ? 0.4918 0.3674 0.3768 0.1832  0.0685  -0.0677 85  THR A CB    
663  O OG1   . THR A 105 ? 0.4692 0.3869 0.4053 0.1901  0.0745  -0.0536 85  THR A OG1   
664  C CG2   . THR A 105 ? 0.5145 0.3856 0.3615 0.1837  0.0870  -0.0774 85  THR A CG2   
665  N N     . ASN A 106 ? 0.5061 0.3456 0.4495 0.2111  0.0482  -0.0628 86  ASN A N     
666  C CA    . ASN A 106 ? 0.4869 0.3282 0.4591 0.2069  0.0274  -0.0485 86  ASN A CA    
667  C C     . ASN A 106 ? 0.5702 0.3599 0.5166 0.2048  0.0123  -0.0554 86  ASN A C     
668  O O     . ASN A 106 ? 0.6073 0.3748 0.5682 0.2216  0.0106  -0.0563 86  ASN A O     
669  C CB    . ASN A 106 ? 0.5206 0.3887 0.5454 0.2267  0.0334  -0.0382 86  ASN A CB    
670  C CG    . ASN A 106 ? 0.5915 0.4738 0.6461 0.2167  0.0099  -0.0186 86  ASN A CG    
671  O OD1   . ASN A 106 ? 0.5654 0.4413 0.6007 0.1949  -0.0067 -0.0132 86  ASN A OD1   
672  N ND2   . ASN A 106 ? 0.5540 0.4560 0.6555 0.2325  0.0089  -0.0075 86  ASN A ND2   
673  N N     . CYS A 107 ? 0.5221 0.2936 0.4334 0.1836  0.0008  -0.0591 87  CYS A N     
674  C CA    . CYS A 107 ? 0.7168 0.4372 0.5962 0.1774  -0.0123 -0.0677 87  CYS A CA    
675  C C     . CYS A 107 ? 0.6645 0.3862 0.5260 0.1490  -0.0287 -0.0624 87  CYS A C     
676  O O     . CYS A 107 ? 0.5389 0.2870 0.3948 0.1383  -0.0248 -0.0618 87  CYS A O     
677  C CB    . CYS A 107 ? 0.7505 0.4350 0.5933 0.1900  0.0016  -0.0892 87  CYS A CB    
678  S SG    . CYS A 107 ? 1.0602 0.6814 0.8508 0.1744  -0.0159 -0.1025 87  CYS A SG    
679  N N     . ALA A 108 ? 0.6187 0.3131 0.4740 0.1369  -0.0466 -0.0573 88  ALA A N     
680  C CA    . ALA A 108 ? 0.6354 0.3388 0.4852 0.1104  -0.0604 -0.0487 88  ALA A CA    
681  C C     . ALA A 108 ? 0.7390 0.4338 0.5596 0.0964  -0.0627 -0.0588 88  ALA A C     
682  O O     . ALA A 108 ? 0.5646 0.2887 0.3906 0.0812  -0.0650 -0.0530 88  ALA A O     
683  C CB    . ALA A 108 ? 0.6816 0.3558 0.5305 0.1002  -0.0772 -0.0400 88  ALA A CB    
684  N N     . GLU A 109 ? 0.5912 0.2435 0.3804 0.1014  -0.0636 -0.0737 89  GLU A N     
685  C CA    . GLU A 109 ? 0.6739 0.3131 0.4313 0.0873  -0.0696 -0.0831 89  GLU A CA    
686  C C     . GLU A 109 ? 0.6791 0.3527 0.4347 0.0903  -0.0569 -0.0853 89  GLU A C     
687  O O     . GLU A 109 ? 0.6763 0.3645 0.4262 0.0737  -0.0652 -0.0824 89  GLU A O     
688  C CB    . GLU A 109 ? 0.8463 0.4268 0.5637 0.0932  -0.0727 -0.1007 89  GLU A CB    
689  C CG    . GLU A 109 ? 0.9380 0.4763 0.6493 0.0822  -0.0914 -0.0983 89  GLU A CG    
690  C CD    . GLU A 109 ? 1.0739 0.6073 0.8125 0.0968  -0.0895 -0.0896 89  GLU A CD    
691  O OE1   . GLU A 109 ? 1.1761 0.7035 0.9203 0.1230  -0.0744 -0.0970 89  GLU A OE1   
692  O OE2   . GLU A 109 ? 0.9193 0.4557 0.6746 0.0818  -0.1030 -0.0744 89  GLU A OE2   
693  N N     . VAL A 110 ? 0.5799 0.2680 0.3436 0.1111  -0.0375 -0.0886 90  VAL A N     
694  C CA    . VAL A 110 ? 0.6433 0.3661 0.4082 0.1128  -0.0248 -0.0874 90  VAL A CA    
695  C C     . VAL A 110 ? 0.5525 0.3224 0.3517 0.1017  -0.0287 -0.0711 90  VAL A C     
696  O O     . VAL A 110 ? 0.5503 0.3395 0.3444 0.0924  -0.0296 -0.0686 90  VAL A O     
697  C CB    . VAL A 110 ? 0.5659 0.2972 0.3372 0.1369  -0.0010 -0.0929 90  VAL A CB    
698  C CG1   . VAL A 110 ? 0.6147 0.3799 0.3850 0.1358  0.0117  -0.0898 90  VAL A CG1   
699  C CG2   . VAL A 110 ? 0.6890 0.3721 0.4239 0.1505  0.0071  -0.1117 90  VAL A CG2   
700  N N     . TYR A 111 ? 0.5208 0.3055 0.3516 0.1025  -0.0318 -0.0602 91  TYR A N     
701  C CA    . TYR A 111 ? 0.4407 0.2639 0.2989 0.0921  -0.0348 -0.0467 91  TYR A CA    
702  C C     . TYR A 111 ? 0.5698 0.3971 0.4223 0.0718  -0.0469 -0.0440 91  TYR A C     
703  O O     . TYR A 111 ? 0.3799 0.2346 0.2419 0.0660  -0.0453 -0.0396 91  TYR A O     
704  C CB    . TYR A 111 ? 0.4059 0.2348 0.2893 0.0940  -0.0390 -0.0360 91  TYR A CB    
705  C CG    . TYR A 111 ? 0.4552 0.3155 0.3586 0.0817  -0.0424 -0.0240 91  TYR A CG    
706  C CD1   . TYR A 111 ? 0.4054 0.2961 0.3291 0.0873  -0.0351 -0.0178 91  TYR A CD1   
707  C CD2   . TYR A 111 ? 0.4620 0.3203 0.3631 0.0641  -0.0521 -0.0194 91  TYR A CD2   
708  C CE1   . TYR A 111 ? 0.3576 0.2705 0.2936 0.0759  -0.0384 -0.0091 91  TYR A CE1   
709  C CE2   . TYR A 111 ? 0.4274 0.3112 0.3425 0.0541  -0.0520 -0.0108 91  TYR A CE2   
710  C CZ    . TYR A 111 ? 0.4326 0.3408 0.3624 0.0603  -0.0456 -0.0066 91  TYR A CZ    
711  O OH    . TYR A 111 ? 0.4114 0.3384 0.3491 0.0504  -0.0457 -0.0004 91  TYR A OH    
712  N N     . TYR A 112 ? 0.5029 0.3034 0.3430 0.0610  -0.0595 -0.0461 92  TYR A N     
713  C CA    . TYR A 112 ? 0.5609 0.3699 0.4041 0.0414  -0.0709 -0.0418 92  TYR A CA    
714  C C     . TYR A 112 ? 0.5953 0.4055 0.4219 0.0366  -0.0749 -0.0474 92  TYR A C     
715  O O     . TYR A 112 ? 0.4606 0.2932 0.3020 0.0247  -0.0811 -0.0414 92  TYR A O     
716  C CB    . TYR A 112 ? 0.4480 0.2287 0.2850 0.0288  -0.0840 -0.0404 92  TYR A CB    
717  C CG    . TYR A 112 ? 0.4359 0.2211 0.2907 0.0273  -0.0831 -0.0298 92  TYR A CG    
718  C CD1   . TYR A 112 ? 0.4873 0.3077 0.3646 0.0228  -0.0774 -0.0200 92  TYR A CD1   
719  C CD2   . TYR A 112 ? 0.4696 0.2203 0.3152 0.0306  -0.0888 -0.0297 92  TYR A CD2   
720  C CE1   . TYR A 112 ? 0.4920 0.3132 0.3779 0.0196  -0.0777 -0.0101 92  TYR A CE1   
721  C CE2   . TYR A 112 ? 0.5866 0.3391 0.4449 0.0280  -0.0906 -0.0179 92  TYR A CE2   
722  C CZ    . TYR A 112 ? 0.5802 0.3683 0.4564 0.0216  -0.0852 -0.0080 92  TYR A CZ    
723  O OH    . TYR A 112 ? 0.5311 0.3179 0.4125 0.0171  -0.0881 0.0039  92  TYR A OH    
724  N N     . GLN A 113 ? 0.5172 0.3038 0.3135 0.0460  -0.0711 -0.0585 93  GLN A N     
725  C CA    . GLN A 113 ? 0.5441 0.3307 0.3191 0.0407  -0.0757 -0.0621 93  GLN A CA    
726  C C     . GLN A 113 ? 0.5452 0.3681 0.3361 0.0461  -0.0652 -0.0553 93  GLN A C     
727  O O     . GLN A 113 ? 0.4774 0.3149 0.2717 0.0366  -0.0739 -0.0503 93  GLN A O     
728  C CB    . GLN A 113 ? 0.5869 0.3323 0.3148 0.0474  -0.0736 -0.0770 93  GLN A CB    
729  C CG    . GLN A 113 ? 0.5575 0.2979 0.2544 0.0390  -0.0814 -0.0797 93  GLN A CG    
730  C CD    . GLN A 113 ? 0.7888 0.4793 0.4285 0.0399  -0.0837 -0.0960 93  GLN A CD    
731  O OE1   . GLN A 113 ? 0.7734 0.4531 0.3853 0.0537  -0.0657 -0.1049 93  GLN A OE1   
732  N NE2   . GLN A 113 ? 0.6612 0.3210 0.2820 0.0240  -0.1056 -0.0999 93  GLN A NE2   
733  N N     . PHE A 114 ? 0.5032 0.3404 0.3064 0.0605  -0.0485 -0.0540 94  PHE A N     
734  C CA    . PHE A 114 ? 0.4802 0.3508 0.3012 0.0633  -0.0399 -0.0461 94  PHE A CA    
735  C C     . PHE A 114 ? 0.4804 0.3781 0.3338 0.0535  -0.0470 -0.0358 94  PHE A C     
736  O O     . PHE A 114 ? 0.4347 0.3508 0.2959 0.0503  -0.0480 -0.0305 94  PHE A O     
737  C CB    . PHE A 114 ? 0.4829 0.3656 0.3167 0.0786  -0.0224 -0.0450 94  PHE A CB    
738  C CG    . PHE A 114 ? 0.5264 0.3972 0.3337 0.0899  -0.0079 -0.0530 94  PHE A CG    
739  C CD1   . PHE A 114 ? 0.5005 0.3682 0.2803 0.0850  -0.0074 -0.0543 94  PHE A CD1   
740  C CD2   . PHE A 114 ? 0.5267 0.3892 0.3369 0.1058  0.0058  -0.0586 94  PHE A CD2   
741  C CE1   . PHE A 114 ? 0.5517 0.4074 0.3016 0.0943  0.0091  -0.0619 94  PHE A CE1   
742  C CE2   . PHE A 114 ? 0.5922 0.4455 0.3793 0.1176  0.0236  -0.0669 94  PHE A CE2   
743  C CZ    . PHE A 114 ? 0.6584 0.5079 0.4126 0.1112  0.0265  -0.0690 94  PHE A CZ    
744  N N     . ARG A 115 ? 0.4001 0.2984 0.2705 0.0491  -0.0506 -0.0330 95  ARG A N     
745  C CA    . ARG A 115 ? 0.3247 0.2459 0.2218 0.0397  -0.0541 -0.0253 95  ARG A CA    
746  C C     . ARG A 115 ? 0.4186 0.3436 0.3179 0.0285  -0.0659 -0.0242 95  ARG A C     
747  O O     . ARG A 115 ? 0.4058 0.3534 0.3254 0.0260  -0.0659 -0.0190 95  ARG A O     
748  C CB    . ARG A 115 ? 0.3426 0.2587 0.2492 0.0348  -0.0555 -0.0224 95  ARG A CB    
749  C CG    . ARG A 115 ? 0.4429 0.3817 0.3726 0.0259  -0.0538 -0.0155 95  ARG A CG    
750  C CD    . ARG A 115 ? 0.3216 0.2522 0.2532 0.0188  -0.0544 -0.0112 95  ARG A CD    
751  N NE    . ARG A 115 ? 0.3099 0.2257 0.2374 0.0067  -0.0635 -0.0110 95  ARG A NE    
752  C CZ    . ARG A 115 ? 0.4628 0.3688 0.3897 -0.0034 -0.0659 -0.0057 95  ARG A CZ    
753  N NH1   . ARG A 115 ? 0.3490 0.2566 0.2759 -0.0028 -0.0607 -0.0002 95  ARG A NH1   
754  N NH2   . ARG A 115 ? 0.3776 0.2706 0.3024 -0.0162 -0.0753 -0.0048 95  ARG A NH2   
755  N N     . GLU A 116 ? 0.4118 0.3134 0.2911 0.0222  -0.0770 -0.0290 96  GLU A N     
756  C CA    . GLU A 116 ? 0.4536 0.3578 0.3351 0.0105  -0.0924 -0.0268 96  GLU A CA    
757  C C     . GLU A 116 ? 0.4530 0.3635 0.3246 0.0138  -0.0950 -0.0254 96  GLU A C     
758  O O     . GLU A 116 ? 0.4234 0.3517 0.3152 0.0075  -0.1048 -0.0187 96  GLU A O     
759  C CB    . GLU A 116 ? 0.4730 0.3451 0.3297 0.0008  -0.1067 -0.0326 96  GLU A CB    
760  C CG    . GLU A 116 ? 0.5558 0.4300 0.4152 -0.0137 -0.1272 -0.0289 96  GLU A CG    
761  C CD    . GLU A 116 ? 0.6955 0.5361 0.5316 -0.0269 -0.1440 -0.0340 96  GLU A CD    
762  O OE1   . GLU A 116 ? 0.6102 0.4366 0.4264 -0.0365 -0.1624 -0.0351 96  GLU A OE1   
763  O OE2   . GLU A 116 ? 0.8506 0.6763 0.6868 -0.0291 -0.1410 -0.0360 96  GLU A OE2   
764  N N     . GLU A 117 ? 0.5062 0.4026 0.3484 0.0235  -0.0862 -0.0306 97  GLU A N     
765  C CA    . GLU A 117 ? 0.4670 0.3677 0.2953 0.0253  -0.0873 -0.0274 97  GLU A CA    
766  C C     . GLU A 117 ? 0.4809 0.4128 0.3436 0.0285  -0.0818 -0.0180 97  GLU A C     
767  O O     . GLU A 117 ? 0.4178 0.3584 0.2863 0.0249  -0.0913 -0.0112 97  GLU A O     
768  C CB    . GLU A 117 ? 0.4841 0.3670 0.2757 0.0353  -0.0732 -0.0343 97  GLU A CB    
769  C CG    . GLU A 117 ? 0.4627 0.3440 0.2292 0.0334  -0.0756 -0.0300 97  GLU A CG    
770  C CD    . GLU A 117 ? 0.6397 0.5080 0.3708 0.0427  -0.0567 -0.0359 97  GLU A CD    
771  O OE1   . GLU A 117 ? 0.5867 0.4453 0.3123 0.0527  -0.0420 -0.0449 97  GLU A OE1   
772  O OE2   . GLU A 117 ? 0.5922 0.4602 0.3015 0.0401  -0.0560 -0.0307 97  GLU A OE2   
773  N N     . PHE A 118 ? 0.4576 0.4029 0.3411 0.0348  -0.0684 -0.0175 98  PHE A N     
774  C CA    . PHE A 118 ? 0.4245 0.3933 0.3356 0.0376  -0.0623 -0.0108 98  PHE A CA    
775  C C     . PHE A 118 ? 0.4205 0.4039 0.3599 0.0311  -0.0722 -0.0063 98  PHE A C     
776  O O     . PHE A 118 ? 0.3745 0.3672 0.3248 0.0317  -0.0773 -0.0005 98  PHE A O     
777  C CB    . PHE A 118 ? 0.2650 0.2409 0.1884 0.0430  -0.0494 -0.0117 98  PHE A CB    
778  C CG    . PHE A 118 ? 0.2814 0.2761 0.2299 0.0432  -0.0449 -0.0069 98  PHE A CG    
779  C CD1   . PHE A 118 ? 0.2944 0.2977 0.2628 0.0387  -0.0451 -0.0070 98  PHE A CD1   
780  C CD2   . PHE A 118 ? 0.3119 0.3134 0.2616 0.0471  -0.0398 -0.0028 98  PHE A CD2   
781  C CE1   . PHE A 118 ? 0.3735 0.3886 0.3589 0.0395  -0.0396 -0.0051 98  PHE A CE1   
782  C CE2   . PHE A 118 ? 0.4242 0.4365 0.3927 0.0467  -0.0371 0.0001  98  PHE A CE2   
783  C CZ    . PHE A 118 ? 0.3936 0.4110 0.3781 0.0436  -0.0367 -0.0022 98  PHE A CZ    
784  N N     . ASN A 119 ? 0.4015 0.3866 0.3539 0.0250  -0.0751 -0.0080 99  ASN A N     
785  C CA    . ASN A 119 ? 0.4022 0.4061 0.3880 0.0193  -0.0806 -0.0038 99  ASN A CA    
786  C C     . ASN A 119 ? 0.4561 0.4630 0.4487 0.0145  -0.0985 0.0014  99  ASN A C     
787  O O     . ASN A 119 ? 0.5275 0.5548 0.5550 0.0140  -0.1021 0.0067  99  ASN A O     
788  C CB    . ASN A 119 ? 0.4114 0.4157 0.4066 0.0110  -0.0793 -0.0053 99  ASN A CB    
789  C CG    . ASN A 119 ? 0.4399 0.4497 0.4408 0.0138  -0.0633 -0.0066 99  ASN A CG    
790  O OD1   . ASN A 119 ? 0.3080 0.3300 0.3206 0.0196  -0.0540 -0.0060 99  ASN A OD1   
791  N ND2   . ASN A 119 ? 0.3090 0.3062 0.2987 0.0087  -0.0619 -0.0081 99  ASN A ND2   
792  N N     . LYS A 120 ? 0.4349 0.4207 0.3941 0.0112  -0.1101 0.0000  100 LYS A N     
793  C CA    . LYS A 120 ? 0.3779 0.3627 0.3373 0.0043  -0.1315 0.0062  100 LYS A CA    
794  C C     . LYS A 120 ? 0.4199 0.4013 0.3649 0.0094  -0.1353 0.0120  100 LYS A C     
795  O O     . LYS A 120 ? 0.4747 0.4592 0.4275 0.0049  -0.1543 0.0203  100 LYS A O     
796  C CB    . LYS A 120 ? 0.4370 0.3950 0.3615 -0.0063 -0.1461 0.0015  100 LYS A CB    
797  C CG    . LYS A 120 ? 0.4152 0.3778 0.3616 -0.0176 -0.1541 0.0014  100 LYS A CG    
798  C CD    . LYS A 120 ? 0.5630 0.4907 0.4679 -0.0282 -0.1683 -0.0052 100 LYS A CD    
799  C CE    . LYS A 120 ? 0.6524 0.5867 0.5835 -0.0445 -0.1845 -0.0009 100 LYS A CE    
800  N NZ    . LYS A 120 ? 0.7205 0.6215 0.6209 -0.0523 -0.1869 -0.0097 100 LYS A NZ    
801  N N     . SER A 121 ? 0.4600 0.4354 0.3853 0.0177  -0.1190 0.0092  101 SER A N     
802  C CA    . SER A 121 ? 0.4446 0.4146 0.3516 0.0205  -0.1207 0.0158  101 SER A CA    
803  C C     . SER A 121 ? 0.4986 0.4869 0.4427 0.0246  -0.1242 0.0252  101 SER A C     
804  O O     . SER A 121 ? 0.4725 0.4779 0.4524 0.0294  -0.1151 0.0235  101 SER A O     
805  C CB    . SER A 121 ? 0.4783 0.4409 0.3599 0.0271  -0.1005 0.0113  101 SER A CB    
806  O OG    . SER A 121 ? 0.4503 0.4116 0.3201 0.0283  -0.0996 0.0197  101 SER A OG    
807  N N     . GLN A 122 ? 0.5571 0.5382 0.4889 0.0229  -0.1369 0.0349  102 GLN A N     
808  C CA    . GLN A 122 ? 0.6393 0.6312 0.6024 0.0285  -0.1402 0.0442  102 GLN A CA    
809  C C     . GLN A 122 ? 0.5925 0.5722 0.5293 0.0294  -0.1358 0.0513  102 GLN A C     
810  O O     . GLN A 122 ? 0.5866 0.5651 0.5361 0.0307  -0.1468 0.0623  102 GLN A O     
811  C CB    . GLN A 122 ? 0.7701 0.7683 0.7591 0.0255  -0.1651 0.0540  102 GLN A CB    
812  C CG    . GLN A 122 ? 0.9310 0.9530 0.9711 0.0282  -0.1642 0.0505  102 GLN A CG    
813  C CD    . GLN A 122 ? 1.0812 1.1118 1.1446 0.0217  -0.1904 0.0594  102 GLN A CD    
814  O OE1   . GLN A 122 ? 1.1610 1.1762 1.1975 0.0143  -0.2123 0.0681  102 GLN A OE1   
815  N NE2   . GLN A 122 ? 1.0920 1.1481 1.2055 0.0232  -0.1887 0.0580  102 GLN A NE2   
816  N N     . ASP A 123 ? 0.5545 0.5260 0.4579 0.0287  -0.1194 0.0458  103 ASP A N     
817  C CA    . ASP A 123 ? 0.4805 0.4447 0.3611 0.0279  -0.1110 0.0530  103 ASP A CA    
818  C C     . ASP A 123 ? 0.5150 0.4904 0.4120 0.0333  -0.0903 0.0485  103 ASP A C     
819  O O     . ASP A 123 ? 0.5866 0.5659 0.4782 0.0358  -0.0765 0.0388  103 ASP A O     
820  C CB    . ASP A 123 ? 0.5447 0.4916 0.3719 0.0220  -0.1078 0.0519  103 ASP A CB    
821  C CG    . ASP A 123 ? 0.6550 0.5996 0.4604 0.0208  -0.0923 0.0585  103 ASP A CG    
822  O OD1   . ASP A 123 ? 0.7337 0.6808 0.5535 0.0194  -0.0960 0.0702  103 ASP A OD1   
823  O OD2   . ASP A 123 ? 0.7188 0.6590 0.4942 0.0211  -0.0756 0.0522  103 ASP A OD2   
824  N N     . PRO A 124 ? 0.3931 0.3712 0.3096 0.0347  -0.0901 0.0559  104 PRO A N     
825  C CA    . PRO A 124 ? 0.4087 0.3955 0.3415 0.0375  -0.0748 0.0525  104 PRO A CA    
826  C C     . PRO A 124 ? 0.4564 0.4471 0.3687 0.0357  -0.0580 0.0512  104 PRO A C     
827  O O     . PRO A 124 ? 0.3404 0.3410 0.2658 0.0387  -0.0470 0.0444  104 PRO A O     
828  C CB    . PRO A 124 ? 0.4581 0.4384 0.4036 0.0363  -0.0817 0.0632  104 PRO A CB    
829  C CG    . PRO A 124 ? 0.4668 0.4409 0.4223 0.0380  -0.1006 0.0683  104 PRO A CG    
830  C CD    . PRO A 124 ? 0.4026 0.3739 0.3313 0.0340  -0.1075 0.0676  104 PRO A CD    
831  N N     . PHE A 125 ? 0.3303 0.3139 0.2115 0.0309  -0.0557 0.0583  105 PHE A N     
832  C CA    . PHE A 125 ? 0.3366 0.3274 0.2028 0.0309  -0.0365 0.0573  105 PHE A CA    
833  C C     . PHE A 125 ? 0.4433 0.4357 0.3026 0.0375  -0.0278 0.0434  105 PHE A C     
834  O O     . PHE A 125 ? 0.4177 0.4225 0.2919 0.0422  -0.0146 0.0390  105 PHE A O     
835  C CB    . PHE A 125 ? 0.3758 0.3576 0.2058 0.0237  -0.0329 0.0678  105 PHE A CB    
836  C CG    . PHE A 125 ? 0.5719 0.5652 0.3907 0.0246  -0.0091 0.0675  105 PHE A CG    
837  C CD1   . PHE A 125 ? 0.4378 0.4470 0.2765 0.0205  0.0012  0.0775  105 PHE A CD1   
838  C CD2   . PHE A 125 ? 0.5335 0.5218 0.3246 0.0297  0.0031  0.0569  105 PHE A CD2   
839  C CE1   . PHE A 125 ? 0.5111 0.5369 0.3482 0.0218  0.0240  0.0785  105 PHE A CE1   
840  C CE2   . PHE A 125 ? 0.5697 0.5708 0.3562 0.0334  0.0277  0.0559  105 PHE A CE2   
841  C CZ    . PHE A 125 ? 0.5701 0.5931 0.3826 0.0296  0.0387  0.0674  105 PHE A CZ    
842  N N     . ARG A 126 ? 0.4957 0.4741 0.3343 0.0373  -0.0373 0.0372  106 ARG A N     
843  C CA    . ARG A 126 ? 0.4768 0.4508 0.3075 0.0428  -0.0312 0.0239  106 ARG A CA    
844  C C     . ARG A 126 ? 0.4362 0.4215 0.3024 0.0472  -0.0313 0.0179  106 ARG A C     
845  O O     . ARG A 126 ? 0.4592 0.4472 0.3285 0.0530  -0.0205 0.0111  106 ARG A O     
846  C CB    . ARG A 126 ? 0.4478 0.4010 0.2482 0.0386  -0.0454 0.0191  106 ARG A CB    
847  C CG    . ARG A 126 ? 0.4171 0.3571 0.2001 0.0429  -0.0399 0.0049  106 ARG A CG    
848  C CD    . ARG A 126 ? 0.5253 0.4607 0.2840 0.0502  -0.0169 -0.0012 106 ARG A CD    
849  N NE    . ARG A 126 ? 0.5941 0.5101 0.3346 0.0556  -0.0136 -0.0157 106 ARG A NE    
850  C CZ    . ARG A 126 ? 0.6529 0.5652 0.3843 0.0663  0.0067  -0.0241 106 ARG A CZ    
851  N NH1   . ARG A 126 ? 0.4883 0.4199 0.2304 0.0723  0.0268  -0.0188 106 ARG A NH1   
852  N NH2   . ARG A 126 ? 0.6934 0.5823 0.4078 0.0712  0.0067  -0.0375 106 ARG A NH2   
853  N N     . ARG A 127 ? 0.3774 0.3683 0.2693 0.0449  -0.0427 0.0208  107 ARG A N     
854  C CA    . ARG A 127 ? 0.3607 0.3606 0.2803 0.0474  -0.0410 0.0154  107 ARG A CA    
855  C C     . ARG A 127 ? 0.4546 0.4654 0.3873 0.0499  -0.0290 0.0168  107 ARG A C     
856  O O     . ARG A 127 ? 0.3571 0.3715 0.2995 0.0524  -0.0248 0.0118  107 ARG A O     
857  C CB    . ARG A 127 ? 0.3605 0.3649 0.3049 0.0456  -0.0514 0.0175  107 ARG A CB    
858  C CG    . ARG A 127 ? 0.3432 0.3439 0.2892 0.0428  -0.0648 0.0160  107 ARG A CG    
859  C CD    . ARG A 127 ? 0.4526 0.4626 0.4313 0.0435  -0.0726 0.0189  107 ARG A CD    
860  N NE    . ARG A 127 ? 0.4153 0.4349 0.4168 0.0457  -0.0628 0.0130  107 ARG A NE    
861  C CZ    . ARG A 127 ? 0.4421 0.4688 0.4582 0.0438  -0.0622 0.0082  107 ARG A CZ    
862  N NH1   . ARG A 127 ? 0.3858 0.4117 0.4001 0.0392  -0.0729 0.0087  107 ARG A NH1   
863  N NH2   . ARG A 127 ? 0.4114 0.4446 0.4414 0.0448  -0.0514 0.0035  107 ARG A NH2   
864  N N     . ALA A 128 ? 0.3699 0.3854 0.3031 0.0478  -0.0255 0.0252  108 ALA A N     
865  C CA    . ALA A 128 ? 0.3905 0.4181 0.3393 0.0477  -0.0171 0.0287  108 ALA A CA    
866  C C     . ALA A 128 ? 0.4172 0.4522 0.3623 0.0532  -0.0046 0.0265  108 ALA A C     
867  O O     . ALA A 128 ? 0.3245 0.3692 0.2876 0.0552  -0.0014 0.0262  108 ALA A O     
868  C CB    . ALA A 128 ? 0.3166 0.3465 0.2680 0.0417  -0.0176 0.0398  108 ALA A CB    
869  N N     . VAL A 129 ? 0.3351 0.3639 0.2562 0.0559  0.0021  0.0250  109 VAL A N     
870  C CA    . VAL A 129 ? 0.3645 0.3973 0.2808 0.0642  0.0167  0.0206  109 VAL A CA    
871  C C     . VAL A 129 ? 0.4375 0.4635 0.3603 0.0705  0.0136  0.0111  109 VAL A C     
872  O O     . VAL A 129 ? 0.3430 0.3788 0.2840 0.0770  0.0202  0.0109  109 VAL A O     
873  C CB    . VAL A 129 ? 0.4838 0.5035 0.3630 0.0658  0.0251  0.0176  109 VAL A CB    
874  C CG1   . VAL A 129 ? 0.4507 0.4690 0.3233 0.0775  0.0416  0.0089  109 VAL A CG1   
875  C CG2   . VAL A 129 ? 0.4685 0.4959 0.3394 0.0588  0.0312  0.0294  109 VAL A CG2   
876  N N     . LEU A 130 ? 0.3407 0.3506 0.2511 0.0676  0.0020  0.0049  110 LEU A N     
877  C CA    . LEU A 130 ? 0.3312 0.3312 0.2441 0.0708  -0.0020 -0.0028 110 LEU A CA    
878  C C     . LEU A 130 ? 0.3998 0.4101 0.3393 0.0686  -0.0066 0.0003  110 LEU A C     
879  O O     . LEU A 130 ? 0.3458 0.3516 0.2906 0.0722  -0.0069 -0.0026 110 LEU A O     
880  C CB    . LEU A 130 ? 0.3467 0.3291 0.2416 0.0654  -0.0139 -0.0083 110 LEU A CB    
881  C CG    . LEU A 130 ? 0.4672 0.4314 0.3264 0.0661  -0.0127 -0.0132 110 LEU A CG    
882  C CD1   . LEU A 130 ? 0.5542 0.5054 0.4010 0.0569  -0.0300 -0.0146 110 LEU A CD1   
883  C CD2   . LEU A 130 ? 0.5436 0.4924 0.3878 0.0754  -0.0029 -0.0228 110 LEU A CD2   
884  N N     . PHE A 131 ? 0.3657 0.3859 0.3180 0.0622  -0.0108 0.0059  111 PHE A N     
885  C CA    . PHE A 131 ? 0.3825 0.4085 0.3521 0.0585  -0.0146 0.0077  111 PHE A CA    
886  C C     . PHE A 131 ? 0.3628 0.3979 0.3455 0.0622  -0.0109 0.0117  111 PHE A C     
887  O O     . PHE A 131 ? 0.3263 0.3584 0.3141 0.0611  -0.0154 0.0114  111 PHE A O     
888  C CB    . PHE A 131 ? 0.3985 0.4292 0.3760 0.0523  -0.0180 0.0118  111 PHE A CB    
889  C CG    . PHE A 131 ? 0.4591 0.4886 0.4448 0.0473  -0.0217 0.0102  111 PHE A CG    
890  C CD1   . PHE A 131 ? 0.4873 0.5109 0.4717 0.0451  -0.0239 0.0046  111 PHE A CD1   
891  C CD2   . PHE A 131 ? 0.4783 0.5127 0.4718 0.0435  -0.0228 0.0147  111 PHE A CD2   
892  C CE1   . PHE A 131 ? 0.5115 0.5325 0.4980 0.0402  -0.0238 0.0022  111 PHE A CE1   
893  C CE2   . PHE A 131 ? 0.5196 0.5479 0.5118 0.0376  -0.0263 0.0120  111 PHE A CE2   
894  C CZ    . PHE A 131 ? 0.5100 0.5309 0.4966 0.0364  -0.0251 0.0052  111 PHE A CZ    
895  N N     . LEU A 132 ? 0.2871 0.3343 0.2765 0.0660  -0.0031 0.0169  112 LEU A N     
896  C CA    . LEU A 132 ? 0.2913 0.3528 0.3018 0.0704  0.0000  0.0228  112 LEU A CA    
897  C C     . LEU A 132 ? 0.3080 0.3617 0.3183 0.0814  0.0028  0.0179  112 LEU A C     
898  O O     . LEU A 132 ? 0.3047 0.3622 0.3315 0.0833  -0.0027 0.0219  112 LEU A O     
899  C CB    . LEU A 132 ? 0.2593 0.3399 0.2815 0.0715  0.0104  0.0305  112 LEU A CB    
900  C CG    . LEU A 132 ? 0.3277 0.4316 0.3815 0.0756  0.0147  0.0393  112 LEU A CG    
901  C CD1   . LEU A 132 ? 0.3271 0.4378 0.3996 0.0658  -0.0001 0.0469  112 LEU A CD1   
902  C CD2   . LEU A 132 ? 0.3334 0.4577 0.3973 0.0761  0.0293  0.0467  112 LEU A CD2   
903  N N     . TYR A 133 ? 0.3820 0.4215 0.3719 0.0880  0.0096  0.0095  113 TYR A N     
904  C CA    . TYR A 133 ? 0.3910 0.4147 0.3759 0.0982  0.0111  0.0029  113 TYR A CA    
905  C C     . TYR A 133 ? 0.3507 0.3614 0.3360 0.0924  -0.0029 0.0028  113 TYR A C     
906  O O     . TYR A 133 ? 0.3046 0.3120 0.3023 0.0983  -0.0064 0.0055  113 TYR A O     
907  C CB    . TYR A 133 ? 0.3542 0.3570 0.3076 0.1022  0.0172  -0.0079 113 TYR A CB    
908  C CG    . TYR A 133 ? 0.3938 0.3707 0.3350 0.1104  0.0159  -0.0170 113 TYR A CG    
909  C CD1   . TYR A 133 ? 0.3968 0.3703 0.3443 0.1265  0.0281  -0.0208 113 TYR A CD1   
910  C CD2   . TYR A 133 ? 0.4436 0.3987 0.3691 0.1020  0.0028  -0.0214 113 TYR A CD2   
911  C CE1   . TYR A 133 ? 0.3568 0.3007 0.2920 0.1349  0.0260  -0.0298 113 TYR A CE1   
912  C CE2   . TYR A 133 ? 0.4411 0.3684 0.3542 0.1075  -0.0002 -0.0289 113 TYR A CE2   
913  C CZ    . TYR A 133 ? 0.4998 0.4188 0.4159 0.1242  0.0107  -0.0335 113 TYR A CZ    
914  O OH    . TYR A 133 ? 0.5302 0.4163 0.4329 0.1301  0.0065  -0.0415 113 TYR A OH    
915  N N     . LEU A 134 ? 0.3440 0.3485 0.3174 0.0809  -0.0104 0.0011  114 LEU A N     
916  C CA    . LEU A 134 ? 0.3043 0.2975 0.2749 0.0734  -0.0203 0.0013  114 LEU A CA    
917  C C     . LEU A 134 ? 0.4343 0.4368 0.4196 0.0689  -0.0263 0.0097  114 LEU A C     
918  O O     . LEU A 134 ? 0.3410 0.3322 0.3240 0.0664  -0.0335 0.0122  114 LEU A O     
919  C CB    . LEU A 134 ? 0.2665 0.2566 0.2270 0.0630  -0.0238 -0.0021 114 LEU A CB    
920  C CG    . LEU A 134 ? 0.3546 0.3318 0.2984 0.0634  -0.0243 -0.0091 114 LEU A CG    
921  C CD1   . LEU A 134 ? 0.3432 0.3263 0.2877 0.0548  -0.0284 -0.0094 114 LEU A CD1   
922  C CD2   . LEU A 134 ? 0.3603 0.3153 0.2931 0.0632  -0.0294 -0.0134 114 LEU A CD2   
923  N N     . ASN A 135 ? 0.3021 0.3221 0.2994 0.0662  -0.0252 0.0149  115 ASN A N     
924  C CA    . ASN A 135 ? 0.3010 0.3278 0.3088 0.0601  -0.0335 0.0231  115 ASN A CA    
925  C C     . ASN A 135 ? 0.3311 0.3619 0.3568 0.0683  -0.0379 0.0303  115 ASN A C     
926  O O     . ASN A 135 ? 0.3077 0.3346 0.3350 0.0625  -0.0496 0.0371  115 ASN A O     
927  C CB    . ASN A 135 ? 0.2356 0.2777 0.2524 0.0544  -0.0327 0.0270  115 ASN A CB    
928  C CG    . ASN A 135 ? 0.3361 0.3822 0.3602 0.0454  -0.0442 0.0352  115 ASN A CG    
929  O OD1   . ASN A 135 ? 0.2936 0.3547 0.3399 0.0479  -0.0482 0.0442  115 ASN A OD1   
930  N ND2   . ASN A 135 ? 0.2769 0.3097 0.2821 0.0345  -0.0495 0.0321  115 ASN A ND2   
931  N N     . ARG A 136 ? 0.2672 0.3044 0.3053 0.0821  -0.0286 0.0289  116 ARG A N     
932  C CA    . ARG A 136 ? 0.3087 0.3540 0.3728 0.0938  -0.0303 0.0359  116 ARG A CA    
933  C C     . ARG A 136 ? 0.3285 0.3517 0.3876 0.1058  -0.0304 0.0312  116 ARG A C     
934  O O     . ARG A 136 ? 0.2879 0.3149 0.3711 0.1168  -0.0340 0.0377  116 ARG A O     
935  C CB    . ARG A 136 ? 0.3102 0.3813 0.3986 0.1032  -0.0165 0.0385  116 ARG A CB    
936  C CG    . ARG A 136 ? 0.3116 0.4060 0.4146 0.0914  -0.0196 0.0474  116 ARG A CG    
937  C CD    . ARG A 136 ? 0.5482 0.6668 0.6917 0.0944  -0.0268 0.0612  116 ARG A CD    
938  N NE    . ARG A 136 ? 0.5614 0.6962 0.7156 0.0788  -0.0360 0.0705  116 ARG A NE    
939  C CZ    . ARG A 136 ? 0.4551 0.6057 0.6373 0.0730  -0.0514 0.0839  116 ARG A CZ    
940  N NH1   . ARG A 136 ? 0.4996 0.6547 0.7059 0.0831  -0.0595 0.0908  116 ARG A NH1   
941  N NH2   . ARG A 136 ? 0.3728 0.5328 0.5591 0.0567  -0.0607 0.0909  116 ARG A NH2   
942  N N     . TYR A 137 ? 0.3191 0.3187 0.3496 0.1038  -0.0278 0.0207  117 TYR A N     
943  C CA    . TYR A 137 ? 0.3661 0.3380 0.3868 0.1124  -0.0298 0.0155  117 TYR A CA    
944  C C     . TYR A 137 ? 0.3606 0.3101 0.3605 0.0981  -0.0430 0.0169  117 TYR A C     
945  O O     . TYR A 137 ? 0.3871 0.3111 0.3796 0.1015  -0.0490 0.0160  117 TYR A O     
946  C CB    . TYR A 137 ? 0.3092 0.2672 0.3110 0.1211  -0.0165 0.0018  117 TYR A CB    
947  C CG    . TYR A 137 ? 0.4935 0.4639 0.5106 0.1393  0.0003  -0.0016 117 TYR A CG    
948  C CD1   . TYR A 137 ? 0.3027 0.3040 0.3338 0.1386  0.0109  0.0025  117 TYR A CD1   
949  C CD2   . TYR A 137 ? 0.4989 0.4485 0.5152 0.1569  0.0073  -0.0093 117 TYR A CD2   
950  C CE1   . TYR A 137 ? 0.3175 0.3332 0.3630 0.1540  0.0297  0.0003  117 TYR A CE1   
951  C CE2   . TYR A 137 ? 0.4484 0.4105 0.4787 0.1749  0.0272  -0.0137 117 TYR A CE2   
952  C CZ    . TYR A 137 ? 0.4239 0.4213 0.4694 0.1728  0.0392  -0.0083 117 TYR A CZ    
953  O OH    . TYR A 137 ? 0.5114 0.5249 0.5718 0.1892  0.0619  -0.0114 117 TYR A OH    
954  N N     . GLY A 138 ? 0.3351 0.2932 0.3257 0.0822  -0.0461 0.0189  118 GLY A N     
955  C CA    . GLY A 138 ? 0.3377 0.2800 0.3095 0.0674  -0.0539 0.0203  118 GLY A CA    
956  C C     . GLY A 138 ? 0.3776 0.3141 0.3489 0.0596  -0.0666 0.0320  118 GLY A C     
957  O O     . GLY A 138 ? 0.4030 0.3516 0.3907 0.0632  -0.0725 0.0404  118 GLY A O     
958  N N     . TYR A 139 ? 0.3771 0.2954 0.3289 0.0469  -0.0717 0.0339  119 TYR A N     
959  C CA    . TYR A 139 ? 0.4997 0.4047 0.4418 0.0372  -0.0846 0.0460  119 TYR A CA    
960  C C     . TYR A 139 ? 0.4334 0.3521 0.3722 0.0277  -0.0894 0.0529  119 TYR A C     
961  O O     . TYR A 139 ? 0.4547 0.3813 0.3805 0.0169  -0.0818 0.0479  119 TYR A O     
962  C CB    . TYR A 139 ? 0.5215 0.4074 0.4405 0.0221  -0.0847 0.0461  119 TYR A CB    
963  C CG    . TYR A 139 ? 0.6248 0.4908 0.5272 0.0105  -0.0978 0.0597  119 TYR A CG    
964  C CD1   . TYR A 139 ? 0.7231 0.5634 0.6268 0.0161  -0.1098 0.0670  119 TYR A CD1   
965  C CD2   . TYR A 139 ? 0.7419 0.6112 0.6240 -0.0061 -0.0983 0.0653  119 TYR A CD2   
966  C CE1   . TYR A 139 ? 0.8526 0.6720 0.7391 0.0043  -0.1241 0.0818  119 TYR A CE1   
967  C CE2   . TYR A 139 ? 0.7968 0.6453 0.6571 -0.0189 -0.1109 0.0791  119 TYR A CE2   
968  C CZ    . TYR A 139 ? 0.8479 0.6720 0.7111 -0.0141 -0.1248 0.0885  119 TYR A CZ    
969  O OH    . TYR A 139 ? 0.8947 0.6958 0.7344 -0.0279 -0.1394 0.1045  119 TYR A OH    
970  N N     . ASN A 140 ? 0.4896 0.4091 0.4404 0.0316  -0.1030 0.0643  120 ASN A N     
971  C CA    . ASN A 140 ? 0.5322 0.4604 0.4780 0.0211  -0.1129 0.0723  120 ASN A CA    
972  C C     . ASN A 140 ? 0.4999 0.4502 0.4515 0.0194  -0.1032 0.0645  120 ASN A C     
973  O O     . ASN A 140 ? 0.5103 0.4613 0.4474 0.0069  -0.1092 0.0674  120 ASN A O     
974  C CB    . ASN A 140 ? 0.4840 0.3920 0.3914 0.0008  -0.1190 0.0776  120 ASN A CB    
975  C CG    . ASN A 140 ? 0.6300 0.5152 0.5298 -0.0022 -0.1377 0.0929  120 ASN A CG    
976  O OD1   . ASN A 140 ? 0.6939 0.5791 0.6214 0.0125  -0.1480 0.1000  120 ASN A OD1   
977  N ND2   . ASN A 140 ? 0.5431 0.4080 0.4051 -0.0210 -0.1412 0.0984  120 ASN A ND2   
978  N N     . GLY A 141 ? 0.4542 0.4183 0.4229 0.0310  -0.0893 0.0549  121 GLY A N     
979  C CA    . GLY A 141 ? 0.3705 0.3522 0.3444 0.0295  -0.0807 0.0487  121 GLY A CA    
980  C C     . GLY A 141 ? 0.5260 0.5020 0.4750 0.0169  -0.0731 0.0405  121 GLY A C     
981  O O     . GLY A 141 ? 0.4666 0.4498 0.4143 0.0118  -0.0719 0.0382  121 GLY A O     
982  N N     . LEU A 142 ? 0.4562 0.4194 0.3879 0.0121  -0.0674 0.0361  122 LEU A N     
983  C CA    . LEU A 142 ? 0.5113 0.4718 0.4244 0.0017  -0.0574 0.0284  122 LEU A CA    
984  C C     . LEU A 142 ? 0.4975 0.4705 0.4227 0.0076  -0.0451 0.0184  122 LEU A C     
985  O O     . LEU A 142 ? 0.3787 0.3597 0.3209 0.0183  -0.0436 0.0169  122 LEU A O     
986  C CB    . LEU A 142 ? 0.4091 0.3558 0.3045 -0.0070 -0.0547 0.0295  122 LEU A CB    
987  C CG    . LEU A 142 ? 0.6565 0.5854 0.5311 -0.0169 -0.0669 0.0407  122 LEU A CG    
988  C CD1   . LEU A 142 ? 0.6789 0.5956 0.5346 -0.0285 -0.0605 0.0417  122 LEU A CD1   
989  C CD2   . LEU A 142 ? 0.7219 0.6472 0.5777 -0.0264 -0.0733 0.0434  122 LEU A CD2   
990  N N     . CYS A 143 ? 0.5154 0.4880 0.4300 0.0008  -0.0363 0.0119  123 CYS A N     
991  C CA    . CYS A 143 ? 0.5622 0.5448 0.4889 0.0054  -0.0255 0.0034  123 CYS A CA    
992  C C     . CYS A 143 ? 0.5133 0.4940 0.4313 -0.0022 -0.0144 -0.0013 123 CYS A C     
993  O O     . CYS A 143 ? 0.4684 0.4410 0.3667 -0.0105 -0.0095 -0.0034 123 CYS A O     
994  C CB    . CYS A 143 ? 0.6471 0.6331 0.5773 0.0073  -0.0248 0.0000  123 CYS A CB    
995  S SG    . CYS A 143 ? 0.6822 0.6786 0.6319 0.0157  -0.0167 -0.0071 123 CYS A SG    
996  N N     . ARG A 144 ? 0.4111 0.3991 0.3429 -0.0005 -0.0104 -0.0026 124 ARG A N     
997  C CA    . ARG A 144 ? 0.3576 0.3497 0.2894 -0.0085 0.0011  -0.0049 124 ARG A CA    
998  C C     . ARG A 144 ? 0.3505 0.3580 0.3097 -0.0039 0.0036  -0.0074 124 ARG A C     
999  O O     . ARG A 144 ? 0.2862 0.2930 0.2533 0.0013  -0.0063 -0.0055 124 ARG A O     
1000 C CB    . ARG A 144 ? 0.3778 0.3577 0.2919 -0.0196 -0.0023 0.0027  124 ARG A CB    
1001 C CG    . ARG A 144 ? 0.4803 0.4664 0.3961 -0.0305 0.0098  0.0033  124 ARG A CG    
1002 C CD    . ARG A 144 ? 0.5209 0.4908 0.4160 -0.0435 0.0044  0.0133  124 ARG A CD    
1003 N NE    . ARG A 144 ? 0.4079 0.3715 0.3140 -0.0424 -0.0079 0.0182  124 ARG A NE    
1004 C CZ    . ARG A 144 ? 0.4783 0.4238 0.3701 -0.0521 -0.0159 0.0274  124 ARG A CZ    
1005 N NH1   . ARG A 144 ? 0.4132 0.3468 0.2785 -0.0647 -0.0134 0.0347  124 ARG A NH1   
1006 N NH2   . ARG A 144 ? 0.4058 0.3412 0.3064 -0.0500 -0.0271 0.0295  124 ARG A NH2   
1007 N N     . TYR A 145 ? 0.3398 0.3606 0.3133 -0.0054 0.0165  -0.0118 125 TYR A N     
1008 C CA    . TYR A 145 ? 0.3624 0.4012 0.3678 -0.0020 0.0168  -0.0124 125 TYR A CA    
1009 C C     . TYR A 145 ? 0.4004 0.4541 0.4211 -0.0114 0.0289  -0.0110 125 TYR A C     
1010 O O     . TYR A 145 ? 0.3919 0.4428 0.3970 -0.0188 0.0424  -0.0119 125 TYR A O     
1011 C CB    . TYR A 145 ? 0.3476 0.3953 0.3715 0.0094  0.0198  -0.0179 125 TYR A CB    
1012 C CG    . TYR A 145 ? 0.3968 0.4341 0.4112 0.0176  0.0099  -0.0183 125 TYR A CG    
1013 C CD1   . TYR A 145 ? 0.3703 0.3947 0.3637 0.0175  0.0120  -0.0207 125 TYR A CD1   
1014 C CD2   . TYR A 145 ? 0.4603 0.5008 0.4860 0.0237  -0.0015 -0.0155 125 TYR A CD2   
1015 C CE1   . TYR A 145 ? 0.4467 0.4648 0.4360 0.0230  0.0034  -0.0192 125 TYR A CE1   
1016 C CE2   . TYR A 145 ? 0.3800 0.4130 0.3974 0.0297  -0.0079 -0.0144 125 TYR A CE2   
1017 C CZ    . TYR A 145 ? 0.4654 0.4891 0.4675 0.0292  -0.0050 -0.0159 125 TYR A CZ    
1018 O OH    . TYR A 145 ? 0.5387 0.5581 0.5368 0.0330  -0.0110 -0.0132 125 TYR A OH    
1019 N N     . ASN A 146 ? 0.2887 0.3590 0.3397 -0.0124 0.0241  -0.0080 126 ASN A N     
1020 C CA    . ASN A 146 ? 0.3227 0.4154 0.4003 -0.0206 0.0371  -0.0057 126 ASN A CA    
1021 C C     . ASN A 146 ? 0.3805 0.4967 0.4948 -0.0097 0.0480  -0.0107 126 ASN A C     
1022 O O     . ASN A 146 ? 0.2751 0.3862 0.3910 0.0032  0.0430  -0.0153 126 ASN A O     
1023 C CB    . ASN A 146 ? 0.2718 0.3700 0.3648 -0.0318 0.0237  0.0025  126 ASN A CB    
1024 C CG    . ASN A 146 ? 0.3205 0.4242 0.4349 -0.0250 0.0049  0.0034  126 ASN A CG    
1025 O OD1   . ASN A 146 ? 0.3563 0.4689 0.4869 -0.0126 0.0044  -0.0001 126 ASN A OD1   
1026 N ND2   . ASN A 146 ? 0.3338 0.4285 0.4451 -0.0346 -0.0117 0.0085  126 ASN A ND2   
1027 N N     . LEU A 147 ? 0.3476 0.4899 0.4943 -0.0145 0.0627  -0.0089 127 LEU A N     
1028 C CA    . LEU A 147 ? 0.4718 0.6380 0.6588 -0.0019 0.0765  -0.0139 127 LEU A CA    
1029 C C     . LEU A 147 ? 0.5324 0.7113 0.7567 0.0079  0.0570  -0.0101 127 LEU A C     
1030 O O     . LEU A 147 ? 0.5372 0.7332 0.7980 0.0208  0.0639  -0.0130 127 LEU A O     
1031 C CB    . LEU A 147 ? 0.4123 0.6082 0.6303 -0.0096 0.0996  -0.0118 127 LEU A CB    
1032 C CG    . LEU A 147 ? 0.4212 0.6075 0.6054 -0.0150 0.1272  -0.0185 127 LEU A CG    
1033 C CD1   . LEU A 147 ? 0.3584 0.5770 0.5737 -0.0251 0.1514  -0.0142 127 LEU A CD1   
1034 C CD2   . LEU A 147 ? 0.4773 0.6500 0.6482 0.0016  0.1404  -0.0325 127 LEU A CD2   
1035 N N     . ARG A 148 ? 0.5621 0.7302 0.7755 0.0018  0.0326  -0.0036 128 ARG A N     
1036 C CA    . ARG A 148 ? 0.4761 0.6499 0.7128 0.0084  0.0110  0.0009  128 ARG A CA    
1037 C C     . ARG A 148 ? 0.4842 0.6318 0.6888 0.0183  -0.0003 -0.0027 128 ARG A C     
1038 O O     . ARG A 148 ? 0.5259 0.6740 0.7424 0.0243  -0.0169 0.0011  128 ARG A O     
1039 C CB    . ARG A 148 ? 0.4273 0.6039 0.6697 -0.0059 -0.0092 0.0097  128 ARG A CB    
1040 C CG    . ARG A 148 ? 0.5822 0.7937 0.8746 -0.0153 -0.0045 0.0170  128 ARG A CG    
1041 C CD    . ARG A 148 ? 0.7888 0.9934 1.0687 -0.0357 -0.0148 0.0236  128 ARG A CD    
1042 N NE    . ARG A 148 ? 0.9815 1.1599 1.2341 -0.0393 -0.0428 0.0251  128 ARG A NE    
1043 C CZ    . ARG A 148 ? 1.0977 1.2561 1.3261 -0.0546 -0.0556 0.0279  128 ARG A CZ    
1044 N NH1   . ARG A 148 ? 1.1811 1.3432 1.4107 -0.0689 -0.0446 0.0318  128 ARG A NH1   
1045 N NH2   . ARG A 148 ? 1.1206 1.2522 1.3207 -0.0558 -0.0786 0.0268  128 ARG A NH2   
1046 N N     . GLY A 149 ? 0.4522 0.5775 0.6166 0.0186  0.0078  -0.0084 129 GLY A N     
1047 C CA    . GLY A 149 ? 0.4989 0.6029 0.6364 0.0263  -0.0010 -0.0105 129 GLY A CA    
1048 C C     . GLY A 149 ? 0.4628 0.5485 0.5698 0.0214  -0.0163 -0.0074 129 GLY A C     
1049 O O     . GLY A 149 ? 0.3796 0.4532 0.4714 0.0274  -0.0246 -0.0071 129 GLY A O     
1050 N N     . GLU A 150 ? 0.3121 0.3945 0.4101 0.0106  -0.0188 -0.0051 130 GLU A N     
1051 C CA    . GLU A 150 ? 0.3448 0.4061 0.4132 0.0075  -0.0309 -0.0042 130 GLU A CA    
1052 C C     . GLU A 150 ? 0.3735 0.4186 0.4136 0.0068  -0.0235 -0.0062 130 GLU A C     
1053 O O     . GLU A 150 ? 0.3940 0.4418 0.4328 0.0007  -0.0127 -0.0060 130 GLU A O     
1054 C CB    . GLU A 150 ? 0.4536 0.5148 0.5280 -0.0040 -0.0420 -0.0003 130 GLU A CB    
1055 C CG    . GLU A 150 ? 0.5642 0.6434 0.6702 -0.0054 -0.0534 0.0038  130 GLU A CG    
1056 C CD    . GLU A 150 ? 0.6895 0.7707 0.8056 -0.0203 -0.0657 0.0087  130 GLU A CD    
1057 O OE1   . GLU A 150 ? 0.7885 0.8700 0.9117 -0.0234 -0.0843 0.0119  130 GLU A OE1   
1058 O OE2   . GLU A 150 ? 0.5410 0.6220 0.6566 -0.0307 -0.0584 0.0103  130 GLU A OE2   
1059 N N     . PHE A 151 ? 0.3370 0.3664 0.3551 0.0127  -0.0292 -0.0071 131 PHE A N     
1060 C CA    . PHE A 151 ? 0.2895 0.3050 0.2859 0.0134  -0.0262 -0.0070 131 PHE A CA    
1061 C C     . PHE A 151 ? 0.3775 0.3788 0.3626 0.0056  -0.0312 -0.0047 131 PHE A C     
1062 O O     . PHE A 151 ? 0.3666 0.3592 0.3486 0.0046  -0.0405 -0.0053 131 PHE A O     
1063 C CB    . PHE A 151 ? 0.3372 0.3460 0.3229 0.0232  -0.0298 -0.0077 131 PHE A CB    
1064 C CG    . PHE A 151 ? 0.3865 0.3862 0.3587 0.0257  -0.0283 -0.0060 131 PHE A CG    
1065 C CD1   . PHE A 151 ? 0.3114 0.3155 0.2834 0.0262  -0.0238 -0.0051 131 PHE A CD1   
1066 C CD2   . PHE A 151 ? 0.3711 0.3566 0.3320 0.0281  -0.0330 -0.0052 131 PHE A CD2   
1067 C CE1   . PHE A 151 ? 0.3534 0.3514 0.3169 0.0274  -0.0260 -0.0015 131 PHE A CE1   
1068 C CE2   . PHE A 151 ? 0.3550 0.3350 0.3106 0.0320  -0.0333 -0.0020 131 PHE A CE2   
1069 C CZ    . PHE A 151 ? 0.4059 0.3940 0.3643 0.0310  -0.0309 0.0009  131 PHE A CZ    
1070 N N     . ASN A 152 ? 0.3247 0.3200 0.3004 -0.0011 -0.0266 -0.0017 132 ASN A N     
1071 C CA    . ASN A 152 ? 0.2754 0.2542 0.2409 -0.0100 -0.0328 0.0024  132 ASN A CA    
1072 C C     . ASN A 152 ? 0.3907 0.3505 0.3364 -0.0109 -0.0354 0.0071  132 ASN A C     
1073 O O     . ASN A 152 ? 0.3354 0.2836 0.2727 -0.0221 -0.0374 0.0128  132 ASN A O     
1074 C CB    . ASN A 152 ? 0.3029 0.2935 0.2817 -0.0243 -0.0276 0.0058  132 ASN A CB    
1075 C CG    . ASN A 152 ? 0.3407 0.3410 0.3167 -0.0302 -0.0128 0.0075  132 ASN A CG    
1076 O OD1   . ASN A 152 ? 0.3290 0.3243 0.2903 -0.0251 -0.0094 0.0061  132 ASN A OD1   
1077 N ND2   . ASN A 152 ? 0.3503 0.3645 0.3397 -0.0422 -0.0039 0.0107  132 ASN A ND2   
1078 N N     . VAL A 153 ? 0.3078 0.2648 0.2481 0.0000  -0.0367 0.0064  133 VAL A N     
1079 C CA    . VAL A 153 ? 0.3690 0.3094 0.2970 0.0023  -0.0431 0.0122  133 VAL A CA    
1080 C C     . VAL A 153 ? 0.4396 0.3590 0.3640 0.0094  -0.0518 0.0115  133 VAL A C     
1081 O O     . VAL A 153 ? 0.3380 0.2581 0.2662 0.0187  -0.0515 0.0048  133 VAL A O     
1082 C CB    . VAL A 153 ? 0.4025 0.3520 0.3333 0.0112  -0.0424 0.0127  133 VAL A CB    
1083 C CG1   . VAL A 153 ? 0.3714 0.3078 0.2972 0.0147  -0.0516 0.0204  133 VAL A CG1   
1084 C CG2   . VAL A 153 ? 0.2785 0.2410 0.2071 0.0043  -0.0346 0.0114  133 VAL A CG2   
1085 N N     . PRO A 154 ? 0.3472 0.2447 0.2616 0.0053  -0.0596 0.0182  134 PRO A N     
1086 C CA    . PRO A 154 ? 0.4088 0.2803 0.3187 0.0133  -0.0676 0.0163  134 PRO A CA    
1087 C C     . PRO A 154 ? 0.4701 0.3372 0.3866 0.0322  -0.0692 0.0157  134 PRO A C     
1088 O O     . PRO A 154 ? 0.4049 0.2914 0.3312 0.0372  -0.0661 0.0187  134 PRO A O     
1089 C CB    . PRO A 154 ? 0.4343 0.2832 0.3324 -0.0002 -0.0759 0.0258  134 PRO A CB    
1090 C CG    . PRO A 154 ? 0.4556 0.3173 0.3496 -0.0088 -0.0734 0.0347  134 PRO A CG    
1091 C CD    . PRO A 154 ? 0.3673 0.2593 0.2703 -0.0087 -0.0613 0.0280  134 PRO A CD    
1092 N N     . PHE A 155 ? 0.4475 0.2891 0.3599 0.0424  -0.0735 0.0116  135 PHE A N     
1093 C CA    . PHE A 155 ? 0.4389 0.2777 0.3622 0.0633  -0.0713 0.0093  135 PHE A CA    
1094 C C     . PHE A 155 ? 0.4642 0.3060 0.4007 0.0669  -0.0789 0.0222  135 PHE A C     
1095 O O     . PHE A 155 ? 0.4542 0.2811 0.3818 0.0552  -0.0894 0.0321  135 PHE A O     
1096 C CB    . PHE A 155 ? 0.5599 0.3636 0.4717 0.0730  -0.0735 0.0004  135 PHE A CB    
1097 C CG    . PHE A 155 ? 0.5637 0.3641 0.4878 0.0972  -0.0665 -0.0046 135 PHE A CG    
1098 C CD1   . PHE A 155 ? 0.5206 0.3472 0.4541 0.1080  -0.0525 -0.0105 135 PHE A CD1   
1099 C CD2   . PHE A 155 ? 0.5755 0.3454 0.5026 0.1094  -0.0730 -0.0033 135 PHE A CD2   
1100 C CE1   . PHE A 155 ? 0.5238 0.3511 0.4716 0.1303  -0.0424 -0.0149 135 PHE A CE1   
1101 C CE2   . PHE A 155 ? 0.5756 0.3445 0.5191 0.1342  -0.0637 -0.0087 135 PHE A CE2   
1102 C CZ    . PHE A 155 ? 0.5513 0.3510 0.5058 0.1445  -0.0470 -0.0147 135 PHE A CZ    
1103 N N     . GLY A 156 ? 0.4474 0.3089 0.4052 0.0817  -0.0746 0.0237  136 GLY A N     
1104 C CA    . GLY A 156 ? 0.4118 0.2817 0.3864 0.0836  -0.0848 0.0377  136 GLY A CA    
1105 C C     . GLY A 156 ? 0.5254 0.3804 0.5196 0.1014  -0.0925 0.0436  136 GLY A C     
1106 O O     . GLY A 156 ? 0.5268 0.3786 0.5292 0.0985  -0.1077 0.0582  136 GLY A O     
1107 N N     . ARG A 157 ? 0.5629 0.4079 0.5641 0.1203  -0.0823 0.0324  137 ARG A N     
1108 C CA    . ARG A 157 ? 0.7047 0.5335 0.7278 0.1417  -0.0862 0.0352  137 ARG A CA    
1109 C C     . ARG A 157 ? 0.6759 0.5340 0.7410 0.1537  -0.0911 0.0487  137 ARG A C     
1110 O O     . ARG A 157 ? 0.7288 0.5735 0.8095 0.1591  -0.1075 0.0616  137 ARG A O     
1111 C CB    . ARG A 157 ? 0.7201 0.5067 0.7263 0.1352  -0.1036 0.0419  137 ARG A CB    
1112 N N     . TYR A 158 ? 0.5337 0.4307 0.6190 0.1574  -0.0786 0.0472  138 TYR A N     
1113 C CA    . TYR A 158 ? 0.4956 0.4244 0.6277 0.1696  -0.0819 0.0598  138 TYR A CA    
1114 C C     . TYR A 158 ? 0.5635 0.4926 0.7275 0.1996  -0.0674 0.0532  138 TYR A C     
1115 O O     . TYR A 158 ? 0.5579 0.4628 0.7007 0.2097  -0.0520 0.0363  138 TYR A O     
1116 C CB    . TYR A 158 ? 0.4703 0.4401 0.6124 0.1592  -0.0748 0.0621  138 TYR A CB    
1117 C CG    . TYR A 158 ? 0.4816 0.4519 0.5977 0.1327  -0.0890 0.0691  138 TYR A CG    
1118 C CD1   . TYR A 158 ? 0.5437 0.5025 0.6212 0.1177  -0.0821 0.0583  138 TYR A CD1   
1119 C CD2   . TYR A 158 ? 0.5183 0.4995 0.6484 0.1229  -0.1095 0.0862  138 TYR A CD2   
1120 C CE1   . TYR A 158 ? 0.4724 0.4309 0.5271 0.0958  -0.0914 0.0629  138 TYR A CE1   
1121 C CE2   . TYR A 158 ? 0.4940 0.4709 0.5938 0.0990  -0.1202 0.0902  138 TYR A CE2   
1122 C CZ    . TYR A 158 ? 0.5254 0.4912 0.5882 0.0866  -0.1092 0.0778  138 TYR A CZ    
1123 O OH    . TYR A 158 ? 0.4757 0.4371 0.5097 0.0652  -0.1161 0.0801  138 TYR A OH    
1124 N N     . LYS A 159 ? 0.4964 0.4536 0.7053 0.2112  -0.0701 0.0657  139 LYS A N     
1125 C CA    . LYS A 159 ? 0.5251 0.4875 0.7585 0.2377  -0.0532 0.0579  139 LYS A CA    
1126 C C     . LYS A 159 ? 0.5603 0.5526 0.8091 0.2457  -0.0274 0.0434  139 LYS A C     
1127 O O     . LYS A 159 ? 0.4504 0.4273 0.6951 0.2601  -0.0079 0.0256  139 LYS A O     
1128 C CB    . LYS A 159 ? 0.5500 0.5339 0.8205 0.2424  -0.0672 0.0734  139 LYS A CB    
1129 N N     . LYS A 160 ? 0.3912 0.4244 0.6559 0.2325  -0.0253 0.0523  140 LYS A N     
1130 C CA    . LYS A 160 ? 0.4649 0.5287 0.7393 0.2353  0.0015  0.0441  140 LYS A CA    
1131 C C     . LYS A 160 ? 0.3845 0.4805 0.6608 0.2154  -0.0011 0.0552  140 LYS A C     
1132 O O     . LYS A 160 ? 0.4216 0.5516 0.7323 0.2080  -0.0097 0.0682  140 LYS A O     
1133 C CB    . LYS A 160 ? 0.4861 0.5784 0.8052 0.2517  0.0133  0.0430  140 LYS A CB    
1134 N N     . PRO A 161 ? 0.4017 0.4835 0.6347 0.2034  0.0043  0.0478  141 PRO A N     
1135 C CA    . PRO A 161 ? 0.2960 0.3994 0.5207 0.1809  -0.0004 0.0541  141 PRO A CA    
1136 C C     . PRO A 161 ? 0.4174 0.5634 0.6738 0.1836  0.0182  0.0590  141 PRO A C     
1137 O O     . PRO A 161 ? 0.3937 0.5469 0.6579 0.2007  0.0431  0.0509  141 PRO A O     
1138 C CB    . PRO A 161 ? 0.4545 0.5277 0.6226 0.1692  0.0035  0.0394  141 PRO A CB    
1139 C CG    . PRO A 161 ? 0.4638 0.4965 0.6097 0.1775  -0.0019 0.0306  141 PRO A CG    
1140 C CD    . PRO A 161 ? 0.3454 0.3826 0.5272 0.2032  0.0078  0.0309  141 PRO A CD    
1141 N N     . TYR A 162 ? 0.3713 0.5424 0.6420 0.1654  0.0064  0.0719  142 TYR A N     
1142 C CA    . TYR A 162 ? 0.3742 0.5873 0.6787 0.1625  0.0191  0.0810  142 TYR A CA    
1143 C C     . TYR A 162 ? 0.3714 0.5814 0.6391 0.1472  0.0298  0.0746  142 TYR A C     
1144 O O     . TYR A 162 ? 0.2816 0.4685 0.5120 0.1311  0.0162  0.0708  142 TYR A O     
1145 C CB    . TYR A 162 ? 0.3500 0.5859 0.6899 0.1479  -0.0052 0.0987  142 TYR A CB    
1146 C CG    . TYR A 162 ? 0.3564 0.6282 0.7216 0.1337  -0.0014 0.1096  142 TYR A CG    
1147 C CD1   . TYR A 162 ? 0.3172 0.6201 0.7190 0.1412  0.0177  0.1124  142 TYR A CD1   
1148 C CD2   . TYR A 162 ? 0.3264 0.5991 0.6788 0.1116  -0.0178 0.1174  142 TYR A CD2   
1149 C CE1   . TYR A 162 ? 0.3621 0.6968 0.7876 0.1261  0.0204  0.1244  142 TYR A CE1   
1150 C CE2   . TYR A 162 ? 0.3726 0.6738 0.7473 0.0968  -0.0165 0.1281  142 TYR A CE2   
1151 C CZ    . TYR A 162 ? 0.4088 0.7413 0.8206 0.1035  0.0024  0.1326  142 TYR A CZ    
1152 O OH    . TYR A 162 ? 0.3685 0.7284 0.8026 0.0870  0.0035  0.1449  142 TYR A OH    
1153 N N     . PHE A 163 ? 0.3115 0.5441 0.5895 0.1528  0.0548  0.0740  143 PHE A N     
1154 C CA    . PHE A 163 ? 0.2939 0.5242 0.5395 0.1380  0.0635  0.0713  143 PHE A CA    
1155 C C     . PHE A 163 ? 0.2749 0.5388 0.5522 0.1209  0.0571  0.0886  143 PHE A C     
1156 O O     . PHE A 163 ? 0.3041 0.6059 0.6263 0.1258  0.0700  0.0994  143 PHE A O     
1157 C CB    . PHE A 163 ? 0.3271 0.5552 0.5526 0.1506  0.0941  0.0606  143 PHE A CB    
1158 C CG    . PHE A 163 ? 0.2663 0.4903 0.4568 0.1352  0.1014  0.0601  143 PHE A CG    
1159 C CD1   . PHE A 163 ? 0.2629 0.4528 0.4058 0.1242  0.0883  0.0517  143 PHE A CD1   
1160 C CD2   . PHE A 163 ? 0.3192 0.5744 0.5272 0.1315  0.1210  0.0697  143 PHE A CD2   
1161 C CE1   . PHE A 163 ? 0.3521 0.5370 0.4658 0.1110  0.0922  0.0531  143 PHE A CE1   
1162 C CE2   . PHE A 163 ? 0.3286 0.5766 0.5024 0.1163  0.1256  0.0715  143 PHE A CE2   
1163 C CZ    . PHE A 163 ? 0.3450 0.5568 0.4719 0.1068  0.1100  0.0632  143 PHE A CZ    
1164 N N     . PRO A 164 ? 0.2127 0.4621 0.4678 0.1006  0.0374  0.0910  144 PRO A N     
1165 C CA    . PRO A 164 ? 0.2768 0.5482 0.5570 0.0815  0.0244  0.1065  144 PRO A CA    
1166 C C     . PRO A 164 ? 0.3358 0.6248 0.6170 0.0717  0.0402  0.1131  144 PRO A C     
1167 O O     . PRO A 164 ? 0.2512 0.5245 0.5075 0.0546  0.0304  0.1140  144 PRO A O     
1168 C CB    . PRO A 164 ? 0.2907 0.5291 0.5352 0.0664  0.0008  0.1016  144 PRO A CB    
1169 C CG    . PRO A 164 ? 0.1999 0.4057 0.3972 0.0736  0.0097  0.0847  144 PRO A CG    
1170 C CD    . PRO A 164 ? 0.3367 0.5457 0.5425 0.0951  0.0259  0.0783  144 PRO A CD    
1171 N N     . GLU A 165 ? 0.2523 0.5728 0.5625 0.0818  0.0646  0.1184  145 GLU A N     
1172 C CA    . GLU A 165 ? 0.3228 0.6569 0.6265 0.0720  0.0826  0.1248  145 GLU A CA    
1173 C C     . GLU A 165 ? 0.3477 0.7047 0.6821 0.0491  0.0683  0.1438  145 GLU A C     
1174 O O     . GLU A 165 ? 0.2807 0.6224 0.5881 0.0321  0.0637  0.1466  145 GLU A O     
1175 C CB    . GLU A 165 ? 0.4033 0.7651 0.7265 0.0890  0.1167  0.1247  145 GLU A CB    
1176 C CG    . GLU A 165 ? 0.4441 0.8193 0.7552 0.0773  0.1378  0.1326  145 GLU A CG    
1177 C CD    . GLU A 165 ? 0.5662 0.9516 0.8694 0.0947  0.1748  0.1251  145 GLU A CD    
1178 O OE1   . GLU A 165 ? 0.6694 1.0319 0.9506 0.1147  0.1824  0.1074  145 GLU A OE1   
1179 O OE2   . GLU A 165 ? 0.5970 1.0019 0.9065 0.0853  0.1924  0.1335  145 GLU A OE2   
1180 N N     . ALA A 166 ? 0.2106 0.6021 0.6019 0.0481  0.0594  0.1575  146 ALA A N     
1181 C CA    . ALA A 166 ? 0.3005 0.7131 0.7236 0.0242  0.0419  0.1762  146 ALA A CA    
1182 C C     . ALA A 166 ? 0.3167 0.6879 0.6987 0.0047  0.0131  0.1720  146 ALA A C     
1183 O O     . ALA A 166 ? 0.2870 0.6532 0.6605 -0.0154 0.0075  0.1799  146 ALA A O     
1184 C CB    . ALA A 166 ? 0.3112 0.7424 0.7786 0.0255  0.0286  0.1837  146 ALA A CB    
1185 N N     . GLU A 167 ? 0.2196 0.5596 0.5751 0.0112  -0.0032 0.1592  147 GLU A N     
1186 C CA    . GLU A 167 ? 0.2639 0.5645 0.5802 -0.0044 -0.0272 0.1528  147 GLU A CA    
1187 C C     . GLU A 167 ? 0.2796 0.5492 0.5484 -0.0088 -0.0189 0.1432  147 GLU A C     
1188 O O     . GLU A 167 ? 0.3031 0.5484 0.5511 -0.0249 -0.0344 0.1429  147 GLU A O     
1189 C CB    . GLU A 167 ? 0.3657 0.6417 0.6624 0.0048  -0.0414 0.1413  147 GLU A CB    
1190 C CG    . GLU A 167 ? 0.3906 0.6871 0.7273 0.0041  -0.0602 0.1528  147 GLU A CG    
1191 C CD    . GLU A 167 ? 0.4963 0.8256 0.8756 0.0264  -0.0439 0.1569  147 GLU A CD    
1192 O OE1   . GLU A 167 ? 0.4997 0.8356 0.8747 0.0411  -0.0160 0.1500  147 GLU A OE1   
1193 O OE2   . GLU A 167 ? 0.5039 0.8407 0.9085 0.0285  -0.0580 0.1631  147 GLU A OE2   
1194 N N     . LEU A 168 ? 0.2520 0.5202 0.5032 0.0057  0.0043  0.1353  148 LEU A N     
1195 C CA    . LEU A 168 ? 0.3110 0.5518 0.5199 0.0019  0.0101  0.1286  148 LEU A CA    
1196 C C     . LEU A 168 ? 0.3322 0.5834 0.5488 -0.0155 0.0134  0.1436  148 LEU A C     
1197 O O     . LEU A 168 ? 0.3254 0.5488 0.5161 -0.0272 0.0027  0.1428  148 LEU A O     
1198 C CB    . LEU A 168 ? 0.2653 0.4999 0.4498 0.0200  0.0312  0.1171  148 LEU A CB    
1199 C CG    . LEU A 168 ? 0.3276 0.5338 0.4831 0.0326  0.0259  0.0997  148 LEU A CG    
1200 C CD1   . LEU A 168 ? 0.3032 0.5071 0.4406 0.0492  0.0468  0.0903  148 LEU A CD1   
1201 C CD2   . LEU A 168 ? 0.3282 0.5001 0.4495 0.0241  0.0114  0.0922  148 LEU A CD2   
1202 N N     . TYR A 169 ? 0.3269 0.6176 0.5805 -0.0171 0.0288  0.1578  149 TYR A N     
1203 C CA    . TYR A 169 ? 0.3138 0.6165 0.5767 -0.0362 0.0327  0.1747  149 TYR A CA    
1204 C C     . TYR A 169 ? 0.3236 0.6176 0.6002 -0.0588 0.0051  0.1845  149 TYR A C     
1205 O O     . TYR A 169 ? 0.3293 0.6036 0.5883 -0.0753 -0.0017 0.1909  149 TYR A O     
1206 C CB    . TYR A 169 ? 0.3339 0.6865 0.6393 -0.0335 0.0578  0.1888  149 TYR A CB    
1207 C CG    . TYR A 169 ? 0.3705 0.7246 0.6490 -0.0193 0.0891  0.1824  149 TYR A CG    
1208 C CD1   . TYR A 169 ? 0.4407 0.8140 0.7324 0.0036  0.1102  0.1736  149 TYR A CD1   
1209 C CD2   . TYR A 169 ? 0.4491 0.7815 0.6856 -0.0289 0.0962  0.1850  149 TYR A CD2   
1210 C CE1   . TYR A 169 ? 0.4959 0.8651 0.7557 0.0159  0.1390  0.1657  149 TYR A CE1   
1211 C CE2   . TYR A 169 ? 0.4545 0.7843 0.6586 -0.0179 0.1230  0.1791  149 TYR A CE2   
1212 C CZ    . TYR A 169 ? 0.5103 0.8577 0.7243 0.0041  0.1449  0.1685  149 TYR A CZ    
1213 O OH    . TYR A 169 ? 0.5385 0.8782 0.7139 0.0143  0.1716  0.1606  149 TYR A OH    
1214 N N     . HIS A 170 ? 0.2661 0.5716 0.5715 -0.0603 -0.0122 0.1859  150 HIS A N     
1215 C CA    . HIS A 170 ? 0.3103 0.6022 0.6224 -0.0827 -0.0411 0.1930  150 HIS A CA    
1216 C C     . HIS A 170 ? 0.2716 0.5079 0.5310 -0.0866 -0.0568 0.1776  150 HIS A C     
1217 O O     . HIS A 170 ? 0.3649 0.5788 0.6151 -0.1061 -0.0733 0.1824  150 HIS A O     
1218 C CB    . HIS A 170 ? 0.3998 0.7125 0.7478 -0.0826 -0.0583 0.1972  150 HIS A CB    
1219 C CG    . HIS A 170 ? 0.5454 0.8359 0.8888 -0.1054 -0.0910 0.2010  150 HIS A CG    
1220 N ND1   . HIS A 170 ? 0.6170 0.9202 0.9871 -0.1305 -0.1039 0.2191  150 HIS A ND1   
1221 C CD2   . HIS A 170 ? 0.5589 0.8131 0.8710 -0.1081 -0.1133 0.1887  150 HIS A CD2   
1222 C CE1   . HIS A 170 ? 0.6129 0.8848 0.9652 -0.1473 -0.1341 0.2164  150 HIS A CE1   
1223 N NE2   . HIS A 170 ? 0.6261 0.8685 0.9422 -0.1339 -0.1393 0.1978  150 HIS A NE2   
1224 N N     . PHE A 171 ? 0.2471 0.4610 0.4739 -0.0682 -0.0508 0.1592  151 PHE A N     
1225 C CA    . PHE A 171 ? 0.2921 0.4584 0.4748 -0.0690 -0.0617 0.1441  151 PHE A CA    
1226 C C     . PHE A 171 ? 0.3312 0.4792 0.4944 -0.0751 -0.0560 0.1477  151 PHE A C     
1227 O O     . PHE A 171 ? 0.3699 0.4839 0.5138 -0.0859 -0.0702 0.1450  151 PHE A O     
1228 C CB    . PHE A 171 ? 0.2406 0.3935 0.3992 -0.0487 -0.0549 0.1261  151 PHE A CB    
1229 C CG    . PHE A 171 ? 0.3069 0.4167 0.4271 -0.0479 -0.0636 0.1105  151 PHE A CG    
1230 C CD1   . PHE A 171 ? 0.4523 0.5434 0.5589 -0.0490 -0.0767 0.1003  151 PHE A CD1   
1231 C CD2   . PHE A 171 ? 0.3823 0.4712 0.4807 -0.0456 -0.0581 0.1069  151 PHE A CD2   
1232 C CE1   . PHE A 171 ? 0.4030 0.4575 0.4768 -0.0470 -0.0804 0.0853  151 PHE A CE1   
1233 C CE2   . PHE A 171 ? 0.4155 0.4689 0.4866 -0.0426 -0.0645 0.0929  151 PHE A CE2   
1234 C CZ    . PHE A 171 ? 0.4036 0.4409 0.4633 -0.0427 -0.0737 0.0814  151 PHE A CZ    
1235 N N     . ALA A 172 ? 0.3429 0.5108 0.5091 -0.0683 -0.0354 0.1540  152 ALA A N     
1236 C CA    . ALA A 172 ? 0.3395 0.4900 0.4843 -0.0744 -0.0305 0.1599  152 ALA A CA    
1237 C C     . ALA A 172 ? 0.3078 0.4565 0.4672 -0.0984 -0.0417 0.1773  152 ALA A C     
1238 O O     . ALA A 172 ? 0.3605 0.4763 0.4981 -0.1070 -0.0506 0.1794  152 ALA A O     
1239 C CB    . ALA A 172 ? 0.2869 0.4597 0.4276 -0.0645 -0.0055 0.1641  152 ALA A CB    
1240 N N     . GLU A 173 ? 0.3050 0.4890 0.5041 -0.1092 -0.0425 0.1907  153 GLU A N     
1241 C CA    . GLU A 173 ? 0.4720 0.6608 0.6918 -0.1349 -0.0533 0.2101  153 GLU A CA    
1242 C C     . GLU A 173 ? 0.4973 0.6427 0.7012 -0.1491 -0.0822 0.2042  153 GLU A C     
1243 O O     . GLU A 173 ? 0.5447 0.6625 0.7364 -0.1654 -0.0922 0.2120  153 GLU A O     
1244 C CB    . GLU A 173 ? 0.5072 0.7505 0.7811 -0.1417 -0.0476 0.2260  153 GLU A CB    
1245 C CG    . GLU A 173 ? 0.6125 0.8691 0.9170 -0.1708 -0.0594 0.2486  153 GLU A CG    
1246 C CD    . GLU A 173 ? 0.6718 0.9841 1.0337 -0.1729 -0.0551 0.2620  153 GLU A CD    
1247 O OE1   . GLU A 173 ? 0.5909 0.9407 0.9728 -0.1641 -0.0280 0.2695  153 GLU A OE1   
1248 O OE2   . GLU A 173 ? 0.6000 0.9091 0.9761 -0.1783 -0.0787 0.2600  153 GLU A OE2   
1249 N N     . LYS A 174 ? 0.4212 0.5569 0.6212 -0.1430 -0.0952 0.1901  154 LYS A N     
1250 C CA    . LYS A 174 ? 0.4247 0.5156 0.6023 -0.1553 -0.1204 0.1812  154 LYS A CA    
1251 C C     . LYS A 174 ? 0.4328 0.4731 0.5669 -0.1460 -0.1207 0.1650  154 LYS A C     
1252 O O     . LYS A 174 ? 0.4663 0.4646 0.5812 -0.1582 -0.1376 0.1611  154 LYS A O     
1253 C CB    . LYS A 174 ? 0.5794 0.6722 0.7584 -0.1517 -0.1329 0.1706  154 LYS A CB    
1254 C CG    . LYS A 174 ? 0.7377 0.8022 0.9096 -0.1751 -0.1617 0.1716  154 LYS A CG    
1255 C CD    . LYS A 174 ? 0.6455 0.7196 0.8231 -0.1758 -0.1761 0.1676  154 LYS A CD    
1256 C CE    . LYS A 174 ? 0.5977 0.6504 0.7731 -0.2040 -0.2073 0.1735  154 LYS A CE    
1257 N NZ    . LYS A 174 ? 0.5168 0.5050 0.6427 -0.2126 -0.2186 0.1582  154 LYS A NZ    
1258 N N     . ALA A 175 ? 0.3613 0.4050 0.4815 -0.1244 -0.1029 0.1558  155 ALA A N     
1259 C CA    . ALA A 175 ? 0.4769 0.4791 0.5636 -0.1131 -0.1031 0.1415  155 ALA A CA    
1260 C C     . ALA A 175 ? 0.5209 0.4990 0.5987 -0.1225 -0.1064 0.1527  155 ALA A C     
1261 O O     . ALA A 175 ? 0.4732 0.4145 0.5285 -0.1140 -0.1101 0.1429  155 ALA A O     
1262 C CB    . ALA A 175 ? 0.4506 0.4659 0.5284 -0.0899 -0.0862 0.1308  155 ALA A CB    
1263 N N     . GLN A 176 ? 0.4572 0.4559 0.5544 -0.1399 -0.1051 0.1744  156 GLN A N     
1264 C CA    . GLN A 176 ? 0.5881 0.5619 0.6748 -0.1512 -0.1095 0.1878  156 GLN A CA    
1265 C C     . GLN A 176 ? 0.5951 0.5151 0.6662 -0.1617 -0.1320 0.1816  156 GLN A C     
1266 O O     . GLN A 176 ? 0.5492 0.4347 0.6056 -0.1648 -0.1384 0.1868  156 GLN A O     
1267 C CB    . GLN A 176 ? 0.5771 0.5858 0.6887 -0.1709 -0.1024 0.2139  156 GLN A CB    
1268 C CG    . GLN A 176 ? 0.6204 0.6765 0.7421 -0.1595 -0.0763 0.2197  156 GLN A CG    
1269 C CD    . GLN A 176 ? 0.7822 0.8227 0.8718 -0.1411 -0.0657 0.2120  156 GLN A CD    
1270 O OE1   . GLN A 176 ? 0.7813 0.7874 0.8487 -0.1451 -0.0737 0.2174  156 GLN A OE1   
1271 N NE2   . GLN A 176 ? 0.7857 0.8496 0.8731 -0.1214 -0.0499 0.2001  156 GLN A NE2   
1272 N N     . ASN A 177 ? 0.4709 0.3804 0.5425 -0.1666 -0.1445 0.1698  157 ASN A N     
1273 C CA    . ASN A 177 ? 0.6193 0.4727 0.6697 -0.1753 -0.1645 0.1594  157 ASN A CA    
1274 C C     . ASN A 177 ? 0.6281 0.4498 0.6520 -0.1556 -0.1643 0.1312  157 ASN A C     
1275 O O     . ASN A 177 ? 0.6467 0.4287 0.6520 -0.1632 -0.1787 0.1187  157 ASN A O     
1276 C CB    . ASN A 177 ? 0.7362 0.5913 0.7998 -0.2021 -0.1829 0.1681  157 ASN A CB    
1277 C CG    . ASN A 177 ? 0.9309 0.8057 1.0201 -0.2265 -0.1865 0.1967  157 ASN A CG    
1278 O OD1   . ASN A 177 ? 0.9251 0.8512 1.0481 -0.2367 -0.1817 0.2123  157 ASN A OD1   
1279 N ND2   . ASN A 177 ? 1.0054 0.8433 1.0794 -0.2321 -0.1931 0.2018  157 ASN A ND2   
1280 N N     . ALA A 178 ? 0.4801 0.3179 0.5008 -0.1316 -0.1477 0.1211  158 ALA A N     
1281 C CA    . ALA A 178 ? 0.4801 0.2932 0.4798 -0.1131 -0.1443 0.0960  158 ALA A CA    
1282 C C     . ALA A 178 ? 0.5354 0.3379 0.5298 -0.0910 -0.1341 0.0891  158 ALA A C     
1283 O O     . ALA A 178 ? 0.5072 0.3326 0.5118 -0.0865 -0.1267 0.1023  158 ALA A O     
1284 C CB    . ALA A 178 ? 0.4477 0.2938 0.4509 -0.1067 -0.1367 0.0878  158 ALA A CB    
1285 N N     . PHE A 179 ? 0.5723 0.3404 0.5507 -0.0776 -0.1336 0.0686  159 PHE A N     
1286 C CA    . PHE A 179 ? 0.5523 0.3175 0.5323 -0.0543 -0.1235 0.0598  159 PHE A CA    
1287 C C     . PHE A 179 ? 0.5965 0.3772 0.5717 -0.0397 -0.1106 0.0408  159 PHE A C     
1288 O O     . PHE A 179 ? 0.4670 0.2362 0.4269 -0.0454 -0.1118 0.0284  159 PHE A O     
1289 C CB    . PHE A 179 ? 0.5215 0.2361 0.4946 -0.0475 -0.1309 0.0525  159 PHE A CB    
1290 C CG    . PHE A 179 ? 0.5481 0.2437 0.5257 -0.0594 -0.1441 0.0728  159 PHE A CG    
1291 C CD1   . PHE A 179 ? 0.6465 0.2890 0.6136 -0.0660 -0.1575 0.0696  159 PHE A CD1   
1292 C CD2   . PHE A 179 ? 0.6102 0.3368 0.5988 -0.0646 -0.1427 0.0947  159 PHE A CD2   
1293 C CE1   . PHE A 179 ? 0.7405 0.3623 0.7107 -0.0788 -0.1710 0.0901  159 PHE A CE1   
1294 C CE2   . PHE A 179 ? 0.7119 0.4197 0.7011 -0.0778 -0.1543 0.1152  159 PHE A CE2   
1295 C CZ    . PHE A 179 ? 0.6781 0.3337 0.6594 -0.0853 -0.1693 0.1139  159 PHE A CZ    
1296 N N     . PHE A 180 ? 0.4255 0.2297 0.4110 -0.0231 -0.0998 0.0397  160 PHE A N     
1297 C CA    . PHE A 180 ? 0.4972 0.3199 0.4814 -0.0102 -0.0870 0.0250  160 PHE A CA    
1298 C C     . PHE A 180 ? 0.5773 0.3871 0.5678 0.0097  -0.0797 0.0121  160 PHE A C     
1299 O O     . PHE A 180 ? 0.5289 0.3350 0.5326 0.0175  -0.0836 0.0201  160 PHE A O     
1300 C CB    . PHE A 180 ? 0.3610 0.2270 0.3553 -0.0086 -0.0803 0.0347  160 PHE A CB    
1301 C CG    . PHE A 180 ? 0.4870 0.3747 0.4832 -0.0238 -0.0833 0.0462  160 PHE A CG    
1302 C CD1   . PHE A 180 ? 0.4414 0.3393 0.4463 -0.0342 -0.0874 0.0647  160 PHE A CD1   
1303 C CD2   . PHE A 180 ? 0.3673 0.2672 0.3590 -0.0275 -0.0816 0.0400  160 PHE A CD2   
1304 C CE1   . PHE A 180 ? 0.5090 0.4324 0.5236 -0.0470 -0.0880 0.0760  160 PHE A CE1   
1305 C CE2   . PHE A 180 ? 0.4173 0.3405 0.4186 -0.0398 -0.0855 0.0519  160 PHE A CE2   
1306 C CZ    . PHE A 180 ? 0.4422 0.3792 0.4578 -0.0488 -0.0878 0.0696  160 PHE A CZ    
1307 N N     . TYR A 181 ? 0.4127 0.2179 0.3952 0.0174  -0.0691 -0.0062 161 TYR A N     
1308 C CA    . TYR A 181 ? 0.4134 0.2136 0.4086 0.0367  -0.0588 -0.0185 161 TYR A CA    
1309 C C     . TYR A 181 ? 0.5439 0.3680 0.5393 0.0440  -0.0431 -0.0301 161 TYR A C     
1310 O O     . TYR A 181 ? 0.3936 0.2186 0.3677 0.0351  -0.0389 -0.0370 161 TYR A O     
1311 C CB    . TYR A 181 ? 0.4609 0.2158 0.4470 0.0417  -0.0584 -0.0326 161 TYR A CB    
1312 C CG    . TYR A 181 ? 0.5458 0.2696 0.5314 0.0347  -0.0747 -0.0220 161 TYR A CG    
1313 C CD1   . TYR A 181 ? 0.5992 0.2973 0.5614 0.0159  -0.0853 -0.0209 161 TYR A CD1   
1314 C CD2   . TYR A 181 ? 0.5812 0.2998 0.5898 0.0454  -0.0816 -0.0115 161 TYR A CD2   
1315 C CE1   . TYR A 181 ? 0.6199 0.2876 0.5819 0.0070  -0.1010 -0.0097 161 TYR A CE1   
1316 C CE2   . TYR A 181 ? 0.5910 0.2776 0.5974 0.0376  -0.0976 0.0001  161 TYR A CE2   
1317 C CZ    . TYR A 181 ? 0.6875 0.3488 0.6706 0.0180  -0.1065 0.0009  161 TYR A CZ    
1318 O OH    . TYR A 181 ? 0.5860 0.2148 0.5674 0.0080  -0.1229 0.0139  161 TYR A OH    
1319 N N     . CYS A 182 ? 0.3920 0.2344 0.4117 0.0587  -0.0364 -0.0307 162 CYS A N     
1320 C CA    . CYS A 182 ? 0.3606 0.2242 0.3845 0.0652  -0.0209 -0.0412 162 CYS A CA    
1321 C C     . CYS A 182 ? 0.4720 0.3186 0.5031 0.0789  -0.0061 -0.0585 162 CYS A C     
1322 O O     . CYS A 182 ? 0.3949 0.2459 0.4576 0.0940  -0.0045 -0.0579 162 CYS A O     
1323 C CB    . CYS A 182 ? 0.4057 0.3036 0.4533 0.0704  -0.0226 -0.0308 162 CYS A CB    
1324 S SG    . CYS A 182 ? 0.5061 0.4332 0.5600 0.0733  -0.0064 -0.0391 162 CYS A SG    
1325 N N     . GLU A 183 ? 0.4558 0.4649 0.3555 0.0699  -0.1078 -0.0013 163 GLU A N     
1326 C CA    . GLU A 183 ? 0.4525 0.4818 0.3787 0.0945  -0.1125 -0.0030 163 GLU A CA    
1327 C C     . GLU A 183 ? 0.4234 0.4582 0.3691 0.0940  -0.0929 -0.0105 163 GLU A C     
1328 O O     . GLU A 183 ? 0.4082 0.4256 0.3459 0.0765  -0.0791 -0.0118 163 GLU A O     
1329 C CB    . GLU A 183 ? 0.4913 0.4826 0.3952 0.1173  -0.1265 0.0070  163 GLU A CB    
1330 C CG    . GLU A 183 ? 0.5035 0.4382 0.3813 0.1111  -0.1184 0.0118  163 GLU A CG    
1331 C CD    . GLU A 183 ? 0.6771 0.5629 0.5271 0.1254  -0.1338 0.0255  163 GLU A CD    
1332 O OE1   . GLU A 183 ? 0.6466 0.5375 0.4875 0.1383  -0.1512 0.0350  163 GLU A OE1   
1333 O OE2   . GLU A 183 ? 0.5707 0.4111 0.4079 0.1229  -0.1302 0.0277  163 GLU A OE2   
1334 N N     . SER A 184 ? 0.4199 0.4817 0.3900 0.1152  -0.0912 -0.0149 164 SER A N     
1335 C CA    . SER A 184 ? 0.5395 0.6123 0.5229 0.1171  -0.0723 -0.0210 164 SER A CA    
1336 C C     . SER A 184 ? 0.5513 0.5789 0.5097 0.1315  -0.0713 -0.0241 164 SER A C     
1337 O O     . SER A 184 ? 0.4500 0.4404 0.3882 0.1434  -0.0855 -0.0213 164 SER A O     
1338 C CB    . SER A 184 ? 0.5823 0.7136 0.6039 0.1320  -0.0670 -0.0244 164 SER A CB    
1339 O OG    . SER A 184 ? 0.5290 0.6747 0.5590 0.1315  -0.0461 -0.0275 164 SER A OG    
1340 N N     . TYR A 185 ? 0.4075 0.4365 0.3657 0.1302  -0.0565 -0.0294 165 TYR A N     
1341 C CA    . TYR A 185 ? 0.4267 0.4107 0.3584 0.1358  -0.0579 -0.0347 165 TYR A CA    
1342 C C     . TYR A 185 ? 0.4677 0.4256 0.3858 0.1658  -0.0691 -0.0429 165 TYR A C     
1343 O O     . TYR A 185 ? 0.5198 0.4259 0.4139 0.1656  -0.0790 -0.0455 165 TYR A O     
1344 C CB    . TYR A 185 ? 0.5051 0.5023 0.4368 0.1309  -0.0420 -0.0387 165 TYR A CB    
1345 C CG    . TYR A 185 ? 0.5268 0.5652 0.4711 0.1509  -0.0293 -0.0441 165 TYR A CG    
1346 C CD1   . TYR A 185 ? 0.4739 0.4993 0.3986 0.1769  -0.0293 -0.0566 165 TYR A CD1   
1347 C CD2   . TYR A 185 ? 0.5491 0.6395 0.5245 0.1432  -0.0165 -0.0373 165 TYR A CD2   
1348 C CE1   . TYR A 185 ? 0.5713 0.6394 0.5054 0.1978  -0.0136 -0.0614 165 TYR A CE1   
1349 C CE2   . TYR A 185 ? 0.5294 0.6647 0.5206 0.1600  -0.0012 -0.0392 165 TYR A CE2   
1350 C CZ    . TYR A 185 ? 0.5781 0.7043 0.5475 0.1886  0.0018  -0.0508 165 TYR A CZ    
1351 O OH    . TYR A 185 ? 0.5784 0.7534 0.5609 0.2073  0.0209  -0.0525 165 TYR A OH    
1352 N N     . ALA A 186 ? 0.4761 0.4681 0.4117 0.1916  -0.0678 -0.0474 166 ALA A N     
1353 C CA    . ALA A 186 ? 0.6351 0.5980 0.5574 0.2251  -0.0780 -0.0569 166 ALA A CA    
1354 C C     . ALA A 186 ? 0.7460 0.6621 0.6544 0.2272  -0.0995 -0.0476 166 ALA A C     
1355 O O     . ALA A 186 ? 0.6006 0.4596 0.4853 0.2418  -0.1109 -0.0529 166 ALA A O     
1356 C CB    . ALA A 186 ? 0.5651 0.5839 0.5152 0.2556  -0.0695 -0.0629 166 ALA A CB    
1357 N N     . ASP A 187 ? 0.5830 0.5199 0.5029 0.2119  -0.1055 -0.0333 167 ASP A N     
1358 C CA    . ASP A 187 ? 0.6364 0.5353 0.5396 0.2152  -0.1251 -0.0202 167 ASP A CA    
1359 C C     . ASP A 187 ? 0.6579 0.4978 0.5306 0.1887  -0.1283 -0.0112 167 ASP A C     
1360 O O     . ASP A 187 ? 0.6312 0.4176 0.4821 0.1950  -0.1424 -0.0021 167 ASP A O     
1361 C CB    . ASP A 187 ? 0.6424 0.5881 0.5633 0.2093  -0.1322 -0.0094 167 ASP A CB    
1362 C CG    . ASP A 187 ? 0.8092 0.8152 0.7671 0.2374  -0.1342 -0.0149 167 ASP A CG    
1363 O OD1   . ASP A 187 ? 0.8957 0.8916 0.8566 0.2718  -0.1364 -0.0223 167 ASP A OD1   
1364 O OD2   . ASP A 187 ? 0.8117 0.8759 0.7976 0.2252  -0.1335 -0.0127 167 ASP A OD2   
1365 N N     . SER A 188 ? 0.5737 0.4239 0.4476 0.1595  -0.1149 -0.0119 168 SER A N     
1366 C CA    . SER A 188 ? 0.5788 0.3849 0.4323 0.1342  -0.1152 -0.0028 168 SER A CA    
1367 C C     . SER A 188 ? 0.6606 0.4193 0.5024 0.1371  -0.1190 -0.0123 168 SER A C     
1368 O O     . SER A 188 ? 0.6580 0.3661 0.4834 0.1251  -0.1274 -0.0031 168 SER A O     
1369 C CB    . SER A 188 ? 0.5142 0.3498 0.3764 0.1056  -0.0998 -0.0009 168 SER A CB    
1370 O OG    . SER A 188 ? 0.4817 0.3472 0.3607 0.1061  -0.0874 -0.0134 168 SER A OG    
1371 N N     . MET A 189 ? 0.6531 0.4274 0.5014 0.1518  -0.1134 -0.0303 169 MET A N     
1372 C CA    . MET A 189 ? 0.6685 0.3984 0.5007 0.1557  -0.1199 -0.0444 169 MET A CA    
1373 C C     . MET A 189 ? 0.7516 0.4231 0.5661 0.1786  -0.1372 -0.0474 169 MET A C     
1374 O O     . MET A 189 ? 0.7237 0.3393 0.5213 0.1738  -0.1481 -0.0554 169 MET A O     
1375 C CB    . MET A 189 ? 0.5985 0.3612 0.4335 0.1696  -0.1089 -0.0633 169 MET A CB    
1376 C CG    . MET A 189 ? 0.5460 0.3516 0.3942 0.1461  -0.0938 -0.0591 169 MET A CG    
1377 S SD    . MET A 189 ? 0.6348 0.4817 0.4814 0.1605  -0.0786 -0.0736 169 MET A SD    
1378 C CE    . MET A 189 ? 0.6649 0.4608 0.4801 0.1613  -0.0934 -0.0918 169 MET A CE    
1379 N N     . ALA A 190 ? 0.7478 0.4304 0.5675 0.2025  -0.1418 -0.0407 170 ALA A N     
1380 C CA    . ALA A 190 ? 0.8778 0.5036 0.6820 0.2294  -0.1589 -0.0408 170 ALA A CA    
1381 C C     . ALA A 190 ? 0.9478 0.5156 0.7350 0.2095  -0.1720 -0.0174 170 ALA A C     
1382 O O     . ALA A 190 ? 0.9164 0.4266 0.6883 0.2292  -0.1876 -0.0127 170 ALA A O     
1383 C CB    . ALA A 190 ? 0.8876 0.5540 0.7085 0.2661  -0.1601 -0.0406 170 ALA A CB    
1384 N N     . ARG A 191 ? 0.8756 0.4578 0.6648 0.1723  -0.1644 -0.0016 171 ARG A N     
1385 C CA    . ARG A 191 ? 0.8400 0.3750 0.6124 0.1495  -0.1715 0.0238  171 ARG A CA    
1386 C C     . ARG A 191 ? 0.9096 0.3873 0.6750 0.1245  -0.1759 0.0212  171 ARG A C     
1387 O O     . ARG A 191 ? 0.9294 0.3551 0.6816 0.1071  -0.1830 0.0421  171 ARG A O     
1388 C CB    . ARG A 191 ? 0.8472 0.4289 0.6236 0.1237  -0.1587 0.0417  171 ARG A CB    
1389 C CG    . ARG A 191 ? 0.8241 0.4534 0.6033 0.1418  -0.1605 0.0482  171 ARG A CG    
1390 C CD    . ARG A 191 ? 0.7888 0.4535 0.5631 0.1152  -0.1493 0.0622  171 ARG A CD    
1391 N NE    . ARG A 191 ? 0.6924 0.4038 0.4694 0.1289  -0.1545 0.0642  171 ARG A NE    
1392 C CZ    . ARG A 191 ? 0.9124 0.6135 0.6662 0.1368  -0.1683 0.0835  171 ARG A CZ    
1393 N NH1   . ARG A 191 ? 0.8373 0.4791 0.5613 0.1327  -0.1756 0.1060  171 ARG A NH1   
1394 N NH2   . ARG A 191 ? 0.8800 0.6306 0.6402 0.1476  -0.1759 0.0817  171 ARG A NH2   
1395 N N     . ALA A 192 ? 0.8163 0.3047 0.5905 0.1217  -0.1727 -0.0032 172 ALA A N     
1396 C CA    . ALA A 192 ? 0.8689 0.3133 0.6414 0.0958  -0.1801 -0.0098 172 ALA A CA    
1397 C C     . ALA A 192 ? 1.0169 0.3736 0.7692 0.1071  -0.2009 -0.0158 172 ALA A C     
1398 O O     . ALA A 192 ? 0.9649 0.3070 0.7065 0.1445  -0.2069 -0.0292 172 ALA A O     
1399 C CB    . ALA A 192 ? 0.8467 0.3282 0.6285 0.0951  -0.1747 -0.0355 172 ALA A CB    
1400 N N     . ASP A 193 ? 1.0504 0.3585 0.8034 0.0732  -0.2092 -0.0061 173 ASP A N     
1401 C CA    . ASP A 193 ? 1.1369 0.3884 0.8820 0.0744  -0.2217 -0.0136 173 ASP A CA    
1402 C C     . ASP A 193 ? 1.1458 0.3793 0.8993 0.0461  -0.2308 -0.0322 173 ASP A C     
1403 O O     . ASP A 193 ? 1.0784 0.3480 0.8410 0.0365  -0.2292 -0.0471 173 ASP A O     
1404 C CB    . ASP A 193 ? 1.2243 0.4379 0.9653 0.0610  -0.2222 0.0203  173 ASP A CB    
1405 C CG    . ASP A 193 ? 1.3064 0.5243 1.0621 0.0130  -0.2144 0.0476  173 ASP A CG    
1406 O OD1   . ASP A 193 ? 1.2839 0.5335 1.0575 -0.0113 -0.2103 0.0402  173 ASP A OD1   
1407 O OD2   . ASP A 193 ? 1.3439 0.5362 1.0944 0.0003  -0.2111 0.0778  173 ASP A OD2   
1408 N N     . ASP A 194 ? 1.2296 0.4078 0.9810 0.0327  -0.2415 -0.0303 174 ASP A N     
1409 C CA    A ASP A 194 ? 1.2154 0.3725 0.9736 0.0091  -0.2544 -0.0510 174 ASP A CA    
1410 C CA    B ASP A 194 ? 1.2157 0.3725 0.9741 0.0087  -0.2544 -0.0506 174 ASP A CA    
1411 C C     . ASP A 194 ? 1.2033 0.3868 0.9921 -0.0396 -0.2517 -0.0353 174 ASP A C     
1412 O O     . ASP A 194 ? 1.2984 0.4795 1.0994 -0.0621 -0.2633 -0.0518 174 ASP A O     
1413 C CB    A ASP A 194 ? 1.3162 0.4017 1.0637 0.0104  -0.2666 -0.0537 174 ASP A CB    
1414 C CB    B ASP A 194 ? 1.3161 0.4015 1.0648 0.0082  -0.2664 -0.0521 174 ASP A CB    
1415 C CG    A ASP A 194 ? 1.3803 0.4372 1.1495 -0.0379 -0.2708 -0.0346 174 ASP A CG    
1416 C CG    B ASP A 194 ? 1.3629 0.4230 1.0856 0.0572  -0.2692 -0.0688 174 ASP A CG    
1417 O OD1   A ASP A 194 ? 1.4961 0.5352 1.2723 -0.0576 -0.2845 -0.0553 174 ASP A OD1   
1418 O OD1   B ASP A 194 ? 1.4030 0.4498 1.1108 0.0759  -0.2779 -0.1027 174 ASP A OD1   
1419 O OD2   A ASP A 194 ? 1.3446 0.3998 1.1239 -0.0564 -0.2599 0.0015  174 ASP A OD2   
1420 O OD2   B ASP A 194 ? 1.3829 0.4402 1.1004 0.0779  -0.2623 -0.0479 174 ASP A OD2   
1421 N N     . SER A 195 ? 1.1644 0.3779 0.9661 -0.0550 -0.2361 -0.0039 175 SER A N     
1422 C CA    . SER A 195 ? 1.1696 0.4171 1.0047 -0.0993 -0.2292 0.0134  175 SER A CA    
1423 C C     . SER A 195 ? 1.1010 0.4126 0.9478 -0.1005 -0.2162 0.0169  175 SER A C     
1424 O O     . SER A 195 ? 1.0318 0.3776 0.9048 -0.1318 -0.2030 0.0404  175 SER A O     
1425 C CB    . SER A 195 ? 1.3467 0.5746 1.1903 -0.1253 -0.2179 0.0517  175 SER A CB    
1426 O OG    . SER A 195 ? 1.4182 0.6929 1.2961 -0.1639 -0.2044 0.0714  175 SER A OG    
1427 N N     . SER A 196 ? 1.0515 0.3807 0.8805 -0.0665 -0.2179 -0.0065 176 SER A N     
1428 C CA    . SER A 196 ? 0.8688 0.2843 0.7122 -0.0593 -0.1956 -0.0030 176 SER A CA    
1429 C C     . SER A 196 ? 0.8647 0.3245 0.7189 -0.0564 -0.1993 -0.0289 176 SER A C     
1430 O O     . SER A 196 ? 0.9018 0.3272 0.7435 -0.0519 -0.2200 -0.0547 176 SER A O     
1431 C CB    . SER A 196 ? 0.8725 0.3030 0.6940 -0.0213 -0.1848 -0.0016 176 SER A CB    
1432 O OG    . SER A 196 ? 0.8861 0.2763 0.6931 -0.0204 -0.1847 0.0234  176 SER A OG    
1433 N N     . VAL A 197 ? 0.8424 0.3746 0.7162 -0.0580 -0.1799 -0.0216 177 VAL A N     
1434 C CA    . VAL A 197 ? 0.7798 0.3606 0.6612 -0.0502 -0.1798 -0.0399 177 VAL A CA    
1435 C C     . VAL A 197 ? 0.7646 0.4001 0.6445 -0.0281 -0.1567 -0.0350 177 VAL A C     
1436 O O     . VAL A 197 ? 0.6471 0.3042 0.5372 -0.0348 -0.1392 -0.0145 177 VAL A O     
1437 C CB    . VAL A 197 ? 0.7956 0.4105 0.7151 -0.0835 -0.1829 -0.0333 177 VAL A CB    
1438 C CG1   . VAL A 197 ? 0.6877 0.3555 0.6130 -0.0717 -0.1822 -0.0469 177 VAL A CG1   
1439 C CG2   . VAL A 197 ? 0.8365 0.4015 0.7631 -0.1101 -0.2088 -0.0402 177 VAL A CG2   
1440 N N     . VAL A 198 ? 0.6417 0.2982 0.5071 -0.0034 -0.1564 -0.0535 178 VAL A N     
1441 C CA    . VAL A 198 ? 0.7073 0.4095 0.5723 0.0158  -0.1358 -0.0491 178 VAL A CA    
1442 C C     . VAL A 198 ? 0.6260 0.3788 0.5020 0.0174  -0.1275 -0.0522 178 VAL A C     
1443 O O     . VAL A 198 ? 0.6180 0.3702 0.4807 0.0253  -0.1387 -0.0682 178 VAL A O     
1444 C CB    . VAL A 198 ? 0.7090 0.3965 0.5481 0.0488  -0.1363 -0.0623 178 VAL A CB    
1445 C CG1   . VAL A 198 ? 0.5626 0.2966 0.4091 0.0620  -0.1161 -0.0537 178 VAL A CG1   
1446 C CG2   . VAL A 198 ? 0.7849 0.4142 0.6099 0.0534  -0.1487 -0.0608 178 VAL A CG2   
1447 N N     . TYR A 199 ? 0.5407 0.3330 0.4363 0.0115  -0.1086 -0.0371 179 TYR A N     
1448 C CA    . TYR A 199 ? 0.5400 0.3747 0.4458 0.0155  -0.0991 -0.0363 179 TYR A CA    
1449 C C     . TYR A 199 ? 0.5662 0.4258 0.4686 0.0308  -0.0803 -0.0325 179 TYR A C     
1450 O O     . TYR A 199 ? 0.4823 0.3468 0.3923 0.0262  -0.0691 -0.0230 179 TYR A O     
1451 C CB    . TYR A 199 ? 0.4484 0.3077 0.3865 -0.0054 -0.0939 -0.0231 179 TYR A CB    
1452 C CG    . TYR A 199 ? 0.5182 0.4168 0.4688 0.0014  -0.0813 -0.0180 179 TYR A CG    
1453 C CD1   . TYR A 199 ? 0.4805 0.3928 0.4267 0.0091  -0.0916 -0.0238 179 TYR A CD1   
1454 C CD2   . TYR A 199 ? 0.5172 0.4346 0.4801 0.0011  -0.0605 -0.0075 179 TYR A CD2   
1455 C CE1   . TYR A 199 ? 0.5573 0.4997 0.5131 0.0169  -0.0807 -0.0153 179 TYR A CE1   
1456 C CE2   . TYR A 199 ? 0.5521 0.4957 0.5258 0.0080  -0.0495 -0.0025 179 TYR A CE2   
1457 C CZ    . TYR A 199 ? 0.5593 0.5146 0.5304 0.0162  -0.0594 -0.0045 179 TYR A CZ    
1458 O OH    . TYR A 199 ? 0.4340 0.4097 0.4139 0.0245  -0.0492 0.0040  179 TYR A OH    
1459 N N     . CYS A 200 ? 0.5620 0.4381 0.4520 0.0473  -0.0773 -0.0396 180 CYS A N     
1460 C CA    . CYS A 200 ? 0.4746 0.3764 0.3657 0.0587  -0.0597 -0.0353 180 CYS A CA    
1461 C C     . CYS A 200 ? 0.5337 0.4644 0.4361 0.0561  -0.0478 -0.0257 180 CYS A C     
1462 O O     . CYS A 200 ? 0.4789 0.4148 0.3727 0.0600  -0.0542 -0.0273 180 CYS A O     
1463 C CB    . CYS A 200 ? 0.5112 0.4118 0.3801 0.0817  -0.0604 -0.0475 180 CYS A CB    
1464 S SG    . CYS A 200 ? 0.5969 0.4550 0.4477 0.0943  -0.0765 -0.0616 180 CYS A SG    
1465 N N     . ASP A 201 ? 0.4653 0.4111 0.3841 0.0503  -0.0324 -0.0162 181 ASP A N     
1466 C CA    . ASP A 201 ? 0.3527 0.3174 0.2820 0.0491  -0.0199 -0.0061 181 ASP A CA    
1467 C C     . ASP A 201 ? 0.5706 0.5501 0.5051 0.0509  -0.0045 -0.0019 181 ASP A C     
1468 O O     . ASP A 201 ? 0.4399 0.4206 0.3898 0.0406  0.0042  0.0024  181 ASP A O     
1469 C CB    . ASP A 201 ? 0.3392 0.3034 0.2895 0.0364  -0.0163 0.0010  181 ASP A CB    
1470 C CG    . ASP A 201 ? 0.5460 0.5213 0.5077 0.0381  -0.0044 0.0116  181 ASP A CG    
1471 O OD1   . ASP A 201 ? 0.4568 0.4392 0.4077 0.0471  -0.0021 0.0165  181 ASP A OD1   
1472 O OD2   . ASP A 201 ? 0.5467 0.5211 0.5259 0.0316  0.0038  0.0155  181 ASP A OD2   
1473 N N     . PRO A 202 ? 0.5067 0.4992 0.4294 0.0633  -0.0007 -0.0038 182 PRO A N     
1474 C CA    . PRO A 202 ? 0.3469 0.3609 0.2820 0.0623  0.0136  0.0010  182 PRO A CA    
1475 C C     . PRO A 202 ? 0.3433 0.3643 0.2908 0.0530  0.0278  0.0155  182 PRO A C     
1476 O O     . PRO A 202 ? 0.3702 0.3816 0.3121 0.0536  0.0267  0.0228  182 PRO A O     
1477 C CB    . PRO A 202 ? 0.4924 0.5221 0.4111 0.0808  0.0158  -0.0043 182 PRO A CB    
1478 C CG    . PRO A 202 ? 0.5255 0.5413 0.4172 0.0897  0.0066  -0.0076 182 PRO A CG    
1479 C CD    . PRO A 202 ? 0.3963 0.3868 0.2933 0.0786  -0.0088 -0.0112 182 PRO A CD    
1480 N N     . PRO A 203 ? 0.3713 0.4075 0.3374 0.0440  0.0392  0.0203  183 PRO A N     
1481 C CA    . PRO A 203 ? 0.3693 0.4056 0.3458 0.0345  0.0531  0.0357  183 PRO A CA    
1482 C C     . PRO A 203 ? 0.3677 0.4123 0.3244 0.0464  0.0603  0.0488  183 PRO A C     
1483 O O     . PRO A 203 ? 0.4495 0.5120 0.3895 0.0605  0.0604  0.0440  183 PRO A O     
1484 C CB    . PRO A 203 ? 0.4338 0.4915 0.4349 0.0220  0.0616  0.0364  183 PRO A CB    
1485 C CG    . PRO A 203 ? 0.3493 0.4117 0.3547 0.0230  0.0485  0.0203  183 PRO A CG    
1486 C CD    . PRO A 203 ? 0.3426 0.3959 0.3235 0.0411  0.0377  0.0126  183 PRO A CD    
1487 N N     . TYR A 204 ? 0.3816 0.4117 0.3369 0.0432  0.0660  0.0649  184 TYR A N     
1488 C CA    . TYR A 204 ? 0.5431 0.5773 0.4723 0.0558  0.0699  0.0804  184 TYR A CA    
1489 C C     . TYR A 204 ? 0.4300 0.4931 0.3486 0.0601  0.0867  0.0905  184 TYR A C     
1490 O O     . TYR A 204 ? 0.4267 0.5054 0.3702 0.0468  0.1009  0.0962  184 TYR A O     
1491 C CB    . TYR A 204 ? 0.5344 0.5457 0.4687 0.0514  0.0744  0.1004  184 TYR A CB    
1492 C CG    . TYR A 204 ? 0.5383 0.5290 0.4777 0.0558  0.0600  0.0956  184 TYR A CG    
1493 C CD1   . TYR A 204 ? 0.4411 0.4077 0.4038 0.0474  0.0642  0.0987  184 TYR A CD1   
1494 C CD2   . TYR A 204 ? 0.5167 0.5133 0.4394 0.0685  0.0425  0.0873  184 TYR A CD2   
1495 C CE1   . TYR A 204 ? 0.5300 0.4850 0.5017 0.0542  0.0545  0.0948  184 TYR A CE1   
1496 C CE2   . TYR A 204 ? 0.6161 0.6034 0.5522 0.0710  0.0306  0.0848  184 TYR A CE2   
1497 C CZ    . TYR A 204 ? 0.5928 0.5624 0.5545 0.0653  0.0383  0.0892  184 TYR A CZ    
1498 O OH    . TYR A 204 ? 0.5362 0.5036 0.5152 0.0707  0.0298  0.0870  184 TYR A OH    
1499 N N     . ALA A 205 ? 0.4969 0.5695 0.3787 0.0782  0.0855  0.0930  185 ALA A N     
1500 C CA    . ALA A 205 ? 0.5429 0.6447 0.4077 0.0850  0.1059  0.1064  185 ALA A CA    
1501 C C     . ALA A 205 ? 0.5745 0.6706 0.4427 0.0735  0.1233  0.1391  185 ALA A C     
1502 O O     . ALA A 205 ? 0.5193 0.5851 0.3861 0.0707  0.1148  0.1504  185 ALA A O     
1503 C CB    . ALA A 205 ? 0.5449 0.6535 0.3597 0.1094  0.0986  0.0971  185 ALA A CB    
1504 N N     . PRO A 206 ? 0.5320 0.6575 0.4069 0.0672  0.1483  0.1559  186 PRO A N     
1505 C CA    . PRO A 206 ? 0.5656 0.6829 0.4455 0.0525  0.1673  0.1909  186 PRO A CA    
1506 C C     . PRO A 206 ? 0.6632 0.7721 0.4907 0.0693  0.1701  0.2143  186 PRO A C     
1507 O O     . PRO A 206 ? 0.6338 0.7616 0.4183 0.0917  0.1667  0.2046  186 PRO A O     
1508 C CB    . PRO A 206 ? 0.5905 0.7529 0.4972 0.0402  0.1934  0.1993  186 PRO A CB    
1509 C CG    . PRO A 206 ? 0.5598 0.7585 0.4492 0.0633  0.1917  0.1744  186 PRO A CG    
1510 C CD    . PRO A 206 ? 0.5248 0.6947 0.4105 0.0724  0.1612  0.1439  186 PRO A CD    
1511 N N     . LEU A 207 ? 0.6555 0.7337 0.4839 0.0596  0.1749  0.2445  187 LEU A N     
1512 C CA    . LEU A 207 ? 0.7835 0.8514 0.5610 0.0760  0.1754  0.2718  187 LEU A CA    
1513 C C     . LEU A 207 ? 0.8837 0.9704 0.6467 0.0679  0.2079  0.3091  187 LEU A C     
1514 O O     . LEU A 207 ? 0.9756 1.0538 0.6961 0.0790  0.2073  0.3297  187 LEU A O     
1515 C CB    . LEU A 207 ? 0.8152 0.8346 0.5985 0.0767  0.1581  0.2851  187 LEU A CB    
1516 C CG    . LEU A 207 ? 0.7429 0.7456 0.5443 0.0837  0.1292  0.2545  187 LEU A CG    
1517 C CD1   . LEU A 207 ? 0.6959 0.6582 0.5028 0.0894  0.1170  0.2726  187 LEU A CD1   
1518 C CD2   . LEU A 207 ? 0.7090 0.7351 0.4765 0.1043  0.1095  0.2293  187 LEU A CD2   
1519 N N     . SER A 208 ? 0.9026 1.0154 0.7082 0.0455  0.2304  0.3108  188 SER A N     
1520 C CA    . SER A 208 ? 0.9958 1.1308 0.8046 0.0310  0.2553  0.3326  188 SER A CA    
1521 C C     . SER A 208 ? 1.0061 1.1849 0.8697 0.0099  0.2735  0.3224  188 SER A C     
1522 O O     . SER A 208 ? 0.8825 1.0624 0.7892 -0.0013 0.2668  0.3060  188 SER A O     
1523 C CB    . SER A 208 ? 1.0559 1.1433 0.8706 0.0119  0.2580  0.3660  188 SER A CB    
1524 O OG    . SER A 208 ? 1.0232 1.0822 0.8938 -0.0156 0.2570  0.3659  188 SER A OG    
1525 N N     . ALA A 209 ? 1.0766 1.2937 0.9397 0.0044  0.2959  0.3326  189 ALA A N     
1526 C CA    . ALA A 209 ? 1.0800 1.3480 0.9982 -0.0139 0.3127  0.3238  189 ALA A CA    
1527 C C     . ALA A 209 ? 1.1351 1.3829 1.1133 -0.0550 0.3154  0.3376  189 ALA A C     
1528 O O     . ALA A 209 ? 1.1436 1.4055 1.1730 -0.0696 0.3085  0.3199  189 ALA A O     
1529 C CB    . ALA A 209 ? 1.0953 1.4095 0.9964 -0.0077 0.3377  0.3327  189 ALA A CB    
1530 N N     . ASN A 219 ? 1.3656 1.8469 1.7272 -0.0882 0.1221  0.0778  199 ASN A N     
1531 C CA    . ASN A 219 ? 1.3675 1.7792 1.7050 -0.1068 0.1013  0.0660  199 ASN A CA    
1532 C C     . ASN A 219 ? 1.3162 1.6704 1.5917 -0.0782 0.0912  0.0539  199 ASN A C     
1533 O O     . ASN A 219 ? 1.3226 1.6719 1.5852 -0.0630 0.0699  0.0363  199 ASN A O     
1534 C CB    . ASN A 219 ? 1.4093 1.7839 1.7521 -0.1399 0.1155  0.0830  199 ASN A CB    
1535 C CG    . ASN A 219 ? 1.4100 1.7231 1.7425 -0.1633 0.0945  0.0677  199 ASN A CG    
1536 O OD1   . ASN A 219 ? 1.4168 1.6922 1.7124 -0.1477 0.0764  0.0488  199 ASN A OD1   
1537 N ND2   . ASN A 219 ? 1.4058 1.7069 1.7703 -0.2015 0.0979  0.0756  199 ASN A ND2   
1538 N N     . SER A 220 ? 1.2579 1.5705 1.4968 -0.0719 0.1060  0.0652  200 SER A N     
1539 C CA    . SER A 220 ? 1.1935 1.4539 1.3805 -0.0500 0.0966  0.0556  200 SER A CA    
1540 C C     . SER A 220 ? 1.0274 1.3057 1.1886 -0.0145 0.1004  0.0525  200 SER A C     
1541 O O     . SER A 220 ? 1.0420 1.3739 1.2244 -0.0023 0.1097  0.0545  200 SER A O     
1542 C CB    . SER A 220 ? 1.2952 1.5034 1.4580 -0.0590 0.1062  0.0683  200 SER A CB    
1543 O OG    . SER A 220 ? 1.3835 1.6111 1.5550 -0.0650 0.1302  0.0925  200 SER A OG    
1544 N N     . PHE A 221 ? 0.8233 1.0566 0.9405 0.0019  0.0930  0.0463  201 PHE A N     
1545 C CA    . PHE A 221 ? 0.6553 0.8907 0.7415 0.0335  0.0919  0.0390  201 PHE A CA    
1546 C C     . PHE A 221 ? 0.6433 0.9117 0.7231 0.0459  0.1157  0.0523  201 PHE A C     
1547 O O     . PHE A 221 ? 0.6866 0.9377 0.7463 0.0410  0.1277  0.0675  201 PHE A O     
1548 C CB    . PHE A 221 ? 0.5747 0.7555 0.6209 0.0403  0.0794  0.0327  201 PHE A CB    
1549 C CG    . PHE A 221 ? 0.5063 0.6754 0.5268 0.0651  0.0656  0.0170  201 PHE A CG    
1550 C CD1   . PHE A 221 ? 0.3939 0.5616 0.4231 0.0690  0.0491  0.0046  201 PHE A CD1   
1551 C CD2   . PHE A 221 ? 0.5173 0.6720 0.5020 0.0837  0.0670  0.0149  201 PHE A CD2   
1552 C CE1   . PHE A 221 ? 0.3790 0.5272 0.3843 0.0906  0.0360  -0.0077 201 PHE A CE1   
1553 C CE2   . PHE A 221 ? 0.5549 0.6907 0.5159 0.1039  0.0524  -0.0014 201 PHE A CE2   
1554 C CZ    . PHE A 221 ? 0.5354 0.6656 0.5080 0.1070  0.0377  -0.0118 201 PHE A CZ    
1555 N N     . THR A 222 ? 0.5300 0.8473 0.6256 0.0640  0.1231  0.0475  202 THR A N     
1556 C CA    . THR A 222 ? 0.4485 0.8092 0.5426 0.0758  0.1505  0.0602  202 THR A CA    
1557 C C     . THR A 222 ? 0.5122 0.8516 0.5481 0.1056  0.1542  0.0537  202 THR A C     
1558 O O     . THR A 222 ? 0.4212 0.7189 0.4255 0.1202  0.1333  0.0357  202 THR A O     
1559 C CB    . THR A 222 ? 0.5651 0.9951 0.7033 0.0876  0.1594  0.0561  202 THR A CB    
1560 O OG1   . THR A 222 ? 0.5223 0.9438 0.6451 0.1191  0.1420  0.0331  202 THR A OG1   
1561 C CG2   . THR A 222 ? 0.5294 0.9880 0.7280 0.0560  0.1527  0.0617  202 THR A CG2   
1562 N N     . LEU A 223 ? 0.4638 0.8330 0.4848 0.1134  0.1808  0.0687  203 LEU A N     
1563 C CA    . LEU A 223 ? 0.5894 0.9450 0.5504 0.1435  0.1849  0.0604  203 LEU A CA    
1564 C C     . LEU A 223 ? 0.6169 0.9782 0.5673 0.1773  0.1752  0.0316  203 LEU A C     
1565 O O     . LEU A 223 ? 0.6015 0.9215 0.5034 0.1973  0.1595  0.0129  203 LEU A O     
1566 C CB    . LEU A 223 ? 0.5721 0.9685 0.5188 0.1472  0.2191  0.0830  203 LEU A CB    
1567 C CG    . LEU A 223 ? 0.5859 0.9644 0.5312 0.1177  0.2284  0.1145  203 LEU A CG    
1568 C CD1   . LEU A 223 ? 0.6164 1.0417 0.5547 0.1183  0.2655  0.1415  203 LEU A CD1   
1569 C CD2   . LEU A 223 ? 0.6473 0.9632 0.5403 0.1217  0.2068  0.1115  203 LEU A CD2   
1570 N N     . GLU A 224 ? 0.5143 0.9261 0.5128 0.1831  0.1829  0.0285  204 GLU A N     
1571 C CA    . GLU A 224 ? 0.5706 0.9889 0.5679 0.2174  0.1736  0.0033  204 GLU A CA    
1572 C C     . GLU A 224 ? 0.5438 0.8968 0.5242 0.2180  0.1378  -0.0152 204 GLU A C     
1573 O O     . GLU A 224 ? 0.5069 0.8284 0.4527 0.2465  0.1258  -0.0370 204 GLU A O     
1574 C CB    . GLU A 224 ? 0.6936 1.1829 0.7578 0.2193  0.1846  0.0077  204 GLU A CB    
1575 C CG    . GLU A 224 ? 0.8664 1.3736 0.9341 0.2620  0.1806  -0.0151 204 GLU A CG    
1576 C CD    . GLU A 224 ? 0.9498 1.5252 1.0898 0.2598  0.1845  -0.0089 204 GLU A CD    
1577 O OE1   . GLU A 224 ? 0.9958 1.6229 1.1789 0.2321  0.2033  0.0125  204 GLU A OE1   
1578 O OE2   . GLU A 224 ? 0.8991 1.4723 1.0529 0.2840  0.1664  -0.0246 204 GLU A OE2   
1579 N N     . GLN A 225 ? 0.4555 0.7862 0.4587 0.1860  0.1221  -0.0062 205 GLN A N     
1580 C CA    . GLN A 225 ? 0.5316 0.8052 0.5208 0.1823  0.0920  -0.0189 205 GLN A CA    
1581 C C     . GLN A 225 ? 0.5542 0.7706 0.4909 0.1833  0.0810  -0.0254 205 GLN A C     
1582 O O     . GLN A 225 ? 0.4795 0.6523 0.3945 0.1933  0.0600  -0.0413 205 GLN A O     
1583 C CB    . GLN A 225 ? 0.4923 0.7624 0.5169 0.1490  0.0813  -0.0085 205 GLN A CB    
1584 C CG    . GLN A 225 ? 0.5110 0.8239 0.5843 0.1484  0.0760  -0.0092 205 GLN A CG    
1585 C CD    . GLN A 225 ? 0.6350 0.9415 0.7347 0.1141  0.0644  -0.0019 205 GLN A CD    
1586 O OE1   . GLN A 225 ? 0.6555 0.9577 0.7611 0.0879  0.0742  0.0101  205 GLN A OE1   
1587 N NE2   . GLN A 225 ? 0.5876 0.8897 0.6991 0.1158  0.0428  -0.0096 205 GLN A NE2   
1588 N N     . GLN A 226 ? 0.5546 0.7712 0.4729 0.1723  0.0936  -0.0118 206 GLN A N     
1589 C CA    . GLN A 226 ? 0.4880 0.6586 0.3607 0.1732  0.0805  -0.0168 206 GLN A CA    
1590 C C     . GLN A 226 ? 0.5693 0.7237 0.3983 0.2049  0.0740  -0.0402 206 GLN A C     
1591 O O     . GLN A 226 ? 0.5300 0.6378 0.3319 0.2069  0.0512  -0.0549 206 GLN A O     
1592 C CB    . GLN A 226 ? 0.4807 0.6590 0.3398 0.1605  0.0951  0.0048  206 GLN A CB    
1593 C CG    . GLN A 226 ? 0.4559 0.6355 0.3525 0.1290  0.0998  0.0264  206 GLN A CG    
1594 C CD    . GLN A 226 ? 0.4896 0.6244 0.3799 0.1143  0.0804  0.0273  206 GLN A CD    
1595 O OE1   . GLN A 226 ? 0.5391 0.6448 0.4060 0.1228  0.0611  0.0125  206 GLN A OE1   
1596 N NE2   . GLN A 226 ? 0.4180 0.5478 0.3321 0.0920  0.0862  0.0444  206 GLN A NE2   
1597 N N     . ALA A 227 ? 0.5436 0.7367 0.3677 0.2292  0.0945  -0.0446 207 ALA A N     
1598 C CA    . ALA A 227 ? 0.5971 0.7742 0.3753 0.2636  0.0914  -0.0702 207 ALA A CA    
1599 C C     . ALA A 227 ? 0.6364 0.7827 0.4225 0.2805  0.0714  -0.0929 207 ALA A C     
1600 O O     . ALA A 227 ? 0.6453 0.7441 0.3907 0.2970  0.0540  -0.1163 207 ALA A O     
1601 C CB    . ALA A 227 ? 0.6290 0.8618 0.3989 0.2872  0.1243  -0.0673 207 ALA A CB    
1602 N N     . HIS A 228 ? 0.6524 0.8230 0.4893 0.2760  0.0722  -0.0855 208 HIS A N     
1603 C CA    . HIS A 228 ? 0.5791 0.7203 0.4251 0.2925  0.0525  -0.1013 208 HIS A CA    
1604 C C     . HIS A 228 ? 0.6467 0.7187 0.4750 0.2738  0.0227  -0.1063 208 HIS A C     
1605 O O     . HIS A 228 ? 0.6118 0.6358 0.4201 0.2905  0.0044  -0.1243 208 HIS A O     
1606 C CB    . HIS A 228 ? 0.5429 0.7312 0.4478 0.2884  0.0569  -0.0884 208 HIS A CB    
1607 C CG    . HIS A 228 ? 0.6339 0.7979 0.5485 0.3097  0.0374  -0.1002 208 HIS A CG    
1608 N ND1   . HIS A 228 ? 0.5573 0.7061 0.4968 0.2912  0.0179  -0.0905 208 HIS A ND1   
1609 C CD2   . HIS A 228 ? 0.6067 0.7568 0.5070 0.3502  0.0346  -0.1201 208 HIS A CD2   
1610 C CE1   . HIS A 228 ? 0.5699 0.6963 0.5097 0.3183  0.0029  -0.1006 208 HIS A CE1   
1611 N NE2   . HIS A 228 ? 0.6170 0.7416 0.5352 0.3549  0.0123  -0.1192 208 HIS A NE2   
1612 N N     . LEU A 229 ? 0.5523 0.6187 0.3895 0.2397  0.0189  -0.0898 209 LEU A N     
1613 C CA    . LEU A 229 ? 0.5345 0.5460 0.3601 0.2197  -0.0051 -0.0917 209 LEU A CA    
1614 C C     . LEU A 229 ? 0.7070 0.6730 0.4857 0.2307  -0.0196 -0.1119 209 LEU A C     
1615 O O     . LEU A 229 ? 0.6746 0.5897 0.4428 0.2293  -0.0412 -0.1231 209 LEU A O     
1616 C CB    . LEU A 229 ? 0.4918 0.5127 0.3344 0.1865  -0.0020 -0.0718 209 LEU A CB    
1617 C CG    . LEU A 229 ? 0.5051 0.4832 0.3422 0.1643  -0.0214 -0.0704 209 LEU A CG    
1618 C CD1   . LEU A 229 ? 0.5028 0.4532 0.3533 0.1589  -0.0358 -0.0712 209 LEU A CD1   
1619 C CD2   . LEU A 229 ? 0.4947 0.4893 0.3487 0.1395  -0.0133 -0.0520 209 LEU A CD2   
1620 N N     . ALA A 230 ? 0.6072 0.5904 0.3562 0.2405  -0.0085 -0.1161 210 ALA A N     
1621 C CA    . ALA A 230 ? 0.6943 0.6376 0.3933 0.2518  -0.0243 -0.1386 210 ALA A CA    
1622 C C     . ALA A 230 ? 0.7989 0.7078 0.4751 0.2832  -0.0326 -0.1665 210 ALA A C     
1623 O O     . ALA A 230 ? 0.9084 0.7614 0.5538 0.2848  -0.0562 -0.1875 210 ALA A O     
1624 C CB    . ALA A 230 ? 0.7589 0.7327 0.4244 0.2599  -0.0091 -0.1361 210 ALA A CB    
1625 N N     . GLU A 231 ? 0.7191 0.6613 0.4133 0.3082  -0.0138 -0.1668 211 GLU A N     
1626 C CA    . GLU A 231 ? 0.8813 0.7945 0.5615 0.3412  -0.0196 -0.1901 211 GLU A CA    
1627 C C     . GLU A 231 ? 0.8807 0.7330 0.5723 0.3354  -0.0460 -0.1946 211 GLU A C     
1628 O O     . GLU A 231 ? 0.8376 0.6356 0.5074 0.3423  -0.0643 -0.2109 211 GLU A O     
1629 C CB    . GLU A 231 ? 0.9231 0.8995 0.6349 0.3636  0.0066  -0.1817 211 GLU A CB    
1630 C CG    . GLU A 231 ? 1.0967 1.0546 0.8031 0.3926  0.0029  -0.1980 211 GLU A CG    
1631 C CD    . GLU A 231 ? 1.2375 1.2670 0.9787 0.4130  0.0300  -0.1890 211 GLU A CD    
1632 O OE1   . GLU A 231 ? 1.2257 1.2577 0.9963 0.4295  0.0255  -0.1893 211 GLU A OE1   
1633 O OE2   . GLU A 231 ? 1.3117 1.3958 1.0522 0.4113  0.0552  -0.1797 211 GLU A OE2   
1634 N N     . ILE A 232 ? 0.7266 0.5930 0.4603 0.3097  -0.0485 -0.1699 212 ILE A N     
1635 C CA    . ILE A 232 ? 0.8288 0.6415 0.5727 0.2982  -0.0715 -0.1661 212 ILE A CA    
1636 C C     . ILE A 232 ? 0.8771 0.6274 0.5948 0.2742  -0.0948 -0.1745 212 ILE A C     
1637 O O     . ILE A 232 ? 0.8688 0.5548 0.5732 0.2777  -0.1150 -0.1852 212 ILE A O     
1638 C CB    . ILE A 232 ? 0.8546 0.7000 0.6423 0.2731  -0.0680 -0.1376 212 ILE A CB    
1639 C CG1   . ILE A 232 ? 0.7938 0.6933 0.6133 0.2965  -0.0537 -0.1312 212 ILE A CG1   
1640 C CG2   . ILE A 232 ? 0.8146 0.6038 0.6044 0.2547  -0.0902 -0.1294 212 ILE A CG2   
1641 C CD1   . ILE A 232 ? 0.6130 0.5380 0.4698 0.2744  -0.0561 -0.1078 212 ILE A CD1   
1642 N N     . ALA A 233 ? 0.7502 0.5194 0.4627 0.2498  -0.0928 -0.1688 213 ALA A N     
1643 C CA    . ALA A 233 ? 0.8054 0.5281 0.4999 0.2261  -0.1159 -0.1767 213 ALA A CA    
1644 C C     . ALA A 233 ? 0.9430 0.6108 0.5918 0.2471  -0.1331 -0.2105 213 ALA A C     
1645 O O     . ALA A 233 ? 1.0625 0.6691 0.7029 0.2325  -0.1579 -0.2202 213 ALA A O     
1646 C CB    . ALA A 233 ? 0.7172 0.4787 0.4148 0.2039  -0.1105 -0.1651 213 ALA A CB    
1647 N N     . GLU A 234 ? 0.9266 0.6193 0.5496 0.2775  -0.1187 -0.2251 214 GLU A N     
1648 C CA    . GLU A 234 ? 0.9429 0.6008 0.5337 0.2897  -0.1304 -0.2476 214 GLU A CA    
1649 C C     . GLU A 234 ? 0.9890 0.5945 0.5864 0.3006  -0.1419 -0.2542 214 GLU A C     
1650 O O     . GLU A 234 ? 1.0900 0.6441 0.6655 0.2990  -0.1603 -0.2720 214 GLU A O     
1651 C CB    . GLU A 234 ? 1.0023 0.7074 0.5697 0.3182  -0.1073 -0.2552 214 GLU A CB    
1652 C CG    . GLU A 234 ? 0.9837 0.7338 0.5350 0.3080  -0.0974 -0.2472 214 GLU A CG    
1653 C CD    . GLU A 234 ? 1.0546 0.8505 0.5820 0.3342  -0.0721 -0.2503 214 GLU A CD    
1654 O OE1   . GLU A 234 ? 1.1530 0.9493 0.6787 0.3610  -0.0616 -0.2607 214 GLU A OE1   
1655 O OE2   . GLU A 234 ? 0.9966 0.8284 0.5070 0.3280  -0.0624 -0.2405 214 GLU A OE2   
1656 N N     . GLY A 235 ? 0.9578 0.5761 0.5853 0.3112  -0.1320 -0.2392 215 GLY A N     
1657 C CA    . GLY A 235 ? 1.0651 0.6362 0.6998 0.3226  -0.1429 -0.2402 215 GLY A CA    
1658 C C     . GLY A 235 ? 1.0843 0.5945 0.7284 0.2911  -0.1665 -0.2298 215 GLY A C     
1659 O O     . GLY A 235 ? 1.0711 0.5237 0.7084 0.2928  -0.1814 -0.2351 215 GLY A O     
1660 N N     . LEU A 236 ? 0.9840 0.5069 0.6447 0.2615  -0.1684 -0.2137 216 LEU A N     
1661 C CA    . LEU A 236 ? 1.0001 0.4734 0.6730 0.2266  -0.1874 -0.2000 216 LEU A CA    
1662 C C     . LEU A 236 ? 1.0735 0.5039 0.7295 0.2031  -0.2084 -0.2155 216 LEU A C     
1663 O O     . LEU A 236 ? 1.0910 0.4659 0.7507 0.1855  -0.2247 -0.2116 216 LEU A O     
1664 C CB    . LEU A 236 ? 0.9034 0.4128 0.6021 0.1999  -0.1801 -0.1771 216 LEU A CB    
1665 C CG    . LEU A 236 ? 0.8734 0.4223 0.6013 0.2050  -0.1644 -0.1504 216 LEU A CG    
1666 C CD1   . LEU A 236 ? 0.8950 0.4968 0.6512 0.1718  -0.1525 -0.1260 216 LEU A CD1   
1667 C CD2   . LEU A 236 ? 0.9064 0.3959 0.6348 0.2069  -0.1781 -0.1391 216 LEU A CD2   
1668 N N     . VAL A 237 ? 1.0613 0.5195 0.6994 0.2025  -0.2080 -0.2316 217 VAL A N     
1669 C CA    . VAL A 237 ? 1.0537 0.4819 0.6790 0.1786  -0.2301 -0.2462 217 VAL A CA    
1670 C C     . VAL A 237 ? 1.2468 0.6212 0.8481 0.1938  -0.2416 -0.2676 217 VAL A C     
1671 O O     . VAL A 237 ? 1.1961 0.5281 0.7941 0.1697  -0.2632 -0.2769 217 VAL A O     
1672 C CB    . VAL A 237 ? 1.0788 0.5547 0.6866 0.1780  -0.2277 -0.2565 217 VAL A CB    
1673 C CG1   . VAL A 237 ? 1.1203 0.6172 0.6930 0.2167  -0.2133 -0.2754 217 VAL A CG1   
1674 C CG2   . VAL A 237 ? 1.0642 0.5205 0.6721 0.1444  -0.2540 -0.2647 217 VAL A CG2   
1675 N N     . GLU A 238 ? 1.2907 0.6683 0.8786 0.2330  -0.2272 -0.2753 218 GLU A N     
1676 C CA    . GLU A 238 ? 1.4059 0.7290 0.9720 0.2515  -0.2362 -0.2953 218 GLU A CA    
1677 C C     . GLU A 238 ? 1.4452 0.7056 1.0298 0.2321  -0.2513 -0.2818 218 GLU A C     
1678 O O     . GLU A 238 ? 1.3746 0.5745 0.9449 0.2288  -0.2673 -0.2969 218 GLU A O     
1679 C CB    . GLU A 238 ? 1.5009 0.8495 1.0565 0.2988  -0.2150 -0.3030 218 GLU A CB    
1680 C CG    . GLU A 238 ? 1.5802 0.9931 1.1171 0.3201  -0.1952 -0.3133 218 GLU A CG    
1681 C CD    . GLU A 238 ? 1.6952 1.1383 1.2298 0.3643  -0.1723 -0.3183 218 GLU A CD    
1682 O OE1   . GLU A 238 ? 1.7138 1.1255 1.2602 0.3803  -0.1746 -0.3160 218 GLU A OE1   
1683 O OE2   . GLU A 238 ? 1.7500 1.2506 1.2729 0.3826  -0.1514 -0.3227 218 GLU A OE2   
1684 N N     . ARG A 239 ? 1.3316 0.6062 0.9463 0.2190  -0.2451 -0.2524 219 ARG A N     
1685 C CA    . ARG A 239 ? 1.3577 0.5802 0.9898 0.2003  -0.2552 -0.2320 219 ARG A CA    
1686 C C     . ARG A 239 ? 1.3588 0.5639 1.0100 0.1495  -0.2695 -0.2185 219 ARG A C     
1687 O O     . ARG A 239 ? 1.2859 0.4660 0.9574 0.1273  -0.2718 -0.1924 219 ARG A O     
1688 C CB    . ARG A 239 ? 1.3346 0.5837 0.9867 0.2144  -0.2405 -0.2053 219 ARG A CB    
1689 C CG    . ARG A 239 ? 1.4337 0.6635 1.0798 0.2533  -0.2362 -0.2072 219 ARG A CG    
1690 C CD    . ARG A 239 ? 1.4438 0.7011 1.1126 0.2609  -0.2265 -0.1775 219 ARG A CD    
1691 N NE    . ARG A 239 ? 1.3800 0.7145 1.0595 0.2783  -0.2081 -0.1771 219 ARG A NE    
1692 C CZ    . ARG A 239 ? 1.2299 0.6028 0.9308 0.2713  -0.2002 -0.1530 219 ARG A CZ    
1693 N NH1   . ARG A 239 ? 1.2884 0.6312 0.9985 0.2478  -0.2084 -0.1262 219 ARG A NH1   
1694 N NH2   . ARG A 239 ? 1.0340 0.4763 0.7465 0.2870  -0.1833 -0.1550 219 ARG A NH2   
1695 N N     . HIS A 240 ? 1.2440 0.4674 0.8897 0.1317  -0.2780 -0.2347 220 HIS A N     
1696 C CA    . HIS A 240 ? 1.2806 0.5032 0.9509 0.0836  -0.2913 -0.2237 220 HIS A CA    
1697 C C     . HIS A 240 ? 1.2156 0.4753 0.9183 0.0621  -0.2797 -0.1915 220 HIS A C     
1698 O O     . HIS A 240 ? 1.1518 0.3961 0.8816 0.0248  -0.2853 -0.1706 220 HIS A O     
1699 C CB    . HIS A 240 ? 1.3112 0.4664 0.9880 0.0581  -0.3086 -0.2222 220 HIS A CB    
1700 C CG    . HIS A 240 ? 1.4788 0.5883 1.1237 0.0751  -0.3223 -0.2554 220 HIS A CG    
1701 N ND1   . HIS A 240 ? 1.5341 0.6121 1.1528 0.1161  -0.3164 -0.2683 220 HIS A ND1   
1702 C CD2   . HIS A 240 ? 1.5544 0.6443 1.1894 0.0568  -0.3420 -0.2793 220 HIS A CD2   
1703 C CE1   . HIS A 240 ? 1.6158 0.6534 1.2075 0.1229  -0.3306 -0.2994 220 HIS A CE1   
1704 N NE2   . HIS A 240 ? 1.6281 0.6709 1.2275 0.0868  -0.3471 -0.3071 220 HIS A NE2   
1705 N N     . ILE A 241 ? 1.0842 0.3933 0.7844 0.0853  -0.2621 -0.1876 221 ILE A N     
1706 C CA    . ILE A 241 ? 1.0335 0.3810 0.7599 0.0674  -0.2506 -0.1621 221 ILE A CA    
1707 C C     . ILE A 241 ? 1.0008 0.4052 0.7261 0.0681  -0.2459 -0.1725 221 ILE A C     
1708 O O     . ILE A 241 ? 0.9452 0.3795 0.6500 0.1013  -0.2338 -0.1857 221 ILE A O     
1709 C CB    . ILE A 241 ? 1.0071 0.3627 0.7341 0.0931  -0.2336 -0.1449 221 ILE A CB    
1710 C CG1   . ILE A 241 ? 1.0666 0.3676 0.7908 0.0971  -0.2391 -0.1330 221 ILE A CG1   
1711 C CG2   . ILE A 241 ? 0.9075 0.3121 0.6627 0.0720  -0.2184 -0.1166 221 ILE A CG2   
1712 C CD1   . ILE A 241 ? 1.0374 0.3495 0.7604 0.1277  -0.2267 -0.1181 221 ILE A CD1   
1713 N N     . PRO A 242 ? 1.0260 0.4520 0.7767 0.0313  -0.2539 -0.1639 222 PRO A N     
1714 C CA    . PRO A 242 ? 1.0314 0.5244 0.7895 0.0278  -0.2490 -0.1665 222 PRO A CA    
1715 C C     . PRO A 242 ? 0.8677 0.4323 0.6471 0.0352  -0.2189 -0.1421 222 PRO A C     
1716 O O     . PRO A 242 ? 0.8676 0.4385 0.6688 0.0272  -0.2044 -0.1182 222 PRO A O     
1717 C CB    . PRO A 242 ? 1.0675 0.5608 0.8578 -0.0156 -0.2679 -0.1600 222 PRO A CB    
1718 C CG    . PRO A 242 ? 1.0569 0.5135 0.8712 -0.0390 -0.2655 -0.1370 222 PRO A CG    
1719 C CD    . PRO A 242 ? 1.0183 0.4171 0.7997 -0.0100 -0.2644 -0.1453 222 PRO A CD    
1720 N N     . VAL A 243 ? 0.7987 0.4123 0.5684 0.0496  -0.2108 -0.1483 223 VAL A N     
1721 C CA    . VAL A 243 ? 0.7314 0.4056 0.5161 0.0595  -0.1830 -0.1291 223 VAL A CA    
1722 C C     . VAL A 243 ? 0.7738 0.4992 0.5654 0.0546  -0.1806 -0.1250 223 VAL A C     
1723 O O     . VAL A 243 ? 0.7809 0.5036 0.5448 0.0628  -0.1955 -0.1435 223 VAL A O     
1724 C CB    . VAL A 243 ? 0.7386 0.4194 0.4979 0.0962  -0.1670 -0.1376 223 VAL A CB    
1725 C CG1   . VAL A 243 ? 0.6653 0.4020 0.4467 0.0996  -0.1404 -0.1162 223 VAL A CG1   
1726 C CG2   . VAL A 243 ? 0.7448 0.3725 0.4917 0.1111  -0.1729 -0.1457 223 VAL A CG2   
1727 N N     . LEU A 244 ? 0.6425 0.4117 0.4665 0.0439  -0.1627 -0.1014 224 LEU A N     
1728 C CA    . LEU A 244 ? 0.6790 0.4945 0.5109 0.0438  -0.1582 -0.0935 224 LEU A CA    
1729 C C     . LEU A 244 ? 0.6896 0.5418 0.5278 0.0568  -0.1299 -0.0776 224 LEU A C     
1730 O O     . LEU A 244 ? 0.5384 0.3949 0.3975 0.0510  -0.1144 -0.0647 224 LEU A O     
1731 C CB    . LEU A 244 ? 0.5627 0.3962 0.4351 0.0162  -0.1669 -0.0808 224 LEU A CB    
1732 C CG    . LEU A 244 ? 0.6423 0.5216 0.5280 0.0176  -0.1661 -0.0710 224 LEU A CG    
1733 C CD1   . LEU A 244 ? 0.6235 0.5002 0.4773 0.0260  -0.1910 -0.0887 224 LEU A CD1   
1734 C CD2   . LEU A 244 ? 0.5122 0.4189 0.4492 -0.0053 -0.1655 -0.0542 224 LEU A CD2   
1735 N N     . ILE A 245 ? 0.5348 0.4119 0.3534 0.0724  -0.1242 -0.0777 225 ILE A N     
1736 C CA    . ILE A 245 ? 0.5383 0.4463 0.3626 0.0823  -0.0980 -0.0622 225 ILE A CA    
1737 C C     . ILE A 245 ? 0.6297 0.5682 0.4621 0.0807  -0.0937 -0.0464 225 ILE A C     
1738 O O     . ILE A 245 ? 0.5767 0.5181 0.3930 0.0829  -0.1113 -0.0513 225 ILE A O     
1739 C CB    . ILE A 245 ? 0.6507 0.5602 0.4419 0.1071  -0.0872 -0.0725 225 ILE A CB    
1740 C CG1   . ILE A 245 ? 0.6180 0.4963 0.4022 0.1147  -0.0922 -0.0879 225 ILE A CG1   
1741 C CG2   . ILE A 245 ? 0.4921 0.4349 0.2949 0.1122  -0.0606 -0.0552 225 ILE A CG2   
1742 C CD1   . ILE A 245 ? 0.5606 0.4496 0.3241 0.1416  -0.0772 -0.0962 225 ILE A CD1   
1743 N N     . SER A 246 ? 0.5700 0.5279 0.4254 0.0776  -0.0730 -0.0282 226 SER A N     
1744 C CA    . SER A 246 ? 0.5650 0.5448 0.4246 0.0807  -0.0673 -0.0113 226 SER A CA    
1745 C C     . SER A 246 ? 0.5118 0.5048 0.3673 0.0884  -0.0424 0.0029  226 SER A C     
1746 O O     . SER A 246 ? 0.5017 0.4941 0.3676 0.0856  -0.0279 0.0021  226 SER A O     
1747 C CB    . SER A 246 ? 0.5832 0.5707 0.4825 0.0667  -0.0696 -0.0006 226 SER A CB    
1748 O OG    . SER A 246 ? 0.3894 0.3737 0.3145 0.0569  -0.0529 0.0042  226 SER A OG    
1749 N N     . ASN A 247 ? 0.5449 0.5501 0.3862 0.0967  -0.0393 0.0174  227 ASN A N     
1750 C CA    . ASN A 247 ? 0.4699 0.4861 0.3043 0.1020  -0.0161 0.0346  227 ASN A CA    
1751 C C     . ASN A 247 ? 0.7281 0.7511 0.5457 0.1106  -0.0185 0.0548  227 ASN A C     
1752 O O     . ASN A 247 ? 0.4960 0.5196 0.3113 0.1133  -0.0398 0.0534  227 ASN A O     
1753 C CB    . ASN A 247 ? 0.5565 0.5805 0.3635 0.1131  -0.0060 0.0249  227 ASN A CB    
1754 C CG    . ASN A 247 ? 0.6084 0.6478 0.4303 0.1093  0.0210  0.0393  227 ASN A CG    
1755 O OD1   . ASN A 247 ? 0.4657 0.5079 0.2976 0.1033  0.0333  0.0612  227 ASN A OD1   
1756 N ND2   . ASN A 247 ? 0.4588 0.5082 0.2843 0.1129  0.0292  0.0273  227 ASN A ND2   
1757 N N     . HIS A 248 ? 0.4995 0.5286 0.3075 0.1140  0.0020  0.0754  228 HIS A N     
1758 C CA    . HIS A 248 ? 0.6251 0.6575 0.4076 0.1250  0.0000  0.0985  228 HIS A CA    
1759 C C     . HIS A 248 ? 0.5831 0.6258 0.3103 0.1415  -0.0122 0.0895  228 HIS A C     
1760 O O     . HIS A 248 ? 0.5979 0.6446 0.3065 0.1458  -0.0096 0.0689  228 HIS A O     
1761 C CB    . HIS A 248 ? 0.5512 0.5828 0.3358 0.1216  0.0273  0.1263  228 HIS A CB    
1762 C CG    . HIS A 248 ? 0.6545 0.6683 0.4841 0.1076  0.0371  0.1369  228 HIS A CG    
1763 N ND1   . HIS A 248 ? 0.7056 0.7071 0.5629 0.1068  0.0234  0.1344  228 HIS A ND1   
1764 C CD2   . HIS A 248 ? 0.5509 0.5567 0.4022 0.0940  0.0593  0.1491  228 HIS A CD2   
1765 C CE1   . HIS A 248 ? 0.6746 0.6575 0.5628 0.0962  0.0376  0.1423  228 HIS A CE1   
1766 N NE2   . HIS A 248 ? 0.5680 0.5508 0.4532 0.0865  0.0577  0.1507  228 HIS A NE2   
1767 N N     . ASP A 249 ? 0.6305 0.6767 0.3290 0.1530  -0.0260 0.1044  229 ASP A N     
1768 C CA    . ASP A 249 ? 0.6845 0.7398 0.3202 0.1701  -0.0375 0.0972  229 ASP A CA    
1769 C C     . ASP A 249 ? 0.7927 0.8581 0.3885 0.1801  -0.0105 0.1234  229 ASP A C     
1770 O O     . ASP A 249 ? 0.7471 0.8110 0.3331 0.1843  -0.0078 0.1552  229 ASP A O     
1771 C CB    . ASP A 249 ? 0.7343 0.7922 0.3568 0.1771  -0.0728 0.0975  229 ASP A CB    
1772 C CG    . ASP A 249 ? 0.8255 0.8905 0.3757 0.1946  -0.0902 0.0861  229 ASP A CG    
1773 O OD1   . ASP A 249 ? 0.8055 0.8710 0.3166 0.2026  -0.0756 0.0710  229 ASP A OD1   
1774 O OD2   . ASP A 249 ? 0.8308 0.9028 0.3627 0.2020  -0.1198 0.0907  229 ASP A OD2   
1775 N N     . THR A 250 ? 0.7298 0.8064 0.3047 0.1847  0.0105  0.1119  230 THR A N     
1776 C CA    . THR A 250 ? 0.8123 0.9065 0.3511 0.1930  0.0411  0.1357  230 THR A CA    
1777 C C     . THR A 250 ? 0.9317 1.0416 0.4115 0.2134  0.0453  0.1123  230 THR A C     
1778 O O     . THR A 250 ? 0.8887 0.9884 0.3554 0.2204  0.0220  0.0764  230 THR A O     
1779 C CB    . THR A 250 ? 0.7951 0.8980 0.3828 0.1761  0.0751  0.1511  230 THR A CB    
1780 O OG1   . THR A 250 ? 0.7827 0.8985 0.3862 0.1767  0.0828  0.1221  230 THR A OG1   
1781 C CG2   . THR A 250 ? 0.7564 0.8376 0.4038 0.1561  0.0703  0.1628  230 THR A CG2   
1782 N N     . MET A 251 ? 0.9929 1.1221 0.4549 0.2165  0.0743  0.1286  231 MET A N     
1783 C CA    . MET A 251 ? 1.0224 1.1655 0.4479 0.2320  0.0822  0.1040  231 MET A CA    
1784 C C     . MET A 251 ? 1.0736 1.2260 0.5253 0.2361  0.0928  0.0754  231 MET A C     
1785 O O     . MET A 251 ? 0.8946 1.0414 0.3212 0.2516  0.0830  0.0415  231 MET A O     
1786 C CB    . MET A 251 ? 0.9539 1.1194 0.3608 0.2326  0.1134  0.1319  231 MET A CB    
1787 N N     . LEU A 252 ? 1.0237 1.1878 0.5269 0.2224  0.1118  0.0891  232 LEU A N     
1788 C CA    . LEU A 252 ? 1.0080 1.1855 0.5422 0.2264  0.1223  0.0657  232 LEU A CA    
1789 C C     . LEU A 252 ? 0.8860 1.0303 0.4299 0.2276  0.0887  0.0306  232 LEU A C     
1790 O O     . LEU A 252 ? 0.7891 0.9311 0.3228 0.2440  0.0860  0.0001  232 LEU A O     
1791 C CB    . LEU A 252 ? 0.9751 1.1729 0.5755 0.2038  0.1461  0.0891  232 LEU A CB    
1792 C CG    . LEU A 252 ? 0.9936 1.2363 0.6083 0.2030  0.1840  0.1074  232 LEU A CG    
1793 C CD1   . LEU A 252 ? 0.9141 1.1761 0.5961 0.1771  0.2026  0.1287  232 LEU A CD1   
1794 C CD2   . LEU A 252 ? 1.0610 1.3238 0.6676 0.2256  0.1892  0.0765  232 LEU A CD2   
1795 N N     . THR A 253 ? 0.8444 0.9615 0.4122 0.2097  0.0635  0.0357  233 THR A N     
1796 C CA    . THR A 253 ? 0.6919 0.7786 0.2801 0.2037  0.0335  0.0079  233 THR A CA    
1797 C C     . THR A 253 ? 0.7629 0.8288 0.2955 0.2210  0.0069  -0.0223 233 THR A C     
1798 O O     . THR A 253 ? 0.7472 0.7899 0.2839 0.2240  -0.0091 -0.0518 233 THR A O     
1799 C CB    . THR A 253 ? 0.6489 0.7189 0.2788 0.1809  0.0170  0.0225  233 THR A CB    
1800 O OG1   . THR A 253 ? 0.6759 0.7495 0.2827 0.1821  0.0137  0.0470  233 THR A OG1   
1801 C CG2   . THR A 253 ? 0.5956 0.6732 0.2839 0.1625  0.0362  0.0377  233 THR A CG2   
1802 N N     . ARG A 254 ? 0.7983 0.8694 0.2765 0.2322  0.0009  -0.0148 234 ARG A N     
1803 C CA    . ARG A 254 ? 0.9105 0.9618 0.3392 0.2448  -0.0255 -0.0449 234 ARG A CA    
1804 C C     . ARG A 254 ? 0.9786 1.0279 0.3906 0.2627  -0.0115 -0.0719 234 ARG A C     
1805 O O     . ARG A 254 ? 0.9865 1.0068 0.3775 0.2689  -0.0344 -0.1042 234 ARG A O     
1806 C CB    . ARG A 254 ? 0.9346 0.9952 0.3257 0.2473  -0.0320 -0.0275 234 ARG A CB    
1807 C CG    . ARG A 254 ? 0.9392 0.9951 0.3442 0.2340  -0.0592 -0.0096 234 ARG A CG    
1808 C CD    . ARG A 254 ? 1.0008 1.0660 0.3670 0.2390  -0.0670 0.0078  234 ARG A CD    
1809 N NE    . ARG A 254 ? 1.0344 1.0989 0.4202 0.2293  -0.0954 0.0245  234 ARG A NE    
1810 C CZ    . ARG A 254 ? 1.2458 1.3025 0.6245 0.2251  -0.1348 0.0059  234 ARG A CZ    
1811 N NH1   . ARG A 254 ? 1.3147 1.3567 0.6626 0.2281  -0.1507 -0.0306 234 ARG A NH1   
1812 N NH2   . ARG A 254 ? 1.2689 1.3336 0.6754 0.2178  -0.1582 0.0242  234 ARG A NH2   
1813 N N     . GLU A 255 ? 0.9457 1.0266 0.3718 0.2702  0.0257  -0.0574 235 GLU A N     
1814 C CA    . GLU A 255 ? 1.0054 1.0927 0.4242 0.2900  0.0417  -0.0792 235 GLU A CA    
1815 C C     . GLU A 255 ? 0.9582 1.0298 0.4146 0.2924  0.0374  -0.1002 235 GLU A C     
1816 O O     . GLU A 255 ? 0.9440 0.9933 0.3882 0.3083  0.0289  -0.1297 235 GLU A O     
1817 C CB    . GLU A 255 ? 0.9248 1.0597 0.3501 0.2953  0.0827  -0.0531 235 GLU A CB    
1818 C CG    . GLU A 255 ? 1.1349 1.2872 0.5640 0.3164  0.1028  -0.0714 235 GLU A CG    
1819 C CD    . GLU A 255 ? 1.2187 1.4227 0.6569 0.3184  0.1428  -0.0442 235 GLU A CD    
1820 O OE1   . GLU A 255 ? 1.2481 1.4839 0.7389 0.3049  0.1640  -0.0216 235 GLU A OE1   
1821 O OE2   . GLU A 255 ? 1.2851 1.4982 0.6783 0.3316  0.1527  -0.0456 235 GLU A OE2   
1822 N N     . TRP A 256 ? 0.8615 0.9421 0.3620 0.2775  0.0432  -0.0842 236 TRP A N     
1823 C CA    . TRP A 256 ? 0.8691 0.9343 0.4066 0.2780  0.0376  -0.1007 236 TRP A CA    
1824 C C     . TRP A 256 ? 0.8930 0.9018 0.4176 0.2741  -0.0010 -0.1291 236 TRP A C     
1825 O O     . TRP A 256 ? 0.8057 0.7881 0.3358 0.2856  -0.0091 -0.1527 236 TRP A O     
1826 C CB    . TRP A 256 ? 0.7933 0.8752 0.3995 0.2493  0.0457  -0.0723 236 TRP A CB    
1827 C CG    . TRP A 256 ? 0.7734 0.9080 0.4072 0.2484  0.0820  -0.0469 236 TRP A CG    
1828 C CD1   . TRP A 256 ? 0.7125 0.8862 0.3351 0.2720  0.1101  -0.0501 236 TRP A CD1   
1829 C CD2   . TRP A 256 ? 0.6359 0.7902 0.3153 0.2211  0.0945  -0.0149 236 TRP A CD2   
1830 N NE1   . TRP A 256 ? 0.6847 0.9050 0.3481 0.2576  0.1388  -0.0200 236 TRP A NE1   
1831 C CE2   . TRP A 256 ? 0.7306 0.9353 0.4273 0.2258  0.1285  0.0010  236 TRP A CE2   
1832 C CE3   . TRP A 256 ? 0.6561 0.7897 0.3643 0.1940  0.0810  0.0006  236 TRP A CE3   
1833 C CZ2   . TRP A 256 ? 0.6080 0.8374 0.3495 0.2003  0.1463  0.0315  236 TRP A CZ2   
1834 C CZ3   . TRP A 256 ? 0.5877 0.7422 0.3354 0.1731  0.0994  0.0285  236 TRP A CZ3   
1835 C CH2   . TRP A 256 ? 0.5742 0.7736 0.3381 0.1746  0.1304  0.0435  236 TRP A CH2   
1836 N N     . TYR A 257 ? 0.7937 0.7852 0.3068 0.2564  -0.0250 -0.1240 237 TYR A N     
1837 C CA    . TYR A 257 ? 0.8050 0.7493 0.3174 0.2441  -0.0624 -0.1454 237 TYR A CA    
1838 C C     . TYR A 257 ? 0.9661 0.8873 0.4262 0.2534  -0.0845 -0.1692 237 TYR A C     
1839 O O     . TYR A 257 ? 1.0223 0.9214 0.4790 0.2367  -0.1161 -0.1760 237 TYR A O     
1840 C CB    . TYR A 257 ? 0.7528 0.6994 0.3083 0.2126  -0.0762 -0.1222 237 TYR A CB    
1841 C CG    . TYR A 257 ? 0.7664 0.7356 0.3821 0.1962  -0.0548 -0.0946 237 TYR A CG    
1842 C CD1   . TYR A 257 ? 0.6447 0.6320 0.2872 0.1783  -0.0517 -0.0670 237 TYR A CD1   
1843 C CD2   . TYR A 257 ? 0.6857 0.6560 0.3299 0.2001  -0.0401 -0.0978 237 TYR A CD2   
1844 C CE1   . TYR A 257 ? 0.6560 0.6577 0.3482 0.1633  -0.0339 -0.0461 237 TYR A CE1   
1845 C CE2   . TYR A 257 ? 0.5977 0.5880 0.2931 0.1836  -0.0243 -0.0753 237 TYR A CE2   
1846 C CZ    . TYR A 257 ? 0.6108 0.6143 0.3279 0.1646  -0.0211 -0.0512 237 TYR A CZ    
1847 O OH    . TYR A 257 ? 0.5244 0.5417 0.2864 0.1485  -0.0069 -0.0331 237 TYR A OH    
1848 N N     . GLN A 258 ? 0.9292 0.8591 0.3601 0.2757  -0.0679 -0.1791 238 GLN A N     
1849 C CA    . GLN A 258 ? 1.0501 0.9623 0.4342 0.2818  -0.0860 -0.1981 238 GLN A CA    
1850 C C     . GLN A 258 ? 1.0645 0.9207 0.4446 0.2756  -0.1196 -0.2309 238 GLN A C     
1851 O O     . GLN A 258 ? 1.1417 0.9799 0.4941 0.2679  -0.1457 -0.2446 238 GLN A O     
1852 C CB    . GLN A 258 ? 1.1324 1.0689 0.4829 0.3084  -0.0576 -0.2009 238 GLN A CB    
1853 C CG    . GLN A 258 ? 1.2060 1.1378 0.5720 0.3290  -0.0396 -0.2158 238 GLN A CG    
1854 C CD    . GLN A 258 ? 1.2847 1.2591 0.6325 0.3526  -0.0037 -0.2085 238 GLN A CD    
1855 O OE1   . GLN A 258 ? 1.2986 1.3081 0.6813 0.3600  0.0247  -0.1942 238 GLN A OE1   
1856 N NE2   . GLN A 258 ? 1.3589 1.3327 0.6532 0.3633  -0.0051 -0.2183 238 GLN A NE2   
1857 N N     . ARG A 259 ? 1.0262 0.8544 0.4351 0.2772  -0.1200 -0.2417 239 ARG A N     
1858 C CA    . ARG A 259 ? 1.1289 0.8987 0.5352 0.2710  -0.1490 -0.2696 239 ARG A CA    
1859 C C     . ARG A 259 ? 1.1158 0.8592 0.5525 0.2367  -0.1805 -0.2671 239 ARG A C     
1860 O O     . ARG A 259 ? 1.1178 0.8119 0.5622 0.2254  -0.2034 -0.2849 239 ARG A O     
1861 C CB    . ARG A 259 ? 1.0793 0.8267 0.5012 0.2898  -0.1364 -0.2798 239 ARG A CB    
1862 N N     . ALA A 260 ? 1.0076 0.7849 0.4635 0.2199  -0.1809 -0.2435 240 ALA A N     
1863 C CA    . ALA A 260 ? 0.9571 0.7211 0.4478 0.1873  -0.2086 -0.2379 240 ALA A CA    
1864 C C     . ALA A 260 ? 1.0486 0.8327 0.5275 0.1734  -0.2316 -0.2347 240 ALA A C     
1865 O O     . ALA A 260 ? 1.0560 0.8630 0.4957 0.1893  -0.2246 -0.2340 240 ALA A O     
1866 C CB    . ALA A 260 ? 0.8778 0.6648 0.4074 0.1783  -0.1942 -0.2131 240 ALA A CB    
1867 N N     . LYS A 261 ? 1.1017 0.8803 0.6173 0.1434  -0.2589 -0.2310 241 LYS A N     
1868 C CA    . LYS A 261 ? 1.1559 0.9642 0.6737 0.1294  -0.2822 -0.2233 241 LYS A CA    
1869 C C     . LYS A 261 ? 1.0817 0.9360 0.6287 0.1262  -0.2727 -0.1905 241 LYS A C     
1870 O O     . LYS A 261 ? 0.9926 0.8496 0.5899 0.1131  -0.2593 -0.1743 241 LYS A O     
1871 C CB    . LYS A 261 ? 1.1169 0.9016 0.6655 0.0979  -0.3179 -0.2371 241 LYS A CB    
1872 N N     . LEU A 262 ? 1.0497 0.9414 0.5761 0.1359  -0.2723 -0.1746 242 LEU A N     
1873 C CA    . LEU A 262 ? 0.9469 0.8790 0.4951 0.1405  -0.2535 -0.1390 242 LEU A CA    
1874 C C     . LEU A 262 ? 0.9438 0.9096 0.5255 0.1270  -0.2774 -0.1201 242 LEU A C     
1875 O O     . LEU A 262 ? 0.8885 0.8621 0.4479 0.1259  -0.3038 -0.1287 242 LEU A O     
1876 C CB    . LEU A 262 ? 0.9120 0.8606 0.4082 0.1682  -0.2248 -0.1272 242 LEU A CB    
1877 C CG    . LEU A 262 ? 0.9253 0.8548 0.3943 0.1858  -0.1961 -0.1425 242 LEU A CG    
1878 C CD1   . LEU A 262 ? 0.9118 0.8679 0.3415 0.2077  -0.1654 -0.1256 242 LEU A CD1   
1879 C CD2   . LEU A 262 ? 0.8289 0.7519 0.3491 0.1771  -0.1748 -0.1346 242 LEU A CD2   
1880 N N     . HIS A 263 ? 0.8586 0.8471 0.5042 0.1153  -0.2604 -0.0917 243 HIS A N     
1881 C CA    . HIS A 263 ? 0.8271 0.8522 0.5151 0.1066  -0.2778 -0.0710 243 HIS A CA    
1882 C C     . HIS A 263 ? 0.7937 0.8439 0.4989 0.1193  -0.2486 -0.0344 243 HIS A C     
1883 O O     . HIS A 263 ? 0.6933 0.7370 0.4264 0.1164  -0.2159 -0.0225 243 HIS A O     
1884 C CB    . HIS A 263 ? 0.7330 0.7612 0.4922 0.0778  -0.2892 -0.0741 243 HIS A CB    
1885 C CG    . HIS A 263 ? 0.9166 0.9189 0.6679 0.0598  -0.3229 -0.1063 243 HIS A CG    
1886 N ND1   . HIS A 263 ? 0.9750 0.9548 0.7681 0.0349  -0.3224 -0.1149 243 HIS A ND1   
1887 C CD2   . HIS A 263 ? 1.0573 1.0482 0.7613 0.0620  -0.3591 -0.1320 243 HIS A CD2   
1888 C CE1   . HIS A 263 ? 1.0709 1.0234 0.8466 0.0210  -0.3567 -0.1438 243 HIS A CE1   
1889 N NE2   . HIS A 263 ? 1.1358 1.0951 0.8597 0.0365  -0.3769 -0.1555 243 HIS A NE2   
1890 N N     . VAL A 264 ? 0.7436 0.8192 0.4311 0.1329  -0.2626 -0.0168 244 VAL A N     
1891 C CA    . VAL A 264 ? 0.8152 0.9063 0.5133 0.1466  -0.2380 0.0193  244 VAL A CA    
1892 C C     . VAL A 264 ? 0.7786 0.8943 0.5514 0.1383  -0.2411 0.0383  244 VAL A C     
1893 O O     . VAL A 264 ? 0.7788 0.9205 0.5783 0.1331  -0.2737 0.0352  244 VAL A O     
1894 C CB    . VAL A 264 ? 0.9005 1.0029 0.5350 0.1697  -0.2495 0.0343  244 VAL A CB    
1895 C CG1   . VAL A 264 ? 0.7970 0.9078 0.4440 0.1827  -0.2257 0.0751  244 VAL A CG1   
1896 C CG2   . VAL A 264 ? 0.9381 1.0204 0.4951 0.1816  -0.2402 0.0165  244 VAL A CG2   
1897 N N     . VAL A 265 ? 0.6603 0.7699 0.4679 0.1376  -0.2073 0.0565  245 VAL A N     
1898 C CA    . VAL A 265 ? 0.6682 0.7985 0.5425 0.1348  -0.2042 0.0733  245 VAL A CA    
1899 C C     . VAL A 265 ? 0.7200 0.8517 0.5902 0.1556  -0.1900 0.1061  245 VAL A C     
1900 O O     . VAL A 265 ? 0.6397 0.7471 0.4971 0.1587  -0.1585 0.1177  245 VAL A O     
1901 C CB    . VAL A 265 ? 0.7114 0.8291 0.6311 0.1175  -0.1780 0.0661  245 VAL A CB    
1902 C CG1   . VAL A 265 ? 0.7026 0.8470 0.6901 0.1153  -0.1770 0.0778  245 VAL A CG1   
1903 C CG2   . VAL A 265 ? 0.6434 0.7473 0.5577 0.0982  -0.1873 0.0377  245 VAL A CG2   
1904 N N     . LYS A 266 ? 0.8036 0.9629 0.6870 0.1694  -0.2146 0.1217  246 LYS A N     
1905 C CA    . LYS A 266 ? 0.9644 1.1200 0.8407 0.1922  -0.2054 0.1557  246 LYS A CA    
1906 C C     . LYS A 266 ? 1.0921 1.2373 1.0248 0.1929  -0.1769 0.1682  246 LYS A C     
1907 O O     . LYS A 266 ? 1.1677 1.3360 1.1606 0.1875  -0.1810 0.1610  246 LYS A O     
1908 C CB    . LYS A 266 ? 0.9158 1.1062 0.7919 0.2099  -0.2438 0.1693  246 LYS A CB    
1909 N N     . VAL A 267 ? 1.0634 1.1739 0.9757 0.1988  -0.1472 0.1863  247 VAL A N     
1910 C CA    . VAL A 267 ? 0.9259 1.0164 0.8816 0.2011  -0.1209 0.1968  247 VAL A CA    
1911 C C     . VAL A 267 ? 0.9482 1.0134 0.8846 0.2223  -0.1126 0.2320  247 VAL A C     
1912 O O     . VAL A 267 ? 0.9591 1.0195 0.9335 0.2383  -0.1100 0.2471  247 VAL A O     
1913 C CB    . VAL A 267 ? 0.8195 0.8829 0.7773 0.1798  -0.0905 0.1797  247 VAL A CB    
1914 C CG1   . VAL A 267 ? 0.7924 0.8239 0.7759 0.1833  -0.0632 0.1922  247 VAL A CG1   
1915 C CG2   . VAL A 267 ? 0.7457 0.8289 0.7336 0.1613  -0.0963 0.1503  247 VAL A CG2   
1916 N N     . ARG A 268 ? 0.9159 0.9642 0.7926 0.2235  -0.1074 0.2458  248 ARG A N     
1917 C CA    . ARG A 268 ? 0.9082 0.9288 0.7569 0.2406  -0.0988 0.2840  248 ARG A CA    
1918 C C     . ARG A 268 ? 0.9959 0.9735 0.8782 0.2388  -0.0696 0.2965  248 ARG A C     
1919 O O     . ARG A 268 ? 0.9581 0.9174 0.8566 0.2576  -0.0718 0.3199  248 ARG A O     
1920 C CB    . ARG A 268 ? 0.8446 0.8858 0.6928 0.2625  -0.1303 0.3001  248 ARG A CB    
1921 N N     . ARG A 269 ? 1.1155 1.0750 1.0078 0.2153  -0.0441 0.2777  249 ARG A N     
1922 C CA    . ARG A 269 ? 1.0943 1.0095 1.0133 0.2090  -0.0178 0.2842  249 ARG A CA    
1923 C C     . ARG A 269 ? 1.0756 0.9525 0.9588 0.2077  -0.0006 0.3180  249 ARG A C     
1924 O O     . ARG A 269 ? 1.0557 0.9416 0.8986 0.1965  0.0070  0.3228  249 ARG A O     
1925 C CB    . ARG A 269 ? 1.0469 0.9602 0.9873 0.1833  -0.0008 0.2516  249 ARG A CB    
1926 C CG    . ARG A 269 ? 1.0737 0.9435 1.0447 0.1764  0.0211  0.2497  249 ARG A CG    
1927 C CD    . ARG A 269 ? 1.0895 0.9550 1.0661 0.1486  0.0378  0.2239  249 ARG A CD    
1928 N NE    . ARG A 269 ? 1.0347 0.9320 1.0309 0.1426  0.0300  0.1927  249 ARG A NE    
1929 C CZ    . ARG A 269 ? 1.0527 0.9442 1.0820 0.1420  0.0355  0.1747  249 ARG A CZ    
1930 N NH1   . ARG A 269 ? 1.0839 0.9365 1.1300 0.1492  0.0478  0.1805  249 ARG A NH1   
1931 N NH2   . ARG A 269 ? 1.0541 0.9756 1.0973 0.1346  0.0296  0.1511  249 ARG A NH2   
1932 N N     . SER A 270 ? 1.0248 0.8582 0.9235 0.2195  0.0070  0.3422  250 SER A N     
1933 C CA    . SER A 270 ? 1.0890 0.8839 0.9602 0.2095  0.0220  0.3684  250 SER A CA    
1934 C C     . SER A 270 ? 1.3310 1.1005 1.2051 0.1802  0.0512  0.3654  250 SER A C     
1935 O O     . SER A 270 ? 1.3397 1.1016 1.2477 0.1678  0.0600  0.3394  250 SER A O     
1936 C CB    . SER A 270 ? 1.0201 0.7728 0.9104 0.2239  0.0181  0.3834  250 SER A CB    
1937 O OG    . SER A 270 ? 1.0419 0.7537 0.9064 0.2116  0.0317  0.4101  250 SER A OG    
1938 N N     . ILE A 271 ? 1.5209 1.2836 1.3619 0.1656  0.0644  0.3864  251 ILE A N     
1939 C CA    . ILE A 271 ? 1.5226 1.2706 1.3696 0.1347  0.0912  0.3868  251 ILE A CA    
1940 C C     . ILE A 271 ? 1.4046 1.1898 1.2632 0.1213  0.0961  0.3551  251 ILE A C     
1941 O O     . ILE A 271 ? 1.4000 1.2021 1.2519 0.0999  0.1134  0.3538  251 ILE A O     
1942 C CB    . ILE A 271 ? 1.5821 1.2705 1.4651 0.1207  0.1023  0.3870  251 ILE A CB    
1943 N N     . ARG A 278 ? 1.6135 1.3188 1.3318 0.1196  0.1150  0.5041  258 ARG A N     
1944 C CA    . ARG A 278 ? 1.5675 1.2886 1.3032 0.1438  0.0913  0.4788  258 ARG A CA    
1945 C C     . ARG A 278 ? 1.6009 1.3744 1.2952 0.1647  0.0725  0.4722  258 ARG A C     
1946 O O     . ARG A 278 ? 1.7181 1.4966 1.3677 0.1741  0.0658  0.4939  258 ARG A O     
1947 C CB    . ARG A 278 ? 1.5617 1.2365 1.3188 0.1621  0.0744  0.4871  258 ARG A CB    
1948 N N     . LYS A 279 ? 1.5094 1.3189 1.2162 0.1707  0.0629  0.4412  259 LYS A N     
1949 C CA    . LYS A 279 ? 1.4549 1.3109 1.1257 0.1884  0.0407  0.4275  259 LYS A CA    
1950 C C     . LYS A 279 ? 1.1912 1.0718 0.8921 0.1955  0.0247  0.3943  259 LYS A C     
1951 O O     . LYS A 279 ? 1.1810 1.0546 0.9172 0.1823  0.0393  0.3795  259 LYS A O     
1952 C CB    . LYS A 279 ? 1.5931 1.4798 1.2177 0.1788  0.0570  0.4268  259 LYS A CB    
1953 C CG    . LYS A 279 ? 1.6003 1.5315 1.1887 0.1933  0.0357  0.4012  259 LYS A CG    
1954 C CD    . LYS A 279 ? 1.6376 1.5897 1.1657 0.1939  0.0453  0.4084  259 LYS A CD    
1955 C CE    . LYS A 279 ? 1.5491 1.5400 1.0458 0.2033  0.0302  0.3731  259 LYS A CE    
1956 N NZ    . LYS A 279 ? 1.4637 1.4627 0.9687 0.2182  -0.0096 0.3543  259 LYS A NZ    
1957 N N     . LYS A 280 ? 1.0494 0.9586 0.7370 0.2145  -0.0066 0.3832  260 LYS A N     
1958 C CA    . LYS A 280 ? 1.0348 0.9716 0.7507 0.2200  -0.0254 0.3528  260 LYS A CA    
1959 C C     . LYS A 280 ? 0.9997 0.9655 0.6914 0.2106  -0.0207 0.3271  260 LYS A C     
1960 O O     . LYS A 280 ? 1.0365 1.0164 0.6782 0.2093  -0.0166 0.3271  260 LYS A O     
1961 C CB    . LYS A 280 ? 1.1044 1.0653 0.8197 0.2395  -0.0631 0.3492  260 LYS A CB    
1962 N N     . VAL A 281 ? 0.9414 0.9148 0.6759 0.1985  -0.0210 0.2948  261 VAL A N     
1963 C CA    . VAL A 281 ? 0.8971 0.8935 0.6206 0.1862  -0.0202 0.2603  261 VAL A CA    
1964 C C     . VAL A 281 ? 0.8195 0.8332 0.5800 0.1830  -0.0438 0.2270  261 VAL A C     
1965 O O     . VAL A 281 ? 0.7613 0.7665 0.5732 0.1792  -0.0432 0.2232  261 VAL A O     
1966 C CB    . VAL A 281 ? 0.9070 0.8916 0.6466 0.1649  0.0127  0.2544  261 VAL A CB    
1967 C CG1   . VAL A 281 ? 0.9521 0.9043 0.7404 0.1548  0.0273  0.2653  261 VAL A CG1   
1968 C CG2   . VAL A 281 ? 0.8200 0.8232 0.5704 0.1537  0.0101  0.2149  261 VAL A CG2   
1969 N N     . ASP A 282 ? 0.8095 0.8460 0.5422 0.1846  -0.0638 0.2032  262 ASP A N     
1970 C CA    . ASP A 282 ? 0.7618 0.8141 0.5268 0.1778  -0.0873 0.1732  262 ASP A CA    
1971 C C     . ASP A 282 ? 0.6487 0.6967 0.4245 0.1601  -0.0752 0.1432  262 ASP A C     
1972 O O     . ASP A 282 ? 0.6178 0.6575 0.3730 0.1561  -0.0519 0.1432  262 ASP A O     
1973 C CB    . ASP A 282 ? 0.7721 0.8470 0.5020 0.1888  -0.1234 0.1643  262 ASP A CB    
1974 C CG    . ASP A 282 ? 0.9313 1.0131 0.6373 0.2100  -0.1382 0.1963  262 ASP A CG    
1975 O OD1   . ASP A 282 ? 0.9442 1.0215 0.6897 0.2170  -0.1356 0.2187  262 ASP A OD1   
1976 O OD2   . ASP A 282 ? 0.9952 1.0855 0.6392 0.2217  -0.1530 0.1986  262 ASP A OD2   
1977 N N     . GLU A 283 ? 0.6020 0.6581 0.4116 0.1499  -0.0914 0.1198  263 GLU A N     
1978 C CA    . GLU A 283 ? 0.5646 0.6130 0.3847 0.1345  -0.0834 0.0937  263 GLU A CA    
1979 C C     . GLU A 283 ? 0.5945 0.6466 0.3825 0.1343  -0.1069 0.0678  263 GLU A C     
1980 O O     . GLU A 283 ? 0.6639 0.7278 0.4271 0.1431  -0.1329 0.0668  263 GLU A O     
1981 C CB    . GLU A 283 ? 0.6230 0.6710 0.5009 0.1209  -0.0806 0.0873  263 GLU A CB    
1982 C CG    . GLU A 283 ? 0.6885 0.7266 0.5972 0.1222  -0.0589 0.1069  263 GLU A CG    
1983 C CD    . GLU A 283 ? 0.7277 0.7463 0.6246 0.1166  -0.0311 0.1118  263 GLU A CD    
1984 O OE1   . GLU A 283 ? 0.6920 0.7083 0.5824 0.1068  -0.0246 0.0947  263 GLU A OE1   
1985 O OE2   . GLU A 283 ? 0.8091 0.8148 0.7060 0.1217  -0.0168 0.1338  263 GLU A OE2   
1986 N N     . LEU A 284 ? 0.5529 0.5924 0.3408 0.1250  -0.0997 0.0462  264 LEU A N     
1987 C CA    . LEU A 284 ? 0.6091 0.6407 0.3630 0.1263  -0.1188 0.0189  264 LEU A CA    
1988 C C     . LEU A 284 ? 0.6698 0.6848 0.4517 0.1102  -0.1225 -0.0026 264 LEU A C     
1989 O O     . LEU A 284 ? 0.5532 0.5621 0.3630 0.1023  -0.1015 0.0012  264 LEU A O     
1990 C CB    . LEU A 284 ? 0.7288 0.7570 0.4288 0.1421  -0.1027 0.0159  264 LEU A CB    
1991 C CG    . LEU A 284 ? 0.7816 0.7952 0.4391 0.1495  -0.1155 -0.0156 264 LEU A CG    
1992 C CD1   . LEU A 284 ? 0.8580 0.8717 0.4824 0.1537  -0.1515 -0.0288 264 LEU A CD1   
1993 C CD2   . LEU A 284 ? 0.7057 0.7240 0.3215 0.1670  -0.0891 -0.0152 264 LEU A CD2   
1994 N N     . LEU A 285 ? 0.6050 0.6107 0.3770 0.1046  -0.1510 -0.0245 265 LEU A N     
1995 C CA    . LEU A 285 ? 0.6467 0.6285 0.4361 0.0896  -0.1576 -0.0441 265 LEU A CA    
1996 C C     . LEU A 285 ? 0.6932 0.6476 0.4331 0.0985  -0.1728 -0.0725 265 LEU A C     
1997 O O     . LEU A 285 ? 0.7201 0.6757 0.4240 0.1056  -0.1960 -0.0839 265 LEU A O     
1998 C CB    . LEU A 285 ? 0.5589 0.5494 0.3952 0.0682  -0.1782 -0.0435 265 LEU A CB    
1999 C CG    . LEU A 285 ? 0.6565 0.6704 0.5477 0.0592  -0.1621 -0.0210 265 LEU A CG    
2000 C CD1   . LEU A 285 ? 0.6496 0.6841 0.5854 0.0416  -0.1842 -0.0204 265 LEU A CD1   
2001 C CD2   . LEU A 285 ? 0.6813 0.6791 0.5893 0.0521  -0.1361 -0.0188 265 LEU A CD2   
2002 N N     . ALA A 286 ? 0.6213 0.5497 0.3574 0.0999  -0.1615 -0.0850 266 ALA A N     
2003 C CA    . ALA A 286 ? 0.8303 0.7257 0.5209 0.1122  -0.1739 -0.1144 266 ALA A CA    
2004 C C     . ALA A 286 ? 0.9442 0.7993 0.6540 0.0962  -0.1884 -0.1304 266 ALA A C     
2005 O O     . ALA A 286 ? 0.9527 0.8024 0.6955 0.0877  -0.1730 -0.1196 266 ALA A O     
2006 C CB    . ALA A 286 ? 0.6819 0.5821 0.3424 0.1371  -0.1459 -0.1153 266 ALA A CB    
2007 N N     . LEU A 287 ? 0.9182 0.7417 0.6037 0.0917  -0.2191 -0.1559 267 LEU A N     
2008 C CA    . LEU A 287 ? 0.8398 0.6183 0.5441 0.0722  -0.2362 -0.1689 267 LEU A CA    
2009 C C     . LEU A 287 ? 0.8736 0.5967 0.5300 0.0894  -0.2474 -0.2017 267 LEU A C     
2010 O O     . LEU A 287 ? 0.8937 0.6016 0.5040 0.0998  -0.2681 -0.2271 267 LEU A O     
2011 C CB    . LEU A 287 ? 0.7735 0.5575 0.5072 0.0422  -0.2671 -0.1695 267 LEU A CB    
2012 C CG    . LEU A 287 ? 0.8178 0.5535 0.5700 0.0156  -0.2906 -0.1830 267 LEU A CG    
2013 C CD1   . LEU A 287 ? 0.8261 0.5646 0.6322 -0.0056 -0.2725 -0.1576 267 LEU A CD1   
2014 C CD2   . LEU A 287 ? 0.9017 0.6434 0.6637 -0.0077 -0.3290 -0.1954 267 LEU A CD2   
2015 N N     . TYR A 288 ? 0.8863 0.5778 0.5517 0.0943  -0.2348 -0.2016 268 TYR A N     
2016 C CA    . TYR A 288 ? 1.0142 0.6454 0.6414 0.1123  -0.2452 -0.2315 268 TYR A CA    
2017 C C     . TYR A 288 ? 1.1157 0.6948 0.7664 0.0831  -0.2691 -0.2360 268 TYR A C     
2018 O O     . TYR A 288 ? 1.0849 0.6476 0.7689 0.0668  -0.2649 -0.2193 268 TYR A O     
2019 C CB    . TYR A 288 ? 1.0268 0.6574 0.6537 0.1390  -0.2168 -0.2253 268 TYR A CB    
2020 C CG    . TYR A 288 ? 0.9906 0.6752 0.6017 0.1665  -0.1879 -0.2179 268 TYR A CG    
2021 C CD1   . TYR A 288 ? 0.8530 0.5934 0.4991 0.1568  -0.1658 -0.1867 268 TYR A CD1   
2022 C CD2   . TYR A 288 ? 1.0204 0.7026 0.5870 0.2002  -0.1795 -0.2389 268 TYR A CD2   
2023 C CE1   . TYR A 288 ? 0.8188 0.6055 0.4537 0.1774  -0.1392 -0.1774 268 TYR A CE1   
2024 C CE2   . TYR A 288 ? 0.9810 0.7147 0.5338 0.2232  -0.1510 -0.2302 268 TYR A CE2   
2025 C CZ    . TYR A 288 ? 0.9009 0.6860 0.4894 0.2099  -0.1315 -0.1983 268 TYR A CZ    
2026 O OH    . TYR A 288 ? 0.8848 0.7201 0.4652 0.2278  -0.1022 -0.1858 268 TYR A OH    
2027 N N     . LYS A 289 ? 1.1550 0.7121 0.7910 0.0751  -0.2906 -0.2543 269 LYS A N     
2028 C CA    . LYS A 289 ? 1.1949 0.7056 0.8553 0.0445  -0.3118 -0.2568 269 LYS A CA    
2029 C C     . LYS A 289 ? 1.2445 0.6989 0.8721 0.0608  -0.3184 -0.2809 269 LYS A C     
2030 O O     . LYS A 289 ? 1.2351 0.6923 0.8213 0.0835  -0.3202 -0.3027 269 LYS A O     
2031 C CB    . LYS A 289 ? 1.2382 0.7740 0.9230 0.0108  -0.3364 -0.2560 269 LYS A CB    
2032 N N     . PRO A 290 ? 1.2990 0.7013 0.9435 0.0497  -0.3216 -0.2758 270 PRO A N     
2033 C CA    . PRO A 290 ? 1.3406 0.6830 0.9570 0.0661  -0.3279 -0.2968 270 PRO A CA    
2034 C C     . PRO A 290 ? 1.4192 0.7290 1.0300 0.0416  -0.3562 -0.3173 270 PRO A C     
2035 O O     . PRO A 290 ? 1.3674 0.7051 1.0021 0.0096  -0.3718 -0.3129 270 PRO A O     
2036 C CB    . PRO A 290 ? 1.3215 0.6255 0.9628 0.0599  -0.3206 -0.2764 270 PRO A CB    
2037 C CG    . PRO A 290 ? 1.3576 0.6868 1.0452 0.0201  -0.3227 -0.2491 270 PRO A CG    
2038 C CD    . PRO A 290 ? 1.2910 0.6882 0.9803 0.0230  -0.3169 -0.2471 270 PRO A CD    
2039 N N     . GLY A 291 ? 1.5245 0.7768 1.1059 0.0569  -0.3632 -0.3400 271 GLY A N     
2040 C CA    . GLY A 291 ? 1.6030 0.8166 1.1741 0.0354  -0.3907 -0.3639 271 GLY A CA    
2041 C C     . GLY A 291 ? 1.6020 0.7512 1.1988 0.0076  -0.4026 -0.3575 271 GLY A C     
2042 O O     . GLY A 291 ? 1.6911 0.8082 1.2915 -0.0203 -0.4265 -0.3729 271 GLY A O     
2043 O "O5'" . DT  B 1   ? 0.6655 0.9860 1.0648 -0.1961 -0.2081 -0.0107 1   DT  F "O5'" 
2044 C "C5'" . DT  B 1   ? 0.6858 1.0281 1.0845 -0.1840 -0.2352 -0.0134 1   DT  F "C5'" 
2045 C "C4'" . DT  B 1   ? 0.6600 1.0073 1.0594 -0.1710 -0.2241 0.0119  1   DT  F "C4'" 
2046 O "O4'" . DT  B 1   ? 0.6225 0.9762 1.0768 -0.1728 -0.1958 0.0151  1   DT  F "O4'" 
2047 C "C3'" . DT  B 1   ? 0.6252 0.9554 0.9731 -0.1662 -0.2134 0.0367  1   DT  F "C3'" 
2048 O "O3'" . DT  B 1   ? 0.7287 1.0625 1.0459 -0.1524 -0.2343 0.0524  1   DT  F "O3'" 
2049 C "C2'" . DT  B 1   ? 0.5089 0.8337 0.8857 -0.1627 -0.1819 0.0483  1   DT  F "C2'" 
2050 C "C1'" . DT  B 1   ? 0.5413 0.8867 0.9819 -0.1633 -0.1752 0.0362  1   DT  F "C1'" 
2051 N N1    . DT  B 1   ? 0.5151 0.8594 0.9876 -0.1692 -0.1394 0.0407  1   DT  F N1    
2052 C C2    . DT  B 1   ? 0.4593 0.8128 0.9446 -0.1550 -0.1185 0.0557  1   DT  F C2    
2053 O O2    . DT  B 1   ? 0.5228 0.8818 0.9996 -0.1385 -0.1311 0.0613  1   DT  F O2    
2054 N N3    . DT  B 1   ? 0.3707 0.7247 0.8768 -0.1570 -0.0826 0.0632  1   DT  F N3    
2055 C C4    . DT  B 1   ? 0.5167 0.8584 1.0389 -0.1747 -0.0668 0.0599  1   DT  F C4    
2056 O O4    . DT  B 1   ? 0.5405 0.8815 1.0797 -0.1735 -0.0324 0.0730  1   DT  F O4    
2057 C C5    . DT  B 1   ? 0.5852 0.9136 1.0990 -0.1904 -0.0944 0.0393  1   DT  F C5    
2058 C C7    . DT  B 1   ? 0.5929 0.9021 1.1261 -0.2077 -0.0859 0.0291  1   DT  F C7    
2059 C C6    . DT  B 1   ? 0.5588 0.8926 1.0469 -0.1859 -0.1290 0.0303  1   DT  F C6    
2060 P P     . DC  B 2   ? 0.8877 1.2053 1.1501 -0.1473 -0.2286 0.0801  2   DC  F P     
2061 O OP1   . DC  B 2   ? 0.7853 1.1131 1.0203 -0.1369 -0.2563 0.0967  2   DC  F OP1   
2062 O OP2   . DC  B 2   ? 0.8345 1.1340 1.0594 -0.1535 -0.2052 0.0721  2   DC  F OP2   
2063 O "O5'" . DC  B 2   ? 0.6296 0.9355 0.9211 -0.1395 -0.2116 0.0931  2   DC  F "O5'" 
2064 C "C5'" . DC  B 2   ? 0.5839 0.8933 0.9069 -0.1250 -0.2216 0.0936  2   DC  F "C5'" 
2065 C "C4'" . DC  B 2   ? 0.5654 0.8604 0.9030 -0.1132 -0.2083 0.1011  2   DC  F "C4'" 
2066 O "O4'" . DC  B 2   ? 0.4960 0.8006 0.8605 -0.1159 -0.1838 0.0890  2   DC  F "O4'" 
2067 C "C3'" . DC  B 2   ? 0.5851 0.8573 0.8903 -0.1136 -0.2044 0.1208  2   DC  F "C3'" 
2068 O "O3'" . DC  B 2   ? 0.6514 0.9071 0.9622 -0.1005 -0.2203 0.1358  2   DC  F "O3'" 
2069 C "C2'" . DC  B 2   ? 0.5539 0.8192 0.8671 -0.1112 -0.1789 0.1123  2   DC  F "C2'" 
2070 C "C1'" . DC  B 2   ? 0.4798 0.7677 0.8347 -0.1060 -0.1705 0.0955  2   DC  F "C1'" 
2071 N N1    . DC  B 2   ? 0.4641 0.7494 0.8155 -0.1078 -0.1357 0.0862  2   DC  F N1    
2072 C C2    . DC  B 2   ? 0.3827 0.6653 0.7393 -0.0877 -0.1177 0.0833  2   DC  F C2    
2073 O O2    . DC  B 2   ? 0.3059 0.5864 0.6726 -0.0687 -0.1340 0.0830  2   DC  F O2    
2074 N N3    . DC  B 2   ? 0.3487 0.6305 0.6991 -0.0869 -0.0849 0.0807  2   DC  F N3    
2075 C C4    . DC  B 2   ? 0.3499 0.6292 0.6980 -0.1080 -0.0719 0.0802  2   DC  F C4    
2076 N N4    . DC  B 2   ? 0.3037 0.5790 0.6505 -0.1068 -0.0399 0.0826  2   DC  F N4    
2077 C C5    . DC  B 2   ? 0.4692 0.7494 0.8159 -0.1284 -0.0936 0.0767  2   DC  F C5    
2078 C C6    . DC  B 2   ? 0.4848 0.7703 0.8289 -0.1260 -0.1241 0.0802  2   DC  F C6    
2079 P P     . DT  B 3   ? 0.7899 1.0280 1.0758 -0.1045 -0.2264 0.1669  3   DT  F P     
2080 O OP1   . DT  B 3   ? 0.8104 1.0403 1.1083 -0.0963 -0.2483 0.1832  3   DT  F OP1   
2081 O OP2   . DT  B 3   ? 0.7377 0.9922 0.9850 -0.1198 -0.2193 0.1750  3   DT  F OP2   
2082 O "O5'" . DT  B 3   ? 0.5907 0.8056 0.8907 -0.0973 -0.2147 0.1643  3   DT  F "O5'" 
2083 C "C5'" . DT  B 3   ? 0.5525 0.7524 0.8845 -0.0782 -0.2211 0.1493  3   DT  F "C5'" 
2084 C "C4'" . DT  B 3   ? 0.5569 0.7403 0.8947 -0.0692 -0.2120 0.1402  3   DT  F "C4'" 
2085 O "O4'" . DT  B 3   ? 0.5332 0.7375 0.8674 -0.0681 -0.1926 0.1222  3   DT  F "O4'" 
2086 C "C3'" . DT  B 3   ? 0.5868 0.7551 0.9118 -0.0808 -0.2085 0.1619  3   DT  F "C3'" 
2087 O "O3'" . DT  B 3   ? 0.7370 0.8776 1.0852 -0.0664 -0.2162 0.1538  3   DT  F "O3'" 
2088 C "C2'" . DT  B 3   ? 0.6577 0.8448 0.9575 -0.0911 -0.1862 0.1542  3   DT  F "C2'" 
2089 C "C1'" . DT  B 3   ? 0.5622 0.7545 0.8734 -0.0739 -0.1771 0.1257  3   DT  F "C1'" 
2090 N N1    . DT  B 3   ? 0.4981 0.6986 0.7803 -0.0797 -0.1453 0.1127  3   DT  F N1    
2091 C C2    . DT  B 3   ? 0.4655 0.6638 0.7445 -0.0625 -0.1261 0.0960  3   DT  F C2    
2092 O O2    . DT  B 3   ? 0.5644 0.7564 0.8573 -0.0395 -0.1352 0.0861  3   DT  F O2    
2093 N N3    . DT  B 3   ? 0.4556 0.6592 0.7150 -0.0705 -0.0977 0.0913  3   DT  F N3    
2094 C C4    . DT  B 3   ? 0.5228 0.7311 0.7699 -0.0932 -0.0906 0.0950  3   DT  F C4    
2095 O O4    . DT  B 3   ? 0.5190 0.7274 0.7587 -0.0995 -0.0678 0.0895  3   DT  F O4    
2096 C C5    . DT  B 3   ? 0.5256 0.7386 0.7704 -0.1067 -0.1138 0.1060  3   DT  F C5    
2097 C C7    . DT  B 3   ? 0.5869 0.8077 0.8130 -0.1250 -0.1131 0.1041  3   DT  F C7    
2098 C C6    . DT  B 3   ? 0.4112 0.6212 0.6716 -0.0995 -0.1377 0.1175  3   DT  F C6    
2099 P P     . DA  B 4   ? 0.7910 0.9035 1.1641 -0.0729 -0.2314 0.1807  4   DA  F P     
2100 O OP1   . DA  B 4   ? 0.6412 0.7398 1.0397 -0.0666 -0.2521 0.1834  4   DA  F OP1   
2101 O OP2   . DA  B 4   ? 0.8106 0.9399 1.1663 -0.0942 -0.2211 0.2147  4   DA  F OP2   
2102 O "O5'" . DA  B 4   ? 0.7024 0.7896 1.0946 -0.0577 -0.2344 0.1577  4   DA  F "O5'" 
2103 C "C5'" . DA  B 4   ? 0.6418 0.7134 1.0511 -0.0328 -0.2477 0.1242  4   DA  F "C5'" 
2104 C "C4'" . DA  B 4   ? 0.6135 0.6821 1.0146 -0.0134 -0.2424 0.0938  4   DA  F "C4'" 
2105 O "O4'" . DA  B 4   ? 0.5682 0.6695 0.9378 -0.0130 -0.2203 0.0890  4   DA  F "O4'" 
2106 C "C3'" . DA  B 4   ? 0.6265 0.6725 1.0425 -0.0201 -0.2460 0.1004  4   DA  F "C3'" 
2107 O "O3'" . DA  B 4   ? 0.6912 0.7193 1.1136 0.0064  -0.2577 0.0628  4   DA  F "O3'" 
2108 C "C2'" . DA  B 4   ? 0.6045 0.6769 0.9897 -0.0336 -0.2220 0.1141  4   DA  F "C2'" 
2109 C "C1'" . DA  B 4   ? 0.5809 0.6807 0.9394 -0.0199 -0.2098 0.0942  4   DA  F "C1'" 
2110 N N9    . DA  B 4   ? 0.5943 0.7211 0.9237 -0.0401 -0.1867 0.1101  4   DA  F N9    
2111 C C8    . DA  B 4   ? 0.6472 0.7840 0.9646 -0.0661 -0.1800 0.1376  4   DA  F C8    
2112 N N7    . DA  B 4   ? 0.6550 0.8034 0.9294 -0.0763 -0.1520 0.1347  4   DA  F N7    
2113 C C5    . DA  B 4   ? 0.5986 0.7436 0.8591 -0.0586 -0.1366 0.1097  4   DA  F C5    
2114 C C6    . DA  B 4   ? 0.6194 0.7693 0.8456 -0.0593 -0.1065 0.0992  4   DA  F C6    
2115 N N6    . DA  B 4   ? 0.6127 0.7693 0.8151 -0.0794 -0.0906 0.1060  4   DA  F N6    
2116 N N1    . DA  B 4   ? 0.5125 0.6600 0.7313 -0.0359 -0.0951 0.0816  4   DA  F N1    
2117 C C2    . DA  B 4   ? 0.4854 0.6274 0.7246 -0.0102 -0.1152 0.0684  4   DA  F C2    
2118 N N3    . DA  B 4   ? 0.4986 0.6322 0.7751 -0.0069 -0.1484 0.0700  4   DA  F N3    
2119 C C4    . DA  B 4   ? 0.5220 0.6567 0.8102 -0.0340 -0.1564 0.0943  4   DA  F C4    
2120 P P     . DA  B 5   ? 0.8243 0.8210 1.2768 0.0051  -0.2719 0.0573  5   DA  F P     
2121 O OP1   . DA  B 5   ? 0.8727 0.8360 1.3605 0.0182  -0.3011 0.0335  5   DA  F OP1   
2122 O OP2   . DA  B 5   ? 0.9251 0.9243 1.3947 -0.0248 -0.2633 0.0998  5   DA  F OP2   
2123 O "O5'" . DA  B 5   ? 0.6962 0.7059 1.1126 0.0282  -0.2606 0.0271  5   DA  F "O5'" 
2124 C "C5'" . DA  B 5   ? 0.6771 0.7137 1.0641 0.0194  -0.2366 0.0422  5   DA  F "C5'" 
2125 C "C4'" . DA  B 5   ? 0.6086 0.6554 0.9609 0.0497  -0.2292 0.0120  5   DA  F "C4'" 
2126 O "O4'" . DA  B 5   ? 0.5593 0.6377 0.8839 0.0461  -0.2067 0.0255  5   DA  F "O4'" 
2127 C "C3'" . DA  B 5   ? 0.5684 0.6021 0.9231 0.0524  -0.2317 0.0041  5   DA  F "C3'" 
2128 O "O3'" . DA  B 5   ? 0.6195 0.6532 0.9398 0.0890  -0.2323 -0.0308 5   DA  F "O3'" 
2129 C "C2'" . DA  B 5   ? 0.5562 0.6128 0.9005 0.0293  -0.2100 0.0345  5   DA  F "C2'" 
2130 C "C1'" . DA  B 5   ? 0.6306 0.7078 0.9351 0.0299  -0.1868 0.0384  5   DA  F "C1'" 
2131 N N9    . DA  B 5   ? 0.6635 0.7520 0.9549 -0.0054 -0.1645 0.0698  5   DA  F N9    
2132 C C8    . DA  B 5   ? 0.6642 0.7557 0.9891 -0.0305 -0.1763 0.0982  5   DA  F C8    
2133 N N7    . DA  B 5   ? 0.7058 0.8116 1.0001 -0.0534 -0.1528 0.1187  5   DA  F N7    
2134 C C5    . DA  B 5   ? 0.6527 0.7611 0.8987 -0.0460 -0.1253 0.1020  5   DA  F C5    
2135 C C6    . DA  B 5   ? 0.6513 0.7691 0.8562 -0.0605 -0.0973 0.1068  5   DA  F C6    
2136 N N6    . DA  B 5   ? 0.6912 0.8217 0.8880 -0.0825 -0.0933 0.1262  5   DA  F N6    
2137 N N1    . DA  B 5   ? 0.6542 0.7682 0.8279 -0.0492 -0.0754 0.0909  5   DA  F N1    
2138 C C2    . DA  B 5   ? 0.6089 0.7148 0.7823 -0.0217 -0.0788 0.0730  5   DA  F C2    
2139 N N3    . DA  B 5   ? 0.5377 0.6369 0.7400 -0.0017 -0.1058 0.0615  5   DA  F N3    
2140 C C4    . DA  B 5   ? 0.5938 0.6925 0.8366 -0.0171 -0.1296 0.0759  5   DA  F C4    
2141 P P     . DA  B 6   ? 0.8728 0.8898 1.1914 0.0999  -0.2407 -0.0503 6   DA  F P     
2142 O OP1   . DA  B 6   ? 0.8219 0.8320 1.1088 0.1384  -0.2516 -0.0911 6   DA  F OP1   
2143 O OP2   . DA  B 6   ? 0.8416 0.8381 1.2177 0.0706  -0.2559 -0.0342 6   DA  F OP2   
2144 O "O5'" . DA  B 6   ? 0.6562 0.6941 0.9428 0.0997  -0.2156 -0.0349 6   DA  F "O5'" 
2145 C "C5'" . DA  B 6   ? 0.6492 0.6992 0.8793 0.1345  -0.1994 -0.0505 6   DA  F "C5'" 
2146 C "C4'" . DA  B 6   ? 0.6103 0.6661 0.7984 0.1163  -0.1595 -0.0278 6   DA  F "C4'" 
2147 O "O4'" . DA  B 6   ? 0.5861 0.6494 0.7831 0.0748  -0.1404 0.0030  6   DA  F "O4'" 
2148 C "C3'" . DA  B 6   ? 0.5781 0.6245 0.7716 0.1117  -0.1613 -0.0282 6   DA  F "C3'" 
2149 O "O3'" . DA  B 6   ? 0.6637 0.7074 0.8002 0.1416  -0.1442 -0.0414 6   DA  F "O3'" 
2150 C "C2'" . DA  B 6   ? 0.5171 0.5694 0.7148 0.0673  -0.1354 0.0051  6   DA  F "C2'" 
2151 C "C1'" . DA  B 6   ? 0.5426 0.6047 0.7212 0.0527  -0.1164 0.0195  6   DA  F "C1'" 
2152 N N9    . DA  B 6   ? 0.5864 0.6570 0.7889 0.0152  -0.1122 0.0466  6   DA  F N9    
2153 C C8    . DA  B 6   ? 0.5468 0.6194 0.8044 0.0006  -0.1377 0.0596  6   DA  F C8    
2154 N N7    . DA  B 6   ? 0.5696 0.6546 0.8290 -0.0290 -0.1252 0.0876  6   DA  F N7    
2155 C C5    . DA  B 6   ? 0.5500 0.6394 0.7546 -0.0342 -0.0929 0.0872  6   DA  F C5    
2156 C C6    . DA  B 6   ? 0.5884 0.6902 0.7669 -0.0569 -0.0716 0.1039  6   DA  F C6    
2157 N N6    . DA  B 6   ? 0.4894 0.6063 0.6851 -0.0770 -0.0767 0.1283  6   DA  F N6    
2158 N N1    . DA  B 6   ? 0.6285 0.7266 0.7631 -0.0556 -0.0466 0.0946  6   DA  F N1    
2159 C C2    . DA  B 6   ? 0.5918 0.6764 0.7079 -0.0338 -0.0393 0.0770  6   DA  F C2    
2160 N N3    . DA  B 6   ? 0.5450 0.6216 0.6730 -0.0081 -0.0550 0.0622  6   DA  F N3    
2161 C C4    . DA  B 6   ? 0.5650 0.6439 0.7385 -0.0094 -0.0837 0.0648  6   DA  F C4    
2162 P P     . DG  B 7   ? 0.6332 0.6685 0.7632 0.1436  -0.1417 -0.0442 7   DG  F P     
2163 O OP1   . DG  B 7   ? 0.4937 0.5250 0.5736 0.1912  -0.1434 -0.0675 7   DG  F OP1   
2164 O OP2   . DG  B 7   ? 0.5835 0.6175 0.7855 0.1265  -0.1725 -0.0452 7   DG  F OP2   
2165 O "O5'" . DG  B 7   ? 0.4759 0.5134 0.5761 0.1096  -0.0984 -0.0144 7   DG  F "O5'" 
2166 C "C5'" . DG  B 7   ? 0.4884 0.5233 0.5308 0.1181  -0.0646 -0.0067 7   DG  F "C5'" 
2167 C "C4'" . DG  B 7   ? 0.5111 0.5438 0.5418 0.0844  -0.0347 0.0148  7   DG  F "C4'" 
2168 O "O4'" . DG  B 7   ? 0.3975 0.4417 0.4628 0.0494  -0.0384 0.0290  7   DG  F "O4'" 
2169 C "C3'" . DG  B 7   ? 0.4534 0.4786 0.4800 0.0839  -0.0308 0.0128  7   DG  F "C3'" 
2170 O "O3'" . DG  B 7   ? 0.4061 0.4201 0.3930 0.0791  0.0002  0.0227  7   DG  F "O3'" 
2171 C "C2'" . DG  B 7   ? 0.4284 0.4676 0.5006 0.0520  -0.0389 0.0236  7   DG  F "C2'" 
2172 C "C1'" . DG  B 7   ? 0.3930 0.4402 0.4660 0.0287  -0.0303 0.0383  7   DG  F "C1'" 
2173 N N9    . DG  B 7   ? 0.3403 0.4033 0.4584 0.0052  -0.0449 0.0518  7   DG  F N9    
2174 C C8    . DG  B 7   ? 0.4226 0.4890 0.5924 0.0089  -0.0755 0.0496  7   DG  F C8    
2175 N N7    . DG  B 7   ? 0.4639 0.5449 0.6698 -0.0164 -0.0805 0.0718  7   DG  F N7    
2176 C C5    . DG  B 7   ? 0.4013 0.4918 0.5697 -0.0347 -0.0524 0.0855  7   DG  F C5    
2177 C C6    . DG  B 7   ? 0.4144 0.5254 0.5886 -0.0593 -0.0443 0.1103  7   DG  F C6    
2178 O O6    . DG  B 7   ? 0.4651 0.5903 0.6813 -0.0724 -0.0573 0.1325  7   DG  F O6    
2179 N N1    . DG  B 7   ? 0.4916 0.6058 0.6173 -0.0664 -0.0199 0.1089  7   DG  F N1    
2180 C C2    . DG  B 7   ? 0.5694 0.6656 0.6559 -0.0551 -0.0046 0.0900  7   DG  F C2    
2181 N N2    . DG  B 7   ? 0.6996 0.7980 0.7528 -0.0648 0.0131  0.0886  7   DG  F N2    
2182 N N3    . DG  B 7   ? 0.3616 0.4389 0.4429 -0.0336 -0.0081 0.0741  7   DG  F N3    
2183 C C4    . DG  B 7   ? 0.3813 0.4587 0.5003 -0.0228 -0.0323 0.0711  7   DG  F C4    
2184 P P     . DA  B 8   ? 0.4077 0.4112 0.3812 0.0818  0.0099  0.0203  8   DA  F P     
2185 O OP1   . DA  B 8   ? 0.4332 0.4167 0.3624 0.0992  0.0316  0.0252  8   DA  F OP1   
2186 O OP2   . DA  B 8   ? 0.3915 0.4015 0.3936 0.0967  -0.0158 0.0057  8   DA  F OP2   
2187 O "O5'" . DA  B 8   ? 0.3504 0.3629 0.3357 0.0452  0.0242  0.0318  8   DA  F "O5'" 
2188 C "C5'" . DA  B 8   ? 0.4465 0.4505 0.4112 0.0289  0.0453  0.0405  8   DA  F "C5'" 
2189 C "C4'" . DA  B 8   ? 0.4087 0.4241 0.3792 0.0032  0.0523  0.0431  8   DA  F "C4'" 
2190 O "O4'" . DA  B 8   ? 0.3593 0.4017 0.3597 -0.0125 0.0389  0.0507  8   DA  F "O4'" 
2191 C "C3'" . DA  B 8   ? 0.4034 0.4162 0.3654 0.0092  0.0593  0.0352  8   DA  F "C3'" 
2192 O "O3'" . DA  B 8   ? 0.4960 0.5013 0.4406 -0.0037 0.0730  0.0317  8   DA  F "O3'" 
2193 C "C2'" . DA  B 8   ? 0.3182 0.3629 0.3134 0.0022  0.0479  0.0395  8   DA  F "C2'" 
2194 C "C1'" . DA  B 8   ? 0.3777 0.4386 0.3880 -0.0182 0.0414  0.0524  8   DA  F "C1'" 
2195 N N9    . DA  B 8   ? 0.4452 0.5289 0.4988 -0.0238 0.0244  0.0638  8   DA  F N9    
2196 C C8    . DA  B 8   ? 0.4001 0.4794 0.4850 -0.0101 0.0037  0.0592  8   DA  F C8    
2197 N N7    . DA  B 8   ? 0.4421 0.5414 0.5758 -0.0217 -0.0118 0.0732  8   DA  F N7    
2198 C C5    . DA  B 8   ? 0.4506 0.5717 0.5769 -0.0430 0.0031  0.0922  8   DA  F C5    
2199 C C6    . DA  B 8   ? 0.4847 0.6344 0.6453 -0.0615 -0.0001 0.1193  8   DA  F C6    
2200 N N6    . DA  B 8   ? 0.4330 0.5901 0.6556 -0.0656 -0.0212 0.1331  8   DA  F N6    
2201 N N1    . DA  B 8   ? 0.5712 0.7416 0.7018 -0.0736 0.0176  0.1323  8   DA  F N1    
2202 C C2    . DA  B 8   ? 0.5106 0.6697 0.5882 -0.0691 0.0331  0.1139  8   DA  F C2    
2203 N N3    . DA  B 8   ? 0.3204 0.4491 0.3721 -0.0560 0.0369  0.0899  8   DA  F N3    
2204 C C4    . DA  B 8   ? 0.4003 0.5126 0.4753 -0.0430 0.0234  0.0828  8   DA  F C4    
2205 P P     . DT  B 9   ? 0.5603 0.5504 0.4876 0.0073  0.0831  0.0187  9   DT  F P     
2206 O OP1   . DT  B 9   ? 0.5309 0.4974 0.4454 -0.0021 0.0914  0.0134  9   DT  F OP1   
2207 O OP2   . DT  B 9   ? 0.5458 0.5213 0.4694 0.0325  0.0804  0.0162  9   DT  F OP2   
2208 O "O5'" . DT  B 9   ? 0.4653 0.4930 0.4023 0.0008  0.0829  0.0156  9   DT  F "O5'" 
2209 C "C5'" . DT  B 9   ? 0.4637 0.5110 0.3934 -0.0156 0.0855  0.0150  9   DT  F "C5'" 
2210 C "C4'" . DT  B 9   ? 0.5309 0.6246 0.4711 -0.0171 0.0885  0.0223  9   DT  F "C4'" 
2211 O "O4'" . DT  B 9   ? 0.3414 0.4571 0.3152 -0.0256 0.0793  0.0440  9   DT  F "O4'" 
2212 C "C3'" . DT  B 9   ? 0.4369 0.5429 0.3816 0.0005  0.0963  0.0137  9   DT  F "C3'" 
2213 O "O3'" . DT  B 9   ? 0.5233 0.6359 0.4391 0.0077  0.1061  -0.0049 9   DT  F "O3'" 
2214 C "C2'" . DT  B 9   ? 0.3865 0.5390 0.3706 -0.0050 0.0955  0.0364  9   DT  F "C2'" 
2215 C "C1'" . DT  B 9   ? 0.4073 0.5648 0.4007 -0.0246 0.0860  0.0555  9   DT  F "C1'" 
2216 N N1    . DT  B 9   ? 0.3452 0.5187 0.3910 -0.0316 0.0730  0.0775  9   DT  F N1    
2217 C C2    . DT  B 9   ? 0.3900 0.6002 0.4592 -0.0467 0.0736  0.1054  9   DT  F C2    
2218 O O2    . DT  B 9   ? 0.4083 0.6436 0.4501 -0.0517 0.0855  0.1135  9   DT  F O2    
2219 N N3    . DT  B 9   ? 0.3904 0.6069 0.5174 -0.0533 0.0575  0.1236  9   DT  F N3    
2220 C C4    . DT  B 9   ? 0.3787 0.5710 0.5386 -0.0437 0.0382  0.1111  9   DT  F C4    
2221 O O4    . DT  B 9   ? 0.2939 0.4920 0.5118 -0.0493 0.0191  0.1243  9   DT  F O4    
2222 C C5    . DT  B 9   ? 0.3503 0.5091 0.4731 -0.0243 0.0396  0.0814  9   DT  F C5    
2223 C C7    . DT  B 9   ? 0.3150 0.4497 0.4594 -0.0061 0.0182  0.0648  9   DT  F C7    
2224 C C6    . DT  B 9   ? 0.3046 0.4545 0.3748 -0.0208 0.0580  0.0692  9   DT  F C6    
2225 P P     . DC  B 10  ? 0.5481 0.6716 0.4614 0.0305  0.1157  -0.0217 10  DC  F P     
2226 O OP1   . DC  B 10  ? 0.4634 0.5631 0.3436 0.0393  0.1167  -0.0498 10  DC  F OP1   
2227 O OP2   . DC  B 10  ? 0.4124 0.5173 0.3486 0.0422  0.1106  -0.0201 10  DC  F OP2   
2228 O "O5'" . DC  B 10  ? 0.4635 0.6556 0.3928 0.0303  0.1278  -0.0048 10  DC  F "O5'" 
2229 C "C5'" . DC  B 10  ? 0.4452 0.6736 0.3463 0.0288  0.1360  -0.0044 10  DC  F "C5'" 
2230 C "C4'" . DC  B 10  ? 0.4366 0.7314 0.3639 0.0240  0.1491  0.0298  10  DC  F "C4'" 
2231 O "O4'" . DC  B 10  ? 0.5198 0.8097 0.4875 0.0028  0.1381  0.0595  10  DC  F "O4'" 
2232 C "C3'" . DC  B 10  ? 0.4356 0.7706 0.3967 0.0385  0.1640  0.0360  10  DC  F "C3'" 
2233 O "O3'" . DC  B 10  ? 0.4752 0.8467 0.4008 0.0619  0.1813  0.0176  10  DC  F "O3'" 
2234 C "C2'" . DC  B 10  ? 0.5160 0.8982 0.5288 0.0214  0.1693  0.0818  10  DC  F "C2'" 
2235 C "C1'" . DC  B 10  ? 0.5071 0.8510 0.5212 -0.0009 0.1491  0.0928  10  DC  F "C1'" 
2236 N N1    . DC  B 10  ? 0.4749 0.8008 0.5522 -0.0130 0.1317  0.1081  10  DC  F N1    
2237 C C2    . DC  B 10  ? 0.5565 0.9091 0.6836 -0.0314 0.1271  0.1466  10  DC  F C2    
2238 O O2    . DC  B 10  ? 0.6720 1.0631 0.7865 -0.0379 0.1404  0.1729  10  DC  F O2    
2239 N N3    . DC  B 10  ? 0.4928 0.8269 0.6808 -0.0392 0.1058  0.1534  10  DC  F N3    
2240 C C4    . DC  B 10  ? 0.4522 0.7479 0.6442 -0.0265 0.0909  0.1240  10  DC  F C4    
2241 N N4    . DC  B 10  ? 0.3245 0.6048 0.5740 -0.0295 0.0656  0.1261  10  DC  F N4    
2242 C C5    . DC  B 10  ? 0.4185 0.6889 0.5564 -0.0075 0.0986  0.0906  10  DC  F C5    
2243 C C6    . DC  B 10  ? 0.4193 0.7038 0.5058 -0.0030 0.1183  0.0839  10  DC  F C6    
2244 P P     . DG  B 11  ? 0.4831 0.9002 0.4378 0.0840  0.1996  0.0152  11  DG  F P     
2245 O OP1   . DG  B 11  ? 0.5306 0.9640 0.4341 0.1131  0.2101  -0.0191 11  DG  F OP1   
2246 O OP2   . DG  B 11  ? 0.4890 0.8667 0.4867 0.0824  0.1854  0.0091  11  DG  F OP2   
2247 O "O5'" . DG  B 11  ? 0.6094 1.1049 0.6091 0.0741  0.2202  0.0654  11  DG  F "O5'" 
2248 C "C5'" . DG  B 11  ? 0.5806 1.1084 0.5452 0.0778  0.2298  0.0786  11  DG  F "C5'" 
2249 C "C4'" . DG  B 11  ? 0.5939 1.1610 0.6120 0.0597  0.2371  0.1314  11  DG  F "C4'" 
2250 O "O4'" . DG  B 11  ? 0.5977 1.1382 0.6557 0.0321  0.2208  0.1543  11  DG  F "O4'" 
2251 C "C3'" . DG  B 11  ? 0.6194 1.2274 0.7039 0.0638  0.2513  0.1490  11  DG  F "C3'" 
2252 O "O3'" . DG  B 11  ? 0.5677 1.2207 0.6259 0.0848  0.2710  0.1510  11  DG  F "O3'" 
2253 C "C2'" . DG  B 11  ? 0.5965 1.2114 0.7526 0.0352  0.2441  0.1968  11  DG  F "C2'" 
2254 C "C1'" . DG  B 11  ? 0.6362 1.2010 0.7762 0.0175  0.2218  0.1918  11  DG  F "C1'" 
2255 N N9    . DG  B 11  ? 0.6426 1.1814 0.8391 0.0072  0.2054  0.1853  11  DG  F N9    
2256 C C8    . DG  B 11  ? 0.5736 1.0796 0.7606 0.0222  0.1966  0.1452  11  DG  F C8    
2257 N N7    . DG  B 11  ? 0.5234 0.9878 0.7559 0.0127  0.1699  0.1397  11  DG  F N7    
2258 C C5    . DG  B 11  ? 0.5461 1.0265 0.8317 -0.0112 0.1630  0.1798  11  DG  F C5    
2259 C C6    . DG  B 11  ? 0.4860 0.9372 0.8363 -0.0267 0.1329  0.1878  11  DG  F C6    
2260 O O6    . DG  B 11  ? 0.4159 0.8240 0.7827 -0.0196 0.1065  0.1598  11  DG  F O6    
2261 N N1    . DG  B 11  ? 0.5375 1.0138 0.9331 -0.0489 0.1329  0.2325  11  DG  F N1    
2262 C C2    . DG  B 11  ? 0.5490 1.0471 0.9043 -0.0507 0.1516  0.2563  11  DG  F C2    
2263 N N2    . DG  B 11  ? 0.4680 0.9594 0.8558 -0.0665 0.1392  0.2892  11  DG  F N2    
2264 N N3    . DG  B 11  ? 0.6154 1.1395 0.9039 -0.0338 0.1775  0.2462  11  DG  F N3    
2265 C C4    . DG  B 11  ? 0.6239 1.1465 0.8875 -0.0159 0.1849  0.2101  11  DG  F C4    
2266 O "O5'" . DA  C 1   ? 0.4865 0.6111 0.7974 -0.0971 -0.0940 0.1138  1   DA  G "O5'" 
2267 C "C5'" . DA  C 1   ? 0.4773 0.6001 0.8330 -0.1116 -0.1139 0.1321  1   DA  G "C5'" 
2268 C "C4'" . DA  C 1   ? 0.5631 0.6885 0.9266 -0.1320 -0.1123 0.1671  1   DA  G "C4'" 
2269 O "O4'" . DA  C 1   ? 0.5494 0.6964 0.8767 -0.1393 -0.0843 0.1849  1   DA  G "O4'" 
2270 C "C3'" . DA  C 1   ? 0.5787 0.6932 0.9329 -0.1315 -0.1142 0.1662  1   DA  G "C3'" 
2271 O "O3'" . DA  C 1   ? 0.4908 0.5998 0.8860 -0.1464 -0.1340 0.1917  1   DA  G "O3'" 
2272 C "C2'" . DA  C 1   ? 0.6258 0.7567 0.9300 -0.1336 -0.0832 0.1745  1   DA  G "C2'" 
2273 C "C1'" . DA  C 1   ? 0.6122 0.7641 0.9168 -0.1451 -0.0726 0.1972  1   DA  G "C1'" 
2274 N N9    . DA  C 1   ? 0.5616 0.7314 0.8212 -0.1424 -0.0424 0.1955  1   DA  G N9    
2275 C C8    . DA  C 1   ? 0.4528 0.6451 0.6936 -0.1529 -0.0260 0.2160  1   DA  G C8    
2276 N N7    . DA  C 1   ? 0.4812 0.6852 0.6869 -0.1464 -0.0011 0.2049  1   DA  G N7    
2277 C C5    . DA  C 1   ? 0.5536 0.7421 0.7538 -0.1309 0.0000  0.1791  1   DA  G C5    
2278 C C6    . DA  C 1   ? 0.4992 0.6910 0.6723 -0.1178 0.0212  0.1609  1   DA  G C6    
2279 N N6    . DA  C 1   ? 0.4493 0.6578 0.5983 -0.1191 0.0451  0.1631  1   DA  G N6    
2280 N N1    . DA  C 1   ? 0.5330 0.7133 0.7083 -0.1023 0.0163  0.1402  1   DA  G N1    
2281 C C2    . DA  C 1   ? 0.5666 0.7328 0.7693 -0.0997 -0.0094 0.1337  1   DA  G C2    
2282 N N3    . DA  C 1   ? 0.5798 0.7378 0.8136 -0.1115 -0.0321 0.1468  1   DA  G N3    
2283 C C4    . DA  C 1   ? 0.5766 0.7462 0.8073 -0.1275 -0.0253 0.1718  1   DA  G C4    
2284 P P     . DC  C 2   ? 0.7363 0.8345 1.1301 -0.1476 -0.1402 0.1948  2   DC  G P     
2285 O OP1   . DC  C 2   ? 0.7717 0.8564 1.2264 -0.1564 -0.1709 0.2094  2   DC  G OP1   
2286 O OP2   . DC  C 2   ? 0.6634 0.7520 1.0231 -0.1292 -0.1317 0.1602  2   DC  G OP2   
2287 O "O5'" . DC  C 2   ? 0.5807 0.7033 0.9423 -0.1600 -0.1171 0.2245  2   DC  G "O5'" 
2288 C "C5'" . DC  C 2   ? 0.5968 0.7399 0.9806 -0.1772 -0.1186 0.2631  2   DC  G "C5'" 
2289 C "C4'" . DC  C 2   ? 0.5860 0.7560 0.9388 -0.1847 -0.1001 0.2855  2   DC  G "C4'" 
2290 O "O4'" . DC  C 2   ? 0.5832 0.7701 0.8869 -0.1788 -0.0718 0.2719  2   DC  G "O4'" 
2291 C "C3'" . DC  C 2   ? 0.6504 0.8111 0.9942 -0.1811 -0.1041 0.2795  2   DC  G "C3'" 
2292 O "O3'" . DC  C 2   ? 0.8045 0.9762 1.1816 -0.1938 -0.1184 0.3155  2   DC  G "O3'" 
2293 C "C2'" . DC  C 2   ? 0.5412 0.7209 0.8300 -0.1757 -0.0757 0.2680  2   DC  G "C2'" 
2294 C "C1'" . DC  C 2   ? 0.5533 0.7536 0.8241 -0.1773 -0.0572 0.2706  2   DC  G "C1'" 
2295 N N1    . DC  C 2   ? 0.6038 0.8022 0.8333 -0.1647 -0.0344 0.2398  2   DC  G N1    
2296 C C2    . DC  C 2   ? 0.5275 0.7526 0.7235 -0.1648 -0.0115 0.2398  2   DC  G C2    
2297 O O2    . DC  C 2   ? 0.5009 0.7548 0.6972 -0.1742 -0.0101 0.2639  2   DC  G O2    
2298 N N3    . DC  C 2   ? 0.3978 0.6196 0.5653 -0.1537 0.0082  0.2134  2   DC  G N3    
2299 C C4    . DC  C 2   ? 0.4665 0.6632 0.6346 -0.1424 0.0068  0.1911  2   DC  G C4    
2300 N N4    . DC  C 2   ? 0.3412 0.5381 0.4852 -0.1316 0.0272  0.1702  2   DC  G N4    
2301 C C5    . DC  C 2   ? 0.4612 0.6350 0.6581 -0.1405 -0.0161 0.1891  2   DC  G C5    
2302 C C6    . DC  C 2   ? 0.5444 0.7182 0.7729 -0.1520 -0.0367 0.2120  2   DC  G C6    
2303 P P     . DG  C 3   ? 1.0660 1.2229 1.4547 -0.1920 -0.1329 0.3150  3   DG  G P     
2304 O OP1   . DG  C 3   ? 0.9243 1.0867 1.3601 -0.2005 -0.1530 0.3508  3   DG  G OP1   
2305 O OP2   . DG  C 3   ? 1.0774 1.1992 1.4636 -0.1774 -0.1415 0.2740  3   DG  G OP2   
2306 O "O5'" . DG  C 3   ? 0.9633 1.1474 1.3002 -0.1900 -0.1090 0.3152  3   DG  G "O5'" 
2307 C "C5'" . DG  C 3   ? 0.9706 1.1979 1.2963 -0.1988 -0.0969 0.3475  3   DG  G "C5'" 
2308 C "C4'" . DG  C 3   ? 1.0273 1.2782 1.3073 -0.1942 -0.0769 0.3372  3   DG  G "C4'" 
2309 O "O4'" . DG  C 3   ? 1.0218 1.2682 1.2633 -0.1845 -0.0558 0.3032  3   DG  G "O4'" 
2310 C "C3'" . DG  C 3   ? 1.0529 1.2860 1.3311 -0.1886 -0.0859 0.3247  3   DG  G "C3'" 
2311 O "O3'" . DG  C 3   ? 1.1527 1.4244 1.4096 -0.1903 -0.0759 0.3391  3   DG  G "O3'" 
2312 C "C2'" . DG  C 3   ? 0.9627 1.1671 1.2126 -0.1750 -0.0755 0.2795  3   DG  G "C2'" 
2313 C "C1'" . DG  C 3   ? 0.9527 1.1791 1.1728 -0.1737 -0.0516 0.2722  3   DG  G "C1'" 
2314 N N9    . DG  C 3   ? 0.9077 1.1082 1.1158 -0.1633 -0.0439 0.2402  3   DG  G N9    
2315 C C8    . DG  C 3   ? 0.9653 1.1334 1.1956 -0.1582 -0.0590 0.2273  3   DG  G C8    
2316 N N7    . DG  C 3   ? 0.9050 1.0622 1.1166 -0.1473 -0.0466 0.2009  3   DG  G N7    
2317 C C5    . DG  C 3   ? 0.7573 0.9372 0.9359 -0.1462 -0.0220 0.1963  3   DG  G C5    
2318 C C6    . DG  C 3   ? 0.5968 0.7776 0.7503 -0.1365 -0.0004 0.1740  3   DG  G C6    
2319 O O6    . DG  C 3   ? 0.5524 0.7162 0.7044 -0.1262 0.0023  0.1559  3   DG  G O6    
2320 N N1    . DG  C 3   ? 0.6253 0.8328 0.7568 -0.1384 0.0190  0.1742  3   DG  G N1    
2321 C C2    . DG  C 3   ? 0.7598 0.9949 0.8895 -0.1472 0.0178  0.1924  3   DG  G C2    
2322 N N2    . DG  C 3   ? 0.8470 1.1101 0.9559 -0.1457 0.0368  0.1847  3   DG  G N2    
2323 N N3    . DG  C 3   ? 0.7326 0.9708 0.8825 -0.1558 -0.0013 0.2167  3   DG  G N3    
2324 C C4    . DG  C 3   ? 0.7712 0.9786 0.9468 -0.1555 -0.0205 0.2178  3   DG  G C4    
2325 P P     . DA  C 4   ? 1.1199 1.3898 1.3882 -0.1900 -0.0899 0.3485  4   DA  G P     
2326 O OP1   . DA  C 4   ? 1.0113 1.3129 1.3119 -0.2014 -0.1013 0.3978  4   DA  G OP1   
2327 O OP2   . DA  C 4   ? 1.1180 1.3374 1.4004 -0.1829 -0.1046 0.3210  4   DA  G OP2   
2328 O "O5'" . DA  C 4   ? 1.0023 1.3005 1.2237 -0.1823 -0.0691 0.3286  4   DA  G "O5'" 
2329 C "C5'" . DA  C 4   ? 0.8703 1.2195 1.0669 -0.1837 -0.0505 0.3383  4   DA  G "C5'" 
2330 C "C4'" . DA  C 4   ? 0.6993 1.0581 0.8561 -0.1733 -0.0306 0.3009  4   DA  G "C4'" 
2331 O "O4'" . DA  C 4   ? 0.5718 0.8965 0.7182 -0.1674 -0.0204 0.2685  4   DA  G "O4'" 
2332 C "C3'" . DA  C 4   ? 0.5739 0.9222 0.7232 -0.1668 -0.0351 0.2838  4   DA  G "C3'" 
2333 O "O3'" . DA  C 4   ? 0.5932 0.9854 0.7144 -0.1614 -0.0195 0.2719  4   DA  G "O3'" 
2334 C "C2'" . DA  C 4   ? 0.5250 0.8202 0.6713 -0.1591 -0.0339 0.2473  4   DA  G "C2'" 
2335 C "C1'" . DA  C 4   ? 0.5627 0.8594 0.6972 -0.1579 -0.0175 0.2354  4   DA  G "C1'" 
2336 N N9    . DA  C 4   ? 0.6819 0.9332 0.8243 -0.1532 -0.0203 0.2164  4   DA  G N9    
2337 C C8    . DA  C 4   ? 0.7106 0.9291 0.8806 -0.1550 -0.0403 0.2233  4   DA  G C8    
2338 N N7    . DA  C 4   ? 0.6645 0.8535 0.8339 -0.1474 -0.0380 0.2005  4   DA  G N7    
2339 C C5    . DA  C 4   ? 0.5936 0.7949 0.7349 -0.1413 -0.0143 0.1807  4   DA  G C5    
2340 C C6    . DA  C 4   ? 0.5092 0.6952 0.6386 -0.1317 0.0000  0.1560  4   DA  G C6    
2341 N N6    . DA  C 4   ? 0.3611 0.5192 0.5013 -0.1251 -0.0080 0.1455  4   DA  G N6    
2342 N N1    . DA  C 4   ? 0.4837 0.6877 0.5927 -0.1280 0.0222  0.1424  4   DA  G N1    
2343 C C2    . DA  C 4   ? 0.5316 0.7686 0.6309 -0.1327 0.0289  0.1490  4   DA  G C2    
2344 N N3    . DA  C 4   ? 0.5036 0.7623 0.6081 -0.1405 0.0174  0.1710  4   DA  G N3    
2345 C C4    . DA  C 4   ? 0.5567 0.7947 0.6829 -0.1450 -0.0037 0.1883  4   DA  G C4    
2346 P P     . DT  C 5   ? 0.6779 1.0827 0.7906 -0.1557 -0.0234 0.2628  5   DT  G P     
2347 O OP1   . DT  C 5   ? 0.5564 1.0290 0.6535 -0.1546 -0.0150 0.2757  5   DT  G OP1   
2348 O OP2   . DT  C 5   ? 0.7004 1.0740 0.8391 -0.1593 -0.0453 0.2802  5   DT  G OP2   
2349 O "O5'" . DT  C 5   ? 0.5543 0.9292 0.6491 -0.1455 -0.0102 0.2143  5   DT  G "O5'" 
2350 C "C5'" . DT  C 5   ? 0.4761 0.8625 0.5548 -0.1414 0.0097  0.1911  5   DT  G "C5'" 
2351 C "C4'" . DT  C 5   ? 0.4902 0.8353 0.5650 -0.1332 0.0189  0.1535  5   DT  G "C4'" 
2352 O "O4'" . DT  C 5   ? 0.5497 0.8504 0.6359 -0.1343 0.0142  0.1546  5   DT  G "O4'" 
2353 C "C3'" . DT  C 5   ? 0.5531 0.8803 0.6282 -0.1272 0.0134  0.1352  5   DT  G "C3'" 
2354 O "O3'" . DT  C 5   ? 0.6154 0.9571 0.6800 -0.1194 0.0299  0.1032  5   DT  G "O3'" 
2355 C "C2'" . DT  C 5   ? 0.5603 0.8319 0.6473 -0.1251 0.0057  0.1281  5   DT  G "C2'" 
2356 C "C1'" . DT  C 5   ? 0.5304 0.7952 0.6170 -0.1262 0.0158  0.1282  5   DT  G "C1'" 
2357 N N1    . DT  C 5   ? 0.5537 0.7766 0.6535 -0.1251 0.0061  0.1297  5   DT  G N1    
2358 C C2    . DT  C 5   ? 0.5836 0.7873 0.6796 -0.1179 0.0192  0.1099  5   DT  G C2    
2359 O O2    . DT  C 5   ? 0.5755 0.7904 0.6617 -0.1133 0.0381  0.0927  5   DT  G O2    
2360 N N3    . DT  C 5   ? 0.5898 0.7632 0.6975 -0.1153 0.0087  0.1108  5   DT  G N3    
2361 C C4    . DT  C 5   ? 0.6373 0.7950 0.7638 -0.1194 -0.0143 0.1263  5   DT  G C4    
2362 O O4    . DT  C 5   ? 0.6306 0.7642 0.7692 -0.1150 -0.0236 0.1213  5   DT  G O4    
2363 C C5    . DT  C 5   ? 0.6274 0.8022 0.7618 -0.1282 -0.0271 0.1484  5   DT  G C5    
2364 C C7    . DT  C 5   ? 0.6111 0.7698 0.7744 -0.1336 -0.0531 0.1682  5   DT  G C7    
2365 C C6    . DT  C 5   ? 0.5263 0.7342 0.6451 -0.1304 -0.0159 0.1504  5   DT  G C6    
2366 P P     . DC  C 6   ? 0.9385 1.2890 1.0006 -0.1132 0.0280  0.0837  6   DC  G P     
2367 O OP1   . DC  C 6   ? 0.9234 1.3309 0.9756 -0.1105 0.0362  0.0760  6   DC  G OP1   
2368 O OP2   . DC  C 6   ? 0.9485 1.2782 1.0183 -0.1160 0.0085  0.1014  6   DC  G OP2   
2369 O "O5'" . DC  C 6   ? 0.8796 1.1943 0.9469 -0.1054 0.0404  0.0498  6   DC  G "O5'" 
2370 C "C5'" . DC  C 6   ? 0.8472 1.1150 0.9220 -0.1043 0.0375  0.0508  6   DC  G "C5'" 
2371 C "C4'" . DC  C 6   ? 0.7156 0.9697 0.7939 -0.0987 0.0561  0.0307  6   DC  G "C4'" 
2372 O "O4'" . DC  C 6   ? 0.6565 0.8856 0.7370 -0.1003 0.0537  0.0438  6   DC  G "O4'" 
2373 C "C3'" . DC  C 6   ? 0.7028 0.9333 0.7901 -0.0900 0.0630  0.0061  6   DC  G "C3'" 
2374 O "O3'" . DC  C 6   ? 0.6188 0.8574 0.7146 -0.0851 0.0830  -0.0145 6   DC  G "O3'" 
2375 C "C2'" . DC  C 6   ? 0.7499 0.9417 0.8409 -0.0873 0.0553  0.0134  6   DC  G "C2'" 
2376 C "C1'" . DC  C 6   ? 0.6388 0.8323 0.7263 -0.0928 0.0534  0.0326  6   DC  G "C1'" 
2377 N N1    . DC  C 6   ? 0.5906 0.7608 0.6824 -0.0950 0.0336  0.0494  6   DC  G N1    
2378 C C2    . DC  C 6   ? 0.5093 0.6548 0.6058 -0.0891 0.0337  0.0468  6   DC  G C2    
2379 O O2    . DC  C 6   ? 0.4630 0.6066 0.5587 -0.0824 0.0510  0.0348  6   DC  G O2    
2380 N N3    . DC  C 6   ? 0.5570 0.6841 0.6621 -0.0898 0.0140  0.0570  6   DC  G N3    
2381 C C4    . DC  C 6   ? 0.5591 0.6884 0.6711 -0.0972 -0.0048 0.0723  6   DC  G C4    
2382 N N4    . DC  C 6   ? 0.5357 0.6454 0.6636 -0.0976 -0.0252 0.0805  6   DC  G N4    
2383 C C5    . DC  C 6   ? 0.6032 0.7579 0.7094 -0.1036 -0.0041 0.0797  6   DC  G C5    
2384 C C6    . DC  C 6   ? 0.5917 0.7675 0.6862 -0.1017 0.0151  0.0665  6   DC  G C6    
2385 P P     . DT  C 7   ? 0.7364 0.9622 0.8495 -0.0765 0.0934  -0.0406 7   DT  G P     
2386 O OP1   . DT  C 7   ? 0.7583 1.0106 0.8842 -0.0744 0.1083  -0.0612 7   DT  G OP1   
2387 O OP2   . DT  C 7   ? 0.6671 0.8839 0.7781 -0.0755 0.0798  -0.0421 7   DT  G OP2   
2388 O "O5'" . DT  C 7   ? 0.6834 0.8765 0.8047 -0.0706 0.1017  -0.0381 7   DT  G "O5'" 
2389 C "C5'" . DT  C 7   ? 0.6870 0.8530 0.8069 -0.0664 0.0918  -0.0331 7   DT  G "C5'" 
2390 C "C4'" . DT  C 7   ? 0.6586 0.8060 0.7848 -0.0589 0.1015  -0.0303 7   DT  G "C4'" 
2391 O "O4'" . DT  C 7   ? 0.5658 0.7011 0.6801 -0.0604 0.0872  -0.0140 7   DT  G "O4'" 
2392 C "C3'" . DT  C 7   ? 0.7052 0.8366 0.8443 -0.0486 0.1064  -0.0401 7   DT  G "C3'" 
2393 O "O3'" . DT  C 7   ? 0.7320 0.8599 0.8839 -0.0404 0.1239  -0.0396 7   DT  G "O3'" 
2394 C "C2'" . DT  C 7   ? 0.6124 0.7273 0.7401 -0.0468 0.0862  -0.0321 7   DT  G "C2'" 
2395 C "C1'" . DT  C 7   ? 0.5741 0.6895 0.6906 -0.0521 0.0785  -0.0165 7   DT  G "C1'" 
2396 N N1    . DT  C 7   ? 0.5478 0.6548 0.6572 -0.0573 0.0541  -0.0059 7   DT  G N1    
2397 C C2    . DT  C 7   ? 0.5432 0.6347 0.6537 -0.0515 0.0420  -0.0020 7   DT  G C2    
2398 O O2    . DT  C 7   ? 0.5392 0.6267 0.6518 -0.0414 0.0506  -0.0063 7   DT  G O2    
2399 N N3    . DT  C 7   ? 0.5539 0.6375 0.6660 -0.0571 0.0186  0.0071  7   DT  G N3    
2400 C C4    . DT  C 7   ? 0.4811 0.5724 0.5927 -0.0676 0.0074  0.0166  7   DT  G C4    
2401 O O4    . DT  C 7   ? 0.4534 0.5366 0.5725 -0.0720 -0.0139 0.0275  7   DT  G O4    
2402 C C5    . DT  C 7   ? 0.4894 0.6017 0.5948 -0.0721 0.0219  0.0126  7   DT  G C5    
2403 C C7    . DT  C 7   ? 0.5092 0.6393 0.6117 -0.0813 0.0119  0.0226  7   DT  G C7    
2404 C C6    . DT  C 7   ? 0.5234 0.6416 0.6289 -0.0668 0.0436  -0.0004 7   DT  G C6    
2405 P P     . DT  C 8   ? 0.7111 0.8310 0.8831 -0.0285 0.1351  -0.0467 8   DT  G P     
2406 O OP1   . DT  C 8   ? 0.6550 0.7802 0.8462 -0.0225 0.1563  -0.0433 8   DT  G OP1   
2407 O OP2   . DT  C 8   ? 0.5382 0.6603 0.7197 -0.0308 0.1319  -0.0609 8   DT  G OP2   
2408 O "O5'" . DT  C 8   ? 0.5335 0.6402 0.6919 -0.0203 0.1211  -0.0394 8   DT  G "O5'" 
2409 C "C5'" . DT  C 8   ? 0.4379 0.5442 0.5898 -0.0138 0.1229  -0.0289 8   DT  G "C5'" 
2410 C "C4'" . DT  C 8   ? 0.4097 0.5073 0.5513 -0.0050 0.1057  -0.0283 8   DT  G "C4'" 
2411 O "O4'" . DT  C 8   ? 0.4468 0.5355 0.5765 -0.0146 0.0824  -0.0280 8   DT  G "O4'" 
2412 C "C3'" . DT  C 8   ? 0.3998 0.4965 0.5510 0.0070  0.1078  -0.0358 8   DT  G "C3'" 
2413 O "O3'" . DT  C 8   ? 0.4430 0.5481 0.5950 0.0231  0.1129  -0.0315 8   DT  G "O3'" 
2414 C "C2'" . DT  C 8   ? 0.4071 0.4920 0.5490 0.0030  0.0835  -0.0423 8   DT  G "C2'" 
2415 C "C1'" . DT  C 8   ? 0.4948 0.5750 0.6243 -0.0063 0.0677  -0.0345 8   DT  G "C1'" 
2416 N N1    . DT  C 8   ? 0.4767 0.5477 0.6015 -0.0170 0.0458  -0.0341 8   DT  G N1    
2417 C C2    . DT  C 8   ? 0.5789 0.6398 0.7026 -0.0151 0.0228  -0.0327 8   DT  G C2    
2418 O O2    . DT  C 8   ? 0.7227 0.7832 0.8476 -0.0040 0.0186  -0.0356 8   DT  G O2    
2419 N N3    . DT  C 8   ? 0.5340 0.5880 0.6587 -0.0255 0.0042  -0.0283 8   DT  G N3    
2420 C C4    . DT  C 8   ? 0.4783 0.5385 0.6006 -0.0364 0.0066  -0.0251 8   DT  G C4    
2421 O O4    . DT  C 8   ? 0.6323 0.6895 0.7563 -0.0443 -0.0109 -0.0180 8   DT  G O4    
2422 C C5    . DT  C 8   ? 0.4357 0.5089 0.5570 -0.0369 0.0303  -0.0307 8   DT  G C5    
2423 C C7    . DT  C 8   ? 0.5177 0.6039 0.6377 -0.0462 0.0335  -0.0324 8   DT  G C7    
2424 C C6    . DT  C 8   ? 0.4884 0.5643 0.6132 -0.0279 0.0485  -0.0347 8   DT  G C6    
2425 P P     . DT  C 9   ? 0.5735 0.6862 0.7348 0.0397  0.1168  -0.0358 9   DT  G P     
2426 O OP1   . DT  C 9   ? 0.4537 0.5858 0.6203 0.0550  0.1325  -0.0258 9   DT  G OP1   
2427 O OP2   . DT  C 9   ? 0.5087 0.6176 0.6857 0.0346  0.1244  -0.0419 9   DT  G OP2   
2428 O "O5'" . DT  C 9   ? 0.4568 0.5613 0.6041 0.0440  0.0890  -0.0454 9   DT  G "O5'" 
2429 C "C5'" . DT  C 9   ? 0.4760 0.5850 0.6131 0.0524  0.0758  -0.0458 9   DT  G "C5'" 
2430 C "C4'" . DT  C 9   ? 0.4085 0.5093 0.5421 0.0573  0.0488  -0.0587 9   DT  G "C4'" 
2431 O "O4'" . DT  C 9   ? 0.3381 0.4180 0.4704 0.0396  0.0326  -0.0595 9   DT  G "O4'" 
2432 C "C3'" . DT  C 9   ? 0.4143 0.5240 0.5534 0.0718  0.0496  -0.0679 9   DT  G "C3'" 
2433 O "O3'" . DT  C 9   ? 0.4256 0.5499 0.5617 0.0908  0.0357  -0.0780 9   DT  G "O3'" 
2434 C "C2'" . DT  C 9   ? 0.4104 0.4994 0.5512 0.0592  0.0345  -0.0748 9   DT  G "C2'" 
2435 C "C1'" . DT  C 9   ? 0.4059 0.4786 0.5417 0.0436  0.0172  -0.0706 9   DT  G "C1'" 
2436 N N1    . DT  C 9   ? 0.4086 0.4662 0.5449 0.0255  0.0102  -0.0677 9   DT  G N1    
2437 C C2    . DT  C 9   ? 0.4460 0.4894 0.5848 0.0190  -0.0160 -0.0692 9   DT  G C2    
2438 O O2    . DT  C 9   ? 0.4639 0.5034 0.6079 0.0269  -0.0353 -0.0757 9   DT  G O2    
2439 N N3    . DT  C 9   ? 0.4048 0.4415 0.5431 0.0039  -0.0195 -0.0632 9   DT  G N3    
2440 C C4    . DT  C 9   ? 0.4789 0.5230 0.6140 -0.0045 -0.0009 -0.0601 9   DT  G C4    
2441 O O4    . DT  C 9   ? 0.4522 0.4959 0.5862 -0.0160 -0.0063 -0.0562 9   DT  G O4    
2442 C C5    . DT  C 9   ? 0.3869 0.4426 0.5236 0.0023  0.0248  -0.0617 9   DT  G C5    
2443 C C7    . DT  C 9   ? 0.3616 0.4259 0.5029 -0.0051 0.0446  -0.0623 9   DT  G C7    
2444 C C6    . DT  C 9   ? 0.4141 0.4754 0.5516 0.0163  0.0296  -0.0632 9   DT  G C6    
2445 P P     . DA  C 10  ? 0.4339 0.5847 0.5739 0.1140  0.0426  -0.0844 10  DA  G P     
2446 O OP1   . DA  C 10  ? 0.4577 0.6345 0.5926 0.1343  0.0356  -0.0909 10  DA  G OP1   
2447 O OP2   . DA  C 10  ? 0.4174 0.5775 0.5671 0.1131  0.0719  -0.0705 10  DA  G OP2   
2448 O "O5'" . DA  C 10  ? 0.3837 0.5187 0.5265 0.1125  0.0203  -0.1004 10  DA  G "O5'" 
2449 C "C5'" . DA  C 10  ? 0.4460 0.5742 0.5890 0.1175  -0.0102 -0.1170 10  DA  G "C5'" 
2450 C "C4'" . DA  C 10  ? 0.4094 0.5174 0.5585 0.1112  -0.0287 -0.1276 10  DA  G "C4'" 
2451 O "O4'" . DA  C 10  ? 0.4400 0.5224 0.5891 0.0871  -0.0266 -0.1161 10  DA  G "O4'" 
2452 C "C3'" . DA  C 10  ? 0.3665 0.4888 0.5184 0.1234  -0.0194 -0.1333 10  DA  G "C3'" 
2453 O "O3'" . DA  C 10  ? 0.3575 0.4745 0.5152 0.1312  -0.0455 -0.1525 10  DA  G "O3'" 
2454 C "C2'" . DA  C 10  ? 0.3387 0.4438 0.4926 0.1044  -0.0039 -0.1214 10  DA  G "C2'" 
2455 C "C1'" . DA  C 10  ? 0.4681 0.5459 0.6204 0.0847  -0.0223 -0.1190 10  DA  G "C1'" 
2456 N N9    . DA  C 10  ? 0.3798 0.4454 0.5312 0.0653  -0.0092 -0.1071 10  DA  G N9    
2457 C C8    . DA  C 10  ? 0.4030 0.4780 0.5569 0.0624  0.0180  -0.0985 10  DA  G C8    
2458 N N7    . DA  C 10  ? 0.3654 0.4299 0.5201 0.0454  0.0225  -0.0937 10  DA  G N7    
2459 C C5    . DA  C 10  ? 0.4463 0.4951 0.5967 0.0364  -0.0023 -0.0957 10  DA  G C5    
2460 C C6    . DA  C 10  ? 0.4402 0.4790 0.5885 0.0195  -0.0103 -0.0907 10  DA  G C6    
2461 N N6    . DA  C 10  ? 0.3830 0.4274 0.5316 0.0092  0.0057  -0.0870 10  DA  G N6    
2462 N N1    . DA  C 10  ? 0.5784 0.6047 0.7277 0.0145  -0.0361 -0.0895 10  DA  G N1    
2463 C C2    . DA  C 10  ? 0.6023 0.6239 0.7568 0.0258  -0.0539 -0.0971 10  DA  G C2    
2464 N N3    . DA  C 10  ? 0.4228 0.4548 0.5779 0.0431  -0.0496 -0.1066 10  DA  G N3    
2465 C C4    . DA  C 10  ? 0.4597 0.5064 0.6108 0.0477  -0.0224 -0.1036 10  DA  G C4    
2466 P P     . DG  C 11  ? 0.4308 0.5778 0.5908 0.1563  -0.0447 -0.1666 11  DG  G P     
2467 O OP1   . DG  C 11  ? 0.3621 0.5424 0.5183 0.1778  -0.0451 -0.1731 11  DG  G OP1   
2468 O OP2   . DG  C 11  ? 0.3496 0.5027 0.5115 0.1543  -0.0208 -0.1560 11  DG  G OP2   
2469 O "O5'" . DG  C 11  ? 0.4025 0.5317 0.5719 0.1572  -0.0774 -0.1875 11  DG  G "O5'" 
2470 C "C5'" . DG  C 11  ? 0.4926 0.6048 0.6712 0.1534  -0.1063 -0.1982 11  DG  G "C5'" 
2471 C "C4'" . DG  C 11  ? 0.4669 0.5431 0.6562 0.1341  -0.1254 -0.1968 11  DG  G "C4'" 
2472 O "O4'" . DG  C 11  ? 0.4841 0.5426 0.6653 0.1110  -0.1083 -0.1738 11  DG  G "O4'" 
2473 C "C3'" . DG  C 11  ? 0.4490 0.5239 0.6434 0.1402  -0.1327 -0.2086 11  DG  G "C3'" 
2474 O "O3'" . DG  C 11  ? 0.4081 0.4654 0.6223 0.1406  -0.1667 -0.2241 11  DG  G "O3'" 
2475 C "C2'" . DG  C 11  ? 0.3849 0.4436 0.5721 0.1205  -0.1149 -0.1905 11  DG  G "C2'" 
2476 C "C1'" . DG  C 11  ? 0.4165 0.4601 0.5998 0.1009  -0.1099 -0.1718 11  DG  G "C1'" 
2477 N N9    . DG  C 11  ? 0.4351 0.4792 0.6080 0.0881  -0.0822 -0.1552 11  DG  G N9    
2478 C C8    . DG  C 11  ? 0.3804 0.4449 0.5474 0.0952  -0.0538 -0.1498 11  DG  G C8    
2479 N N7    . DG  C 11  ? 0.3566 0.4158 0.5217 0.0808  -0.0352 -0.1378 11  DG  G N7    
2480 C C5    . DG  C 11  ? 0.3684 0.4063 0.5339 0.0640  -0.0517 -0.1347 11  DG  G C5    
2481 C C6    . DG  C 11  ? 0.3906 0.4208 0.5539 0.0460  -0.0440 -0.1251 11  DG  G C6    
2482 O O6    . DG  C 11  ? 0.3681 0.4061 0.5316 0.0409  -0.0214 -0.1206 11  DG  G O6    
2483 N N1    . DG  C 11  ? 0.4475 0.4625 0.6123 0.0344  -0.0663 -0.1213 11  DG  G N1    
2484 C C2    . DG  C 11  ? 0.5135 0.5176 0.6864 0.0383  -0.0932 -0.1258 11  DG  G C2    
2485 N N2    . DG  C 11  ? 0.4969 0.4882 0.6758 0.0254  -0.1116 -0.1165 11  DG  G N2    
2486 N N3    . DG  C 11  ? 0.5268 0.5354 0.7049 0.0550  -0.1022 -0.1387 11  DG  G N3    
2487 C C4    . DG  C 11  ? 0.4665 0.4940 0.6379 0.0676  -0.0801 -0.1428 11  DG  G C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  LYS 22  2   ?   ?   ?   A . n 
A 1 23  LYS 23  3   3   LYS LYS A . n 
A 1 24  ASN 24  4   4   ASN ASN A . n 
A 1 25  ARG 25  5   5   ARG ARG A . n 
A 1 26  ALA 26  6   6   ALA ALA A . n 
A 1 27  PHE 27  7   7   PHE PHE A . n 
A 1 28  LEU 28  8   8   LEU LEU A . n 
A 1 29  LYS 29  9   9   LYS LYS A . n 
A 1 30  TRP 30  10  10  TRP TRP A . n 
A 1 31  ALA 31  11  11  ALA ALA A . n 
A 1 32  GLY 32  12  12  GLY GLY A . n 
A 1 33  GLY 33  13  13  GLY GLY A . n 
A 1 34  LYS 34  14  14  LYS LYS A . n 
A 1 35  TYR 35  15  15  TYR TYR A . n 
A 1 36  PRO 36  16  16  PRO PRO A . n 
A 1 37  LEU 37  17  17  LEU LEU A . n 
A 1 38  LEU 38  18  18  LEU LEU A . n 
A 1 39  ASP 39  19  19  ASP ASP A . n 
A 1 40  ASP 40  20  20  ASP ASP A . n 
A 1 41  ILE 41  21  21  ILE ILE A . n 
A 1 42  LYS 42  22  22  LYS LYS A . n 
A 1 43  ARG 43  23  23  ARG ARG A . n 
A 1 44  HIS 44  24  24  HIS HIS A . n 
A 1 45  LEU 45  25  25  LEU LEU A . n 
A 1 46  PRO 46  26  26  PRO PRO A . n 
A 1 47  LYS 47  27  27  LYS LYS A . n 
A 1 48  GLY 48  28  28  GLY GLY A . n 
A 1 49  GLU 49  29  29  GLU GLU A . n 
A 1 50  CYS 50  30  30  CYS CYS A . n 
A 1 51  LEU 51  31  31  LEU LEU A . n 
A 1 52  VAL 52  32  32  VAL VAL A . n 
A 1 53  GLU 53  33  33  GLU GLU A . n 
A 1 54  PRO 54  34  34  PRO PRO A . n 
A 1 55  PHE 55  35  35  PHE PHE A . n 
A 1 56  VAL 56  36  36  VAL VAL A . n 
A 1 57  GLY 57  37  37  GLY GLY A . n 
A 1 58  ALA 58  38  38  ALA ALA A . n 
A 1 59  GLY 59  39  39  GLY GLY A . n 
A 1 60  SER 60  40  40  SER SER A . n 
A 1 61  VAL 61  41  41  VAL VAL A . n 
A 1 62  PHE 62  42  42  PHE PHE A . n 
A 1 63  LEU 63  43  43  LEU LEU A . n 
A 1 64  ASN 64  44  44  ASN ASN A . n 
A 1 65  THR 65  45  45  THR THR A . n 
A 1 66  ASP 66  46  46  ASP ASP A . n 
A 1 67  PHE 67  47  47  PHE PHE A . n 
A 1 68  SER 68  48  48  SER SER A . n 
A 1 69  ARG 69  49  49  ARG ARG A . n 
A 1 70  TYR 70  50  50  TYR TYR A . n 
A 1 71  ILE 71  51  51  ILE ILE A . n 
A 1 72  LEU 72  52  52  LEU LEU A . n 
A 1 73  ALA 73  53  53  ALA ALA A . n 
A 1 74  ASP 74  54  54  ASP ASP A . n 
A 1 75  ILE 75  55  55  ILE ILE A . n 
A 1 76  ASN 76  56  56  ASN ASN A . n 
A 1 77  SER 77  57  57  SER SER A . n 
A 1 78  ASP 78  58  58  ASP ASP A . n 
A 1 79  LEU 79  59  59  LEU LEU A . n 
A 1 80  ILE 80  60  60  ILE ILE A . n 
A 1 81  SER 81  61  61  SER SER A . n 
A 1 82  LEU 82  62  62  LEU LEU A . n 
A 1 83  TYR 83  63  63  TYR TYR A . n 
A 1 84  ASN 84  64  64  ASN ASN A . n 
A 1 85  ILE 85  65  65  ILE ILE A . n 
A 1 86  VAL 86  66  66  VAL VAL A . n 
A 1 87  LYS 87  67  67  LYS LYS A . n 
A 1 88  MET 88  68  68  MET MET A . n 
A 1 89  ARG 89  69  69  ARG ARG A . n 
A 1 90  THR 90  70  70  THR THR A . n 
A 1 91  ASP 91  71  71  ASP ASP A . n 
A 1 92  GLU 92  72  72  GLU GLU A . n 
A 1 93  TYR 93  73  73  TYR TYR A . n 
A 1 94  VAL 94  74  74  VAL VAL A . n 
A 1 95  GLN 95  75  75  GLN GLN A . n 
A 1 96  ALA 96  76  76  ALA ALA A . n 
A 1 97  ALA 97  77  77  ALA ALA A . n 
A 1 98  ARG 98  78  78  ARG ARG A . n 
A 1 99  GLU 99  79  79  GLU GLU A . n 
A 1 100 LEU 100 80  80  LEU LEU A . n 
A 1 101 PHE 101 81  81  PHE PHE A . n 
A 1 102 VAL 102 82  82  VAL VAL A . n 
A 1 103 PRO 103 83  83  PRO PRO A . n 
A 1 104 GLU 104 84  84  GLU GLU A . n 
A 1 105 THR 105 85  85  THR THR A . n 
A 1 106 ASN 106 86  86  ASN ASN A . n 
A 1 107 CYS 107 87  87  CYS CYS A . n 
A 1 108 ALA 108 88  88  ALA ALA A . n 
A 1 109 GLU 109 89  89  GLU GLU A . n 
A 1 110 VAL 110 90  90  VAL VAL A . n 
A 1 111 TYR 111 91  91  TYR TYR A . n 
A 1 112 TYR 112 92  92  TYR TYR A . n 
A 1 113 GLN 113 93  93  GLN GLN A . n 
A 1 114 PHE 114 94  94  PHE PHE A . n 
A 1 115 ARG 115 95  95  ARG ARG A . n 
A 1 116 GLU 116 96  96  GLU GLU A . n 
A 1 117 GLU 117 97  97  GLU GLU A . n 
A 1 118 PHE 118 98  98  PHE PHE A . n 
A 1 119 ASN 119 99  99  ASN ASN A . n 
A 1 120 LYS 120 100 100 LYS LYS A . n 
A 1 121 SER 121 101 101 SER SER A . n 
A 1 122 GLN 122 102 102 GLN GLN A . n 
A 1 123 ASP 123 103 103 ASP ASP A . n 
A 1 124 PRO 124 104 104 PRO PRO A . n 
A 1 125 PHE 125 105 105 PHE PHE A . n 
A 1 126 ARG 126 106 106 ARG ARG A . n 
A 1 127 ARG 127 107 107 ARG ARG A . n 
A 1 128 ALA 128 108 108 ALA ALA A . n 
A 1 129 VAL 129 109 109 VAL VAL A . n 
A 1 130 LEU 130 110 110 LEU LEU A . n 
A 1 131 PHE 131 111 111 PHE PHE A . n 
A 1 132 LEU 132 112 112 LEU LEU A . n 
A 1 133 TYR 133 113 113 TYR TYR A . n 
A 1 134 LEU 134 114 114 LEU LEU A . n 
A 1 135 ASN 135 115 115 ASN ASN A . n 
A 1 136 ARG 136 116 116 ARG ARG A . n 
A 1 137 TYR 137 117 117 TYR TYR A . n 
A 1 138 GLY 138 118 118 GLY GLY A . n 
A 1 139 TYR 139 119 119 TYR TYR A . n 
A 1 140 ASN 140 120 120 ASN ASN A . n 
A 1 141 GLY 141 121 121 GLY GLY A . n 
A 1 142 LEU 142 122 122 LEU LEU A . n 
A 1 143 CYS 143 123 123 CYS CYS A . n 
A 1 144 ARG 144 124 124 ARG ARG A . n 
A 1 145 TYR 145 125 125 TYR TYR A . n 
A 1 146 ASN 146 126 126 ASN ASN A . n 
A 1 147 LEU 147 127 127 LEU LEU A . n 
A 1 148 ARG 148 128 128 ARG ARG A . n 
A 1 149 GLY 149 129 129 GLY GLY A . n 
A 1 150 GLU 150 130 130 GLU GLU A . n 
A 1 151 PHE 151 131 131 PHE PHE A . n 
A 1 152 ASN 152 132 132 ASN ASN A . n 
A 1 153 VAL 153 133 133 VAL VAL A . n 
A 1 154 PRO 154 134 134 PRO PRO A . n 
A 1 155 PHE 155 135 135 PHE PHE A . n 
A 1 156 GLY 156 136 136 GLY GLY A . n 
A 1 157 ARG 157 137 137 ARG ARG A . n 
A 1 158 TYR 158 138 138 TYR TYR A . n 
A 1 159 LYS 159 139 139 LYS LYS A . n 
A 1 160 LYS 160 140 140 LYS LYS A . n 
A 1 161 PRO 161 141 141 PRO PRO A . n 
A 1 162 TYR 162 142 142 TYR TYR A . n 
A 1 163 PHE 163 143 143 PHE PHE A . n 
A 1 164 PRO 164 144 144 PRO PRO A . n 
A 1 165 GLU 165 145 145 GLU GLU A . n 
A 1 166 ALA 166 146 146 ALA ALA A . n 
A 1 167 GLU 167 147 147 GLU GLU A . n 
A 1 168 LEU 168 148 148 LEU LEU A . n 
A 1 169 TYR 169 149 149 TYR TYR A . n 
A 1 170 HIS 170 150 150 HIS HIS A . n 
A 1 171 PHE 171 151 151 PHE PHE A . n 
A 1 172 ALA 172 152 152 ALA ALA A . n 
A 1 173 GLU 173 153 153 GLU GLU A . n 
A 1 174 LYS 174 154 154 LYS LYS A . n 
A 1 175 ALA 175 155 155 ALA ALA A . n 
A 1 176 GLN 176 156 156 GLN GLN A . n 
A 1 177 ASN 177 157 157 ASN ASN A . n 
A 1 178 ALA 178 158 158 ALA ALA A . n 
A 1 179 PHE 179 159 159 PHE PHE A . n 
A 1 180 PHE 180 160 160 PHE PHE A . n 
A 1 181 TYR 181 161 161 TYR TYR A . n 
A 1 182 CYS 182 162 162 CYS CYS A . n 
A 1 183 GLU 183 163 163 GLU GLU A . n 
A 1 184 SER 184 164 164 SER SER A . n 
A 1 185 TYR 185 165 165 TYR TYR A . n 
A 1 186 ALA 186 166 166 ALA ALA A . n 
A 1 187 ASP 187 167 167 ASP ASP A . n 
A 1 188 SER 188 168 168 SER SER A . n 
A 1 189 MET 189 169 169 MET MET A . n 
A 1 190 ALA 190 170 170 ALA ALA A . n 
A 1 191 ARG 191 171 171 ARG ARG A . n 
A 1 192 ALA 192 172 172 ALA ALA A . n 
A 1 193 ASP 193 173 173 ASP ASP A . n 
A 1 194 ASP 194 174 174 ASP ASP A . n 
A 1 195 SER 195 175 175 SER SER A . n 
A 1 196 SER 196 176 176 SER SER A . n 
A 1 197 VAL 197 177 177 VAL VAL A . n 
A 1 198 VAL 198 178 178 VAL VAL A . n 
A 1 199 TYR 199 179 179 TYR TYR A . n 
A 1 200 CYS 200 180 180 CYS CYS A . n 
A 1 201 ASP 201 181 181 ASP ASP A . n 
A 1 202 PRO 202 182 182 PRO PRO A . n 
A 1 203 PRO 203 183 183 PRO PRO A . n 
A 1 204 TYR 204 184 184 TYR TYR A . n 
A 1 205 ALA 205 185 185 ALA ALA A . n 
A 1 206 PRO 206 186 186 PRO PRO A . n 
A 1 207 LEU 207 187 187 LEU LEU A . n 
A 1 208 SER 208 188 188 SER SER A . n 
A 1 209 ALA 209 189 189 ALA ALA A . n 
A 1 210 THR 210 190 ?   ?   ?   A . n 
A 1 211 ALA 211 191 ?   ?   ?   A . n 
A 1 212 ASN 212 192 ?   ?   ?   A . n 
A 1 213 PHE 213 193 ?   ?   ?   A . n 
A 1 214 THR 214 194 ?   ?   ?   A . n 
A 1 215 ALA 215 195 ?   ?   ?   A . n 
A 1 216 TYR 216 196 ?   ?   ?   A . n 
A 1 217 HIS 217 197 ?   ?   ?   A . n 
A 1 218 THR 218 198 ?   ?   ?   A . n 
A 1 219 ASN 219 199 199 ASN ASN A . n 
A 1 220 SER 220 200 200 SER SER A . n 
A 1 221 PHE 221 201 201 PHE PHE A . n 
A 1 222 THR 222 202 202 THR THR A . n 
A 1 223 LEU 223 203 203 LEU LEU A . n 
A 1 224 GLU 224 204 204 GLU GLU A . n 
A 1 225 GLN 225 205 205 GLN GLN A . n 
A 1 226 GLN 226 206 206 GLN GLN A . n 
A 1 227 ALA 227 207 207 ALA ALA A . n 
A 1 228 HIS 228 208 208 HIS HIS A . n 
A 1 229 LEU 229 209 209 LEU LEU A . n 
A 1 230 ALA 230 210 210 ALA ALA A . n 
A 1 231 GLU 231 211 211 GLU GLU A . n 
A 1 232 ILE 232 212 212 ILE ILE A . n 
A 1 233 ALA 233 213 213 ALA ALA A . n 
A 1 234 GLU 234 214 214 GLU GLU A . n 
A 1 235 GLY 235 215 215 GLY GLY A . n 
A 1 236 LEU 236 216 216 LEU LEU A . n 
A 1 237 VAL 237 217 217 VAL VAL A . n 
A 1 238 GLU 238 218 218 GLU GLU A . n 
A 1 239 ARG 239 219 219 ARG ARG A . n 
A 1 240 HIS 240 220 220 HIS HIS A . n 
A 1 241 ILE 241 221 221 ILE ILE A . n 
A 1 242 PRO 242 222 222 PRO PRO A . n 
A 1 243 VAL 243 223 223 VAL VAL A . n 
A 1 244 LEU 244 224 224 LEU LEU A . n 
A 1 245 ILE 245 225 225 ILE ILE A . n 
A 1 246 SER 246 226 226 SER SER A . n 
A 1 247 ASN 247 227 227 ASN ASN A . n 
A 1 248 HIS 248 228 228 HIS HIS A . n 
A 1 249 ASP 249 229 229 ASP ASP A . n 
A 1 250 THR 250 230 230 THR THR A . n 
A 1 251 MET 251 231 231 MET MET A . n 
A 1 252 LEU 252 232 232 LEU LEU A . n 
A 1 253 THR 253 233 233 THR THR A . n 
A 1 254 ARG 254 234 234 ARG ARG A . n 
A 1 255 GLU 255 235 235 GLU GLU A . n 
A 1 256 TRP 256 236 236 TRP TRP A . n 
A 1 257 TYR 257 237 237 TYR TYR A . n 
A 1 258 GLN 258 238 238 GLN GLN A . n 
A 1 259 ARG 259 239 239 ARG ARG A . n 
A 1 260 ALA 260 240 240 ALA ALA A . n 
A 1 261 LYS 261 241 241 LYS LYS A . n 
A 1 262 LEU 262 242 242 LEU LEU A . n 
A 1 263 HIS 263 243 243 HIS HIS A . n 
A 1 264 VAL 264 244 244 VAL VAL A . n 
A 1 265 VAL 265 245 245 VAL VAL A . n 
A 1 266 LYS 266 246 246 LYS LYS A . n 
A 1 267 VAL 267 247 247 VAL VAL A . n 
A 1 268 ARG 268 248 248 ARG ARG A . n 
A 1 269 ARG 269 249 249 ARG ARG A . n 
A 1 270 SER 270 250 250 SER SER A . n 
A 1 271 ILE 271 251 251 ILE ILE A . n 
A 1 272 SER 272 252 ?   ?   ?   A . n 
A 1 273 SER 273 253 ?   ?   ?   A . n 
A 1 274 ASN 274 254 ?   ?   ?   A . n 
A 1 275 GLY 275 255 ?   ?   ?   A . n 
A 1 276 GLY 276 256 ?   ?   ?   A . n 
A 1 277 THR 277 257 ?   ?   ?   A . n 
A 1 278 ARG 278 258 258 ARG ARG A . n 
A 1 279 LYS 279 259 259 LYS LYS A . n 
A 1 280 LYS 280 260 260 LYS LYS A . n 
A 1 281 VAL 281 261 261 VAL VAL A . n 
A 1 282 ASP 282 262 262 ASP ASP A . n 
A 1 283 GLU 283 263 263 GLU GLU A . n 
A 1 284 LEU 284 264 264 LEU LEU A . n 
A 1 285 LEU 285 265 265 LEU LEU A . n 
A 1 286 ALA 286 266 266 ALA ALA A . n 
A 1 287 LEU 287 267 267 LEU LEU A . n 
A 1 288 TYR 288 268 268 TYR TYR A . n 
A 1 289 LYS 289 269 269 LYS LYS A . n 
A 1 290 PRO 290 270 270 PRO PRO A . n 
A 1 291 GLY 291 271 271 GLY GLY A . n 
A 1 292 VAL 292 272 ?   ?   ?   A . n 
A 1 293 VAL 293 273 ?   ?   ?   A . n 
A 1 294 SER 294 274 ?   ?   ?   A . n 
A 1 295 PRO 295 275 ?   ?   ?   A . n 
A 1 296 ALA 296 276 ?   ?   ?   A . n 
A 1 297 LYS 297 277 ?   ?   ?   A . n 
A 1 298 LYS 298 278 ?   ?   ?   A . n 
B 2 1   DT  1   1   1   DT  DT  F . n 
B 2 2   DC  2   2   2   DC  DC  F . n 
B 2 3   DT  3   3   3   DT  DT  F . n 
B 2 4   DA  4   4   4   DA  DA  F . n 
B 2 5   DA  5   5   5   DA  DA  F . n 
B 2 6   DA  6   6   6   DA  DA  F . n 
B 2 7   DG  7   7   7   DG  DG  F . n 
B 2 8   DA  8   8   8   DA  DA  F . n 
B 2 9   DT  9   9   9   DT  DT  F . n 
B 2 10  DC  10  10  10  DC  DC  F . n 
B 2 11  DG  11  11  11  DG  DG  F . n 
C 3 1   DA  1   1   1   DA  DA  G . n 
C 3 2   DC  2   2   2   DC  DC  G . n 
C 3 3   DG  3   3   3   DG  DG  G . n 
C 3 4   DA  4   4   4   DA  DA  G . n 
C 3 5   DT  5   5   5   DT  DT  G . n 
C 3 6   DC  6   6   6   DC  DC  G . n 
C 3 7   DT  7   7   7   DT  DT  G . n 
C 3 8   DT  8   8   8   DT  DT  G . n 
C 3 9   DT  9   9   9   DT  DT  G . n 
C 3 10  DA  10  10  10  DA  DA  G . n 
C 3 11  DG  11  11  11  DG  DG  G . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-04-15 
2 'Structure model' 1 1 2015-04-22 
3 'Structure model' 1 2 2015-05-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 6.6399  -6.1194 168.8400 0.3042 0.3607 0.3173 -0.0465 -0.1017 0.0580  4.2601 3.3955 4.1314 0.2120  
0.9488 1.3384  0.0987  -0.0351 -0.0343 0.1922  -0.2201 0.5629  -0.2074 0.3655  -0.7719 
'X-RAY DIFFRACTION' 2 ? refined 14.0552 7.2745  182.8173 0.2129 0.2594 0.1988 0.0628  -0.0043 0.0177  2.2398 4.0826 2.7163 0.8803  
0.6545 -0.8212 -0.0217 0.1370  -0.1118 -0.2405 0.0343  0.3011  0.2683  -0.1399 -0.3009 
'X-RAY DIFFRACTION' 3 ? refined 15.7295 -7.7479 156.5714 0.5160 0.4684 0.2940 0.1363  -0.0476 -0.0649 4.4925 4.3450 4.9213 -0.6591 
0.4602 -0.4390 0.4432  -0.1998 -0.1717 0.9002  -0.2824 0.0355  -0.7639 0.6421  0.3492  
'X-RAY DIFFRACTION' 4 ? refined 37.9877 19.0228 164.0157 0.2613 0.3792 0.3756 -0.0835 -0.0314 0.1146  7.1545 4.6450 2.6364 -3.3344 
1.8736 -0.1195 -0.5534 0.1929  0.2919  0.5102  0.7009  -0.1196 -0.1240 0.1183  0.0147  
'X-RAY DIFFRACTION' 5 ? refined 40.5200 19.2571 163.9736 0.3500 0.4342 0.4740 -0.0752 -0.0101 0.0478  4.7567 0.5239 0.4475 -1.2152 
0.6051 -0.0202 -0.5167 -0.0061 0.5370  0.3715  0.5547  -0.0229 -0.0704 -0.2459 0.1518  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 3   A 56  '( CHAIN A AND RESID 3:56 )'    ? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 57  A 162 '( CHAIN A AND RESID 57:162 )'  ? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 163 A 271 '( CHAIN A AND RESID 163:271 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 F 1   F 11  '( CHAIN F AND RESID 1:11 )'    ? ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 G 1   G 11  '( CHAIN G AND RESID 1:11 )'    ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SERGUI   'data collection' .                           ? 1 
SOLVE    phasing           .                           ? 2 
PHENIX   refinement        '(phenix.refine: 1.9_1692)' ? 3 
HKL-2000 'data reduction'  .                           ? 4 
HKL-2000 'data scaling'    .                           ? 5 
# 
_pdbx_entry_details.entry_id             4RTL 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'AUTHOR STATES THAT RESIDUES 175 WERE MODELED AS SER INSTEAD OF ALA BECAUSE OF EXTRA DENSITY.' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N  A ASP 174 ? ? CA A ASP 174 ? B 1.591 1.459 0.132 0.020 N 
2 1 CA A ASP 174 ? A C  A ASP 174 ? ? 1.707 1.525 0.182 0.026 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 81  ? ? -100.15 64.16   
2 1 ASN A 120 ? ? 54.32   17.48   
3 1 ASN A 227 ? ? -170.51 -178.30 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 23  ? CG  ? A ARG 43  CG  
2  1 Y 1 A ARG 23  ? CD  ? A ARG 43  CD  
3  1 Y 1 A ARG 23  ? NE  ? A ARG 43  NE  
4  1 Y 1 A ARG 23  ? CZ  ? A ARG 43  CZ  
5  1 Y 1 A ARG 23  ? NH1 ? A ARG 43  NH1 
6  1 Y 1 A ARG 23  ? NH2 ? A ARG 43  NH2 
7  1 Y 1 A GLN 75  ? CG  ? A GLN 95  CG  
8  1 Y 1 A GLN 75  ? CD  ? A GLN 95  CD  
9  1 Y 1 A GLN 75  ? OE1 ? A GLN 95  OE1 
10 1 Y 1 A GLN 75  ? NE2 ? A GLN 95  NE2 
11 1 Y 1 A ARG 137 ? CG  ? A ARG 157 CG  
12 1 Y 1 A ARG 137 ? CD  ? A ARG 157 CD  
13 1 Y 1 A ARG 137 ? NE  ? A ARG 157 NE  
14 1 Y 1 A ARG 137 ? CZ  ? A ARG 157 CZ  
15 1 Y 1 A ARG 137 ? NH1 ? A ARG 157 NH1 
16 1 Y 1 A ARG 137 ? NH2 ? A ARG 157 NH2 
17 1 Y 1 A LYS 139 ? CG  ? A LYS 159 CG  
18 1 Y 1 A LYS 139 ? CD  ? A LYS 159 CD  
19 1 Y 1 A LYS 139 ? CE  ? A LYS 159 CE  
20 1 Y 1 A LYS 139 ? NZ  ? A LYS 159 NZ  
21 1 Y 1 A LYS 140 ? CG  ? A LYS 160 CG  
22 1 Y 1 A LYS 140 ? CD  ? A LYS 160 CD  
23 1 Y 1 A LYS 140 ? CE  ? A LYS 160 CE  
24 1 Y 1 A LYS 140 ? NZ  ? A LYS 160 NZ  
25 1 Y 1 A MET 231 ? CG  ? A MET 251 CG  
26 1 Y 1 A MET 231 ? SD  ? A MET 251 SD  
27 1 Y 1 A MET 231 ? CE  ? A MET 251 CE  
28 1 Y 1 A ARG 239 ? CG  ? A ARG 259 CG  
29 1 Y 1 A ARG 239 ? CD  ? A ARG 259 CD  
30 1 Y 1 A ARG 239 ? NE  ? A ARG 259 NE  
31 1 Y 1 A ARG 239 ? CZ  ? A ARG 259 CZ  
32 1 Y 1 A ARG 239 ? NH1 ? A ARG 259 NH1 
33 1 Y 1 A ARG 239 ? NH2 ? A ARG 259 NH2 
34 1 Y 1 A LYS 241 ? CG  ? A LYS 261 CG  
35 1 Y 1 A LYS 241 ? CD  ? A LYS 261 CD  
36 1 Y 1 A LYS 241 ? CE  ? A LYS 261 CE  
37 1 Y 1 A LYS 241 ? NZ  ? A LYS 261 NZ  
38 1 Y 1 A LYS 246 ? CG  ? A LYS 266 CG  
39 1 Y 1 A LYS 246 ? CD  ? A LYS 266 CD  
40 1 Y 1 A LYS 246 ? CE  ? A LYS 266 CE  
41 1 Y 1 A LYS 246 ? NZ  ? A LYS 266 NZ  
42 1 Y 1 A ARG 248 ? CG  ? A ARG 268 CG  
43 1 Y 1 A ARG 248 ? CD  ? A ARG 268 CD  
44 1 Y 1 A ARG 248 ? NE  ? A ARG 268 NE  
45 1 Y 1 A ARG 248 ? CZ  ? A ARG 268 CZ  
46 1 Y 1 A ARG 248 ? NH1 ? A ARG 268 NH1 
47 1 Y 1 A ARG 248 ? NH2 ? A ARG 268 NH2 
48 1 Y 1 A ILE 251 ? CG1 ? A ILE 271 CG1 
49 1 Y 1 A ILE 251 ? CG2 ? A ILE 271 CG2 
50 1 Y 1 A ILE 251 ? CD1 ? A ILE 271 CD1 
51 1 Y 1 A ARG 258 ? CG  ? A ARG 278 CG  
52 1 Y 1 A ARG 258 ? CD  ? A ARG 278 CD  
53 1 Y 1 A ARG 258 ? NE  ? A ARG 278 NE  
54 1 Y 1 A ARG 258 ? CZ  ? A ARG 278 CZ  
55 1 Y 1 A ARG 258 ? NH1 ? A ARG 278 NH1 
56 1 Y 1 A ARG 258 ? NH2 ? A ARG 278 NH2 
57 1 Y 1 A LYS 260 ? CG  ? A LYS 280 CG  
58 1 Y 1 A LYS 260 ? CD  ? A LYS 280 CD  
59 1 Y 1 A LYS 260 ? CE  ? A LYS 280 CE  
60 1 Y 1 A LYS 260 ? NZ  ? A LYS 280 NZ  
61 1 Y 1 A LYS 269 ? CG  ? A LYS 289 CG  
62 1 Y 1 A LYS 269 ? CD  ? A LYS 289 CD  
63 1 Y 1 A LYS 269 ? CE  ? A LYS 289 CE  
64 1 Y 1 A LYS 269 ? NZ  ? A LYS 289 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1   
2  1 Y 1 A GLY -18 ? A GLY 2   
3  1 Y 1 A SER -17 ? A SER 3   
4  1 Y 1 A SER -16 ? A SER 4   
5  1 Y 1 A HIS -15 ? A HIS 5   
6  1 Y 1 A HIS -14 ? A HIS 6   
7  1 Y 1 A HIS -13 ? A HIS 7   
8  1 Y 1 A HIS -12 ? A HIS 8   
9  1 Y 1 A HIS -11 ? A HIS 9   
10 1 Y 1 A HIS -10 ? A HIS 10  
11 1 Y 1 A SER -9  ? A SER 11  
12 1 Y 1 A SER -8  ? A SER 12  
13 1 Y 1 A GLY -7  ? A GLY 13  
14 1 Y 1 A LEU -6  ? A LEU 14  
15 1 Y 1 A VAL -5  ? A VAL 15  
16 1 Y 1 A PRO -4  ? A PRO 16  
17 1 Y 1 A ARG -3  ? A ARG 17  
18 1 Y 1 A GLY -2  ? A GLY 18  
19 1 Y 1 A SER -1  ? A SER 19  
20 1 Y 1 A HIS 0   ? A HIS 20  
21 1 Y 1 A MET 1   ? A MET 21  
22 1 Y 1 A LYS 2   ? A LYS 22  
23 1 Y 1 A THR 190 ? A THR 210 
24 1 Y 1 A ALA 191 ? A ALA 211 
25 1 Y 1 A ASN 192 ? A ASN 212 
26 1 Y 1 A PHE 193 ? A PHE 213 
27 1 Y 1 A THR 194 ? A THR 214 
28 1 Y 1 A ALA 195 ? A ALA 215 
29 1 Y 1 A TYR 196 ? A TYR 216 
30 1 Y 1 A HIS 197 ? A HIS 217 
31 1 Y 1 A THR 198 ? A THR 218 
32 1 Y 1 A SER 252 ? A SER 272 
33 1 Y 1 A SER 253 ? A SER 273 
34 1 Y 1 A ASN 254 ? A ASN 274 
35 1 Y 1 A GLY 255 ? A GLY 275 
36 1 Y 1 A GLY 256 ? A GLY 276 
37 1 Y 1 A THR 257 ? A THR 277 
38 1 Y 1 A VAL 272 ? A VAL 292 
39 1 Y 1 A VAL 273 ? A VAL 293 
40 1 Y 1 A SER 274 ? A SER 294 
41 1 Y 1 A PRO 275 ? A PRO 295 
42 1 Y 1 A ALA 276 ? A ALA 296 
43 1 Y 1 A LYS 277 ? A LYS 297 
44 1 Y 1 A LYS 278 ? A LYS 298 
# 
_ndb_struct_conf_na.entry_id   4RTL 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 2  1_555 C DG 11 1_555 0.176  0.261 0.159  -12.065 -5.032  3.177  1  F_DC2:DG11_G F 2  ? G 11 ? 19 1 
1 B DT 3  1_555 C DA 10 1_555 -1.066 0.219 0.077  -4.745  8.599   0.646  2  F_DT3:DA10_G F 3  ? G 10 ? 20 1 
1 B DA 4  1_555 C DT 9  1_555 -0.095 0.331 0.369  14.425  -8.323  1.788  3  F_DA4:DT9_G  F 4  ? G 9  ? 20 1 
1 B DA 5  1_555 C DT 8  1_555 0.916  0.136 0.086  9.434   -14.798 4.113  4  F_DA5:DT8_G  F 5  ? G 8  ? 20 1 
1 B DA 6  1_555 C DT 7  1_555 0.597  0.014 0.018  3.257   -10.795 0.240  5  F_DA6:DT7_G  F 6  ? G 7  ? 20 1 
1 B DG 7  1_555 C DC 6  1_555 0.277  0.239 0.037  -7.028  -15.367 4.574  6  F_DG7:DC6_G  F 7  ? G 6  ? 19 1 
1 B DA 8  1_555 C DT 5  1_555 0.848  0.169 0.252  -12.552 -11.627 1.862  7  F_DA8:DT5_G  F 8  ? G 5  ? 20 1 
1 B DT 9  1_555 C DA 4  1_555 -0.172 0.282 0.029  -3.134  -11.144 -0.268 8  F_DT9:DA4_G  F 9  ? G 4  ? 20 1 
1 B DC 10 1_555 C DG 3  1_555 -1.440 0.390 -0.066 0.747   -6.734  4.846  9  F_DC10:DG3_G F 10 ? G 3  ? ?  1 
1 B DG 11 1_555 C DC 2  1_555 -0.220 0.333 0.070  14.549  -16.677 -2.077 10 F_DG11:DC2_G F 11 ? G 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 2  1_555 C DG 11 1_555 B DT 3  1_555 C DA 10 1_555 0.231  0.141  3.560 2.760  3.016  28.568 -0.452 0.209  3.561 6.072  
-5.558 28.853 1 FF_DC2DT3:DA10DG11_GG F 2  ? G 11 ? F 3  ? G 10 ? 
1 B DT 3  1_555 C DA 10 1_555 B DA 4  1_555 C DT 9  1_555 -1.008 1.351  3.194 -3.863 2.998  37.544 1.695  1.054  3.371 4.633  
5.971  37.850 2 FF_DT3DA4:DT9DA10_GG  F 3  ? G 10 ? F 4  ? G 9  ? 
1 B DA 4  1_555 C DT 9  1_555 B DA 5  1_555 C DT 8  1_555 -0.069 -0.331 3.645 2.070  5.118  39.634 -1.135 0.364  3.569 7.504  
-3.034 40.002 3 FF_DA4DA5:DT8DT9_GG   F 4  ? G 9  ? F 5  ? G 8  ? 
1 B DA 5  1_555 C DT 8  1_555 B DA 6  1_555 C DT 7  1_555 -0.291 -0.656 3.516 -0.849 -0.724 32.741 -1.029 0.359  3.535 -1.284 
1.506  32.759 4 FF_DA5DA6:DT7DT8_GG   F 5  ? G 8  ? F 6  ? G 7  ? 
1 B DA 6  1_555 C DT 7  1_555 B DG 7  1_555 C DC 6  1_555 0.193  -0.729 3.769 2.103  2.316  34.864 -1.611 0.042  3.720 3.856  
-3.501 34.999 5 FF_DA6DG7:DC6DT7_GG   F 6  ? G 7  ? F 7  ? G 6  ? 
1 B DG 7  1_555 C DC 6  1_555 B DA 8  1_555 C DT 5  1_555 -0.618 -0.592 3.529 -1.013 -1.468 40.001 -0.683 0.777  3.561 -2.144 
1.481  40.039 6 FF_DG7DA8:DT5DC6_GG   F 7  ? G 6  ? F 8  ? G 5  ? 
1 B DA 8  1_555 C DT 5  1_555 B DT 9  1_555 C DA 4  1_555 -0.348 -0.893 3.181 3.088  3.954  22.866 -3.469 1.847  2.915 9.822  
-7.671 23.403 7 FF_DA8DT9:DA4DT5_GG   F 8  ? G 5  ? F 9  ? G 4  ? 
1 B DT 9  1_555 C DA 4  1_555 B DC 10 1_555 C DG 3  1_555 0.989  0.467  3.494 4.000  2.027  29.050 0.444  -1.010 3.618 4.010  
-7.915 29.387 8 FF_DT9DC10:DG3DA4_GG  F 9  ? G 4  ? F 10 ? G 3  ? 
1 B DC 10 1_555 C DG 3  1_555 B DG 11 1_555 C DC 2  1_555 0.014  0.718  3.421 1.767  8.318  35.553 -0.085 0.239  3.492 13.387 
-2.844 36.524 9 FF_DC10DG11:DC2DG3_GG F 10 ? G 3  ? F 11 ? G 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 SINEFUNGIN SFG 
5 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SFG 1  301 301 SFG SFG A . 
E 5 HOH 1  401 1   HOH HOH A . 
E 5 HOH 2  402 2   HOH HOH A . 
E 5 HOH 3  403 3   HOH HOH A . 
E 5 HOH 4  404 4   HOH HOH A . 
E 5 HOH 5  405 5   HOH HOH A . 
E 5 HOH 6  406 6   HOH HOH A . 
E 5 HOH 7  407 7   HOH HOH A . 
E 5 HOH 8  408 8   HOH HOH A . 
E 5 HOH 9  409 9   HOH HOH A . 
E 5 HOH 10 410 10  HOH HOH A . 
E 5 HOH 11 411 11  HOH HOH A . 
E 5 HOH 12 412 12  HOH HOH A . 
E 5 HOH 13 413 13  HOH HOH A . 
E 5 HOH 14 414 14  HOH HOH A . 
E 5 HOH 15 415 15  HOH HOH A . 
E 5 HOH 16 416 16  HOH HOH A . 
E 5 HOH 17 417 17  HOH HOH A . 
E 5 HOH 18 418 19  HOH HOH A . 
E 5 HOH 19 419 20  HOH HOH A . 
E 5 HOH 20 420 21  HOH HOH A . 
E 5 HOH 21 421 24  HOH HOH A . 
E 5 HOH 22 422 25  HOH HOH A . 
E 5 HOH 23 423 26  HOH HOH A . 
E 5 HOH 24 424 27  HOH HOH A . 
E 5 HOH 25 425 28  HOH HOH A . 
E 5 HOH 26 426 31  HOH HOH A . 
E 5 HOH 27 427 33  HOH HOH A . 
E 5 HOH 28 428 34  HOH HOH A . 
E 5 HOH 29 429 37  HOH HOH A . 
E 5 HOH 30 430 43  HOH HOH A . 
E 5 HOH 31 431 48  HOH HOH A . 
E 5 HOH 32 432 49  HOH HOH A . 
E 5 HOH 33 433 52  HOH HOH A . 
E 5 HOH 34 434 53  HOH HOH A . 
E 5 HOH 35 435 54  HOH HOH A . 
E 5 HOH 36 436 55  HOH HOH A . 
E 5 HOH 37 437 57  HOH HOH A . 
E 5 HOH 38 438 58  HOH HOH A . 
E 5 HOH 39 439 61  HOH HOH A . 
E 5 HOH 40 440 62  HOH HOH A . 
E 5 HOH 41 441 63  HOH HOH A . 
E 5 HOH 42 442 65  HOH HOH A . 
E 5 HOH 43 443 70  HOH HOH A . 
E 5 HOH 44 444 75  HOH HOH A . 
E 5 HOH 45 445 76  HOH HOH A . 
E 5 HOH 46 446 80  HOH HOH A . 
E 5 HOH 47 447 81  HOH HOH A . 
E 5 HOH 48 448 86  HOH HOH A . 
E 5 HOH 49 449 87  HOH HOH A . 
E 5 HOH 50 450 89  HOH HOH A . 
E 5 HOH 51 451 91  HOH HOH A . 
E 5 HOH 52 452 95  HOH HOH A . 
E 5 HOH 53 453 96  HOH HOH A . 
E 5 HOH 54 454 100 HOH HOH A . 
E 5 HOH 55 455 110 HOH HOH A . 
E 5 HOH 56 456 112 HOH HOH A . 
E 5 HOH 57 457 115 HOH HOH A . 
E 5 HOH 58 458 117 HOH HOH A . 
E 5 HOH 59 459 118 HOH HOH A . 
E 5 HOH 60 460 119 HOH HOH A . 
E 5 HOH 61 461 121 HOH HOH A . 
E 5 HOH 62 462 123 HOH HOH A . 
E 5 HOH 63 463 124 HOH HOH A . 
E 5 HOH 64 464 127 HOH HOH A . 
E 5 HOH 65 465 128 HOH HOH A . 
E 5 HOH 66 466 130 HOH HOH A . 
E 5 HOH 67 467 131 HOH HOH A . 
E 5 HOH 68 468 132 HOH HOH A . 
E 5 HOH 69 469 133 HOH HOH A . 
E 5 HOH 70 470 134 HOH HOH A . 
E 5 HOH 71 471 135 HOH HOH A . 
E 5 HOH 72 472 136 HOH HOH A . 
E 5 HOH 73 473 137 HOH HOH A . 
E 5 HOH 74 474 138 HOH HOH A . 
E 5 HOH 75 475 139 HOH HOH A . 
E 5 HOH 76 476 140 HOH HOH A . 
E 5 HOH 77 477 141 HOH HOH A . 
E 5 HOH 78 478 142 HOH HOH A . 
E 5 HOH 79 479 143 HOH HOH A . 
F 5 HOH 1  101 18  HOH HOH F . 
F 5 HOH 2  102 29  HOH HOH F . 
F 5 HOH 3  103 30  HOH HOH F . 
F 5 HOH 4  104 42  HOH HOH F . 
F 5 HOH 5  105 45  HOH HOH F . 
F 5 HOH 6  106 92  HOH HOH F . 
F 5 HOH 7  107 114 HOH HOH F . 
F 5 HOH 8  108 125 HOH HOH F . 
G 5 HOH 1  101 98  HOH HOH G . 
#