data_4RTP
# 
_entry.id   4RTP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
NDB   NA3307       
RCSB  RCSB087783   
PDB   4RTP         
WWPDB D_1000087783 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
2G1P PDB 'Structure of E. coli DNA adenine methyltransferase (DAM) with Cognate Sequence' unspecified 
2ORE PDB 'Binary structure of E.coli DAM'                                                 unspecified 
4RTJ PDB .                                                                                unspecified 
4RTK PDB .                                                                                unspecified 
4RTL PDB .                                                                                unspecified 
4RTM PDB .                                                                                unspecified 
4RTN PDB .                                                                                unspecified 
4RTO PDB .                                                                                unspecified 
4RTQ PDB .                                                                                unspecified 
4RTR PDB .                                                                                unspecified 
4RTS PDB .                                                                                unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4RTP 
_pdbx_database_status.recvd_initial_deposition_date   2014-11-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Horton, J.R.' 1 
'Cheng, X.'    2 
# 
_citation.id                        primary 
_citation.title                     
;Structures of Escherichia coli DNA adenine methyltransferase (Dam) in complex with a non-GATC sequence: potential implications for methylation-independent transcriptional repression.
;
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            43 
_citation.page_first                4296 
_citation.page_last                 4308 
_citation.year                      2015 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25845600 
_citation.pdbx_database_id_DOI      10.1093/nar/gkv251 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Horton, J.R.'     1 
primary 'Zhang, X.'        2 
primary 'Blumenthal, R.M.' 3 
primary 'Cheng, X.'        4 
# 
_cell.entry_id           4RTP 
_cell.length_a           35.817 
_cell.length_b           63.225 
_cell.length_c           144.102 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RTP 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA adenine methylase'                           34330.961 1  ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*TP*TP*TP*AP*AP*AP*GP*AP*TP*CP*G)-3')
;
3372.234  1  ? ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*CP*GP*AP*TP*CP*TP*TP*TP*AP*A)-3')
;
3332.210  1  ? ? ? ? 
4 non-polymer syn S-ADENOSYLMETHIONINE                              398.437   1  ? ? ? ? 
5 water       nat water                                             18.015    25 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLI
SLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKK
PYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERH
IPVLISNHDTMLTREWYQRAKLHVVKVRRSISSNGGTRKKVDELLALYKPGVVSPAKK
;
;MGSSHHHHHHSSGLVPRGSHMKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLI
SLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKK
PYFPEAELYHFAEKAQNAFFYCESYADSMARADDSSVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERH
IPVLISNHDTMLTREWYQRAKLHVVKVRRSISSNGGTRKKVDELLALYKPGVVSPAKK
;
A ? 
2 polydeoxyribonucleotide no no '(DT)(DT)(DT)(DA)(DA)(DA)(DG)(DA)(DT)(DC)(DG)' TTTAAAGATCG F ? 
3 polydeoxyribonucleotide no no '(DA)(DC)(DG)(DA)(DT)(DC)(DT)(DT)(DT)(DA)(DA)' ACGATCTTTAA G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  LYS n 
1 23  LYS n 
1 24  ASN n 
1 25  ARG n 
1 26  ALA n 
1 27  PHE n 
1 28  LEU n 
1 29  LYS n 
1 30  TRP n 
1 31  ALA n 
1 32  GLY n 
1 33  GLY n 
1 34  LYS n 
1 35  TYR n 
1 36  PRO n 
1 37  LEU n 
1 38  LEU n 
1 39  ASP n 
1 40  ASP n 
1 41  ILE n 
1 42  LYS n 
1 43  ARG n 
1 44  HIS n 
1 45  LEU n 
1 46  PRO n 
1 47  LYS n 
1 48  GLY n 
1 49  GLU n 
1 50  CYS n 
1 51  LEU n 
1 52  VAL n 
1 53  GLU n 
1 54  PRO n 
1 55  PHE n 
1 56  VAL n 
1 57  GLY n 
1 58  ALA n 
1 59  GLY n 
1 60  SER n 
1 61  VAL n 
1 62  PHE n 
1 63  LEU n 
1 64  ASN n 
1 65  THR n 
1 66  ASP n 
1 67  PHE n 
1 68  SER n 
1 69  ARG n 
1 70  TYR n 
1 71  ILE n 
1 72  LEU n 
1 73  ALA n 
1 74  ASP n 
1 75  ILE n 
1 76  ASN n 
1 77  SER n 
1 78  ASP n 
1 79  LEU n 
1 80  ILE n 
1 81  SER n 
1 82  LEU n 
1 83  TYR n 
1 84  ASN n 
1 85  ILE n 
1 86  VAL n 
1 87  LYS n 
1 88  MET n 
1 89  ARG n 
1 90  THR n 
1 91  ASP n 
1 92  GLU n 
1 93  TYR n 
1 94  VAL n 
1 95  GLN n 
1 96  ALA n 
1 97  ALA n 
1 98  ARG n 
1 99  GLU n 
1 100 LEU n 
1 101 PHE n 
1 102 VAL n 
1 103 PRO n 
1 104 GLU n 
1 105 THR n 
1 106 ASN n 
1 107 CYS n 
1 108 ALA n 
1 109 GLU n 
1 110 VAL n 
1 111 TYR n 
1 112 TYR n 
1 113 GLN n 
1 114 PHE n 
1 115 ARG n 
1 116 GLU n 
1 117 GLU n 
1 118 PHE n 
1 119 ASN n 
1 120 LYS n 
1 121 SER n 
1 122 GLN n 
1 123 ASP n 
1 124 PRO n 
1 125 PHE n 
1 126 ARG n 
1 127 ARG n 
1 128 ALA n 
1 129 VAL n 
1 130 LEU n 
1 131 PHE n 
1 132 LEU n 
1 133 TYR n 
1 134 LEU n 
1 135 ASN n 
1 136 ARG n 
1 137 TYR n 
1 138 GLY n 
1 139 TYR n 
1 140 ASN n 
1 141 GLY n 
1 142 LEU n 
1 143 CYS n 
1 144 ARG n 
1 145 TYR n 
1 146 ASN n 
1 147 LEU n 
1 148 ARG n 
1 149 GLY n 
1 150 GLU n 
1 151 PHE n 
1 152 ASN n 
1 153 VAL n 
1 154 PRO n 
1 155 PHE n 
1 156 GLY n 
1 157 ARG n 
1 158 TYR n 
1 159 LYS n 
1 160 LYS n 
1 161 PRO n 
1 162 TYR n 
1 163 PHE n 
1 164 PRO n 
1 165 GLU n 
1 166 ALA n 
1 167 GLU n 
1 168 LEU n 
1 169 TYR n 
1 170 HIS n 
1 171 PHE n 
1 172 ALA n 
1 173 GLU n 
1 174 LYS n 
1 175 ALA n 
1 176 GLN n 
1 177 ASN n 
1 178 ALA n 
1 179 PHE n 
1 180 PHE n 
1 181 TYR n 
1 182 CYS n 
1 183 GLU n 
1 184 SER n 
1 185 TYR n 
1 186 ALA n 
1 187 ASP n 
1 188 SER n 
1 189 MET n 
1 190 ALA n 
1 191 ARG n 
1 192 ALA n 
1 193 ASP n 
1 194 ASP n 
1 195 SER n 
1 196 SER n 
1 197 VAL n 
1 198 VAL n 
1 199 TYR n 
1 200 CYS n 
1 201 ASP n 
1 202 PRO n 
1 203 PRO n 
1 204 TYR n 
1 205 ALA n 
1 206 PRO n 
1 207 LEU n 
1 208 SER n 
1 209 ALA n 
1 210 THR n 
1 211 ALA n 
1 212 ASN n 
1 213 PHE n 
1 214 THR n 
1 215 ALA n 
1 216 TYR n 
1 217 HIS n 
1 218 THR n 
1 219 ASN n 
1 220 SER n 
1 221 PHE n 
1 222 THR n 
1 223 LEU n 
1 224 GLU n 
1 225 GLN n 
1 226 GLN n 
1 227 ALA n 
1 228 HIS n 
1 229 LEU n 
1 230 ALA n 
1 231 GLU n 
1 232 ILE n 
1 233 ALA n 
1 234 GLU n 
1 235 GLY n 
1 236 LEU n 
1 237 VAL n 
1 238 GLU n 
1 239 ARG n 
1 240 HIS n 
1 241 ILE n 
1 242 PRO n 
1 243 VAL n 
1 244 LEU n 
1 245 ILE n 
1 246 SER n 
1 247 ASN n 
1 248 HIS n 
1 249 ASP n 
1 250 THR n 
1 251 MET n 
1 252 LEU n 
1 253 THR n 
1 254 ARG n 
1 255 GLU n 
1 256 TRP n 
1 257 TYR n 
1 258 GLN n 
1 259 ARG n 
1 260 ALA n 
1 261 LYS n 
1 262 LEU n 
1 263 HIS n 
1 264 VAL n 
1 265 VAL n 
1 266 LYS n 
1 267 VAL n 
1 268 ARG n 
1 269 ARG n 
1 270 SER n 
1 271 ILE n 
1 272 SER n 
1 273 SER n 
1 274 ASN n 
1 275 GLY n 
1 276 GLY n 
1 277 THR n 
1 278 ARG n 
1 279 LYS n 
1 280 LYS n 
1 281 VAL n 
1 282 ASP n 
1 283 GLU n 
1 284 LEU n 
1 285 LEU n 
1 286 ALA n 
1 287 LEU n 
1 288 TYR n 
1 289 LYS n 
1 290 PRO n 
1 291 GLY n 
1 292 VAL n 
1 293 VAL n 
1 294 SER n 
1 295 PRO n 
1 296 ALA n 
1 297 LYS n 
1 298 LYS n 
2 1   DT  n 
2 2   DT  n 
2 3   DT  n 
2 4   DA  n 
2 5   DA  n 
2 6   DA  n 
2 7   DG  n 
2 8   DA  n 
2 9   DT  n 
2 10  DC  n 
2 11  DG  n 
3 1   DA  n 
3 2   DC  n 
3 3   DG  n 
3 4   DA  n 
3 5   DT  n 
3 6   DC  n 
3 7   DT  n 
3 8   DT  n 
3 9   DT  n 
3 10  DA  n 
3 11  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dam, ECMDS42_2833' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'K-12 substr. MDS42' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1110693 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'HMS174(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'synthetic construct' ? 32630 ? 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H0Q7C9_ECOLI H0Q7C9 1 
;MKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAAREL
FVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFF
YCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRA
KLHVVKVRRSISSNGGTRKKVDELLALYKPGVVSPAKK
;
1 ? 
2 PDB 4RTP         4RTP   2 ? ? ? 
3 PDB 4RTP         4RTP   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4RTP A 21 ? 298 ? H0Q7C9 1 ? 278 ? 1 278 
2 2 4RTP F 1  ? 11  ? 4RTP   1 ? 11  ? 1 11  
3 3 4RTP G 1  ? 11  ? 4RTP   1 ? 11  ? 1 11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4RTP MET A 1   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -19 1  
1 4RTP GLY A 2   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -18 2  
1 4RTP SER A 3   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -17 3  
1 4RTP SER A 4   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -16 4  
1 4RTP HIS A 5   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -15 5  
1 4RTP HIS A 6   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -14 6  
1 4RTP HIS A 7   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -13 7  
1 4RTP HIS A 8   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -12 8  
1 4RTP HIS A 9   ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -11 9  
1 4RTP HIS A 10  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -10 10 
1 4RTP SER A 11  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -9  11 
1 4RTP SER A 12  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -8  12 
1 4RTP GLY A 13  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -7  13 
1 4RTP LEU A 14  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -6  14 
1 4RTP VAL A 15  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -5  15 
1 4RTP PRO A 16  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -4  16 
1 4RTP ARG A 17  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -3  17 
1 4RTP GLY A 18  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -2  18 
1 4RTP SER A 19  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' -1  19 
1 4RTP HIS A 20  ? UNP H0Q7C9 ?   ?   'EXPRESSION TAG' 0   20 
1 4RTP SER A 195 ? UNP H0Q7C9 ALA 175 'SEE REMARK 999' 175 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE                 ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4RTP 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.99 
_exptl_crystal.density_percent_sol   38.13 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pdbx_details    
'20% PEG200, 100mM KCl, 10mM MgSO4, 100mM HEPES buffer, pH 6.8, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-12-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
# 
_reflns.entry_id                     4RTP 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             34.8 
_reflns.d_resolution_high            2.39 
_reflns.number_obs                   13573 
_reflns.number_all                   13573 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.069 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.3 
_reflns.B_iso_Wilson_estimate        50.0 
_reflns.pdbx_redundancy              5.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.39 
_reflns_shell.d_res_low              2.48 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.311 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    6.5 
_reflns_shell.pdbx_redundancy        6.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1312 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4RTP 
_refine.ls_number_reflns_obs                     13526 
_refine.ls_number_reflns_all                     13526 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             34.759 
_refine.ls_d_res_high                            2.390 
_refine.ls_percent_reflns_obs                    99.36 
_refine.ls_R_factor_obs                          0.2182 
_refine.ls_R_factor_R_work                       0.2165 
_refine.ls_R_factor_R_free                       0.2486 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  684 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 2G1P' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.26 
_refine.pdbx_overall_phase_error                 25.20 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1936 
_refine_hist.pdbx_number_atoms_nucleic_acid   445 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             25 
_refine_hist.number_atoms_total               2433 
_refine_hist.d_res_high                       2.390 
_refine_hist.d_res_low                        34.759 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.002  ? ? 2523 ? 'X-RAY DIFFRACTION' 
f_angle_d          0.545  ? ? 3528 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 18.040 ? ? 920  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.024  ? ? 382  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.003  ? ? 380  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.3900 2.5745  2530 0.2551 100.00 0.3229 . . 128 . . . . 'X-RAY DIFFRACTION' 
. 2.5745 2.8335  2512 0.2742 100.00 0.2791 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 2.8335 3.2432  2536 0.2506 100.00 0.3016 . . 149 . . . . 'X-RAY DIFFRACTION' 
. 3.2432 4.0851  2590 0.1996 100.00 0.2420 . . 122 . . . . 'X-RAY DIFFRACTION' 
. 4.0851 34.7631 2674 0.1981 98.00  0.2175 . . 146 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4RTP 
_struct.title                     
'Complex of Escherichia coli DNA Adenine Methyltransferase (DAM) with AdoMet and with DNA Containing Proximal Pap Regulon Sequence' 
_struct.pdbx_descriptor           'DNA adenine methylase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4RTP 
_struct_keywords.pdbx_keywords   Transferase/DNA 
_struct_keywords.text            
;DAM METHYLATION, GATC RECOGNITION, BASE FLIPPING, BACTERIAL VIRULENCE, methylation-independent transcriptional repressor, Transferase-DNA complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 37  ? LEU A 45  ? LEU A 17  LEU A 25  1 ? 9  
HELX_P HELX_P2  2  GLY A 59  ? ASN A 64  ? GLY A 39  ASN A 44  1 ? 6  
HELX_P HELX_P3  3  ASN A 76  ? ARG A 89  ? ASN A 56  ARG A 69  1 ? 14 
HELX_P HELX_P4  4  ARG A 89  ? GLU A 99  ? ARG A 69  GLU A 79  1 ? 11 
HELX_P HELX_P5  5  LEU A 100 ? PHE A 101 ? LEU A 80  PHE A 81  5 ? 2  
HELX_P HELX_P6  6  VAL A 102 ? ASN A 106 ? VAL A 82  ASN A 86  5 ? 5  
HELX_P HELX_P7  7  CYS A 107 ? SER A 121 ? CYS A 87  SER A 101 1 ? 15 
HELX_P HELX_P8  8  ASP A 123 ? GLY A 138 ? ASP A 103 GLY A 118 1 ? 16 
HELX_P HELX_P9  9  TYR A 139 ? LEU A 142 ? TYR A 119 LEU A 122 5 ? 4  
HELX_P HELX_P10 10 PRO A 164 ? ALA A 175 ? PRO A 144 ALA A 155 1 ? 12 
HELX_P HELX_P11 11 SER A 184 ? ALA A 190 ? SER A 164 ALA A 170 1 ? 7  
HELX_P HELX_P12 12 THR A 222 ? ARG A 239 ? THR A 202 ARG A 219 1 ? 18 
HELX_P HELX_P13 13 THR A 250 ? TYR A 257 ? THR A 230 TYR A 237 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? B DT 2  N3 ? ? ? 1_555 C DA 11 N1 ? ? F DT 2  G DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? B DT 2  O4 ? ? ? 1_555 C DA 11 N6 ? ? F DT 2  G DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? B DT 3  N3 ? ? ? 1_555 C DA 10 N1 ? ? F DT 3  G DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? B DT 3  O4 ? ? ? 1_555 C DA 10 N6 ? ? F DT 3  G DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? B DA 4  N1 ? ? ? 1_555 C DT 9  N3 ? ? F DA 4  G DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? B DA 4  N6 ? ? ? 1_555 C DT 9  O4 ? ? F DA 4  G DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? B DA 5  N1 ? ? ? 1_555 C DT 8  N3 ? ? F DA 5  G DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? B DA 5  N6 ? ? ? 1_555 C DT 8  O4 ? ? F DA 5  G DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? B DA 6  N1 ? ? ? 1_555 C DT 7  N3 ? ? F DA 6  G DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? B DA 6  N6 ? ? ? 1_555 C DT 7  O4 ? ? F DA 6  G DT 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? B DG 7  N1 ? ? ? 1_555 C DC 6  N3 ? ? F DG 7  G DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? B DG 7  N2 ? ? ? 1_555 C DC 6  O2 ? ? F DG 7  G DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? B DG 7  O6 ? ? ? 1_555 C DC 6  N4 ? ? F DG 7  G DC 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? B DA 8  N1 ? ? ? 1_555 C DT 5  N3 ? ? F DA 8  G DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? B DA 8  N6 ? ? ? 1_555 C DT 5  O4 ? ? F DA 8  G DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? B DT 9  N3 ? ? ? 1_555 C DA 4  N1 ? ? F DT 9  G DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? B DT 9  O4 ? ? ? 1_555 C DA 4  N6 ? ? F DT 9  G DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? B DC 10 N3 ? ? ? 1_555 C DG 3  N1 ? ? F DC 10 G DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? B DC 10 N4 ? ? ? 1_555 C DG 3  O6 ? ? F DC 10 G DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? B DC 10 O2 ? ? ? 1_555 C DG 3  N2 ? ? F DC 10 G DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? B DG 11 N1 ? ? ? 1_555 C DC 2  N3 ? ? F DG 11 G DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? B DG 11 N2 ? ? ? 1_555 C DC 2  O2 ? ? F DG 11 G DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? B DG 11 O6 ? ? ? 1_555 C DC 2  N4 ? ? F DG 11 G DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 178 ? CYS A 182 ? ALA A 158 CYS A 162 
A 2 ARG A 69  ? ASP A 74  ? ARG A 49  ASP A 54  
A 3 CYS A 50  ? GLU A 53  ? CYS A 30  GLU A 33  
A 4 SER A 196 ? CYS A 200 ? SER A 176 CYS A 180 
A 5 VAL A 243 ? HIS A 248 ? VAL A 223 HIS A 228 
A 6 GLU A 283 ? TYR A 288 ? GLU A 263 TYR A 268 
A 7 LYS A 261 ? VAL A 265 ? LYS A 241 VAL A 245 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 179 ? O PHE A 159 N LEU A 72  ? N LEU A 52  
A 2 3 O ILE A 71  ? O ILE A 51  N LEU A 51  ? N LEU A 31  
A 3 4 N VAL A 52  ? N VAL A 32  O VAL A 197 ? O VAL A 177 
A 4 5 N CYS A 200 ? N CYS A 180 O LEU A 244 ? O LEU A 224 
A 5 6 N ASN A 247 ? N ASN A 227 O LEU A 284 ? O LEU A 264 
A 6 7 O LEU A 287 ? O LEU A 267 N LYS A 261 ? N LYS A 241 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    15 
_struct_site.details              'BINDING SITE FOR RESIDUE SAM A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 TRP A 30  ? TRP A 10  . ? 1_555 ? 
2  AC1 15 ALA A 31  ? ALA A 11  . ? 1_555 ? 
3  AC1 15 GLY A 32  ? GLY A 12  . ? 1_555 ? 
4  AC1 15 PHE A 55  ? PHE A 35  . ? 1_555 ? 
5  AC1 15 VAL A 56  ? VAL A 36  . ? 1_555 ? 
6  AC1 15 GLY A 57  ? GLY A 37  . ? 1_555 ? 
7  AC1 15 ALA A 58  ? ALA A 38  . ? 1_555 ? 
8  AC1 15 SER A 60  ? SER A 40  . ? 1_555 ? 
9  AC1 15 ASP A 74  ? ASP A 54  . ? 1_555 ? 
10 AC1 15 ILE A 75  ? ILE A 55  . ? 1_555 ? 
11 AC1 15 SER A 184 ? SER A 164 . ? 1_555 ? 
12 AC1 15 TYR A 185 ? TYR A 165 . ? 1_555 ? 
13 AC1 15 ASP A 201 ? ASP A 181 . ? 1_555 ? 
14 AC1 15 PHE A 221 ? PHE A 201 . ? 1_555 ? 
15 AC1 15 GLN A 225 ? GLN A 205 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4RTP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4RTP 
_atom_sites.fract_transf_matrix[1][1]   0.027920 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015817 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006940 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 23  ? -23.560 -0.111  92.366  1.00 82.03  ? 3   LYS A N     1 
ATOM   2    C CA    . LYS A 1 23  ? -22.126 -0.200  92.117  1.00 79.85  ? 3   LYS A CA    1 
ATOM   3    C C     . LYS A 1 23  ? -21.332 0.280   93.327  1.00 76.66  ? 3   LYS A C     1 
ATOM   4    O O     . LYS A 1 23  ? -21.362 1.461   93.672  1.00 76.12  ? 3   LYS A O     1 
ATOM   5    C CB    . LYS A 1 23  ? -21.746 0.612   90.878  1.00 80.82  ? 3   LYS A CB    1 
ATOM   6    C CG    . LYS A 1 23  ? -22.650 0.367   89.681  1.00 84.03  ? 3   LYS A CG    1 
ATOM   7    C CD    . LYS A 1 23  ? -22.065 0.953   88.408  1.00 84.96  ? 3   LYS A CD    1 
ATOM   8    C CE    . LYS A 1 23  ? -20.769 0.255   88.032  1.00 84.17  ? 3   LYS A CE    1 
ATOM   9    N NZ    . LYS A 1 23  ? -20.303 0.652   86.677  1.00 85.39  ? 3   LYS A NZ    1 
ATOM   10   N N     . ASN A 1 24  ? -20.625 -0.645  93.968  1.00 74.55  ? 4   ASN A N     1 
ATOM   11   C CA    . ASN A 1 24  ? -19.835 -0.325  95.150  1.00 71.86  ? 4   ASN A CA    1 
ATOM   12   C C     . ASN A 1 24  ? -18.623 0.536   94.813  1.00 68.76  ? 4   ASN A C     1 
ATOM   13   O O     . ASN A 1 24  ? -17.840 0.200   93.926  1.00 68.34  ? 4   ASN A O     1 
ATOM   14   C CB    . ASN A 1 24  ? -19.383 -1.610  95.848  1.00 72.22  ? 4   ASN A CB    1 
ATOM   15   C CG    . ASN A 1 24  ? -20.549 -2.469  96.299  1.00 74.91  ? 4   ASN A CG    1 
ATOM   16   O OD1   . ASN A 1 24  ? -21.560 -1.960  96.781  1.00 76.11  ? 4   ASN A OD1   1 
ATOM   17   N ND2   . ASN A 1 24  ? -20.414 -3.781  96.139  1.00 76.06  ? 4   ASN A ND2   1 
ATOM   18   N N     . ARG A 1 25  ? -18.475 1.650   95.523  1.00 67.04  ? 5   ARG A N     1 
ATOM   19   C CA    . ARG A 1 25  ? -17.341 2.539   95.306  1.00 65.25  ? 5   ARG A CA    1 
ATOM   20   C C     . ARG A 1 25  ? -16.219 2.258   96.298  1.00 61.00  ? 5   ARG A C     1 
ATOM   21   O O     . ARG A 1 25  ? -16.469 1.929   97.457  1.00 60.45  ? 5   ARG A O     1 
ATOM   22   C CB    . ARG A 1 25  ? -17.767 4.005   95.412  1.00 67.82  ? 5   ARG A CB    1 
ATOM   23   C CG    . ARG A 1 25  ? -18.799 4.440   94.387  1.00 72.63  ? 5   ARG A CG    1 
ATOM   24   C CD    . ARG A 1 25  ? -18.759 5.947   94.185  1.00 75.52  ? 5   ARG A CD    1 
ATOM   25   N NE    . ARG A 1 25  ? -17.985 6.319   93.004  1.00 77.87  ? 5   ARG A NE    1 
ATOM   26   C CZ    . ARG A 1 25  ? -17.540 7.547   92.756  1.00 80.02  ? 5   ARG A CZ    1 
ATOM   27   N NH1   . ARG A 1 25  ? -17.779 8.529   93.615  1.00 80.66  ? 5   ARG A NH1   1 
ATOM   28   N NH2   . ARG A 1 25  ? -16.847 7.792   91.651  1.00 81.24  ? 5   ARG A NH2   1 
ATOM   29   N N     . ALA A 1 26  ? -14.983 2.389   95.832  1.00 58.31  ? 6   ALA A N     1 
ATOM   30   C CA    . ALA A 1 26  ? -13.823 2.251   96.701  1.00 54.91  ? 6   ALA A CA    1 
ATOM   31   C C     . ALA A 1 26  ? -13.756 3.436   97.656  1.00 52.29  ? 6   ALA A C     1 
ATOM   32   O O     . ALA A 1 26  ? -14.309 4.498   97.370  1.00 51.92  ? 6   ALA A O     1 
ATOM   33   C CB    . ALA A 1 26  ? -12.553 2.148   95.883  1.00 54.34  ? 6   ALA A CB    1 
ATOM   34   N N     . PHE A 1 27  ? -13.084 3.258   98.789  1.00 50.11  ? 7   PHE A N     1 
ATOM   35   C CA    . PHE A 1 27  ? -12.976 4.338   99.763  1.00 49.11  ? 7   PHE A CA    1 
ATOM   36   C C     . PHE A 1 27  ? -11.787 5.240   99.447  1.00 47.80  ? 7   PHE A C     1 
ATOM   37   O O     . PHE A 1 27  ? -11.555 6.238   100.129 1.00 46.99  ? 7   PHE A O     1 
ATOM   38   C CB    . PHE A 1 27  ? -12.869 3.781   101.188 1.00 48.53  ? 7   PHE A CB    1 
ATOM   39   C CG    . PHE A 1 27  ? -11.648 2.937   101.433 1.00 48.13  ? 7   PHE A CG    1 
ATOM   40   C CD1   . PHE A 1 27  ? -10.483 3.505   101.920 1.00 46.59  ? 7   PHE A CD1   1 
ATOM   41   C CD2   . PHE A 1 27  ? -11.674 1.571   101.198 1.00 49.40  ? 7   PHE A CD2   1 
ATOM   42   C CE1   . PHE A 1 27  ? -9.362  2.730   102.158 1.00 46.08  ? 7   PHE A CE1   1 
ATOM   43   C CE2   . PHE A 1 27  ? -10.557 0.792   101.432 1.00 49.06  ? 7   PHE A CE2   1 
ATOM   44   C CZ    . PHE A 1 27  ? -9.399  1.373   101.912 1.00 47.36  ? 7   PHE A CZ    1 
ATOM   45   N N     . LEU A 1 28  ? -11.044 4.887   98.402  1.00 47.79  ? 8   LEU A N     1 
ATOM   46   C CA    . LEU A 1 28  ? -9.890  5.672   97.977  1.00 46.77  ? 8   LEU A CA    1 
ATOM   47   C C     . LEU A 1 28  ? -10.092 6.294   96.602  1.00 47.60  ? 8   LEU A C     1 
ATOM   48   O O     . LEU A 1 28  ? -10.691 5.683   95.717  1.00 49.43  ? 8   LEU A O     1 
ATOM   49   C CB    . LEU A 1 28  ? -8.631  4.803   97.949  1.00 46.85  ? 8   LEU A CB    1 
ATOM   50   C CG    . LEU A 1 28  ? -8.054  4.301   99.270  1.00 46.18  ? 8   LEU A CG    1 
ATOM   51   C CD1   . LEU A 1 28  ? -6.882  3.376   99.002  1.00 45.51  ? 8   LEU A CD1   1 
ATOM   52   C CD2   . LEU A 1 28  ? -7.625  5.466   100.143 1.00 44.66  ? 8   LEU A CD2   1 
ATOM   53   N N     . LYS A 1 29  ? -9.590  7.513   96.427  1.00 46.53  ? 9   LYS A N     1 
ATOM   54   C CA    . LYS A 1 29  ? -9.430  8.070   95.092  1.00 48.23  ? 9   LYS A CA    1 
ATOM   55   C C     . LYS A 1 29  ? -8.214  7.407   94.467  1.00 47.57  ? 9   LYS A C     1 
ATOM   56   O O     . LYS A 1 29  ? -7.120  7.463   95.028  1.00 46.06  ? 9   LYS A O     1 
ATOM   57   C CB    . LYS A 1 29  ? -9.243  9.587   95.125  1.00 48.65  ? 9   LYS A CB    1 
ATOM   58   C CG    . LYS A 1 29  ? -10.385 10.375  95.732  1.00 49.70  ? 9   LYS A CG    1 
ATOM   59   C CD    . LYS A 1 29  ? -10.098 11.865  95.618  1.00 50.62  ? 9   LYS A CD    1 
ATOM   60   C CE    . LYS A 1 29  ? -11.117 12.697  96.368  1.00 52.29  ? 9   LYS A CE    1 
ATOM   61   N NZ    . LYS A 1 29  ? -10.799 14.150  96.282  1.00 53.58  ? 9   LYS A NZ    1 
ATOM   62   N N     . TRP A 1 30  ? -8.395  6.774   93.314  1.00 49.37  ? 10  TRP A N     1 
ATOM   63   C CA    . TRP A 1 30  ? -7.293  6.048   92.699  1.00 50.48  ? 10  TRP A CA    1 
ATOM   64   C C     . TRP A 1 30  ? -7.424  5.982   91.185  1.00 55.27  ? 10  TRP A C     1 
ATOM   65   O O     . TRP A 1 30  ? -8.529  6.010   90.643  1.00 57.72  ? 10  TRP A O     1 
ATOM   66   C CB    . TRP A 1 30  ? -7.209  4.636   93.278  1.00 49.06  ? 10  TRP A CB    1 
ATOM   67   C CG    . TRP A 1 30  ? -5.835  4.055   93.243  1.00 48.46  ? 10  TRP A CG    1 
ATOM   68   C CD1   . TRP A 1 30  ? -5.315  3.234   92.287  1.00 50.18  ? 10  TRP A CD1   1 
ATOM   69   C CD2   . TRP A 1 30  ? -4.798  4.253   94.211  1.00 46.35  ? 10  TRP A CD2   1 
ATOM   70   N NE1   . TRP A 1 30  ? -4.018  2.906   92.601  1.00 49.86  ? 10  TRP A NE1   1 
ATOM   71   C CE2   . TRP A 1 30  ? -3.677  3.519   93.776  1.00 46.97  ? 10  TRP A CE2   1 
ATOM   72   C CE3   . TRP A 1 30  ? -4.710  4.979   95.403  1.00 44.35  ? 10  TRP A CE3   1 
ATOM   73   C CZ2   . TRP A 1 30  ? -2.482  3.491   94.492  1.00 45.98  ? 10  TRP A CZ2   1 
ATOM   74   C CZ3   . TRP A 1 30  ? -3.522  4.950   96.111  1.00 43.01  ? 10  TRP A CZ3   1 
ATOM   75   C CH2   . TRP A 1 30  ? -2.424  4.211   95.654  1.00 43.58  ? 10  TRP A CH2   1 
ATOM   76   N N     . ALA A 1 31  ? -6.284  5.894   90.508  1.00 57.74  ? 11  ALA A N     1 
ATOM   77   C CA    . ALA A 1 31  ? -6.261  5.774   89.058  1.00 62.24  ? 11  ALA A CA    1 
ATOM   78   C C     . ALA A 1 31  ? -6.876  4.450   88.625  1.00 65.37  ? 11  ALA A C     1 
ATOM   79   O O     . ALA A 1 31  ? -6.793  3.453   89.343  1.00 64.57  ? 11  ALA A O     1 
ATOM   80   C CB    . ALA A 1 31  ? -4.840  5.899   88.535  1.00 62.56  ? 11  ALA A CB    1 
ATOM   81   N N     . GLY A 1 32  ? -7.457  4.422   87.449  1.00 69.69  ? 12  GLY A N     1 
ATOM   82   C CA    . GLY A 1 32  ? -8.077  3.215   86.962  1.00 72.47  ? 12  GLY A CA    1 
ATOM   83   C C     . GLY A 1 32  ? -9.218  2.675   87.768  1.00 72.70  ? 12  GLY A C     1 
ATOM   84   O O     . GLY A 1 32  ? -9.336  1.487   87.959  1.00 72.36  ? 12  GLY A O     1 
ATOM   85   N N     . GLY A 1 33  ? -10.065 3.563   88.242  1.00 73.66  ? 13  GLY A N     1 
ATOM   86   C CA    . GLY A 1 33  ? -11.268 3.161   88.931  1.00 73.96  ? 13  GLY A CA    1 
ATOM   87   C C     . GLY A 1 33  ? -12.151 2.384   87.990  1.00 76.59  ? 13  GLY A C     1 
ATOM   88   O O     . GLY A 1 33  ? -12.793 1.436   88.374  1.00 76.91  ? 13  GLY A O     1 
ATOM   89   N N     . LYS A 1 34  ? -12.210 2.820   86.747  1.00 78.60  ? 14  LYS A N     1 
ATOM   90   C CA    . LYS A 1 34  ? -12.846 2.038   85.722  1.00 80.59  ? 14  LYS A CA    1 
ATOM   91   C C     . LYS A 1 34  ? -14.295 1.734   86.022  1.00 79.91  ? 14  LYS A C     1 
ATOM   92   O O     . LYS A 1 34  ? -14.788 0.695   85.655  1.00 80.82  ? 14  LYS A O     1 
ATOM   93   C CB    . LYS A 1 34  ? -12.085 0.726   85.556  1.00 81.42  ? 14  LYS A CB    1 
ATOM   94   N N     . TYR A 1 35  ? -14.991 2.649   86.665  1.00 78.53  ? 15  TYR A N     1 
ATOM   95   C CA    . TYR A 1 35  ? -16.372 2.412   87.031  1.00 78.61  ? 15  TYR A CA    1 
ATOM   96   C C     . TYR A 1 35  ? -17.310 2.240   85.846  1.00 80.57  ? 15  TYR A C     1 
ATOM   97   O O     . TYR A 1 35  ? -18.226 1.433   85.883  1.00 81.54  ? 15  TYR A O     1 
ATOM   98   C CB    . TYR A 1 35  ? -16.862 3.510   87.950  1.00 77.98  ? 15  TYR A CB    1 
ATOM   99   C CG    . TYR A 1 35  ? -16.249 3.434   89.303  1.00 75.86  ? 15  TYR A CG    1 
ATOM   100  C CD1   . TYR A 1 35  ? -16.415 2.322   90.087  1.00 75.06  ? 15  TYR A CD1   1 
ATOM   101  C CD2   . TYR A 1 35  ? -15.493 4.461   89.792  1.00 75.03  ? 15  TYR A CD2   1 
ATOM   102  C CE1   . TYR A 1 35  ? -15.846 2.240   91.330  1.00 73.18  ? 15  TYR A CE1   1 
ATOM   103  C CE2   . TYR A 1 35  ? -14.919 4.392   91.041  1.00 73.07  ? 15  TYR A CE2   1 
ATOM   104  C CZ    . TYR A 1 35  ? -15.100 3.275   91.803  1.00 72.17  ? 15  TYR A CZ    1 
ATOM   105  O OH    . TYR A 1 35  ? -14.537 3.193   93.039  1.00 70.30  ? 15  TYR A OH    1 
ATOM   106  N N     . PRO A 1 36  ? -17.111 3.019   84.799  1.00 80.96  ? 16  PRO A N     1 
ATOM   107  C CA    . PRO A 1 36  ? -18.008 2.894   83.642  1.00 82.94  ? 16  PRO A CA    1 
ATOM   108  C C     . PRO A 1 36  ? -17.952 1.523   82.968  1.00 83.05  ? 16  PRO A C     1 
ATOM   109  O O     . PRO A 1 36  ? -18.974 1.049   82.473  1.00 84.69  ? 16  PRO A O     1 
ATOM   110  C CB    . PRO A 1 36  ? -17.500 3.980   82.685  1.00 84.54  ? 16  PRO A CB    1 
ATOM   111  C CG    . PRO A 1 36  ? -16.807 4.958   83.555  1.00 82.88  ? 16  PRO A CG    1 
ATOM   112  C CD    . PRO A 1 36  ? -16.165 4.137   84.626  1.00 80.51  ? 16  PRO A CD    1 
ATOM   113  N N     . LEU A 1 37  ? -16.780 0.895   82.955  1.00 81.29  ? 17  LEU A N     1 
ATOM   114  C CA    . LEU A 1 37  ? -16.616 -0.374  82.253  1.00 81.28  ? 17  LEU A CA    1 
ATOM   115  C C     . LEU A 1 37  ? -16.565 -1.573  83.198  1.00 78.73  ? 17  LEU A C     1 
ATOM   116  O O     . LEU A 1 37  ? -16.122 -2.652  82.811  1.00 79.00  ? 17  LEU A O     1 
ATOM   117  C CB    . LEU A 1 37  ? -15.356 -0.340  81.384  1.00 82.73  ? 17  LEU A CB    1 
ATOM   118  C CG    . LEU A 1 37  ? -14.012 -0.146  82.086  1.00 81.23  ? 17  LEU A CG    1 
ATOM   119  C CD1   . LEU A 1 37  ? -13.174 -1.413  81.992  1.00 81.58  ? 17  LEU A CD1   1 
ATOM   120  C CD2   . LEU A 1 37  ? -13.267 1.041   81.494  1.00 82.03  ? 17  LEU A CD2   1 
ATOM   121  N N     . LEU A 1 38  ? -17.022 -1.382  84.433  1.00 80.60  ? 18  LEU A N     1 
ATOM   122  C CA    . LEU A 1 38  ? -17.152 -2.489  85.377  1.00 78.93  ? 18  LEU A CA    1 
ATOM   123  C C     . LEU A 1 38  ? -18.150 -3.511  84.851  1.00 83.19  ? 18  LEU A C     1 
ATOM   124  O O     . LEU A 1 38  ? -18.016 -4.713  85.091  1.00 82.65  ? 18  LEU A O     1 
ATOM   125  C CB    . LEU A 1 38  ? -17.598 -1.988  86.753  1.00 76.96  ? 18  LEU A CB    1 
ATOM   126  C CG    . LEU A 1 38  ? -16.522 -1.540  87.743  1.00 71.80  ? 18  LEU A CG    1 
ATOM   127  C CD1   . LEU A 1 38  ? -17.162 -1.011  89.014  1.00 70.93  ? 18  LEU A CD1   1 
ATOM   128  C CD2   . LEU A 1 38  ? -15.571 -2.683  88.054  1.00 69.55  ? 18  LEU A CD2   1 
ATOM   129  N N     . ASP A 1 39  ? -19.152 -3.014  84.133  1.00 87.59  ? 19  ASP A N     1 
ATOM   130  C CA    . ASP A 1 39  ? -20.196 -3.852  83.560  1.00 93.46  ? 19  ASP A CA    1 
ATOM   131  C C     . ASP A 1 39  ? -19.640 -4.766  82.473  1.00 94.31  ? 19  ASP A C     1 
ATOM   132  O O     . ASP A 1 39  ? -20.086 -5.904  82.316  1.00 97.28  ? 19  ASP A O     1 
ATOM   133  C CB    . ASP A 1 39  ? -21.318 -2.980  82.993  1.00 99.19  ? 19  ASP A CB    1 
ATOM   134  C CG    . ASP A 1 39  ? -21.762 -1.901  83.964  1.00 98.79  ? 19  ASP A CG    1 
ATOM   135  O OD1   . ASP A 1 39  ? -21.724 -2.155  85.187  1.00 96.23  ? 19  ASP A OD1   1 
ATOM   136  O OD2   . ASP A 1 39  ? -22.147 -0.802  83.511  1.00 101.18 ? 19  ASP A OD2   1 
ATOM   137  N N     . ASP A 1 40  ? -18.672 -4.256  81.720  1.00 92.08  ? 20  ASP A N     1 
ATOM   138  C CA    . ASP A 1 40  ? -18.058 -5.020  80.642  1.00 92.87  ? 20  ASP A CA    1 
ATOM   139  C C     . ASP A 1 40  ? -17.102 -6.073  81.194  1.00 88.78  ? 20  ASP A C     1 
ATOM   140  O O     . ASP A 1 40  ? -16.973 -7.161  80.633  1.00 90.92  ? 20  ASP A O     1 
ATOM   141  C CB    . ASP A 1 40  ? -17.319 -4.089  79.678  1.00 92.59  ? 20  ASP A CB    1 
ATOM   142  N N     . ILE A 1 41  ? -16.435 -5.740  82.295  1.00 83.08  ? 21  ILE A N     1 
ATOM   143  C CA    . ILE A 1 41  ? -15.503 -6.661  82.936  1.00 79.62  ? 21  ILE A CA    1 
ATOM   144  C C     . ILE A 1 41  ? -16.218 -7.917  83.419  1.00 81.62  ? 21  ILE A C     1 
ATOM   145  O O     . ILE A 1 41  ? -15.813 -9.032  83.097  1.00 82.41  ? 21  ILE A O     1 
ATOM   146  C CB    . ILE A 1 41  ? -14.782 -6.002  84.131  1.00 74.21  ? 21  ILE A CB    1 
ATOM   147  C CG1   . ILE A 1 41  ? -13.944 -4.813  83.660  1.00 72.28  ? 21  ILE A CG1   1 
ATOM   148  C CG2   . ILE A 1 41  ? -13.904 -7.016  84.851  1.00 71.44  ? 21  ILE A CG2   1 
ATOM   149  C CD1   . ILE A 1 41  ? -12.896 -5.174  82.633  1.00 72.96  ? 21  ILE A CD1   1 
ATOM   150  N N     . LYS A 1 42  ? -17.287 -7.723  84.186  1.00 82.82  ? 22  LYS A N     1 
ATOM   151  C CA    . LYS A 1 42  ? -18.050 -8.829  84.755  1.00 85.43  ? 22  LYS A CA    1 
ATOM   152  C C     . LYS A 1 42  ? -18.641 -9.738  83.680  1.00 90.22  ? 22  LYS A C     1 
ATOM   153  O O     . LYS A 1 42  ? -18.764 -10.946 83.878  1.00 92.76  ? 22  LYS A O     1 
ATOM   154  C CB    . LYS A 1 42  ? -19.167 -8.295  85.652  1.00 86.75  ? 22  LYS A CB    1 
ATOM   155  C CG    . LYS A 1 42  ? -18.677 -7.461  86.824  1.00 81.98  ? 22  LYS A CG    1 
ATOM   156  C CD    . LYS A 1 42  ? -19.840 -6.925  87.642  1.00 83.76  ? 22  LYS A CD    1 
ATOM   157  C CE    . LYS A 1 42  ? -20.725 -8.053  88.145  1.00 87.54  ? 22  LYS A CE    1 
ATOM   158  N NZ    . LYS A 1 42  ? -19.962 -9.027  88.974  1.00 85.44  ? 22  LYS A NZ    1 
ATOM   159  N N     . ARG A 1 43  ? -19.001 -9.151  82.544  1.00 91.65  ? 23  ARG A N     1 
ATOM   160  C CA    . ARG A 1 43  ? -19.599 -9.909  81.451  1.00 96.59  ? 23  ARG A CA    1 
ATOM   161  C C     . ARG A 1 43  ? -18.565 -10.772 80.732  1.00 96.62  ? 23  ARG A C     1 
ATOM   162  O O     . ARG A 1 43  ? -18.907 -11.785 80.125  1.00 101.48 ? 23  ARG A O     1 
ATOM   163  C CB    . ARG A 1 43  ? -20.276 -8.966  80.454  1.00 99.50  ? 23  ARG A CB    1 
ATOM   164  N N     . HIS A 1 44  ? -17.301 -10.368 80.807  1.00 91.82  ? 24  HIS A N     1 
ATOM   165  C CA    . HIS A 1 44  ? -16.231 -11.090 80.127  1.00 91.39  ? 24  HIS A CA    1 
ATOM   166  C C     . HIS A 1 44  ? -15.331 -11.841 81.104  1.00 87.08  ? 24  HIS A C     1 
ATOM   167  O O     . HIS A 1 44  ? -14.410 -12.545 80.691  1.00 87.10  ? 24  HIS A O     1 
ATOM   168  C CB    . HIS A 1 44  ? -15.392 -10.128 79.284  1.00 89.92  ? 24  HIS A CB    1 
ATOM   169  C CG    . HIS A 1 44  ? -16.147 -9.498  78.152  1.00 94.37  ? 24  HIS A CG    1 
ATOM   170  N ND1   . HIS A 1 44  ? -17.115 -8.538  78.349  1.00 95.26  ? 24  HIS A ND1   1 
ATOM   171  C CD2   . HIS A 1 44  ? -16.074 -9.695  76.817  1.00 98.57  ? 24  HIS A CD2   1 
ATOM   172  C CE1   . HIS A 1 44  ? -17.607 -8.169  77.178  1.00 99.82  ? 24  HIS A CE1   1 
ATOM   173  N NE2   . HIS A 1 44  ? -16.993 -8.854  76.232  1.00 101.91 ? 24  HIS A NE2   1 
ATOM   174  N N     . LEU A 1 45  ? -15.598 -11.689 82.397  1.00 83.92  ? 25  LEU A N     1 
ATOM   175  C CA    . LEU A 1 45  ? -14.805 -12.363 83.419  1.00 80.64  ? 25  LEU A CA    1 
ATOM   176  C C     . LEU A 1 45  ? -15.422 -13.710 83.781  1.00 84.59  ? 25  LEU A C     1 
ATOM   177  O O     . LEU A 1 45  ? -16.543 -13.766 84.288  1.00 86.87  ? 25  LEU A O     1 
ATOM   178  C CB    . LEU A 1 45  ? -14.675 -11.489 84.667  1.00 75.67  ? 25  LEU A CB    1 
ATOM   179  C CG    . LEU A 1 45  ? -13.679 -11.948 85.733  1.00 71.72  ? 25  LEU A CG    1 
ATOM   180  C CD1   . LEU A 1 45  ? -12.265 -11.981 85.170  1.00 69.54  ? 25  LEU A CD1   1 
ATOM   181  C CD2   . LEU A 1 45  ? -13.753 -11.044 86.954  1.00 67.94  ? 25  LEU A CD2   1 
ATOM   182  N N     . PRO A 1 46  ? -14.688 -14.801 83.515  1.00 86.06  ? 26  PRO A N     1 
ATOM   183  C CA    . PRO A 1 46  ? -15.148 -16.172 83.768  1.00 89.84  ? 26  PRO A CA    1 
ATOM   184  C C     . PRO A 1 46  ? -15.441 -16.443 85.242  1.00 87.65  ? 26  PRO A C     1 
ATOM   185  O O     . PRO A 1 46  ? -15.092 -15.637 86.105  1.00 83.47  ? 26  PRO A O     1 
ATOM   186  C CB    . PRO A 1 46  ? -13.974 -17.032 83.287  1.00 90.24  ? 26  PRO A CB    1 
ATOM   187  C CG    . PRO A 1 46  ? -13.231 -16.164 82.329  1.00 88.73  ? 26  PRO A CG    1 
ATOM   188  C CD    . PRO A 1 46  ? -13.361 -14.778 82.878  1.00 84.51  ? 26  PRO A CD    1 
ATOM   189  N N     . LYS A 1 47  ? -16.079 -17.576 85.518  1.00 90.74  ? 27  LYS A N     1 
ATOM   190  C CA    . LYS A 1 47  ? -16.406 -17.958 86.885  1.00 89.33  ? 27  LYS A CA    1 
ATOM   191  C C     . LYS A 1 47  ? -15.311 -18.832 87.486  1.00 87.04  ? 27  LYS A C     1 
ATOM   192  O O     . LYS A 1 47  ? -14.649 -19.591 86.778  1.00 88.17  ? 27  LYS A O     1 
ATOM   193  C CB    . LYS A 1 47  ? -17.749 -18.690 86.932  1.00 95.10  ? 27  LYS A CB    1 
ATOM   194  N N     . GLY A 1 48  ? -15.124 -18.717 88.796  1.00 84.18  ? 28  GLY A N     1 
ATOM   195  C CA    . GLY A 1 48  ? -14.114 -19.489 89.494  1.00 82.55  ? 28  GLY A CA    1 
ATOM   196  C C     . GLY A 1 48  ? -14.264 -19.379 90.997  1.00 80.70  ? 28  GLY A C     1 
ATOM   197  O O     . GLY A 1 48  ? -15.096 -18.617 91.492  1.00 80.39  ? 28  GLY A O     1 
ATOM   198  N N     . GLU A 1 49  ? -13.459 -20.142 91.727  1.00 79.82  ? 29  GLU A N     1 
ATOM   199  C CA    . GLU A 1 49  ? -13.513 -20.129 93.183  1.00 78.41  ? 29  GLU A CA    1 
ATOM   200  C C     . GLU A 1 49  ? -12.784 -18.916 93.746  1.00 72.80  ? 29  GLU A C     1 
ATOM   201  O O     . GLU A 1 49  ? -13.256 -18.274 94.685  1.00 71.26  ? 29  GLU A O     1 
ATOM   202  C CB    . GLU A 1 49  ? -12.912 -21.415 93.754  1.00 80.30  ? 29  GLU A CB    1 
ATOM   203  N N     . CYS A 1 50  ? -11.633 -18.602 93.161  1.00 70.03  ? 30  CYS A N     1 
ATOM   204  C CA    . CYS A 1 50  ? -10.806 -17.505 93.642  1.00 65.32  ? 30  CYS A CA    1 
ATOM   205  C C     . CYS A 1 50  ? -10.492 -16.500 92.540  1.00 63.28  ? 30  CYS A C     1 
ATOM   206  O O     . CYS A 1 50  ? -10.301 -16.872 91.382  1.00 65.33  ? 30  CYS A O     1 
ATOM   207  C CB    . CYS A 1 50  ? -9.506  -18.045 94.239  1.00 64.07  ? 30  CYS A CB    1 
ATOM   208  S SG    . CYS A 1 50  ? -8.315  -16.770 94.703  1.00 72.65  ? 30  CYS A SG    1 
ATOM   209  N N     . LEU A 1 51  ? -10.442 -15.224 92.908  1.00 59.58  ? 31  LEU A N     1 
ATOM   210  C CA    . LEU A 1 51  ? -10.068 -14.173 91.971  1.00 57.92  ? 31  LEU A CA    1 
ATOM   211  C C     . LEU A 1 51  ? -8.690  -13.618 92.313  1.00 55.33  ? 31  LEU A C     1 
ATOM   212  O O     . LEU A 1 51  ? -8.411  -13.291 93.467  1.00 52.72  ? 31  LEU A O     1 
ATOM   213  C CB    . LEU A 1 51  ? -11.104 -13.047 91.973  1.00 57.17  ? 31  LEU A CB    1 
ATOM   214  C CG    . LEU A 1 51  ? -10.789 -11.854 91.067  1.00 55.39  ? 31  LEU A CG    1 
ATOM   215  C CD1   . LEU A 1 51  ? -10.699 -12.287 89.612  1.00 57.83  ? 31  LEU A CD1   1 
ATOM   216  C CD2   . LEU A 1 51  ? -11.823 -10.752 91.237  1.00 55.39  ? 31  LEU A CD2   1 
ATOM   217  N N     . VAL A 1 52  ? -7.831  -13.520 91.305  1.00 56.26  ? 32  VAL A N     1 
ATOM   218  C CA    . VAL A 1 52  ? -6.490  -12.987 91.494  1.00 54.29  ? 32  VAL A CA    1 
ATOM   219  C C     . VAL A 1 52  ? -6.335  -11.648 90.781  1.00 53.68  ? 32  VAL A C     1 
ATOM   220  O O     . VAL A 1 52  ? -6.544  -11.553 89.570  1.00 55.08  ? 32  VAL A O     1 
ATOM   221  C CB    . VAL A 1 52  ? -5.416  -13.963 90.979  1.00 55.70  ? 32  VAL A CB    1 
ATOM   222  C CG1   . VAL A 1 52  ? -4.025  -13.405 91.241  1.00 52.97  ? 32  VAL A CG1   1 
ATOM   223  C CG2   . VAL A 1 52  ? -5.581  -15.327 91.634  1.00 57.83  ? 32  VAL A CG2   1 
ATOM   224  N N     . GLU A 1 53  ? -5.978  -10.616 91.539  1.00 51.70  ? 33  GLU A N     1 
ATOM   225  C CA    . GLU A 1 53  ? -5.737  -9.295  90.971  1.00 51.56  ? 33  GLU A CA    1 
ATOM   226  C C     . GLU A 1 53  ? -4.323  -8.814  91.279  1.00 48.57  ? 33  GLU A C     1 
ATOM   227  O O     . GLU A 1 53  ? -4.029  -8.420  92.408  1.00 46.70  ? 33  GLU A O     1 
ATOM   228  C CB    . GLU A 1 53  ? -6.755  -8.281  91.497  1.00 53.19  ? 33  GLU A CB    1 
ATOM   229  C CG    . GLU A 1 53  ? -8.186  -8.539  91.064  1.00 57.71  ? 33  GLU A CG    1 
ATOM   230  C CD    . GLU A 1 53  ? -9.089  -7.346  91.318  1.00 59.61  ? 33  GLU A CD    1 
ATOM   231  O OE1   . GLU A 1 53  ? -10.170 -7.531  91.916  1.00 61.85  ? 33  GLU A OE1   1 
ATOM   232  O OE2   . GLU A 1 53  ? -8.718  -6.223  90.916  1.00 59.22  ? 33  GLU A OE2   1 
ATOM   233  N N     . PRO A 1 54  ? -3.441  -8.852  90.270  1.00 48.22  ? 34  PRO A N     1 
ATOM   234  C CA    . PRO A 1 54  ? -2.056  -8.379  90.375  1.00 46.13  ? 34  PRO A CA    1 
ATOM   235  C C     . PRO A 1 54  ? -1.966  -6.862  90.522  1.00 44.51  ? 34  PRO A C     1 
ATOM   236  O O     . PRO A 1 54  ? -0.985  -6.354  91.065  1.00 43.82  ? 34  PRO A O     1 
ATOM   237  C CB    . PRO A 1 54  ? -1.426  -8.830  89.050  1.00 47.99  ? 34  PRO A CB    1 
ATOM   238  C CG    . PRO A 1 54  ? -2.342  -9.883  88.518  1.00 50.82  ? 34  PRO A CG    1 
ATOM   239  C CD    . PRO A 1 54  ? -3.705  -9.488  88.969  1.00 50.71  ? 34  PRO A CD    1 
ATOM   240  N N     . PHE A 1 55  ? -2.979  -6.154  90.034  1.00 44.63  ? 35  PHE A N     1 
ATOM   241  C CA    . PHE A 1 55  ? -3.019  -4.697  90.117  1.00 43.37  ? 35  PHE A CA    1 
ATOM   242  C C     . PHE A 1 55  ? -4.321  -4.245  90.768  1.00 43.31  ? 35  PHE A C     1 
ATOM   243  O O     . PHE A 1 55  ? -5.165  -3.637  90.112  1.00 44.91  ? 35  PHE A O     1 
ATOM   244  C CB    . PHE A 1 55  ? -2.894  -4.065  88.727  1.00 45.33  ? 35  PHE A CB    1 
ATOM   245  C CG    . PHE A 1 55  ? -1.813  -4.667  87.870  1.00 46.73  ? 35  PHE A CG    1 
ATOM   246  C CD1   . PHE A 1 55  ? -2.077  -5.768  87.070  1.00 48.90  ? 35  PHE A CD1   1 
ATOM   247  C CD2   . PHE A 1 55  ? -0.542  -4.120  87.849  1.00 45.81  ? 35  PHE A CD2   1 
ATOM   248  C CE1   . PHE A 1 55  ? -1.089  -6.320  86.278  1.00 50.21  ? 35  PHE A CE1   1 
ATOM   249  C CE2   . PHE A 1 55  ? 0.450   -4.667  87.056  1.00 47.32  ? 35  PHE A CE2   1 
ATOM   250  C CZ    . PHE A 1 55  ? 0.175   -5.767  86.269  1.00 49.32  ? 35  PHE A CZ    1 
ATOM   251  N N     . VAL A 1 56  ? -4.484  -4.540  92.055  1.00 41.95  ? 36  VAL A N     1 
ATOM   252  C CA    . VAL A 1 56  ? -5.765  -4.327  92.722  1.00 42.45  ? 36  VAL A CA    1 
ATOM   253  C C     . VAL A 1 56  ? -6.146  -2.847  92.814  1.00 41.87  ? 36  VAL A C     1 
ATOM   254  O O     . VAL A 1 56  ? -7.315  -2.497  92.645  1.00 42.52  ? 36  VAL A O     1 
ATOM   255  C CB    . VAL A 1 56  ? -5.773  -4.954  94.142  1.00 44.49  ? 36  VAL A CB    1 
ATOM   256  C CG1   . VAL A 1 56  ? -4.683  -4.356  95.018  1.00 42.46  ? 36  VAL A CG1   1 
ATOM   257  C CG2   . VAL A 1 56  ? -7.142  -4.793  94.791  1.00 45.87  ? 36  VAL A CG2   1 
ATOM   258  N N     . GLY A 1 57  ? -5.161  -1.985  93.057  1.00 40.64  ? 37  GLY A N     1 
ATOM   259  C CA    . GLY A 1 57  ? -5.398  -0.560  93.209  1.00 40.84  ? 37  GLY A CA    1 
ATOM   260  C C     . GLY A 1 57  ? -6.475  -0.234  94.226  1.00 41.77  ? 37  GLY A C     1 
ATOM   261  O O     . GLY A 1 57  ? -6.359  -0.585  95.400  1.00 40.82  ? 37  GLY A O     1 
ATOM   262  N N     . ALA A 1 58  ? -7.530  0.435   93.769  1.00 44.03  ? 38  ALA A N     1 
ATOM   263  C CA    . ALA A 1 58  ? -8.654  0.778   94.631  1.00 45.83  ? 38  ALA A CA    1 
ATOM   264  C C     . ALA A 1 58  ? -9.561  -0.429  94.854  1.00 48.29  ? 38  ALA A C     1 
ATOM   265  O O     . ALA A 1 58  ? -10.389 -0.435  95.766  1.00 49.25  ? 38  ALA A O     1 
ATOM   266  C CB    . ALA A 1 58  ? -9.444  1.931   94.037  1.00 47.17  ? 38  ALA A CB    1 
ATOM   267  N N     . GLY A 1 59  ? -9.404  -1.445  94.011  1.00 49.43  ? 39  GLY A N     1 
ATOM   268  C CA    . GLY A 1 59  ? -10.149 -2.682  94.148  1.00 51.19  ? 39  GLY A CA    1 
ATOM   269  C C     . GLY A 1 59  ? -11.624 -2.566  93.813  1.00 53.91  ? 39  GLY A C     1 
ATOM   270  O O     . GLY A 1 59  ? -12.467 -3.131  94.508  1.00 55.47  ? 39  GLY A O     1 
ATOM   271  N N     . SER A 1 60  ? -11.937 -1.840  92.744  1.00 54.59  ? 40  SER A N     1 
ATOM   272  C CA    . SER A 1 60  ? -13.323 -1.665  92.325  1.00 57.43  ? 40  SER A CA    1 
ATOM   273  C C     . SER A 1 60  ? -13.920 -2.979  91.825  1.00 59.27  ? 40  SER A C     1 
ATOM   274  O O     . SER A 1 60  ? -15.100 -3.257  92.043  1.00 61.96  ? 40  SER A O     1 
ATOM   275  C CB    . SER A 1 60  ? -13.426 -0.592  91.239  1.00 59.26  ? 40  SER A CB    1 
ATOM   276  O OG    . SER A 1 60  ? -12.671 -0.949  90.094  1.00 60.26  ? 40  SER A OG    1 
ATOM   277  N N     . VAL A 1 61  ? -13.101 -3.781  91.154  1.00 57.86  ? 41  VAL A N     1 
ATOM   278  C CA    . VAL A 1 61  ? -13.540 -5.083  90.666  1.00 60.18  ? 41  VAL A CA    1 
ATOM   279  C C     . VAL A 1 61  ? -13.788 -6.026  91.839  1.00 59.34  ? 41  VAL A C     1 
ATOM   280  O O     . VAL A 1 61  ? -14.777 -6.758  91.866  1.00 62.78  ? 41  VAL A O     1 
ATOM   281  C CB    . VAL A 1 61  ? -12.506 -5.705  89.706  1.00 60.36  ? 41  VAL A CB    1 
ATOM   282  C CG1   . VAL A 1 61  ? -12.930 -7.108  89.295  1.00 63.52  ? 41  VAL A CG1   1 
ATOM   283  C CG2   . VAL A 1 61  ? -12.327 -4.819  88.484  1.00 61.24  ? 41  VAL A CG2   1 
ATOM   284  N N     . PHE A 1 62  ? -12.884 -5.989  92.812  1.00 54.98  ? 42  PHE A N     1 
ATOM   285  C CA    . PHE A 1 62  ? -13.004 -6.794  94.022  1.00 53.84  ? 42  PHE A CA    1 
ATOM   286  C C     . PHE A 1 62  ? -14.272 -6.450  94.801  1.00 55.29  ? 42  PHE A C     1 
ATOM   287  O O     . PHE A 1 62  ? -14.939 -7.335  95.340  1.00 57.41  ? 42  PHE A O     1 
ATOM   288  C CB    . PHE A 1 62  ? -11.761 -6.603  94.897  1.00 49.66  ? 42  PHE A CB    1 
ATOM   289  C CG    . PHE A 1 62  ? -11.981 -6.901  96.354  1.00 48.69  ? 42  PHE A CG    1 
ATOM   290  C CD1   . PHE A 1 62  ? -12.227 -8.194  96.785  1.00 49.97  ? 42  PHE A CD1   1 
ATOM   291  C CD2   . PHE A 1 62  ? -11.909 -5.888  97.297  1.00 46.84  ? 42  PHE A CD2   1 
ATOM   292  C CE1   . PHE A 1 62  ? -12.420 -8.468  98.127  1.00 49.90  ? 42  PHE A CE1   1 
ATOM   293  C CE2   . PHE A 1 62  ? -12.099 -6.155  98.641  1.00 46.41  ? 42  PHE A CE2   1 
ATOM   294  C CZ    . PHE A 1 62  ? -12.355 -7.446  99.056  1.00 47.99  ? 42  PHE A CZ    1 
ATOM   295  N N     . LEU A 1 63  ? -14.610 -5.165  94.843  1.00 54.18  ? 43  LEU A N     1 
ATOM   296  C CA    . LEU A 1 63  ? -15.782 -4.708  95.582  1.00 55.31  ? 43  LEU A CA    1 
ATOM   297  C C     . LEU A 1 63  ? -17.083 -4.945  94.817  1.00 58.63  ? 43  LEU A C     1 
ATOM   298  O O     . LEU A 1 63  ? -18.165 -4.919  95.403  1.00 60.84  ? 43  LEU A O     1 
ATOM   299  C CB    . LEU A 1 63  ? -15.646 -3.222  95.924  1.00 53.84  ? 43  LEU A CB    1 
ATOM   300  C CG    . LEU A 1 63  ? -14.550 -2.845  96.923  1.00 51.18  ? 43  LEU A CG    1 
ATOM   301  C CD1   . LEU A 1 63  ? -14.441 -1.335  97.051  1.00 49.90  ? 43  LEU A CD1   1 
ATOM   302  C CD2   . LEU A 1 63  ? -14.811 -3.482  98.280  1.00 52.19  ? 43  LEU A CD2   1 
ATOM   303  N N     . ASN A 1 64  ? -16.976 -5.176  93.512  1.00 58.85  ? 44  ASN A N     1 
ATOM   304  C CA    . ASN A 1 64  ? -18.161 -5.353  92.677  1.00 62.08  ? 44  ASN A CA    1 
ATOM   305  C C     . ASN A 1 64  ? -18.251 -6.733  92.030  1.00 64.79  ? 44  ASN A C     1 
ATOM   306  O O     . ASN A 1 64  ? -18.895 -6.900  90.994  1.00 68.48  ? 44  ASN A O     1 
ATOM   307  C CB    . ASN A 1 64  ? -18.208 -4.273  91.595  1.00 61.51  ? 44  ASN A CB    1 
ATOM   308  C CG    . ASN A 1 64  ? -18.558 -2.907  92.153  1.00 60.22  ? 44  ASN A CG    1 
ATOM   309  O OD1   . ASN A 1 64  ? -19.732 -2.551  92.263  1.00 63.48  ? 44  ASN A OD1   1 
ATOM   310  N ND2   . ASN A 1 64  ? -17.540 -2.134  92.510  1.00 55.61  ? 44  ASN A ND2   1 
ATOM   311  N N     . THR A 1 65  ? -17.602 -7.717  92.643  1.00 63.39  ? 45  THR A N     1 
ATOM   312  C CA    . THR A 1 65  ? -17.736 -9.108  92.222  1.00 66.24  ? 45  THR A CA    1 
ATOM   313  C C     . THR A 1 65  ? -18.066 -9.978  93.427  1.00 68.06  ? 45  THR A C     1 
ATOM   314  O O     . THR A 1 65  ? -18.058 -9.503  94.563  1.00 66.00  ? 45  THR A O     1 
ATOM   315  C CB    . THR A 1 65  ? -16.458 -9.637  91.541  1.00 63.36  ? 45  THR A CB    1 
ATOM   316  O OG1   . THR A 1 65  ? -15.316 -9.324  92.349  1.00 58.53  ? 45  THR A OG1   1 
ATOM   317  C CG2   . THR A 1 65  ? -16.289 -9.016  90.162  1.00 63.63  ? 45  THR A CG2   1 
ATOM   318  N N     . ASP A 1 66  ? -18.358 -11.251 93.182  1.00 72.56  ? 46  ASP A N     1 
ATOM   319  C CA    . ASP A 1 66  ? -18.702 -12.161 94.266  1.00 75.51  ? 46  ASP A CA    1 
ATOM   320  C C     . ASP A 1 66  ? -17.986 -13.500 94.127  1.00 76.70  ? 46  ASP A C     1 
ATOM   321  O O     . ASP A 1 66  ? -18.582 -14.497 93.715  1.00 81.43  ? 46  ASP A O     1 
ATOM   322  C CB    . ASP A 1 66  ? -20.215 -12.375 94.323  1.00 81.97  ? 46  ASP A CB    1 
ATOM   323  C CG    . ASP A 1 66  ? -20.662 -13.018 95.621  1.00 84.86  ? 46  ASP A CG    1 
ATOM   324  O OD1   . ASP A 1 66  ? -19.922 -12.914 96.622  1.00 82.09  ? 46  ASP A OD1   1 
ATOM   325  O OD2   . ASP A 1 66  ? -21.755 -13.622 95.643  1.00 90.44  ? 46  ASP A OD2   1 
ATOM   326  N N     . PHE A 1 67  ? -16.702 -13.512 94.470  1.00 72.71  ? 47  PHE A N     1 
ATOM   327  C CA    . PHE A 1 67  ? -15.919 -14.741 94.484  1.00 73.34  ? 47  PHE A CA    1 
ATOM   328  C C     . PHE A 1 67  ? -15.760 -15.252 95.910  1.00 73.57  ? 47  PHE A C     1 
ATOM   329  O O     . PHE A 1 67  ? -15.796 -14.473 96.863  1.00 71.49  ? 47  PHE A O     1 
ATOM   330  C CB    . PHE A 1 67  ? -14.544 -14.517 93.849  1.00 69.54  ? 47  PHE A CB    1 
ATOM   331  C CG    . PHE A 1 67  ? -14.579 -14.390 92.354  1.00 70.46  ? 47  PHE A CG    1 
ATOM   332  C CD1   . PHE A 1 67  ? -14.879 -13.178 91.754  1.00 69.07  ? 47  PHE A CD1   1 
ATOM   333  C CD2   . PHE A 1 67  ? -14.302 -15.481 91.547  1.00 73.11  ? 47  PHE A CD2   1 
ATOM   334  C CE1   . PHE A 1 67  ? -14.908 -13.059 90.377  1.00 70.69  ? 47  PHE A CE1   1 
ATOM   335  C CE2   . PHE A 1 67  ? -14.330 -15.368 90.170  1.00 74.71  ? 47  PHE A CE2   1 
ATOM   336  C CZ    . PHE A 1 67  ? -14.633 -14.156 89.585  1.00 73.47  ? 47  PHE A CZ    1 
ATOM   337  N N     . SER A 1 68  ? -15.584 -16.563 96.048  1.00 76.35  ? 48  SER A N     1 
ATOM   338  C CA    . SER A 1 68  ? -15.396 -17.180 97.356  1.00 76.94  ? 48  SER A CA    1 
ATOM   339  C C     . SER A 1 68  ? -14.124 -16.667 98.021  1.00 72.17  ? 48  SER A C     1 
ATOM   340  O O     . SER A 1 68  ? -14.124 -16.316 99.202  1.00 71.18  ? 48  SER A O     1 
ATOM   341  C CB    . SER A 1 68  ? -15.343 -18.702 97.228  1.00 81.10  ? 48  SER A CB    1 
ATOM   342  O OG    . SER A 1 68  ? -16.483 -19.196 96.547  1.00 86.40  ? 48  SER A OG    1 
ATOM   343  N N     . ARG A 1 69  ? -13.041 -16.624 97.252  1.00 69.52  ? 49  ARG A N     1 
ATOM   344  C CA    . ARG A 1 69  ? -11.758 -16.151 97.756  1.00 64.73  ? 49  ARG A CA    1 
ATOM   345  C C     . ARG A 1 69  ? -11.170 -15.087 96.838  1.00 60.79  ? 49  ARG A C     1 
ATOM   346  O O     . ARG A 1 69  ? -11.471 -15.045 95.645  1.00 61.38  ? 49  ARG A O     1 
ATOM   347  C CB    . ARG A 1 69  ? -10.778 -17.317 97.908  1.00 65.73  ? 49  ARG A CB    1 
ATOM   348  C CG    . ARG A 1 69  ? -11.205 -18.355 98.934  1.00 69.55  ? 49  ARG A CG    1 
ATOM   349  C CD    . ARG A 1 69  ? -10.172 -19.465 99.085  1.00 71.67  ? 49  ARG A CD    1 
ATOM   350  N NE    . ARG A 1 69  ? -10.087 -20.317 97.902  1.00 74.96  ? 49  ARG A NE    1 
ATOM   351  C CZ    . ARG A 1 69  ? -9.113  -20.252 97.000  1.00 73.46  ? 49  ARG A CZ    1 
ATOM   352  N NH1   . ARG A 1 69  ? -8.131  -19.372 97.143  1.00 69.03  ? 49  ARG A NH1   1 
ATOM   353  N NH2   . ARG A 1 69  ? -9.118  -21.069 95.955  1.00 76.19  ? 49  ARG A NH2   1 
ATOM   354  N N     . TYR A 1 70  ? -10.331 -14.225 97.403  1.00 57.02  ? 50  TYR A N     1 
ATOM   355  C CA    . TYR A 1 70  ? -9.657  -13.191 96.631  1.00 54.26  ? 50  TYR A CA    1 
ATOM   356  C C     . TYR A 1 70  ? -8.167  -13.148 96.948  1.00 52.79  ? 50  TYR A C     1 
ATOM   357  O O     . TYR A 1 70  ? -7.770  -13.156 98.113  1.00 52.16  ? 50  TYR A O     1 
ATOM   358  C CB    . TYR A 1 70  ? -10.273 -11.816 96.904  1.00 52.14  ? 50  TYR A CB    1 
ATOM   359  C CG    . TYR A 1 70  ? -11.661 -11.613 96.343  1.00 54.17  ? 50  TYR A CG    1 
ATOM   360  C CD1   . TYR A 1 70  ? -12.788 -11.892 97.105  1.00 56.24  ? 50  TYR A CD1   1 
ATOM   361  C CD2   . TYR A 1 70  ? -11.845 -11.124 95.056  1.00 54.21  ? 50  TYR A CD2   1 
ATOM   362  C CE1   . TYR A 1 70  ? -14.058 -11.699 96.598  1.00 58.71  ? 50  TYR A CE1   1 
ATOM   363  C CE2   . TYR A 1 70  ? -13.113 -10.928 94.540  1.00 56.56  ? 50  TYR A CE2   1 
ATOM   364  C CZ    . TYR A 1 70  ? -14.215 -11.217 95.316  1.00 58.92  ? 50  TYR A CZ    1 
ATOM   365  O OH    . TYR A 1 70  ? -15.479 -11.024 94.807  1.00 61.82  ? 50  TYR A OH    1 
ATOM   366  N N     . ILE A 1 71  ? -7.346  -13.108 95.905  1.00 52.78  ? 51  ILE A N     1 
ATOM   367  C CA    . ILE A 1 71  ? -5.923  -12.844 96.068  1.00 51.45  ? 51  ILE A CA    1 
ATOM   368  C C     . ILE A 1 71  ? -5.616  -11.486 95.454  1.00 49.69  ? 51  ILE A C     1 
ATOM   369  O O     . ILE A 1 71  ? -5.565  -11.342 94.232  1.00 50.77  ? 51  ILE A O     1 
ATOM   370  C CB    . ILE A 1 71  ? -5.050  -13.929 95.417  1.00 53.75  ? 51  ILE A CB    1 
ATOM   371  C CG1   . ILE A 1 71  ? -5.329  -15.289 96.058  1.00 56.94  ? 51  ILE A CG1   1 
ATOM   372  C CG2   . ILE A 1 71  ? -3.577  -13.576 95.554  1.00 51.74  ? 51  ILE A CG2   1 
ATOM   373  C CD1   . ILE A 1 71  ? -4.474  -16.411 95.510  1.00 59.39  ? 51  ILE A CD1   1 
ATOM   374  N N     . LEU A 1 72  ? -5.428  -10.489 96.312  1.00 46.86  ? 52  LEU A N     1 
ATOM   375  C CA    . LEU A 1 72  ? -5.264  -9.116  95.860  1.00 44.55  ? 52  LEU A CA    1 
ATOM   376  C C     . LEU A 1 72  ? -3.835  -8.632  96.077  1.00 42.94  ? 52  LEU A C     1 
ATOM   377  O O     . LEU A 1 72  ? -3.297  -8.727  97.180  1.00 42.49  ? 52  LEU A O     1 
ATOM   378  C CB    . LEU A 1 72  ? -6.256  -8.204  96.583  1.00 43.84  ? 52  LEU A CB    1 
ATOM   379  C CG    . LEU A 1 72  ? -7.716  -8.659  96.499  1.00 46.21  ? 52  LEU A CG    1 
ATOM   380  C CD1   . LEU A 1 72  ? -8.643  -7.681  97.207  1.00 46.03  ? 52  LEU A CD1   1 
ATOM   381  C CD2   . LEU A 1 72  ? -8.139  -8.850  95.049  1.00 47.52  ? 52  LEU A CD2   1 
ATOM   382  N N     . ALA A 1 73  ? -3.224  -8.111  95.020  1.00 42.69  ? 53  ALA A N     1 
ATOM   383  C CA    . ALA A 1 73  ? -1.830  -7.696  95.090  1.00 42.57  ? 53  ALA A CA    1 
ATOM   384  C C     . ALA A 1 73  ? -1.588  -6.351  94.415  1.00 43.54  ? 53  ALA A C     1 
ATOM   385  O O     . ALA A 1 73  ? -2.325  -5.948  93.515  1.00 43.72  ? 53  ALA A O     1 
ATOM   386  C CB    . ALA A 1 73  ? -0.937  -8.757  94.473  1.00 43.16  ? 53  ALA A CB    1 
ATOM   387  N N     . ASP A 1 74  ? -0.544  -5.665  94.865  1.00 44.35  ? 54  ASP A N     1 
ATOM   388  C CA    . ASP A 1 74  ? -0.146  -4.385  94.294  1.00 45.53  ? 54  ASP A CA    1 
ATOM   389  C C     . ASP A 1 74  ? 1.301   -4.089  94.670  1.00 45.08  ? 54  ASP A C     1 
ATOM   390  O O     . ASP A 1 74  ? 1.791   -4.567  95.691  1.00 44.96  ? 54  ASP A O     1 
ATOM   391  C CB    . ASP A 1 74  ? -1.065  -3.263  94.778  1.00 45.92  ? 54  ASP A CB    1 
ATOM   392  C CG    . ASP A 1 74  ? -0.984  -2.027  93.904  1.00 47.68  ? 54  ASP A CG    1 
ATOM   393  O OD1   . ASP A 1 74  ? 0.014   -1.284  94.011  1.00 48.11  ? 54  ASP A OD1   1 
ATOM   394  O OD2   . ASP A 1 74  ? -1.922  -1.796  93.111  1.00 49.09  ? 54  ASP A OD2   1 
ATOM   395  N N     . ILE A 1 75  ? 1.983   -3.302  93.846  1.00 45.55  ? 55  ILE A N     1 
ATOM   396  C CA    . ILE A 1 75  ? 3.386   -2.986  94.093  1.00 46.02  ? 55  ILE A CA    1 
ATOM   397  C C     . ILE A 1 75  ? 3.515   -1.902  95.162  1.00 44.11  ? 55  ILE A C     1 
ATOM   398  O O     . ILE A 1 75  ? 4.578   -1.726  95.757  1.00 43.68  ? 55  ILE A O     1 
ATOM   399  C CB    . ILE A 1 75  ? 4.101   -2.535  92.797  1.00 48.59  ? 55  ILE A CB    1 
ATOM   400  C CG1   . ILE A 1 75  ? 5.618   -2.704  92.925  1.00 50.69  ? 55  ILE A CG1   1 
ATOM   401  C CG2   . ILE A 1 75  ? 3.727   -1.101  92.438  1.00 48.30  ? 55  ILE A CG2   1 
ATOM   402  C CD1   . ILE A 1 75  ? 6.060   -4.142  93.085  1.00 51.99  ? 55  ILE A CD1   1 
ATOM   403  N N     . ASN A 1 76  ? 2.421   -1.187  95.412  1.00 43.16  ? 56  ASN A N     1 
ATOM   404  C CA    . ASN A 1 76  ? 2.407   -0.113  96.398  1.00 41.98  ? 56  ASN A CA    1 
ATOM   405  C C     . ASN A 1 76  ? 2.249   -0.659  97.814  1.00 40.52  ? 56  ASN A C     1 
ATOM   406  O O     . ASN A 1 76  ? 1.205   -1.212  98.163  1.00 39.88  ? 56  ASN A O     1 
ATOM   407  C CB    . ASN A 1 76  ? 1.285   0.880   96.077  1.00 42.67  ? 56  ASN A CB    1 
ATOM   408  C CG    . ASN A 1 76  ? 1.349   2.139   96.923  1.00 42.99  ? 56  ASN A CG    1 
ATOM   409  O OD1   . ASN A 1 76  ? 1.357   2.082   98.153  1.00 43.22  ? 56  ASN A OD1   1 
ATOM   410  N ND2   . ASN A 1 76  ? 1.393   3.289   96.262  1.00 43.58  ? 56  ASN A ND2   1 
ATOM   411  N N     . SER A 1 77  ? 3.286   -0.489  98.629  1.00 40.02  ? 57  SER A N     1 
ATOM   412  C CA    . SER A 1 77  ? 3.297   -1.038  99.982  1.00 39.84  ? 57  SER A CA    1 
ATOM   413  C C     . SER A 1 77  ? 2.388   -0.263  100.930 1.00 39.66  ? 57  SER A C     1 
ATOM   414  O O     . SER A 1 77  ? 1.773   -0.851  101.819 1.00 39.81  ? 57  SER A O     1 
ATOM   415  C CB    . SER A 1 77  ? 4.724   -1.065  100.536 1.00 40.70  ? 57  SER A CB    1 
ATOM   416  O OG    . SER A 1 77  ? 5.264   0.241   100.626 1.00 41.02  ? 57  SER A OG    1 
ATOM   417  N N     . ASP A 1 78  ? 2.309   1.052   100.749 1.00 39.93  ? 58  ASP A N     1 
ATOM   418  C CA    . ASP A 1 78  ? 1.420   1.874   101.565 1.00 40.78  ? 58  ASP A CA    1 
ATOM   419  C C     . ASP A 1 78  ? -0.028  1.446   101.358 1.00 39.46  ? 58  ASP A C     1 
ATOM   420  O O     . ASP A 1 78  ? -0.801  1.349   102.311 1.00 39.97  ? 58  ASP A O     1 
ATOM   421  C CB    . ASP A 1 78  ? 1.588   3.359   101.235 1.00 43.20  ? 58  ASP A CB    1 
ATOM   422  C CG    . ASP A 1 78  ? 2.950   3.895   101.631 1.00 46.71  ? 58  ASP A CG    1 
ATOM   423  O OD1   . ASP A 1 78  ? 3.456   4.808   100.943 1.00 48.91  ? 58  ASP A OD1   1 
ATOM   424  O OD2   . ASP A 1 78  ? 3.517   3.405   102.631 1.00 47.56  ? 58  ASP A OD2   1 
ATOM   425  N N     . LEU A 1 79  ? -0.379  1.184   100.104 1.00 38.56  ? 59  LEU A N     1 
ATOM   426  C CA    . LEU A 1 79  ? -1.713  0.719   99.745  1.00 38.21  ? 59  LEU A CA    1 
ATOM   427  C C     . LEU A 1 79  ? -2.037  -0.620  100.405 1.00 37.14  ? 59  LEU A C     1 
ATOM   428  O O     . LEU A 1 79  ? -3.088  -0.778  101.027 1.00 36.96  ? 59  LEU A O     1 
ATOM   429  C CB    . LEU A 1 79  ? -1.836  0.599   98.225  1.00 39.91  ? 59  LEU A CB    1 
ATOM   430  C CG    . LEU A 1 79  ? -3.163  0.092   97.659  1.00 41.60  ? 59  LEU A CG    1 
ATOM   431  C CD1   . LEU A 1 79  ? -4.287  1.052   98.001  1.00 42.54  ? 59  LEU A CD1   1 
ATOM   432  C CD2   . LEU A 1 79  ? -3.060  -0.102  96.153  1.00 42.54  ? 59  LEU A CD2   1 
ATOM   433  N N     . ILE A 1 80  ? -1.123  -1.576  100.269 1.00 36.72  ? 60  ILE A N     1 
ATOM   434  C CA    . ILE A 1 80  ? -1.311  -2.912  100.824 1.00 37.12  ? 60  ILE A CA    1 
ATOM   435  C C     . ILE A 1 80  ? -1.361  -2.881  102.350 1.00 37.53  ? 60  ILE A C     1 
ATOM   436  O O     . ILE A 1 80  ? -2.202  -3.538  102.965 1.00 38.42  ? 60  ILE A O     1 
ATOM   437  C CB    . ILE A 1 80  ? -0.192  -3.870  100.364 1.00 38.02  ? 60  ILE A CB    1 
ATOM   438  C CG1   . ILE A 1 80  ? -0.253  -4.063  98.847  1.00 38.17  ? 60  ILE A CG1   1 
ATOM   439  C CG2   . ILE A 1 80  ? -0.303  -5.213  101.069 1.00 38.94  ? 60  ILE A CG2   1 
ATOM   440  C CD1   . ILE A 1 80  ? -1.570  -4.626  98.357  1.00 38.95  ? 60  ILE A CD1   1 
ATOM   441  N N     . SER A 1 81  ? -0.464  -2.107  102.953 1.00 36.79  ? 61  SER A N     1 
ATOM   442  C CA    . SER A 1 81  ? -0.435  -1.952  104.405 1.00 37.14  ? 61  SER A CA    1 
ATOM   443  C C     . SER A 1 81  ? -1.742  -1.358  104.926 1.00 36.81  ? 61  SER A C     1 
ATOM   444  O O     . SER A 1 81  ? -2.251  -1.776  105.965 1.00 38.65  ? 61  SER A O     1 
ATOM   445  C CB    . SER A 1 81  ? 0.745   -1.074  104.828 1.00 37.42  ? 61  SER A CB    1 
ATOM   446  O OG    . SER A 1 81  ? 0.733   -0.843  106.225 1.00 38.79  ? 61  SER A OG    1 
ATOM   447  N N     . LEU A 1 82  ? -2.277  -0.383  104.197 1.00 35.35  ? 62  LEU A N     1 
ATOM   448  C CA    . LEU A 1 82  ? -3.556  0.229   104.545 1.00 35.48  ? 62  LEU A CA    1 
ATOM   449  C C     . LEU A 1 82  ? -4.684  -0.797  104.524 1.00 37.08  ? 62  LEU A C     1 
ATOM   450  O O     . LEU A 1 82  ? -5.523  -0.831  105.423 1.00 38.75  ? 62  LEU A O     1 
ATOM   451  C CB    . LEU A 1 82  ? -3.878  1.380   103.588 1.00 34.25  ? 62  LEU A CB    1 
ATOM   452  C CG    . LEU A 1 82  ? -5.299  1.950   103.639 1.00 34.81  ? 62  LEU A CG    1 
ATOM   453  C CD1   . LEU A 1 82  ? -5.599  2.557   105.002 1.00 35.53  ? 62  LEU A CD1   1 
ATOM   454  C CD2   . LEU A 1 82  ? -5.506  2.977   102.535 1.00 34.59  ? 62  LEU A CD2   1 
ATOM   455  N N     . TYR A 1 83  ? -4.691  -1.635  103.492 1.00 37.54  ? 63  TYR A N     1 
ATOM   456  C CA    . TYR A 1 83  ? -5.729  -2.646  103.321 1.00 38.75  ? 63  TYR A CA    1 
ATOM   457  C C     . TYR A 1 83  ? -5.710  -3.682  104.441 1.00 40.66  ? 63  TYR A C     1 
ATOM   458  O O     . TYR A 1 83  ? -6.760  -4.155  104.876 1.00 42.21  ? 63  TYR A O     1 
ATOM   459  C CB    . TYR A 1 83  ? -5.579  -3.337  101.964 1.00 38.58  ? 63  TYR A CB    1 
ATOM   460  C CG    . TYR A 1 83  ? -6.072  -2.507  100.800 1.00 39.03  ? 63  TYR A CG    1 
ATOM   461  C CD1   . TYR A 1 83  ? -6.838  -1.368  101.011 1.00 39.26  ? 63  TYR A CD1   1 
ATOM   462  C CD2   . TYR A 1 83  ? -5.779  -2.866  99.490  1.00 39.42  ? 63  TYR A CD2   1 
ATOM   463  C CE1   . TYR A 1 83  ? -7.299  -0.610  99.951  1.00 39.74  ? 63  TYR A CE1   1 
ATOM   464  C CE2   . TYR A 1 83  ? -6.236  -2.112  98.423  1.00 39.50  ? 63  TYR A CE2   1 
ATOM   465  C CZ    . TYR A 1 83  ? -6.996  -0.986  98.660  1.00 39.88  ? 63  TYR A CZ    1 
ATOM   466  O OH    . TYR A 1 83  ? -7.453  -0.229  97.605  1.00 40.44  ? 63  TYR A OH    1 
ATOM   467  N N     . ASN A 1 84  ? -4.515  -4.033  104.903 1.00 41.22  ? 64  ASN A N     1 
ATOM   468  C CA    . ASN A 1 84  ? -4.373  -4.975  106.008 1.00 43.40  ? 64  ASN A CA    1 
ATOM   469  C C     . ASN A 1 84  ? -4.848  -4.375  107.329 1.00 44.86  ? 64  ASN A C     1 
ATOM   470  O O     . ASN A 1 84  ? -5.480  -5.057  108.135 1.00 47.36  ? 64  ASN A O     1 
ATOM   471  C CB    . ASN A 1 84  ? -2.921  -5.440  106.131 1.00 43.56  ? 64  ASN A CB    1 
ATOM   472  C CG    . ASN A 1 84  ? -2.557  -6.499  105.104 1.00 45.07  ? 64  ASN A CG    1 
ATOM   473  O OD1   . ASN A 1 84  ? -3.300  -7.460  104.894 1.00 47.18  ? 64  ASN A OD1   1 
ATOM   474  N ND2   . ASN A 1 84  ? -1.410  -6.326  104.455 1.00 43.67  ? 64  ASN A ND2   1 
ATOM   475  N N     . ILE A 1 85  ? -4.544  -3.098  107.543 1.00 43.73  ? 65  ILE A N     1 
ATOM   476  C CA    . ILE A 1 85  ? -4.970  -2.397  108.752 1.00 44.49  ? 65  ILE A CA    1 
ATOM   477  C C     . ILE A 1 85  ? -6.490  -2.280  108.815 1.00 44.77  ? 65  ILE A C     1 
ATOM   478  O O     . ILE A 1 85  ? -7.102  -2.575  109.842 1.00 47.27  ? 65  ILE A O     1 
ATOM   479  C CB    . ILE A 1 85  ? -4.350  -0.985  108.838 1.00 44.03  ? 65  ILE A CB    1 
ATOM   480  C CG1   . ILE A 1 85  ? -2.836  -1.074  109.034 1.00 43.95  ? 65  ILE A CG1   1 
ATOM   481  C CG2   . ILE A 1 85  ? -4.976  -0.194  109.978 1.00 45.45  ? 65  ILE A CG2   1 
ATOM   482  C CD1   . ILE A 1 85  ? -2.427  -1.731  110.332 1.00 46.05  ? 65  ILE A CD1   1 
ATOM   483  N N     . VAL A 1 86  ? -7.091  -1.849  107.709 1.00 42.86  ? 66  VAL A N     1 
ATOM   484  C CA    . VAL A 1 86  ? -8.541  -1.708  107.614 1.00 43.41  ? 66  VAL A CA    1 
ATOM   485  C C     . VAL A 1 86  ? -9.241  -3.041  107.865 1.00 45.18  ? 66  VAL A C     1 
ATOM   486  O O     . VAL A 1 86  ? -10.267 -3.100  108.544 1.00 48.54  ? 66  VAL A O     1 
ATOM   487  C CB    . VAL A 1 86  ? -8.960  -1.154  106.232 1.00 42.35  ? 66  VAL A CB    1 
ATOM   488  C CG1   . VAL A 1 86  ? -10.464 -1.267  106.031 1.00 44.20  ? 66  VAL A CG1   1 
ATOM   489  C CG2   . VAL A 1 86  ? -8.504  0.291   106.079 1.00 40.58  ? 66  VAL A CG2   1 
ATOM   490  N N     . LYS A 1 87  ? -8.668  -4.112  107.327 1.00 44.25  ? 67  LYS A N     1 
ATOM   491  C CA    . LYS A 1 87  ? -9.237  -5.447  107.481 1.00 46.00  ? 67  LYS A CA    1 
ATOM   492  C C     . LYS A 1 87  ? -9.180  -5.951  108.922 1.00 47.29  ? 67  LYS A C     1 
ATOM   493  O O     . LYS A 1 87  ? -10.181 -6.418  109.463 1.00 49.64  ? 67  LYS A O     1 
ATOM   494  C CB    . LYS A 1 87  ? -8.519  -6.440  106.564 1.00 45.66  ? 67  LYS A CB    1 
ATOM   495  C CG    . LYS A 1 87  ? -8.805  -7.893  106.903 1.00 48.36  ? 67  LYS A CG    1 
ATOM   496  C CD    . LYS A 1 87  ? -8.200  -8.846  105.890 1.00 48.08  ? 67  LYS A CD    1 
ATOM   497  C CE    . LYS A 1 87  ? -8.481  -10.289 106.278 1.00 51.40  ? 67  LYS A CE    1 
ATOM   498  N NZ    . LYS A 1 87  ? -8.110  -11.246 105.201 1.00 52.22  ? 67  LYS A NZ    1 
ATOM   499  N N     . MET A 1 88  ? -8.007  -5.855  109.540 1.00 46.10  ? 68  MET A N     1 
ATOM   500  C CA    . MET A 1 88  ? -7.788  -6.450  110.856 1.00 48.11  ? 68  MET A CA    1 
ATOM   501  C C     . MET A 1 88  ? -8.209  -5.545  112.012 1.00 48.68  ? 68  MET A C     1 
ATOM   502  O O     . MET A 1 88  ? -8.562  -6.030  113.087 1.00 50.90  ? 68  MET A O     1 
ATOM   503  C CB    . MET A 1 88  ? -6.314  -6.830  111.020 1.00 47.72  ? 68  MET A CB    1 
ATOM   504  C CG    . MET A 1 88  ? -5.822  -7.877  110.031 1.00 47.62  ? 68  MET A CG    1 
ATOM   505  S SD    . MET A 1 88  ? -6.633  -9.476  110.232 1.00 94.61  ? 68  MET A SD    1 
ATOM   506  C CE    . MET A 1 88  ? -5.744  -10.460 109.028 1.00 67.33  ? 68  MET A CE    1 
ATOM   507  N N     . ARG A 1 89  ? -8.167  -4.234  111.796 1.00 59.45  ? 69  ARG A N     1 
ATOM   508  C CA    . ARG A 1 89  ? -8.444  -3.276  112.863 1.00 60.23  ? 69  ARG A CA    1 
ATOM   509  C C     . ARG A 1 89  ? -9.449  -2.220  112.416 1.00 56.55  ? 69  ARG A C     1 
ATOM   510  O O     . ARG A 1 89  ? -9.187  -1.023  112.515 1.00 53.91  ? 69  ARG A O     1 
ATOM   511  C CB    . ARG A 1 89  ? -7.143  -2.610  113.323 1.00 60.76  ? 69  ARG A CB    1 
ATOM   512  C CG    . ARG A 1 89  ? -6.084  -3.600  113.793 1.00 65.65  ? 69  ARG A CG    1 
ATOM   513  C CD    . ARG A 1 89  ? -4.693  -2.984  113.816 1.00 65.49  ? 69  ARG A CD    1 
ATOM   514  N NE    . ARG A 1 89  ? -4.529  -2.016  114.895 1.00 67.38  ? 69  ARG A NE    1 
ATOM   515  C CZ    . ARG A 1 89  ? -3.369  -1.456  115.222 1.00 68.39  ? 69  ARG A CZ    1 
ATOM   516  N NH1   . ARG A 1 89  ? -2.268  -1.770  114.553 1.00 68.34  ? 69  ARG A NH1   1 
ATOM   517  N NH2   . ARG A 1 89  ? -3.308  -0.584  116.218 1.00 69.83  ? 69  ARG A NH2   1 
ATOM   518  N N     . THR A 1 90  ? -10.604 -2.676  111.942 1.00 57.30  ? 70  THR A N     1 
ATOM   519  C CA    . THR A 1 90  ? -11.589 -1.807  111.301 1.00 55.52  ? 70  THR A CA    1 
ATOM   520  C C     . THR A 1 90  ? -12.121 -0.693  112.201 1.00 55.55  ? 70  THR A C     1 
ATOM   521  O O     . THR A 1 90  ? -11.972 0.488   111.887 1.00 52.09  ? 70  THR A O     1 
ATOM   522  C CB    . THR A 1 90  ? -12.789 -2.623  110.790 1.00 58.41  ? 70  THR A CB    1 
ATOM   523  O OG1   . THR A 1 90  ? -12.321 -3.694  109.960 1.00 58.89  ? 70  THR A OG1   1 
ATOM   524  C CG2   . THR A 1 90  ? -13.732 -1.735  109.991 1.00 56.42  ? 70  THR A CG2   1 
ATOM   525  N N     . ASP A 1 91  ? -12.750 -1.072  113.309 1.00 59.98  ? 71  ASP A N     1 
ATOM   526  C CA    . ASP A 1 91  ? -13.376 -0.104  114.205 1.00 62.59  ? 71  ASP A CA    1 
ATOM   527  C C     . ASP A 1 91  ? -12.362 0.863   114.802 1.00 60.57  ? 71  ASP A C     1 
ATOM   528  O O     . ASP A 1 91  ? -12.634 2.057   114.933 1.00 59.49  ? 71  ASP A O     1 
ATOM   529  C CB    . ASP A 1 91  ? -14.136 -0.823  115.321 1.00 69.28  ? 71  ASP A CB    1 
ATOM   530  C CG    . ASP A 1 91  ? -15.472 -1.365  114.856 1.00 73.06  ? 71  ASP A CG    1 
ATOM   531  O OD1   . ASP A 1 91  ? -16.117 -0.705  114.015 1.00 71.58  ? 71  ASP A OD1   1 
ATOM   532  O OD2   . ASP A 1 91  ? -15.877 -2.448  115.330 1.00 78.05  ? 71  ASP A OD2   1 
ATOM   533  N N     . GLU A 1 92  ? -11.195 0.343   115.162 1.00 60.67  ? 72  GLU A N     1 
ATOM   534  C CA    . GLU A 1 92  ? -10.122 1.173   115.694 1.00 60.29  ? 72  GLU A CA    1 
ATOM   535  C C     . GLU A 1 92  ? -9.641  2.181   114.653 1.00 53.49  ? 72  GLU A C     1 
ATOM   536  O O     . GLU A 1 92  ? -9.386  3.343   114.972 1.00 52.62  ? 72  GLU A O     1 
ATOM   537  C CB    . GLU A 1 92  ? -8.954  0.304   116.161 1.00 64.07  ? 72  GLU A CB    1 
ATOM   538  C CG    . GLU A 1 92  ? -7.765  1.092   116.682 1.00 65.90  ? 72  GLU A CG    1 
ATOM   539  C CD    . GLU A 1 92  ? -6.578  0.207   117.006 1.00 69.72  ? 72  GLU A CD    1 
ATOM   540  O OE1   . GLU A 1 92  ? -5.530  0.744   117.423 1.00 70.89  ? 72  GLU A OE1   1 
ATOM   541  O OE2   . GLU A 1 92  ? -6.691  -1.027  116.841 1.00 71.86  ? 72  GLU A OE2   1 
ATOM   542  N N     . TYR A 1 93  ? -9.528  1.730   113.408 1.00 49.18  ? 73  TYR A N     1 
ATOM   543  C CA    . TYR A 1 93  ? -9.041  2.579   112.326 1.00 44.53  ? 73  TYR A CA    1 
ATOM   544  C C     . TYR A 1 93  ? -10.035 3.677   111.969 1.00 43.51  ? 73  TYR A C     1 
ATOM   545  O O     . TYR A 1 93  ? -9.665  4.845   111.858 1.00 41.13  ? 73  TYR A O     1 
ATOM   546  C CB    . TYR A 1 93  ? -8.734  1.745   111.080 1.00 42.27  ? 73  TYR A CB    1 
ATOM   547  C CG    . TYR A 1 93  ? -8.307  2.578   109.895 1.00 39.15  ? 73  TYR A CG    1 
ATOM   548  C CD1   . TYR A 1 93  ? -7.001  3.031   109.778 1.00 37.89  ? 73  TYR A CD1   1 
ATOM   549  C CD2   . TYR A 1 93  ? -9.212  2.921   108.897 1.00 38.68  ? 73  TYR A CD2   1 
ATOM   550  C CE1   . TYR A 1 93  ? -6.605  3.798   108.701 1.00 35.75  ? 73  TYR A CE1   1 
ATOM   551  C CE2   . TYR A 1 93  ? -8.825  3.690   107.817 1.00 36.66  ? 73  TYR A CE2   1 
ATOM   552  C CZ    . TYR A 1 93  ? -7.520  4.125   107.725 1.00 35.06  ? 73  TYR A CZ    1 
ATOM   553  O OH    . TYR A 1 93  ? -7.126  4.888   106.652 1.00 34.03  ? 73  TYR A OH    1 
ATOM   554  N N     . VAL A 1 94  ? -11.291 3.288   111.774 1.00 45.80  ? 74  VAL A N     1 
ATOM   555  C CA    . VAL A 1 94  ? -12.345 4.222   111.397 1.00 46.70  ? 74  VAL A CA    1 
ATOM   556  C C     . VAL A 1 94  ? -12.469 5.359   112.408 1.00 49.20  ? 74  VAL A C     1 
ATOM   557  O O     . VAL A 1 94  ? -12.581 6.525   112.028 1.00 48.90  ? 74  VAL A O     1 
ATOM   558  C CB    . VAL A 1 94  ? -13.702 3.499   111.255 1.00 49.73  ? 74  VAL A CB    1 
ATOM   559  C CG1   . VAL A 1 94  ? -14.842 4.503   111.141 1.00 50.72  ? 74  VAL A CG1   1 
ATOM   560  C CG2   . VAL A 1 94  ? -13.678 2.567   110.051 1.00 47.86  ? 74  VAL A CG2   1 
ATOM   561  N N     . GLN A 1 95  ? -12.426 5.018   113.692 1.00 52.01  ? 75  GLN A N     1 
ATOM   562  C CA    . GLN A 1 95  ? -12.518 6.015   114.754 1.00 54.81  ? 75  GLN A CA    1 
ATOM   563  C C     . GLN A 1 95  ? -11.356 7.007   114.706 1.00 53.53  ? 75  GLN A C     1 
ATOM   564  O O     . GLN A 1 95  ? -11.549 8.209   114.885 1.00 55.03  ? 75  GLN A O     1 
ATOM   565  C CB    . GLN A 1 95  ? -12.566 5.333   116.123 1.00 58.75  ? 75  GLN A CB    1 
ATOM   566  N N     . ALA A 1 96  ? -10.153 6.499   114.458 1.00 51.23  ? 76  ALA A N     1 
ATOM   567  C CA    . ALA A 1 96  ? -8.962  7.341   114.419 1.00 49.70  ? 76  ALA A CA    1 
ATOM   568  C C     . ALA A 1 96  ? -8.903  8.186   113.149 1.00 46.51  ? 76  ALA A C     1 
ATOM   569  O O     . ALA A 1 96  ? -8.489  9.345   113.185 1.00 46.77  ? 76  ALA A O     1 
ATOM   570  C CB    . ALA A 1 96  ? -7.708  6.488   114.541 1.00 48.62  ? 76  ALA A CB    1 
ATOM   571  N N     . ALA A 1 97  ? -9.317  7.602   112.029 1.00 44.23  ? 77  ALA A N     1 
ATOM   572  C CA    . ALA A 1 97  ? -9.255  8.285   110.740 1.00 42.11  ? 77  ALA A CA    1 
ATOM   573  C C     . ALA A 1 97  ? -10.322 9.370   110.619 1.00 45.23  ? 77  ALA A C     1 
ATOM   574  O O     . ALA A 1 97  ? -10.135 10.359  109.909 1.00 44.69  ? 77  ALA A O     1 
ATOM   575  C CB    . ALA A 1 97  ? -9.395  7.283   109.605 1.00 39.17  ? 77  ALA A CB    1 
ATOM   576  N N     . ARG A 1 98  ? -11.438 9.178   111.316 1.00 48.38  ? 78  ARG A N     1 
ATOM   577  C CA    . ARG A 1 98  ? -12.559 10.108  111.250 1.00 51.53  ? 78  ARG A CA    1 
ATOM   578  C C     . ARG A 1 98  ? -12.213 11.444  111.903 1.00 54.54  ? 78  ARG A C     1 
ATOM   579  O O     . ARG A 1 98  ? -12.777 12.480  111.553 1.00 56.25  ? 78  ARG A O     1 
ATOM   580  C CB    . ARG A 1 98  ? -13.796 9.492   111.911 1.00 55.48  ? 78  ARG A CB    1 
ATOM   581  C CG    . ARG A 1 98  ? -15.084 10.275  111.710 1.00 59.24  ? 78  ARG A CG    1 
ATOM   582  C CD    . ARG A 1 98  ? -16.297 9.412   112.024 1.00 63.58  ? 78  ARG A CD    1 
ATOM   583  N NE    . ARG A 1 98  ? -16.215 8.816   113.355 1.00 67.50  ? 78  ARG A NE    1 
ATOM   584  C CZ    . ARG A 1 98  ? -16.702 7.619   113.668 1.00 70.16  ? 78  ARG A CZ    1 
ATOM   585  N NH1   . ARG A 1 98  ? -17.304 6.884   112.744 1.00 69.35  ? 78  ARG A NH1   1 
ATOM   586  N NH2   . ARG A 1 98  ? -16.583 7.155   114.905 1.00 73.79  ? 78  ARG A NH2   1 
ATOM   587  N N     . GLU A 1 99  ? -11.256 11.423  112.803 1.00 56.06  ? 79  GLU A N     1 
ATOM   588  C CA    . GLU A 1 99  ? -10.733 12.608  113.446 1.00 59.07  ? 79  GLU A CA    1 
ATOM   589  C C     . GLU A 1 99  ? -10.054 13.536  112.486 1.00 55.31  ? 79  GLU A C     1 
ATOM   590  O O     . GLU A 1 99  ? -10.012 14.719  112.702 1.00 57.61  ? 79  GLU A O     1 
ATOM   591  C CB    . GLU A 1 99  ? -9.806  12.243  114.591 1.00 62.91  ? 79  GLU A CB    1 
ATOM   592  C CG    . GLU A 1 99  ? -10.545 11.733  115.806 1.00 68.87  ? 79  GLU A CG    1 
ATOM   593  C CD    . GLU A 1 99  ? -9.679  11.589  117.037 1.00 73.66  ? 79  GLU A CD    1 
ATOM   594  O OE1   . GLU A 1 99  ? -8.480  11.926  117.001 1.00 72.89  ? 79  GLU A OE1   1 
ATOM   595  O OE2   . GLU A 1 99  ? -10.213 11.120  118.061 1.00 78.49  ? 79  GLU A OE2   1 
ATOM   596  N N     . LEU A 1 100 ? -9.425  12.975  111.477 1.00 50.25  ? 80  LEU A N     1 
ATOM   597  C CA    . LEU A 1 100 ? -8.816  13.755  110.426 1.00 47.39  ? 80  LEU A CA    1 
ATOM   598  C C     . LEU A 1 100 ? -9.778  14.497  109.518 1.00 47.19  ? 80  LEU A C     1 
ATOM   599  O O     . LEU A 1 100 ? -9.414  15.476  108.944 1.00 46.77  ? 80  LEU A O     1 
ATOM   600  C CB    . LEU A 1 100 ? -7.800  12.943  109.644 1.00 43.06  ? 80  LEU A CB    1 
ATOM   601  C CG    . LEU A 1 100 ? -6.495  12.788  110.376 1.00 43.72  ? 80  LEU A CG    1 
ATOM   602  C CD1   . LEU A 1 100 ? -6.739  12.183  111.726 1.00 46.69  ? 80  LEU A CD1   1 
ATOM   603  C CD2   . LEU A 1 100 ? -5.566  11.905  109.597 1.00 41.06  ? 80  LEU A CD2   1 
ATOM   604  N N     . PHE A 1 101 ? -10.963 13.966  109.298 1.00 47.68  ? 81  PHE A N     1 
ATOM   605  C CA    . PHE A 1 101 ? -11.928 14.622  108.436 1.00 47.79  ? 81  PHE A CA    1 
ATOM   606  C C     . PHE A 1 101 ? -12.862 15.611  109.122 1.00 52.37  ? 81  PHE A C     1 
ATOM   607  O O     . PHE A 1 101 ? -14.029 15.361  109.252 1.00 54.89  ? 81  PHE A O     1 
ATOM   608  C CB    . PHE A 1 101 ? -12.724 13.603  107.638 1.00 46.38  ? 81  PHE A CB    1 
ATOM   609  C CG    . PHE A 1 101 ? -11.897 12.794  106.715 1.00 42.50  ? 81  PHE A CG    1 
ATOM   610  C CD1   . PHE A 1 101 ? -10.880 12.027  107.191 1.00 40.02  ? 81  PHE A CD1   1 
ATOM   611  C CD2   . PHE A 1 101 ? -12.144 12.795  105.390 1.00 41.74  ? 81  PHE A CD2   1 
ATOM   612  C CE1   . PHE A 1 101 ? -10.127 11.288  106.358 1.00 37.30  ? 81  PHE A CE1   1 
ATOM   613  C CE2   . PHE A 1 101 ? -11.391 12.049  104.542 1.00 38.85  ? 81  PHE A CE2   1 
ATOM   614  C CZ    . PHE A 1 101 ? -10.376 11.295  105.027 1.00 36.70  ? 81  PHE A CZ    1 
ATOM   615  N N     . VAL A 1 102 ? -12.327 16.741  109.529 1.00 54.10  ? 82  VAL A N     1 
ATOM   616  C CA    . VAL A 1 102 ? -13.085 17.806  110.140 1.00 59.67  ? 82  VAL A CA    1 
ATOM   617  C C     . VAL A 1 102 ? -12.591 19.104  109.543 1.00 60.74  ? 82  VAL A C     1 
ATOM   618  O O     . VAL A 1 102 ? -11.514 19.127  109.008 1.00 58.10  ? 82  VAL A O     1 
ATOM   619  C CB    . VAL A 1 102 ? -12.884 17.846  111.645 1.00 62.43  ? 82  VAL A CB    1 
ATOM   620  C CG1   . VAL A 1 102 ? -13.343 16.563  112.276 1.00 63.19  ? 82  VAL A CG1   1 
ATOM   621  C CG2   . VAL A 1 102 ? -11.441 18.099  111.963 1.00 59.98  ? 82  VAL A CG2   1 
ATOM   622  N N     . PRO A 1 103 ? -13.383 20.168  109.612 1.00 65.07  ? 83  PRO A N     1 
ATOM   623  C CA    . PRO A 1 103 ? -13.087 21.444  108.945 1.00 66.15  ? 83  PRO A CA    1 
ATOM   624  C C     . PRO A 1 103 ? -11.700 22.014  109.248 1.00 65.41  ? 83  PRO A C     1 
ATOM   625  O O     . PRO A 1 103 ? -11.083 22.607  108.363 1.00 64.39  ? 83  PRO A O     1 
ATOM   626  C CB    . PRO A 1 103 ? -14.174 22.373  109.490 1.00 73.05  ? 83  PRO A CB    1 
ATOM   627  C CG    . PRO A 1 103 ? -15.322 21.472  109.745 1.00 73.98  ? 83  PRO A CG    1 
ATOM   628  C CD    . PRO A 1 103 ? -14.727 20.173  110.220 1.00 69.85  ? 83  PRO A CD    1 
ATOM   629  N N     . GLU A 1 104 ? -11.216 21.825  110.472 1.00 66.28  ? 84  GLU A N     1 
ATOM   630  C CA    . GLU A 1 104 ? -9.950  22.416  110.896 1.00 66.66  ? 84  GLU A CA    1 
ATOM   631  C C     . GLU A 1 104 ? -8.742  21.855  110.144 1.00 60.40  ? 84  GLU A C     1 
ATOM   632  O O     . GLU A 1 104 ? -7.702  22.507  110.060 1.00 60.53  ? 84  GLU A O     1 
ATOM   633  C CB    . GLU A 1 104 ? -9.750  22.220  112.402 1.00 71.41  ? 84  GLU A CB    1 
ATOM   634  C CG    . GLU A 1 104 ? -10.887 22.752  113.262 1.00 79.97  ? 84  GLU A CG    1 
ATOM   635  C CD    . GLU A 1 104 ? -11.968 21.717  113.507 1.00 81.24  ? 84  GLU A CD    1 
ATOM   636  O OE1   . GLU A 1 104 ? -11.624 20.574  113.874 1.00 78.57  ? 84  GLU A OE1   1 
ATOM   637  O OE2   . GLU A 1 104 ? -13.161 22.045  113.331 1.00 85.25  ? 84  GLU A OE2   1 
ATOM   638  N N     . THR A 1 105 ? -8.877  20.649  109.599 1.00 55.00  ? 85  THR A N     1 
ATOM   639  C CA    . THR A 1 105 ? -7.767  20.013  108.896 1.00 50.07  ? 85  THR A CA    1 
ATOM   640  C C     . THR A 1 105 ? -7.794  20.310  107.399 1.00 47.91  ? 85  THR A C     1 
ATOM   641  O O     . THR A 1 105 ? -6.929  19.853  106.652 1.00 44.10  ? 85  THR A O     1 
ATOM   642  C CB    . THR A 1 105 ? -7.767  18.483  109.099 1.00 46.59  ? 85  THR A CB    1 
ATOM   643  O OG1   . THR A 1 105 ? -8.922  17.910  108.474 1.00 45.43  ? 85  THR A OG1   1 
ATOM   644  C CG2   . THR A 1 105 ? -7.769  18.140  110.581 1.00 50.02  ? 85  THR A CG2   1 
ATOM   645  N N     . ASN A 1 106 ? -8.786  21.080  106.963 1.00 51.14  ? 86  ASN A N     1 
ATOM   646  C CA    . ASN A 1 106 ? -8.914  21.418  105.551 1.00 50.19  ? 86  ASN A CA    1 
ATOM   647  C C     . ASN A 1 106 ? -8.207  22.726  105.207 1.00 51.77  ? 86  ASN A C     1 
ATOM   648  O O     . ASN A 1 106 ? -8.841  23.701  104.804 1.00 54.75  ? 86  ASN A O     1 
ATOM   649  C CB    . ASN A 1 106 ? -10.389 21.501  105.151 1.00 53.31  ? 86  ASN A CB    1 
ATOM   650  C CG    . ASN A 1 106 ? -10.583 21.531  103.646 1.00 52.74  ? 86  ASN A CG    1 
ATOM   651  O OD1   . ASN A 1 106 ? -9.685  21.166  102.886 1.00 49.44  ? 86  ASN A OD1   1 
ATOM   652  N ND2   . ASN A 1 106 ? -11.758 21.966  103.208 1.00 56.30  ? 86  ASN A ND2   1 
ATOM   653  N N     . CYS A 1 107 ? -6.889  22.742  105.378 1.00 50.47  ? 87  CYS A N     1 
ATOM   654  C CA    . CYS A 1 107 ? -6.081  23.893  104.993 1.00 52.63  ? 87  CYS A CA    1 
ATOM   655  C C     . CYS A 1 107 ? -4.644  23.463  104.721 1.00 49.74  ? 87  CYS A C     1 
ATOM   656  O O     . CYS A 1 107 ? -4.221  22.384  105.138 1.00 47.94  ? 87  CYS A O     1 
ATOM   657  C CB    . CYS A 1 107 ? -6.117  24.975  106.074 1.00 58.02  ? 87  CYS A CB    1 
ATOM   658  S SG    . CYS A 1 107 ? -5.215  24.564  107.577 1.00 67.07  ? 87  CYS A SG    1 
ATOM   659  N N     . ALA A 1 108 ? -3.902  24.318  104.025 1.00 52.24  ? 88  ALA A N     1 
ATOM   660  C CA    . ALA A 1 108 ? -2.557  23.993  103.560 1.00 50.12  ? 88  ALA A CA    1 
ATOM   661  C C     . ALA A 1 108 ? -1.598  23.635  104.694 1.00 50.74  ? 88  ALA A C     1 
ATOM   662  O O     . ALA A 1 108 ? -0.948  22.591  104.654 1.00 47.36  ? 88  ALA A O     1 
ATOM   663  C CB    . ALA A 1 108 ? -1.995  25.153  102.751 1.00 52.26  ? 88  ALA A CB    1 
ATOM   664  N N     . GLU A 1 109 ? -1.517  24.501  105.699 1.00 55.83  ? 89  GLU A N     1 
ATOM   665  C CA    . GLU A 1 109 ? -0.552  24.341  106.784 1.00 58.03  ? 89  GLU A CA    1 
ATOM   666  C C     . GLU A 1 109 ? -0.723  23.020  107.532 1.00 53.61  ? 89  GLU A C     1 
ATOM   667  O O     . GLU A 1 109 ? 0.258   22.338  107.826 1.00 52.03  ? 89  GLU A O     1 
ATOM   668  C CB    . GLU A 1 109 ? -0.655  25.511  107.767 1.00 65.80  ? 89  GLU A CB    1 
ATOM   669  C CG    . GLU A 1 109 ? -0.146  26.838  107.218 1.00 72.60  ? 89  GLU A CG    1 
ATOM   670  C CD    . GLU A 1 109 ? -1.073  27.443  106.179 1.00 75.06  ? 89  GLU A CD    1 
ATOM   671  O OE1   . GLU A 1 109 ? -2.289  27.156  106.226 1.00 74.45  ? 89  GLU A OE1   1 
ATOM   672  O OE2   . GLU A 1 109 ? -0.586  28.199  105.313 1.00 77.67  ? 89  GLU A OE2   1 
ATOM   673  N N     . VAL A 1 110 ? -1.966  22.663  107.836 1.00 52.15  ? 90  VAL A N     1 
ATOM   674  C CA    . VAL A 1 110 ? -2.247  21.403  108.515 1.00 49.41  ? 90  VAL A CA    1 
ATOM   675  C C     . VAL A 1 110 ? -1.922  20.218  107.604 1.00 45.16  ? 90  VAL A C     1 
ATOM   676  O O     . VAL A 1 110 ? -1.364  19.214  108.051 1.00 44.47  ? 90  VAL A O     1 
ATOM   677  C CB    . VAL A 1 110 ? -3.718  21.325  108.974 1.00 49.51  ? 90  VAL A CB    1 
ATOM   678  C CG1   . VAL A 1 110 ? -4.047  19.936  109.493 1.00 47.06  ? 90  VAL A CG1   1 
ATOM   679  C CG2   . VAL A 1 110 ? -3.991  22.368  110.045 1.00 54.22  ? 90  VAL A CG2   1 
ATOM   680  N N     . TYR A 1 111 ? -2.257  20.352  106.324 1.00 42.82  ? 91  TYR A N     1 
ATOM   681  C CA    . TYR A 1 111 ? -2.011  19.297  105.345 1.00 39.03  ? 91  TYR A CA    1 
ATOM   682  C C     . TYR A 1 111 ? -0.530  18.939  105.239 1.00 38.39  ? 91  TYR A C     1 
ATOM   683  O O     . TYR A 1 111 ? -0.168  17.762  105.258 1.00 35.51  ? 91  TYR A O     1 
ATOM   684  C CB    . TYR A 1 111 ? -2.540  19.711  103.969 1.00 38.50  ? 91  TYR A CB    1 
ATOM   685  C CG    . TYR A 1 111 ? -2.235  18.714  102.869 1.00 35.71  ? 91  TYR A CG    1 
ATOM   686  C CD1   . TYR A 1 111 ? -3.063  17.622  102.645 1.00 33.29  ? 91  TYR A CD1   1 
ATOM   687  C CD2   . TYR A 1 111 ? -1.121  18.869  102.053 1.00 35.79  ? 91  TYR A CD2   1 
ATOM   688  C CE1   . TYR A 1 111 ? -2.789  16.710  101.644 1.00 31.35  ? 91  TYR A CE1   1 
ATOM   689  C CE2   . TYR A 1 111 ? -0.836  17.961  101.051 1.00 34.18  ? 91  TYR A CE2   1 
ATOM   690  C CZ    . TYR A 1 111 ? -1.675  16.885  100.850 1.00 32.50  ? 91  TYR A CZ    1 
ATOM   691  O OH    . TYR A 1 111 ? -1.397  15.980  99.851  1.00 32.09  ? 91  TYR A OH    1 
ATOM   692  N N     . TYR A 1 112 ? 0.325   19.950  105.127 1.00 41.01  ? 92  TYR A N     1 
ATOM   693  C CA    . TYR A 1 112 ? 1.749   19.705  104.927 1.00 41.94  ? 92  TYR A CA    1 
ATOM   694  C C     . TYR A 1 112 ? 2.426   19.164  106.182 1.00 42.47  ? 92  TYR A C     1 
ATOM   695  O O     . TYR A 1 112 ? 3.455   18.495  106.096 1.00 41.49  ? 92  TYR A O     1 
ATOM   696  C CB    . TYR A 1 112 ? 2.449   20.978  104.446 1.00 45.30  ? 92  TYR A CB    1 
ATOM   697  C CG    . TYR A 1 112 ? 2.084   21.332  103.024 1.00 45.06  ? 92  TYR A CG    1 
ATOM   698  C CD1   . TYR A 1 112 ? 1.435   22.522  102.724 1.00 47.57  ? 92  TYR A CD1   1 
ATOM   699  C CD2   . TYR A 1 112 ? 2.364   20.458  101.982 1.00 42.63  ? 92  TYR A CD2   1 
ATOM   700  C CE1   . TYR A 1 112 ? 1.090   22.838  101.424 1.00 48.21  ? 92  TYR A CE1   1 
ATOM   701  C CE2   . TYR A 1 112 ? 2.023   20.764  100.680 1.00 43.03  ? 92  TYR A CE2   1 
ATOM   702  C CZ    . TYR A 1 112 ? 1.385   21.955  100.406 1.00 46.01  ? 92  TYR A CZ    1 
ATOM   703  O OH    . TYR A 1 112 ? 1.044   22.262  99.110  1.00 47.17  ? 92  TYR A OH    1 
ATOM   704  N N     . GLN A 1 113 ? 1.843   19.437  107.345 1.00 44.60  ? 93  GLN A N     1 
ATOM   705  C CA    . GLN A 1 113 ? 2.356   18.867  108.585 1.00 46.84  ? 93  GLN A CA    1 
ATOM   706  C C     . GLN A 1 113 ? 1.979   17.392  108.688 1.00 44.35  ? 93  GLN A C     1 
ATOM   707  O O     . GLN A 1 113 ? 2.784   16.567  109.117 1.00 44.31  ? 93  GLN A O     1 
ATOM   708  C CB    . GLN A 1 113 ? 1.837   19.637  109.801 1.00 50.82  ? 93  GLN A CB    1 
ATOM   709  C CG    . GLN A 1 113 ? 2.304   19.064  111.130 1.00 53.40  ? 93  GLN A CG    1 
ATOM   710  C CD    . GLN A 1 113 ? 2.221   20.066  112.262 1.00 59.10  ? 93  GLN A CD    1 
ATOM   711  O OE1   . GLN A 1 113 ? 1.284   20.044  113.060 1.00 60.70  ? 93  GLN A OE1   1 
ATOM   712  N NE2   . GLN A 1 113 ? 3.209   20.951  112.341 1.00 62.30  ? 93  GLN A NE2   1 
ATOM   713  N N     . PHE A 1 114 ? 0.754   17.064  108.287 1.00 43.03  ? 94  PHE A N     1 
ATOM   714  C CA    . PHE A 1 114 ? 0.305   15.676  108.264 1.00 41.45  ? 94  PHE A CA    1 
ATOM   715  C C     . PHE A 1 114 ? 1.066   14.878  107.210 1.00 39.10  ? 94  PHE A C     1 
ATOM   716  O O     . PHE A 1 114 ? 1.370   13.702  107.412 1.00 38.38  ? 94  PHE A O     1 
ATOM   717  C CB    . PHE A 1 114 ? -1.202  15.596  108.005 1.00 41.45  ? 94  PHE A CB    1 
ATOM   718  C CG    . PHE A 1 114 ? -2.039  15.761  109.242 1.00 44.06  ? 94  PHE A CG    1 
ATOM   719  C CD1   . PHE A 1 114 ? -3.296  16.338  109.175 1.00 45.49  ? 94  PHE A CD1   1 
ATOM   720  C CD2   . PHE A 1 114 ? -1.571  15.330  110.472 1.00 46.00  ? 94  PHE A CD2   1 
ATOM   721  C CE1   . PHE A 1 114 ? -4.068  16.488  110.313 1.00 47.93  ? 94  PHE A CE1   1 
ATOM   722  C CE2   . PHE A 1 114 ? -2.339  15.476  111.613 1.00 48.65  ? 94  PHE A CE2   1 
ATOM   723  C CZ    . PHE A 1 114 ? -3.588  16.057  111.533 1.00 49.63  ? 94  PHE A CZ    1 
ATOM   724  N N     . ARG A 1 115 ? 1.373   15.523  106.088 1.00 38.15  ? 95  ARG A N     1 
ATOM   725  C CA    . ARG A 1 115 ? 2.166   14.894  105.039 1.00 35.94  ? 95  ARG A CA    1 
ATOM   726  C C     . ARG A 1 115 ? 3.575   14.609  105.545 1.00 38.77  ? 95  ARG A C     1 
ATOM   727  O O     . ARG A 1 115 ? 4.157   13.568  105.240 1.00 38.12  ? 95  ARG A O     1 
ATOM   728  C CB    . ARG A 1 115 ? 2.222   15.776  103.789 1.00 34.38  ? 95  ARG A CB    1 
ATOM   729  C CG    . ARG A 1 115 ? 2.831   15.087  102.574 1.00 32.27  ? 95  ARG A CG    1 
ATOM   730  C CD    . ARG A 1 115 ? 2.858   15.999  101.356 1.00 33.12  ? 95  ARG A CD    1 
ATOM   731  N NE    . ARG A 1 115 ? 3.882   17.035  101.464 1.00 36.09  ? 95  ARG A NE    1 
ATOM   732  C CZ    . ARG A 1 115 ? 4.163   17.911  100.504 1.00 37.68  ? 95  ARG A CZ    1 
ATOM   733  N NH1   . ARG A 1 115 ? 3.494   17.881  99.359  1.00 37.72  ? 95  ARG A NH1   1 
ATOM   734  N NH2   . ARG A 1 115 ? 5.113   18.819  100.689 1.00 39.01  ? 95  ARG A NH2   1 
ATOM   735  N N     . GLU A 1 116 ? 4.116   15.542  106.322 1.00 43.01  ? 96  GLU A N     1 
ATOM   736  C CA    . GLU A 1 116 ? 5.438   15.380  106.916 1.00 46.66  ? 96  GLU A CA    1 
ATOM   737  C C     . GLU A 1 116 ? 5.417   14.286  107.977 1.00 46.81  ? 96  GLU A C     1 
ATOM   738  O O     . GLU A 1 116 ? 6.341   13.478  108.068 1.00 47.29  ? 96  GLU A O     1 
ATOM   739  C CB    . GLU A 1 116 ? 5.921   16.697  107.526 1.00 51.88  ? 96  GLU A CB    1 
ATOM   740  C CG    . GLU A 1 116 ? 7.317   16.631  108.124 1.00 57.33  ? 96  GLU A CG    1 
ATOM   741  C CD    . GLU A 1 116 ? 7.695   17.901  108.862 1.00 64.53  ? 96  GLU A CD    1 
ATOM   742  O OE1   . GLU A 1 116 ? 6.779   18.636  109.288 1.00 66.59  ? 96  GLU A OE1   1 
ATOM   743  O OE2   . GLU A 1 116 ? 8.906   18.166  109.015 1.00 68.13  ? 96  GLU A OE2   1 
ATOM   744  N N     . GLU A 1 117 ? 4.355   14.270  108.776 1.00 46.94  ? 97  GLU A N     1 
ATOM   745  C CA    . GLU A 1 117 ? 4.190   13.264  109.818 1.00 47.62  ? 97  GLU A CA    1 
ATOM   746  C C     . GLU A 1 117 ? 4.094   11.868  109.212 1.00 43.66  ? 97  GLU A C     1 
ATOM   747  O O     . GLU A 1 117 ? 4.652   10.911  109.746 1.00 44.68  ? 97  GLU A O     1 
ATOM   748  C CB    . GLU A 1 117 ? 2.947   13.560  110.661 1.00 49.36  ? 97  GLU A CB    1 
ATOM   749  C CG    . GLU A 1 117 ? 2.712   12.557  111.778 1.00 52.13  ? 97  GLU A CG    1 
ATOM   750  C CD    . GLU A 1 117 ? 1.408   12.791  112.514 1.00 54.60  ? 97  GLU A CD    1 
ATOM   751  O OE1   . GLU A 1 117 ? 0.763   13.834  112.274 1.00 55.53  ? 97  GLU A OE1   1 
ATOM   752  O OE2   . GLU A 1 117 ? 1.027   11.928  113.332 1.00 56.02  ? 97  GLU A OE2   1 
ATOM   753  N N     . PHE A 1 118 ? 3.386   11.767  108.092 1.00 39.74  ? 98  PHE A N     1 
ATOM   754  C CA    . PHE A 1 118 ? 3.249   10.509  107.367 1.00 37.28  ? 98  PHE A CA    1 
ATOM   755  C C     . PHE A 1 118 ? 4.605   9.989   106.899 1.00 39.36  ? 98  PHE A C     1 
ATOM   756  O O     . PHE A 1 118 ? 4.933   8.818   107.094 1.00 40.07  ? 98  PHE A O     1 
ATOM   757  C CB    . PHE A 1 118 ? 2.308   10.688  106.172 1.00 34.52  ? 98  PHE A CB    1 
ATOM   758  C CG    . PHE A 1 118 ? 2.252   9.499   105.253 1.00 32.89  ? 98  PHE A CG    1 
ATOM   759  C CD1   . PHE A 1 118 ? 3.018   9.461   104.099 1.00 32.65  ? 98  PHE A CD1   1 
ATOM   760  C CD2   . PHE A 1 118 ? 1.428   8.422   105.539 1.00 32.26  ? 98  PHE A CD2   1 
ATOM   761  C CE1   . PHE A 1 118 ? 2.970   8.370   103.251 1.00 32.21  ? 98  PHE A CE1   1 
ATOM   762  C CE2   . PHE A 1 118 ? 1.374   7.328   104.694 1.00 31.89  ? 98  PHE A CE2   1 
ATOM   763  C CZ    . PHE A 1 118 ? 2.147   7.303   103.549 1.00 32.01  ? 98  PHE A CZ    1 
ATOM   764  N N     . ASN A 1 119 ? 5.392   10.868  106.287 1.00 40.02  ? 99  ASN A N     1 
ATOM   765  C CA    . ASN A 1 119 ? 6.690   10.487  105.742 1.00 41.12  ? 99  ASN A CA    1 
ATOM   766  C C     . ASN A 1 119 ? 7.723   10.168  106.819 1.00 44.75  ? 99  ASN A C     1 
ATOM   767  O O     . ASN A 1 119 ? 8.733   9.524   106.543 1.00 46.69  ? 99  ASN A O     1 
ATOM   768  C CB    . ASN A 1 119 ? 7.222   11.592  104.828 1.00 40.73  ? 99  ASN A CB    1 
ATOM   769  C CG    . ASN A 1 119 ? 6.437   11.706  103.537 1.00 38.41  ? 99  ASN A CG    1 
ATOM   770  O OD1   . ASN A 1 119 ? 5.978   10.705  102.987 1.00 37.42  ? 99  ASN A OD1   1 
ATOM   771  N ND2   . ASN A 1 119 ? 6.277   12.929  103.045 1.00 38.51  ? 99  ASN A ND2   1 
ATOM   772  N N     . LYS A 1 120 ? 7.467   10.617  108.043 1.00 46.76  ? 100 LYS A N     1 
ATOM   773  C CA    . LYS A 1 120 ? 8.398   10.388  109.144 1.00 50.59  ? 100 LYS A CA    1 
ATOM   774  C C     . LYS A 1 120 ? 7.905   9.321   110.117 1.00 51.26  ? 100 LYS A C     1 
ATOM   775  O O     . LYS A 1 120 ? 8.645   8.888   110.999 1.00 54.16  ? 100 LYS A O     1 
ATOM   776  C CB    . LYS A 1 120 ? 8.658   11.692  109.903 1.00 54.06  ? 100 LYS A CB    1 
ATOM   777  C CG    . LYS A 1 120 ? 9.390   12.748  109.093 1.00 55.71  ? 100 LYS A CG    1 
ATOM   778  C CD    . LYS A 1 120 ? 9.745   13.950  109.955 1.00 60.13  ? 100 LYS A CD    1 
ATOM   779  C CE    . LYS A 1 120 ? 10.535  14.980  109.165 1.00 61.99  ? 100 LYS A CE    1 
ATOM   780  N NZ    . LYS A 1 120 ? 10.954  16.126  110.017 1.00 67.21  ? 100 LYS A NZ    1 
ATOM   781  N N     . SER A 1 121 ? 6.656   8.897   109.957 1.00 49.94  ? 101 SER A N     1 
ATOM   782  C CA    . SER A 1 121 ? 6.063   7.923   110.869 1.00 52.31  ? 101 SER A CA    1 
ATOM   783  C C     . SER A 1 121 ? 6.631   6.521   110.666 1.00 54.27  ? 101 SER A C     1 
ATOM   784  O O     . SER A 1 121 ? 6.905   6.105   109.540 1.00 52.20  ? 101 SER A O     1 
ATOM   785  C CB    . SER A 1 121 ? 4.543   7.891   110.706 1.00 50.11  ? 101 SER A CB    1 
ATOM   786  O OG    . SER A 1 121 ? 3.960   6.931   111.570 1.00 51.44  ? 101 SER A OG    1 
ATOM   787  N N     . GLN A 1 122 ? 6.803   5.800   111.769 1.00 58.73  ? 102 GLN A N     1 
ATOM   788  C CA    . GLN A 1 122 ? 7.278   4.423   111.728 1.00 61.57  ? 102 GLN A CA    1 
ATOM   789  C C     . GLN A 1 122 ? 6.139   3.453   112.025 1.00 60.57  ? 102 GLN A C     1 
ATOM   790  O O     . GLN A 1 122 ? 6.294   2.239   111.895 1.00 61.91  ? 102 GLN A O     1 
ATOM   791  C CB    . GLN A 1 122 ? 8.417   4.216   112.730 1.00 67.86  ? 102 GLN A CB    1 
ATOM   792  C CG    . GLN A 1 122 ? 9.660   5.050   112.456 1.00 71.00  ? 102 GLN A CG    1 
ATOM   793  C CD    . GLN A 1 122 ? 10.446  4.556   111.257 1.00 71.38  ? 102 GLN A CD    1 
ATOM   794  O OE1   . GLN A 1 122 ? 10.091  4.829   110.111 1.00 68.66  ? 102 GLN A OE1   1 
ATOM   795  N NE2   . GLN A 1 122 ? 11.523  3.824   111.518 1.00 75.31  ? 102 GLN A NE2   1 
ATOM   796  N N     . ASP A 1 123 ? 4.995   3.999   112.425 1.00 58.43  ? 103 ASP A N     1 
ATOM   797  C CA    . ASP A 1 123 ? 3.841   3.188   112.795 1.00 57.71  ? 103 ASP A CA    1 
ATOM   798  C C     . ASP A 1 123 ? 2.911   2.954   111.609 1.00 52.71  ? 103 ASP A C     1 
ATOM   799  O O     . ASP A 1 123 ? 2.390   3.905   111.027 1.00 51.06  ? 103 ASP A O     1 
ATOM   800  C CB    . ASP A 1 123 ? 3.072   3.852   113.940 1.00 60.18  ? 103 ASP A CB    1 
ATOM   801  C CG    . ASP A 1 123 ? 1.848   3.059   114.359 1.00 61.71  ? 103 ASP A CG    1 
ATOM   802  O OD1   . ASP A 1 123 ? 1.928   1.813   114.402 1.00 63.91  ? 103 ASP A OD1   1 
ATOM   803  O OD2   . ASP A 1 123 ? 0.804   3.683   114.644 1.00 60.81  ? 103 ASP A OD2   1 
ATOM   804  N N     . PRO A 1 124 ? 2.706   1.678   111.244 1.00 50.97  ? 104 PRO A N     1 
ATOM   805  C CA    . PRO A 1 124 ? 1.813   1.287   110.147 1.00 47.14  ? 104 PRO A CA    1 
ATOM   806  C C     . PRO A 1 124 ? 0.379   1.778   110.338 1.00 44.33  ? 104 PRO A C     1 
ATOM   807  O O     . PRO A 1 124 ? -0.255  2.187   109.365 1.00 42.44  ? 104 PRO A O     1 
ATOM   808  C CB    . PRO A 1 124 ? 1.870   -0.243  110.181 1.00 49.70  ? 104 PRO A CB    1 
ATOM   809  C CG    . PRO A 1 124 ? 3.201   -0.550  110.778 1.00 52.40  ? 104 PRO A CG    1 
ATOM   810  C CD    . PRO A 1 124 ? 3.429   0.522   111.804 1.00 53.48  ? 104 PRO A CD    1 
ATOM   811  N N     . PHE A 1 125 ? -0.122  1.738   111.569 1.00 44.55  ? 105 PHE A N     1 
ATOM   812  C CA    . PHE A 1 125 ? -1.479  2.196   111.849 1.00 42.25  ? 105 PHE A CA    1 
ATOM   813  C C     . PHE A 1 125 ? -1.608  3.697   111.616 1.00 40.74  ? 105 PHE A C     1 
ATOM   814  O O     . PHE A 1 125 ? -2.540  4.150   110.953 1.00 38.52  ? 105 PHE A O     1 
ATOM   815  C CB    . PHE A 1 125 ? -1.888  1.852   113.283 1.00 43.92  ? 105 PHE A CB    1 
ATOM   816  C CG    . PHE A 1 125 ? -3.295  2.263   113.626 1.00 43.83  ? 105 PHE A CG    1 
ATOM   817  C CD1   . PHE A 1 125 ? -4.367  1.446   113.307 1.00 43.74  ? 105 PHE A CD1   1 
ATOM   818  C CD2   . PHE A 1 125 ? -3.546  3.467   114.266 1.00 44.20  ? 105 PHE A CD2   1 
ATOM   819  C CE1   . PHE A 1 125 ? -5.662  1.820   113.618 1.00 44.33  ? 105 PHE A CE1   1 
ATOM   820  C CE2   . PHE A 1 125 ? -4.838  3.848   114.578 1.00 44.53  ? 105 PHE A CE2   1 
ATOM   821  C CZ    . PHE A 1 125 ? -5.897  3.023   114.255 1.00 44.51  ? 105 PHE A CZ    1 
ATOM   822  N N     . ARG A 1 126 ? -0.668  4.461   112.164 1.00 42.51  ? 106 ARG A N     1 
ATOM   823  C CA    . ARG A 1 126 ? -0.677  5.913   112.017 1.00 42.51  ? 106 ARG A CA    1 
ATOM   824  C C     . ARG A 1 126 ? -0.505  6.320   110.555 1.00 40.02  ? 106 ARG A C     1 
ATOM   825  O O     . ARG A 1 126 ? -1.167  7.243   110.079 1.00 39.50  ? 106 ARG A O     1 
ATOM   826  C CB    . ARG A 1 126 ? 0.421   6.545   112.875 1.00 46.03  ? 106 ARG A CB    1 
ATOM   827  C CG    . ARG A 1 126 ? 0.441   8.062   112.832 1.00 47.28  ? 106 ARG A CG    1 
ATOM   828  C CD    . ARG A 1 126 ? -0.908  8.644   113.228 1.00 48.99  ? 106 ARG A CD    1 
ATOM   829  N NE    . ARG A 1 126 ? -0.905  10.103  113.172 1.00 50.95  ? 106 ARG A NE    1 
ATOM   830  C CZ    . ARG A 1 126 ? -1.971  10.863  113.402 1.00 52.23  ? 106 ARG A CZ    1 
ATOM   831  N NH1   . ARG A 1 126 ? -3.136  10.304  113.703 1.00 52.74  ? 106 ARG A NH1   1 
ATOM   832  N NH2   . ARG A 1 126 ? -1.872  12.184  113.329 1.00 52.85  ? 106 ARG A NH2   1 
ATOM   833  N N     . ARG A 1 127 ? 0.381   5.625   109.848 1.00 39.20  ? 107 ARG A N     1 
ATOM   834  C CA    . ARG A 1 127 ? 0.586   5.876   108.425 1.00 37.60  ? 107 ARG A CA    1 
ATOM   835  C C     . ARG A 1 127 ? -0.675  5.569   107.624 1.00 36.36  ? 107 ARG A C     1 
ATOM   836  O O     . ARG A 1 127 ? -1.009  6.288   106.683 1.00 36.10  ? 107 ARG A O     1 
ATOM   837  C CB    . ARG A 1 127 ? 1.759   5.050   107.892 1.00 38.58  ? 107 ARG A CB    1 
ATOM   838  C CG    . ARG A 1 127 ? 3.129   5.577   108.293 1.00 40.61  ? 107 ARG A CG    1 
ATOM   839  C CD    . ARG A 1 127 ? 4.244   4.701   107.743 1.00 42.39  ? 107 ARG A CD    1 
ATOM   840  N NE    . ARG A 1 127 ? 4.246   4.661   106.283 1.00 41.77  ? 107 ARG A NE    1 
ATOM   841  C CZ    . ARG A 1 127 ? 4.983   5.456   105.513 1.00 42.46  ? 107 ARG A CZ    1 
ATOM   842  N NH1   . ARG A 1 127 ? 5.786   6.358   106.061 1.00 43.45  ? 107 ARG A NH1   1 
ATOM   843  N NH2   . ARG A 1 127 ? 4.919   5.347   104.192 1.00 41.93  ? 107 ARG A NH2   1 
ATOM   844  N N     . ALA A 1 128 ? -1.375  4.503   108.002 1.00 35.82  ? 108 ALA A N     1 
ATOM   845  C CA    . ALA A 1 128 ? -2.609  4.119   107.325 1.00 34.88  ? 108 ALA A CA    1 
ATOM   846  C C     . ALA A 1 128 ? -3.695  5.169   107.533 1.00 34.92  ? 108 ALA A C     1 
ATOM   847  O O     . ALA A 1 128 ? -4.469  5.466   106.623 1.00 34.41  ? 108 ALA A O     1 
ATOM   848  C CB    . ALA A 1 128 ? -3.085  2.758   107.814 1.00 36.45  ? 108 ALA A CB    1 
ATOM   849  N N     . VAL A 1 129 ? -3.747  5.725   108.739 1.00 36.17  ? 109 VAL A N     1 
ATOM   850  C CA    . VAL A 1 129 ? -4.702  6.778   109.061 1.00 36.72  ? 109 VAL A CA    1 
ATOM   851  C C     . VAL A 1 129 ? -4.431  8.026   108.228 1.00 36.62  ? 109 VAL A C     1 
ATOM   852  O O     . VAL A 1 129 ? -5.337  8.579   107.607 1.00 36.38  ? 109 VAL A O     1 
ATOM   853  C CB    . VAL A 1 129 ? -4.658  7.142   110.560 1.00 38.16  ? 109 VAL A CB    1 
ATOM   854  C CG1   . VAL A 1 129 ? -5.473  8.394   110.831 1.00 38.54  ? 109 VAL A CG1   1 
ATOM   855  C CG2   . VAL A 1 129 ? -5.160  5.978   111.403 1.00 39.54  ? 109 VAL A CG2   1 
ATOM   856  N N     . LEU A 1 130 ? -3.173  8.455   108.207 1.00 37.64  ? 110 LEU A N     1 
ATOM   857  C CA    . LEU A 1 130 ? -2.783  9.653   107.472 1.00 37.08  ? 110 LEU A CA    1 
ATOM   858  C C     . LEU A 1 130 ? -2.908  9.460   105.965 1.00 35.28  ? 110 LEU A C     1 
ATOM   859  O O     . LEU A 1 130 ? -3.183  10.409  105.232 1.00 34.70  ? 110 LEU A O     1 
ATOM   860  C CB    . LEU A 1 130 ? -1.351  10.055  107.831 1.00 37.60  ? 110 LEU A CB    1 
ATOM   861  C CG    . LEU A 1 130 ? -1.140  10.539  109.266 1.00 39.85  ? 110 LEU A CG    1 
ATOM   862  C CD1   . LEU A 1 130 ? 0.340   10.672  109.579 1.00 40.85  ? 110 LEU A CD1   1 
ATOM   863  C CD2   . LEU A 1 130 ? -1.852  11.864  109.487 1.00 41.10  ? 110 LEU A CD2   1 
ATOM   864  N N     . PHE A 1 131 ? -2.710  8.227   105.509 1.00 34.83  ? 111 PHE A N     1 
ATOM   865  C CA    . PHE A 1 131 ? -2.771  7.920   104.083 1.00 34.32  ? 111 PHE A CA    1 
ATOM   866  C C     . PHE A 1 131 ? -4.152  8.218   103.506 1.00 34.13  ? 111 PHE A C     1 
ATOM   867  O O     . PHE A 1 131 ? -4.271  8.690   102.376 1.00 33.85  ? 111 PHE A O     1 
ATOM   868  C CB    . PHE A 1 131 ? -2.402  6.456   103.837 1.00 35.42  ? 111 PHE A CB    1 
ATOM   869  C CG    . PHE A 1 131 ? -2.138  6.130   102.394 1.00 36.62  ? 111 PHE A CG    1 
ATOM   870  C CD1   . PHE A 1 131 ? -0.912  6.419   101.819 1.00 37.02  ? 111 PHE A CD1   1 
ATOM   871  C CD2   . PHE A 1 131 ? -3.112  5.527   101.615 1.00 38.22  ? 111 PHE A CD2   1 
ATOM   872  C CE1   . PHE A 1 131 ? -0.662  6.118   100.492 1.00 37.65  ? 111 PHE A CE1   1 
ATOM   873  C CE2   . PHE A 1 131 ? -2.869  5.221   100.287 1.00 39.06  ? 111 PHE A CE2   1 
ATOM   874  C CZ    . PHE A 1 131 ? -1.642  5.518   99.726  1.00 38.78  ? 111 PHE A CZ    1 
ATOM   875  N N     . LEU A 1 132 ? -5.192  7.945   104.287 1.00 34.70  ? 112 LEU A N     1 
ATOM   876  C CA    . LEU A 1 132 ? -6.559  8.207   103.848 1.00 35.10  ? 112 LEU A CA    1 
ATOM   877  C C     . LEU A 1 132 ? -6.831  9.707   103.792 1.00 35.65  ? 112 LEU A C     1 
ATOM   878  O O     . LEU A 1 132 ? -7.509  10.192  102.886 1.00 36.84  ? 112 LEU A O     1 
ATOM   879  C CB    . LEU A 1 132 ? -7.564  7.518   104.773 1.00 35.98  ? 112 LEU A CB    1 
ATOM   880  C CG    . LEU A 1 132 ? -9.038  7.648   104.383 1.00 37.55  ? 112 LEU A CG    1 
ATOM   881  C CD1   . LEU A 1 132 ? -9.255  7.187   102.951 1.00 37.49  ? 112 LEU A CD1   1 
ATOM   882  C CD2   . LEU A 1 132 ? -9.921  6.863   105.341 1.00 39.40  ? 112 LEU A CD2   1 
ATOM   883  N N     . TYR A 1 133 ? -6.298  10.436  104.769 1.00 35.25  ? 113 TYR A N     1 
ATOM   884  C CA    . TYR A 1 133 ? -6.413  11.889  104.798 1.00 35.36  ? 113 TYR A CA    1 
ATOM   885  C C     . TYR A 1 133 ? -5.730  12.514  103.587 1.00 35.24  ? 113 TYR A C     1 
ATOM   886  O O     . TYR A 1 133 ? -6.304  13.366  102.907 1.00 36.77  ? 113 TYR A O     1 
ATOM   887  C CB    . TYR A 1 133 ? -5.811  12.449  106.089 1.00 36.20  ? 113 TYR A CB    1 
ATOM   888  C CG    . TYR A 1 133 ? -5.619  13.950  106.079 1.00 37.71  ? 113 TYR A CG    1 
ATOM   889  C CD1   . TYR A 1 133 ? -6.661  14.805  106.412 1.00 39.67  ? 113 TYR A CD1   1 
ATOM   890  C CD2   . TYR A 1 133 ? -4.393  14.511  105.741 1.00 37.43  ? 113 TYR A CD2   1 
ATOM   891  C CE1   . TYR A 1 133 ? -6.489  16.175  106.403 1.00 41.44  ? 113 TYR A CE1   1 
ATOM   892  C CE2   . TYR A 1 133 ? -4.213  15.879  105.728 1.00 39.04  ? 113 TYR A CE2   1 
ATOM   893  C CZ    . TYR A 1 133 ? -5.263  16.706  106.061 1.00 41.21  ? 113 TYR A CZ    1 
ATOM   894  O OH    . TYR A 1 133 ? -5.085  18.071  106.050 1.00 43.64  ? 113 TYR A OH    1 
ATOM   895  N N     . LEU A 1 134 ? -4.498  12.086  103.329 1.00 33.49  ? 114 LEU A N     1 
ATOM   896  C CA    . LEU A 1 134 ? -3.716  12.601  102.211 1.00 32.75  ? 114 LEU A CA    1 
ATOM   897  C C     . LEU A 1 134 ? -4.379  12.293  100.871 1.00 33.14  ? 114 LEU A C     1 
ATOM   898  O O     . LEU A 1 134 ? -4.322  13.096  99.941  1.00 34.25  ? 114 LEU A O     1 
ATOM   899  C CB    . LEU A 1 134 ? -2.301  12.021  102.243 1.00 31.29  ? 114 LEU A CB    1 
ATOM   900  C CG    . LEU A 1 134 ? -1.427  12.451  103.424 1.00 31.75  ? 114 LEU A CG    1 
ATOM   901  C CD1   . LEU A 1 134 ? -0.147  11.632  103.479 1.00 31.31  ? 114 LEU A CD1   1 
ATOM   902  C CD2   . LEU A 1 134 ? -1.110  13.936  103.339 1.00 32.92  ? 114 LEU A CD2   1 
ATOM   903  N N     . ASN A 1 135 ? -5.012  11.128  100.781 1.00 32.29  ? 115 ASN A N     1 
ATOM   904  C CA    . ASN A 1 135 ? -5.683  10.715  99.554  1.00 31.67  ? 115 ASN A CA    1 
ATOM   905  C C     . ASN A 1 135 ? -6.923  11.556  99.259  1.00 33.49  ? 115 ASN A C     1 
ATOM   906  O O     . ASN A 1 135 ? -7.279  11.770  98.101  1.00 35.29  ? 115 ASN A O     1 
ATOM   907  C CB    . ASN A 1 135 ? -6.063  9.235   99.632  1.00 30.06  ? 115 ASN A CB    1 
ATOM   908  C CG    . ASN A 1 135 ? -6.845  8.767   98.421  1.00 31.39  ? 115 ASN A CG    1 
ATOM   909  O OD1   . ASN A 1 135 ? -8.073  8.691   98.453  1.00 32.01  ? 115 ASN A OD1   1 
ATOM   910  N ND2   . ASN A 1 135 ? -6.136  8.454   97.342  1.00 32.26  ? 115 ASN A ND2   1 
ATOM   911  N N     . ARG A 1 136 ? -7.570  12.039  100.313 1.00 34.68  ? 116 ARG A N     1 
ATOM   912  C CA    . ARG A 1 136 ? -8.825  12.772  100.176 1.00 38.21  ? 116 ARG A CA    1 
ATOM   913  C C     . ARG A 1 136 ? -8.638  14.289  100.158 1.00 38.62  ? 116 ARG A C     1 
ATOM   914  O O     . ARG A 1 136 ? -9.465  15.015  99.604  1.00 42.13  ? 116 ARG A O     1 
ATOM   915  C CB    . ARG A 1 136 ? -9.779  12.383  101.307 1.00 40.93  ? 116 ARG A CB    1 
ATOM   916  C CG    . ARG A 1 136 ? -10.386 11.001  101.141 1.00 43.26  ? 116 ARG A CG    1 
ATOM   917  C CD    . ARG A 1 136 ? -11.467 11.027  100.078 1.00 48.02  ? 116 ARG A CD    1 
ATOM   918  N NE    . ARG A 1 136 ? -11.851 9.689   99.640  1.00 50.16  ? 116 ARG A NE    1 
ATOM   919  C CZ    . ARG A 1 136 ? -12.836 9.444   98.783  1.00 53.47  ? 116 ARG A CZ    1 
ATOM   920  N NH1   . ARG A 1 136 ? -13.541 10.448  98.278  1.00 55.54  ? 116 ARG A NH1   1 
ATOM   921  N NH2   . ARG A 1 136 ? -13.119 8.196   98.434  1.00 55.13  ? 116 ARG A NH2   1 
ATOM   922  N N     . TYR A 1 137 ? -7.556  14.765  100.764 1.00 35.47  ? 117 TYR A N     1 
ATOM   923  C CA    . TYR A 1 137 ? -7.295  16.199  100.836 1.00 36.50  ? 117 TYR A CA    1 
ATOM   924  C C     . TYR A 1 137 ? -6.218  16.635  99.849  1.00 37.23  ? 117 TYR A C     1 
ATOM   925  O O     . TYR A 1 137 ? -6.050  17.827  99.594  1.00 39.45  ? 117 TYR A O     1 
ATOM   926  C CB    . TYR A 1 137 ? -6.887  16.597  102.256 1.00 35.69  ? 117 TYR A CB    1 
ATOM   927  C CG    . TYR A 1 137 ? -8.034  16.640  103.241 1.00 36.11  ? 117 TYR A CG    1 
ATOM   928  C CD1   . TYR A 1 137 ? -8.628  15.471  103.699 1.00 34.33  ? 117 TYR A CD1   1 
ATOM   929  C CD2   . TYR A 1 137 ? -8.518  17.852  103.719 1.00 38.30  ? 117 TYR A CD2   1 
ATOM   930  C CE1   . TYR A 1 137 ? -9.674  15.507  104.600 1.00 35.90  ? 117 TYR A CE1   1 
ATOM   931  C CE2   . TYR A 1 137 ? -9.564  17.898  104.622 1.00 39.24  ? 117 TYR A CE2   1 
ATOM   932  C CZ    . TYR A 1 137 ? -10.138 16.722  105.058 1.00 38.28  ? 117 TYR A CZ    1 
ATOM   933  O OH    . TYR A 1 137 ? -11.179 16.760  105.957 1.00 40.81  ? 117 TYR A OH    1 
ATOM   934  N N     . GLY A 1 138 ? -5.473  15.693  99.314  1.00 35.31  ? 118 GLY A N     1 
ATOM   935  C CA    . GLY A 1 138 ? -4.446  15.955  98.346  1.00 35.54  ? 118 GLY A CA    1 
ATOM   936  C C     . GLY A 1 138 ? -4.964  16.203  96.967  1.00 38.95  ? 118 GLY A C     1 
ATOM   937  O O     . GLY A 1 138 ? -6.063  15.867  96.672  1.00 40.70  ? 118 GLY A O     1 
ATOM   938  N N     . TYR A 1 139 ? -4.126  16.754  96.123  1.00 41.77  ? 119 TYR A N     1 
ATOM   939  C CA    . TYR A 1 139 ? -4.485  17.202  94.815  1.00 46.51  ? 119 TYR A CA    1 
ATOM   940  C C     . TYR A 1 139 ? -4.770  16.069  93.863  1.00 48.76  ? 119 TYR A C     1 
ATOM   941  O O     . TYR A 1 139 ? -3.928  15.273  93.584  1.00 48.08  ? 119 TYR A O     1 
ATOM   942  C CB    . TYR A 1 139 ? -3.300  17.979  94.282  1.00 47.79  ? 119 TYR A CB    1 
ATOM   943  C CG    . TYR A 1 139 ? -3.617  19.035  93.287  1.00 51.61  ? 119 TYR A CG    1 
ATOM   944  C CD1   . TYR A 1 139 ? -3.621  20.349  93.648  1.00 53.91  ? 119 TYR A CD1   1 
ATOM   945  C CD2   . TYR A 1 139 ? -3.882  18.722  91.991  1.00 53.76  ? 119 TYR A CD2   1 
ATOM   946  C CE1   . TYR A 1 139 ? -3.899  21.330  92.743  1.00 57.72  ? 119 TYR A CE1   1 
ATOM   947  C CE2   . TYR A 1 139 ? -4.176  19.688  91.083  1.00 57.53  ? 119 TYR A CE2   1 
ATOM   948  C CZ    . TYR A 1 139 ? -4.179  20.991  91.468  1.00 59.56  ? 119 TYR A CZ    1 
ATOM   949  O OH    . TYR A 1 139 ? -4.461  21.963  90.565  1.00 64.13  ? 119 TYR A OH    1 
ATOM   950  N N     . ASN A 1 140 ? -5.994  16.039  93.370  1.00 52.34  ? 120 ASN A N     1 
ATOM   951  C CA    . ASN A 1 140 ? -6.486  15.086  92.403  1.00 54.94  ? 120 ASN A CA    1 
ATOM   952  C C     . ASN A 1 140 ? -6.490  13.697  92.938  1.00 53.41  ? 120 ASN A C     1 
ATOM   953  O O     . ASN A 1 140 ? -6.623  12.751  92.211  1.00 54.92  ? 120 ASN A O     1 
ATOM   954  C CB    . ASN A 1 140 ? -5.720  15.166  91.116  1.00 57.66  ? 120 ASN A CB    1 
ATOM   955  C CG    . ASN A 1 140 ? -5.962  16.457  90.400  1.00 62.00  ? 120 ASN A CG    1 
ATOM   956  O OD1   . ASN A 1 140 ? -6.966  17.104  90.620  1.00 64.39  ? 120 ASN A OD1   1 
ATOM   957  N ND2   . ASN A 1 140 ? -5.040  16.843  89.556  1.00 63.55  ? 120 ASN A ND2   1 
ATOM   958  N N     . GLY A 1 141 ? -6.384  13.582  94.239  1.00 51.34  ? 121 GLY A N     1 
ATOM   959  C CA    . GLY A 1 141 ? -6.325  12.255  94.824  1.00 50.15  ? 121 GLY A CA    1 
ATOM   960  C C     . GLY A 1 141 ? -5.137  11.455  94.325  1.00 49.67  ? 121 GLY A C     1 
ATOM   961  O O     . GLY A 1 141 ? -5.165  10.225  94.307  1.00 49.86  ? 121 GLY A O     1 
ATOM   962  N N     . LEU A 1 142 ? -4.088  12.162  93.916  1.00 49.20  ? 122 LEU A N     1 
ATOM   963  C CA    . LEU A 1 142 ? -2.899  11.521  93.374  1.00 48.44  ? 122 LEU A CA    1 
ATOM   964  C C     . LEU A 1 142 ? -2.096  10.817  94.458  1.00 46.06  ? 122 LEU A C     1 
ATOM   965  O O     . LEU A 1 142 ? -2.235  11.114  95.645  1.00 45.10  ? 122 LEU A O     1 
ATOM   966  C CB    . LEU A 1 142 ? -2.011  12.545  92.662  1.00 49.29  ? 122 LEU A CB    1 
ATOM   967  C CG    . LEU A 1 142 ? -2.566  13.215  91.404  1.00 52.64  ? 122 LEU A CG    1 
ATOM   968  C CD1   . LEU A 1 142 ? -1.542  14.179  90.825  1.00 53.92  ? 122 LEU A CD1   1 
ATOM   969  C CD2   . LEU A 1 142 ? -2.973  12.175  90.371  1.00 54.70  ? 122 LEU A CD2   1 
ATOM   970  N N     . CYS A 1 143 ? -1.261  9.877   94.034  1.00 45.74  ? 123 CYS A N     1 
ATOM   971  C CA    . CYS A 1 143 ? -0.315  9.225   94.926  1.00 44.00  ? 123 CYS A CA    1 
ATOM   972  C C     . CYS A 1 143 ? 1.066   9.269   94.285  1.00 44.25  ? 123 CYS A C     1 
ATOM   973  O O     . CYS A 1 143 ? 1.404   8.427   93.455  1.00 46.66  ? 123 CYS A O     1 
ATOM   974  C CB    . CYS A 1 143 ? -0.736  7.784   95.217  1.00 44.69  ? 123 CYS A CB    1 
ATOM   975  S SG    . CYS A 1 143 ? 0.259   6.964   96.485  1.00 62.45  ? 123 CYS A SG    1 
ATOM   976  N N     . ARG A 1 144 ? 1.853   10.269  94.665  1.00 42.56  ? 124 ARG A N     1 
ATOM   977  C CA    . ARG A 1 144 ? 3.152   10.496  94.048  1.00 41.43  ? 124 ARG A CA    1 
ATOM   978  C C     . ARG A 1 144 ? 4.265   10.485  95.088  1.00 40.08  ? 124 ARG A C     1 
ATOM   979  O O     . ARG A 1 144 ? 4.113   11.030  96.181  1.00 37.87  ? 124 ARG A O     1 
ATOM   980  C CB    . ARG A 1 144 ? 3.151   11.824  93.286  1.00 41.43  ? 124 ARG A CB    1 
ATOM   981  C CG    . ARG A 1 144 ? 4.444   12.134  92.546  1.00 42.30  ? 124 ARG A CG    1 
ATOM   982  C CD    . ARG A 1 144 ? 4.367   13.487  91.849  1.00 42.86  ? 124 ARG A CD    1 
ATOM   983  N NE    . ARG A 1 144 ? 4.206   14.584  92.800  1.00 41.63  ? 124 ARG A NE    1 
ATOM   984  C CZ    . ARG A 1 144 ? 3.959   15.844  92.454  1.00 42.70  ? 124 ARG A CZ    1 
ATOM   985  N NH1   . ARG A 1 144 ? 3.838   16.172  91.175  1.00 44.38  ? 124 ARG A NH1   1 
ATOM   986  N NH2   . ARG A 1 144 ? 3.830   16.777  93.388  1.00 42.42  ? 124 ARG A NH2   1 
ATOM   987  N N     . TYR A 1 145 ? 5.382   9.855   94.741  1.00 42.00  ? 125 TYR A N     1 
ATOM   988  C CA    . TYR A 1 145 ? 6.545   9.816   95.616  1.00 42.61  ? 125 TYR A CA    1 
ATOM   989  C C     . TYR A 1 145 ? 7.776   10.347  94.898  1.00 44.87  ? 125 TYR A C     1 
ATOM   990  O O     . TYR A 1 145 ? 7.860   10.294  93.672  1.00 45.82  ? 125 TYR A O     1 
ATOM   991  C CB    . TYR A 1 145 ? 6.822   8.392   96.103  1.00 42.95  ? 125 TYR A CB    1 
ATOM   992  C CG    . TYR A 1 145 ? 5.639   7.677   96.712  1.00 42.50  ? 125 TYR A CG    1 
ATOM   993  C CD1   . TYR A 1 145 ? 4.786   6.914   95.925  1.00 42.99  ? 125 TYR A CD1   1 
ATOM   994  C CD2   . TYR A 1 145 ? 5.389   7.743   98.076  1.00 42.06  ? 125 TYR A CD2   1 
ATOM   995  C CE1   . TYR A 1 145 ? 3.709   6.249   96.477  1.00 42.46  ? 125 TYR A CE1   1 
ATOM   996  C CE2   . TYR A 1 145 ? 4.313   7.080   98.638  1.00 41.35  ? 125 TYR A CE2   1 
ATOM   997  C CZ    . TYR A 1 145 ? 3.478   6.335   97.833  1.00 41.77  ? 125 TYR A CZ    1 
ATOM   998  O OH    . TYR A 1 145 ? 2.407   5.672   98.383  1.00 42.08  ? 125 TYR A OH    1 
ATOM   999  N N     . ASN A 1 146 ? 8.733   10.858  95.664  1.00 46.57  ? 126 ASN A N     1 
ATOM   1000 C CA    . ASN A 1 146 ? 10.048  11.139  95.114  1.00 50.87  ? 126 ASN A CA    1 
ATOM   1001 C C     . ASN A 1 146 ? 10.896  9.876   95.216  1.00 53.41  ? 126 ASN A C     1 
ATOM   1002 O O     . ASN A 1 146 ? 10.407  8.835   95.659  1.00 52.77  ? 126 ASN A O     1 
ATOM   1003 C CB    . ASN A 1 146 ? 10.713  12.320  95.832  1.00 52.20  ? 126 ASN A CB    1 
ATOM   1004 C CG    . ASN A 1 146 ? 10.728  12.165  97.343  1.00 51.94  ? 126 ASN A CG    1 
ATOM   1005 O OD1   . ASN A 1 146 ? 10.719  11.054  97.872  1.00 51.73  ? 126 ASN A OD1   1 
ATOM   1006 N ND2   . ASN A 1 146 ? 10.756  13.291  98.047  1.00 52.49  ? 126 ASN A ND2   1 
ATOM   1007 N N     . LEU A 1 147 ? 12.158  9.958   94.811  1.00 55.68  ? 127 LEU A N     1 
ATOM   1008 C CA    . LEU A 1 147 ? 13.033  8.793   94.853  1.00 58.88  ? 127 LEU A CA    1 
ATOM   1009 C C     . LEU A 1 147 ? 13.490  8.484   96.276  1.00 61.75  ? 127 LEU A C     1 
ATOM   1010 O O     . LEU A 1 147 ? 14.087  7.439   96.531  1.00 64.06  ? 127 LEU A O     1 
ATOM   1011 C CB    . LEU A 1 147 ? 14.243  8.999   93.940  1.00 61.63  ? 127 LEU A CB    1 
ATOM   1012 C CG    . LEU A 1 147 ? 13.926  8.975   92.443  1.00 61.15  ? 127 LEU A CG    1 
ATOM   1013 C CD1   . LEU A 1 147 ? 15.178  9.229   91.619  1.00 64.32  ? 127 LEU A CD1   1 
ATOM   1014 C CD2   . LEU A 1 147 ? 13.287  7.647   92.060  1.00 60.05  ? 127 LEU A CD2   1 
ATOM   1015 N N     . ARG A 1 148 ? 13.202  9.396   97.199  1.00 62.11  ? 128 ARG A N     1 
ATOM   1016 C CA    . ARG A 1 148 ? 13.534  9.193   98.604  1.00 63.56  ? 128 ARG A CA    1 
ATOM   1017 C C     . ARG A 1 148 ? 12.421  8.423   99.311  1.00 60.78  ? 128 ARG A C     1 
ATOM   1018 O O     . ARG A 1 148 ? 12.509  8.141   100.506 1.00 62.06  ? 128 ARG A O     1 
ATOM   1019 C CB    . ARG A 1 148 ? 13.779  10.535  99.300  1.00 65.24  ? 128 ARG A CB    1 
ATOM   1020 C CG    . ARG A 1 148 ? 14.804  11.416  98.602  1.00 67.87  ? 128 ARG A CG    1 
ATOM   1021 C CD    . ARG A 1 148 ? 15.142  12.648  99.428  1.00 70.40  ? 128 ARG A CD    1 
ATOM   1022 N NE    . ARG A 1 148 ? 16.112  13.505  98.751  1.00 73.81  ? 128 ARG A NE    1 
ATOM   1023 C CZ    . ARG A 1 148 ? 16.727  14.537  99.321  1.00 77.01  ? 128 ARG A CZ    1 
ATOM   1024 N NH1   . ARG A 1 148 ? 16.480  14.844  100.587 1.00 78.00  ? 128 ARG A NH1   1 
ATOM   1025 N NH2   . ARG A 1 148 ? 17.595  15.260  98.626  1.00 79.47  ? 128 ARG A NH2   1 
ATOM   1026 N N     . GLY A 1 149 ? 11.375  8.088   98.562  1.00 57.43  ? 129 GLY A N     1 
ATOM   1027 C CA    . GLY A 1 149 ? 10.256  7.332   99.094  1.00 54.70  ? 129 GLY A CA    1 
ATOM   1028 C C     . GLY A 1 149 ? 9.257   8.192   99.846  1.00 52.74  ? 129 GLY A C     1 
ATOM   1029 O O     . GLY A 1 149 ? 8.436   7.681   100.609 1.00 52.22  ? 129 GLY A O     1 
ATOM   1030 N N     . GLU A 1 150 ? 9.321   9.500   99.625  1.00 51.81  ? 130 GLU A N     1 
ATOM   1031 C CA    . GLU A 1 150 ? 8.463   10.438  100.341 1.00 50.41  ? 130 GLU A CA    1 
ATOM   1032 C C     . GLU A 1 150 ? 7.263   10.886  99.511  1.00 45.38  ? 130 GLU A C     1 
ATOM   1033 O O     . GLU A 1 150 ? 7.402   11.269  98.351  1.00 44.90  ? 130 GLU A O     1 
ATOM   1034 C CB    . GLU A 1 150 ? 9.272   11.659  100.783 1.00 54.81  ? 130 GLU A CB    1 
ATOM   1035 C CG    . GLU A 1 150 ? 10.419  11.330  101.723 1.00 60.09  ? 130 GLU A CG    1 
ATOM   1036 C CD    . GLU A 1 150 ? 11.282  12.537  102.035 1.00 64.98  ? 130 GLU A CD    1 
ATOM   1037 O OE1   . GLU A 1 150 ? 11.172  13.551  101.314 1.00 65.30  ? 130 GLU A OE1   1 
ATOM   1038 O OE2   . GLU A 1 150 ? 12.069  12.472  103.003 1.00 69.06  ? 130 GLU A OE2   1 
ATOM   1039 N N     . PHE A 1 151 ? 6.086   10.830  100.125 1.00 41.87  ? 131 PHE A N     1 
ATOM   1040 C CA    . PHE A 1 151 ? 4.849   11.312  99.519  1.00 38.15  ? 131 PHE A CA    1 
ATOM   1041 C C     . PHE A 1 151 ? 4.911   12.830  99.359  1.00 37.11  ? 131 PHE A C     1 
ATOM   1042 O O     . PHE A 1 151 ? 5.047   13.554  100.346 1.00 38.08  ? 131 PHE A O     1 
ATOM   1043 C CB    . PHE A 1 151 ? 3.655   10.899  100.385 1.00 37.33  ? 131 PHE A CB    1 
ATOM   1044 C CG    . PHE A 1 151 ? 2.315   11.215  99.785  1.00 36.21  ? 131 PHE A CG    1 
ATOM   1045 C CD1   . PHE A 1 151 ? 1.669   10.294  98.977  1.00 35.35  ? 131 PHE A CD1   1 
ATOM   1046 C CD2   . PHE A 1 151 ? 1.686   12.419  100.054 1.00 36.75  ? 131 PHE A CD2   1 
ATOM   1047 C CE1   . PHE A 1 151 ? 0.429   10.574  98.434  1.00 34.71  ? 131 PHE A CE1   1 
ATOM   1048 C CE2   . PHE A 1 151 ? 0.446   12.706  99.515  1.00 36.62  ? 131 PHE A CE2   1 
ATOM   1049 C CZ    . PHE A 1 151 ? -0.183  11.782  98.704  1.00 35.51  ? 131 PHE A CZ    1 
ATOM   1050 N N     . ASN A 1 152 ? 4.814   13.314  98.123  1.00 35.69  ? 132 ASN A N     1 
ATOM   1051 C CA    . ASN A 1 152 ? 4.991   14.742  97.864  1.00 36.86  ? 132 ASN A CA    1 
ATOM   1052 C C     . ASN A 1 152 ? 3.882   15.375  97.023  1.00 36.34  ? 132 ASN A C     1 
ATOM   1053 O O     . ASN A 1 152 ? 4.143   16.244  96.190  1.00 36.90  ? 132 ASN A O     1 
ATOM   1054 C CB    . ASN A 1 152 ? 6.347   14.984  97.191  1.00 38.24  ? 132 ASN A CB    1 
ATOM   1055 C CG    . ASN A 1 152 ? 6.444   14.349  95.816  1.00 37.82  ? 132 ASN A CG    1 
ATOM   1056 O OD1   . ASN A 1 152 ? 5.592   13.552  95.424  1.00 37.52  ? 132 ASN A OD1   1 
ATOM   1057 N ND2   . ASN A 1 152 ? 7.492   14.697  95.078  1.00 39.18  ? 132 ASN A ND2   1 
ATOM   1058 N N     . VAL A 1 153 ? 2.646   14.942  97.248  1.00 34.77  ? 133 VAL A N     1 
ATOM   1059 C CA    . VAL A 1 153 ? 1.491   15.533  96.580  1.00 34.44  ? 133 VAL A CA    1 
ATOM   1060 C C     . VAL A 1 153 ? 1.025   16.771  97.342  1.00 34.64  ? 133 VAL A C     1 
ATOM   1061 O O     . VAL A 1 153 ? 0.809   16.709  98.551  1.00 36.39  ? 133 VAL A O     1 
ATOM   1062 C CB    . VAL A 1 153 ? 0.329   14.525  96.463  1.00 32.57  ? 133 VAL A CB    1 
ATOM   1063 C CG1   . VAL A 1 153 ? -0.916  15.191  95.893  1.00 32.36  ? 133 VAL A CG1   1 
ATOM   1064 C CG2   . VAL A 1 153 ? 0.744   13.335  95.609  1.00 32.31  ? 133 VAL A CG2   1 
ATOM   1065 N N     . PRO A 1 154 ? 0.878   17.904  96.636  1.00 35.54  ? 134 PRO A N     1 
ATOM   1066 C CA    . PRO A 1 154 ? 0.477   19.164  97.275  1.00 37.33  ? 134 PRO A CA    1 
ATOM   1067 C C     . PRO A 1 154 ? -0.971  19.162  97.768  1.00 39.00  ? 134 PRO A C     1 
ATOM   1068 O O     . PRO A 1 154 ? -1.730  18.239  97.474  1.00 37.39  ? 134 PRO A O     1 
ATOM   1069 C CB    . PRO A 1 154 ? 0.665   20.195  96.157  1.00 38.54  ? 134 PRO A CB    1 
ATOM   1070 C CG    . PRO A 1 154 ? 0.504   19.417  94.904  1.00 37.16  ? 134 PRO A CG    1 
ATOM   1071 C CD    . PRO A 1 154 ? 1.104   18.068  95.190  1.00 34.75  ? 134 PRO A CD    1 
ATOM   1072 N N     . PHE A 1 155 ? -1.332  20.201  98.515  1.00 41.57  ? 135 PHE A N     1 
ATOM   1073 C CA    . PHE A 1 155 ? -2.678  20.356  99.060  1.00 43.03  ? 135 PHE A CA    1 
ATOM   1074 C C     . PHE A 1 155 ? -3.712  20.510  97.945  1.00 43.96  ? 135 PHE A C     1 
ATOM   1075 O O     . PHE A 1 155 ? -3.498  21.253  96.988  1.00 45.61  ? 135 PHE A O     1 
ATOM   1076 C CB    . PHE A 1 155 ? -2.716  21.557  100.008 1.00 45.66  ? 135 PHE A CB    1 
ATOM   1077 C CG    . PHE A 1 155 ? -4.064  21.818  100.618 1.00 47.67  ? 135 PHE A CG    1 
ATOM   1078 C CD1   . PHE A 1 155 ? -4.748  20.815  101.285 1.00 46.51  ? 135 PHE A CD1   1 
ATOM   1079 C CD2   . PHE A 1 155 ? -4.634  23.079  100.548 1.00 50.87  ? 135 PHE A CD2   1 
ATOM   1080 C CE1   . PHE A 1 155 ? -5.985  21.061  101.854 1.00 48.29  ? 135 PHE A CE1   1 
ATOM   1081 C CE2   . PHE A 1 155 ? -5.868  23.331  101.116 1.00 53.03  ? 135 PHE A CE2   1 
ATOM   1082 C CZ    . PHE A 1 155 ? -6.545  22.320  101.769 1.00 51.71  ? 135 PHE A CZ    1 
ATOM   1083 N N     . GLY A 1 156 ? -4.831  19.802  98.075  1.00 43.58  ? 136 GLY A N     1 
ATOM   1084 C CA    . GLY A 1 156 ? -5.839  19.756  97.029  1.00 44.39  ? 136 GLY A CA    1 
ATOM   1085 C C     . GLY A 1 156 ? -6.836  20.898  97.040  1.00 48.17  ? 136 GLY A C     1 
ATOM   1086 O O     . GLY A 1 156 ? -7.414  21.228  96.004  1.00 50.63  ? 136 GLY A O     1 
ATOM   1087 N N     . ARG A 1 157 ? -7.043  21.492  98.212  1.00 49.85  ? 137 ARG A N     1 
ATOM   1088 C CA    . ARG A 1 157 ? -7.948  22.629  98.375  1.00 54.19  ? 137 ARG A CA    1 
ATOM   1089 C C     . ARG A 1 157 ? -9.370  22.336  97.896  1.00 55.62  ? 137 ARG A C     1 
ATOM   1090 O O     . ARG A 1 157 ? -9.910  23.052  97.053  1.00 58.50  ? 137 ARG A O     1 
ATOM   1091 C CB    . ARG A 1 157 ? -7.399  23.857  97.641  1.00 56.29  ? 137 ARG A CB    1 
ATOM   1092 N N     . TYR A 1 158 ? -9.970  21.280  98.436  1.00 54.17  ? 138 TYR A N     1 
ATOM   1093 C CA    . TYR A 1 158 ? -11.363 20.964  98.143  1.00 55.44  ? 138 TYR A CA    1 
ATOM   1094 C C     . TYR A 1 158 ? -12.280 21.700  99.108  1.00 58.20  ? 138 TYR A C     1 
ATOM   1095 O O     . TYR A 1 158 ? -11.852 22.115  100.184 1.00 58.59  ? 138 TYR A O     1 
ATOM   1096 C CB    . TYR A 1 158 ? -11.614 19.458  98.228  1.00 53.47  ? 138 TYR A CB    1 
ATOM   1097 C CG    . TYR A 1 158 ? -10.854 18.650  97.204  1.00 51.61  ? 138 TYR A CG    1 
ATOM   1098 C CD1   . TYR A 1 158 ? -9.638  18.060  97.521  1.00 48.95  ? 138 TYR A CD1   1 
ATOM   1099 C CD2   . TYR A 1 158 ? -11.352 18.477  95.920  1.00 52.92  ? 138 TYR A CD2   1 
ATOM   1100 C CE1   . TYR A 1 158 ? -8.940  17.321  96.588  1.00 47.41  ? 138 TYR A CE1   1 
ATOM   1101 C CE2   . TYR A 1 158 ? -10.661 17.740  94.980  1.00 51.18  ? 138 TYR A CE2   1 
ATOM   1102 C CZ    . TYR A 1 158 ? -9.455  17.164  95.320  1.00 48.82  ? 138 TYR A CZ    1 
ATOM   1103 O OH    . TYR A 1 158 ? -8.763  16.429  94.388  1.00 47.74  ? 138 TYR A OH    1 
ATOM   1104 N N     . LYS A 1 159 ? -13.541 21.857  98.719  1.00 60.51  ? 139 LYS A N     1 
ATOM   1105 C CA    . LYS A 1 159 ? -14.522 22.523  99.566  1.00 64.70  ? 139 LYS A CA    1 
ATOM   1106 C C     . LYS A 1 159 ? -14.785 21.716  100.832 1.00 63.84  ? 139 LYS A C     1 
ATOM   1107 O O     . LYS A 1 159 ? -14.732 22.247  101.941 1.00 66.10  ? 139 LYS A O     1 
ATOM   1108 C CB    . LYS A 1 159 ? -15.828 22.749  98.801  1.00 68.49  ? 139 LYS A CB    1 
ATOM   1109 N N     . LYS A 1 160 ? -15.062 20.428  100.658 1.00 60.93  ? 140 LYS A N     1 
ATOM   1110 C CA    . LYS A 1 160 ? -15.349 19.548  101.785 1.00 59.59  ? 140 LYS A CA    1 
ATOM   1111 C C     . LYS A 1 160 ? -15.116 18.087  101.415 1.00 55.52  ? 140 LYS A C     1 
ATOM   1112 O O     . LYS A 1 160 ? -16.008 17.429  100.881 1.00 56.02  ? 140 LYS A O     1 
ATOM   1113 C CB    . LYS A 1 160 ? -16.789 19.744  102.266 1.00 63.31  ? 140 LYS A CB    1 
ATOM   1114 N N     . PRO A 1 161 ? -13.906 17.580  101.693 1.00 52.36  ? 141 PRO A N     1 
ATOM   1115 C CA    . PRO A 1 161 ? -13.554 16.183  101.422 1.00 49.43  ? 141 PRO A CA    1 
ATOM   1116 C C     . PRO A 1 161 ? -14.470 15.202  102.148 1.00 50.46  ? 141 PRO A C     1 
ATOM   1117 O O     . PRO A 1 161 ? -14.782 15.390  103.324 1.00 51.72  ? 141 PRO A O     1 
ATOM   1118 C CB    . PRO A 1 161 ? -12.118 16.079  101.939 1.00 46.75  ? 141 PRO A CB    1 
ATOM   1119 C CG    . PRO A 1 161 ? -11.589 17.467  101.831 1.00 47.71  ? 141 PRO A CG    1 
ATOM   1120 C CD    . PRO A 1 161 ? -12.749 18.349  102.182 1.00 51.76  ? 141 PRO A CD    1 
ATOM   1121 N N     . TYR A 1 162 ? -14.891 14.164  101.435 1.00 50.25  ? 142 TYR A N     1 
ATOM   1122 C CA    . TYR A 1 162 ? -15.832 13.184  101.960 1.00 51.67  ? 142 TYR A CA    1 
ATOM   1123 C C     . TYR A 1 162 ? -15.128 12.075  102.737 1.00 49.31  ? 142 TYR A C     1 
ATOM   1124 O O     . TYR A 1 162 ? -14.119 11.535  102.287 1.00 46.82  ? 142 TYR A O     1 
ATOM   1125 C CB    . TYR A 1 162 ? -16.652 12.594  100.810 1.00 53.06  ? 142 TYR A CB    1 
ATOM   1126 C CG    . TYR A 1 162 ? -17.443 11.353  101.156 1.00 54.46  ? 142 TYR A CG    1 
ATOM   1127 C CD1   . TYR A 1 162 ? -18.491 11.401  102.066 1.00 57.60  ? 142 TYR A CD1   1 
ATOM   1128 C CD2   . TYR A 1 162 ? -17.154 10.136  100.553 1.00 52.86  ? 142 TYR A CD2   1 
ATOM   1129 C CE1   . TYR A 1 162 ? -19.219 10.267  102.377 1.00 59.10  ? 142 TYR A CE1   1 
ATOM   1130 C CE2   . TYR A 1 162 ? -17.878 8.999   100.855 1.00 54.40  ? 142 TYR A CE2   1 
ATOM   1131 C CZ    . TYR A 1 162 ? -18.908 9.069   101.768 1.00 57.76  ? 142 TYR A CZ    1 
ATOM   1132 O OH    . TYR A 1 162 ? -19.628 7.936   102.071 1.00 60.33  ? 142 TYR A OH    1 
ATOM   1133 N N     . PHE A 1 163 ? -15.662 11.750  103.910 1.00 50.51  ? 143 PHE A N     1 
ATOM   1134 C CA    . PHE A 1 163 ? -15.145 10.641  104.704 1.00 48.83  ? 143 PHE A CA    1 
ATOM   1135 C C     . PHE A 1 163 ? -15.916 9.366   104.380 1.00 48.74  ? 143 PHE A C     1 
ATOM   1136 O O     . PHE A 1 163 ? -17.084 9.232   104.745 1.00 51.04  ? 143 PHE A O     1 
ATOM   1137 C CB    . PHE A 1 163 ? -15.229 10.954  106.201 1.00 50.84  ? 143 PHE A CB    1 
ATOM   1138 C CG    . PHE A 1 163 ? -14.683 9.862   107.077 1.00 50.36  ? 143 PHE A CG    1 
ATOM   1139 C CD1   . PHE A 1 163 ? -13.335 9.543   107.048 1.00 47.71  ? 143 PHE A CD1   1 
ATOM   1140 C CD2   . PHE A 1 163 ? -15.515 9.157   107.930 1.00 53.31  ? 143 PHE A CD2   1 
ATOM   1141 C CE1   . PHE A 1 163 ? -12.827 8.538   107.851 1.00 47.88  ? 143 PHE A CE1   1 
ATOM   1142 C CE2   . PHE A 1 163 ? -15.013 8.151   108.738 1.00 53.31  ? 143 PHE A CE2   1 
ATOM   1143 C CZ    . PHE A 1 163 ? -13.667 7.841   108.697 1.00 50.59  ? 143 PHE A CZ    1 
ATOM   1144 N N     . PRO A 1 164 ? -15.258 8.422   103.689 1.00 46.50  ? 144 PRO A N     1 
ATOM   1145 C CA    . PRO A 1 164 ? -15.894 7.201   103.183 1.00 47.15  ? 144 PRO A CA    1 
ATOM   1146 C C     . PRO A 1 164 ? -16.097 6.139   104.257 1.00 48.57  ? 144 PRO A C     1 
ATOM   1147 O O     . PRO A 1 164 ? -15.555 5.043   104.136 1.00 47.63  ? 144 PRO A O     1 
ATOM   1148 C CB    . PRO A 1 164 ? -14.903 6.715   102.128 1.00 44.44  ? 144 PRO A CB    1 
ATOM   1149 C CG    . PRO A 1 164 ? -13.579 7.157   102.655 1.00 42.24  ? 144 PRO A CG    1 
ATOM   1150 C CD    . PRO A 1 164 ? -13.825 8.477   103.346 1.00 43.50  ? 144 PRO A CD    1 
ATOM   1151 N N     . GLU A 1 165 ? -16.877 6.458   105.284 1.00 50.76  ? 145 GLU A N     1 
ATOM   1152 C CA    . GLU A 1 165 ? -17.079 5.546   106.403 1.00 54.15  ? 145 GLU A CA    1 
ATOM   1153 C C     . GLU A 1 165 ? -17.783 4.260   105.974 1.00 55.54  ? 145 GLU A C     1 
ATOM   1154 O O     . GLU A 1 165 ? -17.357 3.163   106.336 1.00 55.97  ? 145 GLU A O     1 
ATOM   1155 C CB    . GLU A 1 165 ? -17.875 6.237   107.513 1.00 59.50  ? 145 GLU A CB    1 
ATOM   1156 C CG    . GLU A 1 165 ? -18.037 5.401   108.771 1.00 64.56  ? 145 GLU A CG    1 
ATOM   1157 C CD    . GLU A 1 165 ? -18.635 6.190   109.919 1.00 70.75  ? 145 GLU A CD    1 
ATOM   1158 O OE1   . GLU A 1 165 ? -19.222 5.567   110.830 1.00 75.48  ? 145 GLU A OE1   1 
ATOM   1159 O OE2   . GLU A 1 165 ? -18.515 7.434   109.913 1.00 71.22  ? 145 GLU A OE2   1 
ATOM   1160 N N     . ALA A 1 166 ? -18.855 4.400   105.200 1.00 56.58  ? 146 ALA A N     1 
ATOM   1161 C CA    . ALA A 1 166 ? -19.605 3.244   104.719 1.00 58.20  ? 146 ALA A CA    1 
ATOM   1162 C C     . ALA A 1 166 ? -18.750 2.379   103.798 1.00 55.38  ? 146 ALA A C     1 
ATOM   1163 O O     . ALA A 1 166 ? -18.754 1.152   103.904 1.00 56.41  ? 146 ALA A O     1 
ATOM   1164 C CB    . ALA A 1 166 ? -20.871 3.692   104.003 1.00 60.39  ? 146 ALA A CB    1 
ATOM   1165 N N     . GLU A 1 167 ? -18.015 3.027   102.900 1.00 52.71  ? 147 GLU A N     1 
ATOM   1166 C CA    . GLU A 1 167 ? -17.141 2.323   101.967 1.00 51.21  ? 147 GLU A CA    1 
ATOM   1167 C C     . GLU A 1 167 ? -16.020 1.590   102.701 1.00 49.58  ? 147 GLU A C     1 
ATOM   1168 O O     . GLU A 1 167 ? -15.531 0.562   102.233 1.00 49.95  ? 147 GLU A O     1 
ATOM   1169 C CB    . GLU A 1 167 ? -16.549 3.298   100.944 1.00 49.75  ? 147 GLU A CB    1 
ATOM   1170 C CG    . GLU A 1 167 ? -17.555 3.869   99.949  1.00 53.55  ? 147 GLU A CG    1 
ATOM   1171 C CD    . GLU A 1 167 ? -18.395 4.995   100.527 1.00 57.15  ? 147 GLU A CD    1 
ATOM   1172 O OE1   . GLU A 1 167 ? -18.196 5.350   101.709 1.00 56.48  ? 147 GLU A OE1   1 
ATOM   1173 O OE2   . GLU A 1 167 ? -19.257 5.529   99.796  1.00 60.82  ? 147 GLU A OE2   1 
ATOM   1174 N N     . LEU A 1 168 ? -15.619 2.124   103.850 1.00 48.47  ? 148 LEU A N     1 
ATOM   1175 C CA    . LEU A 1 168 ? -14.587 1.500   104.672 1.00 47.09  ? 148 LEU A CA    1 
ATOM   1176 C C     . LEU A 1 168 ? -15.077 0.197   105.297 1.00 50.35  ? 148 LEU A C     1 
ATOM   1177 O O     . LEU A 1 168 ? -14.404 -0.831  105.216 1.00 50.21  ? 148 LEU A O     1 
ATOM   1178 C CB    . LEU A 1 168 ? -14.121 2.461   105.767 1.00 46.81  ? 148 LEU A CB    1 
ATOM   1179 C CG    . LEU A 1 168 ? -13.026 3.456   105.379 1.00 43.98  ? 148 LEU A CG    1 
ATOM   1180 C CD1   . LEU A 1 168 ? -12.844 4.505   106.465 1.00 45.07  ? 148 LEU A CD1   1 
ATOM   1181 C CD2   . LEU A 1 168 ? -11.719 2.726   105.120 1.00 41.35  ? 148 LEU A CD2   1 
ATOM   1182 N N     . TYR A 1 169 ? -16.249 0.248   105.923 1.00 53.61  ? 149 TYR A N     1 
ATOM   1183 C CA    . TYR A 1 169 ? -16.818 -0.927  106.575 1.00 57.40  ? 149 TYR A CA    1 
ATOM   1184 C C     . TYR A 1 169 ? -17.175 -2.012  105.565 1.00 57.85  ? 149 TYR A C     1 
ATOM   1185 O O     . TYR A 1 169 ? -17.054 -3.201  105.856 1.00 60.50  ? 149 TYR A O     1 
ATOM   1186 C CB    . TYR A 1 169 ? -18.053 -0.545  107.393 1.00 62.30  ? 149 TYR A CB    1 
ATOM   1187 C CG    . TYR A 1 169 ? -17.730 0.079   108.732 1.00 63.62  ? 149 TYR A CG    1 
ATOM   1188 C CD1   . TYR A 1 169 ? -17.966 1.427   108.969 1.00 63.40  ? 149 TYR A CD1   1 
ATOM   1189 C CD2   . TYR A 1 169 ? -17.186 -0.681  109.758 1.00 65.56  ? 149 TYR A CD2   1 
ATOM   1190 C CE1   . TYR A 1 169 ? -17.672 1.999   110.195 1.00 64.94  ? 149 TYR A CE1   1 
ATOM   1191 C CE2   . TYR A 1 169 ? -16.888 -0.119  110.985 1.00 67.20  ? 149 TYR A CE2   1 
ATOM   1192 C CZ    . TYR A 1 169 ? -17.132 1.220   111.198 1.00 66.81  ? 149 TYR A CZ    1 
ATOM   1193 O OH    . TYR A 1 169 ? -16.836 1.782   112.419 1.00 68.81  ? 149 TYR A OH    1 
ATOM   1194 N N     . HIS A 1 170 ? -17.615 -1.600  104.380 1.00 55.77  ? 150 HIS A N     1 
ATOM   1195 C CA    . HIS A 1 170 ? -17.945 -2.552  103.326 1.00 56.37  ? 150 HIS A CA    1 
ATOM   1196 C C     . HIS A 1 170 ? -16.688 -3.235  102.799 1.00 53.00  ? 150 HIS A C     1 
ATOM   1197 O O     . HIS A 1 170 ? -16.712 -4.417  102.455 1.00 54.72  ? 150 HIS A O     1 
ATOM   1198 C CB    . HIS A 1 170 ? -18.683 -1.864  102.178 1.00 56.58  ? 150 HIS A CB    1 
ATOM   1199 C CG    . HIS A 1 170 ? -19.012 -2.781  101.042 1.00 58.72  ? 150 HIS A CG    1 
ATOM   1200 N ND1   . HIS A 1 170 ? -18.270 -2.823  99.879  1.00 56.03  ? 150 HIS A ND1   1 
ATOM   1201 C CD2   . HIS A 1 170 ? -19.993 -3.700  100.894 1.00 63.72  ? 150 HIS A CD2   1 
ATOM   1202 C CE1   . HIS A 1 170 ? -18.786 -3.722  99.064  1.00 59.23  ? 150 HIS A CE1   1 
ATOM   1203 N NE2   . HIS A 1 170 ? -19.833 -4.271  99.653  1.00 63.90  ? 150 HIS A NE2   1 
ATOM   1204 N N     . PHE A 1 171 ? -15.595 -2.481  102.732 1.00 48.37  ? 151 PHE A N     1 
ATOM   1205 C CA    . PHE A 1 171 ? -14.317 -3.031  102.303 1.00 46.32  ? 151 PHE A CA    1 
ATOM   1206 C C     . PHE A 1 171 ? -13.822 -4.056  103.314 1.00 47.32  ? 151 PHE A C     1 
ATOM   1207 O O     . PHE A 1 171 ? -13.332 -5.119  102.942 1.00 48.01  ? 151 PHE A O     1 
ATOM   1208 C CB    . PHE A 1 171 ? -13.276 -1.923  102.124 1.00 43.18  ? 151 PHE A CB    1 
ATOM   1209 C CG    . PHE A 1 171 ? -11.953 -2.413  101.603 1.00 41.95  ? 151 PHE A CG    1 
ATOM   1210 C CD1   . PHE A 1 171 ? -11.709 -2.465  100.241 1.00 41.92  ? 151 PHE A CD1   1 
ATOM   1211 C CD2   . PHE A 1 171 ? -10.956 -2.823  102.474 1.00 41.89  ? 151 PHE A CD2   1 
ATOM   1212 C CE1   . PHE A 1 171 ? -10.495 -2.916  99.756  1.00 40.41  ? 151 PHE A CE1   1 
ATOM   1213 C CE2   . PHE A 1 171 ? -9.741  -3.278  101.994 1.00 40.50  ? 151 PHE A CE2   1 
ATOM   1214 C CZ    . PHE A 1 171 ? -9.512  -3.325  100.633 1.00 39.51  ? 151 PHE A CZ    1 
ATOM   1215 N N     . ALA A 1 172 ? -13.955 -3.721  104.593 1.00 48.09  ? 152 ALA A N     1 
ATOM   1216 C CA    . ALA A 1 172 ? -13.483 -4.579  105.674 1.00 50.06  ? 152 ALA A CA    1 
ATOM   1217 C C     . ALA A 1 172 ? -14.222 -5.912  105.705 1.00 54.76  ? 152 ALA A C     1 
ATOM   1218 O O     . ALA A 1 172 ? -13.616 -6.958  105.936 1.00 55.27  ? 152 ALA A O     1 
ATOM   1219 C CB    . ALA A 1 172 ? -13.625 -3.868  107.007 1.00 51.21  ? 152 ALA A CB    1 
ATOM   1220 N N     . GLU A 1 173 ? -15.531 -5.868  105.475 1.00 59.06  ? 153 GLU A N     1 
ATOM   1221 C CA    . GLU A 1 173 ? -16.345 -7.078  105.469 1.00 65.65  ? 153 GLU A CA    1 
ATOM   1222 C C     . GLU A 1 173 ? -15.972 -7.990  104.304 1.00 64.75  ? 153 GLU A C     1 
ATOM   1223 O O     . GLU A 1 173 ? -15.872 -9.205  104.466 1.00 68.22  ? 153 GLU A O     1 
ATOM   1224 C CB    . GLU A 1 173 ? -17.834 -6.729  105.409 1.00 71.46  ? 153 GLU A CB    1 
ATOM   1225 C CG    . GLU A 1 173 ? -18.372 -6.078  106.676 1.00 76.08  ? 153 GLU A CG    1 
ATOM   1226 C CD    . GLU A 1 173 ? -19.878 -5.883  106.643 1.00 82.78  ? 153 GLU A CD    1 
ATOM   1227 O OE1   . GLU A 1 173 ? -20.506 -6.244  105.625 1.00 84.49  ? 153 GLU A OE1   1 
ATOM   1228 O OE2   . GLU A 1 173 ? -20.434 -5.369  107.636 1.00 86.59  ? 153 GLU A OE2   1 
ATOM   1229 N N     . LYS A 1 174 ? -15.760 -7.401  103.132 1.00 61.08  ? 154 LYS A N     1 
ATOM   1230 C CA    . LYS A 1 174 ? -15.381 -8.175  101.955 1.00 60.67  ? 154 LYS A CA    1 
ATOM   1231 C C     . LYS A 1 174 ? -13.936 -8.656  102.040 1.00 56.59  ? 154 LYS A C     1 
ATOM   1232 O O     . LYS A 1 174 ? -13.577 -9.672  101.444 1.00 57.14  ? 154 LYS A O     1 
ATOM   1233 C CB    . LYS A 1 174 ? -15.580 -7.353  100.679 1.00 59.40  ? 154 LYS A CB    1 
ATOM   1234 C CG    . LYS A 1 174 ? -17.032 -7.148  100.292 1.00 64.37  ? 154 LYS A CG    1 
ATOM   1235 C CD    . LYS A 1 174 ? -17.211 -7.251  98.787  1.00 65.58  ? 154 LYS A CD    1 
ATOM   1236 C CE    . LYS A 1 174 ? -16.761 -8.613  98.278  1.00 67.43  ? 154 LYS A CE    1 
ATOM   1237 N NZ    . LYS A 1 174 ? -16.911 -8.741  96.803  1.00 68.60  ? 154 LYS A NZ    1 
ATOM   1238 N N     . ALA A 1 175 ? -13.113 -7.925  102.785 1.00 52.71  ? 155 ALA A N     1 
ATOM   1239 C CA    . ALA A 1 175 ? -11.698 -8.256  102.914 1.00 49.97  ? 155 ALA A CA    1 
ATOM   1240 C C     . ALA A 1 175 ? -11.482 -9.517  103.746 1.00 53.61  ? 155 ALA A C     1 
ATOM   1241 O O     . ALA A 1 175 ? -10.396 -10.094 103.735 1.00 53.50  ? 155 ALA A O     1 
ATOM   1242 C CB    . ALA A 1 175 ? -10.935 -7.090  103.523 1.00 46.22  ? 155 ALA A CB    1 
ATOM   1243 N N     . GLN A 1 176 ? -12.519 -9.945  104.460 1.00 57.71  ? 156 GLN A N     1 
ATOM   1244 C CA    . GLN A 1 176 ? -12.432 -11.136 105.299 1.00 63.10  ? 156 GLN A CA    1 
ATOM   1245 C C     . GLN A 1 176 ? -12.243 -12.401 104.466 1.00 64.89  ? 156 GLN A C     1 
ATOM   1246 O O     . GLN A 1 176 ? -11.866 -13.449 104.990 1.00 68.36  ? 156 GLN A O     1 
ATOM   1247 C CB    . GLN A 1 176 ? -13.681 -11.264 106.175 1.00 69.41  ? 156 GLN A CB    1 
ATOM   1248 C CG    . GLN A 1 176 ? -13.860 -10.119 107.158 1.00 69.80  ? 156 GLN A CG    1 
ATOM   1249 C CD    . GLN A 1 176 ? -15.098 -10.273 108.020 1.00 77.38  ? 156 GLN A CD    1 
ATOM   1250 O OE1   . GLN A 1 176 ? -15.840 -11.248 107.893 1.00 83.09  ? 156 GLN A OE1   1 
ATOM   1251 N NE2   . GLN A 1 176 ? -15.326 -9.309  108.904 1.00 77.90  ? 156 GLN A NE2   1 
ATOM   1252 N N     . ASN A 1 177 ? -12.508 -12.296 103.168 1.00 63.45  ? 157 ASN A N     1 
ATOM   1253 C CA    . ASN A 1 177 ? -12.310 -13.409 102.248 1.00 65.69  ? 157 ASN A CA    1 
ATOM   1254 C C     . ASN A 1 177 ? -11.166 -13.132 101.279 1.00 59.57  ? 157 ASN A C     1 
ATOM   1255 O O     . ASN A 1 177 ? -11.065 -13.764 100.228 1.00 60.33  ? 157 ASN A O     1 
ATOM   1256 C CB    . ASN A 1 177 ? -13.593 -13.695 101.467 1.00 70.53  ? 157 ASN A CB    1 
ATOM   1257 C CG    . ASN A 1 177 ? -14.794 -13.898 102.369 1.00 76.93  ? 157 ASN A CG    1 
ATOM   1258 O OD1   . ASN A 1 177 ? -15.773 -13.153 102.296 1.00 77.96  ? 157 ASN A OD1   1 
ATOM   1259 N ND2   . ASN A 1 177 ? -14.726 -14.910 103.227 1.00 81.28  ? 157 ASN A ND2   1 
ATOM   1260 N N     . ALA A 1 178 ? -10.307 -12.184 101.635 1.00 54.40  ? 158 ALA A N     1 
ATOM   1261 C CA    . ALA A 1 178 ? -9.230  -11.767 100.745 1.00 50.32  ? 158 ALA A CA    1 
ATOM   1262 C C     . ALA A 1 178 ? -7.872  -11.750 101.434 1.00 49.66  ? 158 ALA A C     1 
ATOM   1263 O O     . ALA A 1 178 ? -7.767  -11.472 102.629 1.00 49.69  ? 158 ALA A O     1 
ATOM   1264 C CB    . ALA A 1 178 ? -9.535  -10.394 100.165 1.00 46.10  ? 158 ALA A CB    1 
ATOM   1265 N N     . PHE A 1 179 ? -6.832  -12.052 100.663 1.00 49.73  ? 159 PHE A N     1 
ATOM   1266 C CA    . PHE A 1 179 ? -5.460  -11.910 101.127 1.00 49.38  ? 159 PHE A CA    1 
ATOM   1267 C C     . PHE A 1 179 ? -4.777  -10.795 100.345 1.00 46.58  ? 159 PHE A C     1 
ATOM   1268 O O     . PHE A 1 179 ? -4.935  -10.694 99.127  1.00 46.33  ? 159 PHE A O     1 
ATOM   1269 C CB    . PHE A 1 179 ? -4.690  -13.224 100.975 1.00 52.59  ? 159 PHE A CB    1 
ATOM   1270 C CG    . PHE A 1 179 ? -5.115  -14.289 101.944 1.00 57.82  ? 159 PHE A CG    1 
ATOM   1271 C CD1   . PHE A 1 179 ? -5.562  -13.953 103.211 1.00 58.85  ? 159 PHE A CD1   1 
ATOM   1272 C CD2   . PHE A 1 179 ? -5.071  -15.627 101.587 1.00 61.98  ? 159 PHE A CD2   1 
ATOM   1273 C CE1   . PHE A 1 179 ? -5.955  -14.932 104.105 1.00 63.71  ? 159 PHE A CE1   1 
ATOM   1274 C CE2   . PHE A 1 179 ? -5.462  -16.609 102.476 1.00 66.98  ? 159 PHE A CE2   1 
ATOM   1275 C CZ    . PHE A 1 179 ? -5.905  -16.260 103.737 1.00 67.95  ? 159 PHE A CZ    1 
ATOM   1276 N N     . PHE A 1 180 ? -4.028  -9.955  101.051 1.00 44.85  ? 160 PHE A N     1 
ATOM   1277 C CA    . PHE A 1 180 ? -3.351  -8.822  100.432 1.00 41.97  ? 160 PHE A CA    1 
ATOM   1278 C C     . PHE A 1 180 ? -1.839  -9.011  100.428 1.00 42.13  ? 160 PHE A C     1 
ATOM   1279 O O     . PHE A 1 180 ? -1.231  -9.247  101.472 1.00 43.49  ? 160 PHE A O     1 
ATOM   1280 C CB    . PHE A 1 180 ? -3.712  -7.523  101.154 1.00 40.37  ? 160 PHE A CB    1 
ATOM   1281 C CG    . PHE A 1 180 ? -5.179  -7.199  101.124 1.00 40.49  ? 160 PHE A CG    1 
ATOM   1282 C CD1   . PHE A 1 180 ? -6.011  -7.597  102.157 1.00 42.69  ? 160 PHE A CD1   1 
ATOM   1283 C CD2   . PHE A 1 180 ? -5.725  -6.495  100.064 1.00 39.29  ? 160 PHE A CD2   1 
ATOM   1284 C CE1   . PHE A 1 180 ? -7.359  -7.299  102.134 1.00 43.84  ? 160 PHE A CE1   1 
ATOM   1285 C CE2   . PHE A 1 180 ? -7.073  -6.194  100.034 1.00 40.87  ? 160 PHE A CE2   1 
ATOM   1286 C CZ    . PHE A 1 180 ? -7.892  -6.597  101.070 1.00 43.10  ? 160 PHE A CZ    1 
ATOM   1287 N N     . TYR A 1 181 ? -1.238  -8.904  99.249  1.00 41.65  ? 161 TYR A N     1 
ATOM   1288 C CA    . TYR A 1 181 ? 0.204   -9.060  99.109  1.00 42.48  ? 161 TYR A CA    1 
ATOM   1289 C C     . TYR A 1 181 ? 0.827   -7.869  98.397  1.00 41.19  ? 161 TYR A C     1 
ATOM   1290 O O     . TYR A 1 181 ? 0.285   -7.370  97.413  1.00 41.25  ? 161 TYR A O     1 
ATOM   1291 C CB    . TYR A 1 181 ? 0.538   -10.340 98.343  1.00 45.59  ? 161 TYR A CB    1 
ATOM   1292 C CG    . TYR A 1 181 ? -0.010  -11.598 98.968  1.00 48.37  ? 161 TYR A CG    1 
ATOM   1293 C CD1   . TYR A 1 181 ? -1.122  -12.232 98.433  1.00 49.25  ? 161 TYR A CD1   1 
ATOM   1294 C CD2   . TYR A 1 181 ? 0.586   -12.154 100.092 1.00 50.89  ? 161 TYR A CD2   1 
ATOM   1295 C CE1   . TYR A 1 181 ? -1.626  -13.385 99.000  1.00 52.43  ? 161 TYR A CE1   1 
ATOM   1296 C CE2   . TYR A 1 181 ? 0.088   -13.307 100.666 1.00 53.57  ? 161 TYR A CE2   1 
ATOM   1297 C CZ    . TYR A 1 181 ? -1.018  -13.918 100.116 1.00 54.17  ? 161 TYR A CZ    1 
ATOM   1298 O OH    . TYR A 1 181 ? -1.519  -15.066 100.683 1.00 57.85  ? 161 TYR A OH    1 
ATOM   1299 N N     . CYS A 1 182 ? 1.970   -7.415  98.896  1.00 41.33  ? 162 CYS A N     1 
ATOM   1300 C CA    . CYS A 1 182 ? 2.726   -6.378  98.213  1.00 40.22  ? 162 CYS A CA    1 
ATOM   1301 C C     . CYS A 1 182 ? 3.837   -7.012  97.388  1.00 42.69  ? 162 CYS A C     1 
ATOM   1302 O O     . CYS A 1 182 ? 4.898   -7.352  97.913  1.00 43.32  ? 162 CYS A O     1 
ATOM   1303 C CB    . CYS A 1 182 ? 3.309   -5.375  99.206  1.00 39.16  ? 162 CYS A CB    1 
ATOM   1304 S SG    . CYS A 1 182 ? 4.263   -4.064  98.416  1.00 51.25  ? 162 CYS A SG    1 
ATOM   1305 N N     . GLU A 1 183 ? 3.582   -7.174  96.094  1.00 47.82  ? 163 GLU A N     1 
ATOM   1306 C CA    . GLU A 1 183 ? 4.525   -7.831  95.199  1.00 49.08  ? 163 GLU A CA    1 
ATOM   1307 C C     . GLU A 1 183 ? 4.212   -7.498  93.745  1.00 48.77  ? 163 GLU A C     1 
ATOM   1308 O O     . GLU A 1 183 ? 3.141   -6.977  93.436  1.00 47.56  ? 163 GLU A O     1 
ATOM   1309 C CB    . GLU A 1 183 ? 4.496   -9.344  95.417  1.00 51.51  ? 163 GLU A CB    1 
ATOM   1310 C CG    . GLU A 1 183 ? 3.119   -9.964  95.239  1.00 52.53  ? 163 GLU A CG    1 
ATOM   1311 C CD    . GLU A 1 183 ? 3.046   -11.385 95.760  1.00 55.73  ? 163 GLU A CD    1 
ATOM   1312 O OE1   . GLU A 1 183 ? 3.961   -11.795 96.507  1.00 58.00  ? 163 GLU A OE1   1 
ATOM   1313 O OE2   . GLU A 1 183 ? 2.072   -12.093 95.425  1.00 56.38  ? 163 GLU A OE2   1 
ATOM   1314 N N     . SER A 1 184 ? 5.151   -7.801  92.856  1.00 50.24  ? 164 SER A N     1 
ATOM   1315 C CA    . SER A 1 184 ? 4.972   -7.531  91.435  1.00 50.94  ? 164 SER A CA    1 
ATOM   1316 C C     . SER A 1 184 ? 4.005   -8.536  90.818  1.00 51.99  ? 164 SER A C     1 
ATOM   1317 O O     . SER A 1 184 ? 3.728   -9.581  91.406  1.00 53.01  ? 164 SER A O     1 
ATOM   1318 C CB    . SER A 1 184 ? 6.317   -7.566  90.707  1.00 53.16  ? 164 SER A CB    1 
ATOM   1319 O OG    . SER A 1 184 ? 6.199   -7.042  89.396  1.00 54.49  ? 164 SER A OG    1 
ATOM   1320 N N     . TYR A 1 185 ? 3.499   -8.214  89.631  1.00 52.19  ? 165 TYR A N     1 
ATOM   1321 C CA    . TYR A 1 185 ? 2.477   -9.026  88.975  1.00 53.78  ? 165 TYR A CA    1 
ATOM   1322 C C     . TYR A 1 185 ? 2.934   -10.459 88.715  1.00 57.31  ? 165 TYR A C     1 
ATOM   1323 O O     . TYR A 1 185 ? 2.142   -11.394 88.816  1.00 58.55  ? 165 TYR A O     1 
ATOM   1324 C CB    . TYR A 1 185 ? 2.043   -8.374  87.658  1.00 53.94  ? 165 TYR A CB    1 
ATOM   1325 C CG    . TYR A 1 185 ? 3.154   -8.213  86.643  1.00 55.95  ? 165 TYR A CG    1 
ATOM   1326 C CD1   . TYR A 1 185 ? 3.372   -9.174  85.663  1.00 58.91  ? 165 TYR A CD1   1 
ATOM   1327 C CD2   . TYR A 1 185 ? 3.982   -7.098  86.661  1.00 55.50  ? 165 TYR A CD2   1 
ATOM   1328 C CE1   . TYR A 1 185 ? 4.385   -9.032  84.735  1.00 60.81  ? 165 TYR A CE1   1 
ATOM   1329 C CE2   . TYR A 1 185 ? 4.998   -6.947  85.736  1.00 57.63  ? 165 TYR A CE2   1 
ATOM   1330 C CZ    . TYR A 1 185 ? 5.194   -7.916  84.776  1.00 60.33  ? 165 TYR A CZ    1 
ATOM   1331 O OH    . TYR A 1 185 ? 6.204   -7.770  83.853  1.00 63.25  ? 165 TYR A OH    1 
ATOM   1332 N N     . ALA A 1 186 ? 4.211   -10.628 88.386  1.00 59.06  ? 166 ALA A N     1 
ATOM   1333 C CA    . ALA A 1 186 ? 4.752   -11.949 88.084  1.00 62.99  ? 166 ALA A CA    1 
ATOM   1334 C C     . ALA A 1 186 ? 4.655   -12.880 89.289  1.00 65.00  ? 166 ALA A C     1 
ATOM   1335 O O     . ALA A 1 186 ? 4.393   -14.073 89.143  1.00 67.68  ? 166 ALA A O     1 
ATOM   1336 C CB    . ALA A 1 186 ? 6.196   -11.836 87.618  1.00 64.01  ? 166 ALA A CB    1 
ATOM   1337 N N     . ASP A 1 187 ? 4.857   -12.322 90.478  1.00 64.34  ? 167 ASP A N     1 
ATOM   1338 C CA    . ASP A 1 187 ? 4.841   -13.105 91.708  1.00 65.95  ? 167 ASP A CA    1 
ATOM   1339 C C     . ASP A 1 187 ? 3.423   -13.406 92.189  1.00 64.51  ? 167 ASP A C     1 
ATOM   1340 O O     . ASP A 1 187 ? 3.189   -14.414 92.854  1.00 66.76  ? 167 ASP A O     1 
ATOM   1341 C CB    . ASP A 1 187 ? 5.616   -12.377 92.808  1.00 66.63  ? 167 ASP A CB    1 
ATOM   1342 C CG    . ASP A 1 187 ? 7.080   -12.191 92.462  1.00 69.53  ? 167 ASP A CG    1 
ATOM   1343 O OD1   . ASP A 1 187 ? 7.665   -13.099 91.836  1.00 72.63  ? 167 ASP A OD1   1 
ATOM   1344 O OD2   . ASP A 1 187 ? 7.646   -11.134 92.815  1.00 69.10  ? 167 ASP A OD2   1 
ATOM   1345 N N     . SER A 1 188 ? 2.480   -12.533 91.850  1.00 61.19  ? 168 SER A N     1 
ATOM   1346 C CA    . SER A 1 188 ? 1.103   -12.693 92.305  1.00 59.70  ? 168 SER A CA    1 
ATOM   1347 C C     . SER A 1 188 ? 0.305   -13.626 91.398  1.00 60.92  ? 168 SER A C     1 
ATOM   1348 O O     . SER A 1 188 ? -0.569  -14.356 91.864  1.00 62.08  ? 168 SER A O     1 
ATOM   1349 C CB    . SER A 1 188 ? 0.408   -11.333 92.394  1.00 56.71  ? 168 SER A CB    1 
ATOM   1350 O OG    . SER A 1 188 ? 0.345   -10.703 91.128  1.00 56.19  ? 168 SER A OG    1 
ATOM   1351 N N     . MET A 1 189 ? 0.608   -13.600 90.104  1.00 60.90  ? 169 MET A N     1 
ATOM   1352 C CA    . MET A 1 189 ? -0.083  -14.456 89.145  1.00 63.24  ? 169 MET A CA    1 
ATOM   1353 C C     . MET A 1 189 ? 0.338   -15.912 89.307  1.00 66.69  ? 169 MET A C     1 
ATOM   1354 O O     . MET A 1 189 ? -0.351  -16.821 88.845  1.00 69.75  ? 169 MET A O     1 
ATOM   1355 C CB    . MET A 1 189 ? 0.181   -13.985 87.714  1.00 62.86  ? 169 MET A CB    1 
ATOM   1356 C CG    . MET A 1 189 ? -0.380  -12.607 87.416  1.00 60.40  ? 169 MET A CG    1 
ATOM   1357 S SD    . MET A 1 189 ? -0.005  -12.013 85.757  1.00 75.58  ? 169 MET A SD    1 
ATOM   1358 C CE    . MET A 1 189 ? -1.140  -12.992 84.778  1.00 56.56  ? 169 MET A CE    1 
ATOM   1359 N N     . ALA A 1 190 ? 1.469   -16.127 89.972  1.00 66.51  ? 170 ALA A N     1 
ATOM   1360 C CA    . ALA A 1 190 ? 1.967   -17.474 90.225  1.00 69.80  ? 170 ALA A CA    1 
ATOM   1361 C C     . ALA A 1 190 ? 1.258   -18.110 91.418  1.00 71.02  ? 170 ALA A C     1 
ATOM   1362 O O     . ALA A 1 190 ? 1.530   -19.256 91.772  1.00 74.72  ? 170 ALA A O     1 
ATOM   1363 C CB    . ALA A 1 190 ? 3.471   -17.449 90.453  1.00 69.94  ? 170 ALA A CB    1 
ATOM   1364 N N     . ARG A 1 191 ? 0.374   -17.344 92.025  1.00 68.66  ? 171 ARG A N     1 
ATOM   1365 C CA    . ARG A 1 191 ? -0.433  -17.834 93.102  1.00 69.89  ? 171 ARG A CA    1 
ATOM   1366 C C     . ARG A 1 191 ? -1.695  -18.437 92.583  1.00 71.97  ? 171 ARG A C     1 
ATOM   1367 O O     . ARG A 1 191 ? -2.397  -19.085 93.311  1.00 74.63  ? 171 ARG A O     1 
ATOM   1368 C CB    . ARG A 1 191 ? -0.777  -16.704 94.036  1.00 66.39  ? 171 ARG A CB    1 
ATOM   1369 C CG    . ARG A 1 191 ? 0.209   -16.578 95.149  1.00 64.76  ? 171 ARG A CG    1 
ATOM   1370 C CD    . ARG A 1 191 ? -0.110  -15.399 96.009  1.00 61.94  ? 171 ARG A CD    1 
ATOM   1371 N NE    . ARG A 1 191 ? 1.082   -14.689 96.405  1.00 60.28  ? 171 ARG A NE    1 
ATOM   1372 C CZ    . ARG A 1 191 ? 1.720   -14.915 97.525  1.00 61.79  ? 171 ARG A CZ    1 
ATOM   1373 N NH1   . ARG A 1 191 ? 1.292   -15.837 98.338  1.00 64.59  ? 171 ARG A NH1   1 
ATOM   1374 N NH2   . ARG A 1 191 ? 2.779   -14.222 97.823  1.00 61.19  ? 171 ARG A NH2   1 
ATOM   1375 N N     . ALA A 1 192 ? -2.012  -18.187 91.326  1.00 71.38  ? 172 ALA A N     1 
ATOM   1376 C CA    . ALA A 1 192 ? -3.234  -18.714 90.754  1.00 73.32  ? 172 ALA A CA    1 
ATOM   1377 C C     . ALA A 1 192 ? -3.155  -20.200 90.481  1.00 78.31  ? 172 ALA A C     1 
ATOM   1378 O O     . ALA A 1 192 ? -2.161  -20.694 89.988  1.00 79.25  ? 172 ALA A O     1 
ATOM   1379 C CB    . ALA A 1 192 ? -3.588  -17.977 89.489  1.00 71.20  ? 172 ALA A CB    1 
ATOM   1380 N N     . ASP A 1 193 ? -4.236  -20.890 90.781  1.00 81.95  ? 173 ASP A N     1 
ATOM   1381 C CA    . ASP A 1 193 ? -4.378  -22.287 90.440  1.00 87.89  ? 173 ASP A CA    1 
ATOM   1382 C C     . ASP A 1 193 ? -5.680  -22.509 89.672  1.00 89.87  ? 173 ASP A C     1 
ATOM   1383 O O     . ASP A 1 193 ? -6.324  -21.570 89.252  1.00 87.40  ? 173 ASP A O     1 
ATOM   1384 C CB    . ASP A 1 193 ? -4.267  -23.172 91.676  1.00 91.53  ? 173 ASP A CB    1 
ATOM   1385 C CG    . ASP A 1 193 ? -5.331  -22.891 92.677  1.00 90.61  ? 173 ASP A CG    1 
ATOM   1386 O OD1   . ASP A 1 193 ? -6.401  -22.434 92.277  1.00 88.88  ? 173 ASP A OD1   1 
ATOM   1387 O OD2   . ASP A 1 193 ? -5.103  -23.132 93.869  1.00 91.87  ? 173 ASP A OD2   1 
ATOM   1388 N N     . ASP A 1 194 ? -6.054  -23.758 89.484  1.00 94.59  ? 174 ASP A N     1 
ATOM   1389 C CA    . ASP A 1 194 ? -7.173  -24.122 88.626  1.00 97.05  ? 174 ASP A CA    1 
ATOM   1390 C C     . ASP A 1 194 ? -8.492  -23.528 89.066  1.00 94.97  ? 174 ASP A C     1 
ATOM   1391 O O     . ASP A 1 194 ? -9.296  -23.142 88.244  1.00 95.59  ? 174 ASP A O     1 
ATOM   1392 C CB    . ASP A 1 194 ? -7.288  -25.641 88.532  1.00 103.42 ? 174 ASP A CB    1 
ATOM   1393 N N     . SER A 1 195 ? -8.718  -23.454 90.358  1.00 92.67  ? 175 SER A N     1 
ATOM   1394 C CA    . SER A 1 195 ? -9.891  -22.771 90.875  1.00 90.62  ? 175 SER A CA    1 
ATOM   1395 C C     . SER A 1 195 ? -9.844  -21.241 90.686  1.00 83.72  ? 175 SER A C     1 
ATOM   1396 O O     . SER A 1 195 ? -10.819 -20.558 90.900  1.00 82.03  ? 175 SER A O     1 
ATOM   1397 C CB    . SER A 1 195 ? -10.094 -23.120 92.344  1.00 93.05  ? 175 SER A CB    1 
ATOM   1398 N N     . SER A 1 196 ? -8.673  -20.720 90.362  1.00 80.03  ? 176 SER A N     1 
ATOM   1399 C CA    . SER A 1 196 ? -8.455  -19.297 90.195  1.00 74.58  ? 176 SER A CA    1 
ATOM   1400 C C     . SER A 1 196 ? -8.917  -18.682 88.883  1.00 73.10  ? 176 SER A C     1 
ATOM   1401 O O     . SER A 1 196 ? -8.901  -19.299 87.852  1.00 74.72  ? 176 SER A O     1 
ATOM   1402 C CB    . SER A 1 196 ? -6.980  -18.981 90.393  1.00 72.12  ? 176 SER A CB    1 
ATOM   1403 O OG    . SER A 1 196 ? -6.595  -19.186 91.726  1.00 73.42  ? 176 SER A OG    1 
ATOM   1404 N N     . VAL A 1 197 ? -9.287  -17.419 88.950  1.00 70.38  ? 177 VAL A N     1 
ATOM   1405 C CA    . VAL A 1 197 ? -9.473  -16.583 87.771  1.00 69.61  ? 177 VAL A CA    1 
ATOM   1406 C C     . VAL A 1 197 ? -8.639  -15.317 87.936  1.00 65.69  ? 177 VAL A C     1 
ATOM   1407 O O     . VAL A 1 197 ? -8.634  -14.707 89.005  1.00 63.73  ? 177 VAL A O     1 
ATOM   1408 C CB    . VAL A 1 197 ? -10.955 -16.217 87.552  1.00 70.82  ? 177 VAL A CB    1 
ATOM   1409 C CG1   . VAL A 1 197 ? -11.112 -15.336 86.321  1.00 69.70  ? 177 VAL A CG1   1 
ATOM   1410 C CG2   . VAL A 1 197 ? -11.798 -17.476 87.417  1.00 75.76  ? 177 VAL A CG2   1 
ATOM   1411 N N     . VAL A 1 198 ? -7.924  -14.929 86.886  1.00 64.79  ? 178 VAL A N     1 
ATOM   1412 C CA    . VAL A 1 198 ? -7.019  -13.791 86.972  1.00 61.47  ? 178 VAL A CA    1 
ATOM   1413 C C     . VAL A 1 198 ? -7.507  -12.597 86.160  1.00 61.09  ? 178 VAL A C     1 
ATOM   1414 O O     . VAL A 1 198 ? -7.741  -12.705 84.956  1.00 62.68  ? 178 VAL A O     1 
ATOM   1415 C CB    . VAL A 1 198 ? -5.602  -14.168 86.495  1.00 61.02  ? 178 VAL A CB    1 
ATOM   1416 C CG1   . VAL A 1 198 ? -4.645  -13.004 86.698  1.00 57.60  ? 178 VAL A CG1   1 
ATOM   1417 C CG2   . VAL A 1 198 ? -5.108  -15.402 87.232  1.00 62.54  ? 178 VAL A CG2   1 
ATOM   1418 N N     . TYR A 1 199 ? -7.669  -11.459 86.826  1.00 59.42  ? 179 TYR A N     1 
ATOM   1419 C CA    . TYR A 1 199 ? -7.979  -10.213 86.134  1.00 59.04  ? 179 TYR A CA    1 
ATOM   1420 C C     . TYR A 1 199 ? -6.837  -9.217  86.278  1.00 56.99  ? 179 TYR A C     1 
ATOM   1421 O O     . TYR A 1 199 ? -6.455  -8.860  87.393  1.00 55.23  ? 179 TYR A O     1 
ATOM   1422 C CB    . TYR A 1 199 ? -9.271  -9.595  86.662  1.00 58.92  ? 179 TYR A CB    1 
ATOM   1423 C CG    . TYR A 1 199 ? -9.465  -8.166  86.208  1.00 58.20  ? 179 TYR A CG    1 
ATOM   1424 C CD1   . TYR A 1 199 ? -9.804  -7.875  84.893  1.00 59.95  ? 179 TYR A CD1   1 
ATOM   1425 C CD2   . TYR A 1 199 ? -9.289  -7.106  87.088  1.00 56.24  ? 179 TYR A CD2   1 
ATOM   1426 C CE1   . TYR A 1 199 ? -9.971  -6.569  84.470  1.00 59.70  ? 179 TYR A CE1   1 
ATOM   1427 C CE2   . TYR A 1 199 ? -9.453  -5.799  86.675  1.00 55.66  ? 179 TYR A CE2   1 
ATOM   1428 C CZ    . TYR A 1 199 ? -9.795  -5.535  85.366  1.00 57.70  ? 179 TYR A CZ    1 
ATOM   1429 O OH    . TYR A 1 199 ? -9.960  -4.232  84.954  1.00 57.93  ? 179 TYR A OH    1 
ATOM   1430 N N     . CYS A 1 200 ? -6.296  -8.774  85.149  1.00 57.96  ? 180 CYS A N     1 
ATOM   1431 C CA    . CYS A 1 200 ? -5.166  -7.859  85.158  1.00 57.18  ? 180 CYS A CA    1 
ATOM   1432 C C     . CYS A 1 200 ? -5.585  -6.467  84.697  1.00 57.88  ? 180 CYS A C     1 
ATOM   1433 O O     . CYS A 1 200 ? -6.247  -6.316  83.671  1.00 59.51  ? 180 CYS A O     1 
ATOM   1434 C CB    . CYS A 1 200 ? -4.046  -8.391  84.273  1.00 58.43  ? 180 CYS A CB    1 
ATOM   1435 S SG    . CYS A 1 200 ? -3.433  -10.003 84.796  1.00 73.86  ? 180 CYS A SG    1 
ATOM   1436 N N     . ASP A 1 201 ? -5.201  -5.453  85.469  1.00 56.86  ? 181 ASP A N     1 
ATOM   1437 C CA    . ASP A 1 201 ? -5.462  -4.056  85.114  1.00 57.34  ? 181 ASP A CA    1 
ATOM   1438 C C     . ASP A 1 201 ? -4.184  -3.238  85.216  1.00 55.72  ? 181 ASP A C     1 
ATOM   1439 O O     . ASP A 1 201 ? -4.053  -2.390  86.091  1.00 54.52  ? 181 ASP A O     1 
ATOM   1440 C CB    . ASP A 1 201 ? -6.553  -3.475  86.012  1.00 58.32  ? 181 ASP A CB    1 
ATOM   1441 C CG    . ASP A 1 201 ? -7.066  -2.125  85.528  1.00 60.76  ? 181 ASP A CG    1 
ATOM   1442 O OD1   . ASP A 1 201 ? -7.939  -1.539  86.209  1.00 60.98  ? 181 ASP A OD1   1 
ATOM   1443 O OD2   . ASP A 1 201 ? -6.599  -1.643  84.474  1.00 62.69  ? 181 ASP A OD2   1 
ATOM   1444 N N     . PRO A 1 202 ? -3.234  -3.496  84.302  1.00 56.33  ? 182 PRO A N     1 
ATOM   1445 C CA    . PRO A 1 202 ? -1.911  -2.870  84.354  1.00 55.60  ? 182 PRO A CA    1 
ATOM   1446 C C     . PRO A 1 202 ? -2.017  -1.395  84.023  1.00 55.24  ? 182 PRO A C     1 
ATOM   1447 O O     . PRO A 1 202 ? -3.049  -0.977  83.497  1.00 55.45  ? 182 PRO A O     1 
ATOM   1448 C CB    . PRO A 1 202 ? -1.118  -3.626  83.280  1.00 57.61  ? 182 PRO A CB    1 
ATOM   1449 C CG    . PRO A 1 202 ? -2.162  -4.021  82.299  1.00 59.09  ? 182 PRO A CG    1 
ATOM   1450 C CD    . PRO A 1 202 ? -3.411  -4.297  83.078  1.00 58.03  ? 182 PRO A CD    1 
ATOM   1451 N N     . PRO A 1 203 ? -0.987  -0.611  84.368  1.00 55.32  ? 183 PRO A N     1 
ATOM   1452 C CA    . PRO A 1 203 ? -0.931  0.793   83.958  1.00 56.62  ? 183 PRO A CA    1 
ATOM   1453 C C     . PRO A 1 203 ? -1.160  0.934   82.458  1.00 58.20  ? 183 PRO A C     1 
ATOM   1454 O O     . PRO A 1 203 ? -0.678  0.098   81.691  1.00 58.79  ? 183 PRO A O     1 
ATOM   1455 C CB    . PRO A 1 203 ? 0.487   1.206   84.340  1.00 57.50  ? 183 PRO A CB    1 
ATOM   1456 C CG    . PRO A 1 203 ? 0.806   0.355   85.516  1.00 55.77  ? 183 PRO A CG    1 
ATOM   1457 C CD    . PRO A 1 203 ? 0.118   -0.965  85.276  1.00 54.56  ? 183 PRO A CD    1 
ATOM   1458 N N     . TYR A 1 204 ? -1.877  1.977   82.053  1.00 59.37  ? 184 TYR A N     1 
ATOM   1459 C CA    . TYR A 1 204 ? -2.263  2.164   80.657  1.00 62.72  ? 184 TYR A CA    1 
ATOM   1460 C C     . TYR A 1 204 ? -1.081  2.178   79.691  1.00 64.80  ? 184 TYR A C     1 
ATOM   1461 O O     . TYR A 1 204 ? -0.011  2.699   80.006  1.00 65.14  ? 184 TYR A O     1 
ATOM   1462 C CB    . TYR A 1 204 ? -3.057  3.461   80.504  1.00 64.88  ? 184 TYR A CB    1 
ATOM   1463 C CG    . TYR A 1 204 ? -4.511  3.345   80.897  1.00 64.93  ? 184 TYR A CG    1 
ATOM   1464 C CD1   . TYR A 1 204 ? -5.128  4.334   81.651  1.00 64.40  ? 184 TYR A CD1   1 
ATOM   1465 C CD2   . TYR A 1 204 ? -5.272  2.252   80.500  1.00 65.84  ? 184 TYR A CD2   1 
ATOM   1466 C CE1   . TYR A 1 204 ? -6.458  4.235   82.009  1.00 64.27  ? 184 TYR A CE1   1 
ATOM   1467 C CE2   . TYR A 1 204 ? -6.603  2.145   80.852  1.00 65.87  ? 184 TYR A CE2   1 
ATOM   1468 C CZ    . TYR A 1 204 ? -7.191  3.139   81.606  1.00 65.22  ? 184 TYR A CZ    1 
ATOM   1469 O OH    . TYR A 1 204 ? -8.516  3.037   81.959  1.00 65.61  ? 184 TYR A OH    1 
ATOM   1470 N N     . ALA A 1 205 ? -1.288  1.596   78.515  1.00 66.44  ? 185 ALA A N     1 
ATOM   1471 C CA    . ALA A 1 205 ? -0.288  1.620   77.457  1.00 69.27  ? 185 ALA A CA    1 
ATOM   1472 C C     . ALA A 1 205 ? -0.236  3.006   76.822  1.00 72.04  ? 185 ALA A C     1 
ATOM   1473 O O     . ALA A 1 205 ? -1.261  3.682   76.728  1.00 71.86  ? 185 ALA A O     1 
ATOM   1474 C CB    . ALA A 1 205 ? -0.595  0.558   76.408  1.00 70.88  ? 185 ALA A CB    1 
ATOM   1475 N N     . PRO A 1 206 ? 0.962   3.437   76.396  1.00 74.85  ? 186 PRO A N     1 
ATOM   1476 C CA    . PRO A 1 206 ? 1.163   4.754   75.780  1.00 78.17  ? 186 PRO A CA    1 
ATOM   1477 C C     . PRO A 1 206 ? 0.257   5.003   74.576  1.00 81.15  ? 186 PRO A C     1 
ATOM   1478 O O     . PRO A 1 206 ? 0.039   4.104   73.765  1.00 82.29  ? 186 PRO A O     1 
ATOM   1479 C CB    . PRO A 1 206 ? 2.632   4.715   75.348  1.00 80.84  ? 186 PRO A CB    1 
ATOM   1480 C CG    . PRO A 1 206 ? 3.268   3.757   76.288  1.00 78.04  ? 186 PRO A CG    1 
ATOM   1481 C CD    . PRO A 1 206 ? 2.232   2.704   76.551  1.00 75.17  ? 186 PRO A CD    1 
ATOM   1482 N N     . LEU A 1 207 ? -0.267  6.220   74.475  1.00 82.78  ? 187 LEU A N     1 
ATOM   1483 C CA    . LEU A 1 207 ? -1.085  6.612   73.335  1.00 86.36  ? 187 LEU A CA    1 
ATOM   1484 C C     . LEU A 1 207 ? -0.218  7.277   72.273  1.00 91.54  ? 187 LEU A C     1 
ATOM   1485 O O     . LEU A 1 207 ? -0.687  7.596   71.180  1.00 95.37  ? 187 LEU A O     1 
ATOM   1486 C CB    . LEU A 1 207 ? -2.209  7.552   73.772  1.00 85.79  ? 187 LEU A CB    1 
ATOM   1487 N N     . SER A 1 208 ? 1.052   7.483   72.608  1.00 91.95  ? 188 SER A N     1 
ATOM   1488 C CA    . SER A 1 208 ? 2.005   8.100   71.693  1.00 97.09  ? 188 SER A CA    1 
ATOM   1489 C C     . SER A 1 208 ? 3.438   7.765   72.094  1.00 97.27  ? 188 SER A C     1 
ATOM   1490 O O     . SER A 1 208 ? 3.755   7.675   73.281  1.00 93.90  ? 188 SER A O     1 
ATOM   1491 C CB    . SER A 1 208 ? 1.809   9.617   71.655  1.00 99.78  ? 188 SER A CB    1 
ATOM   1492 N N     . SER A 1 220 ? 8.387   3.674   86.029  1.00 82.09  ? 200 SER A N     1 
ATOM   1493 C CA    . SER A 1 220 ? 6.982   3.408   85.740  1.00 80.66  ? 200 SER A CA    1 
ATOM   1494 C C     . SER A 1 220 ? 6.794   2.013   85.153  1.00 80.11  ? 200 SER A C     1 
ATOM   1495 O O     . SER A 1 220 ? 7.536   1.086   85.478  1.00 81.97  ? 200 SER A O     1 
ATOM   1496 C CB    . SER A 1 220 ? 6.424   4.462   84.782  1.00 83.04  ? 200 SER A CB    1 
ATOM   1497 N N     . PHE A 1 221 ? 5.796   1.872   84.286  1.00 77.30  ? 201 PHE A N     1 
ATOM   1498 C CA    . PHE A 1 221 ? 5.505   0.591   83.654  1.00 73.32  ? 201 PHE A CA    1 
ATOM   1499 C C     . PHE A 1 221 ? 6.000   0.587   82.211  1.00 73.41  ? 201 PHE A C     1 
ATOM   1500 O O     . PHE A 1 221 ? 5.448   1.274   81.352  1.00 74.24  ? 201 PHE A O     1 
ATOM   1501 C CB    . PHE A 1 221 ? 4.005   0.297   83.711  1.00 70.61  ? 201 PHE A CB    1 
ATOM   1502 C CG    . PHE A 1 221 ? 3.672   -1.167  83.712  1.00 68.75  ? 201 PHE A CG    1 
ATOM   1503 C CD1   . PHE A 1 221 ? 3.881   -1.935  84.845  1.00 66.42  ? 201 PHE A CD1   1 
ATOM   1504 C CD2   . PHE A 1 221 ? 3.140   -1.773  82.586  1.00 69.67  ? 201 PHE A CD2   1 
ATOM   1505 C CE1   . PHE A 1 221 ? 3.573   -3.282  84.853  1.00 66.22  ? 201 PHE A CE1   1 
ATOM   1506 C CE2   . PHE A 1 221 ? 2.829   -3.120  82.588  1.00 69.44  ? 201 PHE A CE2   1 
ATOM   1507 C CZ    . PHE A 1 221 ? 3.046   -3.875  83.724  1.00 67.77  ? 201 PHE A CZ    1 
ATOM   1508 N N     . THR A 1 222 ? 7.044   -0.194  81.952  1.00 72.43  ? 202 THR A N     1 
ATOM   1509 C CA    . THR A 1 222 ? 7.697   -0.201  80.647  1.00 73.94  ? 202 THR A CA    1 
ATOM   1510 C C     . THR A 1 222 ? 6.950   -1.049  79.622  1.00 73.52  ? 202 THR A C     1 
ATOM   1511 O O     . THR A 1 222 ? 6.011   -1.769  79.959  1.00 70.91  ? 202 THR A O     1 
ATOM   1512 C CB    . THR A 1 222 ? 9.143   -0.720  80.754  1.00 75.04  ? 202 THR A CB    1 
ATOM   1513 O OG1   . THR A 1 222 ? 9.132   -2.086  81.184  1.00 73.57  ? 202 THR A OG1   1 
ATOM   1514 C CG2   . THR A 1 222 ? 9.935   0.114   81.750  1.00 74.45  ? 202 THR A CG2   1 
ATOM   1515 N N     . LEU A 1 223 ? 7.382   -0.957  78.368  1.00 76.82  ? 203 LEU A N     1 
ATOM   1516 C CA    . LEU A 1 223 ? 6.782   -1.728  77.285  1.00 77.84  ? 203 LEU A CA    1 
ATOM   1517 C C     . LEU A 1 223 ? 7.101   -3.213  77.426  1.00 77.14  ? 203 LEU A C     1 
ATOM   1518 O O     . LEU A 1 223 ? 6.301   -4.068  77.046  1.00 76.74  ? 203 LEU A O     1 
ATOM   1519 C CB    . LEU A 1 223 ? 7.267   -1.216  75.927  1.00 82.15  ? 203 LEU A CB    1 
ATOM   1520 C CG    . LEU A 1 223 ? 6.976   0.251   75.602  1.00 83.35  ? 203 LEU A CG    1 
ATOM   1521 C CD1   . LEU A 1 223 ? 7.511   0.611   74.224  1.00 88.25  ? 203 LEU A CD1   1 
ATOM   1522 C CD2   . LEU A 1 223 ? 5.486   0.538   75.694  1.00 81.17  ? 203 LEU A CD2   1 
ATOM   1523 N N     . GLU A 1 224 ? 8.276   -3.510  77.974  1.00 77.14  ? 204 GLU A N     1 
ATOM   1524 C CA    . GLU A 1 224 ? 8.694   -4.890  78.191  1.00 77.23  ? 204 GLU A CA    1 
ATOM   1525 C C     . GLU A 1 224 ? 7.782   -5.583  79.197  1.00 73.50  ? 204 GLU A C     1 
ATOM   1526 O O     . GLU A 1 224 ? 7.416   -6.743  79.016  1.00 74.13  ? 204 GLU A O     1 
ATOM   1527 C CB    . GLU A 1 224 ? 10.147  -4.950  78.671  1.00 78.73  ? 204 GLU A CB    1 
ATOM   1528 C CG    . GLU A 1 224 ? 11.182  -4.570  77.619  1.00 83.22  ? 204 GLU A CG    1 
ATOM   1529 C CD    . GLU A 1 224 ? 11.290  -3.071  77.408  1.00 84.25  ? 204 GLU A CD    1 
ATOM   1530 O OE1   . GLU A 1 224 ? 10.677  -2.311  78.187  1.00 81.38  ? 204 GLU A OE1   1 
ATOM   1531 O OE2   . GLU A 1 224 ? 11.990  -2.653  76.462  1.00 88.34  ? 204 GLU A OE2   1 
ATOM   1532 N N     . GLN A 1 225 ? 7.418   -4.863  80.254  1.00 69.85  ? 205 GLN A N     1 
ATOM   1533 C CA    . GLN A 1 225 ? 6.529   -5.399  81.279  1.00 66.66  ? 205 GLN A CA    1 
ATOM   1534 C C     . GLN A 1 225 ? 5.128   -5.636  80.726  1.00 65.83  ? 205 GLN A C     1 
ATOM   1535 O O     . GLN A 1 225 ? 4.425   -6.547  81.162  1.00 64.95  ? 205 GLN A O     1 
ATOM   1536 C CB    . GLN A 1 225 ? 6.467   -4.458  82.484  1.00 64.12  ? 205 GLN A CB    1 
ATOM   1537 C CG    . GLN A 1 225 ? 7.779   -4.330  83.241  1.00 64.53  ? 205 GLN A CG    1 
ATOM   1538 C CD    . GLN A 1 225 ? 7.668   -3.422  84.450  1.00 62.62  ? 205 GLN A CD    1 
ATOM   1539 O OE1   . GLN A 1 225 ? 7.633   -2.198  84.322  1.00 62.91  ? 205 GLN A OE1   1 
ATOM   1540 N NE2   . GLN A 1 225 ? 7.608   -4.020  85.635  1.00 60.94  ? 205 GLN A NE2   1 
ATOM   1541 N N     . GLN A 1 226 ? 4.727   -4.807  79.767  1.00 66.54  ? 206 GLN A N     1 
ATOM   1542 C CA    . GLN A 1 226 ? 3.435   -4.961  79.108  1.00 66.12  ? 206 GLN A CA    1 
ATOM   1543 C C     . GLN A 1 226 ? 3.380   -6.269  78.324  1.00 68.46  ? 206 GLN A C     1 
ATOM   1544 O O     . GLN A 1 226 ? 2.426   -7.038  78.444  1.00 68.17  ? 206 GLN A O     1 
ATOM   1545 C CB    . GLN A 1 226 ? 3.162   -3.780  78.175  1.00 66.70  ? 206 GLN A CB    1 
ATOM   1546 C CG    . GLN A 1 226 ? 2.984   -2.441  78.875  1.00 64.32  ? 206 GLN A CG    1 
ATOM   1547 C CD    . GLN A 1 226 ? 1.572   -2.227  79.391  1.00 61.62  ? 206 GLN A CD    1 
ATOM   1548 O OE1   . GLN A 1 226 ? 0.753   -3.147  79.402  1.00 61.31  ? 206 GLN A OE1   1 
ATOM   1549 N NE2   . GLN A 1 226 ? 1.279   -1.004  79.817  1.00 59.84  ? 206 GLN A NE2   1 
ATOM   1550 N N     . ALA A 1 227 ? 4.412   -6.512  77.521  1.00 71.17  ? 207 ALA A N     1 
ATOM   1551 C CA    . ALA A 1 227 ? 4.494   -7.729  76.722  1.00 73.95  ? 207 ALA A CA    1 
ATOM   1552 C C     . ALA A 1 227 ? 4.726   -8.951  77.606  1.00 73.53  ? 207 ALA A C     1 
ATOM   1553 O O     . ALA A 1 227 ? 4.240   -10.042 77.310  1.00 74.89  ? 207 ALA A O     1 
ATOM   1554 C CB    . ALA A 1 227 ? 5.599   -7.608  75.684  1.00 77.19  ? 207 ALA A CB    1 
ATOM   1555 N N     . HIS A 1 228 ? 5.472   -8.757  78.690  1.00 72.28  ? 208 HIS A N     1 
ATOM   1556 C CA    . HIS A 1 228 ? 5.743   -9.830  79.641  1.00 72.19  ? 208 HIS A CA    1 
ATOM   1557 C C     . HIS A 1 228 ? 4.457   -10.284 80.319  1.00 69.76  ? 208 HIS A C     1 
ATOM   1558 O O     . HIS A 1 228 ? 4.264   -11.472 80.574  1.00 70.66  ? 208 HIS A O     1 
ATOM   1559 C CB    . HIS A 1 228 ? 6.761   -9.375  80.690  1.00 71.69  ? 208 HIS A CB    1 
ATOM   1560 C CG    . HIS A 1 228 ? 7.140   -10.443 81.671  1.00 72.73  ? 208 HIS A CG    1 
ATOM   1561 N ND1   . HIS A 1 228 ? 7.561   -10.157 82.950  1.00 71.16  ? 208 HIS A ND1   1 
ATOM   1562 C CD2   . HIS A 1 228 ? 7.168   -11.790 81.553  1.00 75.34  ? 208 HIS A CD2   1 
ATOM   1563 C CE1   . HIS A 1 228 ? 7.829   -11.288 83.584  1.00 72.30  ? 208 HIS A CE1   1 
ATOM   1564 N NE2   . HIS A 1 228 ? 7.599   -12.291 82.760  1.00 74.91  ? 208 HIS A NE2   1 
ATOM   1565 N N     . LEU A 1 229 ? 3.579   -9.328  80.607  1.00 66.88  ? 209 LEU A N     1 
ATOM   1566 C CA    . LEU A 1 229 ? 2.296   -9.627  81.229  1.00 64.88  ? 209 LEU A CA    1 
ATOM   1567 C C     . LEU A 1 229 ? 1.442   -10.505 80.323  1.00 67.56  ? 209 LEU A C     1 
ATOM   1568 O O     . LEU A 1 229 ? 0.762   -11.421 80.787  1.00 67.65  ? 209 LEU A O     1 
ATOM   1569 C CB    . LEU A 1 229 ? 1.549   -8.336  81.565  1.00 61.49  ? 209 LEU A CB    1 
ATOM   1570 C CG    . LEU A 1 229 ? 0.169   -8.519  82.195  1.00 59.89  ? 209 LEU A CG    1 
ATOM   1571 C CD1   . LEU A 1 229 ? 0.282   -9.247  83.521  1.00 58.82  ? 209 LEU A CD1   1 
ATOM   1572 C CD2   . LEU A 1 229 ? -0.509  -7.180  82.380  1.00 58.07  ? 209 LEU A CD2   1 
ATOM   1573 N N     . ALA A 1 230 ? 1.485   -10.218 79.026  1.00 70.33  ? 210 ALA A N     1 
ATOM   1574 C CA    . ALA A 1 230 ? 0.738   -10.991 78.044  1.00 73.74  ? 210 ALA A CA    1 
ATOM   1575 C C     . ALA A 1 230 ? 1.281   -12.413 77.941  1.00 77.22  ? 210 ALA A C     1 
ATOM   1576 O O     . ALA A 1 230 ? 0.521   -13.364 77.767  1.00 79.57  ? 210 ALA A O     1 
ATOM   1577 C CB    . ALA A 1 230 ? 0.778   -10.307 76.688  1.00 75.76  ? 210 ALA A CB    1 
ATOM   1578 N N     . GLU A 1 231 ? 2.599   -12.551 78.055  1.00 77.76  ? 211 GLU A N     1 
ATOM   1579 C CA    . GLU A 1 231 ? 3.241   -13.859 77.975  1.00 80.33  ? 211 GLU A CA    1 
ATOM   1580 C C     . GLU A 1 231 ? 2.908   -14.711 79.196  1.00 78.37  ? 211 GLU A C     1 
ATOM   1581 O O     . GLU A 1 231 ? 2.669   -15.913 79.077  1.00 81.03  ? 211 GLU A O     1 
ATOM   1582 C CB    . GLU A 1 231 ? 4.758   -13.711 77.837  1.00 82.35  ? 211 GLU A CB    1 
ATOM   1583 C CG    . GLU A 1 231 ? 5.490   -15.032 77.645  1.00 86.68  ? 211 GLU A CG    1 
ATOM   1584 C CD    . GLU A 1 231 ? 6.993   -14.860 77.536  1.00 88.84  ? 211 GLU A CD    1 
ATOM   1585 O OE1   . GLU A 1 231 ? 7.495   -13.770 77.882  1.00 86.87  ? 211 GLU A OE1   1 
ATOM   1586 O OE2   . GLU A 1 231 ? 7.671   -15.816 77.104  1.00 92.72  ? 211 GLU A OE2   1 
ATOM   1587 N N     . ILE A 1 232 ? 2.899   -14.082 80.368  1.00 73.87  ? 212 ILE A N     1 
ATOM   1588 C CA    . ILE A 1 232 ? 2.527   -14.764 81.602  1.00 72.15  ? 212 ILE A CA    1 
ATOM   1589 C C     . ILE A 1 232 ? 1.078   -15.234 81.517  1.00 71.40  ? 212 ILE A C     1 
ATOM   1590 O O     . ILE A 1 232 ? 0.738   -16.326 81.976  1.00 73.17  ? 212 ILE A O     1 
ATOM   1591 C CB    . ILE A 1 232 ? 2.714   -13.853 82.836  1.00 69.17  ? 212 ILE A CB    1 
ATOM   1592 C CG1   . ILE A 1 232 ? 4.195   -13.525 83.036  1.00 69.49  ? 212 ILE A CG1   1 
ATOM   1593 C CG2   . ILE A 1 232 ? 2.158   -14.512 84.088  1.00 68.58  ? 212 ILE A CG2   1 
ATOM   1594 C CD1   . ILE A 1 232 ? 4.478   -12.688 84.266  1.00 66.59  ? 212 ILE A CD1   1 
ATOM   1595 N N     . ALA A 1 233 ? 0.233   -14.407 80.909  1.00 69.24  ? 213 ALA A N     1 
ATOM   1596 C CA    . ALA A 1 233 ? -1.172  -14.744 80.712  1.00 69.19  ? 213 ALA A CA    1 
ATOM   1597 C C     . ALA A 1 233 ? -1.325  -15.991 79.847  1.00 73.15  ? 213 ALA A C     1 
ATOM   1598 O O     . ALA A 1 233 ? -2.162  -16.850 80.126  1.00 74.75  ? 213 ALA A O     1 
ATOM   1599 C CB    . ALA A 1 233 ? -1.914  -13.573 80.088  1.00 67.47  ? 213 ALA A CB    1 
ATOM   1600 N N     . GLU A 1 234 ? -0.511  -16.087 78.800  1.00 75.67  ? 214 GLU A N     1 
ATOM   1601 C CA    . GLU A 1 234 ? -0.544  -17.242 77.908  1.00 80.93  ? 214 GLU A CA    1 
ATOM   1602 C C     . GLU A 1 234 ? -0.000  -18.486 78.602  1.00 82.66  ? 214 GLU A C     1 
ATOM   1603 O O     . GLU A 1 234 ? -0.316  -19.612 78.217  1.00 86.49  ? 214 GLU A O     1 
ATOM   1604 C CB    . GLU A 1 234 ? 0.254   -16.962 76.633  1.00 84.30  ? 214 GLU A CB    1 
ATOM   1605 C CG    . GLU A 1 234 ? -0.263  -15.785 75.824  1.00 84.69  ? 214 GLU A CG    1 
ATOM   1606 C CD    . GLU A 1 234 ? 0.549   -15.538 74.567  1.00 88.58  ? 214 GLU A CD    1 
ATOM   1607 O OE1   . GLU A 1 234 ? 0.912   -16.523 73.889  1.00 93.13  ? 214 GLU A OE1   1 
ATOM   1608 O OE2   . GLU A 1 234 ? 0.829   -14.360 74.261  1.00 87.47  ? 214 GLU A OE2   1 
ATOM   1609 N N     . GLY A 1 235 ? 0.823   -18.276 79.623  1.00 80.23  ? 215 GLY A N     1 
ATOM   1610 C CA    . GLY A 1 235 ? 1.360   -19.376 80.401  1.00 81.69  ? 215 GLY A CA    1 
ATOM   1611 C C     . GLY A 1 235 ? 0.306   -19.969 81.314  1.00 81.22  ? 215 GLY A C     1 
ATOM   1612 O O     . GLY A 1 235 ? 0.225   -21.186 81.478  1.00 84.84  ? 215 GLY A O     1 
ATOM   1613 N N     . LEU A 1 236 ? -0.507  -19.101 81.908  1.00 76.85  ? 216 LEU A N     1 
ATOM   1614 C CA    . LEU A 1 236 ? -1.564  -19.534 82.813  1.00 75.96  ? 216 LEU A CA    1 
ATOM   1615 C C     . LEU A 1 236 ? -2.684  -20.248 82.066  1.00 79.00  ? 216 LEU A C     1 
ATOM   1616 O O     . LEU A 1 236 ? -3.245  -21.226 82.560  1.00 81.82  ? 216 LEU A O     1 
ATOM   1617 C CB    . LEU A 1 236 ? -2.131  -18.342 83.588  1.00 71.09  ? 216 LEU A CB    1 
ATOM   1618 C CG    . LEU A 1 236 ? -1.170  -17.638 84.546  1.00 67.55  ? 216 LEU A CG    1 
ATOM   1619 C CD1   . LEU A 1 236 ? -1.891  -16.548 85.322  1.00 63.79  ? 216 LEU A CD1   1 
ATOM   1620 C CD2   . LEU A 1 236 ? -0.526  -18.640 85.492  1.00 69.20  ? 216 LEU A CD2   1 
ATOM   1621 N N     . VAL A 1 237 ? -3.004  -19.760 80.871  1.00 78.99  ? 217 VAL A N     1 
ATOM   1622 C CA    . VAL A 1 237 ? -4.078  -20.345 80.076  1.00 82.56  ? 217 VAL A CA    1 
ATOM   1623 C C     . VAL A 1 237 ? -3.669  -21.724 79.557  1.00 87.66  ? 217 VAL A C     1 
ATOM   1624 O O     . VAL A 1 237 ? -4.518  -22.534 79.186  1.00 91.46  ? 217 VAL A O     1 
ATOM   1625 C CB    . VAL A 1 237 ? -4.475  -19.429 78.894  1.00 82.24  ? 217 VAL A CB    1 
ATOM   1626 C CG1   . VAL A 1 237 ? -3.488  -19.565 77.746  1.00 84.71  ? 217 VAL A CG1   1 
ATOM   1627 C CG2   . VAL A 1 237 ? -5.885  -19.746 78.425  1.00 84.75  ? 217 VAL A CG2   1 
ATOM   1628 N N     . GLU A 1 238 ? -2.366  -21.989 79.546  1.00 88.19  ? 218 GLU A N     1 
ATOM   1629 C CA    . GLU A 1 238 ? -1.858  -23.303 79.172  1.00 93.25  ? 218 GLU A CA    1 
ATOM   1630 C C     . GLU A 1 238 ? -2.069  -24.285 80.318  1.00 94.92  ? 218 GLU A C     1 
ATOM   1631 O O     . GLU A 1 238 ? -2.159  -25.494 80.107  1.00 99.85  ? 218 GLU A O     1 
ATOM   1632 C CB    . GLU A 1 238 ? -0.376  -23.227 78.799  1.00 93.52  ? 218 GLU A CB    1 
ATOM   1633 N N     . ARG A 1 239 ? -2.149  -23.752 81.534  1.00 91.19  ? 219 ARG A N     1 
ATOM   1634 C CA    . ARG A 1 239 ? -2.427  -24.560 82.714  1.00 92.56  ? 219 ARG A CA    1 
ATOM   1635 C C     . ARG A 1 239 ? -3.907  -24.480 83.074  1.00 92.22  ? 219 ARG A C     1 
ATOM   1636 O O     . ARG A 1 239 ? -4.288  -24.698 84.225  1.00 92.07  ? 219 ARG A O     1 
ATOM   1637 C CB    . ARG A 1 239 ? -1.567  -24.108 83.895  1.00 89.11  ? 219 ARG A CB    1 
ATOM   1638 N N     . HIS A 1 240 ? -4.726  -24.160 82.074  1.00 92.30  ? 220 HIS A N     1 
ATOM   1639 C CA    . HIS A 1 240 ? -6.176  -24.047 82.228  1.00 92.19  ? 220 HIS A CA    1 
ATOM   1640 C C     . HIS A 1 240 ? -6.570  -23.026 83.292  1.00 87.54  ? 220 HIS A C     1 
ATOM   1641 O O     . HIS A 1 240 ? -7.431  -23.290 84.132  1.00 88.18  ? 220 HIS A O     1 
ATOM   1642 C CB    . HIS A 1 240 ? -6.788  -25.412 82.554  1.00 97.24  ? 220 HIS A CB    1 
ATOM   1643 C CG    . HIS A 1 240 ? -6.562  -26.442 81.492  1.00 102.18 ? 220 HIS A CG    1 
ATOM   1644 N ND1   . HIS A 1 240 ? -7.345  -26.527 80.359  1.00 104.64 ? 220 HIS A ND1   1 
ATOM   1645 C CD2   . HIS A 1 240 ? -5.642  -27.428 81.386  1.00 105.63 ? 220 HIS A CD2   1 
ATOM   1646 C CE1   . HIS A 1 240 ? -6.917  -27.520 79.604  1.00 109.67 ? 220 HIS A CE1   1 
ATOM   1647 N NE2   . HIS A 1 240 ? -5.883  -28.085 80.204  1.00 110.39 ? 220 HIS A NE2   1 
ATOM   1648 N N     . ILE A 1 241 ? -5.934  -21.860 83.248  1.00 83.02  ? 221 ILE A N     1 
ATOM   1649 C CA    . ILE A 1 241 ? -6.273  -20.763 84.146  1.00 78.65  ? 221 ILE A CA    1 
ATOM   1650 C C     . ILE A 1 241 ? -6.716  -19.545 83.343  1.00 76.88  ? 221 ILE A C     1 
ATOM   1651 O O     . ILE A 1 241 ? -5.913  -18.940 82.634  1.00 75.43  ? 221 ILE A O     1 
ATOM   1652 C CB    . ILE A 1 241 ? -5.088  -20.375 85.051  1.00 74.81  ? 221 ILE A CB    1 
ATOM   1653 C CG1   . ILE A 1 241 ? -4.581  -21.595 85.822  1.00 77.48  ? 221 ILE A CG1   1 
ATOM   1654 C CG2   . ILE A 1 241 ? -5.488  -19.260 86.005  1.00 70.19  ? 221 ILE A CG2   1 
ATOM   1655 C CD1   . ILE A 1 241 ? -3.394  -21.304 86.714  1.00 74.79  ? 221 ILE A CD1   1 
ATOM   1656 N N     . PRO A 1 242 ? -8.004  -19.184 83.452  1.00 77.64  ? 222 PRO A N     1 
ATOM   1657 C CA    . PRO A 1 242 ? -8.579  -18.060 82.704  1.00 76.36  ? 222 PRO A CA    1 
ATOM   1658 C C     . PRO A 1 242 ? -7.981  -16.714 83.109  1.00 71.47  ? 222 PRO A C     1 
ATOM   1659 O O     . PRO A 1 242 ? -7.869  -16.421 84.300  1.00 69.31  ? 222 PRO A O     1 
ATOM   1660 C CB    . PRO A 1 242 ? -10.067 -18.126 83.063  1.00 77.83  ? 222 PRO A CB    1 
ATOM   1661 C CG    . PRO A 1 242 ? -10.106 -18.825 84.379  1.00 78.40  ? 222 PRO A CG    1 
ATOM   1662 C CD    . PRO A 1 242 ? -8.995  -19.828 84.331  1.00 79.97  ? 222 PRO A CD    1 
ATOM   1663 N N     . VAL A 1 243 ? -7.598  -15.912 82.120  1.00 70.09  ? 223 VAL A N     1 
ATOM   1664 C CA    . VAL A 1 243 ? -7.006  -14.601 82.373  1.00 65.97  ? 223 VAL A CA    1 
ATOM   1665 C C     . VAL A 1 243 ? -7.698  -13.513 81.553  1.00 65.32  ? 223 VAL A C     1 
ATOM   1666 O O     . VAL A 1 243 ? -7.877  -13.656 80.344  1.00 67.77  ? 223 VAL A O     1 
ATOM   1667 C CB    . VAL A 1 243 ? -5.495  -14.589 82.051  1.00 64.99  ? 223 VAL A CB    1 
ATOM   1668 C CG1   . VAL A 1 243 ? -4.905  -13.211 82.312  1.00 61.09  ? 223 VAL A CG1   1 
ATOM   1669 C CG2   . VAL A 1 243 ? -4.763  -15.647 82.865  1.00 65.87  ? 223 VAL A CG2   1 
ATOM   1670 N N     . LEU A 1 244 ? -8.085  -12.429 82.220  1.00 62.43  ? 224 LEU A N     1 
ATOM   1671 C CA    . LEU A 1 244 ? -8.710  -11.293 81.549  1.00 62.23  ? 224 LEU A CA    1 
ATOM   1672 C C     . LEU A 1 244 ? -7.889  -10.022 81.756  1.00 59.89  ? 224 LEU A C     1 
ATOM   1673 O O     . LEU A 1 244 ? -7.594  -9.641  82.889  1.00 57.13  ? 224 LEU A O     1 
ATOM   1674 C CB    . LEU A 1 244 ? -10.139 -11.086 82.057  1.00 62.07  ? 224 LEU A CB    1 
ATOM   1675 C CG    . LEU A 1 244 ? -10.942 -9.971  81.381  1.00 62.28  ? 224 LEU A CG    1 
ATOM   1676 C CD1   . LEU A 1 244 ? -11.155 -10.281 79.907  1.00 65.62  ? 224 LEU A CD1   1 
ATOM   1677 C CD2   . LEU A 1 244 ? -12.274 -9.757  82.086  1.00 62.34  ? 224 LEU A CD2   1 
ATOM   1678 N N     . ILE A 1 245 ? -7.524  -9.369  80.657  1.00 61.08  ? 225 ILE A N     1 
ATOM   1679 C CA    . ILE A 1 245 ? -6.705  -8.163  80.721  1.00 59.57  ? 225 ILE A CA    1 
ATOM   1680 C C     . ILE A 1 245 ? -7.407  -6.972  80.073  1.00 59.90  ? 225 ILE A C     1 
ATOM   1681 O O     . ILE A 1 245 ? -7.898  -7.065  78.948  1.00 62.44  ? 225 ILE A O     1 
ATOM   1682 C CB    . ILE A 1 245 ? -5.340  -8.372  80.037  1.00 60.71  ? 225 ILE A CB    1 
ATOM   1683 C CG1   . ILE A 1 245 ? -4.634  -9.601  80.612  1.00 61.17  ? 225 ILE A CG1   1 
ATOM   1684 C CG2   . ILE A 1 245 ? -4.469  -7.134  80.189  1.00 59.09  ? 225 ILE A CG2   1 
ATOM   1685 C CD1   . ILE A 1 245 ? -3.302  -9.899  79.959  1.00 62.70  ? 225 ILE A CD1   1 
ATOM   1686 N N     . SER A 1 246 ? -7.451  -5.855  80.792  1.00 57.37  ? 226 SER A N     1 
ATOM   1687 C CA    . SER A 1 246 ? -8.039  -4.628  80.269  1.00 57.87  ? 226 SER A CA    1 
ATOM   1688 C C     . SER A 1 246 ? -6.959  -3.585  79.998  1.00 57.08  ? 226 SER A C     1 
ATOM   1689 O O     . SER A 1 246 ? -6.041  -3.407  80.799  1.00 55.37  ? 226 SER A O     1 
ATOM   1690 C CB    . SER A 1 246 ? -9.081  -4.070  81.241  1.00 56.84  ? 226 SER A CB    1 
ATOM   1691 O OG    . SER A 1 246 ? -8.494  -3.752  82.491  1.00 54.93  ? 226 SER A OG    1 
ATOM   1692 N N     . ASN A 1 247 ? -7.078  -2.899  78.865  1.00 58.54  ? 227 ASN A N     1 
ATOM   1693 C CA    . ASN A 1 247 ? -6.096  -1.902  78.458  1.00 58.33  ? 227 ASN A CA    1 
ATOM   1694 C C     . ASN A 1 247 ? -6.639  -1.031  77.329  1.00 60.46  ? 227 ASN A C     1 
ATOM   1695 O O     . ASN A 1 247 ? -7.725  -1.288  76.809  1.00 61.49  ? 227 ASN A O     1 
ATOM   1696 C CB    . ASN A 1 247 ? -4.796  -2.584  78.022  1.00 59.17  ? 227 ASN A CB    1 
ATOM   1697 C CG    . ASN A 1 247 ? -3.574  -1.712  78.241  1.00 59.00  ? 227 ASN A CG    1 
ATOM   1698 O OD1   . ASN A 1 247 ? -3.646  -0.487  78.151  1.00 59.71  ? 227 ASN A OD1   1 
ATOM   1699 N ND2   . ASN A 1 247 ? -2.443  -2.344  78.533  1.00 58.69  ? 227 ASN A ND2   1 
ATOM   1700 N N     . HIS A 1 248 ? -5.886  -0.000  76.956  1.00 61.74  ? 228 HIS A N     1 
ATOM   1701 C CA    . HIS A 1 248 ? -6.246  0.835   75.815  1.00 65.69  ? 228 HIS A CA    1 
ATOM   1702 C C     . HIS A 1 248 ? -6.237  0.015   74.530  1.00 69.20  ? 228 HIS A C     1 
ATOM   1703 O O     . HIS A 1 248 ? -5.496  -0.961  74.416  1.00 69.08  ? 228 HIS A O     1 
ATOM   1704 C CB    . HIS A 1 248 ? -5.288  2.022   75.685  1.00 67.12  ? 228 HIS A CB    1 
ATOM   1705 C CG    . HIS A 1 248 ? -5.547  3.124   76.661  1.00 65.94  ? 228 HIS A CG    1 
ATOM   1706 N ND1   . HIS A 1 248 ? -6.808  3.413   77.145  1.00 65.46  ? 228 HIS A ND1   1 
ATOM   1707 C CD2   . HIS A 1 248 ? -4.713  4.016   77.247  1.00 65.24  ? 228 HIS A CD2   1 
ATOM   1708 C CE1   . HIS A 1 248 ? -6.736  4.429   77.981  1.00 64.29  ? 228 HIS A CE1   1 
ATOM   1709 N NE2   . HIS A 1 248 ? -5.472  4.815   78.062  1.00 64.25  ? 228 HIS A NE2   1 
ATOM   1710 N N     . ASP A 1 249 ? -7.063  0.407   73.566  1.00 81.73  ? 229 ASP A N     1 
ATOM   1711 C CA    . ASP A 1 249 ? -7.097  -0.275  72.278  1.00 84.90  ? 229 ASP A CA    1 
ATOM   1712 C C     . ASP A 1 249 ? -6.165  0.410   71.286  1.00 85.67  ? 229 ASP A C     1 
ATOM   1713 O O     . ASP A 1 249 ? -6.569  1.322   70.565  1.00 86.55  ? 229 ASP A O     1 
ATOM   1714 C CB    . ASP A 1 249 ? -8.522  -0.321  71.722  1.00 87.41  ? 229 ASP A CB    1 
ATOM   1715 C CG    . ASP A 1 249 ? -8.618  -1.111  70.429  1.00 90.75  ? 229 ASP A CG    1 
ATOM   1716 O OD1   . ASP A 1 249 ? -7.792  -2.027  70.227  1.00 91.54  ? 229 ASP A OD1   1 
ATOM   1717 O OD2   . ASP A 1 249 ? -9.518  -0.816  69.614  1.00 92.64  ? 229 ASP A OD2   1 
ATOM   1718 N N     . THR A 1 250 ? -4.912  -0.031  71.262  1.00 85.64  ? 230 THR A N     1 
ATOM   1719 C CA    . THR A 1 250 ? -3.919  0.524   70.351  1.00 86.80  ? 230 THR A CA    1 
ATOM   1720 C C     . THR A 1 250 ? -3.332  -0.570  69.469  1.00 89.15  ? 230 THR A C     1 
ATOM   1721 O O     . THR A 1 250 ? -3.817  -1.701  69.462  1.00 90.51  ? 230 THR A O     1 
ATOM   1722 C CB    . THR A 1 250 ? -2.778  1.226   71.111  1.00 84.64  ? 230 THR A CB    1 
ATOM   1723 O OG1   . THR A 1 250 ? -2.042  0.261   71.874  1.00 84.00  ? 230 THR A OG1   1 
ATOM   1724 C CG2   . THR A 1 250 ? -3.331  2.293   72.046  1.00 82.51  ? 230 THR A CG2   1 
ATOM   1725 N N     . MET A 1 251 ? -2.285  -0.227  68.727  1.00 89.59  ? 231 MET A N     1 
ATOM   1726 C CA    . MET A 1 251 ? -1.611  -1.193  67.868  1.00 91.05  ? 231 MET A CA    1 
ATOM   1727 C C     . MET A 1 251 ? -0.763  -2.152  68.695  1.00 89.75  ? 231 MET A C     1 
ATOM   1728 O O     . MET A 1 251 ? -0.687  -3.344  68.397  1.00 91.44  ? 231 MET A O     1 
ATOM   1729 C CB    . MET A 1 251 ? -0.742  -0.477  66.832  1.00 91.77  ? 231 MET A CB    1 
ATOM   1730 N N     . LEU A 1 252 ? -0.132  -1.624  69.740  1.00 86.97  ? 232 LEU A N     1 
ATOM   1731 C CA    . LEU A 1 252 ? 0.744   -2.420  70.592  1.00 85.52  ? 232 LEU A CA    1 
ATOM   1732 C C     . LEU A 1 252 ? -0.040  -3.427  71.427  1.00 84.57  ? 232 LEU A C     1 
ATOM   1733 O O     . LEU A 1 252 ? 0.404   -4.557  71.629  1.00 85.41  ? 232 LEU A O     1 
ATOM   1734 C CB    . LEU A 1 252 ? 1.569   -1.516  71.515  1.00 83.57  ? 232 LEU A CB    1 
ATOM   1735 C CG    . LEU A 1 252 ? 2.631   -0.607  70.887  1.00 84.07  ? 232 LEU A CG    1 
ATOM   1736 C CD1   . LEU A 1 252 ? 2.023   0.687   70.361  1.00 84.30  ? 232 LEU A CD1   1 
ATOM   1737 C CD2   . LEU A 1 252 ? 3.742   -0.315  71.886  1.00 82.05  ? 232 LEU A CD2   1 
ATOM   1738 N N     . THR A 1 253 ? -1.207  -3.013  71.910  1.00 82.94  ? 233 THR A N     1 
ATOM   1739 C CA    . THR A 1 253 ? -2.014  -3.859  72.782  1.00 81.99  ? 233 THR A CA    1 
ATOM   1740 C C     . THR A 1 253 ? -2.686  -4.994  72.015  1.00 84.60  ? 233 THR A C     1 
ATOM   1741 O O     . THR A 1 253 ? -2.893  -6.079  72.557  1.00 84.89  ? 233 THR A O     1 
ATOM   1742 C CB    . THR A 1 253 ? -3.089  -3.041  73.518  1.00 80.08  ? 233 THR A CB    1 
ATOM   1743 O OG1   . THR A 1 253 ? -3.946  -2.402  72.564  1.00 81.39  ? 233 THR A OG1   1 
ATOM   1744 C CG2   . THR A 1 253 ? -2.438  -1.983  74.396  1.00 77.36  ? 233 THR A CG2   1 
ATOM   1745 N N     . ARG A 1 254 ? -3.070  -4.695  70.787  1.00 86.78  ? 234 ARG A N     1 
ATOM   1746 C CA    . ARG A 1 254 ? -3.628  -5.675  69.882  1.00 90.01  ? 234 ARG A CA    1 
ATOM   1747 C C     . ARG A 1 254 ? -2.613  -6.735  69.504  1.00 91.20  ? 234 ARG A C     1 
ATOM   1748 O O     . ARG A 1 254 ? -2.939  -7.905  69.424  1.00 93.37  ? 234 ARG A O     1 
ATOM   1749 C CB    . ARG A 1 254 ? -4.183  -5.003  68.649  1.00 92.43  ? 234 ARG A CB    1 
ATOM   1750 C CG    . ARG A 1 254 ? -5.576  -5.481  68.315  1.00 93.36  ? 234 ARG A CG    1 
ATOM   1751 C CD    . ARG A 1 254 ? -6.519  -4.339  68.013  1.00 96.60  ? 234 ARG A CD    1 
ATOM   1752 N NE    . ARG A 1 254 ? -7.884  -4.735  68.290  1.00 98.07  ? 234 ARG A NE    1 
ATOM   1753 C CZ    . ARG A 1 254 ? -8.820  -4.810  67.367  1.00 101.17 ? 234 ARG A CZ    1 
ATOM   1754 N NH1   . ARG A 1 254 ? -8.525  -4.502  66.121  1.00 103.01 ? 234 ARG A NH1   1 
ATOM   1755 N NH2   . ARG A 1 254 ? -10.041 -5.190  67.685  1.00 102.36 ? 234 ARG A NH2   1 
ATOM   1756 N N     . GLU A 1 255 ? -1.379  -6.311  69.271  1.00 89.99  ? 235 GLU A N     1 
ATOM   1757 C CA    . GLU A 1 255 ? -0.270  -7.231  69.090  1.00 91.00  ? 235 GLU A CA    1 
ATOM   1758 C C     . GLU A 1 255 ? 0.060   -8.071  70.327  1.00 89.81  ? 235 GLU A C     1 
ATOM   1759 O O     . GLU A 1 255 ? 0.257   -9.266  70.223  1.00 91.39  ? 235 GLU A O     1 
ATOM   1760 C CB    . GLU A 1 255 ? 0.974   -6.461  68.650  1.00 90.50  ? 235 GLU A CB    1 
ATOM   1761 N N     . TRP A 1 256 ? 0.093   -7.445  71.496  1.00 87.25  ? 236 TRP A N     1 
ATOM   1762 C CA    . TRP A 1 256 ? 0.440   -8.128  72.730  1.00 86.24  ? 236 TRP A CA    1 
ATOM   1763 C C     . TRP A 1 256 ? -0.554  -9.202  73.093  1.00 87.50  ? 236 TRP A C     1 
ATOM   1764 O O     . TRP A 1 256 ? -0.177  -10.249 73.569  1.00 88.15  ? 236 TRP A O     1 
ATOM   1765 C CB    . TRP A 1 256 ? 0.576   -7.143  73.872  1.00 83.51  ? 236 TRP A CB    1 
ATOM   1766 C CG    . TRP A 1 256 ? 1.729   -6.268  73.767  1.00 82.49  ? 236 TRP A CG    1 
ATOM   1767 C CD1   . TRP A 1 256 ? 2.890   -6.538  73.159  1.00 83.41  ? 236 TRP A CD1   1 
ATOM   1768 C CD2   . TRP A 1 256 ? 1.848   -4.961  74.300  1.00 80.34  ? 236 TRP A CD2   1 
ATOM   1769 N NE1   . TRP A 1 256 ? 3.745   -5.484  73.271  1.00 81.98  ? 236 TRP A NE1   1 
ATOM   1770 C CE2   . TRP A 1 256 ? 3.123   -4.497  73.973  1.00 80.11  ? 236 TRP A CE2   1 
ATOM   1771 C CE3   . TRP A 1 256 ? 1.002   -4.136  75.028  1.00 78.77  ? 236 TRP A CE3   1 
ATOM   1772 C CZ2   . TRP A 1 256 ? 3.572   -3.254  74.344  1.00 78.27  ? 236 TRP A CZ2   1 
ATOM   1773 C CZ3   . TRP A 1 256 ? 1.441   -2.909  75.380  1.00 76.81  ? 236 TRP A CZ3   1 
ATOM   1774 C CH2   . TRP A 1 256 ? 2.715   -2.472  75.045  1.00 76.65  ? 236 TRP A CH2   1 
ATOM   1775 N N     . TYR A 1 257 ? -1.828  -8.935  72.858  1.00 87.82  ? 237 TYR A N     1 
ATOM   1776 C CA    . TYR A 1 257 ? -2.907  -9.815  73.275  1.00 89.03  ? 237 TYR A CA    1 
ATOM   1777 C C     . TYR A 1 257 ? -3.462  -10.650 72.131  1.00 92.52  ? 237 TYR A C     1 
ATOM   1778 O O     . TYR A 1 257 ? -4.607  -11.076 72.148  1.00 94.07  ? 237 TYR A O     1 
ATOM   1779 C CB    . TYR A 1 257 ? -4.013  -9.041  73.961  1.00 87.51  ? 237 TYR A CB    1 
ATOM   1780 C CG    . TYR A 1 257 ? -3.504  -8.133  75.020  1.00 84.63  ? 237 TYR A CG    1 
ATOM   1781 C CD1   . TYR A 1 257 ? -3.961  -6.856  75.120  1.00 83.26  ? 237 TYR A CD1   1 
ATOM   1782 C CD2   . TYR A 1 257 ? -2.551  -8.555  75.913  1.00 83.41  ? 237 TYR A CD2   1 
ATOM   1783 C CE1   . TYR A 1 257 ? -3.489  -6.009  76.084  1.00 80.80  ? 237 TYR A CE1   1 
ATOM   1784 C CE2   . TYR A 1 257 ? -2.073  -7.721  76.884  1.00 80.89  ? 237 TYR A CE2   1 
ATOM   1785 C CZ    . TYR A 1 257 ? -2.549  -6.441  76.961  1.00 79.75  ? 237 TYR A CZ    1 
ATOM   1786 O OH    . TYR A 1 257 ? -2.096  -5.578  77.910  1.00 77.66  ? 237 TYR A OH    1 
ATOM   1787 N N     . GLN A 1 258 ? -2.618  -10.894 71.143  1.00 93.81  ? 238 GLN A N     1 
ATOM   1788 C CA    . GLN A 1 258 ? -3.013  -11.519 69.903  1.00 96.66  ? 238 GLN A CA    1 
ATOM   1789 C C     . GLN A 1 258 ? -3.623  -12.870 70.149  1.00 98.06  ? 238 GLN A C     1 
ATOM   1790 O O     . GLN A 1 258 ? -4.557  -13.252 69.466  1.00 100.20 ? 238 GLN A O     1 
ATOM   1791 C CB    . GLN A 1 258 ? -1.783  -11.699 69.042  1.00 98.07  ? 238 GLN A CB    1 
ATOM   1792 C CG    . GLN A 1 258 ? -2.040  -12.135 67.620  1.00 102.05 ? 238 GLN A CG    1 
ATOM   1793 C CD    . GLN A 1 258 ? -0.789  -12.039 66.777  1.00 103.59 ? 238 GLN A CD    1 
ATOM   1794 O OE1   . GLN A 1 258 ? 0.309   -11.876 67.302  1.00 102.31 ? 238 GLN A OE1   1 
ATOM   1795 N NE2   . GLN A 1 258 ? -0.950  -12.117 65.465  1.00 106.37 ? 238 GLN A NE2   1 
ATOM   1796 N N     . ARG A 1 259 ? -3.097  -13.611 71.107  1.00 96.98  ? 239 ARG A N     1 
ATOM   1797 C CA    . ARG A 1 259 ? -3.606  -14.957 71.348  1.00 98.88  ? 239 ARG A CA    1 
ATOM   1798 C C     . ARG A 1 259 ? -4.802  -14.966 72.297  1.00 98.46  ? 239 ARG A C     1 
ATOM   1799 O O     . ARG A 1 259 ? -5.101  -15.987 72.918  1.00 99.67  ? 239 ARG A O     1 
ATOM   1800 C CB    . ARG A 1 259 ? -2.496  -15.850 71.907  1.00 98.52  ? 239 ARG A CB    1 
ATOM   1801 N N     . ALA A 1 260 ? -5.487  -13.832 72.403  1.00 96.75  ? 240 ALA A N     1 
ATOM   1802 C CA    . ALA A 1 260 ? -6.640  -13.719 73.289  1.00 95.88  ? 240 ALA A CA    1 
ATOM   1803 C C     . ALA A 1 260 ? -7.906  -13.364 72.518  1.00 98.15  ? 240 ALA A C     1 
ATOM   1804 O O     . ALA A 1 260 ? -7.847  -12.714 71.474  1.00 98.96  ? 240 ALA A O     1 
ATOM   1805 C CB    . ALA A 1 260 ? -6.375  -12.682 74.369  1.00 92.26  ? 240 ALA A CB    1 
ATOM   1806 N N     . LYS A 1 261 ? -9.050  -13.801 73.035  1.00 99.33  ? 241 LYS A N     1 
ATOM   1807 C CA    . LYS A 1 261 ? -10.338 -13.427 72.464  1.00 101.31 ? 241 LYS A CA    1 
ATOM   1808 C C     . LYS A 1 261 ? -10.630 -11.970 72.800  1.00 99.15  ? 241 LYS A C     1 
ATOM   1809 O O     . LYS A 1 261 ? -11.013 -11.647 73.924  1.00 97.13  ? 241 LYS A O     1 
ATOM   1810 C CB    . LYS A 1 261 ? -11.452 -14.336 72.984  1.00 102.92 ? 241 LYS A CB    1 
ATOM   1811 N N     . LEU A 1 262 ? -10.443 -11.096 71.818  1.00 99.36  ? 242 LEU A N     1 
ATOM   1812 C CA    . LEU A 1 262 ? -10.508 -9.657  72.047  1.00 97.03  ? 242 LEU A CA    1 
ATOM   1813 C C     . LEU A 1 262 ? -11.925 -9.101  71.956  1.00 98.97  ? 242 LEU A C     1 
ATOM   1814 O O     . LEU A 1 262 ? -12.715 -9.510  71.106  1.00 102.28 ? 242 LEU A O     1 
ATOM   1815 C CB    . LEU A 1 262 ? -9.603  -8.930  71.051  1.00 96.28  ? 242 LEU A CB    1 
ATOM   1816 C CG    . LEU A 1 262 ? -8.144  -9.390  71.030  1.00 95.18  ? 242 LEU A CG    1 
ATOM   1817 C CD1   . LEU A 1 262 ? -7.343  -8.610  69.999  1.00 95.58  ? 242 LEU A CD1   1 
ATOM   1818 C CD2   . LEU A 1 262 ? -7.522  -9.259  72.411  1.00 92.25  ? 242 LEU A CD2   1 
ATOM   1819 N N     . HIS A 1 263 ? -12.234 -8.162  72.845  1.00 97.20  ? 243 HIS A N     1 
ATOM   1820 C CA    . HIS A 1 263 ? -13.508 -7.454  72.819  1.00 98.32  ? 243 HIS A CA    1 
ATOM   1821 C C     . HIS A 1 263 ? -13.273 -5.955  72.965  1.00 96.29  ? 243 HIS A C     1 
ATOM   1822 O O     . HIS A 1 263 ? -12.546 -5.518  73.858  1.00 93.20  ? 243 HIS A O     1 
ATOM   1823 C CB    . HIS A 1 263 ? -14.436 -7.955  73.928  1.00 98.53  ? 243 HIS A CB    1 
ATOM   1824 C CG    . HIS A 1 263 ? -14.788 -9.406  73.815  1.00 101.73 ? 243 HIS A CG    1 
ATOM   1825 N ND1   . HIS A 1 263 ? -14.029 -10.402 74.385  1.00 101.41 ? 243 HIS A ND1   1 
ATOM   1826 C CD2   . HIS A 1 263 ? -15.822 -10.026 73.196  1.00 105.36 ? 243 HIS A CD2   1 
ATOM   1827 C CE1   . HIS A 1 263 ? -14.578 -11.577 74.124  1.00 104.36 ? 243 HIS A CE1   1 
ATOM   1828 N NE2   . HIS A 1 263 ? -15.666 -11.374 73.404  1.00 106.79 ? 243 HIS A NE2   1 
ATOM   1829 N N     . VAL A 1 264 ? -13.887 -5.172  72.085  1.00 98.46  ? 244 VAL A N     1 
ATOM   1830 C CA    . VAL A 1 264 ? -13.703 -3.726  72.095  1.00 97.81  ? 244 VAL A CA    1 
ATOM   1831 C C     . VAL A 1 264 ? -14.910 -3.008  72.690  1.00 99.11  ? 244 VAL A C     1 
ATOM   1832 O O     . VAL A 1 264 ? -16.044 -3.223  72.263  1.00 102.25 ? 244 VAL A O     1 
ATOM   1833 C CB    . VAL A 1 264 ? -13.449 -3.183  70.675  1.00 99.02  ? 244 VAL A CB    1 
ATOM   1834 C CG1   . VAL A 1 264 ? -13.247 -1.675  70.709  1.00 97.23  ? 244 VAL A CG1   1 
ATOM   1835 C CG2   . VAL A 1 264 ? -12.246 -3.871  70.051  1.00 99.07  ? 244 VAL A CG2   1 
ATOM   1836 N N     . VAL A 1 265 ? -14.659 -2.159  73.681  1.00 97.34  ? 245 VAL A N     1 
ATOM   1837 C CA    . VAL A 1 265 ? -15.710 -1.337  74.268  1.00 98.19  ? 245 VAL A CA    1 
ATOM   1838 C C     . VAL A 1 265 ? -15.495 0.132   73.908  1.00 98.35  ? 245 VAL A C     1 
ATOM   1839 O O     . VAL A 1 265 ? -14.409 0.679   74.098  1.00 96.32  ? 245 VAL A O     1 
ATOM   1840 C CB    . VAL A 1 265 ? -15.773 -1.500  75.803  1.00 95.80  ? 245 VAL A CB    1 
ATOM   1841 C CG1   . VAL A 1 265 ? -16.483 -2.795  76.169  1.00 97.54  ? 245 VAL A CG1   1 
ATOM   1842 C CG2   . VAL A 1 265 ? -14.379 -1.465  76.407  1.00 93.34  ? 245 VAL A CG2   1 
ATOM   1843 N N     . LYS A 1 266 ? -16.536 0.763   73.374  1.00 79.83  ? 246 LYS A N     1 
ATOM   1844 C CA    . LYS A 1 266 ? -16.442 2.144   72.913  1.00 80.64  ? 246 LYS A CA    1 
ATOM   1845 C C     . LYS A 1 266 ? -16.616 3.137   74.056  1.00 81.59  ? 246 LYS A C     1 
ATOM   1846 O O     . LYS A 1 266 ? -17.705 3.275   74.612  1.00 82.09  ? 246 LYS A O     1 
ATOM   1847 C CB    . LYS A 1 266 ? -17.483 2.414   71.824  1.00 81.48  ? 246 LYS A CB    1 
ATOM   1848 N N     . VAL A 1 267 ? -15.535 3.830   74.399  1.00 82.53  ? 247 VAL A N     1 
ATOM   1849 C CA    . VAL A 1 267 ? -15.567 4.825   75.464  1.00 84.42  ? 247 VAL A CA    1 
ATOM   1850 C C     . VAL A 1 267 ? -15.404 6.234   74.905  1.00 86.42  ? 247 VAL A C     1 
ATOM   1851 O O     . VAL A 1 267 ? -16.388 6.933   74.661  1.00 87.41  ? 247 VAL A O     1 
ATOM   1852 C CB    . VAL A 1 267 ? -14.466 4.568   76.511  1.00 85.05  ? 247 VAL A CB    1 
ATOM   1853 N N     . LYS A 1 279 ? -7.461  12.411  70.896  1.00 103.25 ? 259 LYS A N     1 
ATOM   1854 C CA    . LYS A 1 279 ? -8.090  11.432  70.018  1.00 101.45 ? 259 LYS A CA    1 
ATOM   1855 C C     . LYS A 1 279 ? -9.057  10.540  70.789  1.00 97.87  ? 259 LYS A C     1 
ATOM   1856 O O     . LYS A 1 279 ? -8.966  10.420  72.011  1.00 96.94  ? 259 LYS A O     1 
ATOM   1857 C CB    . LYS A 1 279 ? -7.029  10.577  69.322  1.00 102.65 ? 259 LYS A CB    1 
ATOM   1858 N N     . LYS A 1 280 ? -9.983  9.917   70.067  1.00 96.40  ? 260 LYS A N     1 
ATOM   1859 C CA    . LYS A 1 280 ? -10.966 9.030   70.679  1.00 92.83  ? 260 LYS A CA    1 
ATOM   1860 C C     . LYS A 1 280 ? -10.414 7.615   70.824  1.00 91.19  ? 260 LYS A C     1 
ATOM   1861 O O     . LYS A 1 280 ? -10.420 6.836   69.872  1.00 91.64  ? 260 LYS A O     1 
ATOM   1862 C CB    . LYS A 1 280 ? -12.255 9.010   69.856  1.00 92.61  ? 260 LYS A CB    1 
ATOM   1863 N N     . VAL A 1 281 ? -9.940  7.290   72.023  1.00 89.59  ? 261 VAL A N     1 
ATOM   1864 C CA    . VAL A 1 281 ? -9.364  5.977   72.288  1.00 87.75  ? 261 VAL A CA    1 
ATOM   1865 C C     . VAL A 1 281 ? -10.349 5.074   73.030  1.00 84.56  ? 261 VAL A C     1 
ATOM   1866 O O     . VAL A 1 281 ? -10.930 5.467   74.042  1.00 84.15  ? 261 VAL A O     1 
ATOM   1867 C CB    . VAL A 1 281 ? -8.053  6.096   73.102  1.00 88.73  ? 261 VAL A CB    1 
ATOM   1868 C CG1   . VAL A 1 281 ? -8.215  7.088   74.247  1.00 89.23  ? 261 VAL A CG1   1 
ATOM   1869 C CG2   . VAL A 1 281 ? -7.607  4.732   73.615  1.00 87.51  ? 261 VAL A CG2   1 
ATOM   1870 N N     . ASP A 1 282 ? -10.542 3.866   72.510  1.00 82.66  ? 262 ASP A N     1 
ATOM   1871 C CA    . ASP A 1 282 ? -11.418 2.888   73.144  1.00 80.08  ? 262 ASP A CA    1 
ATOM   1872 C C     . ASP A 1 282 ? -10.615 1.932   74.021  1.00 79.26  ? 262 ASP A C     1 
ATOM   1873 O O     . ASP A 1 282 ? -9.387  1.894   73.948  1.00 80.06  ? 262 ASP A O     1 
ATOM   1874 C CB    . ASP A 1 282 ? -12.202 2.106   72.089  1.00 79.75  ? 262 ASP A CB    1 
ATOM   1875 N N     . GLU A 1 283 ? -11.313 1.164   74.852  1.00 78.15  ? 263 GLU A N     1 
ATOM   1876 C CA    . GLU A 1 283 ? -10.660 0.193   75.723  1.00 78.20  ? 263 GLU A CA    1 
ATOM   1877 C C     . GLU A 1 283 ? -10.757 -1.219  75.157  1.00 76.98  ? 263 GLU A C     1 
ATOM   1878 O O     . GLU A 1 283 ? -11.715 -1.557  74.462  1.00 76.39  ? 263 GLU A O     1 
ATOM   1879 C CB    . GLU A 1 283 ? -11.264 0.233   77.129  1.00 79.11  ? 263 GLU A CB    1 
ATOM   1880 C CG    . GLU A 1 283 ? -10.713 1.338   78.016  1.00 81.13  ? 263 GLU A CG    1 
ATOM   1881 C CD    . GLU A 1 283 ? -10.115 0.803   79.305  1.00 83.26  ? 263 GLU A CD    1 
ATOM   1882 O OE1   . GLU A 1 283 ? -10.119 -0.432  79.496  1.00 83.69  ? 263 GLU A OE1   1 
ATOM   1883 O OE2   . GLU A 1 283 ? -9.641  1.615   80.126  1.00 84.82  ? 263 GLU A OE2   1 
ATOM   1884 N N     . LEU A 1 284 ? -9.757  -2.039  75.463  1.00 76.85  ? 264 LEU A N     1 
ATOM   1885 C CA    . LEU A 1 284 ? -9.710  -3.412  74.977  1.00 76.36  ? 264 LEU A CA    1 
ATOM   1886 C C     . LEU A 1 284 ? -9.743  -4.414  76.125  1.00 76.13  ? 264 LEU A C     1 
ATOM   1887 O O     . LEU A 1 284 ? -9.022  -4.267  77.112  1.00 77.02  ? 264 LEU A O     1 
ATOM   1888 C CB    . LEU A 1 284 ? -8.458  -3.635  74.126  1.00 77.48  ? 264 LEU A CB    1 
ATOM   1889 C CG    . LEU A 1 284 ? -8.204  -5.067  73.650  1.00 78.31  ? 264 LEU A CG    1 
ATOM   1890 C CD1   . LEU A 1 284 ? -9.345  -5.551  72.769  1.00 78.34  ? 264 LEU A CD1   1 
ATOM   1891 C CD2   . LEU A 1 284 ? -6.875  -5.165  72.919  1.00 79.57  ? 264 LEU A CD2   1 
ATOM   1892 N N     . LEU A 1 285 ? -10.588 -5.431  75.990  1.00 75.44  ? 265 LEU A N     1 
ATOM   1893 C CA    . LEU A 1 285 ? -10.670 -6.500  76.977  1.00 75.93  ? 265 LEU A CA    1 
ATOM   1894 C C     . LEU A 1 285 ? -10.164 -7.813  76.387  1.00 76.93  ? 265 LEU A C     1 
ATOM   1895 O O     . LEU A 1 285 ? -10.862 -8.467  75.611  1.00 77.69  ? 265 LEU A O     1 
ATOM   1896 C CB    . LEU A 1 285 ? -12.106 -6.663  77.482  1.00 76.05  ? 265 LEU A CB    1 
ATOM   1897 C CG    . LEU A 1 285 ? -12.500 -5.902  78.752  1.00 76.56  ? 265 LEU A CG    1 
ATOM   1898 C CD1   . LEU A 1 285 ? -12.265 -4.405  78.607  1.00 75.44  ? 265 LEU A CD1   1 
ATOM   1899 C CD2   . LEU A 1 285 ? -13.951 -6.184  79.111  1.00 77.49  ? 265 LEU A CD2   1 
ATOM   1900 N N     . ALA A 1 286 ? -8.945  -8.189  76.758  1.00 77.24  ? 266 ALA A N     1 
ATOM   1901 C CA    . ALA A 1 286 ? -8.324  -9.404  76.244  1.00 77.75  ? 266 ALA A CA    1 
ATOM   1902 C C     . ALA A 1 286 ? -8.652  -10.606 77.122  1.00 78.72  ? 266 ALA A C     1 
ATOM   1903 O O     . ALA A 1 286 ? -8.316  -10.630 78.305  1.00 79.67  ? 266 ALA A O     1 
ATOM   1904 C CB    . ALA A 1 286 ? -6.822  -9.223  76.140  1.00 78.57  ? 266 ALA A CB    1 
ATOM   1905 N N     . LEU A 1 287 ? -9.300  -11.605 76.533  1.00 78.95  ? 267 LEU A N     1 
ATOM   1906 C CA    . LEU A 1 287 ? -9.713  -12.784 77.282  1.00 80.75  ? 267 LEU A CA    1 
ATOM   1907 C C     . LEU A 1 287 ? -8.940  -14.031 76.863  1.00 82.36  ? 267 LEU A C     1 
ATOM   1908 O O     . LEU A 1 287 ? -9.026  -14.473 75.718  1.00 82.63  ? 267 LEU A O     1 
ATOM   1909 C CB    . LEU A 1 287 ? -11.215 -13.021 77.111  1.00 81.15  ? 267 LEU A CB    1 
ATOM   1910 C CG    . LEU A 1 287 ? -11.798 -14.212 77.874  1.00 83.77  ? 267 LEU A CG    1 
ATOM   1911 C CD1   . LEU A 1 287 ? -11.524 -14.077 79.364  1.00 84.87  ? 267 LEU A CD1   1 
ATOM   1912 C CD2   . LEU A 1 287 ? -13.289 -14.339 77.609  1.00 84.71  ? 267 LEU A CD2   1 
ATOM   1913 N N     . TYR A 1 288 ? -8.184  -14.591 77.802  1.00 84.09  ? 268 TYR A N     1 
ATOM   1914 C CA    . TYR A 1 288 ? -7.474  -15.844 77.574  1.00 86.24  ? 268 TYR A CA    1 
ATOM   1915 C C     . TYR A 1 288 ? -8.250  -17.008 78.179  1.00 89.02  ? 268 TYR A C     1 
ATOM   1916 O O     . TYR A 1 288 ? -8.038  -17.370 79.336  1.00 91.22  ? 268 TYR A O     1 
ATOM   1917 C CB    . TYR A 1 288 ? -6.064  -15.789 78.168  1.00 87.20  ? 268 TYR A CB    1 
ATOM   1918 C CG    . TYR A 1 288 ? -5.141  -14.791 77.506  1.00 85.83  ? 268 TYR A CG    1 
ATOM   1919 C CD1   . TYR A 1 288 ? -5.048  -13.485 77.971  1.00 84.62  ? 268 TYR A CD1   1 
ATOM   1920 C CD2   . TYR A 1 288 ? -4.352  -15.158 76.423  1.00 86.22  ? 268 TYR A CD2   1 
ATOM   1921 C CE1   . TYR A 1 288 ? -4.201  -12.572 77.372  1.00 83.74  ? 268 TYR A CE1   1 
ATOM   1922 C CE2   . TYR A 1 288 ? -3.502  -14.251 75.818  1.00 85.49  ? 268 TYR A CE2   1 
ATOM   1923 C CZ    . TYR A 1 288 ? -3.431  -12.960 76.296  1.00 84.29  ? 268 TYR A CZ    1 
ATOM   1924 O OH    . TYR A 1 288 ? -2.587  -12.054 75.697  1.00 84.14  ? 268 TYR A OH    1 
ATOM   1925 N N     . LYS A 1 289 ? -9.150  -17.590 77.393  1.00 89.61  ? 269 LYS A N     1 
ATOM   1926 C CA    . LYS A 1 289 ? -9.973  -18.699 77.862  1.00 92.92  ? 269 LYS A CA    1 
ATOM   1927 C C     . LYS A 1 289 ? -9.311  -20.044 77.576  1.00 96.05  ? 269 LYS A C     1 
ATOM   1928 O O     . LYS A 1 289 ? -8.885  -20.303 76.450  1.00 95.70  ? 269 LYS A O     1 
ATOM   1929 C CB    . LYS A 1 289 ? -11.358 -18.648 77.214  1.00 92.81  ? 269 LYS A CB    1 
ATOM   1930 N N     . PRO A 1 290 ? -9.222  -20.904 78.604  1.00 99.44  ? 270 PRO A N     1 
ATOM   1931 C CA    . PRO A 1 290 ? -8.615  -22.236 78.495  1.00 102.51 ? 270 PRO A CA    1 
ATOM   1932 C C     . PRO A 1 290 ? -9.295  -23.110 77.445  1.00 104.25 ? 270 PRO A C     1 
ATOM   1933 O O     . PRO A 1 290 ? -10.520 -23.121 77.325  1.00 105.00 ? 270 PRO A O     1 
ATOM   1934 C CB    . PRO A 1 290 ? -8.808  -22.825 79.896  1.00 105.96 ? 270 PRO A CB    1 
ATOM   1935 C CG    . PRO A 1 290 ? -8.939  -21.642 80.790  1.00 104.25 ? 270 PRO A CG    1 
ATOM   1936 C CD    . PRO A 1 290 ? -9.663  -20.612 79.978  1.00 100.69 ? 270 PRO A CD    1 
ATOM   1937 O "O5'" . DT  B 2 1   ? 34.919  23.972  92.876  1.00 79.90  ? 1   DT  F "O5'" 1 
ATOM   1938 C "C5'" . DT  B 2 1   ? 35.723  23.055  92.144  1.00 80.26  ? 1   DT  F "C5'" 1 
ATOM   1939 C "C4'" . DT  B 2 1   ? 36.045  23.600  90.764  1.00 81.87  ? 1   DT  F "C4'" 1 
ATOM   1940 O "O4'" . DT  B 2 1   ? 36.760  22.590  90.008  1.00 82.37  ? 1   DT  F "O4'" 1 
ATOM   1941 C "C3'" . DT  B 2 1   ? 34.832  23.946  89.914  1.00 80.57  ? 1   DT  F "C3'" 1 
ATOM   1942 O "O3'" . DT  B 2 1   ? 35.176  24.941  88.956  1.00 82.98  ? 1   DT  F "O3'" 1 
ATOM   1943 C "C2'" . DT  B 2 1   ? 34.525  22.614  89.245  1.00 78.94  ? 1   DT  F "C2'" 1 
ATOM   1944 C "C1'" . DT  B 2 1   ? 35.928  22.075  88.984  1.00 80.53  ? 1   DT  F "C1'" 1 
ATOM   1945 N N1    . DT  B 2 1   ? 36.006  20.588  89.014  1.00 78.29  ? 1   DT  F N1    1 
ATOM   1946 C C2    . DT  B 2 1   ? 36.214  19.904  87.841  1.00 78.51  ? 1   DT  F C2    1 
ATOM   1947 O O2    . DT  B 2 1   ? 36.345  20.452  86.762  1.00 79.90  ? 1   DT  F O2    1 
ATOM   1948 N N3    . DT  B 2 1   ? 36.268  18.544  87.976  1.00 77.32  ? 1   DT  F N3    1 
ATOM   1949 C C4    . DT  B 2 1   ? 36.134  17.812  89.138  1.00 75.73  ? 1   DT  F C4    1 
ATOM   1950 O O4    . DT  B 2 1   ? 36.197  16.587  89.153  1.00 75.18  ? 1   DT  F O4    1 
ATOM   1951 C C5    . DT  B 2 1   ? 35.915  18.588  90.333  1.00 75.10  ? 1   DT  F C5    1 
ATOM   1952 C C7    . DT  B 2 1   ? 35.754  17.903  91.657  1.00 73.53  ? 1   DT  F C7    1 
ATOM   1953 C C6    . DT  B 2 1   ? 35.861  19.925  90.216  1.00 76.12  ? 1   DT  F C6    1 
ATOM   1954 P P     . DT  B 2 2   ? 34.053  25.532  87.969  1.00 89.76  ? 2   DT  F P     1 
ATOM   1955 O OP1   . DT  B 2 2   ? 34.451  26.911  87.609  1.00 92.63  ? 2   DT  F OP1   1 
ATOM   1956 O OP2   . DT  B 2 2   ? 32.733  25.287  88.593  1.00 86.06  ? 2   DT  F OP2   1 
ATOM   1957 O "O5'" . DT  B 2 2   ? 34.159  24.610  86.666  1.00 83.61  ? 2   DT  F "O5'" 1 
ATOM   1958 C "C5'" . DT  B 2 2   ? 35.359  24.600  85.899  1.00 85.87  ? 2   DT  F "C5'" 1 
ATOM   1959 C "C4'" . DT  B 2 2   ? 35.091  24.148  84.473  1.00 86.06  ? 2   DT  F "C4'" 1 
ATOM   1960 O "O4'" . DT  B 2 2   ? 35.076  22.697  84.412  1.00 84.51  ? 2   DT  F "O4'" 1 
ATOM   1961 C "C3'" . DT  B 2 2   ? 33.758  24.615  83.884  1.00 85.02  ? 2   DT  F "C3'" 1 
ATOM   1962 O "O3'" . DT  B 2 2   ? 33.948  25.054  82.545  1.00 87.68  ? 2   DT  F "O3'" 1 
ATOM   1963 C "C2'" . DT  B 2 2   ? 32.886  23.362  83.947  1.00 82.10  ? 2   DT  F "C2'" 1 
ATOM   1964 C "C1'" . DT  B 2 2   ? 33.917  22.266  83.735  1.00 82.68  ? 2   DT  F "C1'" 1 
ATOM   1965 N N1    . DT  B 2 2   ? 33.511  20.947  84.294  1.00 79.48  ? 2   DT  F N1    1 
ATOM   1966 C C2    . DT  B 2 2   ? 33.432  19.857  83.459  1.00 79.34  ? 2   DT  F C2    1 
ATOM   1967 O O2    . DT  B 2 2   ? 33.676  19.911  82.267  1.00 81.85  ? 2   DT  F O2    1 
ATOM   1968 N N3    . DT  B 2 2   ? 33.055  18.692  84.072  1.00 76.79  ? 2   DT  F N3    1 
ATOM   1969 C C4    . DT  B 2 2   ? 32.756  18.512  85.409  1.00 74.87  ? 2   DT  F C4    1 
ATOM   1970 O O4    . DT  B 2 2   ? 32.426  17.423  85.866  1.00 73.74  ? 2   DT  F O4    1 
ATOM   1971 C C5    . DT  B 2 2   ? 32.858  19.695  86.230  1.00 74.95  ? 2   DT  F C5    1 
ATOM   1972 C C7    . DT  B 2 2   ? 32.558  19.622  87.696  1.00 72.93  ? 2   DT  F C7    1 
ATOM   1973 C C6    . DT  B 2 2   ? 33.228  20.841  85.640  1.00 77.11  ? 2   DT  F C6    1 
ATOM   1974 P P     . DT  B 2 3   ? 32.775  25.840  81.779  1.00 100.45 ? 3   DT  F P     1 
ATOM   1975 O OP1   . DT  B 2 3   ? 33.409  26.718  80.771  1.00 103.71 ? 3   DT  F OP1   1 
ATOM   1976 O OP2   . DT  B 2 3   ? 31.876  26.419  82.802  1.00 98.20  ? 3   DT  F OP2   1 
ATOM   1977 O "O5'" . DT  B 2 3   ? 31.970  24.683  81.024  1.00 88.75  ? 3   DT  F "O5'" 1 
ATOM   1978 C "C5'" . DT  B 2 3   ? 32.639  23.851  80.084  1.00 89.59  ? 3   DT  F "C5'" 1 
ATOM   1979 C "C4'" . DT  B 2 3   ? 31.688  22.820  79.506  1.00 87.59  ? 3   DT  F "C4'" 1 
ATOM   1980 O "O4'" . DT  B 2 3   ? 31.576  21.695  80.413  1.00 83.86  ? 3   DT  F "O4'" 1 
ATOM   1981 C "C3'" . DT  B 2 3   ? 30.262  23.322  79.261  1.00 86.70  ? 3   DT  F "C3'" 1 
ATOM   1982 O "O3'" . DT  B 2 3   ? 29.868  23.027  77.929  1.00 89.13  ? 3   DT  F "O3'" 1 
ATOM   1983 C "C2'" . DT  B 2 3   ? 29.418  22.555  80.283  1.00 82.36  ? 3   DT  F "C2'" 1 
ATOM   1984 C "C1'" . DT  B 2 3   ? 30.234  21.287  80.474  1.00 80.97  ? 3   DT  F "C1'" 1 
ATOM   1985 N N1    . DT  B 2 3   ? 30.003  20.618  81.787  1.00 76.59  ? 3   DT  F N1    1 
ATOM   1986 C C2    . DT  B 2 3   ? 29.883  19.248  81.832  1.00 74.64  ? 3   DT  F C2    1 
ATOM   1987 O O2    . DT  B 2 3   ? 29.955  18.539  80.845  1.00 76.14  ? 3   DT  F O2    1 
ATOM   1988 N N3    . DT  B 2 3   ? 29.675  18.733  83.083  1.00 71.20  ? 3   DT  F N3    1 
ATOM   1989 C C4    . DT  B 2 3   ? 29.577  19.435  84.270  1.00 69.77  ? 3   DT  F C4    1 
ATOM   1990 O O4    . DT  B 2 3   ? 29.388  18.880  85.348  1.00 67.75  ? 3   DT  F O4    1 
ATOM   1991 C C5    . DT  B 2 3   ? 29.711  20.869  84.152  1.00 71.09  ? 3   DT  F C5    1 
ATOM   1992 C C7    . DT  B 2 3   ? 29.622  21.737  85.372  1.00 69.42  ? 3   DT  F C7    1 
ATOM   1993 C C6    . DT  B 2 3   ? 29.915  21.384  82.931  1.00 74.34  ? 3   DT  F C6    1 
ATOM   1994 P P     . DA  B 2 4   ? 28.863  24.006  77.146  1.00 97.50  ? 4   DA  F P     1 
ATOM   1995 O OP1   . DA  B 2 4   ? 29.537  24.436  75.901  1.00 100.90 ? 4   DA  F OP1   1 
ATOM   1996 O OP2   . DA  B 2 4   ? 28.373  25.018  78.107  1.00 96.19  ? 4   DA  F OP2   1 
ATOM   1997 O "O5'" . DA  B 2 4   ? 27.633  23.060  76.768  1.00 86.23  ? 4   DA  F "O5'" 1 
ATOM   1998 C "C5'" . DA  B 2 4   ? 27.864  21.849  76.063  1.00 86.38  ? 4   DA  F "C5'" 1 
ATOM   1999 C "C4'" . DA  B 2 4   ? 26.881  20.780  76.499  1.00 83.26  ? 4   DA  F "C4'" 1 
ATOM   2000 O "O4'" . DA  B 2 4   ? 27.095  20.474  77.886  1.00 79.79  ? 4   DA  F "O4'" 1 
ATOM   2001 C "C3'" . DA  B 2 4   ? 25.411  21.178  76.395  1.00 82.86  ? 4   DA  F "C3'" 1 
ATOM   2002 O "O3'" . DA  B 2 4   ? 24.849  20.623  75.207  1.00 84.95  ? 4   DA  F "O3'" 1 
ATOM   2003 C "C2'" . DA  B 2 4   ? 24.757  20.597  77.667  1.00 79.19  ? 4   DA  F "C2'" 1 
ATOM   2004 C "C1'" . DA  B 2 4   ? 25.916  19.924  78.407  1.00 77.31  ? 4   DA  F "C1'" 1 
ATOM   2005 N N9    . DA  B 2 4   ? 25.902  20.153  79.850  1.00 73.62  ? 4   DA  F N9    1 
ATOM   2006 C C8    . DA  B 2 4   ? 25.807  21.356  80.495  1.00 72.68  ? 4   DA  F C8    1 
ATOM   2007 N N7    . DA  B 2 4   ? 25.826  21.259  81.803  1.00 69.84  ? 4   DA  F N7    1 
ATOM   2008 C C5    . DA  B 2 4   ? 25.948  19.898  82.034  1.00 68.55  ? 4   DA  F C5    1 
ATOM   2009 C C6    . DA  B 2 4   ? 26.026  19.138  83.218  1.00 66.35  ? 4   DA  F C6    1 
ATOM   2010 N N6    . DA  B 2 4   ? 25.990  19.676  84.442  1.00 65.22  ? 4   DA  F N6    1 
ATOM   2011 N N1    . DA  B 2 4   ? 26.141  17.800  83.095  1.00 65.53  ? 4   DA  F N1    1 
ATOM   2012 C C2    . DA  B 2 4   ? 26.176  17.265  81.869  1.00 67.05  ? 4   DA  F C2    1 
ATOM   2013 N N3    . DA  B 2 4   ? 26.112  17.875  80.686  1.00 69.47  ? 4   DA  F N3    1 
ATOM   2014 C C4    . DA  B 2 4   ? 25.997  19.203  80.841  1.00 70.40  ? 4   DA  F C4    1 
ATOM   2015 P P     . DA  B 2 5   ? 23.281  20.781  74.889  1.00 99.24  ? 5   DA  F P     1 
ATOM   2016 O OP1   . DA  B 2 5   ? 23.117  20.680  73.423  1.00 102.70 ? 5   DA  F OP1   1 
ATOM   2017 O OP2   . DA  B 2 5   ? 22.775  21.975  75.602  1.00 98.32  ? 5   DA  F OP2   1 
ATOM   2018 O "O5'" . DA  B 2 5   ? 22.629  19.486  75.562  1.00 86.22  ? 5   DA  F "O5'" 1 
ATOM   2019 C "C5'" . DA  B 2 5   ? 23.202  18.207  75.327  1.00 86.08  ? 5   DA  F "C5'" 1 
ATOM   2020 C "C4'" . DA  B 2 5   ? 22.608  17.168  76.258  1.00 83.11  ? 5   DA  F "C4'" 1 
ATOM   2021 O "O4'" . DA  B 2 5   ? 23.030  17.437  77.616  1.00 80.08  ? 5   DA  F "O4'" 1 
ATOM   2022 C "C3'" . DA  B 2 5   ? 21.078  17.122  76.277  1.00 82.65  ? 5   DA  F "C3'" 1 
ATOM   2023 O "O3'" . DA  B 2 5   ? 20.633  15.816  75.930  1.00 83.26  ? 5   DA  F "O3'" 1 
ATOM   2024 C "C2'" . DA  B 2 5   ? 20.700  17.493  77.720  1.00 79.11  ? 5   DA  F "C2'" 1 
ATOM   2025 C "C1'" . DA  B 2 5   ? 21.969  17.169  78.494  1.00 77.35  ? 5   DA  F "C1'" 1 
ATOM   2026 N N9    . DA  B 2 5   ? 22.147  17.992  79.689  1.00 74.80  ? 5   DA  F N9    1 
ATOM   2027 C C8    . DA  B 2 5   ? 22.073  19.355  79.768  1.00 75.17  ? 5   DA  F C8    1 
ATOM   2028 N N7    . DA  B 2 5   ? 22.281  19.828  80.975  1.00 72.97  ? 5   DA  F N7    1 
ATOM   2029 C C5    . DA  B 2 5   ? 22.511  18.697  81.741  1.00 70.61  ? 5   DA  F C5    1 
ATOM   2030 C C6    . DA  B 2 5   ? 22.796  18.518  83.109  1.00 67.79  ? 5   DA  F C6    1 
ATOM   2031 N N6    . DA  B 2 5   ? 22.901  19.529  83.978  1.00 66.57  ? 5   DA  F N6    1 
ATOM   2032 N N1    . DA  B 2 5   ? 22.970  17.256  83.552  1.00 66.93  ? 5   DA  F N1    1 
ATOM   2033 C C2    . DA  B 2 5   ? 22.864  16.246  82.680  1.00 68.28  ? 5   DA  F C2    1 
ATOM   2034 N N3    . DA  B 2 5   ? 22.601  16.289  81.374  1.00 70.72  ? 5   DA  F N3    1 
ATOM   2035 C C4    . DA  B 2 5   ? 22.433  17.556  80.964  1.00 71.82  ? 5   DA  F C4    1 
ATOM   2036 P P     . DA  B 2 6   ? 19.063  15.487  75.826  1.00 91.83  ? 6   DA  F P     1 
ATOM   2037 O OP1   . DA  B 2 6   ? 18.890  14.479  74.758  1.00 94.38  ? 6   DA  F OP1   1 
ATOM   2038 O OP2   . DA  B 2 6   ? 18.320  16.765  75.753  1.00 92.40  ? 6   DA  F OP2   1 
ATOM   2039 O "O5'" . DA  B 2 6   ? 18.739  14.804  77.232  1.00 82.92  ? 6   DA  F "O5'" 1 
ATOM   2040 C "C5'" . DA  B 2 6   ? 19.649  13.860  77.777  1.00 81.38  ? 6   DA  F "C5'" 1 
ATOM   2041 C "C4'" . DA  B 2 6   ? 19.339  13.590  79.235  1.00 77.55  ? 6   DA  F "C4'" 1 
ATOM   2042 O "O4'" . DA  B 2 6   ? 19.803  14.691  80.041  1.00 75.64  ? 6   DA  F "O4'" 1 
ATOM   2043 C "C3'" . DA  B 2 6   ? 17.853  13.430  79.554  1.00 76.71  ? 6   DA  F "C3'" 1 
ATOM   2044 O "O3'" . DA  B 2 6   ? 17.582  12.078  79.896  1.00 76.34  ? 6   DA  F "O3'" 1 
ATOM   2045 C "C2'" . DA  B 2 6   ? 17.600  14.384  80.738  1.00 73.77  ? 6   DA  F "C2'" 1 
ATOM   2046 C "C1'" . DA  B 2 6   ? 19.004  14.766  81.189  1.00 72.41  ? 6   DA  F "C1'" 1 
ATOM   2047 N N9    . DA  B 2 6   ? 19.099  16.121  81.728  1.00 70.35  ? 6   DA  F N9    1 
ATOM   2048 C C8    . DA  B 2 6   ? 18.895  17.292  81.052  1.00 71.69  ? 6   DA  F C8    1 
ATOM   2049 N N7    . DA  B 2 6   ? 19.054  18.364  81.792  1.00 70.33  ? 6   DA  F N7    1 
ATOM   2050 C C5    . DA  B 2 6   ? 19.387  17.862  83.039  1.00 67.18  ? 6   DA  F C5    1 
ATOM   2051 C C6    . DA  B 2 6   ? 19.682  18.487  84.267  1.00 64.62  ? 6   DA  F C6    1 
ATOM   2052 N N6    . DA  B 2 6   ? 19.688  19.813  84.436  1.00 65.05  ? 6   DA  F N6    1 
ATOM   2053 N N1    . DA  B 2 6   ? 19.974  17.694  85.319  1.00 62.18  ? 6   DA  F N1    1 
ATOM   2054 C C2    . DA  B 2 6   ? 19.967  16.367  85.147  1.00 62.15  ? 6   DA  F C2    1 
ATOM   2055 N N3    . DA  B 2 6   ? 19.705  15.665  84.044  1.00 64.23  ? 6   DA  F N3    1 
ATOM   2056 C C4    . DA  B 2 6   ? 19.420  16.480  83.017  1.00 66.96  ? 6   DA  F C4    1 
ATOM   2057 P P     . DG  B 2 7   ? 16.098  11.621  80.306  1.00 92.34  ? 7   DG  F P     1 
ATOM   2058 O OP1   . DG  B 2 7   ? 15.954  10.198  79.928  1.00 93.40  ? 7   DG  F OP1   1 
ATOM   2059 O OP2   . DG  B 2 7   ? 15.140  12.619  79.778  1.00 93.62  ? 7   DG  F OP2   1 
ATOM   2060 O "O5'" . DG  B 2 7   ? 16.103  11.732  81.899  1.00 74.02  ? 7   DG  F "O5'" 1 
ATOM   2061 C "C5'" . DG  B 2 7   ? 17.213  11.229  82.634  1.00 71.90  ? 7   DG  F "C5'" 1 
ATOM   2062 C "C4'" . DG  B 2 7   ? 17.109  11.612  84.098  1.00 67.88  ? 7   DG  F "C4'" 1 
ATOM   2063 O "O4'" . DG  B 2 7   ? 17.428  13.018  84.261  1.00 66.69  ? 7   DG  F "O4'" 1 
ATOM   2064 C "C3'" . DG  B 2 7   ? 15.726  11.407  84.721  1.00 66.06  ? 7   DG  F "C3'" 1 
ATOM   2065 O "O3'" . DG  B 2 7   ? 15.852  10.718  85.957  1.00 63.96  ? 7   DG  F "O3'" 1 
ATOM   2066 C "C2'" . DG  B 2 7   ? 15.202  12.832  84.916  1.00 65.09  ? 7   DG  F "C2'" 1 
ATOM   2067 C "C1'" . DG  B 2 7   ? 16.489  13.608  85.125  1.00 64.04  ? 7   DG  F "C1'" 1 
ATOM   2068 N N9    . DG  B 2 7   ? 16.378  15.025  84.790  1.00 63.14  ? 7   DG  F N9    1 
ATOM   2069 C C8    . DG  B 2 7   ? 16.069  15.564  83.565  1.00 64.92  ? 7   DG  F C8    1 
ATOM   2070 N N7    . DG  B 2 7   ? 16.043  16.868  83.563  1.00 64.86  ? 7   DG  F N7    1 
ATOM   2071 C C5    . DG  B 2 7   ? 16.355  17.216  84.870  1.00 62.05  ? 7   DG  F C5    1 
ATOM   2072 C C6    . DG  B 2 7   ? 16.477  18.492  85.469  1.00 61.27  ? 7   DG  F C6    1 
ATOM   2073 O O6    . DG  B 2 7   ? 16.327  19.603  84.945  1.00 62.85  ? 7   DG  F O6    1 
ATOM   2074 N N1    . DG  B 2 7   ? 16.807  18.398  86.819  1.00 59.14  ? 7   DG  F N1    1 
ATOM   2075 C C2    . DG  B 2 7   ? 16.997  17.220  87.502  1.00 57.93  ? 7   DG  F C2    1 
ATOM   2076 N N2    . DG  B 2 7   ? 17.310  17.330  88.801  1.00 56.65  ? 7   DG  F N2    1 
ATOM   2077 N N3    . DG  B 2 7   ? 16.887  16.018  86.952  1.00 58.20  ? 7   DG  F N3    1 
ATOM   2078 C C4    . DG  B 2 7   ? 16.564  16.092  85.638  1.00 60.81  ? 7   DG  F C4    1 
ATOM   2079 P P     . DA  B 2 8   ? 14.546  10.314  86.802  1.00 83.28  ? 8   DA  F P     1 
ATOM   2080 O OP1   . DA  B 2 8   ? 14.824  9.010   87.443  1.00 82.41  ? 8   DA  F OP1   1 
ATOM   2081 O OP2   . DA  B 2 8   ? 13.360  10.464  85.930  1.00 84.53  ? 8   DA  F OP2   1 
ATOM   2082 O "O5'" . DA  B 2 8   ? 14.473  11.436  87.938  1.00 57.82  ? 8   DA  F "O5'" 1 
ATOM   2083 C "C5'" . DA  B 2 8   ? 15.618  11.701  88.739  1.00 55.44  ? 8   DA  F "C5'" 1 
ATOM   2084 C "C4'" . DA  B 2 8   ? 15.323  12.771  89.774  1.00 52.99  ? 8   DA  F "C4'" 1 
ATOM   2085 O "O4'" . DA  B 2 8   ? 15.353  14.081  89.149  1.00 53.58  ? 8   DA  F "O4'" 1 
ATOM   2086 C "C3'" . DA  B 2 8   ? 13.965  12.653  90.464  1.00 51.77  ? 8   DA  F "C3'" 1 
ATOM   2087 O "O3'" . DA  B 2 8   ? 14.114  12.905  91.853  1.00 50.29  ? 8   DA  F "O3'" 1 
ATOM   2088 C "C2'" . DA  B 2 8   ? 13.125  13.732  89.777  1.00 52.63  ? 8   DA  F "C2'" 1 
ATOM   2089 C "C1'" . DA  B 2 8   ? 14.174  14.788  89.461  1.00 53.14  ? 8   DA  F "C1'" 1 
ATOM   2090 N N9    . DA  B 2 8   ? 13.832  15.629  88.316  1.00 54.90  ? 8   DA  F N9    1 
ATOM   2091 C C8    . DA  B 2 8   ? 13.505  15.211  87.056  1.00 56.35  ? 8   DA  F C8    1 
ATOM   2092 N N7    . DA  B 2 8   ? 13.252  16.191  86.221  1.00 57.84  ? 8   DA  F N7    1 
ATOM   2093 C C5    . DA  B 2 8   ? 13.431  17.333  86.985  1.00 56.95  ? 8   DA  F C5    1 
ATOM   2094 C C6    . DA  B 2 8   ? 13.314  18.704  86.683  1.00 57.47  ? 8   DA  F C6    1 
ATOM   2095 N N6    . DA  B 2 8   ? 12.974  19.165  85.476  1.00 58.52  ? 8   DA  F N6    1 
ATOM   2096 N N1    . DA  B 2 8   ? 13.560  19.585  87.675  1.00 56.36  ? 8   DA  F N1    1 
ATOM   2097 C C2    . DA  B 2 8   ? 13.900  19.119  88.882  1.00 54.86  ? 8   DA  F C2    1 
ATOM   2098 N N3    . DA  B 2 8   ? 14.042  17.857  89.285  1.00 54.27  ? 8   DA  F N3    1 
ATOM   2099 C C4    . DA  B 2 8   ? 13.790  17.005  88.278  1.00 55.36  ? 8   DA  F C4    1 
ATOM   2100 P P     . DT  B 2 9   ? 12.875  12.719  92.858  1.00 56.45  ? 9   DT  F P     1 
ATOM   2101 O OP1   . DT  B 2 9   ? 13.403  12.120  94.103  1.00 55.09  ? 9   DT  F OP1   1 
ATOM   2102 O OP2   . DT  B 2 9   ? 11.770  12.057  92.130  1.00 57.51  ? 9   DT  F OP2   1 
ATOM   2103 O "O5'" . DT  B 2 9   ? 12.429  14.217  93.176  1.00 48.63  ? 9   DT  F "O5'" 1 
ATOM   2104 C "C5'" . DT  B 2 9   ? 13.396  15.160  93.611  1.00 48.12  ? 9   DT  F "C5'" 1 
ATOM   2105 C "C4'" . DT  B 2 9   ? 12.767  16.526  93.781  1.00 48.44  ? 9   DT  F "C4'" 1 
ATOM   2106 O "O4'" . DT  B 2 9   ? 12.609  17.148  92.489  1.00 51.01  ? 9   DT  F "O4'" 1 
ATOM   2107 C "C3'" . DT  B 2 9   ? 11.378  16.511  94.426  1.00 47.50  ? 9   DT  F "C3'" 1 
ATOM   2108 O "O3'" . DT  B 2 9   ? 11.402  17.251  95.635  1.00 46.53  ? 9   DT  F "O3'" 1 
ATOM   2109 C "C2'" . DT  B 2 9   ? 10.456  17.155  93.378  1.00 49.58  ? 9   DT  F "C2'" 1 
ATOM   2110 C "C1'" . DT  B 2 9   ? 11.434  17.911  92.491  1.00 51.61  ? 9   DT  F "C1'" 1 
ATOM   2111 N N1    . DT  B 2 9   ? 10.975  18.058  91.081  1.00 53.65  ? 9   DT  F N1    1 
ATOM   2112 C C2    . DT  B 2 9   ? 10.822  19.316  90.552  1.00 54.50  ? 9   DT  F C2    1 
ATOM   2113 O O2    . DT  B 2 9   ? 11.036  20.335  91.182  1.00 53.92  ? 9   DT  F O2    1 
ATOM   2114 N N3    . DT  B 2 9   ? 10.403  19.341  89.247  1.00 55.95  ? 9   DT  F N3    1 
ATOM   2115 C C4    . DT  B 2 9   ? 10.130  18.255  88.436  1.00 56.71  ? 9   DT  F C4    1 
ATOM   2116 O O4    . DT  B 2 9   ? 9.758   18.380  87.274  1.00 58.35  ? 9   DT  F O4    1 
ATOM   2117 C C5    . DT  B 2 9   ? 10.314  16.962  89.054  1.00 55.45  ? 9   DT  F C5    1 
ATOM   2118 C C7    . DT  B 2 9   ? 10.049  15.709  88.274  1.00 55.81  ? 9   DT  F C7    1 
ATOM   2119 C C6    . DT  B 2 9   ? 10.724  16.927  90.331  1.00 53.94  ? 9   DT  F C6    1 
ATOM   2120 P P     . DC  B 2 10  ? 10.349  16.922  96.801  1.00 50.27  ? 10  DC  F P     1 
ATOM   2121 O OP1   . DC  B 2 10  ? 10.982  17.267  98.092  1.00 49.33  ? 10  DC  F OP1   1 
ATOM   2122 O OP2   . DC  B 2 10  ? 9.841   15.551  96.571  1.00 49.80  ? 10  DC  F OP2   1 
ATOM   2123 O "O5'" . DC  B 2 10  ? 9.155   17.947  96.524  1.00 46.09  ? 10  DC  F "O5'" 1 
ATOM   2124 C "C5'" . DC  B 2 10  ? 9.431   19.338  96.437  1.00 46.43  ? 10  DC  F "C5'" 1 
ATOM   2125 C "C4'" . DC  B 2 10  ? 8.271   20.086  95.805  1.00 46.93  ? 10  DC  F "C4'" 1 
ATOM   2126 O "O4'" . DC  B 2 10  ? 8.292   19.910  94.361  1.00 48.15  ? 10  DC  F "O4'" 1 
ATOM   2127 C "C3'" . DC  B 2 10  ? 6.876   19.640  96.262  1.00 45.97  ? 10  DC  F "C3'" 1 
ATOM   2128 O "O3'" . DC  B 2 10  ? 6.069   20.782  96.485  1.00 47.41  ? 10  DC  F "O3'" 1 
ATOM   2129 C "C2'" . DC  B 2 10  ? 6.369   18.843  95.064  1.00 46.85  ? 10  DC  F "C2'" 1 
ATOM   2130 C "C1'" . DC  B 2 10  ? 6.981   19.647  93.934  1.00 48.88  ? 10  DC  F "C1'" 1 
ATOM   2131 N N1    . DC  B 2 10  ? 7.016   18.939  92.623  1.00 50.65  ? 10  DC  F N1    1 
ATOM   2132 C C2    . DC  B 2 10  ? 7.020   19.688  91.443  1.00 52.40  ? 10  DC  F C2    1 
ATOM   2133 O O2    . DC  B 2 10  ? 7.012   20.922  91.515  1.00 53.32  ? 10  DC  F O2    1 
ATOM   2134 N N3    . DC  B 2 10  ? 7.039   19.040  90.253  1.00 54.24  ? 10  DC  F N3    1 
ATOM   2135 C C4    . DC  B 2 10  ? 7.046   17.707  90.219  1.00 54.27  ? 10  DC  F C4    1 
ATOM   2136 N N4    . DC  B 2 10  ? 7.064   17.113  89.021  1.00 55.96  ? 10  DC  F N4    1 
ATOM   2137 C C5    . DC  B 2 10  ? 7.035   16.924  91.412  1.00 52.11  ? 10  DC  F C5    1 
ATOM   2138 C C6    . DC  B 2 10  ? 7.016   17.576  92.581  1.00 50.58  ? 10  DC  F C6    1 
ATOM   2139 P P     . DG  B 2 11  ? 4.995   20.805  97.677  1.00 50.88  ? 11  DG  F P     1 
ATOM   2140 O OP1   . DG  B 2 11  ? 5.741   20.796  98.954  1.00 49.66  ? 11  DG  F OP1   1 
ATOM   2141 O OP2   . DG  B 2 11  ? 3.993   19.751  97.403  1.00 51.13  ? 11  DG  F OP2   1 
ATOM   2142 O "O5'" . DG  B 2 11  ? 4.275   22.222  97.497  1.00 57.10  ? 11  DG  F "O5'" 1 
ATOM   2143 C "C5'" . DG  B 2 11  ? 5.057   23.386  97.238  1.00 57.38  ? 11  DG  F "C5'" 1 
ATOM   2144 C "C4'" . DG  B 2 11  ? 4.558   24.113  95.999  1.00 59.07  ? 11  DG  F "C4'" 1 
ATOM   2145 O "O4'" . DG  B 2 11  ? 4.839   23.318  94.817  1.00 59.13  ? 11  DG  F "O4'" 1 
ATOM   2146 C "C3'" . DG  B 2 11  ? 3.055   24.403  95.977  1.00 60.00  ? 11  DG  F "C3'" 1 
ATOM   2147 O "O3'" . DG  B 2 11  ? 2.823   25.742  95.559  1.00 62.77  ? 11  DG  F "O3'" 1 
ATOM   2148 C "C2'" . DG  B 2 11  ? 2.511   23.397  94.963  1.00 59.98  ? 11  DG  F "C2'" 1 
ATOM   2149 C "C1'" . DG  B 2 11  ? 3.687   23.252  94.010  1.00 60.32  ? 11  DG  F "C1'" 1 
ATOM   2150 N N9    . DG  B 2 11  ? 3.696   21.980  93.291  1.00 59.93  ? 11  DG  F N9    1 
ATOM   2151 C C8    . DG  B 2 11  ? 3.613   20.722  93.838  1.00 57.87  ? 11  DG  F C8    1 
ATOM   2152 N N7    . DG  B 2 11  ? 3.642   19.766  92.951  1.00 58.08  ? 11  DG  F N7    1 
ATOM   2153 C C5    . DG  B 2 11  ? 3.750   20.432  91.737  1.00 59.99  ? 11  DG  F C5    1 
ATOM   2154 C C6    . DG  B 2 11  ? 3.825   19.918  90.420  1.00 60.73  ? 11  DG  F C6    1 
ATOM   2155 O O6    . DG  B 2 11  ? 3.809   18.735  90.055  1.00 59.84  ? 11  DG  F O6    1 
ATOM   2156 N N1    . DG  B 2 11  ? 3.927   20.936  89.475  1.00 63.26  ? 11  DG  F N1    1 
ATOM   2157 C C2    . DG  B 2 11  ? 3.954   22.280  89.766  1.00 63.94  ? 11  DG  F C2    1 
ATOM   2158 N N2    . DG  B 2 11  ? 4.056   23.112  88.720  1.00 66.34  ? 11  DG  F N2    1 
ATOM   2159 N N3    . DG  B 2 11  ? 3.884   22.774  90.997  1.00 62.82  ? 11  DG  F N3    1 
ATOM   2160 C C4    . DG  B 2 11  ? 3.784   21.796  91.928  1.00 61.04  ? 11  DG  F C4    1 
ATOM   2161 O "O5'" . DA  C 3 1   ? 2.080   14.597  79.049  1.00 87.83  ? 1   DA  G "O5'" 1 
ATOM   2162 C "C5'" . DA  C 3 1   ? 1.393   15.298  78.015  1.00 91.01  ? 1   DA  G "C5'" 1 
ATOM   2163 C "C4'" . DA  C 3 1   ? 0.882   16.642  78.511  1.00 90.03  ? 1   DA  G "C4'" 1 
ATOM   2164 O "O4'" . DA  C 3 1   ? 0.042   16.441  79.675  1.00 88.59  ? 1   DA  G "O4'" 1 
ATOM   2165 C "C3'" . DA  C 3 1   ? 1.962   17.629  78.938  1.00 86.93  ? 1   DA  G "C3'" 1 
ATOM   2166 O "O3'" . DA  C 3 1   ? 1.554   18.959  78.649  1.00 88.32  ? 1   DA  G "O3'" 1 
ATOM   2167 C "C2'" . DA  C 3 1   ? 2.071   17.393  80.440  1.00 83.14  ? 1   DA  G "C2'" 1 
ATOM   2168 C "C1'" . DA  C 3 1   ? 0.639   17.026  80.817  1.00 84.36  ? 1   DA  G "C1'" 1 
ATOM   2169 N N9    . DA  C 3 1   ? 0.569   16.064  81.910  1.00 81.44  ? 1   DA  G N9    1 
ATOM   2170 C C8    . DA  C 3 1   ? 0.537   14.701  81.809  1.00 81.76  ? 1   DA  G C8    1 
ATOM   2171 N N7    . DA  C 3 1   ? 0.483   14.086  82.967  1.00 79.56  ? 1   DA  G N7    1 
ATOM   2172 C C5    . DA  C 3 1   ? 0.484   15.118  83.889  1.00 77.25  ? 1   DA  G C5    1 
ATOM   2173 C C6    . DA  C 3 1   ? 0.441   15.134  85.296  1.00 74.64  ? 1   DA  G C6    1 
ATOM   2174 N N6    . DA  C 3 1   ? 0.385   14.027  86.044  1.00 73.68  ? 1   DA  G N6    1 
ATOM   2175 N N1    . DA  C 3 1   ? 0.457   16.336  85.907  1.00 73.42  ? 1   DA  G N1    1 
ATOM   2176 C C2    . DA  C 3 1   ? 0.512   17.441  85.153  1.00 74.13  ? 1   DA  G C2    1 
ATOM   2177 N N3    . DA  C 3 1   ? 0.556   17.552  83.830  1.00 76.26  ? 1   DA  G N3    1 
ATOM   2178 C C4    . DA  C 3 1   ? 0.539   16.343  83.253  1.00 78.05  ? 1   DA  G C4    1 
ATOM   2179 P P     . DC  C 3 2   ? 2.628   20.153  78.689  1.00 98.19  ? 2   DC  G P     1 
ATOM   2180 O OP1   . DC  C 3 2   ? 2.154   21.215  77.775  1.00 100.94 ? 2   DC  G OP1   1 
ATOM   2181 O OP2   . DC  C 3 2   ? 3.969   19.559  78.499  1.00 96.69  ? 2   DC  G OP2   1 
ATOM   2182 O "O5'" . DC  C 3 2   ? 2.547   20.693  80.192  1.00 86.34  ? 2   DC  G "O5'" 1 
ATOM   2183 C "C5'" . DC  C 3 2   ? 1.447   21.496  80.600  1.00 87.15  ? 2   DC  G "C5'" 1 
ATOM   2184 C "C4'" . DC  C 3 2   ? 1.873   22.482  81.670  1.00 84.73  ? 2   DC  G "C4'" 1 
ATOM   2185 O "O4'" . DC  C 3 2   ? 1.834   21.836  82.968  1.00 81.84  ? 2   DC  G "O4'" 1 
ATOM   2186 C "C3'" . DC  C 3 2   ? 3.292   23.034  81.504  1.00 83.50  ? 2   DC  G "C3'" 1 
ATOM   2187 O "O3'" . DC  C 3 2   ? 3.289   24.450  81.651  1.00 84.53  ? 2   DC  G "O3'" 1 
ATOM   2188 C "C2'" . DC  C 3 2   ? 4.082   22.350  82.621  1.00 79.84  ? 2   DC  G "C2'" 1 
ATOM   2189 C "C1'" . DC  C 3 2   ? 3.011   22.134  83.677  1.00 78.60  ? 2   DC  G "C1'" 1 
ATOM   2190 N N1    . DC  C 3 2   ? 3.304   20.999  84.602  1.00 74.91  ? 2   DC  G N1    1 
ATOM   2191 C C2    . DC  C 3 2   ? 3.444   21.242  85.973  1.00 72.21  ? 2   DC  G C2    1 
ATOM   2192 O O2    . DC  C 3 2   ? 3.323   22.397  86.396  1.00 72.57  ? 2   DC  G O2    1 
ATOM   2193 N N3    . DC  C 3 2   ? 3.708   20.200  86.800  1.00 69.50  ? 2   DC  G N3    1 
ATOM   2194 C C4    . DC  C 3 2   ? 3.830   18.967  86.304  1.00 68.91  ? 2   DC  G C4    1 
ATOM   2195 N N4    . DC  C 3 2   ? 4.091   17.973  87.159  1.00 66.51  ? 2   DC  G N4    1 
ATOM   2196 C C5    . DC  C 3 2   ? 3.692   18.701  84.910  1.00 71.44  ? 2   DC  G C5    1 
ATOM   2197 C C6    . DC  C 3 2   ? 3.430   19.736  84.104  1.00 74.12  ? 2   DC  G C6    1 
ATOM   2198 P P     . DG  C 3 3   ? 4.375   25.343  80.872  1.00 94.28  ? 3   DG  G P     1 
ATOM   2199 O OP1   . DG  C 3 3   ? 3.706   26.590  80.441  1.00 96.76  ? 3   DG  G OP1   1 
ATOM   2200 O OP2   . DG  C 3 3   ? 5.035   24.478  79.870  1.00 94.76  ? 3   DG  G OP2   1 
ATOM   2201 O "O5'" . DG  C 3 3   ? 5.458   25.695  81.994  1.00 84.25  ? 3   DG  G "O5'" 1 
ATOM   2202 C "C5'" . DG  C 3 3   ? 5.089   26.493  83.111  1.00 83.31  ? 3   DG  G "C5'" 1 
ATOM   2203 C "C4'" . DG  C 3 3   ? 6.179   26.484  84.168  1.00 80.83  ? 3   DG  G "C4'" 1 
ATOM   2204 O "O4'" . DG  C 3 3   ? 6.119   25.244  84.925  1.00 78.01  ? 3   DG  G "O4'" 1 
ATOM   2205 C "C3'" . DG  C 3 3   ? 7.609   26.581  83.631  1.00 81.13  ? 3   DG  G "C3'" 1 
ATOM   2206 O "O3'" . DG  C 3 3   ? 8.378   27.426  84.472  1.00 81.15  ? 3   DG  G "O3'" 1 
ATOM   2207 C "C2'" . DG  C 3 3   ? 8.098   25.136  83.709  1.00 78.85  ? 3   DG  G "C2'" 1 
ATOM   2208 C "C1'" . DG  C 3 3   ? 7.408   24.679  84.982  1.00 76.32  ? 3   DG  G "C1'" 1 
ATOM   2209 N N9    . DG  C 3 3   ? 7.280   23.231  85.103  1.00 73.71  ? 3   DG  G N9    1 
ATOM   2210 C C8    . DG  C 3 3   ? 7.175   22.316  84.082  1.00 73.89  ? 3   DG  G C8    1 
ATOM   2211 N N7    . DG  C 3 3   ? 7.071   21.084  84.499  1.00 71.89  ? 3   DG  G N7    1 
ATOM   2212 C C5    . DG  C 3 3   ? 7.108   21.189  85.883  1.00 69.76  ? 3   DG  G C5    1 
ATOM   2213 C C6    . DG  C 3 3   ? 7.036   20.184  86.878  1.00 67.09  ? 3   DG  G C6    1 
ATOM   2214 O O6    . DG  C 3 3   ? 6.921   18.960  86.726  1.00 66.32  ? 3   DG  G O6    1 
ATOM   2215 N N1    . DG  C 3 3   ? 7.111   20.722  88.161  1.00 65.90  ? 3   DG  G N1    1 
ATOM   2216 C C2    . DG  C 3 3   ? 7.240   22.062  88.445  1.00 67.00  ? 3   DG  G C2    1 
ATOM   2217 N N2    . DG  C 3 3   ? 7.297   22.393  89.743  1.00 66.06  ? 3   DG  G N2    1 
ATOM   2218 N N3    . DG  C 3 3   ? 7.308   23.012  87.523  1.00 69.33  ? 3   DG  G N3    1 
ATOM   2219 C C4    . DG  C 3 3   ? 7.236   22.504  86.269  1.00 70.78  ? 3   DG  G C4    1 
ATOM   2220 P P     . DA  C 3 4   ? 9.323   28.562  83.842  1.00 82.97  ? 4   DA  G P     1 
ATOM   2221 O OP1   . DA  C 3 4   ? 8.449   29.660  83.372  1.00 85.30  ? 4   DA  G OP1   1 
ATOM   2222 O OP2   . DA  C 3 4   ? 10.255  27.904  82.899  1.00 83.39  ? 4   DA  G OP2   1 
ATOM   2223 O "O5'" . DA  C 3 4   ? 10.177  29.078  85.092  1.00 88.28  ? 4   DA  G "O5'" 1 
ATOM   2224 C "C5'" . DA  C 3 4   ? 9.515   29.507  86.276  1.00 87.61  ? 4   DA  G "C5'" 1 
ATOM   2225 C "C4'" . DA  C 3 4   ? 10.188  28.935  87.511  1.00 85.60  ? 4   DA  G "C4'" 1 
ATOM   2226 O "O4'" . DA  C 3 4   ? 9.931   27.507  87.586  1.00 83.10  ? 4   DA  G "O4'" 1 
ATOM   2227 C "C3'" . DA  C 3 4   ? 11.706  29.103  87.557  1.00 86.45  ? 4   DA  G "C3'" 1 
ATOM   2228 O "O3'" . DA  C 3 4   ? 12.118  29.457  88.872  1.00 86.33  ? 4   DA  G "O3'" 1 
ATOM   2229 C "C2'" . DA  C 3 4   ? 12.229  27.725  87.154  1.00 84.63  ? 4   DA  G "C2'" 1 
ATOM   2230 C "C1'" . DA  C 3 4   ? 11.149  26.801  87.698  1.00 82.22  ? 4   DA  G "C1'" 1 
ATOM   2231 N N9    . DA  C 3 4   ? 11.026  25.555  86.946  1.00 81.13  ? 4   DA  G N9    1 
ATOM   2232 C C8    . DA  C 3 4   ? 11.025  25.412  85.587  1.00 82.44  ? 4   DA  G C8    1 
ATOM   2233 N N7    . DA  C 3 4   ? 10.900  24.170  85.184  1.00 81.31  ? 4   DA  G N7    1 
ATOM   2234 C C5    . DA  C 3 4   ? 10.810  23.447  86.361  1.00 78.99  ? 4   DA  G C5    1 
ATOM   2235 C C6    . DA  C 3 4   ? 10.662  22.070  86.620  1.00 76.85  ? 4   DA  G C6    1 
ATOM   2236 N N6    . DA  C 3 4   ? 10.575  21.145  85.658  1.00 76.87  ? 4   DA  G N6    1 
ATOM   2237 N N1    . DA  C 3 4   ? 10.607  21.679  87.910  1.00 75.18  ? 4   DA  G N1    1 
ATOM   2238 C C2    . DA  C 3 4   ? 10.695  22.607  88.870  1.00 75.39  ? 4   DA  G C2    1 
ATOM   2239 N N3    . DA  C 3 4   ? 10.835  23.927  88.750  1.00 77.21  ? 4   DA  G N3    1 
ATOM   2240 C C4    . DA  C 3 4   ? 10.887  24.285  87.458  1.00 78.94  ? 4   DA  G C4    1 
ATOM   2241 P P     . DT  C 3 5   ? 13.647  29.859  89.162  1.00 99.36  ? 5   DT  G P     1 
ATOM   2242 O OP1   . DT  C 3 5   ? 13.638  30.981  90.127  1.00 100.80 ? 5   DT  G OP1   1 
ATOM   2243 O OP2   . DT  C 3 5   ? 14.335  30.020  87.862  1.00 101.13 ? 5   DT  G OP2   1 
ATOM   2244 O "O5'" . DT  C 3 5   ? 14.248  28.564  89.883  1.00 87.54  ? 5   DT  G "O5'" 1 
ATOM   2245 C "C5'" . DT  C 3 5   ? 13.649  28.079  91.078  1.00 85.26  ? 5   DT  G "C5'" 1 
ATOM   2246 C "C4'" . DT  C 3 5   ? 14.291  26.776  91.521  1.00 83.06  ? 5   DT  G "C4'" 1 
ATOM   2247 O "O4'" . DT  C 3 5   ? 13.833  25.688  90.674  1.00 81.47  ? 5   DT  G "O4'" 1 
ATOM   2248 C "C3'" . DT  C 3 5   ? 15.822  26.747  91.456  1.00 84.08  ? 5   DT  G "C3'" 1 
ATOM   2249 O "O3'" . DT  C 3 5   ? 16.341  26.136  92.628  1.00 82.83  ? 5   DT  G "O3'" 1 
ATOM   2250 C "C2'" . DT  C 3 5   ? 16.096  25.893  90.221  1.00 83.58  ? 5   DT  G "C2'" 1 
ATOM   2251 C "C1'" . DT  C 3 5   ? 14.944  24.910  90.302  1.00 81.02  ? 5   DT  G "C1'" 1 
ATOM   2252 N N1    . DT  C 3 5   ? 14.643  24.219  89.018  1.00 80.62  ? 5   DT  G N1    1 
ATOM   2253 C C2    . DT  C 3 5   ? 14.328  22.881  89.038  1.00 78.62  ? 5   DT  G C2    1 
ATOM   2254 O O2    . DT  C 3 5   ? 14.275  22.223  90.061  1.00 76.95  ? 5   DT  G O2    1 
ATOM   2255 N N3    . DT  C 3 5   ? 14.069  22.335  87.810  1.00 78.92  ? 5   DT  G N3    1 
ATOM   2256 C C4    . DT  C 3 5   ? 14.097  22.979  86.587  1.00 80.91  ? 5   DT  G C4    1 
ATOM   2257 O O4    . DT  C 3 5   ? 13.850  22.400  85.534  1.00 81.43  ? 5   DT  G O4    1 
ATOM   2258 C C5    . DT  C 3 5   ? 14.438  24.382  86.636  1.00 82.65  ? 5   DT  G C5    1 
ATOM   2259 C C7    . DT  C 3 5   ? 14.501  25.188  85.372  1.00 85.04  ? 5   DT  G C7    1 
ATOM   2260 C C6    . DT  C 3 5   ? 14.693  24.928  87.836  1.00 82.45  ? 5   DT  G C6    1 
ATOM   2261 P P     . DC  C 3 6   ? 17.687  26.693  93.305  1.00 95.75  ? 6   DC  G P     1 
ATOM   2262 O OP1   . DC  C 3 6   ? 17.305  27.787  94.225  1.00 97.30  ? 6   DC  G OP1   1 
ATOM   2263 O OP2   . DC  C 3 6   ? 18.660  26.947  92.220  1.00 97.61  ? 6   DC  G OP2   1 
ATOM   2264 O "O5'" . DC  C 3 6   ? 18.225  25.459  94.169  1.00 81.12  ? 6   DC  G "O5'" 1 
ATOM   2265 C "C5'" . DC  C 3 6   ? 18.982  24.425  93.546  1.00 80.06  ? 6   DC  G "C5'" 1 
ATOM   2266 C "C4'" . DC  C 3 6   ? 18.231  23.105  93.576  1.00 76.58  ? 6   DC  G "C4'" 1 
ATOM   2267 O "O4'" . DC  C 3 6   ? 17.284  23.069  92.486  1.00 75.90  ? 6   DC  G "O4'" 1 
ATOM   2268 C "C3'" . DC  C 3 6   ? 19.103  21.876  93.387  1.00 75.55  ? 6   DC  G "C3'" 1 
ATOM   2269 O "O3'" . DC  C 3 6   ? 19.580  21.430  94.652  1.00 75.13  ? 6   DC  G "O3'" 1 
ATOM   2270 C "C2'" . DC  C 3 6   ? 18.139  20.864  92.772  1.00 73.34  ? 6   DC  G "C2'" 1 
ATOM   2271 C "C1'" . DC  C 3 6   ? 17.152  21.746  91.999  1.00 73.95  ? 6   DC  G "C1'" 1 
ATOM   2272 N N1    . DC  C 3 6   ? 17.375  21.760  90.520  1.00 74.75  ? 6   DC  G N1    1 
ATOM   2273 C C2    . DC  C 3 6   ? 17.075  20.623  89.758  1.00 73.48  ? 6   DC  G C2    1 
ATOM   2274 O O2    . DC  C 3 6   ? 16.640  19.614  90.323  1.00 71.99  ? 6   DC  G O2    1 
ATOM   2275 N N3    . DC  C 3 6   ? 17.277  20.661  88.417  1.00 74.29  ? 6   DC  G N3    1 
ATOM   2276 C C4    . DC  C 3 6   ? 17.749  21.769  87.843  1.00 76.16  ? 6   DC  G C4    1 
ATOM   2277 N N4    . DC  C 3 6   ? 17.931  21.758  86.519  1.00 77.34  ? 6   DC  G N4    1 
ATOM   2278 C C5    . DC  C 3 6   ? 18.056  22.937  88.601  1.00 77.51  ? 6   DC  G C5    1 
ATOM   2279 C C6    . DC  C 3 6   ? 17.855  22.888  89.922  1.00 76.63  ? 6   DC  G C6    1 
ATOM   2280 P P     . DT  C 3 7   ? 21.045  20.782  94.785  1.00 76.12  ? 7   DT  G P     1 
ATOM   2281 O OP1   . DT  C 3 7   ? 21.290  20.530  96.222  1.00 75.82  ? 7   DT  G OP1   1 
ATOM   2282 O OP2   . DT  C 3 7   ? 21.985  21.623  94.011  1.00 78.68  ? 7   DT  G OP2   1 
ATOM   2283 O "O5'" . DT  C 3 7   ? 20.913  19.375  94.039  1.00 67.16  ? 7   DT  G "O5'" 1 
ATOM   2284 C "C5'" . DT  C 3 7   ? 20.036  18.381  94.550  1.00 64.48  ? 7   DT  G "C5'" 1 
ATOM   2285 C "C4'" . DT  C 3 7   ? 20.011  17.166  93.642  1.00 63.86  ? 7   DT  G "C4'" 1 
ATOM   2286 O "O4'" . DT  C 3 7   ? 19.617  17.566  92.304  1.00 64.88  ? 7   DT  G "O4'" 1 
ATOM   2287 C "C3'" . DT  C 3 7   ? 21.349  16.438  93.500  1.00 65.05  ? 7   DT  G "C3'" 1 
ATOM   2288 O "O3'" . DT  C 3 7   ? 21.148  15.037  93.629  1.00 64.18  ? 7   DT  G "O3'" 1 
ATOM   2289 C "C2'" . DT  C 3 7   ? 21.821  16.818  92.095  1.00 66.50  ? 7   DT  G "C2'" 1 
ATOM   2290 C "C1'" . DT  C 3 7   ? 20.503  17.009  91.362  1.00 65.87  ? 7   DT  G "C1'" 1 
ATOM   2291 N N1    . DT  C 3 7   ? 20.596  17.940  90.200  1.00 67.77  ? 7   DT  G N1    1 
ATOM   2292 C C2    . DT  C 3 7   ? 20.421  17.450  88.926  1.00 68.21  ? 7   DT  G C2    1 
ATOM   2293 O O2    . DT  C 3 7   ? 20.192  16.279  88.686  1.00 67.16  ? 7   DT  G O2    1 
ATOM   2294 N N3    . DT  C 3 7   ? 20.523  18.389  87.933  1.00 70.21  ? 7   DT  G N3    1 
ATOM   2295 C C4    . DT  C 3 7   ? 20.778  19.739  88.083  1.00 71.71  ? 7   DT  G C4    1 
ATOM   2296 O O4    . DT  C 3 7   ? 20.851  20.503  87.127  1.00 73.71  ? 7   DT  G O4    1 
ATOM   2297 C C5    . DT  C 3 7   ? 20.951  20.187  89.445  1.00 71.13  ? 7   DT  G C5    1 
ATOM   2298 C C7    . DT  C 3 7   ? 21.233  21.632  89.734  1.00 73.01  ? 7   DT  G C7    1 
ATOM   2299 C C6    . DT  C 3 7   ? 20.853  19.277  90.426  1.00 69.13  ? 7   DT  G C6    1 
ATOM   2300 P P     . DT  C 3 8   ? 22.393  14.023  93.559  1.00 71.73  ? 8   DT  G P     1 
ATOM   2301 O OP1   . DT  C 3 8   ? 22.079  12.887  94.454  1.00 70.29  ? 8   DT  G OP1   1 
ATOM   2302 O OP2   . DT  C 3 8   ? 23.638  14.796  93.764  1.00 73.74  ? 8   DT  G OP2   1 
ATOM   2303 O "O5'" . DT  C 3 8   ? 22.366  13.498  92.049  1.00 65.03  ? 8   DT  G "O5'" 1 
ATOM   2304 C "C5'" . DT  C 3 8   ? 21.176  12.914  91.531  1.00 63.85  ? 8   DT  G "C5'" 1 
ATOM   2305 C "C4'" . DT  C 3 8   ? 21.358  12.490  90.085  1.00 64.44  ? 8   DT  G "C4'" 1 
ATOM   2306 O "O4'" . DT  C 3 8   ? 21.404  13.662  89.232  1.00 65.85  ? 8   DT  G "O4'" 1 
ATOM   2307 C "C3'" . DT  C 3 8   ? 22.635  11.694  89.795  1.00 65.73  ? 8   DT  G "C3'" 1 
ATOM   2308 O "O3'" . DT  C 3 8   ? 22.312  10.523  89.054  1.00 65.53  ? 8   DT  G "O3'" 1 
ATOM   2309 C "C2'" . DT  C 3 8   ? 23.492  12.667  88.977  1.00 67.90  ? 8   DT  G "C2'" 1 
ATOM   2310 C "C1'" . DT  C 3 8   ? 22.428  13.499  88.282  1.00 68.01  ? 8   DT  G "C1'" 1 
ATOM   2311 N N1    . DT  C 3 8   ? 22.893  14.853  87.853  1.00 70.08  ? 8   DT  G N1    1 
ATOM   2312 C C2    . DT  C 3 8   ? 22.846  15.187  86.519  1.00 72.15  ? 8   DT  G C2    1 
ATOM   2313 O O2    . DT  C 3 8   ? 22.449  14.426  85.655  1.00 72.84  ? 8   DT  G O2    1 
ATOM   2314 N N3    . DT  C 3 8   ? 23.284  16.451  86.228  1.00 73.68  ? 8   DT  G N3    1 
ATOM   2315 C C4    . DT  C 3 8   ? 23.752  17.398  87.119  1.00 74.20  ? 8   DT  G C4    1 
ATOM   2316 O O4    . DT  C 3 8   ? 24.125  18.510  86.758  1.00 76.68  ? 8   DT  G O4    1 
ATOM   2317 C C5    . DT  C 3 8   ? 23.774  16.987  88.503  1.00 72.17  ? 8   DT  G C5    1 
ATOM   2318 C C7    . DT  C 3 8   ? 24.264  17.930  89.562  1.00 72.88  ? 8   DT  G C7    1 
ATOM   2319 C C6    . DT  C 3 8   ? 23.347  15.749  88.800  1.00 70.11  ? 8   DT  G C6    1 
ATOM   2320 P P     . DT  C 3 9   ? 23.345  9.294   88.981  1.00 82.01  ? 9   DT  G P     1 
ATOM   2321 O OP1   . DT  C 3 9   ? 22.554  8.043   88.969  1.00 80.89  ? 9   DT  G OP1   1 
ATOM   2322 O OP2   . DT  C 3 9   ? 24.373  9.505   90.024  1.00 82.40  ? 9   DT  G OP2   1 
ATOM   2323 O "O5'" . DT  C 3 9   ? 24.046  9.473   87.555  1.00 67.67  ? 9   DT  G "O5'" 1 
ATOM   2324 C "C5'" . DT  C 3 9   ? 23.257  9.456   86.372  1.00 67.95  ? 9   DT  G "C5'" 1 
ATOM   2325 C "C4'" . DT  C 3 9   ? 24.074  9.881   85.166  1.00 70.32  ? 9   DT  G "C4'" 1 
ATOM   2326 O "O4'" . DT  C 3 9   ? 24.186  11.323  85.131  1.00 70.27  ? 9   DT  G "O4'" 1 
ATOM   2327 C "C3'" . DT  C 3 9   ? 25.509  9.339   85.126  1.00 72.10  ? 9   DT  G "C3'" 1 
ATOM   2328 O "O3'" . DT  C 3 9   ? 25.706  8.582   83.938  1.00 74.78  ? 9   DT  G "O3'" 1 
ATOM   2329 C "C2'" . DT  C 3 9   ? 26.390  10.598  85.149  1.00 73.26  ? 9   DT  G "C2'" 1 
ATOM   2330 C "C1'" . DT  C 3 9   ? 25.443  11.658  84.610  1.00 72.35  ? 9   DT  G "C1'" 1 
ATOM   2331 N N1    . DT  C 3 9   ? 25.781  13.048  85.038  1.00 71.52  ? 9   DT  G N1    1 
ATOM   2332 C C2    . DT  C 3 9   ? 25.752  14.061  84.109  1.00 73.06  ? 9   DT  G C2    1 
ATOM   2333 O O2    . DT  C 3 9   ? 25.462  13.885  82.940  1.00 74.69  ? 9   DT  G O2    1 
ATOM   2334 N N3    . DT  C 3 9   ? 26.074  15.298  84.600  1.00 73.05  ? 9   DT  G N3    1 
ATOM   2335 C C4    . DT  C 3 9   ? 26.416  15.617  85.900  1.00 71.56  ? 9   DT  G C4    1 
ATOM   2336 O O4    . DT  C 3 9   ? 26.690  16.763  86.244  1.00 72.04  ? 9   DT  G O4    1 
ATOM   2337 C C5    . DT  C 3 9   ? 26.429  14.508  86.825  1.00 69.80  ? 9   DT  G C5    1 
ATOM   2338 C C7    . DT  C 3 9   ? 26.786  14.732  88.265  1.00 68.97  ? 9   DT  G C7    1 
ATOM   2339 C C6    . DT  C 3 9   ? 26.114  13.291  86.355  1.00 69.58  ? 9   DT  G C6    1 
ATOM   2340 P P     . DA  C 3 10  ? 26.631  7.268   83.957  1.00 93.10  ? 10  DA  G P     1 
ATOM   2341 O OP1   . DA  C 3 10  ? 25.857  6.167   83.342  1.00 92.98  ? 10  DA  G OP1   1 
ATOM   2342 O OP2   . DA  C 3 10  ? 27.173  7.116   85.325  1.00 91.55  ? 10  DA  G OP2   1 
ATOM   2343 O "O5'" . DA  C 3 10  ? 27.847  7.646   82.991  1.00 77.76  ? 10  DA  G "O5'" 1 
ATOM   2344 C "C5'" . DA  C 3 10  ? 27.606  7.897   81.614  1.00 79.56  ? 10  DA  G "C5'" 1 
ATOM   2345 C "C4'" . DA  C 3 10  ? 28.544  8.967   81.089  1.00 81.65  ? 10  DA  G "C4'" 1 
ATOM   2346 O "O4'" . DA  C 3 10  ? 28.278  10.208  81.759  1.00 79.78  ? 10  DA  G "O4'" 1 
ATOM   2347 C "C3'" . DA  C 3 10  ? 30.020  8.709   81.341  1.00 83.49  ? 10  DA  G "C3'" 1 
ATOM   2348 O "O3'" . DA  C 3 10  ? 30.575  7.977   80.253  1.00 86.55  ? 10  DA  G "O3'" 1 
ATOM   2349 C "C2'" . DA  C 3 10  ? 30.624  10.122  81.439  1.00 85.11  ? 10  DA  G "C2'" 1 
ATOM   2350 C "C1'" . DA  C 3 10  ? 29.406  11.038  81.623  1.00 82.23  ? 10  DA  G "C1'" 1 
ATOM   2351 N N9    . DA  C 3 10  ? 29.494  11.904  82.796  1.00 79.85  ? 10  DA  G N9    1 
ATOM   2352 C C8    . DA  C 3 10  ? 29.614  11.518  84.103  1.00 77.45  ? 10  DA  G C8    1 
ATOM   2353 N N7    . DA  C 3 10  ? 29.670  12.520  84.948  1.00 76.43  ? 10  DA  G N7    1 
ATOM   2354 C C5    . DA  C 3 10  ? 29.578  13.642  84.140  1.00 77.88  ? 10  DA  G C5    1 
ATOM   2355 C C6    . DA  C 3 10  ? 29.578  15.022  84.425  1.00 78.02  ? 10  DA  G C6    1 
ATOM   2356 N N6    . DA  C 3 10  ? 29.677  15.517  85.663  1.00 76.79  ? 10  DA  G N6    1 
ATOM   2357 N N1    . DA  C 3 10  ? 29.472  15.875  83.386  1.00 80.02  ? 10  DA  G N1    1 
ATOM   2358 C C2    . DA  C 3 10  ? 29.372  15.376  82.148  1.00 81.42  ? 10  DA  G C2    1 
ATOM   2359 N N3    . DA  C 3 10  ? 29.362  14.103  81.757  1.00 81.34  ? 10  DA  G N3    1 
ATOM   2360 C C4    . DA  C 3 10  ? 29.469  13.279  82.811  1.00 79.78  ? 10  DA  G C4    1 
ATOM   2361 P P     . DA  C 3 11  ? 32.141  7.618   80.224  1.00 81.72  ? 11  DA  G P     1 
ATOM   2362 O OP1   . DA  C 3 11  ? 32.305  6.434   79.352  1.00 83.32  ? 11  DA  G OP1   1 
ATOM   2363 O OP2   . DA  C 3 11  ? 32.630  7.578   81.620  1.00 80.86  ? 11  DA  G OP2   1 
ATOM   2364 O "O5'" . DA  C 3 11  ? 32.812  8.877   79.499  1.00 96.38  ? 11  DA  G "O5'" 1 
ATOM   2365 C "C5'" . DA  C 3 11  ? 32.337  9.294   78.224  1.00 98.24  ? 11  DA  G "C5'" 1 
ATOM   2366 C "C4'" . DA  C 3 11  ? 32.851  10.681  77.879  1.00 100.69 ? 11  DA  G "C4'" 1 
ATOM   2367 O "O4'" . DA  C 3 11  ? 32.463  11.616  78.922  1.00 97.65  ? 11  DA  G "O4'" 1 
ATOM   2368 C "C3'" . DA  C 3 11  ? 34.372  10.795  77.746  1.00 104.97 ? 11  DA  G "C3'" 1 
ATOM   2369 O "O3'" . DA  C 3 11  ? 34.704  11.592  76.616  1.00 109.55 ? 11  DA  G "O3'" 1 
ATOM   2370 C "C2'" . DA  C 3 11  ? 34.789  11.472  79.050  1.00 103.21 ? 11  DA  G "C2'" 1 
ATOM   2371 C "C1'" . DA  C 3 11  ? 33.588  12.361  79.326  1.00 99.66  ? 11  DA  G "C1'" 1 
ATOM   2372 N N9    . DA  C 3 11  ? 33.434  12.710  80.736  1.00 95.58  ? 11  DA  G N9    1 
ATOM   2373 C C8    . DA  C 3 11  ? 33.555  11.873  81.810  1.00 92.77  ? 11  DA  G C8    1 
ATOM   2374 N N7    . DA  C 3 11  ? 33.364  12.464  82.966  1.00 89.96  ? 11  DA  G N7    1 
ATOM   2375 C C5    . DA  C 3 11  ? 33.101  13.781  82.627  1.00 90.40  ? 11  DA  G C5    1 
ATOM   2376 C C6    . DA  C 3 11  ? 32.815  14.922  83.403  1.00 88.25  ? 11  DA  G C6    1 
ATOM   2377 N N6    . DA  C 3 11  ? 32.745  14.906  84.737  1.00 85.58  ? 11  DA  G N6    1 
ATOM   2378 N N1    . DA  C 3 11  ? 32.602  16.084  82.750  1.00 89.70  ? 11  DA  G N1    1 
ATOM   2379 C C2    . DA  C 3 11  ? 32.673  16.096  81.414  1.00 92.64  ? 11  DA  G C2    1 
ATOM   2380 N N3    . DA  C 3 11  ? 32.933  15.091  80.579  1.00 94.80  ? 11  DA  G N3    1 
ATOM   2381 C C4    . DA  C 3 11  ? 33.140  13.950  81.256  1.00 93.77  ? 11  DA  G C4    1 
HETATM 2382 N N     . SAM D 4 .   ? -7.548  -1.856  88.574  1.00 99.29  ? 301 SAM A N     1 
HETATM 2383 C CA    . SAM D 4 .   ? -7.288  -1.146  89.827  1.00 99.35  ? 301 SAM A CA    1 
HETATM 2384 C C     . SAM D 4 .   ? -8.462  -0.266  90.267  1.00 99.48  ? 301 SAM A C     1 
HETATM 2385 O O     . SAM D 4 .   ? -9.610  -0.551  89.923  1.00 99.59  ? 301 SAM A O     1 
HETATM 2386 O OXT   . SAM D 4 .   ? -8.302  0.725   90.984  1.00 99.33  ? 301 SAM A OXT   1 
HETATM 2387 C CB    . SAM D 4 .   ? -5.970  -0.375  89.790  1.00 99.30  ? 301 SAM A CB    1 
HETATM 2388 C CG    . SAM D 4 .   ? -5.462  0.103   88.441  1.00 99.22  ? 301 SAM A CG    1 
HETATM 2389 S SD    . SAM D 4 .   ? -3.964  1.101   88.638  1.00 84.23  ? 301 SAM A SD    1 
HETATM 2390 C CE    . SAM D 4 .   ? -3.847  1.912   87.023  1.00 100.61 ? 301 SAM A CE    1 
HETATM 2391 C "C5'" . SAM D 4 .   ? -2.663  -0.148  88.477  1.00 54.48  ? 301 SAM A "C5'" 1 
HETATM 2392 C "C4'" . SAM D 4 .   ? -2.044  -0.539  89.815  1.00 54.45  ? 301 SAM A "C4'" 1 
HETATM 2393 O "O4'" . SAM D 4 .   ? -1.019  -1.490  89.601  1.00 54.35  ? 301 SAM A "O4'" 1 
HETATM 2394 C "C3'" . SAM D 4 .   ? -1.412  0.642   90.536  1.00 54.15  ? 301 SAM A "C3'" 1 
HETATM 2395 O "O3'" . SAM D 4 .   ? -2.126  0.919   91.718  1.00 53.60  ? 301 SAM A "O3'" 1 
HETATM 2396 C "C2'" . SAM D 4 .   ? 0.001   0.207   90.874  1.00 54.29  ? 301 SAM A "C2'" 1 
HETATM 2397 O "O2'" . SAM D 4 .   ? 0.243   0.337   92.256  1.00 54.08  ? 301 SAM A "O2'" 1 
HETATM 2398 C "C1'" . SAM D 4 .   ? 0.079   -1.254  90.459  1.00 54.30  ? 301 SAM A "C1'" 1 
HETATM 2399 N N9    . SAM D 4 .   ? 1.337   -1.522  89.740  1.00 54.08  ? 301 SAM A N9    1 
HETATM 2400 C C8    . SAM D 4 .   ? 2.060   -0.621  89.002  1.00 53.74  ? 301 SAM A C8    1 
HETATM 2401 N N7    . SAM D 4 .   ? 3.147   -1.250  88.501  1.00 53.74  ? 301 SAM A N7    1 
HETATM 2402 C C5    . SAM D 4 .   ? 3.129   -2.539  88.907  1.00 54.07  ? 301 SAM A C5    1 
HETATM 2403 C C6    . SAM D 4 .   ? 3.992   -3.605  88.682  1.00 54.31  ? 301 SAM A C6    1 
HETATM 2404 N N6    . SAM D 4 .   ? 5.082   -3.440  87.937  1.00 54.67  ? 301 SAM A N6    1 
HETATM 2405 N N1    . SAM D 4 .   ? 3.714   -4.836  89.237  1.00 54.26  ? 301 SAM A N1    1 
HETATM 2406 C C2    . SAM D 4 .   ? 2.582   -5.003  90.009  1.00 54.08  ? 301 SAM A C2    1 
HETATM 2407 N N3    . SAM D 4 .   ? 1.728   -3.939  90.229  1.00 54.06  ? 301 SAM A N3    1 
HETATM 2408 C C4    . SAM D 4 .   ? 1.996   -2.725  89.688  1.00 53.98  ? 301 SAM A C4    1 
HETATM 2409 O O     . HOH E 5 .   ? -3.865  13.051  96.911  1.00 39.52  ? 401 HOH A O     1 
HETATM 2410 O O     . HOH E 5 .   ? -8.049  14.096  97.036  1.00 43.55  ? 402 HOH A O     1 
HETATM 2411 O O     . HOH E 5 .   ? -13.646 13.447  98.971  1.00 42.07  ? 403 HOH A O     1 
HETATM 2412 O O     . HOH E 5 .   ? 4.964   1.550   102.694 1.00 52.43  ? 404 HOH A O     1 
HETATM 2413 O O     . HOH E 5 .   ? -5.443  -6.206  88.419  1.00 43.34  ? 405 HOH A O     1 
HETATM 2414 O O     . HOH E 5 .   ? -3.887  7.650   114.724 1.00 45.09  ? 406 HOH A O     1 
HETATM 2415 O O     . HOH E 5 .   ? -10.367 1.517   98.204  1.00 45.00  ? 407 HOH A O     1 
HETATM 2416 O O     . HOH E 5 .   ? -3.320  9.272   97.503  1.00 46.56  ? 408 HOH A O     1 
HETATM 2417 O O     . HOH E 5 .   ? 2.384   -3.505  102.597 1.00 52.57  ? 409 HOH A O     1 
HETATM 2418 O O     . HOH E 5 .   ? 0.612   -8.955  103.605 1.00 57.65  ? 410 HOH A O     1 
HETATM 2419 O O     . HOH E 5 .   ? 0.038   1.671   106.823 1.00 41.21  ? 411 HOH A O     1 
HETATM 2420 O O     . HOH E 5 .   ? 3.810   10.315  113.962 1.00 53.19  ? 412 HOH A O     1 
HETATM 2421 O O     . HOH E 5 .   ? 5.279   8.074   92.445  1.00 49.25  ? 413 HOH A O     1 
HETATM 2422 O O     . HOH E 5 .   ? -11.847 15.042  98.513  1.00 39.07  ? 414 HOH A O     1 
HETATM 2423 O O     . HOH E 5 .   ? 5.601   10.944  112.365 1.00 47.07  ? 415 HOH A O     1 
HETATM 2424 O O     . HOH E 5 .   ? -4.184  8.101   94.311  1.00 58.74  ? 416 HOH A O     1 
HETATM 2425 O O     . HOH E 5 .   ? -6.608  10.320  114.693 1.00 53.22  ? 417 HOH A O     1 
HETATM 2426 O O     . HOH E 5 .   ? 5.261   18.339  103.908 1.00 45.86  ? 418 HOH A O     1 
HETATM 2427 O O     . HOH E 5 .   ? -8.203  -2.841  116.765 1.00 59.48  ? 419 HOH A O     1 
HETATM 2428 O O     . HOH E 5 .   ? 3.675   7.818   114.268 1.00 56.16  ? 420 HOH A O     1 
HETATM 2429 O O     . HOH E 5 .   ? 5.929   5.521   101.245 1.00 62.20  ? 421 HOH A O     1 
HETATM 2430 O O     . HOH E 5 .   ? 7.621   11.898  113.466 1.00 58.29  ? 422 HOH A O     1 
HETATM 2431 O O     . HOH E 5 .   ? 8.528   13.399  92.585  1.00 56.89  ? 423 HOH A O     1 
HETATM 2432 O O     . HOH F 5 .   ? 5.669   22.175  101.623 1.00 54.92  ? 101 HOH F O     1 
HETATM 2433 O O     . HOH F 5 .   ? 6.645   14.521  88.543  1.00 52.37  ? 102 HOH F O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . LYS A 23  ? 0.8575 0.9854 1.2739 -0.0511 -0.0805 -0.0279 3   LYS A N     
2    C CA    . LYS A 23  ? 0.8587 0.9601 1.2150 -0.0392 -0.0799 -0.0145 3   LYS A CA    
3    C C     . LYS A 23  ? 0.8269 0.9127 1.1731 -0.0295 -0.0575 -0.0098 3   LYS A C     
4    O O     . LYS A 23  ? 0.8021 0.9063 1.1837 -0.0192 -0.0599 -0.0037 3   LYS A O     
5    C CB    . LYS A 23  ? 0.8662 0.9863 1.2183 -0.0307 -0.1090 0.0011  3   LYS A CB    
6    C CG    . LYS A 23  ? 0.8937 1.0349 1.2642 -0.0414 -0.1344 -0.0018 3   LYS A CG    
7    C CD    . LYS A 23  ? 0.9083 1.0647 1.2550 -0.0404 -0.1631 0.0157  3   LYS A CD    
8    C CE    . LYS A 23  ? 0.9250 1.0699 1.2031 -0.0385 -0.1552 0.0145  3   LYS A CE    
9    N NZ    . LYS A 23  ? 0.9407 1.1122 1.1916 -0.0461 -0.1821 0.0271  3   LYS A NZ    
10   N N     . ASN A 24  ? 0.8279 0.8775 1.1272 -0.0326 -0.0390 -0.0132 4   ASN A N     
11   C CA    . ASN A 24  ? 0.8055 0.8357 1.0893 -0.0255 -0.0172 -0.0086 4   ASN A CA    
12   C C     . ASN A 24  ? 0.7742 0.8037 1.0348 -0.0045 -0.0237 0.0062  4   ASN A C     
13   O O     . ASN A 24  ? 0.7843 0.8073 1.0048 0.0014  -0.0360 0.0088  4   ASN A O     
14   C CB    . ASN A 24  ? 0.8409 0.8256 1.0774 -0.0364 -0.0031 -0.0149 4   ASN A CB    
15   C CG    . ASN A 24  ? 0.8701 0.8533 1.1230 -0.0639 0.0031  -0.0264 4   ASN A CG    
16   O OD1   . ASN A 24  ? 0.8572 0.8753 1.1592 -0.0754 0.0121  -0.0327 4   ASN A OD1   
17   N ND2   . ASN A 24  ? 0.9105 0.8556 1.1240 -0.0755 -0.0040 -0.0315 4   ASN A ND2   
18   N N     . ARG A 25  ? 0.7398 0.7807 1.0270 0.0052  -0.0159 0.0136  5   ARG A N     
19   C CA    . ARG A 25  ? 0.7245 0.7644 0.9903 0.0225  -0.0222 0.0297  5   ARG A CA    
20   C C     . ARG A 25  ? 0.6956 0.7025 0.9197 0.0301  0.0015  0.0307  5   ARG A C     
21   O O     . ARG A 25  ? 0.6914 0.6834 0.9221 0.0231  0.0232  0.0233  5   ARG A O     
22   C CB    . ARG A 25  ? 0.7295 0.7974 1.0501 0.0309  -0.0348 0.0384  5   ARG A CB    
23   C CG    . ARG A 25  ? 0.7661 0.8632 1.1304 0.0254  -0.0660 0.0393  5   ARG A CG    
24   C CD    . ARG A 25  ? 0.7850 0.8982 1.1861 0.0365  -0.0921 0.0544  5   ARG A CD    
25   N NE    . ARG A 25  ? 0.8284 0.9413 1.1891 0.0348  -0.1189 0.0772  5   ARG A NE    
26   C CZ    . ARG A 25  ? 0.8520 0.9686 1.2197 0.0405  -0.1439 0.0981  5   ARG A CZ    
27   N NH1   . ARG A 25  ? 0.8428 0.9608 1.2610 0.0535  -0.1464 0.0969  5   ARG A NH1   
28   N NH2   . ARG A 25  ? 0.8807 1.0017 1.2041 0.0309  -0.1678 0.1193  5   ARG A NH2   
29   N N     . ALA A 26  ? 0.6790 0.6776 0.8591 0.0419  -0.0036 0.0390  6   ALA A N     
30   C CA    . ALA A 26  ? 0.6584 0.6271 0.8009 0.0523  0.0154  0.0399  6   ALA A CA    
31   C C     . ALA A 26  ? 0.6131 0.5885 0.7850 0.0609  0.0272  0.0507  6   ALA A C     
32   O O     . ALA A 26  ? 0.5844 0.5889 0.7995 0.0634  0.0133  0.0589  6   ALA A O     
33   C CB    . ALA A 26  ? 0.6672 0.6365 0.7609 0.0623  0.0059  0.0412  6   ALA A CB    
34   N N     . PHE A 27  ? 0.6021 0.5493 0.7525 0.0656  0.0496  0.0496  7   PHE A N     
35   C CA    . PHE A 27  ? 0.5778 0.5325 0.7556 0.0741  0.0626  0.0570  7   PHE A CA    
36   C C     . PHE A 27  ? 0.5683 0.5247 0.7233 0.0918  0.0555  0.0728  7   PHE A C     
37   O O     . PHE A 27  ? 0.5494 0.5111 0.7250 0.1017  0.0619  0.0809  7   PHE A O     
38   C CB    . PHE A 27  ? 0.5839 0.5106 0.7494 0.0665  0.0902  0.0499  7   PHE A CB    
39   C CG    . PHE A 27  ? 0.6147 0.4963 0.7178 0.0716  0.0968  0.0501  7   PHE A CG    
40   C CD1   . PHE A 27  ? 0.6074 0.4756 0.6873 0.0884  0.1060  0.0588  7   PHE A CD1   
41   C CD2   . PHE A 27  ? 0.6516 0.5029 0.7225 0.0604  0.0910  0.0396  7   PHE A CD2   
42   C CE1   . PHE A 27  ? 0.6320 0.4595 0.6594 0.0949  0.1094  0.0551  7   PHE A CE1   
43   C CE2   . PHE A 27  ? 0.6787 0.4864 0.6989 0.0675  0.0909  0.0354  7   PHE A CE2   
44   C CZ    . PHE A 27  ? 0.6677 0.4646 0.6671 0.0853  0.1003  0.0422  7   PHE A CZ    
45   N N     . LEU A 28  ? 0.5820 0.5386 0.6954 0.0940  0.0416  0.0751  8   LEU A N     
46   C CA    . LEU A 28  ? 0.5753 0.5410 0.6608 0.1048  0.0339  0.0890  8   LEU A CA    
47   C C     . LEU A 28  ? 0.5725 0.5731 0.6632 0.0970  0.0034  0.1014  8   LEU A C     
48   O O     . LEU A 28  ? 0.5910 0.6045 0.6827 0.0856  -0.0101 0.0939  8   LEU A O     
49   C CB    . LEU A 28  ? 0.6026 0.5478 0.6298 0.1115  0.0434  0.0777  8   LEU A CB    
50   C CG    . LEU A 28  ? 0.6139 0.5178 0.6229 0.1199  0.0679  0.0703  8   LEU A CG    
51   C CD1   . LEU A 28  ? 0.6284 0.5146 0.5863 0.1279  0.0675  0.0537  8   LEU A CD1   
52   C CD2   . LEU A 28  ? 0.5906 0.4941 0.6122 0.1306  0.0800  0.0860  8   LEU A CD2   
53   N N     . LYS A 29  ? 0.5539 0.5681 0.6461 0.1007  -0.0098 0.1219  9   LYS A N     
54   C CA    . LYS A 29  ? 0.5703 0.6145 0.6476 0.0878  -0.0410 0.1379  9   LYS A CA    
55   C C     . LYS A 29  ? 0.5795 0.6350 0.5930 0.0843  -0.0351 0.1288  9   LYS A C     
56   O O     . LYS A 29  ? 0.5737 0.6191 0.5572 0.0953  -0.0180 0.1268  9   LYS A O     
57   C CB    . LYS A 29  ? 0.5673 0.6182 0.6632 0.0889  -0.0622 0.1649  9   LYS A CB    
58   C CG    . LYS A 29  ? 0.5584 0.6040 0.7262 0.0958  -0.0735 0.1680  9   LYS A CG    
59   C CD    . LYS A 29  ? 0.5637 0.6123 0.7472 0.0968  -0.1038 0.1947  9   LYS A CD    
60   C CE    . LYS A 29  ? 0.5597 0.6046 0.8223 0.1095  -0.1158 0.1903  9   LYS A CE    
61   N NZ    . LYS A 29  ? 0.5777 0.6163 0.8416 0.1067  -0.1431 0.2037  9   LYS A NZ    
62   N N     . TRP A 30  ? 0.6001 0.6804 0.5953 0.0696  -0.0493 0.1198  10  TRP A N     
63   C CA    . TRP A 30  ? 0.6252 0.7261 0.5665 0.0668  -0.0439 0.1013  10  TRP A CA    
64   C C     . TRP A 30  ? 0.6766 0.8244 0.5989 0.0429  -0.0691 0.1019  10  TRP A C     
65   O O     . TRP A 30  ? 0.6964 0.8496 0.6472 0.0312  -0.0874 0.1092  10  TRP A O     
66   C CB    . TRP A 30  ? 0.6195 0.6910 0.5537 0.0806  -0.0225 0.0692  10  TRP A CB    
67   C CG    . TRP A 30  ? 0.6247 0.7031 0.5136 0.0899  -0.0119 0.0459  10  TRP A CG    
68   C CD1   . TRP A 30  ? 0.6451 0.7564 0.5051 0.0848  -0.0193 0.0178  10  TRP A CD1   
69   C CD2   . TRP A 30  ? 0.6113 0.6671 0.4826 0.1070  0.0066  0.0443  10  TRP A CD2   
70   N NE1   . TRP A 30  ? 0.6511 0.7635 0.4798 0.0990  -0.0076 -0.0044 10  TRP A NE1   
71   C CE2   . TRP A 30  ? 0.6251 0.7012 0.4586 0.1125  0.0083  0.0133  10  TRP A CE2   
72   C CE3   . TRP A 30  ? 0.5918 0.6153 0.4781 0.1185  0.0213  0.0633  10  TRP A CE3   
73   C CZ2   . TRP A 30  ? 0.6250 0.6867 0.4353 0.1297  0.0231  0.0019  10  TRP A CZ2   
74   C CZ3   . TRP A 30  ? 0.5890 0.5967 0.4486 0.1340  0.0374  0.0551  10  TRP A CZ3   
75   C CH2   . TRP A 30  ? 0.6029 0.6281 0.4249 0.1398  0.0376  0.0253  10  TRP A CH2   
76   N N     . ALA A 31  ? 0.7113 0.8972 0.5853 0.0341  -0.0700 0.0922  11  ALA A N     
77   C CA    . ALA A 31  ? 0.7586 0.9993 0.6069 0.0069  -0.0914 0.0887  11  ALA A CA    
78   C C     . ALA A 31  ? 0.7946 1.0370 0.6521 0.0092  -0.0897 0.0570  11  ALA A C     
79   O O     . ALA A 31  ? 0.7933 1.0026 0.6575 0.0311  -0.0706 0.0298  11  ALA A O     
80   C CB    . ALA A 31  ? 0.7638 1.0542 0.5588 -0.0041 -0.0881 0.0775  11  ALA A CB    
81   N N     . GLY A 32  ? 0.8378 1.1159 0.6944 -0.0153 -0.1128 0.0619  12  GLY A N     
82   C CA    . GLY A 32  ? 0.8680 1.1513 0.7342 -0.0154 -0.1145 0.0334  12  GLY A CA    
83   C C     . GLY A 32  ? 0.8733 1.1013 0.7876 0.0002  -0.1082 0.0351  12  GLY A C     
84   O O     . GLY A 32  ? 0.8761 1.0776 0.7958 0.0154  -0.0947 0.0067  12  GLY A O     
85   N N     . GLY A 33  ? 0.8787 1.0908 0.8292 -0.0052 -0.1208 0.0668  13  GLY A N     
86   C CA    . GLY A 33  ? 0.8791 1.0519 0.8792 0.0050  -0.1154 0.0664  13  GLY A CA    
87   C C     . GLY A 33  ? 0.9069 1.0874 0.9157 -0.0031 -0.1227 0.0465  13  GLY A C     
88   O O     . GLY A 33  ? 0.9145 1.0626 0.9451 0.0064  -0.1097 0.0308  13  GLY A O     
89   N N     . LYS A 34  ? 0.9240 1.1488 0.9136 -0.0241 -0.1450 0.0484  14  LYS A N     
90   C CA    . LYS A 34  ? 0.9430 1.1837 0.9352 -0.0335 -0.1542 0.0279  14  LYS A CA    
91   C C     . LYS A 34  ? 0.9262 1.1402 0.9700 -0.0332 -0.1597 0.0337  14  LYS A C     
92   O O     . LYS A 34  ? 0.9349 1.1499 0.9859 -0.0368 -0.1624 0.0145  14  LYS A O     
93   C CB    . LYS A 34  ? 0.9638 1.1978 0.9320 -0.0195 -0.1369 -0.0122 14  LYS A CB    
94   N N     . TYR A 35  ? 0.9025 1.0967 0.9846 -0.0289 -0.1625 0.0571  15  TYR A N     
95   C CA    . TYR A 35  ? 0.8905 1.0680 1.0284 -0.0284 -0.1671 0.0585  15  TYR A CA    
96   C C     . TYR A 35  ? 0.9018 1.1052 1.0543 -0.0472 -0.1961 0.0620  15  TYR A C     
97   O O     . TYR A 35  ? 0.9076 1.1030 1.0875 -0.0480 -0.1935 0.0473  15  TYR A O     
98   C CB    . TYR A 35  ? 0.8730 1.0364 1.0536 -0.0199 -0.1697 0.0782  15  TYR A CB    
99   C CG    . TYR A 35  ? 0.8567 0.9913 1.0344 -0.0016 -0.1381 0.0720  15  TYR A CG    
100  C CD1   . TYR A 35  ? 0.8582 0.9676 1.0261 0.0049  -0.1111 0.0494  15  TYR A CD1   
101  C CD2   . TYR A 35  ? 0.8460 0.9759 1.0289 0.0070  -0.1385 0.0902  15  TYR A CD2   
102  C CE1   . TYR A 35  ? 0.8459 0.9270 1.0077 0.0179  -0.0849 0.0458  15  TYR A CE1   
103  C CE2   . TYR A 35  ? 0.8309 0.9356 1.0100 0.0226  -0.1094 0.0846  15  TYR A CE2   
104  C CZ    . TYR A 35  ? 0.8313 0.9121 0.9988 0.0272  -0.0824 0.0628  15  TYR A CZ    
105  O OH    . TYR A 35  ? 0.8188 0.8727 0.9795 0.0393  -0.0560 0.0593  15  TYR A OH    
106  N N     . PRO A 36  ? 0.9031 1.1376 1.0355 -0.0655 -0.2251 0.0828  16  PRO A N     
107  C CA    . PRO A 36  ? 0.9167 1.1738 1.0607 -0.0852 -0.2536 0.0861  16  PRO A CA    
108  C C     . PRO A 36  ? 0.9215 1.1960 1.0381 -0.0906 -0.2442 0.0574  16  PRO A C     
109  O O     . PRO A 36  ? 0.9330 1.2108 1.0742 -0.0978 -0.2556 0.0505  16  PRO A O     
110  C CB    . PRO A 36  ? 0.9370 1.2230 1.0522 -0.1091 -0.2872 0.1163  16  PRO A CB    
111  C CG    . PRO A 36  ? 0.9220 1.1896 1.0374 -0.0976 -0.2819 0.1340  16  PRO A CG    
112  C CD    . PRO A 36  ? 0.9024 1.1501 1.0065 -0.0730 -0.2382 0.1080  16  PRO A CD    
113  N N     . LEU A 37  ? 0.9109 1.1969 0.9807 -0.0859 -0.2257 0.0380  17  LEU A N     
114  C CA    . LEU A 37  ? 0.9117 1.2188 0.9576 -0.0895 -0.2218 0.0057  17  LEU A CA    
115  C C     . LEU A 37  ? 0.8905 1.1576 0.9434 -0.0667 -0.1963 -0.0239 17  LEU A C     
116  O O     . LEU A 37  ? 0.8978 1.1756 0.9283 -0.0635 -0.1929 -0.0556 17  LEU A O     
117  C CB    . LEU A 37  ? 0.9309 1.2903 0.9221 -0.1032 -0.2257 -0.0039 17  LEU A CB    
118  C CG    . LEU A 37  ? 0.9227 1.2796 0.8843 -0.0891 -0.2054 -0.0106 17  LEU A CG    
119  C CD1   . LEU A 37  ? 0.9306 1.3018 0.8672 -0.0763 -0.1907 -0.0574 17  LEU A CD1   
120  C CD2   . LEU A 37  ? 0.9299 1.3288 0.8579 -0.1124 -0.2202 0.0158  17  LEU A CD2   
121  N N     . LEU A 38  ? 0.9900 1.0718 1.0008 0.1351  -0.4541 0.0219  18  LEU A N     
122  C CA    . LEU A 38  ? 0.9301 1.0410 1.0278 0.0970  -0.4550 0.0144  18  LEU A CA    
123  C C     . LEU A 38  ? 0.9531 1.1049 1.1028 0.0752  -0.4911 -0.0085 18  LEU A C     
124  O O     . LEU A 38  ? 0.9364 1.0824 1.1217 0.0415  -0.4971 -0.0251 18  LEU A O     
125  C CB    . LEU A 38  ? 0.8637 1.0202 1.0401 0.0934  -0.4232 0.0392  18  LEU A CB    
126  C CG    . LEU A 38  ? 0.8196 0.9377 0.9707 0.0907  -0.3661 0.0555  18  LEU A CG    
127  C CD1   . LEU A 38  ? 0.7678 0.9348 0.9924 0.0908  -0.3388 0.0776  18  LEU A CD1   
128  C CD2   . LEU A 38  ? 0.8054 0.8871 0.9503 0.0596  -0.3527 0.0419  18  LEU A CD2   
129  N N     . ASP A 39  ? 0.9949 1.1856 1.1476 0.0951  -0.5141 -0.0089 19  ASP A N     
130  C CA    . ASP A 39  ? 1.0381 1.2737 1.2392 0.0773  -0.5507 -0.0307 19  ASP A CA    
131  C C     . ASP A 39  ? 1.0885 1.2713 1.2237 0.0668  -0.5734 -0.0605 19  ASP A C     
132  O O     . ASP A 39  ? 1.1064 1.3043 1.2855 0.0369  -0.5943 -0.0832 19  ASP A O     
133  C CB    . ASP A 39  ? 1.0897 1.3785 1.3005 0.1066  -0.5711 -0.0221 19  ASP A CB    
134  C CG    . ASP A 39  ? 1.0547 1.3854 1.3133 0.1262  -0.5444 0.0081  19  ASP A CG    
135  O OD1   . ASP A 39  ? 0.9930 1.3439 1.3192 0.1056  -0.5184 0.0171  19  ASP A OD1   
136  O OD2   . ASP A 39  ? 1.0926 1.4326 1.3191 0.1629  -0.5476 0.0237  19  ASP A OD2   
137  N N     . ASP A 40  ? 1.1174 1.2359 1.1455 0.0918  -0.5660 -0.0602 20  ASP A N     
138  C CA    . ASP A 40  ? 1.1702 1.2340 1.1244 0.0875  -0.5819 -0.0878 20  ASP A CA    
139  C C     . ASP A 40  ? 1.1306 1.1518 1.0909 0.0582  -0.5654 -0.1010 20  ASP A C     
140  O O     . ASP A 40  ? 1.1697 1.1665 1.1182 0.0401  -0.5821 -0.1285 20  ASP A O     
141  C CB    . ASP A 40  ? 1.2244 1.2328 1.0609 0.1243  -0.5719 -0.0808 20  ASP A CB    
142  N N     . ILE A 41  ? 1.0558 1.0672 1.0338 0.0548  -0.5324 -0.0811 21  ILE A N     
143  C CA    . ILE A 41  ? 1.0217 0.9949 1.0085 0.0293  -0.5152 -0.0897 21  ILE A CA    
144  C C     . ILE A 41  ? 1.0072 1.0095 1.0846 -0.0091 -0.5284 -0.1027 21  ILE A C     
145  O O     . ILE A 41  ? 1.0349 0.9982 1.0982 -0.0276 -0.5345 -0.1260 21  ILE A O     
146  C CB    . ILE A 41  ? 0.9510 0.9189 0.9496 0.0324  -0.4755 -0.0626 21  ILE A CB    
147  C CG1   . ILE A 41  ? 0.9712 0.8996 0.8756 0.0663  -0.4482 -0.0496 21  ILE A CG1   
148  C CG2   . ILE A 41  ? 0.9214 0.8560 0.9370 0.0056  -0.4483 -0.0688 21  ILE A CG2   
149  C CD1   . ILE A 41  ? 1.0339 0.8967 0.8417 0.0742  -0.4470 -0.0711 21  ILE A CD1   
150  N N     . LYS A 42  ? 0.9699 1.0384 1.1384 -0.0200 -0.5289 -0.0869 22  LYS A N     
151  C CA    . LYS A 42  ? 0.9624 1.0617 1.2219 -0.0581 -0.5339 -0.0944 22  LYS A CA    
152  C C     . LYS A 42  ? 1.0251 1.1232 1.2795 -0.0708 -0.5687 -0.1260 22  LYS A C     
153  O O     . LYS A 42  ? 1.0489 1.1340 1.3416 -0.1032 -0.5707 -0.1409 22  LYS A O     
154  C CB    . LYS A 42  ? 0.9223 1.0992 1.2746 -0.0623 -0.5250 -0.0716 22  LYS A CB    
155  C CG    . LYS A 42  ? 0.8555 1.0376 1.2219 -0.0522 -0.4884 -0.0400 22  LYS A CG    
156  C CD    . LYS A 42  ? 0.8229 1.0824 1.2774 -0.0528 -0.4768 -0.0193 22  LYS A CD    
157  C CE    . LYS A 42  ? 0.8291 1.1237 1.3732 -0.0928 -0.4769 -0.0264 22  LYS A CE    
158  N NZ    . LYS A 42  ? 0.8147 1.0627 1.3689 -0.1229 -0.4522 -0.0226 22  LYS A NZ    
159  N N     . ARG A 43  ? 1.0565 1.1652 1.2604 -0.0446 -0.5951 -0.1353 23  ARG A N     
160  C CA    . ARG A 43  ? 1.1213 1.2332 1.3155 -0.0538 -0.6316 -0.1657 23  ARG A CA    
161  C C     . ARG A 43  ? 1.1737 1.2069 1.2907 -0.0575 -0.6330 -0.1911 23  ARG A C     
162  O O     . ARG A 43  ? 1.2363 1.2606 1.3588 -0.0768 -0.6560 -0.2187 23  ARG A O     
163  C CB    . ARG A 43  ? 1.1588 1.3050 1.3168 -0.0213 -0.6592 -0.1651 23  ARG A CB    
164  N N     . HIS A 44  ? 1.1552 1.1326 1.2010 -0.0388 -0.6070 -0.1825 24  HIS A N     
165  C CA    . HIS A 44  ? 1.2000 1.1041 1.1685 -0.0369 -0.6025 -0.2053 24  HIS A CA    
166  C C     . HIS A 44  ? 1.1513 1.0159 1.1414 -0.0572 -0.5724 -0.2023 24  HIS A C     
167  O O     . HIS A 44  ? 1.1892 0.9944 1.1259 -0.0566 -0.5640 -0.2206 24  HIS A O     
168  C CB    . HIS A 44  ? 1.2303 1.0961 1.0900 0.0018  -0.5935 -0.2015 24  HIS A CB    
169  C CG    . HIS A 44  ? 1.2921 1.1816 1.1120 0.0251  -0.6226 -0.2057 24  HIS A CG    
170  N ND1   . HIS A 44  ? 1.2702 1.2201 1.1291 0.0377  -0.6335 -0.1849 24  HIS A ND1   
171  C CD2   . HIS A 44  ? 1.3805 1.2408 1.1240 0.0397  -0.6426 -0.2275 24  HIS A CD2   
172  C CE1   . HIS A 44  ? 1.3428 1.2992 1.1507 0.0595  -0.6605 -0.1932 24  HIS A CE1   
173  N NE2   . HIS A 44  ? 1.4111 1.3135 1.1474 0.0605  -0.6669 -0.2189 24  HIS A NE2   
174  N N     . LEU A 45  ? 1.0743 0.9723 1.1418 -0.0732 -0.5547 -0.1784 25  LEU A N     
175  C CA    . LEU A 45  ? 1.0365 0.8999 1.1276 -0.0916 -0.5259 -0.1713 25  LEU A CA    
176  C C     . LEU A 45  ? 1.0631 0.9280 1.2227 -0.1281 -0.5313 -0.1820 25  LEU A C     
177  O O     . LEU A 45  ? 1.0469 0.9668 1.2869 -0.1480 -0.5375 -0.1724 25  LEU A O     
178  C CB    . LEU A 45  ? 0.9502 0.8433 1.0814 -0.0890 -0.5001 -0.1377 25  LEU A CB    
179  C CG    . LEU A 45  ? 0.9096 0.7651 1.0505 -0.1008 -0.4683 -0.1268 25  LEU A CG    
180  C CD1   . LEU A 45  ? 0.9340 0.7246 0.9835 -0.0806 -0.4569 -0.1420 25  LEU A CD1   
181  C CD2   . LEU A 45  ? 0.8338 0.7296 1.0179 -0.0976 -0.4388 -0.0914 25  LEU A CD2   
182  N N     . PRO A 46  ? 1.1133 0.9167 1.2400 -0.1361 -0.5259 -0.2017 26  PRO A N     
183  C CA    . PRO A 46  ? 1.1487 0.9383 1.3265 -0.1695 -0.5288 -0.2137 26  PRO A CA    
184  C C     . PRO A 46  ? 1.0879 0.8962 1.3463 -0.1942 -0.5029 -0.1858 26  PRO A C     
185  O O     . PRO A 46  ? 1.0261 0.8504 1.2950 -0.1842 -0.4807 -0.1585 26  PRO A O     
186  C CB    . PRO A 46  ? 1.2020 0.9145 1.3123 -0.1615 -0.5193 -0.2344 26  PRO A CB    
187  C CG    . PRO A 46  ? 1.2177 0.9145 1.2392 -0.1256 -0.5229 -0.2431 26  PRO A CG    
188  C CD    . PRO A 46  ? 1.1450 0.8872 1.1789 -0.1111 -0.5149 -0.2149 26  PRO A CD    
189  N N     . LYS A 47  ? 1.1108 0.9148 1.4221 -0.2267 -0.5041 -0.1927 27  LYS A N     
190  C CA    . LYS A 47  ? 1.0654 0.8812 1.4476 -0.2516 -0.4760 -0.1657 27  LYS A CA    
191  C C     . LYS A 47  ? 1.0698 0.8132 1.4241 -0.2528 -0.4484 -0.1601 27  LYS A C     
192  O O     . LYS A 47  ? 1.1206 0.8067 1.4229 -0.2471 -0.4552 -0.1845 27  LYS A O     
193  C CB    . LYS A 47  ? 1.1015 0.9535 1.5583 -0.2880 -0.4878 -0.1738 27  LYS A CB    
194  N N     . GLY A 48  ? 1.0214 0.7684 1.4085 -0.2579 -0.4164 -0.1273 28  GLY A N     
195  C CA    . GLY A 48  ? 1.0304 0.7136 1.3927 -0.2555 -0.3890 -0.1172 28  GLY A CA    
196  C C     . GLY A 48  ? 0.9862 0.6856 1.3945 -0.2659 -0.3554 -0.0785 28  GLY A C     
197  O O     . GLY A 48  ? 0.9447 0.7066 1.4032 -0.2734 -0.3509 -0.0597 28  GLY A O     
198  N N     . GLU A 49  ? 1.0005 0.6438 1.3885 -0.2635 -0.3304 -0.0661 29  GLU A N     
199  C CA    . GLU A 49  ? 0.9704 0.6203 1.3885 -0.2702 -0.2961 -0.0283 29  GLU A CA    
200  C C     . GLU A 49  ? 0.8989 0.5713 1.2959 -0.2434 -0.2822 -0.0072 29  GLU A C     
201  O O     . GLU A 49  ? 0.8529 0.5686 1.2861 -0.2480 -0.2627 0.0213  29  GLU A O     
202  C CB    . GLU A 49  ? 1.0254 0.6034 1.4223 -0.2742 -0.2756 -0.0221 29  GLU A CB    
203  N N     . CYS A 50  ? 0.8934 0.5364 1.2308 -0.2156 -0.2900 -0.0227 30  CYS A N     
204  C CA    . CYS A 50  ? 0.8377 0.4941 1.1502 -0.1912 -0.2763 -0.0068 30  CYS A CA    
205  C C     . CYS A 50  ? 0.8182 0.4910 1.0951 -0.1730 -0.2984 -0.0295 30  CYS A C     
206  O O     . CYS A 50  ? 0.8641 0.5126 1.1056 -0.1671 -0.3196 -0.0603 30  CYS A O     
207  C CB    . CYS A 50  ? 0.8536 0.4566 1.1240 -0.1711 -0.2556 0.0005  30  CYS A CB    
208  S SG    . CYS A 50  ? 0.9698 0.5882 1.2023 -0.1380 -0.2385 0.0126  30  CYS A SG    
209  N N     . LEU A 51  ? 0.7564 0.4772 1.0300 -0.1572 -0.2837 -0.0124 31  LEU A N     
210  C CA    . LEU A 51  ? 0.7448 0.4850 0.9708 -0.1323 -0.2912 -0.0274 31  LEU A CA    
211  C C     . LEU A 51  ? 0.7334 0.4602 0.9087 -0.1036 -0.2633 -0.0216 31  LEU A C     
212  O O     . LEU A 51  ? 0.6911 0.4330 0.8790 -0.0993 -0.2367 0.0032  31  LEU A O     
213  C CB    . LEU A 51  ? 0.7027 0.5095 0.9601 -0.1328 -0.2951 -0.0148 31  LEU A CB    
214  C CG    . LEU A 51  ? 0.6924 0.5150 0.8971 -0.1055 -0.2998 -0.0246 31  LEU A CG    
215  C CD1   . LEU A 51  ? 0.7480 0.5394 0.9099 -0.1021 -0.3329 -0.0585 31  LEU A CD1   
216  C CD2   . LEU A 51  ? 0.6602 0.5452 0.8990 -0.1023 -0.3009 -0.0079 31  LEU A CD2   
217  N N     . VAL A 52  ? 0.7731 0.4732 0.8914 -0.0846 -0.2692 -0.0460 32  VAL A N     
218  C CA    . VAL A 52  ? 0.7647 0.4574 0.8407 -0.0593 -0.2432 -0.0450 32  VAL A CA    
219  C C     . VAL A 52  ? 0.7606 0.4797 0.7992 -0.0424 -0.2380 -0.0489 32  VAL A C     
220  O O     . VAL A 52  ? 0.7930 0.5015 0.7983 -0.0380 -0.2573 -0.0690 32  VAL A O     
221  C CB    . VAL A 52  ? 0.8127 0.4509 0.8527 -0.0482 -0.2450 -0.0688 32  VAL A CB    
222  C CG1   . VAL A 52  ? 0.7872 0.4291 0.7963 -0.0232 -0.2172 -0.0680 32  VAL A CG1   
223  C CG2   . VAL A 52  ? 0.8416 0.4421 0.9134 -0.0634 -0.2506 -0.0642 32  VAL A CG2   
224  N N     . GLU A 53  ? 0.7251 0.4739 0.7651 -0.0327 -0.2117 -0.0297 33  GLU A N     
225  C CA    . GLU A 53  ? 0.7301 0.4959 0.7330 -0.0170 -0.2007 -0.0305 33  GLU A CA    
226  C C     . GLU A 53  ? 0.7033 0.4636 0.6786 -0.0017 -0.1706 -0.0322 33  GLU A C     
227  O O     . GLU A 53  ? 0.6656 0.4464 0.6625 -0.0015 -0.1509 -0.0157 33  GLU A O     
228  C CB    . GLU A 53  ? 0.7265 0.5356 0.7589 -0.0203 -0.1974 -0.0080 33  GLU A CB    
229  C CG    . GLU A 53  ? 0.7667 0.5946 0.8315 -0.0330 -0.2279 -0.0080 33  GLU A CG    
230  C CD    . GLU A 53  ? 0.7694 0.6412 0.8541 -0.0274 -0.2239 0.0107  33  GLU A CD    
231  O OE1   . GLU A 53  ? 0.7671 0.6726 0.9101 -0.0413 -0.2312 0.0238  33  GLU A OE1   
232  O OE2   . GLU A 53  ? 0.7788 0.6498 0.8215 -0.0088 -0.2115 0.0124  33  GLU A OE2   
233  N N     . PRO A 54  ? 0.7232 0.4577 0.6512 0.0109  -0.1667 -0.0537 34  PRO A N     
234  C CA    . PRO A 54  ? 0.7041 0.4384 0.6100 0.0242  -0.1374 -0.0596 34  PRO A CA    
235  C C     . PRO A 54  ? 0.6796 0.4382 0.5733 0.0281  -0.1148 -0.0470 34  PRO A C     
236  O O     . PRO A 54  ? 0.6660 0.4368 0.5622 0.0323  -0.0894 -0.0463 34  PRO A O     
237  C CB    . PRO A 54  ? 0.7553 0.4553 0.6126 0.0350  -0.1403 -0.0864 34  PRO A CB    
238  C CG    . PRO A 54  ? 0.7984 0.4742 0.6583 0.0264  -0.1745 -0.0968 34  PRO A CG    
239  C CD    . PRO A 54  ? 0.7762 0.4797 0.6710 0.0122  -0.1908 -0.0765 34  PRO A CD    
240  N N     . PHE A 55  ? 0.6831 0.4476 0.5649 0.0272  -0.1252 -0.0384 35  PHE A N     
241  C CA    . PHE A 55  ? 0.6678 0.4460 0.5340 0.0326  -0.1046 -0.0252 35  PHE A CA    
242  C C     . PHE A 55  ? 0.6460 0.4517 0.5477 0.0274  -0.1155 -0.0042 35  PHE A C     
243  O O     . PHE A 55  ? 0.6714 0.4787 0.5564 0.0337  -0.1272 0.0013  35  PHE A O     
244  C CB    . PHE A 55  ? 0.7219 0.4748 0.5257 0.0444  -0.1017 -0.0338 35  PHE A CB    
245  C CG    . PHE A 55  ? 0.7617 0.4864 0.5274 0.0505  -0.0935 -0.0568 35  PHE A CG    
246  C CD1   . PHE A 55  ? 0.8022 0.5044 0.5513 0.0520  -0.1203 -0.0744 35  PHE A CD1   
247  C CD2   . PHE A 55  ? 0.7570 0.4784 0.5052 0.0544  -0.0581 -0.0627 35  PHE A CD2   
248  C CE1   . PHE A 55  ? 0.8406 0.5152 0.5519 0.0605  -0.1104 -0.0971 35  PHE A CE1   
249  C CE2   . PHE A 55  ? 0.7936 0.4938 0.5107 0.0616  -0.0470 -0.0843 35  PHE A CE2   
250  C CZ    . PHE A 55  ? 0.8341 0.5096 0.5303 0.0664  -0.0724 -0.1012 35  PHE A CZ    
251  N N     . VAL A 56  ? 0.6058 0.4335 0.5546 0.0182  -0.1112 0.0079  36  VAL A N     
252  C CA    . VAL A 56  ? 0.5889 0.4455 0.5784 0.0123  -0.1200 0.0269  36  VAL A CA    
253  C C     . VAL A 56  ? 0.5810 0.4512 0.5588 0.0224  -0.1044 0.0399  36  VAL A C     
254  O O     . VAL A 56  ? 0.5774 0.4662 0.5718 0.0255  -0.1180 0.0501  36  VAL A O     
255  C CB    . VAL A 56  ? 0.5947 0.4672 0.6285 0.0016  -0.1128 0.0388  36  VAL A CB    
256  C CG1   . VAL A 56  ? 0.5715 0.4471 0.5948 0.0068  -0.0850 0.0405  36  VAL A CG1   
257  C CG2   . VAL A 56  ? 0.5868 0.4912 0.6649 -0.0055 -0.1180 0.0583  36  VAL A CG2   
258  N N     . GLY A 57  ? 0.5772 0.4379 0.5290 0.0279  -0.0765 0.0382  37  GLY A N     
259  C CA    . GLY A 57  ? 0.5839 0.4470 0.5210 0.0369  -0.0578 0.0492  37  GLY A CA    
260  C C     . GLY A 57  ? 0.5713 0.4656 0.5501 0.0366  -0.0575 0.0674  37  GLY A C     
261  O O     . GLY A 57  ? 0.5435 0.4548 0.5526 0.0284  -0.0490 0.0725  37  GLY A O     
262  N N     . ALA A 58  ? 0.5975 0.4997 0.5759 0.0480  -0.0664 0.0775  38  ALA A N     
263  C CA    . ALA A 58  ? 0.5944 0.5309 0.6161 0.0508  -0.0649 0.0941  38  ALA A CA    
264  C C     . ALA A 58  ? 0.5972 0.5649 0.6729 0.0379  -0.0888 0.0976  38  ALA A C     
265  O O     . ALA A 58  ? 0.5831 0.5838 0.7043 0.0348  -0.0833 0.1111  38  ALA A O     
266  C CB    . ALA A 58  ? 0.6172 0.5528 0.6224 0.0714  -0.0666 0.1034  38  ALA A CB    
267  N N     . GLY A 59  ? 0.6178 0.5726 0.6876 0.0296  -0.1130 0.0844  39  GLY A N     
268  C CA    . GLY A 59  ? 0.6168 0.5921 0.7363 0.0127  -0.1355 0.0843  39  GLY A CA    
269  C C     . GLY A 59  ? 0.6242 0.6381 0.7860 0.0148  -0.1580 0.0912  39  GLY A C     
270  O O     . GLY A 59  ? 0.6125 0.6602 0.8348 0.0005  -0.1608 0.1006  39  GLY A O     
271  N N     . SER A 60  ? 0.6442 0.6546 0.7752 0.0331  -0.1736 0.0871  40  SER A N     
272  C CA    . SER A 60  ? 0.6528 0.7052 0.8240 0.0400  -0.2001 0.0918  40  SER A CA    
273  C C     . SER A 60  ? 0.6578 0.7256 0.8685 0.0190  -0.2362 0.0780  40  SER A C     
274  O O     . SER A 60  ? 0.6525 0.7699 0.9316 0.0102  -0.2522 0.0828  40  SER A O     
275  C CB    . SER A 60  ? 0.6991 0.7362 0.8162 0.0688  -0.2108 0.0912  40  SER A CB    
276  O OG    . SER A 60  ? 0.7475 0.7407 0.8012 0.0705  -0.2258 0.0737  40  SER A OG    
277  N N     . VAL A 61  ? 0.6676 0.6932 0.8377 0.0104  -0.2478 0.0592  41  VAL A N     
278  C CA    . VAL A 61  ? 0.6862 0.7141 0.8863 -0.0113 -0.2813 0.0421  41  VAL A CA    
279  C C     . VAL A 61  ? 0.6481 0.6916 0.9148 -0.0392 -0.2685 0.0510  41  VAL A C     
280  O O     . VAL A 61  ? 0.6604 0.7348 0.9901 -0.0597 -0.2897 0.0482  41  VAL A O     
281  C CB    . VAL A 61  ? 0.7295 0.7010 0.8631 -0.0108 -0.2919 0.0185  41  VAL A CB    
282  C CG1   . VAL A 61  ? 0.7611 0.7271 0.9253 -0.0350 -0.3248 -0.0016 41  VAL A CG1   
283  C CG2   . VAL A 61  ? 0.7707 0.7235 0.8326 0.0163  -0.3034 0.0113  41  VAL A CG2   
284  N N     . PHE A 62  ? 0.6051 0.6270 0.8568 -0.0400 -0.2334 0.0620  42  PHE A N     
285  C CA    . PHE A 62  ? 0.5722 0.6008 0.8725 -0.0618 -0.2160 0.0751  42  PHE A CA    
286  C C     . PHE A 62  ? 0.5479 0.6347 0.9182 -0.0682 -0.2078 0.0948  42  PHE A C     
287  O O     . PHE A 62  ? 0.5495 0.6534 0.9786 -0.0930 -0.2085 0.1014  42  PHE A O     
288  C CB    . PHE A 62  ? 0.5423 0.5407 0.8040 -0.0541 -0.1823 0.0831  42  PHE A CB    
289  C CG    . PHE A 62  ? 0.5121 0.5254 0.8126 -0.0659 -0.1568 0.1049  42  PHE A CG    
290  C CD1   . PHE A 62  ? 0.5204 0.5221 0.8562 -0.0896 -0.1606 0.1088  42  PHE A CD1   
291  C CD2   . PHE A 62  ? 0.4839 0.5166 0.7792 -0.0528 -0.1273 0.1214  42  PHE A CD2   
292  C CE1   . PHE A 62  ? 0.5078 0.5179 0.8703 -0.0990 -0.1343 0.1318  42  PHE A CE1   
293  C CE2   . PHE A 62  ? 0.4662 0.5099 0.7872 -0.0614 -0.1028 0.1413  42  PHE A CE2   
294  C CZ    . PHE A 62  ? 0.4793 0.5119 0.8323 -0.0840 -0.1056 0.1480  42  PHE A CZ    
295  N N     . LEU A 63  ? 0.5264 0.6415 0.8906 -0.0454 -0.1978 0.1043  43  LEU A N     
296  C CA    . LEU A 63  ? 0.4997 0.6730 0.9287 -0.0455 -0.1860 0.1224  43  LEU A CA    
297  C C     . LEU A 63  ? 0.5052 0.7279 0.9947 -0.0522 -0.2217 0.1148  43  LEU A C     
298  O O     . LEU A 63  ? 0.4898 0.7687 1.0530 -0.0601 -0.2151 0.1271  43  LEU A O     
299  C CB    . LEU A 63  ? 0.4889 0.6693 0.8875 -0.0156 -0.1615 0.1339  43  LEU A CB    
300  C CG    . LEU A 63  ? 0.4814 0.6279 0.8354 -0.0106 -0.1241 0.1419  43  LEU A CG    
301  C CD1   . LEU A 63  ? 0.4762 0.6227 0.7970 0.0176  -0.1045 0.1479  43  LEU A CD1   
302  C CD2   . LEU A 63  ? 0.4748 0.6376 0.8708 -0.0288 -0.0996 0.1581  43  LEU A CD2   
303  N N     . ASN A 64  ? 0.5242 0.7287 0.9831 -0.0487 -0.2594 0.0933  44  ASN A N     
304  C CA    . ASN A 64  ? 0.5320 0.7846 1.0421 -0.0523 -0.3006 0.0818  44  ASN A CA    
305  C C     . ASN A 64  ? 0.5659 0.8019 1.0937 -0.0827 -0.3344 0.0587  44  ASN A C     
306  O O     . ASN A 64  ? 0.6013 0.8588 1.1419 -0.0826 -0.3777 0.0397  44  ASN A O     
307  C CB    . ASN A 64  ? 0.5426 0.7948 0.9997 -0.0163 -0.3226 0.0757  44  ASN A CB    
308  C CG    . ASN A 64  ? 0.5149 0.7962 0.9768 0.0133  -0.2969 0.0974  44  ASN A CG    
309  O OD1   . ASN A 64  ? 0.5127 0.8584 1.0408 0.0209  -0.3071 0.1044  44  ASN A OD1   
310  N ND2   . ASN A 64  ? 0.4943 0.7293 0.8893 0.0301  -0.2631 0.1065  44  ASN A ND2   
311  N N     . THR A 65  ? 0.5627 0.7576 1.0882 -0.1071 -0.3159 0.0595  45  THR A N     
312  C CA    . THR A 65  ? 0.5979 0.7711 1.1478 -0.1394 -0.3421 0.0394  45  THR A CA    
313  C C     . THR A 65  ? 0.5967 0.7764 1.2128 -0.1724 -0.3155 0.0564  45  THR A C     
314  O O     . THR A 65  ? 0.5601 0.7568 1.1906 -0.1672 -0.2765 0.0829  45  THR A O     
315  C CB    . THR A 65  ? 0.6155 0.7112 1.0807 -0.1342 -0.3493 0.0194  45  THR A CB    
316  O OG1   . THR A 65  ? 0.5823 0.6413 1.0001 -0.1210 -0.3086 0.0357  45  THR A OG1   
317  C CG2   . THR A 65  ? 0.6432 0.7297 1.0449 -0.1078 -0.3805 -0.0009 45  THR A CG2   
318  N N     . ASP A 66  ? 0.6541 0.8111 1.2919 -0.2015 -0.3285 0.0406  46  ASP A N     
319  C CA    . ASP A 66  ? 0.6782 0.8293 1.3616 -0.2298 -0.2972 0.0571  46  ASP A CA    
320  C C     . ASP A 66  ? 0.7299 0.8049 1.3793 -0.2475 -0.2996 0.0439  46  ASP A C     
321  O O     . ASP A 66  ? 0.7846 0.8518 1.4575 -0.2705 -0.3132 0.0265  46  ASP A O     
322  C CB    . ASP A 66  ? 0.7132 0.9280 1.4734 -0.2483 -0.2992 0.0552  46  ASP A CB    
323  C CG    . ASP A 66  ? 0.7330 0.9518 1.5394 -0.2729 -0.2581 0.0788  46  ASP A CG    
324  O OD1   . ASP A 66  ? 0.7166 0.9054 1.4971 -0.2670 -0.2246 0.1033  46  ASP A OD1   
325  O OD2   . ASP A 66  ? 0.7730 1.0252 1.6382 -0.2979 -0.2588 0.0725  46  ASP A OD2   
326  N N     . PHE A 67  ? 0.7163 0.7360 1.3105 -0.2357 -0.2858 0.0512  47  PHE A N     
327  C CA    . PHE A 67  ? 0.7614 0.7061 1.3191 -0.2452 -0.2823 0.0424  47  PHE A CA    
328  C C     . PHE A 67  ? 0.7668 0.6917 1.3368 -0.2550 -0.2411 0.0731  47  PHE A C     
329  O O     . PHE A 67  ? 0.7259 0.6819 1.3083 -0.2467 -0.2141 0.1004  47  PHE A O     
330  C CB    . PHE A 67  ? 0.7560 0.6487 1.2377 -0.2215 -0.2946 0.0265  47  PHE A CB    
331  C CG    . PHE A 67  ? 0.7795 0.6692 1.2283 -0.2119 -0.3336 -0.0079 47  PHE A CG    
332  C CD1   . PHE A 67  ? 0.7493 0.6858 1.1893 -0.1924 -0.3498 -0.0115 47  PHE A CD1   
333  C CD2   . PHE A 67  ? 0.8407 0.6790 1.2580 -0.2177 -0.3504 -0.0355 47  PHE A CD2   
334  C CE1   . PHE A 67  ? 0.7854 0.7152 1.1850 -0.1808 -0.3858 -0.0412 47  PHE A CE1   
335  C CE2   . PHE A 67  ? 0.8756 0.7095 1.2537 -0.2065 -0.3836 -0.0667 47  PHE A CE2   
336  C CZ    . PHE A 67  ? 0.8488 0.7276 1.2152 -0.1878 -0.4011 -0.0690 47  PHE A CZ    
337  N N     . SER A 68  ? 0.8232 0.6940 1.3837 -0.2706 -0.2357 0.0685  48  SER A N     
338  C CA    . SER A 68  ? 0.8408 0.6827 1.4001 -0.2773 -0.1981 0.0970  48  SER A CA    
339  C C     . SER A 68  ? 0.8079 0.6219 1.3125 -0.2491 -0.1800 0.1142  48  SER A C     
340  O O     . SER A 68  ? 0.7900 0.6181 1.2964 -0.2439 -0.1483 0.1438  48  SER A O     
341  C CB    . SER A 68  ? 0.9170 0.6969 1.4675 -0.2964 -0.1992 0.0858  48  SER A CB    
342  O OG    . SER A 68  ? 0.9595 0.7640 1.5593 -0.3246 -0.2178 0.0659  48  SER A OG    
343  N N     . ARG A 69  ? 0.8044 0.5796 1.2574 -0.2299 -0.1996 0.0936  49  ARG A N     
344  C CA    . ARG A 69  ? 0.7695 0.5193 1.1708 -0.2022 -0.1856 0.1044  49  ARG A CA    
345  C C     . ARG A 69  ? 0.7253 0.4941 1.0902 -0.1779 -0.2018 0.0836  49  ARG A C     
346  O O     . ARG A 69  ? 0.7310 0.5053 1.0960 -0.1814 -0.2305 0.0569  49  ARG A O     
347  C CB    . ARG A 69  ? 0.8203 0.4995 1.1777 -0.1930 -0.1811 0.0996  49  ARG A CB    
348  C CG    . ARG A 69  ? 0.8719 0.5271 1.2434 -0.2086 -0.1569 0.1220  49  ARG A CG    
349  C CD    . ARG A 69  ? 0.9387 0.5215 1.2631 -0.1948 -0.1532 0.1185  49  ARG A CD    
350  N NE    . ARG A 69  ? 0.9957 0.5401 1.3124 -0.2015 -0.1776 0.0856  49  ARG A NE    
351  C CZ    . ARG A 69  ? 0.9974 0.5189 1.2748 -0.1793 -0.1956 0.0594  49  ARG A CZ    
352  N NH1   . ARG A 69  ? 0.9475 0.4813 1.1941 -0.1508 -0.1924 0.0620  49  ARG A NH1   
353  N NH2   . ARG A 69  ? 1.0469 0.5335 1.3145 -0.1857 -0.2150 0.0293  49  ARG A NH2   
354  N N     . TYR A 70  ? 0.6864 0.4673 1.0129 -0.1507 -0.1808 0.0945  50  TYR A N     
355  C CA    . TYR A 70  ? 0.6605 0.4572 0.9438 -0.1252 -0.1867 0.0765  50  TYR A CA    
356  C C     . TYR A 70  ? 0.6692 0.4362 0.9005 -0.1000 -0.1727 0.0740  50  TYR A C     
357  O O     . TYR A 70  ? 0.6630 0.4284 0.8904 -0.0935 -0.1513 0.0950  50  TYR A O     
358  C CB    . TYR A 70  ? 0.6086 0.4658 0.9068 -0.1180 -0.1749 0.0893  50  TYR A CB    
359  C CG    . TYR A 70  ? 0.6037 0.5027 0.9518 -0.1345 -0.1934 0.0863  50  TYR A CG    
360  C CD1   . TYR A 70  ? 0.5982 0.5284 1.0101 -0.1571 -0.1841 0.1063  50  TYR A CD1   
361  C CD2   . TYR A 70  ? 0.6060 0.5162 0.9376 -0.1260 -0.2196 0.0637  50  TYR A CD2   
362  C CE1   . TYR A 70  ? 0.5951 0.5732 1.0624 -0.1714 -0.2025 0.1018  50  TYR A CE1   
363  C CE2   . TYR A 70  ? 0.6054 0.5593 0.9843 -0.1377 -0.2412 0.0599  50  TYR A CE2   
364  C CZ    . TYR A 70  ? 0.5987 0.5900 1.0500 -0.1606 -0.2335 0.0779  50  TYR A CZ    
365  O OH    . TYR A 70  ? 0.5991 0.6430 1.1069 -0.1717 -0.2564 0.0724  50  TYR A OH    
366  N N     . ILE A 71  ? 0.6892 0.4353 0.8808 -0.0851 -0.1850 0.0475  51  ILE A N     
367  C CA    . ILE A 71  ? 0.6908 0.4240 0.8403 -0.0599 -0.1713 0.0415  51  ILE A CA    
368  C C     . ILE A 71  ? 0.6667 0.4315 0.7897 -0.0454 -0.1656 0.0315  51  ILE A C     
369  O O     . ILE A 71  ? 0.6911 0.4472 0.7906 -0.0416 -0.1794 0.0100  51  ILE A O     
370  C CB    . ILE A 71  ? 0.7460 0.4263 0.8699 -0.0517 -0.1828 0.0191  51  ILE A CB    
371  C CG1   . ILE A 71  ? 0.7931 0.4310 0.9392 -0.0652 -0.1865 0.0309  51  ILE A CG1   
372  C CG2   . ILE A 71  ? 0.7322 0.4117 0.8219 -0.0246 -0.1678 0.0112  51  ILE A CG2   
373  C CD1   . ILE A 71  ? 0.8523 0.4312 0.9732 -0.0541 -0.1966 0.0096  51  ILE A CD1   
374  N N     . LEU A 72  ? 0.6202 0.4171 0.7431 -0.0375 -0.1444 0.0475  52  LEU A N     
375  C CA    . LEU A 72  ? 0.5895 0.4126 0.6906 -0.0266 -0.1353 0.0422  52  LEU A CA    
376  C C     . LEU A 72  ? 0.5800 0.4010 0.6507 -0.0095 -0.1173 0.0337  52  LEU A C     
377  O O     . LEU A 72  ? 0.5703 0.3971 0.6470 -0.0050 -0.1051 0.0439  52  LEU A O     
378  C CB    . LEU A 72  ? 0.5590 0.4209 0.6859 -0.0317 -0.1246 0.0635  52  LEU A CB    
379  C CG    . LEU A 72  ? 0.5693 0.4459 0.7404 -0.0499 -0.1401 0.0730  52  LEU A CG    
380  C CD1   . LEU A 72  ? 0.5436 0.4635 0.7418 -0.0503 -0.1258 0.0930  52  LEU A CD1   
381  C CD2   . LEU A 72  ? 0.5915 0.4592 0.7549 -0.0527 -0.1677 0.0526  52  LEU A CD2   
382  N N     . ALA A 73  ? 0.5898 0.4042 0.6281 -0.0002 -0.1156 0.0146  53  ALA A N     
383  C CA    . ALA A 73  ? 0.5948 0.4110 0.6117 0.0130  -0.0976 0.0029  53  ALA A CA    
384  C C     . ALA A 73  ? 0.6129 0.4393 0.6023 0.0177  -0.0824 -0.0035 53  ALA A C     
385  O O     . ALA A 73  ? 0.6225 0.4431 0.5957 0.0163  -0.0904 -0.0044 53  ALA A O     
386  C CB    . ALA A 73  ? 0.6164 0.4034 0.6202 0.0213  -0.1048 -0.0173 53  ALA A CB    
387  N N     . ASP A 74  ? 0.6201 0.4608 0.6043 0.0233  -0.0610 -0.0081 54  ASP A N     
388  C CA    . ASP A 74  ? 0.6426 0.4867 0.6007 0.0255  -0.0409 -0.0143 54  ASP A CA    
389  C C     . ASP A 74  ? 0.6312 0.4893 0.5924 0.0291  -0.0206 -0.0278 54  ASP A C     
390  O O     . ASP A 74  ? 0.6161 0.4905 0.6019 0.0313  -0.0230 -0.0269 54  ASP A O     
391  C CB    . ASP A 74  ? 0.6417 0.4995 0.6036 0.0213  -0.0341 0.0036  54  ASP A CB    
392  C CG    . ASP A 74  ? 0.6796 0.5257 0.6065 0.0244  -0.0177 0.0006  54  ASP A CG    
393  O OD1   . ASP A 74  ? 0.6875 0.5356 0.6047 0.0234  0.0061  -0.0081 54  ASP A OD1   
394  O OD2   . ASP A 74  ? 0.7073 0.5414 0.6164 0.0277  -0.0290 0.0070  54  ASP A OD2   
395  N N     . ILE A 75  ? 0.6472 0.4998 0.5837 0.0299  -0.0004 -0.0401 55  ILE A N     
396  C CA    . ILE A 75  ? 0.6432 0.5151 0.5904 0.0303  0.0206  -0.0561 55  ILE A CA    
397  C C     . ILE A 75  ? 0.6059 0.5012 0.5689 0.0220  0.0345  -0.0502 55  ILE A C     
398  O O     . ILE A 75  ? 0.5845 0.5059 0.5692 0.0204  0.0449  -0.0630 55  ILE A O     
399  C CB    . ILE A 75  ? 0.6912 0.5477 0.6074 0.0313  0.0428  -0.0715 55  ILE A CB    
400  C CG1   . ILE A 75  ? 0.7012 0.5836 0.6413 0.0335  0.0603  -0.0926 55  ILE A CG1   
401  C CG2   . ILE A 75  ? 0.7013 0.5443 0.5895 0.0235  0.0631  -0.0623 55  ILE A CG2   
402  C CD1   . ILE A 75  ? 0.7087 0.5969 0.6698 0.0472  0.0416  -0.1025 55  ILE A CD1   
403  N N     . ASN A 76  ? 0.5997 0.4870 0.5531 0.0179  0.0334  -0.0327 56  ASN A N     
404  C CA    . ASN A 76  ? 0.5771 0.4789 0.5388 0.0112  0.0469  -0.0280 56  ASN A CA    
405  C C     . ASN A 76  ? 0.5420 0.4671 0.5303 0.0131  0.0329  -0.0206 56  ASN A C     
406  O O     . ASN A 76  ? 0.5333 0.4550 0.5270 0.0159  0.0174  -0.0033 56  ASN A O     
407  C CB    . ASN A 76  ? 0.6004 0.4818 0.5392 0.0106  0.0530  -0.0122 56  ASN A CB    
408  C CG    . ASN A 76  ? 0.6026 0.4887 0.5423 0.0044  0.0720  -0.0110 56  ASN A CG    
409  O OD1   . ASN A 76  ? 0.5917 0.4992 0.5514 0.0031  0.0681  -0.0097 56  ASN A OD1   
410  N ND2   . ASN A 76  ? 0.6276 0.4882 0.5401 0.0014  0.0934  -0.0116 56  ASN A ND2   
411  N N     . SER A 77  ? 0.5220 0.4719 0.5266 0.0114  0.0388  -0.0338 57  SER A N     
412  C CA    . SER A 77  ? 0.5075 0.4778 0.5284 0.0167  0.0247  -0.0276 57  SER A CA    
413  C C     . SER A 77  ? 0.5075 0.4785 0.5209 0.0135  0.0297  -0.0128 57  SER A C     
414  O O     . SER A 77  ? 0.5070 0.4820 0.5238 0.0188  0.0184  0.0031  57  SER A O     
415  C CB    . SER A 77  ? 0.5017 0.5030 0.5416 0.0185  0.0255  -0.0489 57  SER A CB    
416  O OG    . SER A 77  ? 0.5023 0.5140 0.5425 0.0059  0.0455  -0.0640 57  SER A OG    
417  N N     . ASP A 78  ? 0.5176 0.4810 0.5185 0.0055  0.0491  -0.0177 58  ASP A N     
418  C CA    . ASP A 78  ? 0.5327 0.4927 0.5241 0.0051  0.0567  -0.0057 58  ASP A CA    
419  C C     . ASP A 78  ? 0.5196 0.4690 0.5107 0.0111  0.0483  0.0187  58  ASP A C     
420  O O     . ASP A 78  ? 0.5220 0.4797 0.5169 0.0148  0.0466  0.0334  58  ASP A O     
421  C CB    . ASP A 78  ? 0.5742 0.5176 0.5498 -0.0033 0.0803  -0.0157 58  ASP A CB    
422  C CG    . ASP A 78  ? 0.6108 0.5695 0.5945 -0.0142 0.0900  -0.0418 58  ASP A CG    
423  O OD1   . ASP A 78  ? 0.6464 0.5890 0.6230 -0.0253 0.1104  -0.0539 58  ASP A OD1   
424  O OD2   . ASP A 78  ? 0.6075 0.5947 0.6050 -0.0118 0.0772  -0.0500 58  ASP A OD2   
425  N N     . LEU A 79  ? 0.5148 0.4481 0.5020 0.0118  0.0434  0.0218  59  LEU A N     
426  C CA    . LEU A 79  ? 0.5098 0.4385 0.5038 0.0156  0.0310  0.0408  59  LEU A CA    
427  C C     . LEU A 79  ? 0.4850 0.4252 0.5008 0.0158  0.0139  0.0516  59  LEU A C     
428  O O     . LEU A 79  ? 0.4751 0.4245 0.5049 0.0160  0.0123  0.0696  59  LEU A O     
429  C CB    . LEU A 79  ? 0.5425 0.4514 0.5226 0.0169  0.0244  0.0370  59  LEU A CB    
430  C CG    . LEU A 79  ? 0.5612 0.4687 0.5509 0.0198  0.0059  0.0515  59  LEU A CG    
431  C CD1   . LEU A 79  ? 0.5691 0.4841 0.5631 0.0254  0.0135  0.0668  59  LEU A CD1   
432  C CD2   . LEU A 79  ? 0.5881 0.4739 0.5544 0.0225  -0.0036 0.0427  59  LEU A CD2   
433  N N     . ILE A 80  ? 0.4793 0.4175 0.4984 0.0162  0.0037  0.0412  60  ILE A N     
434  C CA    . ILE A 80  ? 0.4791 0.4175 0.5138 0.0175  -0.0118 0.0518  60  ILE A CA    
435  C C     . ILE A 80  ? 0.4790 0.4319 0.5151 0.0204  -0.0063 0.0635  60  ILE A C     
436  O O     . ILE A 80  ? 0.4872 0.4391 0.5336 0.0189  -0.0100 0.0835  60  ILE A O     
437  C CB    . ILE A 80  ? 0.4935 0.4231 0.5281 0.0224  -0.0225 0.0362  60  ILE A CB    
438  C CG1   . ILE A 80  ? 0.5044 0.4149 0.5310 0.0207  -0.0281 0.0252  60  ILE A CG1   
439  C CG2   . ILE A 80  ? 0.5041 0.4256 0.5499 0.0261  -0.0367 0.0487  60  ILE A CG2   
440  C CD1   . ILE A 80  ? 0.5157 0.4132 0.5508 0.0149  -0.0427 0.0384  60  ILE A CD1   
441  N N     . SER A 81  ? 0.4693 0.4351 0.4935 0.0234  0.0033  0.0503  61  SER A N     
442  C CA    . SER A 81  ? 0.4723 0.4510 0.4879 0.0281  0.0075  0.0577  61  SER A CA    
443  C C     . SER A 81  ? 0.4682 0.4485 0.4819 0.0260  0.0208  0.0763  61  SER A C     
444  O O     . SER A 81  ? 0.4915 0.4755 0.5017 0.0295  0.0229  0.0938  61  SER A O     
445  C CB    . SER A 81  ? 0.4742 0.4684 0.4793 0.0291  0.0135  0.0344  61  SER A CB    
446  O OG    . SER A 81  ? 0.4931 0.4984 0.4824 0.0347  0.0156  0.0390  61  SER A OG    
447  N N     . LEU A 82  ? 0.4506 0.4273 0.4652 0.0224  0.0313  0.0732  62  LEU A N     
448  C CA    . LEU A 82  ? 0.4494 0.4307 0.4681 0.0240  0.0442  0.0894  62  LEU A CA    
449  C C     . LEU A 82  ? 0.4593 0.4455 0.5040 0.0210  0.0363  0.1120  62  LEU A C     
450  O O     . LEU A 82  ? 0.4744 0.4720 0.5260 0.0225  0.0471  0.1294  62  LEU A O     
451  C CB    . LEU A 82  ? 0.4384 0.4104 0.4525 0.0246  0.0533  0.0825  62  LEU A CB    
452  C CG    . LEU A 82  ? 0.4392 0.4181 0.4652 0.0304  0.0629  0.0992  62  LEU A CG    
453  C CD1   . LEU A 82  ? 0.4488 0.4365 0.4646 0.0365  0.0817  0.1041  62  LEU A CD1   
454  C CD2   . LEU A 82  ? 0.4452 0.4080 0.4611 0.0351  0.0674  0.0935  62  LEU A CD2   
455  N N     . TYR A 83  ? 0.4632 0.4403 0.5227 0.0156  0.0191  0.1103  63  TYR A N     
456  C CA    . TYR A 83  ? 0.4678 0.4473 0.5573 0.0081  0.0091  0.1275  63  TYR A CA    
457  C C     . TYR A 83  ? 0.4921 0.4685 0.5842 0.0059  0.0102  0.1435  63  TYR A C     
458  O O     . TYR A 83  ? 0.5012 0.4855 0.6172 -0.0011 0.0156  0.1637  63  TYR A O     
459  C CB    . TYR A 83  ? 0.4682 0.4324 0.5652 0.0029  -0.0118 0.1167  63  TYR A CB    
460  C CG    . TYR A 83  ? 0.4735 0.4397 0.5696 0.0051  -0.0151 0.1095  63  TYR A CG    
461  C CD1   . TYR A 83  ? 0.4701 0.4523 0.5692 0.0113  -0.0014 0.1170  63  TYR A CD1   
462  C CD2   . TYR A 83  ? 0.4871 0.4363 0.5745 0.0039  -0.0319 0.0955  63  TYR A CD2   
463  C CE1   . TYR A 83  ? 0.4787 0.4589 0.5723 0.0175  -0.0059 0.1130  63  TYR A CE1   
464  C CE2   . TYR A 83  ? 0.4920 0.4394 0.5694 0.0089  -0.0362 0.0909  63  TYR A CE2   
465  C CZ    . TYR A 83  ? 0.4906 0.4532 0.5714 0.0163  -0.0240 0.1008  63  TYR A CZ    
466  O OH    . TYR A 83  ? 0.5044 0.4615 0.5707 0.0255  -0.0296 0.0987  63  TYR A OH    
467  N N     . ASN A 84  ? 0.5108 0.4761 0.5791 0.0126  0.0059  0.1350  64  ASN A N     
468  C CA    . ASN A 84  ? 0.5445 0.5006 0.6040 0.0156  0.0061  0.1515  64  ASN A CA    
469  C C     . ASN A 84  ? 0.5636 0.5337 0.6070 0.0206  0.0268  0.1662  64  ASN A C     
470  O O     . ASN A 84  ? 0.5965 0.5615 0.6415 0.0182  0.0352  0.1901  64  ASN A O     
471  C CB    . ASN A 84  ? 0.5574 0.5024 0.5954 0.0268  -0.0071 0.1369  64  ASN A CB    
472  C CG    . ASN A 84  ? 0.5793 0.5021 0.6310 0.0244  -0.0255 0.1292  64  ASN A CG    
473  O OD1   . ASN A 84  ? 0.6065 0.5105 0.6755 0.0153  -0.0308 0.1438  64  ASN A OD1   
474  N ND2   . ASN A 84  ? 0.5632 0.4877 0.6083 0.0316  -0.0336 0.1048  64  ASN A ND2   
475  N N     . ILE A 85  ? 0.5506 0.5347 0.5762 0.0270  0.0370  0.1516  65  ILE A N     
476  C CA    . ILE A 85  ? 0.5636 0.5586 0.5681 0.0336  0.0576  0.1605  65  ILE A CA    
477  C C     . ILE A 85  ? 0.5536 0.5614 0.5860 0.0279  0.0751  0.1813  65  ILE A C     
478  O O     . ILE A 85  ? 0.5863 0.5977 0.6121 0.0295  0.0915  0.2021  65  ILE A O     
479  C CB    . ILE A 85  ? 0.5631 0.5648 0.5451 0.0394  0.0646  0.1361  65  ILE A CB    
480  C CG1   . ILE A 85  ? 0.5702 0.5696 0.5301 0.0443  0.0493  0.1147  65  ILE A CG1   
481  C CG2   . ILE A 85  ? 0.5859 0.5953 0.5459 0.0468  0.0876  0.1432  65  ILE A CG2   
482  C CD1   . ILE A 85  ? 0.6072 0.6055 0.5370 0.0550  0.0446  0.1243  65  ILE A CD1   
483  N N     . VAL A 86  ? 0.5162 0.5326 0.5796 0.0224  0.0719  0.1759  66  VAL A N     
484  C CA    . VAL A 86  ? 0.5036 0.5413 0.6045 0.0184  0.0844  0.1926  66  VAL A CA    
485  C C     . VAL A 86  ? 0.5155 0.5545 0.6468 0.0051  0.0835  0.2156  66  VAL A C     
486  O O     . VAL A 86  ? 0.5448 0.6027 0.6969 0.0023  0.1042  0.2354  66  VAL A O     
487  C CB    . VAL A 86  ? 0.4790 0.5243 0.6059 0.0172  0.0727  0.1816  66  VAL A CB    
488  C CG1   . VAL A 86  ? 0.4756 0.5505 0.6534 0.0125  0.0778  0.1982  66  VAL A CG1   
489  C CG2   . VAL A 86  ? 0.4682 0.5077 0.5660 0.0298  0.0816  0.1641  66  VAL A CG2   
490  N N     . LYS A 87  ? 0.5102 0.5269 0.6441 -0.0033 0.0621  0.2126  67  LYS A N     
491  C CA    . LYS A 87  ? 0.5267 0.5335 0.6877 -0.0185 0.0601  0.2328  67  LYS A CA    
492  C C     . LYS A 87  ? 0.5565 0.5507 0.6897 -0.0150 0.0799  0.2556  67  LYS A C     
493  O O     . LYS A 87  ? 0.5752 0.5773 0.7335 -0.0261 0.0986  0.2794  67  LYS A O     
494  C CB    . LYS A 87  ? 0.5319 0.5089 0.6941 -0.0249 0.0326  0.2209  67  LYS A CB    
495  C CG    . LYS A 87  ? 0.5702 0.5208 0.7464 -0.0387 0.0312  0.2407  67  LYS A CG    
496  C CD    . LYS A 87  ? 0.5763 0.4944 0.7560 -0.0440 0.0041  0.2259  67  LYS A CD    
497  C CE    . LYS A 87  ? 0.6267 0.5087 0.8175 -0.0578 0.0047  0.2461  67  LYS A CE    
498  N NZ    . LYS A 87  ? 0.6454 0.4932 0.8454 -0.0651 -0.0212 0.2298  67  LYS A NZ    
499  N N     . MET A 88  ? 0.5647 0.5408 0.6460 0.0006  0.0760  0.2483  68  MET A N     
500  C CA    . MET A 88  ? 0.6094 0.5663 0.6522 0.0081  0.0886  0.2697  68  MET A CA    
501  C C     . MET A 88  ? 0.6199 0.5954 0.6343 0.0187  0.1169  0.2782  68  MET A C     
502  O O     . MET A 88  ? 0.6593 0.6243 0.6505 0.0206  0.1351  0.2998  68  MET A O     
503  C CB    . MET A 88  ? 0.6268 0.5592 0.6270 0.0235  0.0669  0.2571  68  MET A CB    
504  C CG    . MET A 88  ? 0.6274 0.5344 0.6478 0.0174  0.0419  0.2502  68  MET A CG    
505  S SD    . MET A 88  ? 1.2284 1.0979 1.2685 0.0011  0.0478  0.2833  68  MET A SD    
506  C CE    . MET A 88  ? 0.8901 0.7264 0.9417 0.0010  0.0151  0.2639  68  MET A CE    
507  N N     . ARG A 89  ? 0.8404 0.6689 0.7495 -0.0571 0.0628  0.2958  69  ARG A N     
508  C CA    . ARG A 89  ? 0.8503 0.7268 0.7112 -0.0551 0.0641  0.2978  69  ARG A CA    
509  C C     . ARG A 89  ? 0.7712 0.7169 0.6607 -0.0663 0.0839  0.2605  69  ARG A C     
510  O O     . ARG A 89  ? 0.7246 0.7115 0.6122 -0.0479 0.0734  0.2368  69  ARG A O     
511  C CB    . ARG A 89  ? 0.8613 0.7455 0.7019 -0.0215 0.0277  0.2993  69  ARG A CB    
512  C CG    . ARG A 89  ? 0.9479 0.7750 0.7714 -0.0042 0.0027  0.3420  69  ARG A CG    
513  C CD    . ARG A 89  ? 0.9348 0.7822 0.7712 0.0291  -0.0375 0.3380  69  ARG A CD    
514  N NE    . ARG A 89  ? 0.9672 0.8520 0.7408 0.0285  -0.0534 0.3387  69  ARG A NE    
515  C CZ    . ARG A 89  ? 0.9749 0.8812 0.7425 0.0484  -0.0923 0.3415  69  ARG A CZ    
516  N NH1   . ARG A 89  ? 0.9548 0.8570 0.7849 0.0743  -0.1171 0.3467  69  ARG A NH1   
517  N NH2   . ARG A 89  ? 1.0067 0.9404 0.7062 0.0404  -0.1049 0.3375  69  ARG A NH2   
518  N N     . THR A 90  ? 0.7671 0.7245 0.6856 -0.0974 0.1115  0.2576  70  THR A N     
519  C CA    . THR A 90  ? 0.7053 0.7329 0.6714 -0.1069 0.1270  0.2269  70  THR A CA    
520  C C     . THR A 90  ? 0.6956 0.7778 0.6372 -0.0972 0.1435  0.2175  70  THR A C     
521  O O     . THR A 90  ? 0.6320 0.7514 0.5957 -0.0753 0.1341  0.1891  70  THR A O     
522  C CB    . THR A 90  ? 0.7275 0.7643 0.7276 -0.1485 0.1522  0.2329  70  THR A CB    
523  O OG1   . THR A 90  ? 0.7498 0.7234 0.7645 -0.1606 0.1409  0.2362  70  THR A OG1   
524  C CG2   . THR A 90  ? 0.6545 0.7722 0.7171 -0.1554 0.1600  0.2055  70  THR A CG2   
525  N N     . ASP A 91  ? 0.7676 0.8501 0.6613 -0.1147 0.1709  0.2405  71  ASP A N     
526  C CA    . ASP A 91  ? 0.7933 0.9256 0.6594 -0.1083 0.1973  0.2279  71  ASP A CA    
527  C C     . ASP A 91  ? 0.7887 0.9088 0.6037 -0.0771 0.1743  0.2123  71  ASP A C     
528  O O     . ASP A 91  ? 0.7603 0.9187 0.5812 -0.0605 0.1848  0.1815  71  ASP A O     
529  C CB    . ASP A 91  ? 0.8966 1.0266 0.7093 -0.1375 0.2335  0.2587  71  ASP A CB    
530  C CG    . ASP A 91  ? 0.9104 1.0830 0.7827 -0.1721 0.2667  0.2651  71  ASP A CG    
531  O OD1   . ASP A 91  ? 0.8454 1.0794 0.7947 -0.1672 0.2723  0.2387  71  ASP A OD1   
532  O OD2   . ASP A 91  ? 0.9950 1.1310 0.8396 -0.2014 0.2813  0.2904  71  ASP A OD2   
533  N N     . GLU A 92  ? 0.8236 0.8896 0.5919 -0.0698 0.1421  0.2342  72  GLU A N     
534  C CA    . GLU A 92  ? 0.8376 0.8941 0.5592 -0.0464 0.1125  0.2226  72  GLU A CA    
535  C C     . GLU A 92  ? 0.7241 0.8017 0.5065 -0.0240 0.0904  0.1859  72  GLU A C     
536  O O     . GLU A 92  ? 0.7153 0.8076 0.4763 -0.0101 0.0846  0.1589  72  GLU A O     
537  C CB    . GLU A 92  ? 0.9173 0.9216 0.5954 -0.0426 0.0772  0.2605  72  GLU A CB    
538  C CG    . GLU A 92  ? 0.9553 0.9578 0.5909 -0.0235 0.0392  0.2525  72  GLU A CG    
539  C CD    . GLU A 92  ? 1.0238 0.9867 0.6385 -0.0152 -0.0007 0.2948  72  GLU A CD    
540  O OE1   . GLU A 92  ? 1.0462 1.0146 0.6326 -0.0027 -0.0380 0.2942  72  GLU A OE1   
541  O OE2   . GLU A 92  ? 1.0579 0.9841 0.6882 -0.0214 0.0043  0.3297  72  GLU A OE2   
542  N N     . TYR A 93  ? 0.6473 0.7215 0.4997 -0.0239 0.0797  0.1844  73  TYR A N     
543  C CA    . TYR A 93  ? 0.5639 0.6566 0.4714 -0.0073 0.0586  0.1553  73  TYR A CA    
544  C C     . TYR A 93  ? 0.5226 0.6639 0.4668 -0.0045 0.0797  0.1263  73  TYR A C     
545  O O     . TYR A 93  ? 0.4874 0.6393 0.4359 0.0128  0.0673  0.1019  73  TYR A O     
546  C CB    . TYR A 93  ? 0.5223 0.5981 0.4856 -0.0123 0.0471  0.1600  73  TYR A CB    
547  C CG    . TYR A 93  ? 0.4578 0.5562 0.4735 -0.0009 0.0289  0.1325  73  TYR A CG    
548  C CD1   . TYR A 93  ? 0.4458 0.5347 0.4593 0.0178  -0.0015 0.1263  73  TYR A CD1   
549  C CD2   . TYR A 93  ? 0.4224 0.5569 0.4904 -0.0117 0.0407  0.1164  73  TYR A CD2   
550  C CE1   . TYR A 93  ? 0.3973 0.5066 0.4545 0.0240  -0.0158 0.1041  73  TYR A CE1   
551  C CE2   . TYR A 93  ? 0.3772 0.5305 0.4854 -0.0042 0.0228  0.0964  73  TYR A CE2   
552  C CZ    . TYR A 93  ? 0.3646 0.5027 0.4649 0.0128  -0.0034 0.0900  73  TYR A CZ    
553  O OH    . TYR A 93  ? 0.3332 0.4898 0.4699 0.0161  -0.0190 0.0729  73  TYR A OH    
554  N N     . VAL A 94  ? 0.5311 0.7019 0.5071 -0.0220 0.1106  0.1314  74  VAL A N     
555  C CA    . VAL A 94  ? 0.5070 0.7332 0.5340 -0.0168 0.1314  0.1106  74  VAL A CA    
556  C C     . VAL A 94  ? 0.5493 0.7840 0.5360 0.0030  0.1481  0.0904  74  VAL A C     
557  O O     . VAL A 94  ? 0.5283 0.7818 0.5479 0.0231  0.1458  0.0657  74  VAL A O     
558  C CB    . VAL A 94  ? 0.5191 0.7851 0.5852 -0.0430 0.1636  0.1252  74  VAL A CB    
559  C CG1   . VAL A 94  ? 0.4905 0.8245 0.6121 -0.0317 0.1890  0.1085  74  VAL A CG1   
560  C CG2   . VAL A 94  ? 0.4834 0.7411 0.5940 -0.0659 0.1465  0.1352  74  VAL A CG2   
561  N N     . GLN A 95  ? 0.6173 0.8317 0.5272 -0.0041 0.1650  0.1008  75  GLN A N     
562  C CA    . GLN A 95  ? 0.6718 0.8859 0.5250 0.0095  0.1849  0.0773  75  GLN A CA    
563  C C     . GLN A 95  ? 0.6748 0.8567 0.5026 0.0282  0.1489  0.0536  75  GLN A C     
564  O O     . GLN A 95  ? 0.6931 0.8785 0.5194 0.0454  0.1607  0.0212  75  GLN A O     
565  C CB    . GLN A 95  ? 0.7592 0.9538 0.5192 -0.0089 0.2049  0.0973  75  GLN A CB    
566  N N     . ALA A 96  ? 0.6611 0.8113 0.4739 0.0246  0.1065  0.0700  76  ALA A N     
567  C CA    . ALA A 96  ? 0.6564 0.7831 0.4490 0.0360  0.0693  0.0522  76  ALA A CA    
568  C C     . ALA A 96  ? 0.5852 0.7262 0.4557 0.0496  0.0561  0.0319  76  ALA A C     
569  O O     . ALA A 96  ? 0.5958 0.7242 0.4568 0.0599  0.0447  0.0056  76  ALA A O     
570  C CB    . ALA A 96  ? 0.6602 0.7611 0.4261 0.0299  0.0296  0.0804  76  ALA A CB    
571  N N     . ALA A 97  ? 0.5251 0.6886 0.4669 0.0457  0.0568  0.0448  77  ALA A N     
572  C CA    . ALA A 97  ? 0.4700 0.6493 0.4805 0.0538  0.0414  0.0325  77  ALA A CA    
573  C C     . ALA A 97  ? 0.4888 0.6942 0.5355 0.0681  0.0660  0.0127  77  ALA A C     
574  O O     . ALA A 97  ? 0.4703 0.6752 0.5523 0.0798  0.0511  -0.0009 77  ALA A O     
575  C CB    . ALA A 97  ? 0.4101 0.6044 0.4738 0.0402  0.0349  0.0508  77  ALA A CB    
576  N N     . ARG A 98  ? 0.5228 0.7513 0.5641 0.0681  0.1051  0.0138  78  ARG A N     
577  C CA    . ARG A 98  ? 0.5357 0.7976 0.6247 0.0868  0.1348  -0.0023 78  ARG A CA    
578  C C     . ARG A 98  ? 0.5992 0.8243 0.6488 0.1085  0.1392  -0.0350 78  ARG A C     
579  O O     . ARG A 98  ? 0.6012 0.8361 0.7001 0.1314  0.1507  -0.0509 78  ARG A O     
580  C CB    . ARG A 98  ? 0.5700 0.8730 0.6649 0.0795  0.1804  0.0073  78  ARG A CB    
581  C CG    . ARG A 98  ? 0.5748 0.9314 0.7446 0.1009  0.2137  -0.0028 78  ARG A CG    
582  C CD    . ARG A 98  ? 0.5999 1.0162 0.7998 0.0846  0.2529  0.0157  78  ARG A CD    
583  N NE    . ARG A 98  ? 0.6869 1.0805 0.7974 0.0695  0.2812  0.0167  78  ARG A NE    
584  C CZ    . ARG A 98  ? 0.7167 1.1322 0.8169 0.0391  0.2993  0.0432  78  ARG A CZ    
585  N NH1   . ARG A 98  ? 0.6671 1.1265 0.8415 0.0186  0.2921  0.0665  78  ARG A NH1   
586  N NH2   . ARG A 98  ? 0.8009 1.1914 0.8113 0.0249  0.3233  0.0475  78  ARG A NH2   
587  N N     . GLU A 99  ? 0.6631 0.8432 0.6237 0.1001  0.1281  -0.0442 79  GLU A N     
588  C CA    . GLU A 99  ? 0.7338 0.8696 0.6412 0.1118  0.1293  -0.0792 79  GLU A CA    
589  C C     . GLU A 99  ? 0.6818 0.7933 0.6263 0.1197  0.0932  -0.0896 79  GLU A C     
590  O O     . GLU A 99  ? 0.7298 0.8032 0.6557 0.1323  0.0976  -0.1203 79  GLU A O     
591  C CB    . GLU A 99  ? 0.8305 0.9305 0.6295 0.0927  0.1171  -0.0818 79  GLU A CB    
592  C CG    . GLU A 99  ? 0.9217 1.0343 0.6609 0.0829  0.1571  -0.0755 79  GLU A CG    
593  C CD    . GLU A 99  ? 1.0339 1.1094 0.6557 0.0630  0.1411  -0.0779 79  GLU A CD    
594  O OE1   . GLU A 99  ? 1.0425 1.0885 0.6385 0.0568  0.0962  -0.0836 79  GLU A OE1   
595  O OE2   . GLU A 99  ? 1.1157 1.1959 0.6706 0.0508  0.1721  -0.0718 79  GLU A OE2   
596  N N     . LEU A 100 ? 0.5956 0.7249 0.5887 0.1101  0.0601  -0.0649 80  LEU A N     
597  C CA    . LEU A 100 ? 0.5546 0.6660 0.5799 0.1114  0.0257  -0.0691 80  LEU A CA    
598  C C     . LEU A 100 ? 0.5165 0.6513 0.6253 0.1287  0.0335  -0.0657 80  LEU A C     
599  O O     . LEU A 100 ? 0.5089 0.6243 0.6437 0.1319  0.0106  -0.0689 80  LEU A O     
600  C CB    . LEU A 100 ? 0.4941 0.6148 0.5274 0.0924  -0.0105 -0.0461 80  LEU A CB    
601  C CG    . LEU A 100 ? 0.5321 0.6259 0.5031 0.0788  -0.0390 -0.0483 80  LEU A CG    
602  C CD1   . LEU A 100 ? 0.5981 0.6819 0.4939 0.0740  -0.0235 -0.0482 80  LEU A CD1   
603  C CD2   . LEU A 100 ? 0.4818 0.5940 0.4843 0.0679  -0.0673 -0.0247 80  LEU A CD2   
604  N N     . PHE A 101 ? 0.4930 0.6731 0.6455 0.1376  0.0640  -0.0553 81  PHE A N     
605  C CA    . PHE A 101 ? 0.4536 0.6692 0.6931 0.1545  0.0683  -0.0454 81  PHE A CA    
606  C C     . PHE A 101 ? 0.5081 0.7174 0.7644 0.1873  0.1062  -0.0672 81  PHE A C     
607  O O     . PHE A 101 ? 0.5048 0.7670 0.8138 0.2008  0.1379  -0.0595 81  PHE A O     
608  C CB    . PHE A 101 ? 0.3962 0.6772 0.6886 0.1398  0.0721  -0.0167 81  PHE A CB    
609  C CG    . PHE A 101 ? 0.3445 0.6291 0.6411 0.1132  0.0358  0.0017  81  PHE A CG    
610  C CD1   . PHE A 101 ? 0.3428 0.5974 0.5806 0.0949  0.0228  0.0016  81  PHE A CD1   
611  C CD2   . PHE A 101 ? 0.3028 0.6214 0.6616 0.1071  0.0154  0.0196  81  PHE A CD2   
612  C CE1   . PHE A 101 ? 0.3049 0.5613 0.5508 0.0748  -0.0037 0.0144  81  PHE A CE1   
613  C CE2   . PHE A 101 ? 0.2780 0.5834 0.6148 0.0778  -0.0124 0.0256  81  PHE A CE2   
614  C CZ    . PHE A 101 ? 0.2691 0.5559 0.5695 0.0667  -0.0185 0.0261  81  PHE A CZ    
615  N N     . VAL A 102 ? 0.5662 0.7100 0.7795 0.1989  0.1039  -0.0960 82  VAL A N     
616  C CA    . VAL A 102 ? 0.6425 0.7597 0.8649 0.2329  0.1412  -0.1247 82  VAL A CA    
617  C C     . VAL A 102 ? 0.6644 0.7288 0.9148 0.2476  0.1167  -0.1308 82  VAL A C     
618  O O     . VAL A 102 ? 0.6451 0.6849 0.8777 0.2243  0.0738  -0.1208 82  VAL A O     
619  C CB    . VAL A 102 ? 0.7272 0.7977 0.8471 0.2285  0.1703  -0.1625 82  VAL A CB    
620  C CG1   . VAL A 102 ? 0.7265 0.8499 0.8244 0.2174  0.2027  -0.1525 82  VAL A CG1   
621  C CG2   . VAL A 102 ? 0.7432 0.7571 0.7788 0.1985  0.1297  -0.1727 82  VAL A CG2   
622  N N     . PRO A 103 ? 0.7087 0.7558 1.0077 0.2870  0.1455  -0.1449 83  PRO A N     
623  C CA    . PRO A 103 ? 0.7320 0.7196 1.0619 0.3034  0.1241  -0.1463 83  PRO A CA    
624  C C     . PRO A 103 ? 0.7808 0.6803 1.0242 0.2769  0.0966  -0.1718 83  PRO A C     
625  O O     . PRO A 103 ? 0.7715 0.6401 1.0349 0.2676  0.0597  -0.1562 83  PRO A O     
626  C CB    . PRO A 103 ? 0.8219 0.7916 1.1619 0.3422  0.1628  -0.1613 83  PRO A CB    
627  C CG    . PRO A 103 ? 0.7902 0.8546 1.1661 0.3477  0.1887  -0.1484 83  PRO A CG    
628  C CD    . PRO A 103 ? 0.7444 0.8339 1.0758 0.3162  0.1953  -0.1520 83  PRO A CD    
629  N N     . GLU A 104 ? 0.8353 0.7000 0.9831 0.2608  0.1126  -0.2077 84  GLU A N     
630  C CA    . GLU A 104 ? 0.8944 0.6800 0.9586 0.2327  0.0868  -0.2351 84  GLU A CA    
631  C C     . GLU A 104 ? 0.8101 0.6175 0.8675 0.1934  0.0323  -0.2058 84  GLU A C     
632  O O     . GLU A 104 ? 0.8414 0.5946 0.8640 0.1702  0.0022  -0.2167 84  GLU A O     
633  C CB    . GLU A 104 ? 0.9998 0.7560 0.9574 0.2197  0.1129  -0.2763 84  GLU A CB    
634  C CG    . GLU A 104 ? 1.1177 0.8512 1.0695 0.2564  0.1757  -0.3130 84  GLU A CG    
635  C CD    . GLU A 104 ? 1.0930 0.9145 1.0794 0.2713  0.2132  -0.2944 84  GLU A CD    
636  O OE1   . GLU A 104 ? 1.0604 0.9251 0.9998 0.2417  0.2023  -0.2780 84  GLU A OE1   
637  O OE2   . GLU A 104 ? 1.1083 0.9572 1.1735 0.3123  0.2532  -0.2937 84  GLU A OE2   
638  N N     . THR A 105 ? 0.7039 0.5897 0.7960 0.1846  0.0220  -0.1702 85  THR A N     
639  C CA    . THR A 105 ? 0.6341 0.5446 0.7237 0.1516  -0.0217 -0.1451 85  THR A CA    
640  C C     . THR A 105 ? 0.5751 0.5050 0.7402 0.1522  -0.0458 -0.1133 85  THR A C     
641  O O     . THR A 105 ? 0.5172 0.4702 0.6880 0.1264  -0.0771 -0.0931 85  THR A O     
642  C CB    . THR A 105 ? 0.5733 0.5460 0.6510 0.1387  -0.0200 -0.1258 85  THR A CB    
643  O OG1   . THR A 105 ? 0.5166 0.5471 0.6625 0.1547  -0.0014 -0.1020 85  THR A OG1   
644  C CG2   . THR A 105 ? 0.6491 0.6057 0.6458 0.1351  0.0022  -0.1499 85  THR A CG2   
645  N N     . ASN A 106 ? 0.5991 0.5216 0.8223 0.1822  -0.0304 -0.1077 86  ASN A N     
646  C CA    . ASN A 106 ? 0.5583 0.4998 0.8490 0.1823  -0.0553 -0.0725 86  ASN A CA    
647  C C     . ASN A 106 ? 0.6063 0.4722 0.8887 0.1760  -0.0768 -0.0775 86  ASN A C     
648  O O     . ASN A 106 ? 0.6391 0.4735 0.9677 0.2021  -0.0726 -0.0687 86  ASN A O     
649  C CB    . ASN A 106 ? 0.5567 0.5422 0.9266 0.2176  -0.0344 -0.0527 86  ASN A CB    
650  C CG    . ASN A 106 ? 0.5232 0.5488 0.9318 0.2013  -0.0612 -0.0070 86  ASN A CG    
651  O OD1   . ASN A 106 ? 0.4834 0.5184 0.8766 0.1683  -0.0907 0.0071  86  ASN A OD1   
652  N ND2   . ASN A 106 ? 0.5479 0.5984 0.9929 0.2211  -0.0496 0.0132  86  ASN A ND2   
653  N N     . CYS A 107 ? 0.6175 0.4553 0.8449 0.1409  -0.1005 -0.0891 87  CYS A N     
654  C CA    . CYS A 107 ? 0.6706 0.4411 0.8880 0.1233  -0.1243 -0.0910 87  CYS A CA    
655  C C     . CYS A 107 ? 0.6381 0.4277 0.8240 0.0780  -0.1562 -0.0852 87  CYS A C     
656  O O     . CYS A 107 ? 0.6076 0.4454 0.7685 0.0657  -0.1573 -0.0888 87  CYS A O     
657  C CB    . CYS A 107 ? 0.7851 0.4620 0.9573 0.1353  -0.1057 -0.1342 87  CYS A CB    
658  S SG    . CYS A 107 ? 0.9397 0.5976 1.0112 0.1075  -0.1033 -0.1791 87  CYS A SG    
659  N N     . ALA A 108 ? 0.7234 0.3543 0.9074 0.1038  0.1435  -0.0340 88  ALA A N     
660  C CA    . ALA A 108 ? 0.6899 0.3350 0.8793 0.0720  0.1200  -0.0407 88  ALA A CA    
661  C C     . ALA A 108 ? 0.7130 0.3497 0.8653 0.0422  0.1003  -0.0889 88  ALA A C     
662  O O     . ALA A 108 ? 0.6556 0.3454 0.7986 0.0277  0.0725  -0.0913 88  ALA A O     
663  C CB    . ALA A 108 ? 0.7189 0.3248 0.9419 0.0630  0.1344  -0.0234 88  ALA A CB    
664  N N     . GLU A 109 ? 0.8071 0.3772 0.9369 0.0340  0.1153  -0.1268 89  GLU A N     
665  C CA    . GLU A 109 ? 0.8503 0.4126 0.9419 0.0015  0.0935  -0.1740 89  GLU A CA    
666  C C     . GLU A 109 ? 0.7892 0.4074 0.8404 0.0072  0.0714  -0.1817 89  GLU A C     
667  O O     . GLU A 109 ? 0.7596 0.4177 0.7995 -0.0157 0.0404  -0.1936 89  GLU A O     
668  C CB    . GLU A 109 ? 0.9821 0.4806 1.0373 -0.0050 0.1075  -0.2063 89  GLU A CB    
669  C CG    . GLU A 109 ? 1.0731 0.5265 1.1588 -0.0207 0.1191  -0.2004 89  GLU A CG    
670  C CD    . GLU A 109 ? 1.0942 0.5377 1.2201 0.0119  0.1487  -0.1542 89  GLU A CD    
671  O OE1   . GLU A 109 ? 1.0829 0.5413 1.2046 0.0472  0.1637  -0.1359 89  GLU A OE1   
672  O OE2   . GLU A 109 ? 1.1200 0.5477 1.2833 0.0018  0.1562  -0.1333 89  GLU A OE2   
673  N N     . VAL A 110 ? 0.7744 0.3978 0.8093 0.0389  0.0891  -0.1710 90  VAL A N     
674  C CA    . VAL A 110 ? 0.7350 0.4071 0.7353 0.0463  0.0742  -0.1722 90  VAL A CA    
675  C C     . VAL A 110 ? 0.6489 0.3903 0.6766 0.0440  0.0502  -0.1403 90  VAL A C     
676  O O     . VAL A 110 ? 0.6346 0.4137 0.6413 0.0344  0.0272  -0.1459 90  VAL A O     
677  C CB    . VAL A 110 ? 0.7434 0.4075 0.7304 0.0802  0.1039  -0.1635 90  VAL A CB    
678  C CG1   . VAL A 110 ? 0.7027 0.4208 0.6645 0.0870  0.0910  -0.1554 90  VAL A CG1   
679  C CG2   . VAL A 110 ? 0.8406 0.4320 0.7875 0.0841  0.1316  -0.2018 90  VAL A CG2   
680  N N     . TYR A 111 ? 0.5997 0.3555 0.6716 0.0536  0.0571  -0.1065 91  TYR A N     
681  C CA    . TYR A 111 ? 0.5257 0.3392 0.6179 0.0510  0.0390  -0.0799 91  TYR A CA    
682  C C     . TYR A 111 ? 0.5104 0.3429 0.6054 0.0251  0.0151  -0.0902 91  TYR A C     
683  O O     . TYR A 111 ? 0.4626 0.3363 0.5503 0.0227  -0.0014 -0.0860 91  TYR A O     
684  C CB    . TYR A 111 ? 0.5030 0.3258 0.6341 0.0630  0.0498  -0.0442 91  TYR A CB    
685  C CG    . TYR A 111 ? 0.4461 0.3217 0.5892 0.0573  0.0332  -0.0222 91  TYR A CG    
686  C CD1   . TYR A 111 ? 0.4034 0.3200 0.5417 0.0668  0.0279  -0.0090 91  TYR A CD1   
687  C CD2   . TYR A 111 ? 0.4397 0.3216 0.5987 0.0408  0.0258  -0.0162 91  TYR A CD2   
688  C CE1   . TYR A 111 ? 0.3645 0.3201 0.5065 0.0593  0.0152  0.0046  91  TYR A CE1   
689  C CE2   . TYR A 111 ? 0.4038 0.3283 0.5665 0.0373  0.0158  0.0003  91  TYR A CE2   
690  C CZ    . TYR A 111 ? 0.3754 0.3331 0.5261 0.0462  0.0104  0.0083  91  TYR A CZ    
691  O OH    . TYR A 111 ? 0.3601 0.3513 0.5077 0.0405  0.0028  0.0186  91  TYR A OH    
692  N N     . TYR A 112 ? 0.5482 0.3508 0.6592 0.0061  0.0157  -0.1019 92  TYR A N     
693  C CA    . TYR A 112 ? 0.5455 0.3748 0.6733 -0.0190 -0.0051 -0.1067 92  TYR A CA    
694  C C     . TYR A 112 ? 0.5564 0.4032 0.6539 -0.0325 -0.0283 -0.1344 92  TYR A C     
695  O O     . TYR A 112 ? 0.5246 0.4152 0.6367 -0.0445 -0.0486 -0.1306 92  TYR A O     
696  C CB    . TYR A 112 ? 0.5886 0.3828 0.7497 -0.0393 0.0037  -0.1091 92  TYR A CB    
697  C CG    . TYR A 112 ? 0.5749 0.3685 0.7686 -0.0266 0.0223  -0.0713 92  TYR A CG    
698  C CD1   . TYR A 112 ? 0.6198 0.3608 0.8268 -0.0169 0.0479  -0.0613 92  TYR A CD1   
699  C CD2   . TYR A 112 ? 0.5225 0.3675 0.7297 -0.0221 0.0158  -0.0444 92  TYR A CD2   
700  C CE1   . TYR A 112 ? 0.6169 0.3642 0.8506 -0.0028 0.0629  -0.0206 92  TYR A CE1   
701  C CE2   . TYR A 112 ? 0.5199 0.3690 0.7461 -0.0111 0.0307  -0.0098 92  TYR A CE2   
702  C CZ    . TYR A 112 ? 0.5680 0.3723 0.8077 -0.0012 0.0524  0.0045  92  TYR A CZ    
703  O OH    . TYR A 112 ? 0.5738 0.3886 0.8299 0.0119  0.0654  0.0449  92  TYR A OH    
704  N N     . GLN A 113 ? 0.6080 0.4240 0.6625 -0.0281 -0.0239 -0.1597 93  GLN A N     
705  C CA    . GLN A 113 ? 0.6426 0.4802 0.6570 -0.0376 -0.0468 -0.1822 93  GLN A CA    
706  C C     . GLN A 113 ? 0.6003 0.4835 0.6011 -0.0165 -0.0529 -0.1599 93  GLN A C     
707  O O     . GLN A 113 ? 0.5878 0.5129 0.5826 -0.0222 -0.0759 -0.1578 93  GLN A O     
708  C CB    . GLN A 113 ? 0.7277 0.5141 0.6893 -0.0394 -0.0367 -0.2183 93  GLN A CB    
709  C CG    . GLN A 113 ? 0.7697 0.5819 0.6775 -0.0483 -0.0615 -0.2402 93  GLN A CG    
710  C CD    . GLN A 113 ? 0.8782 0.6368 0.7305 -0.0635 -0.0568 -0.2868 93  GLN A CD    
711  O OE1   . GLN A 113 ? 0.9251 0.6568 0.7243 -0.0444 -0.0372 -0.2985 93  GLN A OE1   
712  N NE2   . GLN A 113 ? 0.9206 0.6623 0.7843 -0.0998 -0.0727 -0.3153 93  GLN A NE2   
713  N N     . PHE A 114 ? 0.5859 0.4623 0.5868 0.0074  -0.0316 -0.1412 94  PHE A N     
714  C CA    . PHE A 114 ? 0.5560 0.4682 0.5506 0.0236  -0.0333 -0.1199 94  PHE A CA    
715  C C     . PHE A 114 ? 0.5016 0.4510 0.5329 0.0191  -0.0444 -0.0990 94  PHE A C     
716  O O     . PHE A 114 ? 0.4845 0.4633 0.5106 0.0244  -0.0535 -0.0887 94  PHE A O     
717  C CB    . PHE A 114 ? 0.5592 0.4606 0.5551 0.0446  -0.0089 -0.1054 94  PHE A CB    
718  C CG    . PHE A 114 ? 0.6137 0.4931 0.5672 0.0570  0.0060  -0.1194 94  PHE A CG    
719  C CD1   . PHE A 114 ? 0.6369 0.4945 0.5971 0.0746  0.0333  -0.1140 94  PHE A CD1   
720  C CD2   . PHE A 114 ? 0.6520 0.5372 0.5588 0.0532  -0.0059 -0.1348 94  PHE A CD2   
721  C CE1   . PHE A 114 ? 0.6874 0.5249 0.6088 0.0885  0.0531  -0.1265 94  PHE A CE1   
722  C CE2   . PHE A 114 ? 0.7081 0.5729 0.5675 0.0655  0.0113  -0.1476 94  PHE A CE2   
723  C CZ    . PHE A 114 ? 0.7268 0.5655 0.5935 0.0833  0.0432  -0.1448 94  PHE A CZ    
724  N N     . ARG A 115 ? 0.4794 0.4238 0.5462 0.0114  -0.0398 -0.0914 95  ARG A N     
725  C CA    . ARG A 115 ? 0.4306 0.4066 0.5282 0.0072  -0.0453 -0.0742 95  ARG A CA    
726  C C     . ARG A 115 ? 0.4538 0.4580 0.5613 -0.0058 -0.0654 -0.0811 95  ARG A C     
727  O O     . ARG A 115 ? 0.4303 0.4669 0.5510 -0.0004 -0.0702 -0.0675 95  ARG A O     
728  C CB    . ARG A 115 ? 0.4045 0.3693 0.5326 0.0017  -0.0338 -0.0625 95  ARG A CB    
729  C CG    . ARG A 115 ? 0.3602 0.3553 0.5106 0.0011  -0.0324 -0.0437 95  ARG A CG    
730  C CD    . ARG A 115 ? 0.3665 0.3523 0.5396 -0.0031 -0.0193 -0.0280 95  ARG A CD    
731  N NE    . ARG A 115 ? 0.3987 0.3733 0.5992 -0.0217 -0.0203 -0.0342 95  ARG A NE    
732  C CZ    . ARG A 115 ? 0.4138 0.3780 0.6398 -0.0284 -0.0069 -0.0182 95  ARG A CZ    
733  N NH1   . ARG A 115 ? 0.4147 0.3824 0.6360 -0.0155 0.0062  0.0062  95  ARG A NH1   
734  N NH2   . ARG A 115 ? 0.4246 0.3770 0.6806 -0.0499 -0.0072 -0.0253 95  ARG A NH2   
735  N N     . GLU A 116 ? 0.5130 0.5053 0.6160 -0.0233 -0.0767 -0.1026 96  GLU A N     
736  C CA    . GLU A 116 ? 0.5425 0.5720 0.6582 -0.0394 -0.1016 -0.1096 96  GLU A CA    
737  C C     . GLU A 116 ? 0.5467 0.6032 0.6285 -0.0259 -0.1160 -0.1070 96  GLU A C     
738  O O     . GLU A 116 ? 0.5306 0.6336 0.6327 -0.0233 -0.1309 -0.0927 96  GLU A O     
739  C CB    . GLU A 116 ? 0.6166 0.6238 0.7308 -0.0676 -0.1122 -0.1386 96  GLU A CB    
740  C CG    . GLU A 116 ? 0.6624 0.7191 0.7966 -0.0905 -0.1434 -0.1464 96  GLU A CG    
741  C CD    . GLU A 116 ? 0.7661 0.7962 0.8894 -0.1246 -0.1565 -0.1830 96  GLU A CD    
742  O OE1   . GLU A 116 ? 0.8267 0.7955 0.9079 -0.1238 -0.1412 -0.2064 96  GLU A OE1   
743  O OE2   . GLU A 116 ? 0.7864 0.8567 0.9457 -0.1531 -0.1807 -0.1893 96  GLU A OE2   
744  N N     . GLU A 117 ? 0.5743 0.6023 0.6069 -0.0148 -0.1083 -0.1170 97  GLU A N     
745  C CA    . GLU A 117 ? 0.5890 0.6372 0.5833 0.0000  -0.1169 -0.1104 97  GLU A CA    
746  C C     . GLU A 117 ? 0.5250 0.5945 0.5395 0.0202  -0.1078 -0.0797 97  GLU A C     
747  O O     . GLU A 117 ? 0.5281 0.6302 0.5393 0.0300  -0.1196 -0.0642 97  GLU A O     
748  C CB    . GLU A 117 ? 0.6417 0.6517 0.5819 0.0096  -0.1015 -0.1246 97  GLU A CB    
749  C CG    . GLU A 117 ? 0.6856 0.7142 0.5808 0.0254  -0.1061 -0.1143 97  GLU A CG    
750  C CD    . GLU A 117 ? 0.7452 0.7381 0.5912 0.0376  -0.0833 -0.1242 97  GLU A CD    
751  O OE1   . GLU A 117 ? 0.7702 0.7237 0.6160 0.0340  -0.0660 -0.1427 97  GLU A OE1   
752  O OE2   . GLU A 117 ? 0.7713 0.7757 0.5815 0.0529  -0.0793 -0.1103 97  GLU A OE2   
753  N N     . PHE A 118 ? 0.4752 0.5252 0.5097 0.0260  -0.0866 -0.0709 98  PHE A N     
754  C CA    . PHE A 118 ? 0.4351 0.4951 0.4863 0.0397  -0.0752 -0.0491 98  PHE A CA    
755  C C     . PHE A 118 ? 0.4378 0.5318 0.5261 0.0394  -0.0839 -0.0369 98  PHE A C     
756  O O     . PHE A 118 ? 0.4402 0.5500 0.5324 0.0542  -0.0825 -0.0199 98  PHE A O     
757  C CB    . PHE A 118 ? 0.4034 0.4420 0.4663 0.0395  -0.0562 -0.0465 98  PHE A CB    
758  C CG    . PHE A 118 ? 0.3763 0.4204 0.4532 0.0464  -0.0450 -0.0321 98  PHE A CG    
759  C CD1   . PHE A 118 ? 0.3607 0.4150 0.4648 0.0420  -0.0413 -0.0278 98  PHE A CD1   
760  C CD2   . PHE A 118 ? 0.3765 0.4116 0.4377 0.0557  -0.0350 -0.0243 98  PHE A CD2   
761  C CE1   . PHE A 118 ? 0.3545 0.4063 0.4629 0.0473  -0.0279 -0.0205 98  PHE A CE1   
762  C CE2   . PHE A 118 ? 0.3699 0.4005 0.4411 0.0578  -0.0230 -0.0169 98  PHE A CE2   
763  C CZ    . PHE A 118 ? 0.3626 0.3996 0.4539 0.0539  -0.0194 -0.0173 98  PHE A CZ    
764  N N     . ASN A 119 ? 0.4321 0.5366 0.5520 0.0240  -0.0893 -0.0429 99  ASN A N     
765  C CA    . ASN A 119 ? 0.4188 0.5606 0.5831 0.0240  -0.0928 -0.0296 99  ASN A CA    
766  C C     . ASN A 119 ? 0.4464 0.6337 0.6204 0.0253  -0.1176 -0.0231 99  ASN A C     
767  O O     . ASN A 119 ? 0.4447 0.6707 0.6587 0.0342  -0.1187 -0.0044 99  ASN A O     
768  C CB    . ASN A 119 ? 0.4021 0.5448 0.6007 0.0050  -0.0894 -0.0349 99  ASN A CB    
769  C CG    . ASN A 119 ? 0.3839 0.4968 0.5787 0.0081  -0.0653 -0.0310 99  ASN A CG    
770  O OD1   . ASN A 119 ? 0.3773 0.4836 0.5610 0.0225  -0.0512 -0.0224 99  ASN A OD1   
771  N ND2   . ASN A 119 ? 0.3886 0.4829 0.5917 -0.0064 -0.0609 -0.0367 99  ASN A ND2   
772  N N     . LYS A 120 ? 0.4849 0.6706 0.6213 0.0178  -0.1367 -0.0374 100 LYS A N     
773  C CA    . LYS A 120 ? 0.5164 0.7526 0.6530 0.0166  -0.1664 -0.0315 100 LYS A CA    
774  C C     . LYS A 120 ? 0.5385 0.7767 0.6323 0.0407  -0.1674 -0.0152 100 LYS A C     
775  O O     . LYS A 120 ? 0.5599 0.8459 0.6520 0.0471  -0.1910 -0.0003 100 LYS A O     
776  C CB    . LYS A 120 ? 0.5658 0.8042 0.6841 -0.0139 -0.1912 -0.0619 100 LYS A CB    
777  C CG    . LYS A 120 ? 0.5679 0.8112 0.7377 -0.0415 -0.1930 -0.0737 100 LYS A CG    
778  C CD    . LYS A 120 ? 0.6297 0.8726 0.7822 -0.0761 -0.2190 -0.1070 100 LYS A CD    
779  C CE    . LYS A 120 ? 0.6321 0.8791 0.8441 -0.1068 -0.2189 -0.1157 100 LYS A CE    
780  N NZ    . LYS A 120 ? 0.7040 0.9473 0.9025 -0.1467 -0.2450 -0.1522 100 LYS A NZ    
781  N N     . SER A 121 ? 0.5482 0.7389 0.6105 0.0536  -0.1422 -0.0147 101 SER A N     
782  C CA    . SER A 121 ? 0.5933 0.7789 0.6155 0.0745  -0.1372 0.0023  101 SER A CA    
783  C C     . SER A 121 ? 0.6008 0.8074 0.6539 0.0993  -0.1292 0.0377  101 SER A C     
784  O O     . SER A 121 ? 0.5628 0.7623 0.6583 0.1039  -0.1118 0.0445  101 SER A O     
785  C CB    . SER A 121 ? 0.5933 0.7264 0.5843 0.0780  -0.1104 -0.0060 101 SER A CB    
786  O OG    . SER A 121 ? 0.6234 0.7508 0.5803 0.0966  -0.1014 0.0135  101 SER A OG    
787  N N     . GLN A 122 ? 0.6577 0.8874 0.6862 0.1169  -0.1393 0.0610  102 GLN A N     
788  C CA    . GLN A 122 ? 0.6801 0.9230 0.7364 0.1457  -0.1276 0.0999  102 GLN A CA    
789  C C     . GLN A 122 ? 0.6941 0.8896 0.7176 0.1620  -0.0993 0.1149  102 GLN A C     
790  O O     . GLN A 122 ? 0.7076 0.8927 0.7521 0.1853  -0.0799 0.1453  102 GLN A O     
791  C CB    . GLN A 122 ? 0.7346 1.0465 0.7971 0.1576  -0.1597 0.1264  102 GLN A CB    
792  C CG    . GLN A 122 ? 0.7394 1.1098 0.8484 0.1394  -0.1891 0.1164  102 GLN A CG    
793  C CD    . GLN A 122 ? 0.7157 1.0968 0.8996 0.1512  -0.1700 0.1321  102 GLN A CD    
794  O OE1   . GLN A 122 ? 0.6898 1.0296 0.8896 0.1407  -0.1460 0.1120  102 GLN A OE1   
795  N NE2   . GLN A 122 ? 0.7421 1.1576 0.9617 0.1675  -0.1733 0.1606  102 GLN A NE2   
796  N N     . ASP A 123 ? 0.6929 0.8580 0.6691 0.1496  -0.0938 0.0945  103 ASP A N     
797  C CA    . ASP A 123 ? 0.7061 0.8324 0.6542 0.1607  -0.0668 0.1088  103 ASP A CA    
798  C C     . ASP A 123 ? 0.6506 0.7300 0.6222 0.1506  -0.0381 0.0951  103 ASP A C     
799  O O     . ASP A 123 ? 0.6334 0.7019 0.6049 0.1316  -0.0391 0.0664  103 ASP A O     
800  C CB    . ASP A 123 ? 0.7587 0.8836 0.6440 0.1554  -0.0725 0.0974  103 ASP A CB    
801  C CG    . ASP A 123 ? 0.7977 0.8880 0.6588 0.1658  -0.0413 0.1152  103 ASP A CG    
802  O OD1   . ASP A 123 ? 0.8235 0.9040 0.7008 0.1835  -0.0249 0.1492  103 ASP A OD1   
803  O OD2   . ASP A 123 ? 0.8028 0.8744 0.6332 0.1567  -0.0302 0.0967  103 ASP A OD2   
804  N N     . PRO A 124 ? 0.6312 0.6825 0.6228 0.1627  -0.0128 0.1163  104 PRO A N     
805  C CA    . PRO A 124 ? 0.5909 0.5995 0.6009 0.1494  0.0123  0.1025  104 PRO A CA    
806  C C     . PRO A 124 ? 0.5682 0.5615 0.5547 0.1340  0.0204  0.0882  104 PRO A C     
807  O O     . PRO A 124 ? 0.5434 0.5251 0.5441 0.1160  0.0249  0.0667  104 PRO A O     
808  C CB    . PRO A 124 ? 0.6285 0.6062 0.6537 0.1663  0.0382  0.1310  104 PRO A CB    
809  C CG    . PRO A 124 ? 0.6480 0.6595 0.6835 0.1921  0.0250  0.1590  104 PRO A CG    
810  C CD    . PRO A 124 ? 0.6571 0.7163 0.6585 0.1897  -0.0073 0.1554  104 PRO A CD    
811  N N     . PHE A 125 ? 0.5812 0.5788 0.5327 0.1428  0.0232  0.1028  105 PHE A N     
812  C CA    . PHE A 125 ? 0.5614 0.5491 0.4949 0.1325  0.0358  0.0932  105 PHE A CA    
813  C C     . PHE A 125 ? 0.5404 0.5419 0.4656 0.1207  0.0200  0.0625  105 PHE A C     
814  O O     . PHE A 125 ? 0.5096 0.5030 0.4509 0.1081  0.0289  0.0485  105 PHE A O     
815  C CB    . PHE A 125 ? 0.5954 0.5861 0.4872 0.1476  0.0463  0.1172  105 PHE A CB    
816  C CG    . PHE A 125 ? 0.6013 0.5848 0.4792 0.1406  0.0658  0.1110  105 PHE A CG    
817  C CD1   . PHE A 125 ? 0.5974 0.5611 0.5034 0.1324  0.0933  0.1236  105 PHE A CD1   
818  C CD2   . PHE A 125 ? 0.6143 0.6104 0.4545 0.1415  0.0589  0.0919  105 PHE A CD2   
819  C CE1   . PHE A 125 ? 0.6044 0.5716 0.5084 0.1271  0.1125  0.1220  105 PHE A CE1   
820  C CE2   . PHE A 125 ? 0.6227 0.6138 0.4555 0.1400  0.0822  0.0886  105 PHE A CE2   
821  C CZ    . PHE A 125 ? 0.6137 0.5955 0.4820 0.1337  0.1086  0.1061  105 PHE A CZ    
822  N N     . ARG A 126 ? 0.5630 0.5863 0.4660 0.1240  -0.0036 0.0537  106 ARG A N     
823  C CA    . ARG A 126 ? 0.5645 0.5916 0.4593 0.1118  -0.0164 0.0237  106 ARG A CA    
824  C C     . ARG A 126 ? 0.5195 0.5424 0.4588 0.0983  -0.0191 0.0100  106 ARG A C     
825  O O     . ARG A 126 ? 0.5140 0.5274 0.4594 0.0895  -0.0147 -0.0062 106 ARG A O     
826  C CB    . ARG A 126 ? 0.6110 0.6622 0.4758 0.1119  -0.0437 0.0149  106 ARG A CB    
827  C CG    . ARG A 126 ? 0.6328 0.6771 0.4865 0.0965  -0.0539 -0.0190 106 ARG A CG    
828  C CD    . ARG A 126 ? 0.6730 0.6897 0.4985 0.0991  -0.0305 -0.0310 106 ARG A CD    
829  N NE    . ARG A 126 ? 0.7066 0.7056 0.5235 0.0871  -0.0345 -0.0630 106 ARG A NE    
830  C CZ    . ARG A 126 ? 0.7376 0.7092 0.5376 0.0912  -0.0121 -0.0767 106 ARG A CZ    
831  N NH1   . ARG A 126 ? 0.7477 0.7154 0.5410 0.1054  0.0143  -0.0602 106 ARG A NH1   
832  N NH2   . ARG A 126 ? 0.7553 0.7025 0.5502 0.0815  -0.0130 -0.1053 106 ARG A NH2   
833  N N     . ARG A 127 ? 0.4968 0.5269 0.4659 0.0995  -0.0236 0.0193  107 ARG A N     
834  C CA    . ARG A 127 ? 0.4660 0.4926 0.4700 0.0881  -0.0227 0.0088  107 ARG A CA    
835  C C     . ARG A 127 ? 0.4534 0.4607 0.4673 0.0801  -0.0045 0.0068  107 ARG A C     
836  O O     . ARG A 127 ? 0.4454 0.4532 0.4729 0.0691  -0.0056 -0.0049 107 ARG A O     
837  C CB    . ARG A 127 ? 0.4663 0.5022 0.4971 0.0949  -0.0240 0.0203  107 ARG A CB    
838  C CG    . ARG A 127 ? 0.4775 0.5477 0.5178 0.0973  -0.0466 0.0213  107 ARG A CG    
839  C CD    . ARG A 127 ? 0.4835 0.5676 0.5596 0.1092  -0.0423 0.0377  107 ARG A CD    
840  N NE    . ARG A 127 ? 0.4731 0.5411 0.5728 0.1013  -0.0267 0.0276  107 ARG A NE    
841  C CZ    . ARG A 127 ? 0.4677 0.5541 0.5915 0.0917  -0.0328 0.0188  107 ARG A CZ    
842  N NH1   . ARG A 127 ? 0.4652 0.5856 0.6000 0.0854  -0.0553 0.0167  107 ARG A NH1   
843  N NH2   . ARG A 127 ? 0.4623 0.5335 0.5975 0.0862  -0.0160 0.0117  107 ARG A NH2   
844  N N     . ALA A 128 ? 0.4527 0.4466 0.4619 0.0843  0.0114  0.0206  108 ALA A N     
845  C CA    . ALA A 128 ? 0.4397 0.4225 0.4630 0.0716  0.0260  0.0189  108 ALA A CA    
846  C C     . ALA A 128 ? 0.4377 0.4316 0.4577 0.0681  0.0269  0.0127  108 ALA A C     
847  O O     . ALA A 128 ? 0.4219 0.4233 0.4620 0.0562  0.0280  0.0074  108 ALA A O     
848  C CB    . ALA A 128 ? 0.4659 0.4296 0.4894 0.0742  0.0450  0.0363  108 ALA A CB    
849  N N     . VAL A 129 ? 0.4617 0.4582 0.4546 0.0799  0.0272  0.0142  109 VAL A N     
850  C CA    . VAL A 129 ? 0.4689 0.4697 0.4567 0.0821  0.0341  0.0076  109 VAL A CA    
851  C C     . VAL A 129 ? 0.4622 0.4654 0.4636 0.0767  0.0225  -0.0079 109 VAL A C     
852  O O     . VAL A 129 ? 0.4494 0.4598 0.4730 0.0742  0.0286  -0.0070 109 VAL A O     
853  C CB    . VAL A 129 ? 0.5034 0.4994 0.4469 0.0960  0.0389  0.0067  109 VAL A CB    
854  C CG1   . VAL A 129 ? 0.5121 0.5037 0.4485 0.1010  0.0498  -0.0058 109 VAL A CG1   
855  C CG2   . VAL A 129 ? 0.5259 0.5205 0.4558 0.1035  0.0565  0.0289  109 VAL A CG2   
856  N N     . LEU A 130 ? 0.4789 0.4796 0.4715 0.0752  0.0060  -0.0182 110 LEU A N     
857  C CA    . LEU A 130 ? 0.4680 0.4664 0.4747 0.0688  -0.0026 -0.0304 110 LEU A CA    
858  C C     . LEU A 130 ? 0.4315 0.4392 0.4696 0.0598  -0.0034 -0.0243 110 LEU A C     
859  O O     . LEU A 130 ? 0.4189 0.4273 0.4722 0.0572  -0.0033 -0.0253 110 LEU A O     
860  C CB    . LEU A 130 ? 0.4774 0.4771 0.4742 0.0647  -0.0203 -0.0413 110 LEU A CB    
861  C CG    . LEU A 130 ? 0.5215 0.5141 0.4783 0.0684  -0.0253 -0.0539 110 LEU A CG    
862  C CD1   . LEU A 130 ? 0.5297 0.5384 0.4839 0.0600  -0.0491 -0.0613 110 LEU A CD1   
863  C CD2   . LEU A 130 ? 0.5492 0.5167 0.4956 0.0687  -0.0140 -0.0706 110 LEU A CD2   
864  N N     . PHE A 131 ? 0.4224 0.4345 0.4667 0.0556  -0.0026 -0.0177 111 PHE A N     
865  C CA    . PHE A 131 ? 0.4079 0.4265 0.4698 0.0448  -0.0031 -0.0168 111 PHE A CA    
866  C C     . PHE A 131 ? 0.3964 0.4288 0.4715 0.0393  0.0006  -0.0114 111 PHE A C     
867  O O     . PHE A 131 ? 0.3854 0.4302 0.4706 0.0327  -0.0045 -0.0098 111 PHE A O     
868  C CB    . PHE A 131 ? 0.4250 0.4349 0.4859 0.0415  0.0026  -0.0151 111 PHE A CB    
869  C CG    . PHE A 131 ? 0.4380 0.4486 0.5049 0.0302  0.0032  -0.0210 111 PHE A CG    
870  C CD1   . PHE A 131 ? 0.4413 0.4538 0.5114 0.0327  0.0006  -0.0241 111 PHE A CD1   
871  C CD2   . PHE A 131 ? 0.4573 0.4697 0.5253 0.0152  0.0069  -0.0241 111 PHE A CD2   
872  C CE1   . PHE A 131 ? 0.4505 0.4622 0.5179 0.0240  0.0056  -0.0300 111 PHE A CE1   
873  C CE2   . PHE A 131 ? 0.4703 0.4822 0.5315 0.0031  0.0072  -0.0335 111 PHE A CE2   
874  C CZ    . PHE A 131 ? 0.4689 0.4782 0.5263 0.0093  0.0086  -0.0364 111 PHE A CZ    
875  N N     . LEU A 132 ? 0.4019 0.4378 0.4787 0.0429  0.0099  -0.0051 112 LEU A N     
876  C CA    . LEU A 132 ? 0.3910 0.4516 0.4910 0.0390  0.0133  0.0045  112 LEU A CA    
877  C C     . LEU A 132 ? 0.3931 0.4591 0.5025 0.0515  0.0139  0.0086  112 LEU A C     
878  O O     . LEU A 132 ? 0.3921 0.4833 0.5244 0.0496  0.0099  0.0196  112 LEU A O     
879  C CB    . LEU A 132 ? 0.3982 0.4641 0.5047 0.0403  0.0278  0.0131  112 LEU A CB    
880  C CG    . LEU A 132 ? 0.3935 0.4969 0.5362 0.0348  0.0316  0.0267  112 LEU A CG    
881  C CD1   . LEU A 132 ? 0.3797 0.5068 0.5380 0.0119  0.0156  0.0251  112 LEU A CD1   
882  C CD2   . LEU A 132 ? 0.4116 0.5204 0.5650 0.0340  0.0499  0.0370  112 LEU A CD2   
883  N N     . TYR A 133 ? 0.4025 0.4438 0.4931 0.0641  0.0191  0.0000  113 TYR A N     
884  C CA    . TYR A 133 ? 0.4055 0.4357 0.5021 0.0756  0.0244  -0.0006 113 TYR A CA    
885  C C     . TYR A 133 ? 0.3999 0.4309 0.5080 0.0689  0.0133  0.0020  113 TYR A C     
886  O O     . TYR A 133 ? 0.4089 0.4493 0.5390 0.0756  0.0168  0.0162  113 TYR A O     
887  C CB    . TYR A 133 ? 0.4378 0.4348 0.5027 0.0833  0.0302  -0.0185 113 TYR A CB    
888  C CG    . TYR A 133 ? 0.4653 0.4350 0.5326 0.0897  0.0362  -0.0267 113 TYR A CG    
889  C CD1   . TYR A 133 ? 0.4904 0.4492 0.5677 0.1073  0.0578  -0.0219 113 TYR A CD1   
890  C CD2   . TYR A 133 ? 0.4683 0.4210 0.5327 0.0784  0.0239  -0.0381 113 TYR A CD2   
891  C CE1   . TYR A 133 ? 0.5239 0.4463 0.6045 0.1142  0.0683  -0.0298 113 TYR A CE1   
892  C CE2   . TYR A 133 ? 0.4980 0.4179 0.5677 0.0807  0.0322  -0.0459 113 TYR A CE2   
893  C CZ    . TYR A 133 ? 0.5299 0.4300 0.6057 0.0990  0.0551  -0.0426 113 TYR A CZ    
894  O OH    . TYR A 133 ? 0.5733 0.4296 0.6553 0.1023  0.0681  -0.0509 113 TYR A OH    
895  N N     . LEU A 134 ? 0.3843 0.4081 0.4800 0.0581  0.0024  -0.0077 114 LEU A N     
896  C CA    . LEU A 134 ? 0.3714 0.3966 0.4761 0.0512  -0.0042 -0.0042 114 LEU A CA    
897  C C     . LEU A 134 ? 0.3628 0.4175 0.4788 0.0459  -0.0080 0.0115  114 LEU A C     
898  O O     . LEU A 134 ? 0.3715 0.4328 0.4972 0.0470  -0.0088 0.0243  114 LEU A O     
899  C CB    . LEU A 134 ? 0.3579 0.3779 0.4529 0.0425  -0.0118 -0.0152 114 LEU A CB    
900  C CG    . LEU A 134 ? 0.3730 0.3752 0.4582 0.0430  -0.0156 -0.0298 114 LEU A CG    
901  C CD1   . LEU A 134 ? 0.3641 0.3766 0.4489 0.0376  -0.0245 -0.0336 114 LEU A CD1   
902  C CD2   . LEU A 134 ? 0.3909 0.3734 0.4868 0.0404  -0.0133 -0.0337 114 LEU A CD2   
903  N N     . ASN A 135 ? 0.3472 0.4196 0.4600 0.0385  -0.0105 0.0108  115 ASN A N     
904  C CA    . ASN A 135 ? 0.3272 0.4315 0.4447 0.0273  -0.0184 0.0202  115 ASN A CA    
905  C C     . ASN A 135 ? 0.3313 0.4667 0.4745 0.0361  -0.0196 0.0423  115 ASN A C     
906  O O     . ASN A 135 ? 0.3423 0.5091 0.4894 0.0312  -0.0296 0.0568  115 ASN A O     
907  C CB    . ASN A 135 ? 0.3075 0.4166 0.4179 0.0122  -0.0195 0.0098  115 ASN A CB    
908  C CG    . ASN A 135 ? 0.3125 0.4562 0.4239 -0.0061 -0.0309 0.0134  115 ASN A CG    
909  O OD1   . ASN A 135 ? 0.3017 0.4787 0.4357 -0.0111 -0.0356 0.0239  115 ASN A OD1   
910  N ND2   . ASN A 135 ? 0.3330 0.4731 0.4196 -0.0172 -0.0354 0.0043  115 ASN A ND2   
911  N N     . ARG A 136 ? 0.3431 0.4722 0.5026 0.0514  -0.0081 0.0468  116 ARG A N     
912  C CA    . ARG A 136 ? 0.3658 0.5271 0.5590 0.0654  -0.0040 0.0711  116 ARG A CA    
913  C C     . ARG A 136 ? 0.3747 0.5137 0.5790 0.0867  0.0070  0.0837  116 ARG A C     
914  O O     . ARG A 136 ? 0.3995 0.5674 0.6338 0.1008  0.0087  0.1116  116 ARG A O     
915  C CB    . ARG A 136 ? 0.3924 0.5611 0.6015 0.0723  0.0094  0.0712  116 ARG A CB    
916  C CG    . ARG A 136 ? 0.4090 0.6099 0.6249 0.0502  0.0006  0.0690  116 ARG A CG    
917  C CD    . ARG A 136 ? 0.4362 0.7011 0.6870 0.0420  -0.0144 0.0915  116 ARG A CD    
918  N NE    . ARG A 136 ? 0.4545 0.7455 0.7059 0.0106  -0.0281 0.0823  116 ARG A NE    
919  C CZ    . ARG A 136 ? 0.4660 0.8199 0.7459 -0.0064 -0.0463 0.0964  116 ARG A CZ    
920  N NH1   . ARG A 136 ? 0.4646 0.8680 0.7778 0.0103  -0.0532 0.1267  116 ARG A NH1   
921  N NH2   . ARG A 136 ? 0.4833 0.8512 0.7601 -0.0406 -0.0577 0.0810  116 ARG A NH2   
922  N N     . TYR A 137 ? 0.3586 0.4472 0.5420 0.0885  0.0147  0.0647  117 TYR A N     
923  C CA    . TYR A 137 ? 0.3799 0.4337 0.5731 0.1038  0.0285  0.0710  117 TYR A CA    
924  C C     . TYR A 137 ? 0.3946 0.4377 0.5821 0.0939  0.0213  0.0754  117 TYR A C     
925  O O     . TYR A 137 ? 0.4264 0.4441 0.6284 0.1041  0.0328  0.0883  117 TYR A O     
926  C CB    . TYR A 137 ? 0.3928 0.3960 0.5673 0.1088  0.0431  0.0440  117 TYR A CB    
927  C CG    . TYR A 137 ? 0.3954 0.3997 0.5769 0.1270  0.0617  0.0450  117 TYR A CG    
928  C CD1   . TYR A 137 ? 0.3639 0.3991 0.5412 0.1224  0.0587  0.0435  117 TYR A CD1   
929  C CD2   . TYR A 137 ? 0.4304 0.4008 0.6241 0.1496  0.0870  0.0479  117 TYR A CD2   
930  C CE1   . TYR A 137 ? 0.3793 0.4191 0.5655 0.1395  0.0799  0.0474  117 TYR A CE1   
931  C CE2   . TYR A 137 ? 0.4398 0.4114 0.6397 0.1694  0.1098  0.0491  117 TYR A CE2   
932  C CZ    . TYR A 137 ? 0.4159 0.4260 0.6126 0.1641  0.1059  0.0500  117 TYR A CZ    
933  O OH    . TYR A 137 ? 0.4433 0.4585 0.6489 0.1841  0.1326  0.0543  117 TYR A OH    
934  N N     . GLY A 138 ? 0.3715 0.4307 0.5395 0.0750  0.0065  0.0660  118 GLY A N     
935  C CA    . GLY A 138 ? 0.3784 0.4319 0.5399 0.0655  0.0034  0.0705  118 GLY A CA    
936  C C     . GLY A 138 ? 0.4082 0.4958 0.5761 0.0695  -0.0007 0.1024  118 GLY A C     
937  O O     . GLY A 138 ? 0.4143 0.5407 0.5916 0.0756  -0.0077 0.1196  118 GLY A O     
938  N N     . TYR A 139 ? 0.4483 0.5269 0.6119 0.0651  0.0032  0.1127  119 TYR A N     
939  C CA    . TYR A 139 ? 0.4985 0.6077 0.6610 0.0706  0.0011  0.1478  119 TYR A CA    
940  C C     . TYR A 139 ? 0.5200 0.6795 0.6533 0.0580  -0.0172 0.1470  119 TYR A C     
941  O O     . TYR A 139 ? 0.5215 0.6780 0.6271 0.0417  -0.0197 0.1236  119 TYR A O     
942  C CB    . TYR A 139 ? 0.5230 0.6080 0.6850 0.0667  0.0137  0.1583  119 TYR A CB    
943  C CG    . TYR A 139 ? 0.5642 0.6581 0.7387 0.0822  0.0220  0.2037  119 TYR A CG    
944  C CD1   . TYR A 139 ? 0.5968 0.6466 0.8050 0.0963  0.0416  0.2203  119 TYR A CD1   
945  C CD2   . TYR A 139 ? 0.5828 0.7271 0.7325 0.0827  0.0111  0.2307  119 TYR A CD2   
946  C CE1   . TYR A 139 ? 0.6386 0.6926 0.8619 0.1142  0.0527  0.2681  119 TYR A CE1   
947  C CE2   . TYR A 139 ? 0.6229 0.7806 0.7822 0.1000  0.0179  0.2792  119 TYR A CE2   
948  C CZ    . TYR A 139 ? 0.6507 0.7624 0.8500 0.1175  0.0400  0.3006  119 TYR A CZ    
949  O OH    . TYR A 139 ? 0.7011 0.8220 0.9134 0.1382  0.0502  0.3549  119 TYR A OH    
950  N N     . ASN A 140 ? 0.5472 0.7529 0.6886 0.0654  -0.0291 0.1722  120 ASN A N     
951  C CA    . ASN A 140 ? 0.5720 0.8309 0.6848 0.0490  -0.0504 0.1714  120 ASN A CA    
952  C C     . ASN A 140 ? 0.5603 0.8139 0.6551 0.0272  -0.0574 0.1309  120 ASN A C     
953  O O     . ASN A 140 ? 0.5826 0.8608 0.6434 0.0070  -0.0703 0.1180  120 ASN A O     
954  C CB    . ASN A 140 ? 0.6158 0.8860 0.6890 0.0421  -0.0511 0.1835  120 ASN A CB    
955  C CG    . ASN A 140 ? 0.6596 0.9493 0.7468 0.0629  -0.0477 0.2336  120 ASN A CG    
956  O OD1   . ASN A 140 ? 0.6696 0.9830 0.7940 0.0814  -0.0518 0.2623  120 ASN A OD1   
957  N ND2   . ASN A 140 ? 0.6912 0.9716 0.7517 0.0624  -0.0368 0.2481  120 ASN A ND2   
958  N N     . GLY A 141 ? 0.5393 0.7579 0.6535 0.0312  -0.0473 0.1111  121 GLY A N     
959  C CA    . GLY A 141 ? 0.5322 0.7395 0.6339 0.0148  -0.0495 0.0790  121 GLY A CA    
960  C C     . GLY A 141 ? 0.5460 0.7300 0.6113 0.0009  -0.0450 0.0558  121 GLY A C     
961  O O     . GLY A 141 ? 0.5560 0.7356 0.6029 -0.0155 -0.0473 0.0326  121 GLY A O     
962  N N     . LEU A 142 ? 0.5479 0.7147 0.6068 0.0079  -0.0350 0.0633  122 LEU A N     
963  C CA    . LEU A 142 ? 0.5534 0.7030 0.5842 -0.0007 -0.0256 0.0463  122 LEU A CA    
964  C C     . LEU A 142 ? 0.5313 0.6472 0.5717 0.0000  -0.0166 0.0227  122 LEU A C     
965  O O     . LEU A 142 ? 0.5155 0.6179 0.5803 0.0080  -0.0171 0.0215  122 LEU A O     
966  C CB    . LEU A 142 ? 0.5652 0.7119 0.5957 0.0067  -0.0145 0.0664  122 LEU A CB    
967  C CG    . LEU A 142 ? 0.6022 0.7831 0.6149 0.0086  -0.0203 0.0963  122 LEU A CG    
968  C CD1   . LEU A 142 ? 0.6210 0.7907 0.6369 0.0159  -0.0028 0.1178  122 LEU A CD1   
969  C CD2   . LEU A 142 ? 0.6356 0.8441 0.5988 -0.0082 -0.0308 0.0832  122 LEU A CD2   
970  N N     . CYS A 143 ? 0.5386 0.6421 0.5572 -0.0065 -0.0069 0.0054  123 CYS A N     
971  C CA    . CYS A 143 ? 0.5209 0.5986 0.5522 -0.0014 0.0030  -0.0094 123 CYS A CA    
972  C C     . CYS A 143 ? 0.5260 0.5998 0.5553 0.0022  0.0193  -0.0088 123 CYS A C     
973  O O     . CYS A 143 ? 0.5676 0.6358 0.5693 -0.0019 0.0318  -0.0206 123 CYS A O     
974  C CB    . CYS A 143 ? 0.5394 0.6021 0.5566 -0.0089 0.0046  -0.0294 123 CYS A CB    
975  S SG    . CYS A 143 ? 0.7669 0.8022 0.8039 0.0036  0.0154  -0.0375 123 CYS A SG    
976  N N     . ARG A 144 ? 0.4939 0.5697 0.5535 0.0086  0.0213  0.0039  124 ARG A N     
977  C CA    . ARG A 144 ? 0.4745 0.5555 0.5442 0.0108  0.0380  0.0104  124 ARG A CA    
978  C C     . ARG A 144 ? 0.4442 0.5244 0.5543 0.0159  0.0389  0.0078  124 ARG A C     
979  O O     . ARG A 144 ? 0.4105 0.4871 0.5413 0.0153  0.0246  0.0072  124 ARG A O     
980  C CB    . ARG A 144 ? 0.4694 0.5613 0.5435 0.0088  0.0408  0.0337  124 ARG A CB    
981  C CG    . ARG A 144 ? 0.4731 0.5739 0.5601 0.0092  0.0621  0.0452  124 ARG A CG    
982  C CD    . ARG A 144 ? 0.4762 0.5828 0.5695 0.0072  0.0672  0.0735  124 ARG A CD    
983  N NE    . ARG A 144 ? 0.4524 0.5447 0.5847 0.0052  0.0566  0.0802  124 ARG A NE    
984  C CZ    . ARG A 144 ? 0.4641 0.5491 0.6091 0.0053  0.0610  0.1051  124 ARG A CZ    
985  N NH1   . ARG A 144 ? 0.4890 0.5870 0.6103 0.0084  0.0733  0.1310  124 ARG A NH1   
986  N NH2   . ARG A 144 ? 0.4575 0.5189 0.6353 0.0029  0.0551  0.1045  124 ARG A NH2   
987  N N     . TYR A 145 ? 0.4629 0.5497 0.5832 0.0213  0.0562  0.0063  125 TYR A N     
988  C CA    . TYR A 145 ? 0.4508 0.5514 0.6166 0.0266  0.0553  0.0090  125 TYR A CA    
989  C C     . TYR A 145 ? 0.4611 0.5848 0.6588 0.0255  0.0733  0.0234  125 TYR A C     
990  O O     . TYR A 145 ? 0.4809 0.6044 0.6557 0.0264  0.0944  0.0285  125 TYR A O     
991  C CB    . TYR A 145 ? 0.4577 0.5515 0.6227 0.0398  0.0616  -0.0004 125 TYR A CB    
992  C CG    . TYR A 145 ? 0.4702 0.5393 0.6051 0.0399  0.0504  -0.0125 125 TYR A CG    
993  C CD1   . TYR A 145 ? 0.4977 0.5445 0.5914 0.0356  0.0599  -0.0249 125 TYR A CD1   
994  C CD2   . TYR A 145 ? 0.4605 0.5304 0.6072 0.0421  0.0313  -0.0121 125 TYR A CD2   
995  C CE1   . TYR A 145 ? 0.5037 0.5311 0.5786 0.0319  0.0512  -0.0345 125 TYR A CE1   
996  C CE2   . TYR A 145 ? 0.4664 0.5157 0.5891 0.0425  0.0257  -0.0195 125 TYR A CE2   
997  C CZ    . TYR A 145 ? 0.4888 0.5177 0.5807 0.0367  0.0361  -0.0296 125 TYR A CZ    
998  O OH    . TYR A 145 ? 0.5035 0.5151 0.5801 0.0332  0.0317  -0.0354 125 TYR A OH    
999  N N     . ASN A 146 ? 0.4576 0.6045 0.7072 0.0218  0.0650  0.0303  126 ASN A N     
1000 C CA    . ASN A 146 ? 0.4867 0.6648 0.7812 0.0209  0.0839  0.0456  126 ASN A CA    
1001 C C     . ASN A 146 ? 0.5062 0.7025 0.8205 0.0403  0.0989  0.0459  126 ASN A C     
1002 O O     . ASN A 146 ? 0.5132 0.6901 0.8018 0.0528  0.0953  0.0343  126 ASN A O     
1003 C CB    . ASN A 146 ? 0.4784 0.6781 0.8270 0.0026  0.0671  0.0526  126 ASN A CB    
1004 C CG    . ASN A 146 ? 0.4677 0.6753 0.8304 0.0000  0.0361  0.0404  126 ASN A CG    
1005 O OD1   . ASN A 146 ? 0.4663 0.6790 0.8201 0.0164  0.0319  0.0360  126 ASN A OD1   
1006 N ND2   . ASN A 146 ? 0.4691 0.6745 0.8507 -0.0210 0.0162  0.0351  126 ASN A ND2   
1007 N N     . LEU A 147 ? 0.6073 0.6191 0.8891 -0.0258 0.0423  0.0329  127 LEU A N     
1008 C CA    . LEU A 147 ? 0.6202 0.6584 0.9587 -0.0101 0.0583  0.0414  127 LEU A CA    
1009 C C     . LEU A 147 ? 0.6295 0.7070 1.0097 0.0022  0.0197  0.0496  127 LEU A C     
1010 O O     . LEU A 147 ? 0.6358 0.7357 1.0624 0.0209  0.0258  0.0615  127 LEU A O     
1011 C CB    . LEU A 147 ? 0.6273 0.6846 1.0298 -0.0183 0.0921  0.0456  127 LEU A CB    
1012 C CG    . LEU A 147 ? 0.6495 0.6673 1.0067 -0.0276 0.1381  0.0401  127 LEU A CG    
1013 C CD1   . LEU A 147 ? 0.6612 0.6995 1.0832 -0.0363 0.1753  0.0452  127 LEU A CD1   
1014 C CD2   . LEU A 147 ? 0.6603 0.6480 0.9735 -0.0131 0.1609  0.0353  127 LEU A CD2   
1015 N N     . ARG A 148 ? 0.6388 0.7217 0.9993 -0.0079 -0.0194 0.0438  128 ARG A N     
1016 C CA    . ARG A 148 ? 0.6389 0.7560 1.0202 -0.0001 -0.0608 0.0502  128 ARG A CA    
1017 C C     . ARG A 148 ? 0.6332 0.7265 0.9495 0.0162  -0.0721 0.0517  128 ARG A C     
1018 O O     . ARG A 148 ? 0.6430 0.7571 0.9579 0.0244  -0.1048 0.0590  128 ARG A O     
1019 C CB    . ARG A 148 ? 0.6555 0.7846 1.0388 -0.0222 -0.0957 0.0389  128 ARG A CB    
1020 C CG    . ARG A 148 ? 0.6614 0.8097 1.1079 -0.0437 -0.0837 0.0369  128 ARG A CG    
1021 C CD    . ARG A 148 ? 0.6870 0.8469 1.1410 -0.0685 -0.1214 0.0242  128 ARG A CD    
1022 N NE    . ARG A 148 ? 0.7033 0.8797 1.2216 -0.0926 -0.1080 0.0230  128 ARG A NE    
1023 C CZ    . ARG A 148 ? 0.7279 0.9217 1.2766 -0.1199 -0.1366 0.0125  128 ARG A CZ    
1024 N NH1   . ARG A 148 ? 0.7514 0.9470 1.2652 -0.1262 -0.1813 0.0000  128 ARG A NH1   
1025 N NH2   . ARG A 148 ? 0.7334 0.9411 1.3449 -0.1432 -0.1191 0.0135  128 ARG A NH2   
1026 N N     . GLY A 149 ? 0.6230 0.6744 0.8847 0.0188  -0.0452 0.0458  129 GLY A N     
1027 C CA    . GLY A 149 ? 0.6150 0.6435 0.8199 0.0311  -0.0497 0.0474  129 GLY A CA    
1028 C C     . GLY A 149 ? 0.6147 0.6280 0.7610 0.0239  -0.0742 0.0364  129 GLY A C     
1029 O O     . GLY A 149 ? 0.6252 0.6287 0.7303 0.0335  -0.0837 0.0391  129 GLY A O     
1030 N N     . GLU A 150 ? 0.6055 0.6138 0.7492 0.0075  -0.0806 0.0245  130 GLU A N     
1031 C CA    . GLU A 150 ? 0.6104 0.6003 0.7045 0.0020  -0.0998 0.0120  130 GLU A CA    
1032 C C     . GLU A 150 ? 0.5726 0.5280 0.6234 -0.0004 -0.0803 0.0063  130 GLU A C     
1033 O O     . GLU A 150 ? 0.5665 0.5115 0.6280 -0.0090 -0.0606 0.0071  130 GLU A O     
1034 C CB    . GLU A 150 ? 0.6544 0.6552 0.7729 -0.0150 -0.1217 0.0014  130 GLU A CB    
1035 C CG    . GLU A 150 ? 0.6928 0.7363 0.8542 -0.0157 -0.1504 0.0076  130 GLU A CG    
1036 C CD    . GLU A 150 ? 0.7402 0.7969 0.9319 -0.0392 -0.1723 -0.0051 130 GLU A CD    
1037 O OE1   . GLU A 150 ? 0.7530 0.7837 0.9445 -0.0539 -0.1573 -0.0155 130 GLU A OE1   
1038 O OE2   . GLU A 150 ? 0.7720 0.8645 0.9873 -0.0443 -0.2057 -0.0035 130 GLU A OE2   
1039 N N     . PHE A 151 ? 0.5491 0.4899 0.5519 0.0075  -0.0859 0.0028  131 PHE A N     
1040 C CA    . PHE A 151 ? 0.5218 0.4382 0.4895 0.0075  -0.0732 0.0000  131 PHE A CA    
1041 C C     . PHE A 151 ? 0.5143 0.4129 0.4828 -0.0021 -0.0773 -0.0090 131 PHE A C     
1042 O O     . PHE A 151 ? 0.5309 0.4241 0.4919 -0.0043 -0.0942 -0.0209 131 PHE A O     
1043 C CB    . PHE A 151 ? 0.5263 0.4383 0.4540 0.0190  -0.0775 -0.0007 131 PHE A CB    
1044 C CG    . PHE A 151 ? 0.5249 0.4230 0.4278 0.0213  -0.0654 0.0004  131 PHE A CG    
1045 C CD1   . PHE A 151 ? 0.5153 0.4163 0.4116 0.0209  -0.0513 0.0090  131 PHE A CD1   
1046 C CD2   . PHE A 151 ? 0.5419 0.4243 0.4303 0.0238  -0.0687 -0.0070 131 PHE A CD2   
1047 C CE1   . PHE A 151 ? 0.5141 0.4117 0.3932 0.0215  -0.0455 0.0125  131 PHE A CE1   
1048 C CE2   . PHE A 151 ? 0.5464 0.4231 0.4220 0.0292  -0.0592 -0.0014 131 PHE A CE2   
1049 C CZ    . PHE A 151 ? 0.5292 0.4182 0.4018 0.0274  -0.0501 0.0096  131 PHE A CZ    
1050 N N     . ASN A 152 ? 0.4991 0.3844 0.4723 -0.0089 -0.0611 -0.0034 132 ASN A N     
1051 C CA    . ASN A 152 ? 0.5194 0.3824 0.4986 -0.0184 -0.0614 -0.0077 132 ASN A CA    
1052 C C     . ASN A 152 ? 0.5291 0.3684 0.4831 -0.0140 -0.0500 0.0011  132 ASN A C     
1053 O O     . ASN A 152 ? 0.5396 0.3607 0.5019 -0.0227 -0.0411 0.0078  132 ASN A O     
1054 C CB    . ASN A 152 ? 0.5199 0.3910 0.5422 -0.0343 -0.0539 -0.0046 132 ASN A CB    
1055 C CG    . ASN A 152 ? 0.5129 0.3870 0.5370 -0.0367 -0.0294 0.0088  132 ASN A CG    
1056 O OD1   . ASN A 152 ? 0.5192 0.3928 0.5136 -0.0284 -0.0221 0.0139  132 ASN A OD1   
1057 N ND2   . ASN A 152 ? 0.5182 0.3947 0.5759 -0.0505 -0.0152 0.0132  132 ASN A ND2   
1058 N N     . VAL A 153 ? 0.5175 0.3597 0.4441 -0.0006 -0.0508 0.0038  133 VAL A N     
1059 C CA    . VAL A 153 ? 0.5233 0.3523 0.4330 0.0065  -0.0450 0.0151  133 VAL A CA    
1060 C C     . VAL A 153 ? 0.5354 0.3387 0.4420 0.0157  -0.0490 0.0071  133 VAL A C     
1061 O O     . VAL A 153 ? 0.5608 0.3641 0.4577 0.0229  -0.0554 -0.0078 133 VAL A O     
1062 C CB    . VAL A 153 ? 0.4990 0.3486 0.3901 0.0150  -0.0439 0.0223  133 VAL A CB    
1063 C CG1   . VAL A 153 ? 0.5002 0.3461 0.3831 0.0239  -0.0431 0.0365  133 VAL A CG1   
1064 C CG2   . VAL A 153 ? 0.4916 0.3556 0.3803 0.0040  -0.0361 0.0272  133 VAL A CG2   
1065 N N     . PRO A 154 ? 0.5540 0.3309 0.4657 0.0155  -0.0427 0.0171  134 PRO A N     
1066 C CA    . PRO A 154 ? 0.5883 0.3302 0.5000 0.0250  -0.0412 0.0088  134 PRO A CA    
1067 C C     . PRO A 154 ? 0.6117 0.3582 0.5120 0.0481  -0.0383 0.0112  134 PRO A C     
1068 O O     . PRO A 154 ? 0.5819 0.3617 0.4772 0.0543  -0.0396 0.0228  134 PRO A O     
1069 C CB    . PRO A 154 ? 0.6097 0.3228 0.5321 0.0200  -0.0324 0.0272  134 PRO A CB    
1070 C CG    . PRO A 154 ? 0.5856 0.3256 0.5007 0.0158  -0.0303 0.0499  134 PRO A CG    
1071 C CD    . PRO A 154 ? 0.5444 0.3177 0.4583 0.0063  -0.0343 0.0377  134 PRO A CD    
1072 N N     . PHE A 155 ? 0.6563 0.3682 0.5550 0.0593  -0.0321 -0.0012 135 PHE A N     
1073 C CA    . PHE A 155 ? 0.6754 0.3889 0.5706 0.0839  -0.0232 -0.0001 135 PHE A CA    
1074 C C     . PHE A 155 ? 0.6757 0.4053 0.5895 0.0988  -0.0200 0.0325  135 PHE A C     
1075 O O     . PHE A 155 ? 0.6997 0.4090 0.6243 0.0967  -0.0191 0.0509  135 PHE A O     
1076 C CB    . PHE A 155 ? 0.7279 0.3903 0.6166 0.0920  -0.0119 -0.0229 135 PHE A CB    
1077 C CG    . PHE A 155 ? 0.7541 0.4138 0.6433 0.1200  0.0046  -0.0238 135 PHE A CG    
1078 C CD1   . PHE A 155 ? 0.7307 0.4289 0.6078 0.1278  0.0061  -0.0272 135 PHE A CD1   
1079 C CD2   . PHE A 155 ? 0.8036 0.4202 0.7090 0.1395  0.0222  -0.0204 135 PHE A CD2   
1080 C CE1   . PHE A 155 ? 0.7505 0.4500 0.6341 0.1535  0.0259  -0.0275 135 PHE A CE1   
1081 C CE2   . PHE A 155 ? 0.8282 0.4444 0.7422 0.1683  0.0420  -0.0207 135 PHE A CE2   
1082 C CZ    . PHE A 155 ? 0.8000 0.4604 0.7041 0.1748  0.0444  -0.0247 135 PHE A CZ    
1083 N N     . GLY A 156 ? 0.6565 0.4248 0.5745 0.1123  -0.0194 0.0415  136 GLY A N     
1084 C CA    . GLY A 156 ? 0.6502 0.4483 0.5879 0.1227  -0.0234 0.0736  136 GLY A CA    
1085 C C     . GLY A 156 ? 0.6941 0.4764 0.6598 0.1512  -0.0125 0.0890  136 GLY A C     
1086 O O     . GLY A 156 ? 0.7140 0.5110 0.6988 0.1596  -0.0195 0.1213  136 GLY A O     
1087 N N     . ARG A 157 ? 0.7251 0.4771 0.6919 0.1669  0.0050  0.0666  137 ARG A N     
1088 C CA    . ARG A 157 ? 0.7781 0.5058 0.7749 0.1980  0.0229  0.0767  137 ARG A CA    
1089 C C     . ARG A 157 ? 0.7639 0.5483 0.8010 0.2199  0.0207  0.1089  137 ARG A C     
1090 O O     . ARG A 157 ? 0.7892 0.5750 0.8584 0.2372  0.0177  0.1417  137 ARG A O     
1091 C CB    . ARG A 157 ? 0.8199 0.4945 0.8244 0.1990  0.0247  0.0902  137 ARG A CB    
1092 N N     . TYR A 158 ? 0.7291 0.5620 0.7670 0.2181  0.0211  0.1019  138 TYR A N     
1093 C CA    . TYR A 158 ? 0.7097 0.6032 0.7936 0.2361  0.0200  0.1291  138 TYR A CA    
1094 C C     . TYR A 158 ? 0.7377 0.6193 0.8544 0.2708  0.0514  0.1228  138 TYR A C     
1095 O O     . TYR A 158 ? 0.7693 0.5996 0.8574 0.2747  0.0739  0.0894  138 TYR A O     
1096 C CB    . TYR A 158 ? 0.6691 0.6194 0.7432 0.2149  0.0088  0.1255  138 TYR A CB    
1097 C CG    . TYR A 158 ? 0.6507 0.6143 0.6958 0.1828  -0.0177 0.1320  138 TYR A CG    
1098 C CD1   . TYR A 158 ? 0.6411 0.5778 0.6412 0.1591  -0.0198 0.1064  138 TYR A CD1   
1099 C CD2   . TYR A 158 ? 0.6483 0.6518 0.7106 0.1765  -0.0399 0.1638  138 TYR A CD2   
1100 C CE1   . TYR A 158 ? 0.6263 0.5721 0.6031 0.1324  -0.0373 0.1109  138 TYR A CE1   
1101 C CE2   . TYR A 158 ? 0.6358 0.6452 0.6635 0.1463  -0.0591 0.1659  138 TYR A CE2   
1102 C CZ    . TYR A 158 ? 0.6297 0.6084 0.6168 0.1256  -0.0547 0.1386  138 TYR A CZ    
1103 O OH    . TYR A 158 ? 0.6255 0.6072 0.5814 0.0981  -0.0675 0.1394  138 TYR A OH    
1104 N N     . LYS A 159 ? 0.7306 0.6610 0.9074 0.2954  0.0530  0.1545  139 LYS A N     
1105 C CA    . LYS A 159 ? 0.7717 0.6992 0.9876 0.3263  0.0856  0.1488  139 LYS A CA    
1106 C C     . LYS A 159 ? 0.7618 0.7027 0.9613 0.3275  0.1106  0.1216  139 LYS A C     
1107 O O     . LYS A 159 ? 0.8135 0.7063 0.9918 0.3401  0.1434  0.0913  139 LYS A O     
1108 C CB    . LYS A 159 ? 0.7761 0.7670 1.0593 0.3383  0.0742  0.1853  139 LYS A CB    
1109 N N     . LYS A 160 ? 0.7038 0.7075 0.9039 0.3053  0.0935  0.1288  140 LYS A N     
1110 C CA    . LYS A 160 ? 0.6873 0.7084 0.8683 0.2984  0.1144  0.1066  140 LYS A CA    
1111 C C     . LYS A 160 ? 0.6280 0.6934 0.7882 0.2625  0.0881  0.1102  140 LYS A C     
1112 O O     . LYS A 160 ? 0.5964 0.7293 0.8027 0.2574  0.0771  0.1343  140 LYS A O     
1113 C CB    . LYS A 160 ? 0.6974 0.7625 0.9453 0.3297  0.1456  0.1200  140 LYS A CB    
1114 N N     . PRO A 161 ? 0.6228 0.6498 0.7168 0.2369  0.0779  0.0862  141 PRO A N     
1115 C CA    . PRO A 161 ? 0.5841 0.6397 0.6544 0.2047  0.0581  0.0866  141 PRO A CA    
1116 C C     . PRO A 161 ? 0.5775 0.6768 0.6631 0.2020  0.0758  0.0877  141 PRO A C     
1117 O O     . PRO A 161 ? 0.6020 0.6864 0.6768 0.2172  0.1067  0.0728  141 PRO A O     
1118 C CB    . PRO A 161 ? 0.5908 0.5903 0.5950 0.1889  0.0536  0.0591  141 PRO A CB    
1119 C CG    . PRO A 161 ? 0.6215 0.5700 0.6214 0.2033  0.0561  0.0518  141 PRO A CG    
1120 C CD    . PRO A 161 ? 0.6564 0.6103 0.6998 0.2364  0.0825  0.0592  141 PRO A CD    
1121 N N     . TYR A 162 ? 0.5506 0.7006 0.6579 0.1802  0.0578  0.1044  142 TYR A N     
1122 C CA    . TYR A 162 ? 0.5450 0.7415 0.6767 0.1728  0.0732  0.1097  142 TYR A CA    
1123 C C     . TYR A 162 ? 0.5430 0.7135 0.6170 0.1515  0.0796  0.0918  142 TYR A C     
1124 O O     . TYR A 162 ? 0.5324 0.6786 0.5679 0.1306  0.0586  0.0852  142 TYR A O     
1125 C CB    . TYR A 162 ? 0.5232 0.7858 0.7070 0.1551  0.0490  0.1352  142 TYR A CB    
1126 C CG    . TYR A 162 ? 0.5182 0.8268 0.7240 0.1347  0.0588  0.1395  142 TYR A CG    
1127 C CD1   . TYR A 162 ? 0.5328 0.8742 0.7817 0.1515  0.0918  0.1444  142 TYR A CD1   
1128 C CD2   . TYR A 162 ? 0.5022 0.8188 0.6876 0.0978  0.0384  0.1385  142 TYR A CD2   
1129 C CE1   . TYR A 162 ? 0.5299 0.9132 0.8026 0.1301  0.1031  0.1502  142 TYR A CE1   
1130 C CE2   . TYR A 162 ? 0.5024 0.8552 0.7094 0.0761  0.0487  0.1423  142 TYR A CE2   
1131 C CZ    . TYR A 162 ? 0.5184 0.9059 0.7702 0.0914  0.0803  0.1493  142 TYR A CZ    
1132 O OH    . TYR A 162 ? 0.5309 0.9542 0.8073 0.0671  0.0930  0.1547  142 TYR A OH    
1133 N N     . PHE A 163 ? 0.5583 0.7333 0.6275 0.1586  0.1108  0.0859  143 PHE A N     
1134 C CA    . PHE A 163 ? 0.5611 0.7155 0.5787 0.1404  0.1183  0.0760  143 PHE A CA    
1135 C C     . PHE A 163 ? 0.5329 0.7352 0.5840 0.1164  0.1180  0.0921  143 PHE A C     
1136 O O     . PHE A 163 ? 0.5325 0.7776 0.6290 0.1215  0.1410  0.1031  143 PHE A O     
1137 C CB    . PHE A 163 ? 0.6088 0.7348 0.5880 0.1582  0.1532  0.0612  143 PHE A CB    
1138 C CG    . PHE A 163 ? 0.6297 0.7332 0.5504 0.1418  0.1593  0.0560  143 PHE A CG    
1139 C CD1   . PHE A 163 ? 0.6270 0.6908 0.4951 0.1295  0.1347  0.0467  143 PHE A CD1   
1140 C CD2   . PHE A 163 ? 0.6600 0.7835 0.5821 0.1397  0.1906  0.0637  143 PHE A CD2   
1141 C CE1   . PHE A 163 ? 0.6521 0.6967 0.4706 0.1178  0.1383  0.0474  143 PHE A CE1   
1142 C CE2   . PHE A 163 ? 0.6869 0.7862 0.5525 0.1259  0.1962  0.0641  143 PHE A CE2   
1143 C CZ    . PHE A 163 ? 0.6828 0.7426 0.4967 0.1162  0.1685  0.0570  143 PHE A CZ    
1144 N N     . PRO A 164 ? 0.5141 0.7076 0.5453 0.0891  0.0942  0.0927  144 PRO A N     
1145 C CA    . PRO A 164 ? 0.5003 0.7306 0.5604 0.0602  0.0899  0.1044  144 PRO A CA    
1146 C C     . PRO A 164 ? 0.5278 0.7498 0.5678 0.0502  0.1169  0.1054  144 PRO A C     
1147 O O     . PRO A 164 ? 0.5327 0.7317 0.5453 0.0277  0.1109  0.1042  144 PRO A O     
1148 C CB    . PRO A 164 ? 0.4837 0.6890 0.5160 0.0383  0.0602  0.0989  144 PRO A CB    
1149 C CG    . PRO A 164 ? 0.4931 0.6419 0.4701 0.0527  0.0590  0.0843  144 PRO A CG    
1150 C CD    . PRO A 164 ? 0.5088 0.6537 0.4903 0.0835  0.0726  0.0803  144 PRO A CD    
1151 N N     . GLU A 165 ? 0.4586 0.8228 0.6471 0.0473  0.0067  -0.0192 145 GLU A N     
1152 C CA    . GLU A 165 ? 0.4876 0.8848 0.6850 0.0337  0.0504  0.0014  145 GLU A CA    
1153 C C     . GLU A 165 ? 0.4710 0.8916 0.7475 0.0087  0.0544  0.0170  145 GLU A C     
1154 O O     . GLU A 165 ? 0.4854 0.8938 0.7473 -0.0116 0.0714  0.0433  145 GLU A O     
1155 C CB    . GLU A 165 ? 0.5354 0.9785 0.7468 0.0534  0.0885  -0.0099 145 GLU A CB    
1156 C CG    . GLU A 165 ? 0.5948 1.0652 0.7929 0.0443  0.1425  0.0163  145 GLU A CG    
1157 C CD    . GLU A 165 ? 0.6641 1.1742 0.8499 0.0705  0.1832  0.0022  145 GLU A CD    
1158 O OE1   . GLU A 165 ? 0.7074 1.2542 0.9063 0.0655  0.2372  0.0234  145 GLU A OE1   
1159 O OE2   . GLU A 165 ? 0.6812 1.1824 0.8423 0.0970  0.1638  -0.0298 145 GLU A OE2   
1160 N N     . ALA A 166 ? 0.4447 0.8962 0.8091 0.0119  0.0349  -0.0016 146 ALA A N     
1161 C CA    . ALA A 166 ? 0.4251 0.9021 0.8843 -0.0120 0.0314  0.0038  146 ALA A CA    
1162 C C     . ALA A 166 ? 0.4177 0.8424 0.8440 -0.0277 -0.0043 0.0117  146 ALA A C     
1163 O O     . ALA A 166 ? 0.4202 0.8426 0.8805 -0.0535 0.0076  0.0299  146 ALA A O     
1164 C CB    . ALA A 166 ? 0.4036 0.9258 0.9653 0.0010  0.0052  -0.0272 146 ALA A CB    
1165 N N     . GLU A 167 ? 0.4210 0.8006 0.7810 -0.0111 -0.0448 -0.0013 147 GLU A N     
1166 C CA    . GLU A 167 ? 0.4319 0.7626 0.7511 -0.0201 -0.0759 0.0023  147 GLU A CA    
1167 C C     . GLU A 167 ? 0.4397 0.7434 0.7009 -0.0359 -0.0506 0.0286  147 GLU A C     
1168 O O     . GLU A 167 ? 0.4542 0.7313 0.7125 -0.0499 -0.0641 0.0355  147 GLU A O     
1169 C CB    . GLU A 167 ? 0.4508 0.7381 0.7014 0.0029  -0.1121 -0.0122 147 GLU A CB    
1170 C CG    . GLU A 167 ? 0.4816 0.7791 0.7738 0.0247  -0.1514 -0.0371 147 GLU A CG    
1171 C CD    . GLU A 167 ? 0.5043 0.8370 0.8300 0.0446  -0.1397 -0.0486 147 GLU A CD    
1172 O OE1   . GLU A 167 ? 0.4951 0.8440 0.8068 0.0414  -0.0990 -0.0390 147 GLU A OE1   
1173 O OE2   . GLU A 167 ? 0.5348 0.8778 0.8981 0.0677  -0.1743 -0.0700 147 GLU A OE2   
1174 N N     . LEU A 168 ? 0.4395 0.7488 0.6533 -0.0296 -0.0181 0.0396  148 LEU A N     
1175 C CA    . LEU A 168 ? 0.4496 0.7356 0.6041 -0.0375 0.0017  0.0627  148 LEU A CA    
1176 C C     . LEU A 168 ? 0.4721 0.7704 0.6706 -0.0584 0.0306  0.0897  148 LEU A C     
1177 O O     . LEU A 168 ? 0.4870 0.7525 0.6683 -0.0704 0.0250  0.1063  148 LEU A O     
1178 C CB    . LEU A 168 ? 0.4657 0.7559 0.5569 -0.0198 0.0227  0.0611  148 LEU A CB    
1179 C CG    . LEU A 168 ? 0.4608 0.7184 0.4919 -0.0065 -0.0022 0.0429  148 LEU A CG    
1180 C CD1   . LEU A 168 ? 0.4851 0.7526 0.4745 0.0122  0.0141  0.0315  148 LEU A CD1   
1181 C CD2   . LEU A 168 ? 0.4528 0.6750 0.4434 -0.0152 -0.0163 0.0521  148 LEU A CD2   
1182 N N     . TYR A 169 ? 0.4780 0.8219 0.7372 -0.0623 0.0645  0.0949  149 TYR A N     
1183 C CA    . TYR A 169 ? 0.5055 0.8606 0.8150 -0.0854 0.1030  0.1258  149 TYR A CA    
1184 C C     . TYR A 169 ? 0.4868 0.8308 0.8805 -0.1099 0.0764  0.1223  149 TYR A C     
1185 O O     . TYR A 169 ? 0.5231 0.8426 0.9330 -0.1309 0.0927  0.1500  149 TYR A O     
1186 C CB    . TYR A 169 ? 0.5281 0.9426 0.8965 -0.0845 0.1515  0.1290  149 TYR A CB    
1187 C CG    . TYR A 169 ? 0.5732 0.9928 0.8512 -0.0629 0.1923  0.1423  149 TYR A CG    
1188 C CD1   . TYR A 169 ? 0.5677 1.0159 0.8252 -0.0355 0.1925  0.1135  149 TYR A CD1   
1189 C CD2   . TYR A 169 ? 0.6310 1.0214 0.8385 -0.0657 0.2269  0.1817  149 TYR A CD2   
1190 C CE1   . TYR A 169 ? 0.6148 1.0662 0.7865 -0.0121 0.2253  0.1185  149 TYR A CE1   
1191 C CE2   . TYR A 169 ? 0.6825 1.0754 0.7952 -0.0398 0.2587  0.1898  149 TYR A CE2   
1192 C CZ    . TYR A 169 ? 0.6723 1.0976 0.7684 -0.0133 0.2573  0.1555  149 TYR A CZ    
1193 O OH    . TYR A 169 ? 0.7297 1.1562 0.7285 0.0158  0.2847  0.1566  149 TYR A OH    
1194 N N     . HIS A 170 ? 0.4397 0.7965 0.8829 -0.1044 0.0326  0.0871  150 HIS A N     
1195 C CA    . HIS A 170 ? 0.4261 0.7717 0.9440 -0.1216 -0.0034 0.0730  150 HIS A CA    
1196 C C     . HIS A 170 ? 0.4279 0.7112 0.8744 -0.1220 -0.0310 0.0778  150 HIS A C     
1197 O O     . HIS A 170 ? 0.4422 0.7024 0.9344 -0.1412 -0.0423 0.0813  150 HIS A O     
1198 C CB    . HIS A 170 ? 0.4031 0.7743 0.9723 -0.1061 -0.0503 0.0311  150 HIS A CB    
1199 C CG    . HIS A 170 ? 0.4115 0.7706 1.0490 -0.1173 -0.0968 0.0077  150 HIS A CG    
1200 N ND1   . HIS A 170 ? 0.4143 0.7272 0.9874 -0.1014 -0.1473 -0.0126 150 HIS A ND1   
1201 C CD2   . HIS A 170 ? 0.4262 0.8096 1.1854 -0.1409 -0.0994 -0.0018 150 HIS A CD2   
1202 C CE1   . HIS A 170 ? 0.4342 0.7411 1.0751 -0.1105 -0.1817 -0.0362 150 HIS A CE1   
1203 N NE2   . HIS A 170 ? 0.4493 0.7897 1.1891 -0.1327 -0.1521 -0.0306 150 HIS A NE2   
1204 N N     . PHE A 171 ? 0.4124 0.6697 0.7557 -0.1008 -0.0414 0.0751  151 PHE A N     
1205 C CA    . PHE A 171 ? 0.4252 0.6318 0.7031 -0.0981 -0.0619 0.0777  151 PHE A CA    
1206 C C     . PHE A 171 ? 0.4509 0.6343 0.7126 -0.1112 -0.0327 0.1129  151 PHE A C     
1207 O O     . PHE A 171 ? 0.4704 0.6168 0.7368 -0.1194 -0.0484 0.1168  151 PHE A O     
1208 C CB    . PHE A 171 ? 0.4206 0.6121 0.6078 -0.0757 -0.0716 0.0679  151 PHE A CB    
1209 C CG    . PHE A 171 ? 0.4373 0.5868 0.5696 -0.0716 -0.0899 0.0659  151 PHE A CG    
1210 C CD1   . PHE A 171 ? 0.4472 0.5756 0.5702 -0.0639 -0.1237 0.0423  151 PHE A CD1   
1211 C CD2   . PHE A 171 ? 0.4573 0.5896 0.5449 -0.0714 -0.0738 0.0858  151 PHE A CD2   
1212 C CE1   . PHE A 171 ? 0.4543 0.5498 0.5313 -0.0584 -0.1344 0.0382  151 PHE A CE1   
1213 C CE2   . PHE A 171 ? 0.4625 0.5635 0.5127 -0.0654 -0.0906 0.0800  151 PHE A CE2   
1214 C CZ    . PHE A 171 ? 0.4559 0.5409 0.5043 -0.0601 -0.1177 0.0560  151 PHE A CZ    
1215 N N     . ALA A 172 ? 0.4633 0.6646 0.6993 -0.1090 0.0088  0.1378  152 ALA A N     
1216 C CA    . ALA A 172 ? 0.5099 0.6836 0.7085 -0.1139 0.0383  0.1765  152 ALA A CA    
1217 C C     . ALA A 172 ? 0.5466 0.7066 0.8272 -0.1421 0.0540  0.1992  152 ALA A C     
1218 O O     . ALA A 172 ? 0.5760 0.6881 0.8359 -0.1474 0.0540  0.2232  152 ALA A O     
1219 C CB    . ALA A 172 ? 0.5339 0.7313 0.6805 -0.1006 0.0798  0.1951  152 ALA A CB    
1220 N N     . GLU A 173 ? 0.5536 0.7551 0.9353 -0.1597 0.0662  0.1902  153 GLU A N     
1221 C CA    . GLU A 173 ? 0.6052 0.7990 1.0902 -0.1921 0.0827  0.2075  153 GLU A CA    
1222 C C     . GLU A 173 ? 0.5960 0.7479 1.1162 -0.2006 0.0311  0.1845  153 GLU A C     
1223 O O     . GLU A 173 ? 0.6446 0.7521 1.1954 -0.2196 0.0382  0.2076  153 GLU A O     
1224 C CB    . GLU A 173 ? 0.6170 0.8768 1.2213 -0.2081 0.1027  0.1932  153 GLU A CB    
1225 C CG    . GLU A 173 ? 0.6673 0.9695 1.2539 -0.2030 0.1666  0.2196  153 GLU A CG    
1226 C CD    . GLU A 173 ? 0.6912 1.0562 1.3978 -0.2165 0.1875  0.1995  153 GLU A CD    
1227 O OE1   . GLU A 173 ? 0.6797 1.0531 1.4773 -0.2276 0.1464  0.1635  153 GLU A OE1   
1228 O OE2   . GLU A 173 ? 0.7330 1.1331 1.4241 -0.2094 0.2393  0.2123  153 GLU A OE2   
1229 N N     . LYS A 174 ? 0.5501 0.7107 1.0600 -0.1838 -0.0199 0.1394  154 LYS A N     
1230 C CA    . LYS A 174 ? 0.5514 0.6739 1.0796 -0.1845 -0.0706 0.1106  154 LYS A CA    
1231 C C     . LYS A 174 ? 0.5499 0.6162 0.9841 -0.1703 -0.0791 0.1238  154 LYS A C     
1232 O O     . LYS A 174 ? 0.5648 0.5882 1.0182 -0.1746 -0.1062 0.1131  154 LYS A O     
1233 C CB    . LYS A 174 ? 0.5287 0.6736 1.0548 -0.1646 -0.1190 0.0615  154 LYS A CB    
1234 C CG    . LYS A 174 ? 0.5364 0.7322 1.1771 -0.1752 -0.1310 0.0360  154 LYS A CG    
1235 C CD    . LYS A 174 ? 0.5557 0.7372 1.1990 -0.1564 -0.1919 -0.0145 154 LYS A CD    
1236 C CE    . LYS A 174 ? 0.5960 0.7224 1.2436 -0.1626 -0.2124 -0.0232 154 LYS A CE    
1237 N NZ    . LYS A 174 ? 0.6256 0.7324 1.2486 -0.1351 -0.2630 -0.0711 154 LYS A NZ    
1238 N N     . ALA A 175 ? 0.5317 0.6000 0.8710 -0.1516 -0.0587 0.1423  155 ALA A N     
1239 C CA    . ALA A 175 ? 0.5384 0.5644 0.7958 -0.1344 -0.0691 0.1502  155 ALA A CA    
1240 C C     . ALA A 175 ? 0.5986 0.5777 0.8607 -0.1450 -0.0499 0.1900  155 ALA A C     
1241 O O     . ALA A 175 ? 0.6265 0.5641 0.8420 -0.1308 -0.0664 0.1936  155 ALA A O     
1242 C CB    . ALA A 175 ? 0.5136 0.5593 0.6833 -0.1122 -0.0570 0.1537  155 ALA A CB    
1243 N N     . GLN A 176 ? 0.6290 0.6135 0.9502 -0.1689 -0.0129 0.2211  156 GLN A N     
1244 C CA    . GLN A 176 ? 0.7142 0.6452 1.0381 -0.1807 0.0130  0.2681  156 GLN A CA    
1245 C C     . GLN A 176 ? 0.7357 0.6127 1.1171 -0.1920 -0.0215 0.2545  156 GLN A C     
1246 O O     . GLN A 176 ? 0.8037 0.6192 1.1745 -0.1948 -0.0123 0.2893  156 GLN A O     
1247 C CB    . GLN A 176 ? 0.7671 0.7189 1.1513 -0.2074 0.0696  0.3055  156 GLN A CB    
1248 C CG    . GLN A 176 ? 0.7782 0.7771 1.0967 -0.1918 0.1091  0.3211  156 GLN A CG    
1249 C CD    . GLN A 176 ? 0.8478 0.8708 1.2213 -0.2141 0.1715  0.3534  156 GLN A CD    
1250 O OE1   . GLN A 176 ? 0.9001 0.9042 1.3526 -0.2388 0.1815  0.3542  156 GLN A OE1   
1251 N NE2   . GLN A 176 ? 0.8601 0.9240 1.1755 -0.1976 0.2083  0.3627  156 GLN A NE2   
1252 N N     . ASN A 177 ? 0.6931 0.5883 1.1293 -0.1946 -0.0635 0.2026  157 ASN A N     
1253 C CA    . ASN A 177 ? 0.7211 0.5679 1.2071 -0.1997 -0.1037 0.1767  157 ASN A CA    
1254 C C     . ASN A 177 ? 0.6693 0.5088 1.0852 -0.1670 -0.1476 0.1349  157 ASN A C     
1255 O O     . ASN A 177 ? 0.6763 0.4908 1.1253 -0.1636 -0.1876 0.0962  157 ASN A O     
1256 C CB    . ASN A 177 ? 0.7328 0.6015 1.3455 -0.2271 -0.1213 0.1446  157 ASN A CB    
1257 C CG    . ASN A 177 ? 0.7848 0.6788 1.4594 -0.2512 -0.0685 0.1756  157 ASN A CG    
1258 O OD1   . ASN A 177 ? 0.7620 0.7178 1.4824 -0.2575 -0.0578 0.1600  157 ASN A OD1   
1259 N ND2   . ASN A 177 ? 0.8577 0.7019 1.5288 -0.2618 -0.0348 0.2180  157 ASN A ND2   
1260 N N     . ALA A 178 ? 0.6276 0.4898 0.9498 -0.1426 -0.1381 0.1406  158 ALA A N     
1261 C CA    . ALA A 178 ? 0.5950 0.4599 0.8569 -0.1143 -0.1686 0.1035  158 ALA A CA    
1262 C C     . ALA A 178 ? 0.6180 0.4663 0.8026 -0.0909 -0.1616 0.1220  158 ALA A C     
1263 O O     . ALA A 178 ? 0.6286 0.4821 0.7774 -0.0896 -0.1338 0.1589  158 ALA A O     
1264 C CB    . ALA A 178 ? 0.5312 0.4492 0.7713 -0.1071 -0.1718 0.0780  158 ALA A CB    
1265 N N     . PHE A 179 ? 0.6330 0.4637 0.7930 -0.0695 -0.1882 0.0924  159 PHE A N     
1266 C CA    . PHE A 179 ? 0.6491 0.4777 0.7493 -0.0440 -0.1880 0.0972  159 PHE A CA    
1267 C C     . PHE A 179 ? 0.6119 0.4826 0.6753 -0.0289 -0.1921 0.0629  159 PHE A C     
1268 O O     . PHE A 179 ? 0.6044 0.4793 0.6767 -0.0267 -0.2068 0.0290  159 PHE A O     
1269 C CB    . PHE A 179 ? 0.7041 0.4792 0.8149 -0.0290 -0.2101 0.0928  159 PHE A CB    
1270 C CG    . PHE A 179 ? 0.7809 0.5022 0.9138 -0.0402 -0.2014 0.1372  159 PHE A CG    
1271 C CD1   . PHE A 179 ? 0.8005 0.5275 0.9079 -0.0494 -0.1697 0.1845  159 PHE A CD1   
1272 C CD2   . PHE A 179 ? 0.8399 0.4997 1.0153 -0.0399 -0.2224 0.1326  159 PHE A CD2   
1273 C CE1   . PHE A 179 ? 0.8773 0.5481 0.9953 -0.0591 -0.1539 0.2325  159 PHE A CE1   
1274 C CE2   . PHE A 179 ? 0.9164 0.5164 1.1121 -0.0518 -0.2102 0.1795  159 PHE A CE2   
1275 C CZ    . PHE A 179 ? 0.9377 0.5424 1.1018 -0.0619 -0.1732 0.2327  159 PHE A CZ    
1276 N N     . PHE A 180 ? 0.5950 0.4934 0.6156 -0.0177 -0.1790 0.0719  160 PHE A N     
1277 C CA    . PHE A 180 ? 0.5550 0.4907 0.5489 -0.0081 -0.1757 0.0450  160 PHE A CA    
1278 C C     . PHE A 180 ? 0.5604 0.4994 0.5411 0.0145  -0.1833 0.0295  160 PHE A C     
1279 O O     . PHE A 180 ? 0.5821 0.5181 0.5521 0.0258  -0.1865 0.0458  160 PHE A O     
1280 C CB    . PHE A 180 ? 0.5302 0.5014 0.5022 -0.0156 -0.1556 0.0584  160 PHE A CB    
1281 C CG    . PHE A 180 ? 0.5222 0.5010 0.5154 -0.0345 -0.1464 0.0687  160 PHE A CG    
1282 C CD1   . PHE A 180 ? 0.5470 0.5195 0.5554 -0.0464 -0.1320 0.1007  160 PHE A CD1   
1283 C CD2   . PHE A 180 ? 0.5007 0.4935 0.4987 -0.0379 -0.1507 0.0469  160 PHE A CD2   
1284 C CE1   . PHE A 180 ? 0.5442 0.5333 0.5881 -0.0639 -0.1205 0.1067  160 PHE A CE1   
1285 C CE2   . PHE A 180 ? 0.5064 0.5120 0.5343 -0.0515 -0.1474 0.0516  160 PHE A CE2   
1286 C CZ    . PHE A 180 ? 0.5234 0.5319 0.5824 -0.0658 -0.1315 0.0795  160 PHE A CZ    
1287 N N     . TYR A 181 ? 0.5515 0.4984 0.5324 0.0241  -0.1860 -0.0033 161 TYR A N     
1288 C CA    . TYR A 181 ? 0.5566 0.5167 0.5407 0.0453  -0.1884 -0.0239 161 TYR A CA    
1289 C C     . TYR A 181 ? 0.5311 0.5300 0.5040 0.0455  -0.1670 -0.0450 161 TYR A C     
1290 O O     . TYR A 181 ? 0.5388 0.5359 0.4925 0.0388  -0.1570 -0.0539 161 TYR A O     
1291 C CB    . TYR A 181 ? 0.6009 0.5283 0.6029 0.0614  -0.2064 -0.0451 161 TYR A CB    
1292 C CG    . TYR A 181 ? 0.6465 0.5240 0.6673 0.0601  -0.2266 -0.0234 161 TYR A CG    
1293 C CD1   . TYR A 181 ? 0.6632 0.5058 0.7024 0.0460  -0.2369 -0.0243 161 TYR A CD1   
1294 C CD2   . TYR A 181 ? 0.6832 0.5451 0.7053 0.0738  -0.2367 -0.0020 161 TYR A CD2   
1295 C CE1   . TYR A 181 ? 0.7109 0.5028 0.7784 0.0399  -0.2505 -0.0020 161 TYR A CE1   
1296 C CE2   . TYR A 181 ? 0.7322 0.5373 0.7661 0.0723  -0.2502 0.0251  161 TYR A CE2   
1297 C CZ    . TYR A 181 ? 0.7425 0.5121 0.8035 0.0525  -0.2539 0.0263  161 TYR A CZ    
1298 O OH    . TYR A 181 ? 0.8020 0.5104 0.8857 0.0463  -0.2627 0.0556  161 TYR A OH    
1299 N N     . CYS A 182 ? 0.5174 0.5488 0.5041 0.0540  -0.1609 -0.0529 162 CYS A N     
1300 C CA    . CYS A 182 ? 0.4902 0.5563 0.4818 0.0517  -0.1351 -0.0727 162 CYS A CA    
1301 C C     . CYS A 182 ? 0.5102 0.5863 0.5256 0.0712  -0.1296 -0.1021 162 CYS A C     
1302 O O     . CYS A 182 ? 0.4970 0.5966 0.5523 0.0860  -0.1384 -0.1150 162 CYS A O     
1303 C CB    . CYS A 182 ? 0.4587 0.5609 0.4684 0.0459  -0.1302 -0.0705 162 CYS A CB    
1304 S SG    . CYS A 182 ? 0.5906 0.7314 0.6251 0.0360  -0.0928 -0.0919 162 CYS A SG    
1305 N N     . GLU A 183 ? 0.5445 0.7107 0.5619 0.1502  -0.0209 -0.0161 163 GLU A N     
1306 C CA    . GLU A 183 ? 0.5693 0.7250 0.5704 0.1722  -0.0175 -0.0227 163 GLU A CA    
1307 C C     . GLU A 183 ? 0.5744 0.7125 0.5661 0.1631  -0.0151 -0.0311 163 GLU A C     
1308 O O     . GLU A 183 ? 0.5635 0.6863 0.5573 0.1415  -0.0189 -0.0303 163 GLU A O     
1309 C CB    . GLU A 183 ? 0.6257 0.7321 0.5995 0.1919  -0.0235 -0.0163 163 GLU A CB    
1310 C CG    . GLU A 183 ? 0.6629 0.7102 0.6227 0.1738  -0.0306 -0.0105 163 GLU A CG    
1311 C CD    . GLU A 183 ? 0.7282 0.7233 0.6661 0.1880  -0.0361 0.0010  163 GLU A CD    
1312 O OE1   . GLU A 183 ? 0.7543 0.7628 0.6867 0.2131  -0.0354 0.0081  163 GLU A OE1   
1313 O OE2   . GLU A 183 ? 0.7584 0.6982 0.6854 0.1742  -0.0420 0.0028  163 GLU A OE2   
1314 N N     . SER A 184 ? 0.5947 0.7397 0.5747 0.1822  -0.0089 -0.0395 164 SER A N     
1315 C CA    . SER A 184 ? 0.6125 0.7463 0.5769 0.1784  -0.0053 -0.0466 164 SER A CA    
1316 C C     . SER A 184 ? 0.6560 0.7280 0.5914 0.1803  -0.0168 -0.0520 164 SER A C     
1317 O O     . SER A 184 ? 0.6839 0.7191 0.6111 0.1874  -0.0251 -0.0500 164 SER A O     
1318 C CB    . SER A 184 ? 0.6299 0.7995 0.5906 0.1997  0.0071  -0.0546 164 SER A CB    
1319 O OG    . SER A 184 ? 0.6511 0.8221 0.5972 0.1938  0.0141  -0.0575 164 SER A OG    
1320 N N     . TYR A 185 ? 0.6677 0.7279 0.5875 0.1737  -0.0178 -0.0588 165 TYR A N     
1321 C CA    . TYR A 185 ? 0.7131 0.7204 0.6098 0.1720  -0.0314 -0.0686 165 TYR A CA    
1322 C C     . TYR A 185 ? 0.7780 0.7479 0.6517 0.1981  -0.0368 -0.0809 165 TYR A C     
1323 O O     . TYR A 185 ? 0.8137 0.7315 0.6794 0.1939  -0.0499 -0.0857 165 TYR A O     
1324 C CB    . TYR A 185 ? 0.7197 0.7305 0.5993 0.1672  -0.0319 -0.0756 165 TYR A CB    
1325 C CG    . TYR A 185 ? 0.7422 0.7813 0.6024 0.1882  -0.0188 -0.0811 165 TYR A CG    
1326 C CD1   . TYR A 185 ? 0.7979 0.8153 0.6252 0.2121  -0.0231 -0.0994 165 TYR A CD1   
1327 C CD2   . TYR A 185 ? 0.7143 0.8039 0.5905 0.1833  -0.0017 -0.0690 165 TYR A CD2   
1328 C CE1   . TYR A 185 ? 0.8169 0.8684 0.6253 0.2330  -0.0090 -0.1048 165 TYR A CE1   
1329 C CE2   . TYR A 185 ? 0.7355 0.8577 0.5964 0.1996  0.0137  -0.0717 165 TYR A CE2   
1330 C CZ    . TYR A 185 ? 0.7869 0.8930 0.6125 0.2256  0.0108  -0.0892 165 TYR A CZ    
1331 O OH    . TYR A 185 ? 0.8158 0.9624 0.6249 0.2436  0.0280  -0.0923 165 TYR A OH    
1332 N N     . ALA A 186 ? 0.7939 0.7907 0.6595 0.2249  -0.0270 -0.0868 166 ALA A N     
1333 C CA    . ALA A 186 ? 0.8625 0.8257 0.7051 0.2562  -0.0328 -0.1016 166 ALA A CA    
1334 C C     . ALA A 186 ? 0.8991 0.8230 0.7477 0.2605  -0.0413 -0.0921 166 ALA A C     
1335 O O     . ALA A 186 ? 0.9594 0.8226 0.7895 0.2729  -0.0534 -0.1013 166 ALA A O     
1336 C CB    . ALA A 186 ? 0.8599 0.8741 0.6983 0.2854  -0.0187 -0.1094 166 ALA A CB    
1337 N N     . ASP A 187 ? 0.8715 0.8283 0.7448 0.2504  -0.0354 -0.0734 167 ASP A N     
1338 C CA    . ASP A 187 ? 0.9008 0.8288 0.7761 0.2566  -0.0412 -0.0592 167 ASP A CA    
1339 C C     . ASP A 187 ? 0.8980 0.7771 0.7758 0.2265  -0.0499 -0.0479 167 ASP A C     
1340 O O     . ASP A 187 ? 0.9461 0.7756 0.8151 0.2307  -0.0564 -0.0373 167 ASP A O     
1341 C CB    . ASP A 187 ? 0.8809 0.8712 0.7797 0.2598  -0.0326 -0.0462 167 ASP A CB    
1342 C CG    . ASP A 187 ? 0.8982 0.9427 0.8012 0.2890  -0.0239 -0.0576 167 ASP A CG    
1343 O OD1   . ASP A 187 ? 0.9517 0.9743 0.8335 0.3197  -0.0267 -0.0709 167 ASP A OD1   
1344 O OD2   . ASP A 187 ? 0.8615 0.9725 0.7914 0.2811  -0.0144 -0.0552 167 ASP A OD2   
1345 N N     . SER A 188 ? 0.8468 0.7410 0.7373 0.1966  -0.0497 -0.0491 168 SER A N     
1346 C CA    . SER A 188 ? 0.8350 0.6984 0.7349 0.1661  -0.0565 -0.0403 168 SER A CA    
1347 C C     . SER A 188 ? 0.8760 0.6777 0.7609 0.1602  -0.0692 -0.0559 168 SER A C     
1348 O O     . SER A 188 ? 0.9039 0.6614 0.7933 0.1420  -0.0756 -0.0484 168 SER A O     
1349 C CB    . SER A 188 ? 0.7739 0.6840 0.6967 0.1399  -0.0528 -0.0373 168 SER A CB    
1350 O OG    . SER A 188 ? 0.7654 0.6881 0.6814 0.1397  -0.0539 -0.0529 168 SER A OG    
1351 N N     . MET A 189 ? 0.8818 0.6828 0.7494 0.1748  -0.0725 -0.0781 169 MET A N     
1352 C CA    . MET A 189 ? 0.9344 0.6816 0.7867 0.1727  -0.0873 -0.0998 169 MET A CA    
1353 C C     . MET A 189 ? 1.0054 0.6875 0.8411 0.1934  -0.0947 -0.1045 169 MET A C     
1354 O O     . MET A 189 ? 1.0660 0.6889 0.8953 0.1861  -0.1090 -0.1200 169 MET A O     
1355 C CB    . MET A 189 ? 0.9283 0.6992 0.7610 0.1872  -0.0885 -0.1226 169 MET A CB    
1356 C CG    . MET A 189 ? 0.8767 0.6971 0.7211 0.1672  -0.0842 -0.1175 169 MET A CG    
1357 S SD    . MET A 189 ? 1.0694 0.9186 0.8835 0.1863  -0.0827 -0.1366 169 MET A SD    
1358 C CE    . MET A 189 ? 0.8523 0.6480 0.6489 0.1830  -0.1071 -0.1672 169 MET A CE    
1359 N N     . ALA A 190 ? 1.0014 0.6938 0.8318 0.2199  -0.0866 -0.0924 170 ALA A N     
1360 C CA    . ALA A 190 ? 1.0703 0.6991 0.8829 0.2455  -0.0941 -0.0937 170 ALA A CA    
1361 C C     . ALA A 190 ? 1.0987 0.6787 0.9211 0.2233  -0.0964 -0.0668 170 ALA A C     
1362 O O     . ALA A 190 ? 1.1720 0.6873 0.9796 0.2403  -0.1030 -0.0611 170 ALA A O     
1363 C CB    . ALA A 190 ? 1.0631 0.7284 0.8661 0.2866  -0.0858 -0.0922 170 ALA A CB    
1364 N N     . ARG A 191 ? 1.0506 0.6617 0.8967 0.1867  -0.0904 -0.0494 171 ARG A N     
1365 C CA    . ARG A 191 ? 1.0744 0.6502 0.9308 0.1611  -0.0890 -0.0218 171 ARG A CA    
1366 C C     . ARG A 191 ? 1.1156 0.6365 0.9823 0.1273  -0.0999 -0.0322 171 ARG A C     
1367 O O     . ARG A 191 ? 1.1616 0.6379 1.0362 0.1040  -0.0993 -0.0112 171 ARG A O     
1368 C CB    . ARG A 191 ? 0.9997 0.6449 0.8778 0.1411  -0.0762 0.0006  171 ARG A CB    
1369 C CG    . ARG A 191 ? 0.9622 0.6623 0.8360 0.1699  -0.0669 0.0116  171 ARG A CG    
1370 C CD    . ARG A 191 ? 0.8980 0.6618 0.7938 0.1491  -0.0570 0.0292  171 ARG A CD    
1371 N NE    . ARG A 191 ? 0.8574 0.6792 0.7537 0.1744  -0.0503 0.0345  171 ARG A NE    
1372 C CZ    . ARG A 191 ? 0.8794 0.7032 0.7653 0.1922  -0.0476 0.0561  171 ARG A CZ    
1373 N NH1   . ARG A 191 ? 0.9393 0.7044 0.8103 0.1867  -0.0489 0.0790  171 ARG A NH1   
1374 N NH2   . ARG A 191 ? 0.8499 0.7347 0.7405 0.2150  -0.0439 0.0551  171 ARG A NH2   
1375 N N     . ALA A 192 ? 1.1059 0.6333 0.9728 0.1243  -0.1096 -0.0644 172 ALA A N     
1376 C CA    . ALA A 192 ? 1.1392 0.6263 1.0201 0.0926  -0.1229 -0.0815 172 ALA A CA    
1377 C C     . ALA A 192 ? 1.2388 0.6325 1.1040 0.1032  -0.1372 -0.0965 172 ALA A C     
1378 O O     . ALA A 192 ? 1.2672 0.6390 1.1051 0.1431  -0.1422 -0.1130 172 ALA A O     
1379 C CB    . ALA A 192 ? 1.0966 0.6289 0.9797 0.0896  -0.1302 -0.1112 172 ALA A CB    
1380 N N     . ASP A 193 ? 1.2963 0.6361 1.1812 0.0669  -0.1438 -0.0918 173 ASP A N     
1381 C CA    . ASP A 193 ? 1.4075 0.6488 1.2832 0.0701  -0.1596 -0.1080 173 ASP A CA    
1382 C C     . ASP A 193 ? 1.4315 0.6529 1.3301 0.0368  -0.1774 -0.1421 173 ASP A C     
1383 O O     . ASP A 193 ? 1.3748 0.6615 1.2844 0.0273  -0.1807 -0.1617 173 ASP A O     
1384 C CB    . ASP A 193 ? 1.4748 0.6507 1.3522 0.0573  -0.1519 -0.0680 173 ASP A CB    
1385 C CG    . ASP A 193 ? 1.4394 0.6560 1.3476 0.0121  -0.1359 -0.0327 173 ASP A CG    
1386 O OD1   . ASP A 193 ? 1.3897 0.6607 1.3266 -0.0189 -0.1370 -0.0469 173 ASP A OD1   
1387 O OD2   . ASP A 193 ? 1.4639 0.6610 1.3658 0.0102  -0.1225 0.0089  173 ASP A OD2   
1388 N N     . ASP A 194 ? 1.5193 0.6492 1.4255 0.0194  -0.1900 -0.1494 174 ASP A N     
1389 C CA    . ASP A 194 ? 1.5506 0.6552 1.4815 -0.0119 -0.2104 -0.1875 174 ASP A CA    
1390 C C     . ASP A 194 ? 1.4902 0.6518 1.4664 -0.0649 -0.2041 -0.1761 174 ASP A C     
1391 O O     . ASP A 194 ? 1.4809 0.6741 1.4770 -0.0823 -0.2192 -0.2111 174 ASP A O     
1392 C CB    . ASP A 194 ? 1.6703 0.6558 1.6032 -0.0213 -0.2249 -0.1958 174 ASP A CB    
1393 N N     . SER A 195 ? 1.4501 0.6296 1.4413 -0.0874 -0.1823 -0.1285 175 SER A N     
1394 C CA    . SER A 195 ? 1.3898 0.6282 1.4253 -0.1359 -0.1736 -0.1156 175 SER A CA    
1395 C C     . SER A 195 ? 1.2665 0.6129 1.3015 -0.1234 -0.1631 -0.1110 175 SER A C     
1396 O O     . SER A 195 ? 1.2142 0.6208 1.2816 -0.1548 -0.1528 -0.0960 175 SER A O     
1397 C CB    . SER A 195 ? 1.4261 0.6318 1.4777 -0.1683 -0.1541 -0.0663 175 SER A CB    
1398 N N     . SER A 196 ? 1.2236 0.5940 1.2231 -0.0778 -0.1655 -0.1246 176 SER A N     
1399 C CA    . SER A 196 ? 1.1251 0.5869 1.1216 -0.0640 -0.1554 -0.1186 176 SER A CA    
1400 C C     . SER A 196 ? 1.0941 0.5964 1.0868 -0.0539 -0.1717 -0.1579 176 SER A C     
1401 O O     . SER A 196 ? 1.1335 0.5969 1.1087 -0.0385 -0.1895 -0.1917 176 SER A O     
1402 C CB    . SER A 196 ? 1.1021 0.5736 1.0646 -0.0226 -0.1419 -0.0982 176 SER A CB    
1403 O OG    . SER A 196 ? 1.1268 0.5733 1.0896 -0.0282 -0.1270 -0.0590 176 SER A OG    
1404 N N     . VAL A 197 ? 1.0291 0.6090 1.0359 -0.0605 -0.1662 -0.1534 177 VAL A N     
1405 C CA    . VAL A 197 ? 1.0082 0.6321 1.0047 -0.0456 -0.1792 -0.1825 177 VAL A CA    
1406 C C     . VAL A 197 ? 0.9463 0.6257 0.9239 -0.0195 -0.1643 -0.1647 177 VAL A C     
1407 O O     . VAL A 197 ? 0.9048 0.6184 0.8983 -0.0289 -0.1484 -0.1363 177 VAL A O     
1408 C CB    . VAL A 197 ? 0.9975 0.6612 1.0321 -0.0786 -0.1913 -0.1984 177 VAL A CB    
1409 C CG1   . VAL A 197 ? 0.9747 0.6816 0.9918 -0.0576 -0.2061 -0.2257 177 VAL A CG1   
1410 C CG2   . VAL A 197 ? 1.0685 0.6800 1.1298 -0.1104 -0.2057 -0.2173 177 VAL A CG2   
1411 N N     . VAL A 198 ? 0.9430 0.6320 0.8869 0.0126  -0.1690 -0.1817 178 VAL A N     
1412 C CA    . VAL A 198 ? 0.8910 0.6264 0.8181 0.0354  -0.1538 -0.1648 178 VAL A CA    
1413 C C     . VAL A 198 ? 0.8707 0.6564 0.7940 0.0387  -0.1603 -0.1749 178 VAL A C     
1414 O O     . VAL A 198 ? 0.8991 0.6803 0.8021 0.0502  -0.1756 -0.2013 178 VAL A O     
1415 C CB    . VAL A 198 ? 0.9046 0.6191 0.7947 0.0721  -0.1480 -0.1688 178 VAL A CB    
1416 C CG1   . VAL A 198 ? 0.8472 0.6129 0.7283 0.0894  -0.1302 -0.1493 178 VAL A CG1   
1417 C CG2   . VAL A 198 ? 0.9429 0.6007 0.8325 0.0749  -0.1450 -0.1601 178 VAL A CG2   
1418 N N     . TYR A 199 ? 0.8283 0.6604 0.7691 0.0307  -0.1498 -0.1545 179 TYR A N     
1419 C CA    . TYR A 199 ? 0.8118 0.6861 0.7454 0.0383  -0.1542 -0.1584 179 TYR A CA    
1420 C C     . TYR A 199 ? 0.7825 0.6820 0.7008 0.0569  -0.1364 -0.1381 179 TYR A C     
1421 O O     . TYR A 199 ? 0.7489 0.6636 0.6859 0.0505  -0.1223 -0.1174 179 TYR A O     
1422 C CB    . TYR A 199 ? 0.7867 0.6952 0.7570 0.0140  -0.1606 -0.1566 179 TYR A CB    
1423 C CG    . TYR A 199 ? 0.7662 0.7150 0.7300 0.0253  -0.1630 -0.1537 179 TYR A CG    
1424 C CD1   . TYR A 199 ? 0.7955 0.7485 0.7338 0.0404  -0.1790 -0.1719 179 TYR A CD1   
1425 C CD2   . TYR A 199 ? 0.7257 0.7053 0.7060 0.0228  -0.1503 -0.1328 179 TYR A CD2   
1426 C CE1   . TYR A 199 ? 0.7861 0.7683 0.7141 0.0526  -0.1813 -0.1650 179 TYR A CE1   
1427 C CE2   . TYR A 199 ? 0.7115 0.7178 0.6856 0.0335  -0.1534 -0.1293 179 TYR A CE2   
1428 C CZ    . TYR A 199 ? 0.7467 0.7519 0.6938 0.0483  -0.1685 -0.1432 179 TYR A CZ    
1429 O OH    . TYR A 199 ? 0.7464 0.7710 0.6836 0.0607  -0.1718 -0.1357 179 TYR A OH    
1430 N N     . CYS A 200 ? 0.8038 0.7100 0.6884 0.0792  -0.1368 -0.1445 180 CYS A N     
1431 C CA    . CYS A 200 ? 0.7903 0.7202 0.6622 0.0938  -0.1186 -0.1257 180 CYS A CA    
1432 C C     . CYS A 200 ? 0.7905 0.7495 0.6590 0.0941  -0.1205 -0.1181 180 CYS A C     
1433 O O     . CYS A 200 ? 0.8180 0.7768 0.6663 0.1011  -0.1351 -0.1312 180 CYS A O     
1434 C CB    . CYS A 200 ? 0.8221 0.7406 0.6573 0.1198  -0.1121 -0.1335 180 CYS A CB    
1435 S SG    . CYS A 200 ? 1.0311 0.9084 0.8669 0.1269  -0.1113 -0.1425 180 CYS A SG    
1436 N N     . ASP A 201 ? 0.7635 0.7456 0.6512 0.0880  -0.1075 -0.0977 181 ASP A N     
1437 C CA    . ASP A 201 ? 0.7641 0.7654 0.6491 0.0894  -0.1080 -0.0873 181 ASP A CA    
1438 C C     . ASP A 201 ? 0.7402 0.7553 0.6216 0.0948  -0.0872 -0.0676 181 ASP A C     
1439 O O     . ASP A 201 ? 0.7108 0.7411 0.6197 0.0845  -0.0806 -0.0557 181 ASP A O     
1440 C CB    . ASP A 201 ? 0.7595 0.7756 0.6808 0.0726  -0.1171 -0.0866 181 ASP A CB    
1441 C CG    . ASP A 201 ? 0.7883 0.8156 0.7047 0.0779  -0.1241 -0.0804 181 ASP A CG    
1442 O OD1   . ASP A 201 ? 0.7763 0.8192 0.7217 0.0689  -0.1322 -0.0820 181 ASP A OD1   
1443 O OD2   . ASP A 201 ? 0.8264 0.8470 0.7084 0.0926  -0.1211 -0.0730 181 ASP A OD2   
1444 N N     . PRO A 202 ? 0.7594 0.7726 0.6082 0.1110  -0.0770 -0.0664 182 PRO A N     
1445 C CA    . PRO A 202 ? 0.7436 0.7761 0.5929 0.1140  -0.0547 -0.0491 182 PRO A CA    
1446 C C     . PRO A 202 ? 0.7371 0.7769 0.5850 0.1087  -0.0506 -0.0309 182 PRO A C     
1447 O O     . PRO A 202 ? 0.7479 0.7763 0.5826 0.1106  -0.0660 -0.0327 182 PRO A O     
1448 C CB    . PRO A 202 ? 0.7820 0.8141 0.5929 0.1349  -0.0472 -0.0564 182 PRO A CB    
1449 C CG    . PRO A 202 ? 0.8173 0.8302 0.5977 0.1439  -0.0670 -0.0725 182 PRO A CG    
1450 C CD    . PRO A 202 ? 0.7988 0.7974 0.6085 0.1279  -0.0864 -0.0832 182 PRO A CD    
1451 N N     . PRO A 203 ? 0.7267 0.7843 0.5910 0.1018  -0.0317 -0.0142 183 PRO A N     
1452 C CA    . PRO A 203 ? 0.7447 0.8009 0.6058 0.0956  -0.0254 0.0061  183 PRO A CA    
1453 C C     . PRO A 203 ? 0.7856 0.8305 0.5954 0.1112  -0.0266 0.0134  183 PRO A C     
1454 O O     . PRO A 203 ? 0.8008 0.8532 0.5798 0.1262  -0.0204 0.0065  183 PRO A O     
1455 C CB    . PRO A 203 ? 0.7401 0.8213 0.6232 0.0866  -0.0015 0.0184  183 PRO A CB    
1456 C CG    . PRO A 203 ? 0.7028 0.7993 0.6169 0.0844  -0.0027 0.0033  183 PRO A CG    
1457 C CD    . PRO A 203 ? 0.7006 0.7801 0.5925 0.0978  -0.0172 -0.0144 183 PRO A CD    
1458 N N     . TYR A 204 ? 0.8098 0.8376 0.6085 0.1107  -0.0352 0.0265  184 TYR A N     
1459 C CA    . TYR A 204 ? 0.8738 0.8905 0.6190 0.1288  -0.0402 0.0347  184 TYR A CA    
1460 C C     . TYR A 204 ? 0.9067 0.9383 0.6169 0.1365  -0.0149 0.0522  184 TYR A C     
1461 O O     . TYR A 204 ? 0.8995 0.9449 0.6306 0.1224  0.0087  0.0696  184 TYR A O     
1462 C CB    . TYR A 204 ? 0.9099 0.9037 0.6515 0.1280  -0.0514 0.0517  184 TYR A CB    
1463 C CG    . TYR A 204 ? 0.9084 0.8944 0.6643 0.1320  -0.0812 0.0310  184 TYR A CG    
1464 C CD1   . TYR A 204 ? 0.8948 0.8696 0.6826 0.1239  -0.0912 0.0351  184 TYR A CD1   
1465 C CD2   . TYR A 204 ? 0.9231 0.9157 0.6630 0.1439  -0.0995 0.0051  184 TYR A CD2   
1466 C CE1   . TYR A 204 ? 0.8870 0.8643 0.6908 0.1286  -0.1170 0.0148  184 TYR A CE1   
1467 C CE2   . TYR A 204 ? 0.9168 0.9104 0.6756 0.1446  -0.1253 -0.0146 184 TYR A CE2   
1468 C CZ    . TYR A 204 ? 0.8993 0.8888 0.6900 0.1375  -0.1331 -0.0090 184 TYR A CZ    
1469 O OH    . TYR A 204 ? 0.8936 0.8934 0.7059 0.1393  -0.1575 -0.0298 184 TYR A OH    
1470 N N     . ALA A 205 ? 0.9440 0.9779 0.6024 0.1592  -0.0200 0.0452  185 ALA A N     
1471 C CA    . ALA A 205 ? 0.9873 1.0409 0.6039 0.1709  0.0040  0.0616  185 ALA A CA    
1472 C C     . ALA A 205 ? 1.0348 1.0755 0.6270 0.1672  0.0155  0.1004  185 ALA A C     
1473 O O     . ALA A 205 ? 1.0449 1.0572 0.6284 0.1703  -0.0043 0.1072  185 ALA A O     
1474 C CB    . ALA A 205 ? 1.0221 1.0830 0.5879 0.1994  -0.0078 0.0381  185 ALA A CB    
1475 N N     . PRO A 206 ? 1.0665 1.1282 0.6491 0.1606  0.0478  0.1267  186 PRO A N     
1476 C CA    . PRO A 206 ? 1.1216 1.1674 0.6812 0.1531  0.0640  0.1697  186 PRO A CA    
1477 C C     . PRO A 206 ? 1.1890 1.2143 0.6800 0.1799  0.0486  0.1812  186 PRO A C     
1478 O O     . PRO A 206 ? 1.2123 1.2563 0.6582 0.2066  0.0402  0.1615  186 PRO A O     
1479 C CB    . PRO A 206 ? 1.1430 1.2306 0.6978 0.1459  0.1026  0.1877  186 PRO A CB    
1480 C CG    . PRO A 206 ? 1.0808 1.1999 0.6844 0.1396  0.1053  0.1563  186 PRO A CG    
1481 C CD    . PRO A 206 ? 1.0512 1.1549 0.6498 0.1584  0.0718  0.1178  186 PRO A CD    
1482 N N     . LEU A 207 ? 1.2252 1.2116 0.7083 0.1749  0.0429  0.2110  187 LEU A N     
1483 C CA    . LEU A 207 ? 1.3000 1.2659 0.7153 0.2026  0.0283  0.2276  187 LEU A CA    
1484 C C     . LEU A 207 ? 1.3810 1.3519 0.7453 0.2040  0.0615  0.2746  187 LEU A C     
1485 O O     . LEU A 207 ? 1.4560 1.4154 0.7522 0.2298  0.0556  0.2953  187 LEU A O     
1486 C CB    . LEU A 207 ? 1.3038 1.2221 0.7339 0.2025  0.0011  0.2342  187 LEU A CB    
1487 N N     . SER A 208 ? 1.3680 1.3600 0.7659 0.1761  0.0969  0.2918  188 SER A N     
1488 C CA    . SER A 208 ? 1.4416 1.4464 0.8010 0.1701  0.1347  0.3384  188 SER A CA    
1489 C C     . SER A 208 ? 1.4119 1.4678 0.8162 0.1446  0.1705  0.3364  188 SER A C     
1490 O O     . SER A 208 ? 1.3438 1.4040 0.8200 0.1203  0.1688  0.3160  188 SER A O     
1491 C CB    . SER A 208 ? 1.4959 1.4424 0.8529 0.1529  0.1397  0.3871  188 SER A CB    
1492 N N     . SER A 220 ? 0.9088 1.2260 0.9844 0.0134  0.1244  0.0546  200 SER A N     
1493 C CA    . SER A 220 ? 0.9230 1.1846 0.9572 0.0264  0.1037  0.0547  200 SER A CA    
1494 C C     . SER A 220 ? 0.9311 1.1913 0.9214 0.0565  0.0993  0.0433  200 SER A C     
1495 O O     . SER A 220 ? 0.9407 1.2343 0.9393 0.0711  0.1033  0.0285  200 SER A O     
1496 C CB    . SER A 220 ? 0.9746 1.1974 0.9830 0.0151  0.1077  0.0801  200 SER A CB    
1497 N N     . PHE A 221 ? 0.9242 1.1447 0.8683 0.0672  0.0892  0.0483  201 PHE A N     
1498 C CA    . PHE A 221 ? 0.8905 1.1030 0.7925 0.0946  0.0818  0.0340  201 PHE A CA    
1499 C C     . PHE A 221 ? 0.9009 1.1284 0.7598 0.1067  0.1003  0.0458  201 PHE A C     
1500 O O     . PHE A 221 ? 0.9294 1.1343 0.7570 0.1040  0.1008  0.0634  201 PHE A O     
1501 C CB    . PHE A 221 ? 0.8785 1.0438 0.7607 0.0998  0.0549  0.0251  201 PHE A CB    
1502 C CG    . PHE A 221 ? 0.8652 1.0188 0.7280 0.1209  0.0413  0.0023  201 PHE A CG    
1503 C CD1   . PHE A 221 ? 0.8246 0.9837 0.7154 0.1227  0.0352  -0.0114 201 PHE A CD1   
1504 C CD2   . PHE A 221 ? 0.8991 1.0337 0.7145 0.1393  0.0333  -0.0057 201 PHE A CD2   
1505 C CE1   . PHE A 221 ? 0.8348 0.9734 0.7079 0.1404  0.0227  -0.0297 201 PHE A CE1   
1506 C CE2   . PHE A 221 ? 0.9067 1.0240 0.7076 0.1564  0.0193  -0.0290 201 PHE A CE2   
1507 C CZ    . PHE A 221 ? 0.8763 0.9920 0.7067 0.1559  0.0145  -0.0397 201 PHE A CZ    
1508 N N     . THR A 222 ? 0.8762 1.1446 0.7314 0.1230  0.1153  0.0360  202 THR A N     
1509 C CA    . THR A 222 ? 0.8981 1.1956 0.7156 0.1356  0.1375  0.0461  202 THR A CA    
1510 C C     . THR A 222 ? 0.9216 1.1931 0.6785 0.1644  0.1237  0.0328  202 THR A C     
1511 O O     . THR A 222 ? 0.9040 1.1366 0.6538 0.1737  0.0972  0.0130  202 THR A O     
1512 C CB    . THR A 222 ? 0.8835 1.2446 0.7230 0.1454  0.1591  0.0367  202 THR A CB    
1513 O OG1   . THR A 222 ? 0.8680 1.2238 0.7037 0.1727  0.1426  0.0066  202 THR A OG1   
1514 C CG2   . THR A 222 ? 0.8435 1.2384 0.7469 0.1163  0.1714  0.0457  202 THR A CG2   
1515 N N     . LEU A 223 ? 0.9694 1.2658 0.6836 0.1778  0.1423  0.0431  203 LEU A N     
1516 C CA    . LEU A 223 ? 1.0081 1.2884 0.6612 0.2082  0.1299  0.0274  203 LEU A CA    
1517 C C     . LEU A 223 ? 0.9980 1.2857 0.6473 0.2370  0.1200  -0.0095 203 LEU A C     
1518 O O     . LEU A 223 ? 1.0148 1.2688 0.6320 0.2572  0.0964  -0.0337 203 LEU A O     
1519 C CB    . LEU A 223 ? 1.0676 1.3808 0.6731 0.2172  0.1553  0.0495  203 LEU A CB    
1520 C CG    . LEU A 223 ? 1.0900 1.3882 0.6888 0.1919  0.1666  0.0911  203 LEU A CG    
1521 C CD1   . LEU A 223 ? 1.1584 1.4917 0.7032 0.2038  0.1942  0.1151  203 LEU A CD1   
1522 C CD2   . LEU A 223 ? 1.0880 1.3244 0.6718 0.1899  0.1342  0.0903  203 LEU A CD2   
1523 N N     . GLU A 224 ? 0.9719 1.3032 0.6559 0.2394  0.1368  -0.0149 204 GLU A N     
1524 C CA    . GLU A 224 ? 0.9717 1.3079 0.6548 0.2695  0.1277  -0.0483 204 GLU A CA    
1525 C C     . GLU A 224 ? 0.9378 1.2154 0.6394 0.2663  0.0965  -0.0654 204 GLU A C     
1526 O O     . GLU A 224 ? 0.9638 1.2100 0.6427 0.2904  0.0776  -0.0928 204 GLU A O     
1527 C CB    . GLU A 224 ? 0.9564 1.3565 0.6783 0.2729  0.1510  -0.0488 204 GLU A CB    
1528 C CG    . GLU A 224 ? 0.9963 1.4656 0.6999 0.2815  0.1845  -0.0378 204 GLU A CG    
1529 C CD    . GLU A 224 ? 0.9987 1.4869 0.7157 0.2443  0.2074  0.0018  204 GLU A CD    
1530 O OE1   . GLU A 224 ? 0.9648 1.4155 0.7117 0.2134  0.1965  0.0172  204 GLU A OE1   
1531 O OE2   . GLU A 224 ? 1.0399 1.5797 0.7370 0.2463  0.2369  0.0178  204 GLU A OE2   
1532 N N     . GLN A 225 ? 0.8825 1.1456 0.6258 0.2360  0.0917  -0.0494 205 GLN A N     
1533 C CA    . GLN A 225 ? 0.8518 1.0663 0.6145 0.2290  0.0659  -0.0604 205 GLN A CA    
1534 C C     . GLN A 225 ? 0.8692 1.0326 0.5995 0.2295  0.0425  -0.0691 205 GLN A C     
1535 O O     . GLN A 225 ? 0.8710 0.9938 0.6030 0.2335  0.0209  -0.0871 205 GLN A O     
1536 C CB    . GLN A 225 ? 0.8014 1.0212 0.6135 0.1981  0.0676  -0.0423 205 GLN A CB    
1537 C CG    . GLN A 225 ? 0.7762 1.0473 0.6285 0.1969  0.0848  -0.0397 205 GLN A CG    
1538 C CD    . GLN A 225 ? 0.7343 1.0105 0.6345 0.1680  0.0829  -0.0273 205 GLN A CD    
1539 O OE1   . GLN A 225 ? 0.7302 1.0158 0.6443 0.1442  0.0926  -0.0091 205 GLN A OE1   
1540 N NE2   . GLN A 225 ? 0.7081 0.9758 0.6316 0.1714  0.0699  -0.0372 205 GLN A NE2   
1541 N N     . GLN A 226 ? 0.8866 1.0533 0.5882 0.2250  0.0468  -0.0554 206 GLN A N     
1542 C CA    . GLN A 226 ? 0.9050 1.0336 0.5737 0.2289  0.0238  -0.0654 206 GLN A CA    
1543 C C     . GLN A 226 ? 0.9515 1.0674 0.5825 0.2596  0.0115  -0.0977 206 GLN A C     
1544 O O     . GLN A 226 ? 0.9621 1.0374 0.5908 0.2610  -0.0141 -0.1197 206 GLN A O     
1545 C CB    . GLN A 226 ? 0.9188 1.0573 0.5584 0.2238  0.0321  -0.0414 206 GLN A CB    
1546 C CG    . GLN A 226 ? 0.8776 1.0141 0.5521 0.1938  0.0383  -0.0122 206 GLN A CG    
1547 C CD    . GLN A 226 ? 0.8518 0.9495 0.5399 0.1810  0.0113  -0.0168 206 GLN A CD    
1548 O OE1   . GLN A 226 ? 0.8580 0.9325 0.5391 0.1893  -0.0112 -0.0417 206 GLN A OE1   
1549 N NE2   . GLN A 226 ? 0.8238 0.9158 0.5341 0.1605  0.0135  0.0058  206 GLN A NE2   
1550 N N     . ALA A 227 ? 0.9826 1.1354 0.5861 0.2836  0.0301  -0.1022 207 ALA A N     
1551 C CA    . ALA A 227 ? 1.0331 1.1779 0.5986 0.3176  0.0194  -0.1367 207 ALA A CA    
1552 C C     . ALA A 227 ? 1.0284 1.1450 0.6204 0.3263  0.0074  -0.1603 207 ALA A C     
1553 O O     . ALA A 227 ? 1.0647 1.1427 0.6381 0.3436  -0.0146 -0.1918 207 ALA A O     
1554 C CB    . ALA A 227 ? 1.0672 1.2681 0.5977 0.3427  0.0453  -0.1346 207 ALA A CB    
1555 N N     . HIS A 228 ? 0.9923 1.1266 0.6273 0.3148  0.0209  -0.1450 208 HIS A N     
1556 C CA    . HIS A 228 ? 0.9921 1.0995 0.6512 0.3240  0.0106  -0.1605 208 HIS A CA    
1557 C C     . HIS A 228 ? 0.9779 1.0217 0.6511 0.3048  -0.0161 -0.1664 208 HIS A C     
1558 O O     . HIS A 228 ? 1.0047 1.0039 0.6760 0.3174  -0.0327 -0.1878 208 HIS A O     
1559 C CB    . HIS A 228 ? 0.9582 1.1055 0.6602 0.3150  0.0295  -0.1410 208 HIS A CB    
1560 C CG    . HIS A 228 ? 0.9726 1.0963 0.6943 0.3296  0.0198  -0.1534 208 HIS A CG    
1561 N ND1   . HIS A 228 ? 0.9337 1.0730 0.6971 0.3163  0.0249  -0.1373 208 HIS A ND1   
1562 C CD2   . HIS A 228 ? 1.0255 1.1086 0.7287 0.3583  0.0043  -0.1799 208 HIS A CD2   
1563 C CE1   . HIS A 228 ? 0.9567 1.0669 0.7234 0.3373  0.0136  -0.1502 208 HIS A CE1   
1564 N NE2   . HIS A 228 ? 1.0143 1.0862 0.7458 0.3623  0.0011  -0.1754 208 HIS A NE2   
1565 N N     . LEU A 229 ? 0.9375 0.9775 0.6260 0.2742  -0.0195 -0.1470 209 LEU A N     
1566 C CA    . LEU A 229 ? 0.9224 0.9145 0.6281 0.2529  -0.0421 -0.1510 209 LEU A CA    
1567 C C     . LEU A 229 ? 0.9795 0.9331 0.6544 0.2645  -0.0652 -0.1812 209 LEU A C     
1568 O O     . LEU A 229 ? 0.9921 0.8987 0.6795 0.2573  -0.0838 -0.1960 209 LEU A O     
1569 C CB    . LEU A 229 ? 0.8687 0.8734 0.5943 0.2232  -0.0410 -0.1276 209 LEU A CB    
1570 C CG    . LEU A 229 ? 0.8534 0.8221 0.6003 0.2003  -0.0624 -0.1315 209 LEU A CG    
1571 C CD1   . LEU A 229 ? 0.8361 0.7839 0.6150 0.1918  -0.0640 -0.1290 209 LEU A CD1   
1572 C CD2   . LEU A 229 ? 0.8193 0.8056 0.5815 0.1784  -0.0616 -0.1117 209 LEU A CD2   
1573 N N     . ALA A 230 ? 1.0210 0.9957 0.6556 0.2817  -0.0637 -0.1902 210 ALA A N     
1574 C CA    . ALA A 230 ? 1.0844 1.0310 0.6862 0.2965  -0.0869 -0.2237 210 ALA A CA    
1575 C C     . ALA A 230 ? 1.1422 1.0585 0.7333 0.3230  -0.0947 -0.2550 210 ALA A C     
1576 O O     . ALA A 230 ? 1.1890 1.0576 0.7768 0.3238  -0.1196 -0.2843 210 ALA A O     
1577 C CB    . ALA A 230 ? 1.1133 1.0967 0.6683 0.3137  -0.0816 -0.2238 210 ALA A CB    
1578 N N     . GLU A 231 ? 1.1407 1.0847 0.7289 0.3448  -0.0742 -0.2502 211 GLU A N     
1579 C CA    . GLU A 231 ? 1.1860 1.1031 0.7631 0.3763  -0.0809 -0.2796 211 GLU A CA    
1580 C C     . GLU A 231 ? 1.1697 1.0263 0.7818 0.3617  -0.0946 -0.2793 211 GLU A C     
1581 O O     . GLU A 231 ? 1.2249 1.0253 0.8288 0.3753  -0.1144 -0.3084 211 GLU A O     
1582 C CB    . GLU A 231 ? 1.1954 1.1685 0.7650 0.4044  -0.0544 -0.2734 211 GLU A CB    
1583 C CG    . GLU A 231 ? 1.2628 1.2137 0.8169 0.4452  -0.0617 -0.3070 211 GLU A CG    
1584 C CD    . GLU A 231 ? 1.2681 1.2861 0.8214 0.4728  -0.0351 -0.3012 211 GLU A CD    
1585 O OE1   . GLU A 231 ? 1.2175 1.2924 0.7909 0.4555  -0.0107 -0.2695 211 GLU A OE1   
1586 O OE2   . GLU A 231 ? 1.3195 1.3366 0.8668 0.4999  -0.0412 -0.3199 211 GLU A OE2   
1587 N N     . ILE A 232 ? 1.0967 0.9637 0.7465 0.3345  -0.0839 -0.2460 212 ILE A N     
1588 C CA    . ILE A 232 ? 1.0816 0.8973 0.7623 0.3179  -0.0940 -0.2383 212 ILE A CA    
1589 C C     . ILE A 232 ? 1.0885 0.8499 0.7747 0.2933  -0.1184 -0.2523 212 ILE A C     
1590 O O     . ILE A 232 ? 1.1285 0.8281 0.8236 0.2903  -0.1330 -0.2630 212 ILE A O     
1591 C CB    . ILE A 232 ? 1.0210 0.8688 0.7382 0.2934  -0.0780 -0.2012 212 ILE A CB    
1592 C CG1   . ILE A 232 ? 1.0062 0.9077 0.7263 0.3162  -0.0560 -0.1909 212 ILE A CG1   
1593 C CG2   . ILE A 232 ? 1.0214 0.8189 0.7654 0.2744  -0.0881 -0.1904 212 ILE A CG2   
1594 C CD1   . ILE A 232 ? 0.9460 0.8809 0.7031 0.2951  -0.0428 -0.1602 212 ILE A CD1   
1595 N N     . ALA A 233 ? 1.0547 0.8400 0.7362 0.2760  -0.1228 -0.2521 213 ALA A N     
1596 C CA    . ALA A 233 ? 1.0634 0.8123 0.7533 0.2528  -0.1467 -0.2690 213 ALA A CA    
1597 C C     . ALA A 233 ? 1.1375 0.8390 0.8029 0.2736  -0.1683 -0.3117 213 ALA A C     
1598 O O     . ALA A 233 ? 1.1699 0.8165 0.8537 0.2552  -0.1878 -0.3270 213 ALA A O     
1599 C CB    . ALA A 233 ? 1.0296 0.8208 0.7132 0.2399  -0.1483 -0.2630 213 ALA A CB    
1600 N N     . GLU A 234 ? 1.1753 0.8995 0.8003 0.3113  -0.1645 -0.3318 214 GLU A N     
1601 C CA    . GLU A 234 ? 1.2646 0.9483 0.8620 0.3376  -0.1856 -0.3778 214 GLU A CA    
1602 C C     . GLU A 234 ? 1.3036 0.9248 0.9124 0.3498  -0.1900 -0.3862 214 GLU A C     
1603 O O     . GLU A 234 ? 1.3720 0.9378 0.9765 0.3568  -0.2118 -0.4188 214 GLU A O     
1604 C CB    . GLU A 234 ? 1.3069 1.0412 0.8550 0.3785  -0.1772 -0.3956 214 GLU A CB    
1605 C CG    . GLU A 234 ? 1.3003 1.0900 0.8275 0.3716  -0.1739 -0.3862 214 GLU A CG    
1606 C CD    . GLU A 234 ? 1.3444 1.1904 0.8308 0.4050  -0.1608 -0.3901 214 GLU A CD    
1607 O OE1   . GLU A 234 ? 1.4084 1.2446 0.8853 0.4277  -0.1698 -0.4151 214 GLU A OE1   
1608 O OE2   . GLU A 234 ? 1.3185 1.2194 0.7855 0.4064  -0.1408 -0.3648 214 GLU A OE2   
1609 N N     . GLY A 235 ? 1.2629 0.8962 0.8895 0.3507  -0.1695 -0.3530 215 GLY A N     
1610 C CA    . GLY A 235 ? 1.2976 0.8724 0.9336 0.3642  -0.1730 -0.3538 215 GLY A CA    
1611 C C     . GLY A 235 ? 1.3037 0.8096 0.9726 0.3255  -0.1874 -0.3438 215 GLY A C     
1612 O O     . GLY A 235 ? 1.3750 0.8041 1.0443 0.3322  -0.2034 -0.3610 215 GLY A O     
1613 N N     . LEU A 236 ? 1.2298 0.7631 0.9270 0.2850  -0.1811 -0.3155 216 LEU A N     
1614 C CA    . LEU A 236 ? 1.2238 0.7068 0.9556 0.2440  -0.1903 -0.3020 216 LEU A CA    
1615 C C     . LEU A 236 ? 1.2769 0.7127 1.0120 0.2273  -0.2171 -0.3390 216 LEU A C     
1616 O O     . LEU A 236 ? 1.3293 0.6947 1.0846 0.2065  -0.2294 -0.3422 216 LEU A O     
1617 C CB    . LEU A 236 ? 1.1346 0.6710 0.8955 0.2091  -0.1762 -0.2663 216 LEU A CB    
1618 C CG    . LEU A 236 ? 1.0732 0.6531 0.8405 0.2173  -0.1520 -0.2297 216 LEU A CG    
1619 C CD1   . LEU A 236 ? 1.0008 0.6244 0.7986 0.1816  -0.1424 -0.2007 216 LEU A CD1   
1620 C CD2   . LEU A 236 ? 1.1105 0.6388 0.8798 0.2303  -0.1498 -0.2165 216 LEU A CD2   
1621 N N     . VAL A 237 ? 1.2703 0.7455 0.9856 0.2362  -0.2265 -0.3667 217 VAL A N     
1622 C CA    . VAL A 237 ? 1.3251 0.7680 1.0439 0.2222  -0.2546 -0.4071 217 VAL A CA    
1623 C C     . VAL A 237 ? 1.4145 0.7969 1.1192 0.2456  -0.2688 -0.4388 217 VAL A C     
1624 O O     . VAL A 237 ? 1.4677 0.8157 1.1916 0.2243  -0.2874 -0.4610 217 VAL A O     
1625 C CB    . VAL A 237 ? 1.3068 0.8155 1.0023 0.2311  -0.2612 -0.4263 217 VAL A CB    
1626 C CG1   . VAL A 237 ? 1.3450 0.8797 0.9941 0.2784  -0.2581 -0.4474 217 VAL A CG1   
1627 C CG2   . VAL A 237 ? 1.3342 0.8324 1.0537 0.2007  -0.2868 -0.4532 217 VAL A CG2   
1628 N N     . GLU A 238 ? 1.4297 0.8127 1.1085 0.2857  -0.2561 -0.4344 218 GLU A N     
1629 C CA    . GLU A 238 ? 1.5123 0.8477 1.1832 0.3078  -0.2650 -0.4546 218 GLU A CA    
1630 C C     . GLU A 238 ? 1.5530 0.8017 1.2518 0.2862  -0.2686 -0.4379 218 GLU A C     
1631 O O     . GLU A 238 ? 1.6335 0.8229 1.3375 0.2869  -0.2817 -0.4557 218 GLU A O     
1632 C CB    . GLU A 238 ? 1.5135 0.8888 1.1510 0.3582  -0.2499 -0.4543 218 GLU A CB    
1633 N N     . ARG A 239 ? 1.5029 0.7437 1.2182 0.2672  -0.2565 -0.4020 219 ARG A N     
1634 C CA    . ARG A 239 ? 1.5381 0.7002 1.2785 0.2428  -0.2573 -0.3769 219 ARG A CA    
1635 C C     . ARG A 239 ? 1.5272 0.6701 1.3068 0.1853  -0.2664 -0.3722 219 ARG A C     
1636 O O     . ARG A 239 ? 1.5303 0.6330 1.3349 0.1548  -0.2600 -0.3386 219 ARG A O     
1637 C CB    . ARG A 239 ? 1.4920 0.6655 1.2284 0.2572  -0.2364 -0.3341 219 ARG A CB    
1638 N N     . HIS A 240 ? 1.5127 0.6958 1.2984 0.1707  -0.2790 -0.4026 220 HIS A N     
1639 C CA    . HIS A 240 ? 1.4970 0.6817 1.3240 0.1175  -0.2888 -0.4047 220 HIS A CA    
1640 C C     . HIS A 240 ? 1.4152 0.6439 1.2670 0.0877  -0.2714 -0.3624 220 HIS A C     
1641 O O     . HIS A 240 ? 1.4179 0.6234 1.3090 0.0430  -0.2690 -0.3415 220 HIS A O     
1642 C CB    . HIS A 240 ? 1.5778 0.6824 1.4346 0.0860  -0.2968 -0.4068 220 HIS A CB    
1643 C CG    . HIS A 240 ? 1.6556 0.7303 1.4965 0.1084  -0.3109 -0.4455 220 HIS A CG    
1644 N ND1   . HIS A 240 ? 1.6747 0.7789 1.5222 0.0993  -0.3284 -0.4849 220 HIS A ND1   
1645 C CD2   . HIS A 240 ? 1.7248 0.7452 1.5433 0.1415  -0.3116 -0.4518 220 HIS A CD2   
1646 C CE1   . HIS A 240 ? 1.7567 0.8238 1.5864 0.1247  -0.3393 -0.5146 220 HIS A CE1   
1647 N NE2   . HIS A 240 ? 1.7886 0.8044 1.6012 0.1505  -0.3294 -0.4958 220 HIS A NE2   
1648 N N     . ILE A 241 ? 1.3386 0.6451 1.1707 0.1103  -0.2537 -0.3441 221 ILE A N     
1649 C CA    . ILE A 241 ? 1.2543 0.6238 1.1104 0.0850  -0.2336 -0.3030 221 ILE A CA    
1650 C C     . ILE A 241 ? 1.2066 0.6562 1.0582 0.0859  -0.2361 -0.3151 221 ILE A C     
1651 O O     . ILE A 241 ? 1.1867 0.6755 1.0036 0.1211  -0.2307 -0.3216 221 ILE A O     
1652 C CB    . ILE A 241 ? 1.2041 0.5922 1.0462 0.1079  -0.2088 -0.2639 221 ILE A CB    
1653 C CG1   . ILE A 241 ? 1.2659 0.5726 1.1055 0.1145  -0.2079 -0.2503 221 ILE A CG1   
1654 C CG2   . ILE A 241 ? 1.1160 0.5669 0.9842 0.0815  -0.1905 -0.2264 221 ILE A CG2   
1655 C CD1   . ILE A 241 ? 1.2298 0.5566 1.0552 0.1411  -0.1869 -0.2154 221 ILE A CD1   
1656 N N     . PRO A 242 ? 1.1959 0.6711 1.0828 0.0476  -0.2439 -0.3170 222 PRO A N     
1657 C CA    . PRO A 242 ? 1.1571 0.7032 1.0409 0.0486  -0.2501 -0.3286 222 PRO A CA    
1658 C C     . PRO A 242 ? 1.0777 0.6868 0.9511 0.0616  -0.2271 -0.2938 222 PRO A C     
1659 O O     . PRO A 242 ? 1.0401 0.6583 0.9352 0.0459  -0.2090 -0.2585 222 PRO A O     
1660 C CB    . PRO A 242 ? 1.1560 0.7113 1.0899 0.0020  -0.2614 -0.3333 222 PRO A CB    
1661 C CG    . PRO A 242 ? 1.1680 0.6791 1.1317 -0.0264 -0.2476 -0.3030 222 PRO A CG    
1662 C CD    . PRO A 242 ? 1.2217 0.6620 1.1546 0.0012  -0.2463 -0.3060 222 PRO A CD    
1663 N N     . VAL A 243 ? 1.0576 0.7087 0.8970 0.0899  -0.2280 -0.3039 223 VAL A N     
1664 C CA    . VAL A 243 ? 0.9903 0.6964 0.8199 0.1012  -0.2072 -0.2731 223 VAL A CA    
1665 C C     . VAL A 243 ? 0.9679 0.7252 0.7888 0.1031  -0.2163 -0.2806 223 VAL A C     
1666 O O     . VAL A 243 ? 1.0077 0.7676 0.7994 0.1213  -0.2330 -0.3102 223 VAL A O     
1667 C CB    . VAL A 243 ? 0.9901 0.6978 0.7814 0.1388  -0.1915 -0.2674 223 VAL A CB    
1668 C CG1   . VAL A 243 ? 0.9233 0.6870 0.7108 0.1447  -0.1701 -0.2363 223 VAL A CG1   
1669 C CG2   . VAL A 243 ? 1.0159 0.6738 0.8130 0.1434  -0.1844 -0.2599 223 VAL A CG2   
1670 N N     . LEU A 244 ? 0.9103 0.7076 0.7542 0.0872  -0.2065 -0.2544 224 LEU A N     
1671 C CA    . LEU A 244 ? 0.8956 0.7382 0.7308 0.0919  -0.2146 -0.2561 224 LEU A CA    
1672 C C     . LEU A 244 ? 0.8596 0.7351 0.6809 0.1049  -0.1928 -0.2239 224 LEU A C     
1673 O O     . LEU A 244 ? 0.8134 0.6968 0.6605 0.0918  -0.1762 -0.1980 224 LEU A O     
1674 C CB    . LEU A 244 ? 0.8721 0.7341 0.7521 0.0610  -0.2277 -0.2602 224 LEU A CB    
1675 C CG    . LEU A 244 ? 0.8618 0.7691 0.7356 0.0683  -0.2410 -0.2652 224 LEU A CG    
1676 C CD1   . LEU A 244 ? 0.9173 0.8229 0.7530 0.0911  -0.2634 -0.2985 224 LEU A CD1   
1677 C CD2   . LEU A 244 ? 0.8361 0.7707 0.7616 0.0385  -0.2507 -0.2678 224 LEU A CD2   
1678 N N     . ILE A 245 ? 0.8820 0.7769 0.6621 0.1302  -0.1929 -0.2256 225 ILE A N     
1679 C CA    . ILE A 245 ? 0.8584 0.7802 0.6247 0.1405  -0.1718 -0.1949 225 ILE A CA    
1680 C C     . ILE A 245 ? 0.8579 0.8073 0.6106 0.1458  -0.1808 -0.1888 225 ILE A C     
1681 O O     . ILE A 245 ? 0.8992 0.8526 0.6205 0.1617  -0.1984 -0.2086 225 ILE A O     
1682 C CB    . ILE A 245 ? 0.8868 0.8077 0.6124 0.1676  -0.1557 -0.1928 225 ILE A CB    
1683 C CG1   . ILE A 245 ? 0.8992 0.7901 0.6350 0.1690  -0.1499 -0.2015 225 ILE A CG1   
1684 C CG2   . ILE A 245 ? 0.8584 0.8081 0.5786 0.1713  -0.1316 -0.1595 225 ILE A CG2   
1685 C CD1   . ILE A 245 ? 0.9289 0.8250 0.6284 0.1988  -0.1352 -0.2043 225 ILE A CD1   
1686 N N     . SER A 246 ? 0.8126 0.7797 0.5873 0.1350  -0.1703 -0.1625 226 SER A N     
1687 C CA    . SER A 246 ? 0.8169 0.8034 0.5786 0.1425  -0.1779 -0.1523 226 SER A CA    
1688 C C     . SER A 246 ? 0.8131 0.8063 0.5493 0.1542  -0.1554 -0.1217 226 SER A C     
1689 O O     . SER A 246 ? 0.7848 0.7789 0.5402 0.1449  -0.1341 -0.1041 226 SER A O     
1690 C CB    . SER A 246 ? 0.7837 0.7840 0.5920 0.1223  -0.1867 -0.1493 226 SER A CB    
1691 O OG    . SER A 246 ? 0.7481 0.7503 0.5888 0.1069  -0.1671 -0.1291 226 SER A OG    
1692 N N     . ASN A 247 ? 0.8439 0.8432 0.5371 0.1739  -0.1603 -0.1151 227 ASN A N     
1693 C CA    . ASN A 247 ? 0.8490 0.8526 0.5148 0.1830  -0.1378 -0.0833 227 ASN A CA    
1694 C C     . ASN A 247 ? 0.8900 0.8961 0.5110 0.2030  -0.1490 -0.0730 227 ASN A C     
1695 O O     . ASN A 247 ? 0.9058 0.9153 0.5154 0.2135  -0.1759 -0.0949 227 ASN A O     
1696 C CB    . ASN A 247 ? 0.8669 0.8744 0.5070 0.1937  -0.1170 -0.0833 227 ASN A CB    
1697 C CG    . ASN A 247 ? 0.8606 0.8784 0.5029 0.1883  -0.0865 -0.0501 227 ASN A CG    
1698 O OD1   . ASN A 247 ? 0.8710 0.8877 0.5100 0.1843  -0.0810 -0.0239 227 ASN A OD1   
1699 N ND2   . ASN A 247 ? 0.8508 0.8783 0.5011 0.1881  -0.0673 -0.0520 227 ASN A ND2   
1700 N N     . HIS A 248 ? 0.9147 0.9199 0.5113 0.2080  -0.1287 -0.0390 228 HIS A N     
1701 C CA    . HIS A 248 ? 0.9829 0.9858 0.5274 0.2300  -0.1358 -0.0219 228 HIS A CA    
1702 C C     . HIS A 248 ? 1.0421 1.0577 0.5295 0.2570  -0.1440 -0.0413 228 HIS A C     
1703 O O     . HIS A 248 ? 1.0396 1.0637 0.5214 0.2593  -0.1331 -0.0572 228 HIS A O     
1704 C CB    . HIS A 248 ? 1.0083 1.0033 0.5387 0.2257  -0.1074 0.0222  228 HIS A CB    
1705 C CG    . HIS A 248 ? 0.9848 0.9618 0.5589 0.2067  -0.1071 0.0407  228 HIS A CG    
1706 N ND1   . HIS A 248 ? 0.9723 0.9426 0.5722 0.2069  -0.1345 0.0266  228 HIS A ND1   
1707 C CD2   . HIS A 248 ? 0.9710 0.9379 0.5699 0.1878  -0.0838 0.0690  228 HIS A CD2   
1708 C CE1   . HIS A 248 ? 0.9510 0.9058 0.5861 0.1918  -0.1283 0.0447  228 HIS A CE1   
1709 N NE2   . HIS A 248 ? 0.9517 0.9018 0.5876 0.1788  -0.0984 0.0701  228 HIS A NE2   
1710 N N     . ASP A 249 ? 1.1471 1.3482 0.6099 0.4769  -0.1555 -0.1273 229 ASP A N     
1711 C CA    . ASP A 249 ? 1.2253 1.3830 0.6176 0.4924  -0.1760 -0.1385 229 ASP A CA    
1712 C C     . ASP A 249 ? 1.2568 1.3994 0.5989 0.5227  -0.1579 -0.1273 229 ASP A C     
1713 O O     . ASP A 249 ? 1.2676 1.4196 0.6012 0.5344  -0.1650 -0.1196 229 ASP A O     
1714 C CB    . ASP A 249 ? 1.2539 1.4168 0.6506 0.4827  -0.2146 -0.1492 229 ASP A CB    
1715 C CG    . ASP A 249 ? 1.3355 1.4539 0.6587 0.4959  -0.2380 -0.1633 229 ASP A CG    
1716 O OD1   . ASP A 249 ? 1.3738 1.4528 0.6513 0.5029  -0.2283 -0.1701 229 ASP A OD1   
1717 O OD2   . ASP A 249 ? 1.3619 1.4848 0.6730 0.4996  -0.2663 -0.1680 229 ASP A OD2   
1718 N N     . THR A 250 ? 1.2733 1.3910 0.5898 0.5332  -0.1322 -0.1256 230 THR A N     
1719 C CA    . THR A 250 ? 1.3022 1.4004 0.5954 0.5523  -0.1083 -0.1141 230 THR A CA    
1720 C C     . THR A 250 ? 1.3657 1.4111 0.6105 0.5587  -0.1107 -0.1225 230 THR A C     
1721 O O     . THR A 250 ? 1.3970 1.4196 0.6226 0.5490  -0.1324 -0.1377 230 THR A O     
1722 C CB    . THR A 250 ? 1.2542 1.3777 0.5838 0.5554  -0.0694 -0.0998 230 THR A CB    
1723 O OG1   . THR A 250 ? 1.2457 1.3610 0.5849 0.5482  -0.0589 -0.1046 230 THR A OG1   
1724 C CG2   . THR A 250 ? 1.1935 1.3701 0.5715 0.5478  -0.0635 -0.0919 230 THR A CG2   
1725 N N     . MET A 251 ? 1.3841 1.4096 0.6102 0.5739  -0.0879 -0.1127 231 MET A N     
1726 C CA    . MET A 251 ? 1.4336 1.4106 0.6155 0.5808  -0.0870 -0.1188 231 MET A CA    
1727 C C     . MET A 251 ? 1.4151 1.3854 0.6097 0.5751  -0.0733 -0.1216 231 MET A C     
1728 O O     . MET A 251 ? 1.4593 1.3931 0.6219 0.5735  -0.0831 -0.1329 231 MET A O     
1729 C CB    . MET A 251 ? 1.4556 1.4149 0.6164 0.5976  -0.0670 -0.1068 231 MET A CB    
1730 N N     . LEU A 252 ? 1.3523 1.3580 0.5943 0.5715  -0.0508 -0.1111 232 LEU A N     
1731 C CA    . LEU A 252 ? 1.3285 1.3329 0.5879 0.5668  -0.0372 -0.1111 232 LEU A CA    
1732 C C     . LEU A 252 ? 1.3173 1.3186 0.5773 0.5540  -0.0555 -0.1251 232 LEU A C     
1733 O O     . LEU A 252 ? 1.3424 1.3163 0.5865 0.5534  -0.0547 -0.1313 232 LEU A O     
1734 C CB    . LEU A 252 ? 1.2711 1.3184 0.5857 0.5624  -0.0112 -0.0959 232 LEU A CB    
1735 C CG    . LEU A 252 ? 1.2747 1.3239 0.5957 0.5695  0.0109  -0.0814 232 LEU A CG    
1736 C CD1   . LEU A 252 ? 1.2717 1.3361 0.5951 0.5735  0.0113  -0.0743 232 LEU A CD1   
1737 C CD2   . LEU A 252 ? 1.2226 1.3019 0.5932 0.5584  0.0326  -0.0706 232 LEU A CD2   
1738 N N     . THR A 253 ? 1.2817 1.3100 0.5596 0.5432  -0.0720 -0.1298 233 THR A N     
1739 C CA    . THR A 253 ? 1.2680 1.2962 0.5510 0.5276  -0.0897 -0.1433 233 THR A CA    
1740 C C     . THR A 253 ? 1.3324 1.3146 0.5675 0.5236  -0.1166 -0.1605 233 THR A C     
1741 O O     . THR A 253 ? 1.3461 1.3075 0.5720 0.5138  -0.1243 -0.1724 233 THR A O     
1742 C CB    . THR A 253 ? 1.2161 1.2903 0.5364 0.5150  -0.1013 -0.1434 233 THR A CB    
1743 O OG1   . THR A 253 ? 1.2362 1.3134 0.5429 0.5179  -0.1219 -0.1441 233 THR A OG1   
1744 C CG2   . THR A 253 ? 1.1496 1.2698 0.5197 0.5159  -0.0722 -0.1278 233 THR A CG2   
1745 N N     . ARG A 254 ? 1.3761 1.3409 0.5802 0.5308  -0.1300 -0.1622 234 ARG A N     
1746 C CA    . ARG A 254 ? 1.4463 1.3684 0.6054 0.5262  -0.1547 -0.1789 234 ARG A CA    
1747 C C     . ARG A 254 ? 1.4889 1.3648 0.6115 0.5356  -0.1399 -0.1804 234 ARG A C     
1748 O O     . ARG A 254 ? 1.5416 1.3782 0.6277 0.5300  -0.1551 -0.1953 234 ARG A O     
1749 C CB    . ARG A 254 ? 1.4841 1.4050 0.6228 0.5308  -0.1745 -0.1798 234 ARG A CB    
1750 C CG    . ARG A 254 ? 1.4793 1.4284 0.6397 0.5152  -0.2064 -0.1893 234 ARG A CG    
1751 C CD    . ARG A 254 ? 1.5322 1.4723 0.6658 0.5199  -0.2298 -0.1930 234 ARG A CD    
1752 N NE    . ARG A 254 ? 1.5360 1.4993 0.6910 0.5025  -0.2650 -0.2063 234 ARG A NE    
1753 C CZ    . ARG A 254 ? 1.5807 1.5428 0.7203 0.5025  -0.2917 -0.2127 234 ARG A CZ    
1754 N NH1   . ARG A 254 ? 1.6271 1.5626 0.7244 0.5196  -0.2869 -0.2066 234 ARG A NH1   
1755 N NH2   . ARG A 254 ? 1.5775 1.5659 0.7459 0.4851  -0.3233 -0.2257 234 ARG A NH2   
1756 N N     . GLU A 255 ? 1.4672 1.3495 0.6025 0.5490  -0.1104 -0.1653 235 GLU A N     
1757 C CA    . GLU A 255 ? 1.5015 1.3461 0.6102 0.5586  -0.0951 -0.1647 235 GLU A CA    
1758 C C     . GLU A 255 ? 1.4814 1.3241 0.6071 0.5530  -0.0857 -0.1666 235 GLU A C     
1759 O O     . GLU A 255 ? 1.5253 1.3273 0.6199 0.5537  -0.0870 -0.1750 235 GLU A O     
1760 C CB    . GLU A 255 ? 1.4900 1.3426 0.6060 0.5743  -0.0699 -0.1482 235 GLU A CB    
1761 N N     . TRP A 256 ? 1.4183 1.3044 0.5924 0.5478  -0.0756 -0.1583 236 TRP A N     
1762 C CA    . TRP A 256 ? 1.3983 1.2869 0.5914 0.5425  -0.0669 -0.1588 236 TRP A CA    
1763 C C     . TRP A 256 ? 1.4317 1.2914 0.6014 0.5282  -0.0883 -0.1773 236 TRP A C     
1764 O O     . TRP A 256 ? 1.4571 1.2838 0.6084 0.5285  -0.0843 -0.1826 236 TRP A O     
1765 C CB    . TRP A 256 ? 1.3262 1.2703 0.5766 0.5369  -0.0541 -0.1474 236 TRP A CB    
1766 C CG    . TRP A 256 ? 1.2939 1.2667 0.5735 0.5467  -0.0310 -0.1297 236 TRP A CG    
1767 C CD1   . TRP A 256 ? 1.3158 1.2706 0.5827 0.5591  -0.0167 -0.1225 236 TRP A CD1   
1768 C CD2   . TRP A 256 ? 1.2337 1.2577 0.5611 0.5420  -0.0200 -0.1179 236 TRP A CD2   
1769 N NE1   . TRP A 256 ? 1.2732 1.2644 0.5773 0.5604  0.0013  -0.1075 236 TRP A NE1   
1770 C CE2   . TRP A 256 ? 1.2232 1.2559 0.5646 0.5498  0.0002  -0.1041 236 TRP A CE2   
1771 C CE3   . TRP A 256 ? 1.1899 1.2529 0.5500 0.5305  -0.0250 -0.1179 236 TRP A CE3   
1772 C CZ2   . TRP A 256 ? 1.1707 1.2465 0.5567 0.5440  0.0151  -0.0906 236 TRP A CZ2   
1773 C CZ3   . TRP A 256 ? 1.1356 1.2426 0.5404 0.5277  -0.0083 -0.1037 236 TRP A CZ3   
1774 C CH2   . TRP A 256 ? 1.1280 1.2394 0.5451 0.5332  0.0112  -0.0901 236 TRP A CH2   
1775 N N     . TYR A 257 ? 1.4311 1.3033 0.6025 0.5153  -0.1114 -0.1871 237 TYR A N     
1776 C CA    . TYR A 257 ? 1.4583 1.3091 0.6154 0.4972  -0.1340 -0.2067 237 TYR A CA    
1777 C C     . TYR A 257 ? 1.5323 1.3410 0.6420 0.4941  -0.1555 -0.2221 237 TYR A C     
1778 O O     . TYR A 257 ? 1.5535 1.3612 0.6597 0.4775  -0.1821 -0.2384 237 TYR A O     
1779 C CB    . TYR A 257 ? 1.4088 1.3050 0.6113 0.4791  -0.1483 -0.2084 237 TYR A CB    
1780 C CG    . TYR A 257 ? 1.3371 1.2818 0.5966 0.4784  -0.1262 -0.1906 237 TYR A CG    
1781 C CD1   . TYR A 257 ? 1.2860 1.2815 0.5961 0.4693  -0.1290 -0.1811 237 TYR A CD1   
1782 C CD2   . TYR A 257 ? 1.3222 1.2622 0.5847 0.4871  -0.1026 -0.1839 237 TYR A CD2   
1783 C CE1   . TYR A 257 ? 1.2231 1.2624 0.5846 0.4670  -0.1077 -0.1662 237 TYR A CE1   
1784 C CE2   . TYR A 257 ? 1.2577 1.2441 0.5717 0.4857  -0.0833 -0.1693 237 TYR A CE2   
1785 C CZ    . TYR A 257 ? 1.2104 1.2459 0.5736 0.4746  -0.0854 -0.1609 237 TYR A CZ    
1786 O OH    . TYR A 257 ? 1.1520 1.2332 0.5658 0.4716  -0.0651 -0.1476 237 TYR A OH    
1787 N N     . GLN A 258 ? 1.5707 1.3469 0.6467 0.5092  -0.1442 -0.2177 238 GLN A N     
1788 C CA    . GLN A 258 ? 1.6355 1.3724 0.6646 0.5078  -0.1615 -0.2310 238 GLN A CA    
1789 C C     . GLN A 258 ? 1.6762 1.3713 0.6784 0.4912  -0.1756 -0.2525 238 GLN A C     
1790 O O     . GLN A 258 ? 1.7159 1.3953 0.6959 0.4788  -0.2001 -0.2696 238 GLN A O     
1791 C CB    . GLN A 258 ? 1.6717 1.3825 0.6720 0.5276  -0.1427 -0.2210 238 GLN A CB    
1792 C CG    . GLN A 258 ? 1.7536 1.4216 0.7021 0.5270  -0.1576 -0.2341 238 GLN A CG    
1793 C CD    . GLN A 258 ? 1.7901 1.4340 0.7119 0.5463  -0.1380 -0.2239 238 GLN A CD    
1794 O OE1   . GLN A 258 ? 1.7581 1.4260 0.7033 0.5601  -0.1175 -0.2065 238 GLN A OE1   
1795 N NE2   . GLN A 258 ? 1.8572 1.4536 0.7307 0.5459  -0.1438 -0.2359 238 GLN A NE2   
1796 N N     . ARG A 259 ? 1.6674 1.3448 0.6726 0.4907  -0.1597 -0.2521 239 ARG A N     
1797 C CA    . ARG A 259 ? 1.7164 1.3468 0.6938 0.4759  -0.1674 -0.2717 239 ARG A CA    
1798 C C     . ARG A 259 ? 1.6973 1.3432 0.7006 0.4524  -0.1843 -0.2862 239 ARG A C     
1799 O O     . ARG A 259 ? 1.7283 1.3390 0.7195 0.4396  -0.1833 -0.2998 239 ARG A O     
1800 C CB    . ARG A 259 ? 1.7271 1.3248 0.6915 0.4880  -0.1415 -0.2639 239 ARG A CB    
1801 N N     . ALA A 260 ? 1.6467 1.3435 0.6860 0.4463  -0.1989 -0.2837 240 ALA A N     
1802 C CA    . ALA A 260 ? 1.6070 1.3318 0.7041 0.4153  -0.2116 -0.2891 240 ALA A CA    
1803 C C     . ALA A 260 ? 1.6269 1.3700 0.7324 0.3992  -0.2436 -0.3038 240 ALA A C     
1804 O O     . ALA A 260 ? 1.6414 1.3955 0.7231 0.4153  -0.2546 -0.3016 240 ALA A O     
1805 C CB    . ALA A 260 ? 1.5224 1.3012 0.6820 0.4149  -0.1964 -0.2677 240 ALA A CB    
1806 N N     . LYS A 261 ? 1.6297 1.3758 0.7686 0.3679  -0.2582 -0.3193 241 LYS A N     
1807 C CA    . LYS A 261 ? 1.6390 1.4118 0.7985 0.3505  -0.2897 -0.3342 241 LYS A CA    
1808 C C     . LYS A 261 ? 1.5700 1.4085 0.7888 0.3519  -0.2929 -0.3164 241 LYS A C     
1809 O O     . LYS A 261 ? 1.5141 1.3831 0.7934 0.3338  -0.2858 -0.3101 241 LYS A O     
1810 C CB    . LYS A 261 ? 1.6566 1.4147 0.8392 0.3151  -0.3015 -0.3576 241 LYS A CB    
1811 N N     . LEU A 262 ? 1.5730 1.4301 0.7720 0.3735  -0.3021 -0.3082 242 LEU A N     
1812 C CA    . LEU A 262 ? 1.5091 1.4226 0.7552 0.3807  -0.2997 -0.2883 242 LEU A CA    
1813 C C     . LEU A 262 ? 1.5040 1.4591 0.7973 0.3613  -0.3289 -0.2976 242 LEU A C     
1814 O O     . LEU A 262 ? 1.5572 1.5016 0.8273 0.3549  -0.3570 -0.3176 242 LEU A O     
1815 C CB    . LEU A 262 ? 1.5153 1.4265 0.7164 0.4145  -0.2924 -0.2738 242 LEU A CB    
1816 C CG    . LEU A 262 ? 1.5291 1.4030 0.6842 0.4367  -0.2632 -0.2650 242 LEU A CG    
1817 C CD1   . LEU A 262 ? 1.5442 1.4181 0.6692 0.4641  -0.2527 -0.2493 242 LEU A CD1   
1818 C CD2   . LEU A 262 ? 1.4705 1.3629 0.6715 0.4321  -0.2351 -0.2501 242 LEU A CD2   
1819 N N     . HIS A 263 ? 1.4429 1.4467 0.8034 0.3521  -0.3217 -0.2837 243 HIS A N     
1820 C CA    . HIS A 263 ? 1.4245 1.4744 0.8370 0.3370  -0.3463 -0.2889 243 HIS A CA    
1821 C C     . HIS A 263 ? 1.3715 1.4682 0.8190 0.3522  -0.3356 -0.2641 243 HIS A C     
1822 O O     . HIS A 263 ? 1.3193 1.4288 0.7931 0.3547  -0.3069 -0.2462 243 HIS A O     
1823 C CB    . HIS A 263 ? 1.4036 1.4653 0.8749 0.3009  -0.3492 -0.3024 243 HIS A CB    
1824 C CG    . HIS A 263 ? 1.4697 1.4852 0.9104 0.2827  -0.3586 -0.3286 243 HIS A CG    
1825 N ND1   . HIS A 263 ? 1.4900 1.4597 0.9033 0.2801  -0.3356 -0.3295 243 HIS A ND1   
1826 C CD2   . HIS A 263 ? 1.5207 1.5286 0.9540 0.2661  -0.3878 -0.3556 243 HIS A CD2   
1827 C CE1   . HIS A 263 ? 1.5481 1.4803 0.9368 0.2624  -0.3483 -0.3554 243 HIS A CE1   
1828 N NE2   . HIS A 263 ? 1.5670 1.5226 0.9681 0.2525  -0.3799 -0.3725 243 HIS A NE2   
1829 N N     . VAL A 264 ? 1.3910 1.5124 0.8376 0.3629  -0.3584 -0.2633 244 VAL A N     
1830 C CA    . VAL A 264 ? 1.3604 1.5216 0.8343 0.3793  -0.3482 -0.2400 244 VAL A CA    
1831 C C     . VAL A 264 ? 1.3339 1.5472 0.8847 0.3595  -0.3620 -0.2405 244 VAL A C     
1832 O O     . VAL A 264 ? 1.3656 1.5909 0.9284 0.3480  -0.3940 -0.2583 244 VAL A O     
1833 C CB    . VAL A 264 ? 1.3987 1.5496 0.8139 0.4105  -0.3602 -0.2341 244 VAL A CB    
1834 C CG1   . VAL A 264 ? 1.3547 1.5427 0.7968 0.4275  -0.3461 -0.2094 244 VAL A CG1   
1835 C CG2   . VAL A 264 ? 1.4421 1.5408 0.7812 0.4302  -0.3451 -0.2342 244 VAL A CG2   
1836 N N     . VAL A 265 ? 1.2830 1.5285 0.8871 0.3551  -0.3371 -0.2220 245 VAL A N     
1837 C CA    . VAL A 265 ? 1.2520 1.5480 0.9308 0.3386  -0.3455 -0.2195 245 VAL A CA    
1838 C C     . VAL A 265 ? 1.2408 1.5670 0.9289 0.3620  -0.3367 -0.1964 245 VAL A C     
1839 O O     . VAL A 265 ? 1.2208 1.5430 0.8958 0.3777  -0.3062 -0.1774 245 VAL A O     
1840 C CB    . VAL A 265 ? 1.1965 1.5072 0.9364 0.3102  -0.3238 -0.2181 245 VAL A CB    
1841 C CG1   . VAL A 265 ? 1.2231 1.5129 0.9700 0.2816  -0.3388 -0.2437 245 VAL A CG1   
1842 C CG2   . VAL A 265 ? 1.1765 1.4710 0.8988 0.3205  -0.2868 -0.2012 245 VAL A CG2   
1843 N N     . LYS A 266 ? 0.8773 1.3076 0.8483 0.1708  -0.1298 -0.1593 246 LYS A N     
1844 C CA    . LYS A 266 ? 0.8723 1.3309 0.8608 0.1980  -0.1092 -0.1307 246 LYS A CA    
1845 C C     . LYS A 266 ? 0.9090 1.3079 0.8833 0.1719  -0.0954 -0.1193 246 LYS A C     
1846 O O     . LYS A 266 ? 0.9240 1.3117 0.8833 0.1568  -0.0815 -0.1353 246 LYS A O     
1847 C CB    . LYS A 266 ? 0.8517 1.3894 0.8547 0.2364  -0.0971 -0.1405 246 LYS A CB    
1848 N N     . VAL A 267 ? 0.9302 1.2909 0.9147 0.1682  -0.0994 -0.0937 247 VAL A N     
1849 C CA    . VAL A 267 ? 0.9794 1.2780 0.9500 0.1475  -0.0928 -0.0864 247 VAL A CA    
1850 C C     . VAL A 267 ? 0.9820 1.3070 0.9944 0.1736  -0.0705 -0.0570 247 VAL A C     
1851 O O     . VAL A 267 ? 0.9854 1.3377 0.9983 0.1885  -0.0464 -0.0561 247 VAL A O     
1852 C CB    . VAL A 267 ? 1.0198 1.2390 0.9727 0.1196  -0.1231 -0.0865 247 VAL A CB    
1853 N N     . LYS A 279 ? 0.9642 1.3480 1.6108 0.2912  0.0933  0.2451  259 LYS A N     
1854 C CA    . LYS A 279 ? 0.9537 1.3930 1.5081 0.3259  0.1029  0.2405  259 LYS A CA    
1855 C C     . LYS A 279 ? 0.9467 1.3711 1.4007 0.3016  0.0551  0.1858  259 LYS A C     
1856 O O     . LYS A 279 ? 0.9542 1.3239 1.4053 0.2585  0.0127  0.1531  259 LYS A O     
1857 C CB    . LYS A 279 ? 0.9440 1.4196 1.5368 0.3430  0.1117  0.2552  259 LYS A CB    
1858 N N     . LYS A 280 ? 0.9396 1.4105 1.3125 0.3319  0.0626  0.1759  260 LYS A N     
1859 C CA    . LYS A 280 ? 0.9244 1.3874 1.2155 0.3108  0.0257  0.1268  260 LYS A CA    
1860 C C     . LYS A 280 ? 0.9082 1.3729 1.1836 0.2962  -0.0082 0.1006  260 LYS A C     
1861 O O     . LYS A 280 ? 0.9053 1.4195 1.1572 0.3281  -0.0014 0.1004  260 LYS A O     
1862 C CB    . LYS A 280 ? 0.9256 1.4396 1.1536 0.3488  0.0435  0.1221  260 LYS A CB    
1863 N N     . VAL A 281 ? 0.9048 1.3110 1.1882 0.2518  -0.0468 0.0774  261 VAL A N     
1864 C CA    . VAL A 281 ? 0.8891 1.2858 1.1591 0.2366  -0.0819 0.0538  261 VAL A CA    
1865 C C     . VAL A 281 ? 0.8856 1.2553 1.0720 0.2120  -0.1101 0.0119  261 VAL A C     
1866 O O     . VAL A 281 ? 0.9082 1.2276 1.0617 0.1851  -0.1201 -0.0035 261 VAL A O     
1867 C CB    . VAL A 281 ? 0.8958 1.2432 1.2325 0.2088  -0.1110 0.0565  261 VAL A CB    
1868 C CG1   . VAL A 281 ? 0.9219 1.2049 1.2634 0.1791  -0.1263 0.0487  261 VAL A CG1   
1869 C CG2   . VAL A 281 ? 0.8980 1.2212 1.2058 0.1905  -0.1547 0.0276  261 VAL A CG2   
1870 N N     . ASP A 282 ? 0.8618 1.2628 1.0160 0.2232  -0.1193 -0.0062 262 ASP A N     
1871 C CA    . ASP A 282 ? 0.8590 1.2348 0.9488 0.1992  -0.1415 -0.0438 262 ASP A CA    
1872 C C     . ASP A 282 ? 0.8712 1.1896 0.9507 0.1701  -0.1802 -0.0593 262 ASP A C     
1873 O O     . ASP A 282 ? 0.8669 1.1800 0.9949 0.1737  -0.1931 -0.0450 262 ASP A O     
1874 C CB    . ASP A 282 ? 0.8415 1.2811 0.9077 0.2277  -0.1333 -0.0604 262 ASP A CB    
1875 N N     . GLU A 283 ? 0.8917 1.1658 0.9117 0.1432  -0.1967 -0.0870 263 GLU A N     
1876 C CA    . GLU A 283 ? 0.9220 1.1328 0.9166 0.1193  -0.2333 -0.1006 263 GLU A CA    
1877 C C     . GLU A 283 ? 0.9020 1.1374 0.8856 0.1266  -0.2426 -0.1191 263 GLU A C     
1878 O O     . GLU A 283 ? 0.8813 1.1645 0.8565 0.1387  -0.2252 -0.1332 263 GLU A O     
1879 C CB    . GLU A 283 ? 0.9839 1.1121 0.9098 0.0868  -0.2425 -0.1147 263 GLU A CB    
1880 C CG    . GLU A 283 ? 1.0269 1.1003 0.9553 0.0763  -0.2555 -0.1045 263 GLU A CG    
1881 C CD    . GLU A 283 ? 1.1033 1.0828 0.9773 0.0554  -0.2977 -0.1166 263 GLU A CD    
1882 O OE1   . GLU A 283 ? 1.1297 1.0855 0.9648 0.0486  -0.3120 -0.1278 263 GLU A OE1   
1883 O OE2   . GLU A 283 ? 1.1429 1.0686 1.0112 0.0483  -0.3188 -0.1160 263 GLU A OE2   
1884 N N     . LEU A 284 ? 0.9100 1.1115 0.8985 0.1208  -0.2739 -0.1220 264 LEU A N     
1885 C CA    . LEU A 284 ? 0.9010 1.1171 0.8831 0.1280  -0.2861 -0.1404 264 LEU A CA    
1886 C C     . LEU A 284 ? 0.9449 1.0760 0.8717 0.0979  -0.3136 -0.1562 264 LEU A C     
1887 O O     . LEU A 284 ? 0.9842 1.0489 0.8933 0.0835  -0.3399 -0.1488 264 LEU A O     
1888 C CB    . LEU A 284 ? 0.8819 1.1390 0.9229 0.1564  -0.2941 -0.1281 264 LEU A CB    
1889 C CG    . LEU A 284 ? 0.8909 1.1564 0.9281 0.1673  -0.3112 -0.1484 264 LEU A CG    
1890 C CD1   . LEU A 284 ? 0.8807 1.1971 0.8986 0.1828  -0.2938 -0.1717 264 LEU A CD1   
1891 C CD2   . LEU A 284 ? 0.8742 1.1758 0.9732 0.1966  -0.3146 -0.1332 264 LEU A CD2   
1892 N N     . LEU A 285 ? 0.9450 1.0757 0.8458 0.0908  -0.3085 -0.1785 265 LEU A N     
1893 C CA    . LEU A 285 ? 0.9960 1.0440 0.8449 0.0653  -0.3268 -0.1896 265 LEU A CA    
1894 C C     . LEU A 285 ? 0.9980 1.0569 0.8679 0.0770  -0.3470 -0.2042 265 LEU A C     
1895 O O     . LEU A 285 ? 0.9873 1.0898 0.8750 0.0843  -0.3362 -0.2258 265 LEU A O     
1896 C CB    . LEU A 285 ? 1.0188 1.0424 0.8284 0.0417  -0.2990 -0.2022 265 LEU A CB    
1897 C CG    . LEU A 285 ? 1.0691 1.0217 0.8181 0.0200  -0.2868 -0.1901 265 LEU A CG    
1898 C CD1   . LEU A 285 ? 1.0366 1.0222 0.8077 0.0321  -0.2801 -0.1748 265 LEU A CD1   
1899 C CD2   . LEU A 285 ? 1.0935 1.0320 0.8189 -0.0006 -0.2502 -0.2022 265 LEU A CD2   
1900 N N     . ALA A 286 ? 1.0146 1.0333 0.8867 0.0808  -0.3799 -0.1955 266 ALA A N     
1901 C CA    . ALA A 286 ? 1.0120 1.0361 0.9061 0.0949  -0.4010 -0.2082 266 ALA A CA    
1902 C C     . ALA A 286 ? 1.0714 1.0087 0.9110 0.0714  -0.4146 -0.2191 266 ALA A C     
1903 O O     . ALA A 286 ? 1.1298 0.9812 0.9161 0.0557  -0.4331 -0.2067 266 ALA A O     
1904 C CB    . ALA A 286 ? 1.0055 1.0360 0.9437 0.1140  -0.4281 -0.1931 266 ALA A CB    
1905 N N     . LEU A 287 ? 1.0639 1.0197 0.9159 0.0717  -0.4060 -0.2429 267 LEU A N     
1906 C CA    . LEU A 287 ? 1.1278 1.0013 0.9392 0.0483  -0.4105 -0.2517 267 LEU A CA    
1907 C C     . LEU A 287 ? 1.1442 1.0064 0.9787 0.0638  -0.4391 -0.2651 267 LEU A C     
1908 O O     . LEU A 287 ? 1.1087 1.0379 0.9929 0.0841  -0.4384 -0.2891 267 LEU A O     
1909 C CB    . LEU A 287 ? 1.1247 1.0150 0.9436 0.0290  -0.3765 -0.2714 267 LEU A CB    
1910 C CG    . LEU A 287 ? 1.1961 1.0006 0.9860 0.0012  -0.3687 -0.2774 267 LEU A CG    
1911 C CD1   . LEU A 287 ? 1.2761 0.9700 0.9786 -0.0163 -0.3688 -0.2466 267 LEU A CD1   
1912 C CD2   . LEU A 287 ? 1.1855 1.0218 1.0112 -0.0181 -0.3328 -0.2992 267 LEU A CD2   
1913 N N     . TYR A 288 ? 1.2094 0.9833 1.0022 0.0581  -0.4663 -0.2511 268 TYR A N     
1914 C CA    . TYR A 288 ? 1.2401 0.9874 1.0491 0.0714  -0.4941 -0.2622 268 TYR A CA    
1915 C C     . TYR A 288 ? 1.3154 0.9798 1.0871 0.0466  -0.4843 -0.2696 268 TYR A C     
1916 O O     . TYR A 288 ? 1.3999 0.9617 1.1045 0.0343  -0.4946 -0.2492 268 TYR A O     
1917 C CB    . TYR A 288 ? 1.2709 0.9744 1.0679 0.0861  -0.5354 -0.2427 268 TYR A CB    
1918 C CG    . TYR A 288 ? 1.2057 0.9908 1.0647 0.1111  -0.5440 -0.2352 268 TYR A CG    
1919 C CD1   . TYR A 288 ? 1.1906 0.9829 1.0417 0.1045  -0.5406 -0.2166 268 TYR A CD1   
1920 C CD2   . TYR A 288 ? 1.1652 1.0166 1.0940 0.1425  -0.5520 -0.2461 268 TYR A CD2   
1921 C CE1   . TYR A 288 ? 1.1325 0.9958 1.0535 0.1252  -0.5435 -0.2071 268 TYR A CE1   
1922 C CE2   . TYR A 288 ? 1.1108 1.0342 1.1032 0.1658  -0.5503 -0.2342 268 TYR A CE2   
1923 C CZ    . TYR A 288 ? 1.0934 1.0224 1.0868 0.1554  -0.5454 -0.2137 268 TYR A CZ    
1924 O OH    . TYR A 288 ? 1.0432 1.0408 1.1127 0.1765  -0.5390 -0.1993 268 TYR A OH    
1925 N N     . LYS A 289 ? 1.2941 1.0002 1.1105 0.0415  -0.4646 -0.2989 269 LYS A N     
1926 C CA    . LYS A 289 ? 1.3637 0.9980 1.1688 0.0151  -0.4491 -0.3079 269 LYS A CA    
1927 C C     . LYS A 289 ? 1.4081 1.0069 1.2345 0.0287  -0.4778 -0.3232 269 LYS A C     
1928 O O     . LYS A 289 ? 1.3613 1.0313 1.2437 0.0564  -0.4960 -0.3503 269 LYS A O     
1929 C CB    . LYS A 289 ? 1.3239 1.0197 1.1829 -0.0003 -0.4166 -0.3370 269 LYS A CB    
1930 N N     . PRO A 290 ? 1.5065 0.9897 1.2819 0.0128  -0.4800 -0.3045 270 PRO A N     
1931 C CA    . PRO A 290 ? 1.5582 0.9892 1.3475 0.0244  -0.5064 -0.3148 270 PRO A CA    
1932 C C     . PRO A 290 ? 1.5376 1.0145 1.4090 0.0226  -0.4998 -0.3604 270 PRO A C     
1933 O O     . PRO A 290 ? 1.5307 1.0244 1.4346 -0.0033 -0.4676 -0.3767 270 PRO A O     
1934 C CB    . PRO A 290 ? 1.6752 0.9672 1.3838 0.0020  -0.4938 -0.2810 270 PRO A CB    
1935 C CG    . PRO A 290 ? 1.6847 0.9572 1.3192 -0.0067 -0.4794 -0.2491 270 PRO A CG    
1936 C CD    . PRO A 290 ? 1.5825 0.9706 1.2727 -0.0124 -0.4558 -0.2689 270 PRO A CD    
1937 O "O5'" . DT  B 1   ? 0.5648 1.0367 1.4344 -0.0868 0.0348  0.2819  1   DT  F "O5'" 
1938 C "C5'" . DT  B 1   ? 0.5558 1.0683 1.4254 -0.0752 0.0598  0.2937  1   DT  F "C5'" 
1939 C "C4'" . DT  B 1   ? 0.5661 1.0965 1.4481 -0.0877 0.0794  0.3228  1   DT  F "C4'" 
1940 O "O4'" . DT  B 1   ? 0.5630 1.1290 1.4377 -0.0745 0.1081  0.3325  1   DT  F "O4'" 
1941 C "C3'" . DT  B 1   ? 0.5747 1.0715 1.4151 -0.0900 0.0841  0.3290  1   DT  F "C3'" 
1942 O "O3'" . DT  B 1   ? 0.5929 1.1010 1.4589 -0.1075 0.0926  0.3581  1   DT  F "O3'" 
1943 C "C2'" . DT  B 1   ? 0.5693 1.0718 1.3583 -0.0707 0.1080  0.3228  1   DT  F "C2'" 
1944 C "C1'" . DT  B 1   ? 0.5635 1.1127 1.3835 -0.0666 0.1278  0.3345  1   DT  F "C1'" 
1945 N N1    . DT  B 1   ? 0.5444 1.1002 1.3300 -0.0437 0.1479  0.3198  1   DT  F N1    
1946 C C2    . DT  B 1   ? 0.5510 1.1220 1.3100 -0.0379 0.1805  0.3305  1   DT  F C2    
1947 O O2    . DT  B 1   ? 0.5645 1.1462 1.3253 -0.0503 0.1926  0.3524  1   DT  F O2    
1948 N N3    . DT  B 1   ? 0.5464 1.1171 1.2743 -0.0168 0.2006  0.3147  1   DT  F N3    
1949 C C4    . DT  B 1   ? 0.5327 1.0907 1.2540 0.0002  0.1913  0.2919  1   DT  F C4    
1950 O O4    . DT  B 1   ? 0.5362 1.0917 1.2287 0.0196  0.2143  0.2804  1   DT  F O4    
1951 C C5    . DT  B 1   ? 0.5200 1.0649 1.2685 -0.0066 0.1550  0.2825  1   DT  F C5    
1952 C C7    . DT  B 1   ? 0.5076 1.0380 1.2480 0.0109  0.1423  0.2589  1   DT  F C7    
1953 C C6    . DT  B 1   ? 0.5232 1.0670 1.3018 -0.0287 0.1355  0.2957  1   DT  F C6    
1954 P P     . DT  B 2   ? 0.6991 1.1805 1.5310 -0.1118 0.0967  0.3732  2   DT  F P     
1955 O OP1   . DT  B 2   ? 0.7209 1.2027 1.5962 -0.1325 0.0948  0.3991  2   DT  F OP1   
1956 O OP2   . DT  B 2   ? 0.6784 1.1205 1.4709 -0.1018 0.0807  0.3500  2   DT  F OP2   
1957 O "O5'" . DT  B 2   ? 0.6259 1.1322 1.4189 -0.1021 0.1265  0.3848  2   DT  F "O5'" 
1958 C "C5'" . DT  B 2   ? 0.6340 1.1769 1.4516 -0.1072 0.1481  0.4057  2   DT  F "C5'" 
1959 C "C4'" . DT  B 2   ? 0.6488 1.2011 1.4200 -0.1033 0.1740  0.4205  2   DT  F "C4'" 
1960 O "O4'" . DT  B 2   ? 0.6382 1.2004 1.3724 -0.0867 0.1922  0.4025  2   DT  F "O4'" 
1961 C "C3'" . DT  B 2   ? 0.6564 1.1847 1.3891 -0.1064 0.1674  0.4286  2   DT  F "C3'" 
1962 O "O3'" . DT  B 2   ? 0.6894 1.2319 1.4103 -0.1138 0.1855  0.4579  2   DT  F "O3'" 
1963 C "C2'" . DT  B 2   ? 0.6434 1.1600 1.3161 -0.0910 0.1709  0.4013  2   DT  F "C2'" 
1964 C "C1'" . DT  B 2   ? 0.6421 1.1863 1.3131 -0.0823 0.1973  0.3961  2   DT  F "C1'" 
1965 N N1    . DT  B 2   ? 0.6182 1.1502 1.2514 -0.0656 0.2017  0.3640  2   DT  F N1    
1966 C C2    . DT  B 2   ? 0.6306 1.1696 1.2142 -0.0584 0.2302  0.3577  2   DT  F C2    
1967 O O2    . DT  B 2   ? 0.6624 1.2186 1.2289 -0.0651 0.2513  0.3768  2   DT  F O2    
1968 N N3    . DT  B 2   ? 0.6142 1.1368 1.1667 -0.0436 0.2352  0.3275  2   DT  F N3    
1969 C C4    . DT  B 2   ? 0.5927 1.0944 1.1574 -0.0342 0.2142  0.3051  2   DT  F C4    
1970 O O4    . DT  B 2   ? 0.5941 1.0800 1.1276 -0.0202 0.2229  0.2800  2   DT  F O4    
1971 C C5    . DT  B 2   ? 0.5787 1.0757 1.1935 -0.0426 0.1835  0.3129  2   DT  F C5    
1972 C C7    . DT  B 2   ? 0.5565 1.0304 1.1841 -0.0346 0.1594  0.2896  2   DT  F C7    
1973 C C6    . DT  B 2   ? 0.5906 1.1020 1.2373 -0.0584 0.1792  0.3409  2   DT  F C6    
1974 P P     . DT  B 3   ? 0.8656 1.3926 1.5585 -0.1191 0.1791  0.4786  3   DT  F P     
1975 O OP1   . DT  B 3   ? 0.9014 1.4356 1.6037 -0.1273 0.1903  0.5082  3   DT  F OP1   
1976 O OP2   . DT  B 3   ? 0.8449 1.3375 1.5488 -0.1184 0.1502  0.4650  3   DT  F OP2   
1977 O "O5'" . DT  B 3   ? 0.7399 1.2723 1.3596 -0.1091 0.1914  0.4657  3   DT  F "O5'" 
1978 C "C5'" . DT  B 3   ? 0.7504 1.3096 1.3438 -0.1076 0.2217  0.4703  3   DT  F "C5'" 
1979 C "C4'" . DT  B 3   ? 0.7499 1.3072 1.2708 -0.1013 0.2297  0.4525  3   DT  F "C4'" 
1980 O "O4'" . DT  B 3   ? 0.7110 1.2559 1.2193 -0.0896 0.2291  0.4158  3   DT  F "O4'" 
1981 C "C3'" . DT  B 3   ? 0.7539 1.2973 1.2431 -0.1033 0.2089  0.4567  3   DT  F "C3'" 
1982 O "O3'" . DT  B 3   ? 0.7968 1.3590 1.2307 -0.1076 0.2245  0.4691  3   DT  F "O3'" 
1983 C "C2'" . DT  B 3   ? 0.7128 1.2332 1.1835 -0.0938 0.1933  0.4188  3   DT  F "C2'" 
1984 C "C1'" . DT  B 3   ? 0.6963 1.2238 1.1566 -0.0865 0.2168  0.3961  3   DT  F "C1'" 
1985 N N1    . DT  B 3   ? 0.6462 1.1509 1.1128 -0.0752 0.2053  0.3623  3   DT  F N1    
1986 C C2    . DT  B 3   ? 0.6368 1.1372 1.0620 -0.0664 0.2236  0.3342  3   DT  F C2    
1987 O O2    . DT  B 3   ? 0.6658 1.1791 1.0481 -0.0687 0.2493  0.3335  3   DT  F O2    
1988 N N3    . DT  B 3   ? 0.5980 1.0757 1.0316 -0.0552 0.2125  0.3065  3   DT  F N3    
1989 C C4    . DT  B 3   ? 0.5715 1.0318 1.0475 -0.0528 0.1847  0.3029  3   DT  F C4    
1990 O O4    . DT  B 3   ? 0.5524 0.9927 1.0292 -0.0421 0.1772  0.2776  3   DT  F O4    
1991 C C5    . DT  B 3   ? 0.5731 1.0379 1.0903 -0.0642 0.1671  0.3310  3   DT  F C5    
1992 C C7    . DT  B 3   ? 0.5441 0.9874 1.1062 -0.0651 0.1390  0.3274  3   DT  F C7    
1993 C C6    . DT  B 3   ? 0.6089 1.0949 1.1207 -0.0742 0.1787  0.3596  3   DT  F C6    
1994 P P     . DA  B 4   ? 0.9076 1.4741 1.3227 -0.1131 0.2098  0.4981  4   DA  F P     
1995 O OP1   . DA  B 4   ? 0.9450 1.5355 1.3531 -0.1208 0.2313  0.5330  4   DA  F OP1   
1996 O OP2   . DA  B 4   ? 0.8842 1.4260 1.3447 -0.1108 0.1817  0.5026  4   DA  F OP2   
1997 O "O5'" . DA  B 4   ? 0.7865 1.3575 1.1323 -0.1114 0.2062  0.4747  4   DA  F "O5'" 
1998 C "C5'" . DA  B 4   ? 0.8013 1.3870 1.0940 -0.1140 0.2323  0.4572  4   DA  F "C5'" 
1999 C "C4'" . DA  B 4   ? 0.7795 1.3538 1.0301 -0.1108 0.2260  0.4175  4   DA  F "C4'" 
2000 O "O4'" . DA  B 4   ? 0.7322 1.2798 1.0198 -0.1008 0.2178  0.3916  4   DA  F "O4'" 
2001 C "C3'" . DA  B 4   ? 0.7809 1.3580 1.0092 -0.1128 0.1992  0.4197  4   DA  F "C3'" 
2002 O "O3'" . DA  B 4   ? 0.8209 1.4239 0.9827 -0.1226 0.2094  0.4189  4   DA  F "O3'" 
2003 C "C2'" . DA  B 4   ? 0.7413 1.2906 0.9768 -0.1047 0.1843  0.3821  4   DA  F "C2'" 
2004 C "C1'" . DA  B 4   ? 0.7148 1.2478 0.9748 -0.0978 0.2029  0.3626  4   DA  F "C1'" 
2005 N N9    . DA  B 4   ? 0.6622 1.1666 0.9683 -0.0879 0.1841  0.3479  4   DA  F N9    
2006 C C8    . DA  B 4   ? 0.6377 1.1297 0.9942 -0.0863 0.1602  0.3655  4   DA  F C8    
2007 N N7    . DA  B 4   ? 0.6009 1.0663 0.9865 -0.0781 0.1480  0.3440  4   DA  F N7    
2008 C C5    . DA  B 4   ? 0.5966 1.0575 0.9504 -0.0724 0.1651  0.3121  4   DA  F C5    
2009 C C6    . DA  B 4   ? 0.5747 1.0115 0.9349 -0.0615 0.1644  0.2807  4   DA  F C6    
2010 N N6    . DA  B 4   ? 0.5546 0.9684 0.9550 -0.0556 0.1430  0.2748  4   DA  F N6    
2011 N N1    . DA  B 4   ? 0.5778 1.0132 0.8989 -0.0568 0.1882  0.2557  4   DA  F N1    
2012 C C2    . DA  B 4   ? 0.6047 1.0604 0.8822 -0.0646 0.2112  0.2595  4   DA  F C2    
2013 N N3    . DA  B 4   ? 0.6314 1.1124 0.8958 -0.0762 0.2129  0.2865  4   DA  F N3    
2014 C C4    . DA  B 4   ? 0.6288 1.1117 0.9342 -0.0787 0.1886  0.3134  4   DA  F C4    
2015 P P     . DA  B 5   ? 1.0083 1.6268 1.1356 -0.1266 0.1844  0.4188  5   DA  F P     
2016 O OP1   . DA  B 5   ? 1.0588 1.7136 1.1298 -0.1388 0.1956  0.4365  5   DA  F OP1   
2017 O OP2   . DA  B 5   ? 0.9833 1.5894 1.1632 -0.1180 0.1553  0.4394  5   DA  F OP2   
2018 O "O5'" . DA  B 5   ? 0.8590 1.4610 0.9560 -0.1265 0.1859  0.3685  5   DA  F "O5'" 
2019 C "C5'" . DA  B 5   ? 0.8718 1.4689 0.9300 -0.1311 0.2172  0.3391  5   DA  F "C5'" 
2020 C "C4'" . DA  B 5   ? 0.8470 1.4184 0.8924 -0.1275 0.2168  0.2941  5   DA  F "C4'" 
2021 O "O4'" . DA  B 5   ? 0.7996 1.3397 0.9035 -0.1123 0.2071  0.2882  5   DA  F "O4'" 
2022 C "C3'" . DA  B 5   ? 0.8462 1.4276 0.8665 -0.1335 0.1926  0.2813  5   DA  F "C3'" 
2023 O "O3'" . DA  B 5   ? 0.8736 1.4559 0.8339 -0.1449 0.2113  0.2440  5   DA  F "O3'" 
2024 C "C2'" . DA  B 5   ? 0.7945 1.3448 0.8664 -0.1192 0.1700  0.2716  5   DA  F "C2'" 
2025 C "C1'" . DA  B 5   ? 0.7711 1.2927 0.8750 -0.1082 0.1885  0.2624  5   DA  F "C1'" 
2026 N N9    . DA  B 5   ? 0.7261 1.2237 0.8922 -0.0953 0.1677  0.2704  5   DA  F N9    
2027 C C8    . DA  B 5   ? 0.7153 1.2169 0.9241 -0.0932 0.1454  0.3037  5   DA  F C8    
2028 N N7    . DA  B 5   ? 0.6806 1.1538 0.9382 -0.0832 0.1318  0.3001  5   DA  F N7    
2029 C C5    . DA  B 5   ? 0.6617 1.1134 0.9078 -0.0769 0.1446  0.2639  5   DA  F C5    
2030 C C6    . DA  B 5   ? 0.6262 1.0460 0.9036 -0.0653 0.1391  0.2439  5   DA  F C6    
2031 N N6    . DA  B 5   ? 0.5997 1.0024 0.9271 -0.0604 0.1181  0.2555  5   DA  F N6    
2032 N N1    . DA  B 5   ? 0.6283 1.0332 0.8814 -0.0593 0.1574  0.2114  5   DA  F N1    
2033 C C2    . DA  B 5   ? 0.6584 1.0760 0.8598 -0.0659 0.1814  0.1980  5   DA  F C2    
2034 N N3    . DA  B 5   ? 0.6914 1.1382 0.8575 -0.0792 0.1887  0.2115  5   DA  F N3    
2035 C C4    . DA  B 5   ? 0.6911 1.1557 0.8822 -0.0835 0.1681  0.2457  5   DA  F C4    
2036 P P     . DA  B 6   ? 0.9884 1.5868 0.9138 -0.1559 0.1919  0.2235  6   DA  F P     
2037 O OP1   . DA  B 6   ? 1.0383 1.6562 0.8915 -0.1761 0.2150  0.2024  6   DA  F OP1   
2038 O OP2   . DA  B 6   ? 0.9775 1.5997 0.9336 -0.1523 0.1568  0.2584  6   DA  F OP2   
2039 O "O5'" . DA  B 6   ? 0.8830 1.4393 0.8282 -0.1453 0.1912  0.1854  6   DA  F "O5'" 
2040 C "C5'" . DA  B 6   ? 0.8757 1.3974 0.8191 -0.1380 0.2212  0.1600  6   DA  F "C5'" 
2041 C "C4'" . DA  B 6   ? 0.8294 1.3125 0.8045 -0.1235 0.2126  0.1357  6   DA  F "C4'" 
2042 O "O4'" . DA  B 6   ? 0.7877 1.2597 0.8266 -0.1078 0.1916  0.1616  6   DA  F "O4'" 
2043 C "C3'" . DA  B 6   ? 0.8226 1.3077 0.7844 -0.1297 0.1923  0.1152  6   DA  F "C3'" 
2044 O "O3'" . DA  B 6   ? 0.8384 1.2980 0.7642 -0.1336 0.2158  0.0715  6   DA  F "O3'" 
2045 C "C2'" . DA  B 6   ? 0.7717 1.2372 0.7941 -0.1127 0.1633  0.1281  6   DA  F "C2'" 
2046 C "C1'" . DA  B 6   ? 0.7473 1.1946 0.8093 -0.0990 0.1720  0.1450  6   DA  F "C1'" 
2047 N N9    . DA  B 6   ? 0.7032 1.1478 0.8219 -0.0893 0.1449  0.1753  6   DA  F N9    
2048 C C8    . DA  B 6   ? 0.7055 1.1775 0.8407 -0.0935 0.1266  0.2126  6   DA  F C8    
2049 N N7    . DA  B 6   ? 0.6758 1.1321 0.8642 -0.0834 0.1075  0.2322  6   DA  F N7    
2050 C C5    . DA  B 6   ? 0.6424 1.0613 0.8487 -0.0727 0.1115  0.2055  6   DA  F C5    
2051 C C6    . DA  B 6   ? 0.6041 0.9920 0.8592 -0.0610 0.0977  0.2065  6   DA  F C6    
2052 N N6    . DA  B 6   ? 0.5959 0.9820 0.8937 -0.0593 0.0783  0.2355  6   DA  F N6    
2053 N N1    . DA  B 6   ? 0.5828 0.9403 0.8394 -0.0517 0.1058  0.1766  6   DA  F N1    
2054 C C2    . DA  B 6   ? 0.5973 0.9525 0.8116 -0.0527 0.1287  0.1485  6   DA  F C2    
2055 N N3    . DA  B 6   ? 0.6317 1.0102 0.7986 -0.0643 0.1456  0.1426  6   DA  F N3    
2056 C C4    . DA  B 6   ? 0.6560 1.0676 0.8206 -0.0747 0.1346  0.1718  6   DA  F C4    
2057 P P     . DG  B 7   ? 1.0477 1.5043 0.9566 -0.1416 0.2029  0.0414  7   DG  F P     
2058 O OP1   . DG  B 7   ? 1.0841 1.5297 0.9351 -0.1564 0.2359  0.0018  7   DG  F OP1   
2059 O OP2   . DG  B 7   ? 1.0467 1.5455 0.9648 -0.1495 0.1692  0.0670  7   DG  F OP2   
2060 O "O5'" . DG  B 7   ? 0.8148 1.2268 0.7708 -0.1196 0.1936  0.0313  7   DG  F "O5'" 
2061 C "C5'" . DG  B 7   ? 0.7958 1.1706 0.7654 -0.1035 0.2159  0.0224  7   DG  F "C5'" 
2062 C "C4'" . DG  B 7   ? 0.7408 1.0817 0.7566 -0.0840 0.1985  0.0194  7   DG  F "C4'" 
2063 O "O4'" . DG  B 7   ? 0.7050 1.0582 0.7706 -0.0766 0.1708  0.0564  7   DG  F "O4'" 
2064 C "C3'" . DG  B 7   ? 0.7234 1.0518 0.7346 -0.0863 0.1846  -0.0041 7   DG  F "C3'" 
2065 O "O3'" . DG  B 7   ? 0.7100 0.9921 0.7280 -0.0711 0.1967  -0.0300 7   DG  F "O3'" 
2066 C "C2'" . DG  B 7   ? 0.6911 1.0360 0.7460 -0.0824 0.1473  0.0262  7   DG  F "C2'" 
2067 C "C1'" . DG  B 7   ? 0.6668 1.0065 0.7600 -0.0703 0.1444  0.0547  7   DG  F "C1'" 
2068 N N9    . DG  B 7   ? 0.6359 0.9994 0.7638 -0.0710 0.1176  0.0928  7   DG  F N9    
2069 C C8    . DG  B 7   ? 0.6484 1.0548 0.7634 -0.0837 0.1095  0.1180  7   DG  F C8    
2070 N N7    . DG  B 7   ? 0.6314 1.0471 0.7859 -0.0790 0.0872  0.1522  7   DG  F N7    
2071 C C5    . DG  B 7   ? 0.5955 0.9714 0.7907 -0.0643 0.0799  0.1469  7   DG  F C5    
2072 C C6    . DG  B 7   ? 0.5733 0.9354 0.8192 -0.0556 0.0597  0.1716  7   DG  F C6    
2073 O O6    . DG  B 7   ? 0.5797 0.9607 0.8475 -0.0574 0.0455  0.2058  7   DG  F O6    
2074 N N1    . DG  B 7   ? 0.5523 0.8724 0.8224 -0.0439 0.0584  0.1530  7   DG  F N1    
2075 C C2    . DG  B 7   ? 0.5521 0.8480 0.8010 -0.0386 0.0745  0.1182  7   DG  F C2    
2076 N N2    . DG  B 7   ? 0.5395 0.7982 0.8146 -0.0266 0.0692  0.1064  7   DG  F N2    
2077 N N3    . DG  B 7   ? 0.5673 0.8732 0.7709 -0.0450 0.0955  0.0963  7   DG  F N3    
2078 C C4    . DG  B 7   ? 0.5954 0.9411 0.7740 -0.0589 0.0970  0.1111  7   DG  F C4    
2079 P P     . DA  B 8   ? 0.9643 1.2226 0.9775 -0.0706 0.1898  -0.0593 8   DA  F P     
2080 O OP1   . DA  B 8   ? 0.9754 1.1922 0.9637 -0.0629 0.2220  -0.0927 8   DA  F OP1   
2081 O OP2   . DA  B 8   ? 0.9741 1.2703 0.9673 -0.0912 0.1767  -0.0603 8   DA  F OP2   
2082 O "O5'" . DA  B 8   ? 0.6296 0.8702 0.6971 -0.0531 0.1599  -0.0415 8   DA  F "O5'" 
2083 C "C5'" . DA  B 8   ? 0.5976 0.8141 0.6947 -0.0353 0.1610  -0.0312 8   DA  F "C5'" 
2084 C "C4'" . DA  B 8   ? 0.5574 0.7564 0.6995 -0.0238 0.1322  -0.0191 8   DA  F "C4'" 
2085 O "O4'" . DA  B 8   ? 0.5451 0.7750 0.7159 -0.0298 0.1089  0.0164  8   DA  F "O4'" 
2086 C "C3'" . DA  B 8   ? 0.5493 0.7286 0.6891 -0.0229 0.1228  -0.0399 8   DA  F "C3'" 
2087 O "O3'" . DA  B 8   ? 0.5355 0.6742 0.7010 -0.0059 0.1148  -0.0461 8   DA  F "O3'" 
2088 C "C2'" . DA  B 8   ? 0.5426 0.7570 0.7001 -0.0330 0.0973  -0.0153 8   DA  F "C2'" 
2089 C "C1'" . DA  B 8   ? 0.5339 0.7629 0.7225 -0.0302 0.0862  0.0202  8   DA  F "C1'" 
2090 N N9    . DA  B 8   ? 0.5397 0.8124 0.7337 -0.0415 0.0719  0.0504  8   DA  F N9    
2091 C C8    . DA  B 8   ? 0.5564 0.8692 0.7154 -0.0573 0.0792  0.0523  8   DA  F C8    
2092 N N7    . DA  B 8   ? 0.5588 0.9079 0.7310 -0.0631 0.0621  0.0855  8   DA  F N7    
2093 C C5    . DA  B 8   ? 0.5385 0.8664 0.7591 -0.0504 0.0445  0.1064  8   DA  F C5    
2094 C C6    . DA  B 8   ? 0.5282 0.8713 0.7840 -0.0480 0.0249  0.1448  8   DA  F C6    
2095 N N6    . DA  B 8   ? 0.5294 0.9180 0.7763 -0.0569 0.0178  0.1724  8   DA  F N6    
2096 N N1    . DA  B 8   ? 0.5114 0.8199 0.8102 -0.0364 0.0139  0.1539  8   DA  F N1    
2097 C C2    . DA  B 8   ? 0.5047 0.7705 0.8090 -0.0278 0.0197  0.1268  8   DA  F C2    
2098 N N3    . DA  B 8   ? 0.5127 0.7627 0.7868 -0.0269 0.0367  0.0924  8   DA  F N3    
2099 C C4    . DA  B 8   ? 0.5295 0.8108 0.7630 -0.0384 0.0496  0.0838  8   DA  F C4    
2100 P P     . DT  B 9   ? 0.6242 0.7307 0.7897 -0.0004 0.1094  -0.0699 9   DT  F P     
2101 O OP1   . DT  B 9   ? 0.6230 0.6842 0.7858 0.0166  0.1214  -0.0891 9   DT  F OP1   
2102 O OP2   . DT  B 9   ? 0.6411 0.7675 0.7764 -0.0155 0.1178  -0.0869 9   DT  F OP2   
2103 O "O5'" . DT  B 9   ? 0.5098 0.6189 0.7191 0.0024  0.0783  -0.0448 9   DT  F "O5'" 
2104 C "C5'" . DT  B 9   ? 0.4951 0.5952 0.7379 0.0101  0.0654  -0.0230 9   DT  F "C5'" 
2105 C "C4'" . DT  B 9   ? 0.4868 0.5870 0.7665 0.0103  0.0406  -0.0012 9   DT  F "C4'" 
2106 O "O4'" . DT  B 9   ? 0.5023 0.6479 0.7878 -0.0012 0.0326  0.0272  9   DT  F "O4'" 
2107 C "C3'" . DT  B 9   ? 0.4814 0.5609 0.7625 0.0141  0.0351  -0.0176 9   DT  F "C3'" 
2108 O "O3'" . DT  B 9   ? 0.4736 0.5122 0.7820 0.0253  0.0239  -0.0176 9   DT  F "O3'" 
2109 C "C2'" . DT  B 9   ? 0.4905 0.6120 0.7813 0.0043  0.0226  0.0047  9   DT  F "C2'" 
2110 C "C1'" . DT  B 9   ? 0.5018 0.6524 0.8066 -0.0012 0.0165  0.0379  9   DT  F "C1'" 
2111 N N1    . DT  B 9   ? 0.5134 0.7173 0.8079 -0.0135 0.0127  0.0583  9   DT  F N1    
2112 C C2    . DT  B 9   ? 0.5069 0.7321 0.8316 -0.0138 -0.0038 0.0953  9   DT  F C2    
2113 O O2    . DT  B 9   ? 0.4963 0.6954 0.8569 -0.0055 -0.0140 0.1109  9   DT  F O2    
2114 N N3    . DT  B 9   ? 0.5130 0.7904 0.8225 -0.0246 -0.0070 0.1135  9   DT  F N3    
2115 C C4    . DT  B 9   ? 0.5263 0.8358 0.7926 -0.0375 0.0042  0.0960  9   DT  F C4    
2116 O O4    . DT  B 9   ? 0.5354 0.8937 0.7877 -0.0481 -0.0010 0.1141  9   DT  F O4    
2117 C C5    . DT  B 9   ? 0.5298 0.8104 0.7666 -0.0380 0.0237  0.0550  9   DT  F C5    
2118 C C7    . DT  B 9   ? 0.5422 0.8481 0.7302 -0.0535 0.0407  0.0307  9   DT  F C7    
2119 C C6    . DT  B 9   ? 0.5222 0.7522 0.7751 -0.0248 0.0271  0.0398  9   DT  F C6    
2120 P P     . DC  B 10  ? 0.5363 0.5334 0.8403 0.0347  0.0261  -0.0447 10  DC  F P     
2121 O OP1   . DC  B 10  ? 0.5355 0.4872 0.8517 0.0459  0.0221  -0.0514 10  DC  F OP1   
2122 O OP2   . DC  B 10  ? 0.5411 0.5435 0.8074 0.0312  0.0455  -0.0721 10  DC  F OP2   
2123 O "O5'" . DC  B 10  ? 0.4697 0.4796 0.8021 0.0327  0.0103  -0.0260 10  DC  F "O5'" 
2124 C "C5'" . DC  B 10  ? 0.4613 0.4722 0.8305 0.0336  -0.0058 0.0050  10  DC  F "C5'" 
2125 C "C4'" . DC  B 10  ? 0.4515 0.4892 0.8424 0.0319  -0.0166 0.0268  10  DC  F "C4'" 
2126 O "O4'" . DC  B 10  ? 0.4515 0.5472 0.8307 0.0205  -0.0175 0.0449  10  DC  F "O4'" 
2127 C "C3'" . DC  B 10  ? 0.4437 0.4724 0.8307 0.0361  -0.0133 0.0065  10  DC  F "C3'" 
2128 O "O3'" . DC  B 10  ? 0.4521 0.4730 0.8762 0.0434  -0.0246 0.0271  10  DC  F "O3'" 
2129 C "C2'" . DC  B 10  ? 0.4443 0.5283 0.8073 0.0237  -0.0095 0.0048  10  DC  F "C2'" 
2130 C "C1'" . DC  B 10  ? 0.4526 0.5768 0.8280 0.0175  -0.0198 0.0421  10  DC  F "C1'" 
2131 N N1    . DC  B 10  ? 0.4669 0.6457 0.8120 0.0028  -0.0156 0.0443  10  DC  F N1    
2132 C C2    . DC  B 10  ? 0.4694 0.6965 0.8251 -0.0031 -0.0270 0.0808  10  DC  F C2    
2133 O O2    . DC  B 10  ? 0.4707 0.6922 0.8630 0.0051  -0.0390 0.1115  10  DC  F O2    
2134 N N3    . DC  B 10  ? 0.4868 0.7635 0.8105 -0.0178 -0.0231 0.0815  10  DC  F N3    
2135 C C4    . DC  B 10  ? 0.5007 0.7769 0.7845 -0.0272 -0.0068 0.0464  10  DC  F C4    
2136 N N4    . DC  B 10  ? 0.5176 0.8408 0.7676 -0.0437 -0.0018 0.0463  10  DC  F N4    
2137 C C5    . DC  B 10  ? 0.4933 0.7186 0.7680 -0.0204 0.0068  0.0099  10  DC  F C5    
2138 C C6    . DC  B 10  ? 0.4789 0.6585 0.7844 -0.0050 0.0010  0.0109  10  DC  F C6    
2139 P P     . DG  B 11  ? 0.5067 0.4845 0.9419 0.0547  -0.0210 0.0070  11  DG  F P     
2140 O OP1   . DG  B 11  ? 0.5135 0.4310 0.9422 0.0617  -0.0158 -0.0127 11  DG  F OP1   
2141 O OP2   . DG  B 11  ? 0.5080 0.5112 0.9233 0.0499  -0.0134 -0.0140 11  DG  F OP2   
2142 O "O5'" . DG  B 11  ? 0.5687 0.5520 1.0490 0.0618  -0.0327 0.0415  11  DG  F "O5'" 
2143 C "C5'" . DG  B 11  ? 0.5657 0.5443 1.0703 0.0622  -0.0406 0.0725  11  DG  F "C5'" 
2144 C "C4'" . DG  B 11  ? 0.5614 0.5939 1.0890 0.0610  -0.0503 0.1125  11  DG  F "C4'" 
2145 O "O4'" . DG  B 11  ? 0.5525 0.6425 1.0516 0.0484  -0.0515 0.1147  11  DG  F "O4'" 
2146 C "C3'" . DG  B 11  ? 0.5597 0.6083 1.1115 0.0701  -0.0531 0.1221  11  DG  F "C3'" 
2147 O "O3'" . DG  B 11  ? 0.5790 0.6357 1.1701 0.0783  -0.0600 0.1642  11  DG  F "O3'" 
2148 C "C2'" . DG  B 11  ? 0.5459 0.6598 1.0732 0.0594  -0.0556 0.1164  11  DG  F "C2'" 
2149 C "C1'" . DG  B 11  ? 0.5481 0.6907 1.0532 0.0475  -0.0578 0.1285  11  DG  F "C1'" 
2150 N N9    . DG  B 11  ? 0.5428 0.7270 1.0072 0.0329  -0.0536 0.1079  11  DG  F N9    
2151 C C8    . DG  B 11  ? 0.5333 0.6993 0.9660 0.0279  -0.0411 0.0658  11  DG  F C8    
2152 N N7    . DG  B 11  ? 0.5332 0.7419 0.9316 0.0130  -0.0369 0.0546  11  DG  F N7    
2153 C C5    . DG  B 11  ? 0.5373 0.7984 0.9437 0.0079  -0.0490 0.0918  11  DG  F C5    
2154 C C6    . DG  B 11  ? 0.5366 0.8575 0.9133 -0.0084 -0.0505 0.0982  11  DG  F C6    
2155 O O6    . DG  B 11  ? 0.5329 0.8709 0.8700 -0.0230 -0.0399 0.0697  11  DG  F O6    
2156 N N1    . DG  B 11  ? 0.5495 0.9098 0.9444 -0.0071 -0.0642 0.1426  11  DG  F N1    
2157 C C2    . DG  B 11  ? 0.5498 0.8913 0.9883 0.0083  -0.0731 0.1768  11  DG  F C2    
2158 N N2    . DG  B 11  ? 0.5624 0.9461 1.0121 0.0084  -0.0834 0.2196  11  DG  F N2    
2159 N N3    . DG  B 11  ? 0.5457 0.8287 1.0126 0.0222  -0.0704 0.1694  11  DG  F N3    
2160 C C4    . DG  B 11  ? 0.5416 0.7883 0.9893 0.0210  -0.0592 0.1262  11  DG  F C4    
2161 O "O5'" . DA  C 1   ? 0.9771 1.4324 0.9277 -0.1855 -0.2267 0.1677  1   DA  G "O5'" 
2162 C "C5'" . DA  C 1   ? 1.0177 1.4925 0.9477 -0.1730 -0.2484 0.1860  1   DA  G "C5'" 
2163 C "C4'" . DA  C 1   ? 0.9717 1.4902 0.9590 -0.1532 -0.2360 0.2129  1   DA  G "C4'" 
2164 O "O4'" . DA  C 1   ? 0.9125 1.4781 0.9753 -0.1653 -0.2415 0.2171  1   DA  G "O4'" 
2165 C "C3'" . DA  C 1   ? 0.9387 1.4319 0.9324 -0.1316 -0.1927 0.2192  1   DA  G "C3'" 
2166 O "O3'" . DA  C 1   ? 0.9460 1.4586 0.9512 -0.1075 -0.1886 0.2456  1   DA  G "O3'" 
2167 C "C2'" . DA  C 1   ? 0.8666 1.3716 0.9207 -0.1394 -0.1765 0.2105  1   DA  G "C2'" 
2168 C "C1'" . DA  C 1   ? 0.8481 1.4083 0.9489 -0.1521 -0.2055 0.2190  1   DA  G "C1'" 
2169 N N9    . DA  C 1   ? 0.7975 1.3631 0.9339 -0.1708 -0.2022 0.2047  1   DA  G N9    
2170 C C8    . DA  C 1   ? 0.8126 1.3631 0.9308 -0.1984 -0.2191 0.1854  1   DA  G C8    
2171 N N7    . DA  C 1   ? 0.7699 1.3259 0.9270 -0.2084 -0.2081 0.1783  1   DA  G N7    
2172 C C5    . DA  C 1   ? 0.7194 1.2956 0.9200 -0.1837 -0.1836 0.1928  1   DA  G C5    
2173 C C6    . DA  C 1   ? 0.6676 1.2544 0.9138 -0.1749 -0.1624 0.1941  1   DA  G C6    
2174 N N6    . DA  C 1   ? 0.6529 1.2341 0.9125 -0.1918 -0.1598 0.1824  1   DA  G N6    
2175 N N1    . DA  C 1   ? 0.6400 1.2377 0.9120 -0.1453 -0.1441 0.2082  1   DA  G N1    
2176 C C2    . DA  C 1   ? 0.6538 1.2520 0.9108 -0.1287 -0.1456 0.2212  1   DA  G C2    
2177 N N3    . DA  C 1   ? 0.6965 1.2873 0.9136 -0.1346 -0.1616 0.2238  1   DA  G N3    
2178 C C4    . DA  C 1   ? 0.7321 1.3127 0.9209 -0.1616 -0.1807 0.2084  1   DA  G C4    
2179 P P     . DC  C 2   ? 1.0839 1.5624 1.0845 -0.0849 -0.1493 0.2570  2   DC  G P     
2180 O OP1   . DC  C 2   ? 1.1243 1.6093 1.1018 -0.0620 -0.1541 0.2833  2   DC  G OP1   
2181 O OP2   . DC  C 2   ? 1.0924 1.5240 1.0574 -0.0921 -0.1273 0.2386  2   DC  G OP2   
2182 O "O5'" . DC  C 2   ? 0.9045 1.4005 0.9755 -0.0802 -0.1333 0.2588  2   DC  G "O5'" 
2183 C "C5'" . DC  C 2   ? 0.8879 1.4249 0.9987 -0.0650 -0.1430 0.2796  2   DC  G "C5'" 
2184 C "C4'" . DC  C 2   ? 0.8494 1.3721 0.9980 -0.0475 -0.1173 0.2844  2   DC  G "C4'" 
2185 O "O4'" . DC  C 2   ? 0.7959 1.3295 0.9843 -0.0562 -0.1141 0.2682  2   DC  G "O4'" 
2186 C "C3'" . DC  C 2   ? 0.8581 1.3266 0.9880 -0.0434 -0.0889 0.2797  2   DC  G "C3'" 
2187 O "O3'" . DC  C 2   ? 0.8712 1.3261 1.0144 -0.0200 -0.0762 0.2997  2   DC  G "O3'" 
2188 C "C2'" . DC  C 2   ? 0.8086 1.2613 0.9636 -0.0560 -0.0768 0.2537  2   DC  G "C2'" 
2189 C "C1'" . DC  C 2   ? 0.7664 1.2581 0.9620 -0.0522 -0.0895 0.2544  2   DC  G "C1'" 
2190 N N1    . DC  C 2   ? 0.7151 1.2055 0.9256 -0.0677 -0.0877 0.2302  2   DC  G N1    
2191 C C2    . DC  C 2   ? 0.6716 1.1560 0.9161 -0.0548 -0.0764 0.2228  2   DC  G C2    
2192 O O2    . DC  C 2   ? 0.6730 1.1507 0.9336 -0.0314 -0.0697 0.2352  2   DC  G O2    
2193 N N3    . DC  C 2   ? 0.6357 1.1164 0.8884 -0.0656 -0.0735 0.2021  2   DC  G N3    
2194 C C4    . DC  C 2   ? 0.6357 1.1167 0.8659 -0.0901 -0.0814 0.1890  2   DC  G C4    
2195 N N4    . DC  C 2   ? 0.6061 1.0788 0.8422 -0.0985 -0.0768 0.1698  2   DC  G N4    
2196 C C5    . DC  C 2   ? 0.6790 1.1628 0.8728 -0.1042 -0.0950 0.1945  2   DC  G C5    
2197 C C6    . DC  C 2   ? 0.7140 1.2036 0.8987 -0.0914 -0.0977 0.2151  2   DC  G C6    
2198 P P     . DG  C 3   ? 1.0192 1.4260 1.1369 -0.0128 -0.0520 0.3112  3   DG  G P     
2199 O OP1   . DG  C 3   ? 1.0529 1.4601 1.1633 0.0119  -0.0530 0.3402  3   DG  G OP1   
2200 O OP2   . DG  C 3   ? 1.0444 1.4380 1.1179 -0.0275 -0.0485 0.3029  3   DG  G OP2   
2201 O "O5'" . DG  C 3   ? 0.8903 1.2637 1.0472 -0.0158 -0.0316 0.2963  3   DG  G "O5'" 
2202 C "C5'" . DG  C 3   ? 0.8673 1.2377 1.0603 0.0004  -0.0328 0.2983  3   DG  G "C5'" 
2203 C "C4'" . DG  C 3   ? 0.8361 1.1751 1.0602 -0.0062 -0.0210 0.2758  3   DG  G "C4'" 
2204 O "O4'" . DG  C 3   ? 0.7899 1.1503 1.0240 -0.0181 -0.0291 0.2511  3   DG  G "O4'" 
2205 C "C3'" . DG  C 3   ? 0.8520 1.1563 1.0744 -0.0205 -0.0009 0.2723  3   DG  G "C3'" 
2206 O "O3'" . DG  C 3   ? 0.8523 1.1204 1.1108 -0.0165 0.0069  0.2660  3   DG  G "O3'" 
2207 C "C2'" . DG  C 3   ? 0.8209 1.1392 1.0360 -0.0399 -0.0017 0.2476  3   DG  G "C2'" 
2208 C "C1'" . DG  C 3   ? 0.7751 1.1127 1.0119 -0.0348 -0.0168 0.2310  3   DG  G "C1'" 
2209 N N9    . DG  C 3   ? 0.7389 1.0983 0.9634 -0.0500 -0.0244 0.2121  3   DG  G N9    
2210 C C8    . DG  C 3   ? 0.7495 1.1211 0.9370 -0.0645 -0.0290 0.2120  3   DG  G C8    
2211 N N7    . DG  C 3   ? 0.7219 1.1046 0.9048 -0.0770 -0.0367 0.1923  3   DG  G N7    
2212 C C5    . DG  C 3   ? 0.6837 1.0643 0.9027 -0.0687 -0.0350 0.1801  3   DG  G C5    
2213 C C6    . DG  C 3   ? 0.6449 1.0311 0.8732 -0.0733 -0.0383 0.1598  3   DG  G C6    
2214 O O6    . DG  C 3   ? 0.6392 1.0324 0.8483 -0.0891 -0.0440 0.1481  3   DG  G O6    
2215 N N1    . DG  C 3   ? 0.6228 0.9995 0.8816 -0.0552 -0.0347 0.1534  3   DG  G N1    
2216 C C2    . DG  C 3   ? 0.6362 0.9961 0.9133 -0.0368 -0.0314 0.1633  3   DG  G C2    
2217 N N2    . DG  C 3   ? 0.6227 0.9678 0.9195 -0.0176 -0.0315 0.1524  3   DG  G N2    
2218 N N3    . DG  C 3   ? 0.6701 1.0226 0.9416 -0.0352 -0.0283 0.1825  3   DG  G N3    
2219 C C4    . DG  C 3   ? 0.6938 1.0592 0.9364 -0.0511 -0.0290 0.1909  3   DG  G C4    
2220 P P     . DA  C 4   ? 0.8857 1.1125 1.1543 -0.0187 0.0268  0.2848  4   DA  G P     
2221 O OP1   . DA  C 4   ? 0.9246 1.1419 1.1747 0.0016  0.0249  0.3134  4   DA  G OP1   
2222 O OP2   . DA  C 4   ? 0.8942 1.1241 1.1501 -0.0363 0.0448  0.2861  4   DA  G OP2   
2223 O "O5'" . DA  C 4   ? 0.9483 1.1408 1.2651 -0.0207 0.0249  0.2650  4   DA  G "O5'" 
2224 C "C5'" . DA  C 4   ? 0.9399 1.1223 1.2665 -0.0013 0.0074  0.2547  4   DA  G "C5'" 
2225 C "C4'" . DA  C 4   ? 0.9077 1.0830 1.2618 -0.0060 -0.0011 0.2208  4   DA  G "C4'" 
2226 O "O4'" . DA  C 4   ? 0.8674 1.0835 1.2066 -0.0137 -0.0037 0.2055  4   DA  G "O4'" 
2227 C "C3'" . DA  C 4   ? 0.9147 1.0634 1.3068 -0.0259 0.0076  0.2096  4   DA  G "C3'" 
2228 O "O3'" . DA  C 4   ? 0.9144 1.0319 1.3340 -0.0177 -0.0085 0.1850  4   DA  G "O3'" 
2229 C "C2'" . DA  C 4   ? 0.8824 1.0656 1.2676 -0.0438 0.0169  0.1972  4   DA  G "C2'" 
2230 C "C1'" . DA  C 4   ? 0.8512 1.0644 1.2085 -0.0324 0.0033  0.1851  4   DA  G "C1'" 
2231 N N9    . DA  C 4   ? 0.8358 1.0825 1.1644 -0.0455 0.0093  0.1839  4   DA  G N9    
2232 C C8    . DA  C 4   ? 0.8579 1.1154 1.1592 -0.0545 0.0212  0.2037  4   DA  G C8    
2233 N N7    . DA  C 4   ? 0.8458 1.1262 1.1176 -0.0638 0.0204  0.1947  4   DA  G N7    
2234 C C5    . DA  C 4   ? 0.8101 1.0967 1.0944 -0.0624 0.0095  0.1690  4   DA  G C5    
2235 C C6    . DA  C 4   ? 0.7839 1.0870 1.0492 -0.0700 0.0041  0.1499  4   DA  G C6    
2236 N N6    . DA  C 4   ? 0.7931 1.1077 1.0201 -0.0817 0.0058  0.1515  4   DA  G N6    
2237 N N1    . DA  C 4   ? 0.7577 1.0592 1.0397 -0.0629 -0.0036 0.1290  4   DA  G N1    
2238 C C2    . DA  C 4   ? 0.7564 1.0399 1.0681 -0.0474 -0.0081 0.1255  4   DA  G C2    
2239 N N3    . DA  C 4   ? 0.7798 1.0434 1.1103 -0.0398 -0.0069 0.1398  4   DA  G N3    
2240 C C4    . DA  C 4   ? 0.8048 1.0720 1.1224 -0.0494 0.0031  0.1623  4   DA  G C4    
2241 P P     . DT  C 5   ? 1.0721 1.1589 1.5443 -0.0365 -0.0082 0.1713  5   DT  G P     
2242 O OP1   . DT  C 5   ? 1.1027 1.1372 1.5902 -0.0213 -0.0285 0.1621  5   DT  G OP1   
2243 O OP2   . DT  C 5   ? 1.0871 1.1819 1.5734 -0.0585 0.0166  0.1965  5   DT  G OP2   
2244 O "O5'" . DT  C 5   ? 0.9110 1.0226 1.3925 -0.0421 -0.0140 0.1383  5   DT  G "O5'" 
2245 C "C5'" . DT  C 5   ? 0.8887 1.0002 1.3507 -0.0205 -0.0320 0.1143  5   DT  G "C5'" 
2246 C "C4'" . DT  C 5   ? 0.8516 0.9867 1.3174 -0.0276 -0.0320 0.0878  5   DT  G "C4'" 
2247 O "O4'" . DT  C 5   ? 0.8284 1.0047 1.2625 -0.0369 -0.0165 0.0979  5   DT  G "O4'" 
2248 C "C3'" . DT  C 5   ? 0.8501 0.9806 1.3639 -0.0479 -0.0289 0.0757  5   DT  G "C3'" 
2249 O "O3'" . DT  C 5   ? 0.8329 0.9585 1.3556 -0.0384 -0.0451 0.0416  5   DT  G "O3'" 
2250 C "C2'" . DT  C 5   ? 0.8351 1.0034 1.3373 -0.0667 -0.0035 0.0911  5   DT  G "C2'" 
2251 C "C1'" . DT  C 5   ? 0.8127 1.0036 1.2619 -0.0551 -0.0051 0.0880  5   DT  G "C1'" 
2252 N N1    . DT  C 5   ? 0.8093 1.0286 1.2253 -0.0671 0.0130  0.1068  5   DT  G N1    
2253 C C2    . DT  C 5   ? 0.7880 1.0291 1.1699 -0.0680 0.0136  0.0944  5   DT  G C2    
2254 O O2    . DT  C 5   ? 0.7682 1.0086 1.1471 -0.0593 0.0034  0.0709  5   DT  G O2    
2255 N N3    . DT  C 5   ? 0.7977 1.0565 1.1446 -0.0781 0.0260  0.1105  5   DT  G N3    
2256 C C4    . DT  C 5   ? 0.8255 1.0838 1.1649 -0.0839 0.0395  0.1383  5   DT  G C4    
2257 O O4    . DT  C 5   ? 0.8417 1.1120 1.1403 -0.0887 0.0477  0.1496  5   DT  G O4    
2258 C C5    . DT  C 5   ? 0.8417 1.0787 1.2199 -0.0822 0.0422  0.1530  5   DT  G C5    
2259 C C7    . DT  C 5   ? 0.8763 1.1072 1.2476 -0.0860 0.0599  0.1863  5   DT  G C7    
2260 C C6    . DT  C 5   ? 0.8331 1.0508 1.2488 -0.0756 0.0279  0.1362  5   DT  G C6    
2261 P P     . DC  C 6   ? 0.9856 1.0857 1.5667 -0.0455 -0.0625 0.0202  6   DC  G P     
2262 O OP1   . DC  C 6   ? 1.0222 1.0722 1.6025 -0.0258 -0.0885 0.0111  6   DC  G OP1   
2263 O OP2   . DC  C 6   ? 0.9883 1.1050 1.6155 -0.0746 -0.0427 0.0402  6   DC  G OP2   
2264 O "O5'" . DC  C 6   ? 0.7969 0.9132 1.3722 -0.0364 -0.0706 -0.0131 6   DC  G "O5'" 
2265 C "C5'" . DC  C 6   ? 0.7677 0.9223 1.3520 -0.0526 -0.0513 -0.0135 6   DC  G "C5'" 
2266 C "C4'" . DC  C 6   ? 0.7360 0.9119 1.2619 -0.0418 -0.0413 -0.0188 6   DC  G "C4'" 
2267 O "O4'" . DC  C 6   ? 0.7333 0.9246 1.2260 -0.0499 -0.0233 0.0105  6   DC  G "O4'" 
2268 C "C3'" . DC  C 6   ? 0.7140 0.9167 1.2397 -0.0486 -0.0290 -0.0317 6   DC  G "C3'" 
2269 O "O3'" . DC  C 6   ? 0.7113 0.9027 1.2407 -0.0305 -0.0481 -0.0647 6   DC  G "O3'" 
2270 C "C2'" . DC  C 6   ? 0.7002 0.9202 1.1662 -0.0490 -0.0130 -0.0206 6   DC  G "C2'" 
2271 C "C1'" . DC  C 6   ? 0.7122 0.9296 1.1681 -0.0547 -0.0086 0.0092  6   DC  G "C1'" 
2272 N N1    . DC  C 6   ? 0.7175 0.9527 1.1700 -0.0736 0.0140  0.0355  6   DC  G N1    
2273 C C2    . DC  C 6   ? 0.7109 0.9643 1.1166 -0.0787 0.0274  0.0397  6   DC  G C2    
2274 O O2    . DC  C 6   ? 0.7021 0.9575 1.0757 -0.0713 0.0209  0.0224  6   DC  G O2    
2275 N N3    . DC  C 6   ? 0.7219 0.9857 1.1151 -0.0903 0.0470  0.0629  6   DC  G N3    
2276 C C4    . DC  C 6   ? 0.7350 0.9945 1.1643 -0.0975 0.0571  0.0844  6   DC  G C4    
2277 N N4    . DC  C 6   ? 0.7536 1.0215 1.1634 -0.1044 0.0794  0.1091  6   DC  G N4    
2278 C C5    . DC  C 6   ? 0.7401 0.9815 1.2235 -0.0966 0.0442  0.0818  6   DC  G C5    
2279 C C6    . DC  C 6   ? 0.7307 0.9590 1.2218 -0.0842 0.0210  0.0557  6   DC  G C6    
2280 P P     . DT  C 7   ? 0.7054 0.9161 1.2706 -0.0351 -0.0468 -0.0837 7   DT  G P     
2281 O OP1   . DT  C 7   ? 0.7099 0.9003 1.2705 -0.0099 -0.0729 -0.1180 7   DT  G OP1   
2282 O OP2   . DT  C 7   ? 0.7115 0.9356 1.3423 -0.0585 -0.0393 -0.0665 7   DT  G OP2   
2283 O "O5'" . DT  C 7   ? 0.5997 0.8356 1.1167 -0.0387 -0.0206 -0.0779 7   DT  G "O5'" 
2284 C "C5'" . DT  C 7   ? 0.5890 0.8162 1.0448 -0.0229 -0.0213 -0.0889 7   DT  G "C5'" 
2285 C "C4'" . DT  C 7   ? 0.5894 0.8338 1.0033 -0.0318 0.0018  -0.0814 7   DT  G "C4'" 
2286 O "O4'" . DT  C 7   ? 0.6002 0.8562 1.0089 -0.0510 0.0178  -0.0513 7   DT  G "O4'" 
2287 C "C3'" . DT  C 7   ? 0.5941 0.8546 1.0231 -0.0310 0.0120  -0.0940 7   DT  G "C3'" 
2288 O "O3'" . DT  C 7   ? 0.6044 0.8590 0.9752 -0.0213 0.0198  -0.1064 7   DT  G "O3'" 
2289 C "C2'" . DT  C 7   ? 0.5983 0.8801 1.0482 -0.0510 0.0342  -0.0667 7   DT  G "C2'" 
2290 C "C1'" . DT  C 7   ? 0.6072 0.8808 1.0147 -0.0599 0.0389  -0.0446 7   DT  G "C1'" 
2291 N N1    . DT  C 7   ? 0.6202 0.9038 1.0510 -0.0756 0.0533  -0.0141 7   DT  G N1    
2292 C C2    . DT  C 7   ? 0.6376 0.9283 1.0257 -0.0824 0.0742  0.0051  7   DT  G C2    
2293 O O2    . DT  C 7   ? 0.6442 0.9311 0.9763 -0.0784 0.0793  -0.0032 7   DT  G O2    
2294 N N3    . DT  C 7   ? 0.6542 0.9508 1.0627 -0.0927 0.0884  0.0345  7   DT  G N3    
2295 C C4    . DT  C 7   ? 0.6535 0.9481 1.1232 -0.0997 0.0843  0.0471  7   DT  G C4    
2296 O O4    . DT  C 7   ? 0.6739 0.9707 1.1559 -0.1081 0.1007  0.0761  7   DT  G O4    
2297 C C5    . DT  C 7   ? 0.6351 0.9192 1.1483 -0.0945 0.0589  0.0238  7   DT  G C5    
2298 C C7    . DT  C 7   ? 0.6417 0.9137 1.2187 -0.1021 0.0483  0.0325  7   DT  G C7    
2299 C C6    . DT  C 7   ? 0.6190 0.8987 1.1089 -0.0812 0.0446  -0.0056 7   DT  G C6    
2300 P P     . DT  C 8   ? 0.6971 0.9638 1.0646 -0.0129 0.0318  -0.1213 8   DT  G P     
2301 O OP1   . DT  C 8   ? 0.7034 0.9482 1.0190 0.0065  0.0264  -0.1439 8   DT  G OP1   
2302 O OP2   . DT  C 8   ? 0.6902 0.9783 1.1332 -0.0134 0.0257  -0.1255 8   DT  G OP2   
2303 O "O5'" . DT  C 8   ? 0.6210 0.8972 0.9525 -0.0272 0.0583  -0.0992 8   DT  G "O5'" 
2304 C "C5'" . DT  C 8   ? 0.6335 0.8922 0.9005 -0.0343 0.0616  -0.0902 8   DT  G "C5'" 
2305 C "C4'" . DT  C 8   ? 0.6513 0.9145 0.8827 -0.0435 0.0833  -0.0722 8   DT  G "C4'" 
2306 O "O4'" . DT  C 8   ? 0.6511 0.9312 0.9197 -0.0564 0.0909  -0.0457 8   DT  G "O4'" 
2307 C "C3'" . DT  C 8   ? 0.6676 0.9388 0.8910 -0.0312 0.1019  -0.0801 8   DT  G "C3'" 
2308 O "O3'" . DT  C 8   ? 0.6995 0.9477 0.8426 -0.0293 0.1123  -0.0805 8   DT  G "O3'" 
2309 C "C2'" . DT  C 8   ? 0.6662 0.9675 0.9461 -0.0381 0.1188  -0.0567 8   DT  G "C2'" 
2310 C "C1'" . DT  C 8   ? 0.6725 0.9675 0.9439 -0.0546 0.1156  -0.0334 8   DT  G "C1'" 
2311 N N1    . DT  C 8   ? 0.6690 0.9856 1.0083 -0.0648 0.1238  -0.0097 8   DT  G N1    
2312 C C2    . DT  C 8   ? 0.6999 1.0203 1.0211 -0.0706 0.1453  0.0198  8   DT  G C2    
2313 O O2    . DT  C 8   ? 0.7375 1.0438 0.9864 -0.0666 0.1551  0.0253  8   DT  G O2    
2314 N N3    . DT  C 8   ? 0.6917 1.0285 1.0794 -0.0803 0.1539  0.0427  8   DT  G N3    
2315 C C4    . DT  C 8   ? 0.6673 1.0143 1.1378 -0.0872 0.1397  0.0372  8   DT  G C4    
2316 O O4    . DT  C 8   ? 0.6764 1.0328 1.2041 -0.0984 0.1482  0.0600  8   DT  G O4    
2317 C C5    . DT  C 8   ? 0.6400 0.9808 1.1214 -0.0790 0.1133  0.0028  8   DT  G C5    
2318 C C7    . DT  C 8   ? 0.6214 0.9655 1.1822 -0.0826 0.0909  -0.0094 8   DT  G C7    
2319 C C6    . DT  C 8   ? 0.6405 0.9676 1.0559 -0.0671 0.1086  -0.0176 8   DT  G C6    
2320 P P     . DT  C 9   ? 0.9235 1.1639 1.0286 -0.0093 0.1286  -0.0954 9   DT  G P     
2321 O OP1   . DT  C 9   ? 0.9516 1.1498 0.9721 -0.0081 0.1229  -0.1080 9   DT  G OP1   
2322 O OP2   . DT  C 9   ? 0.9002 1.1636 1.0669 0.0050  0.1245  -0.1113 9   DT  G OP2   
2323 O "O5'" . DT  C 9   ? 0.7392 0.9951 0.8369 -0.0079 0.1560  -0.0711 9   DT  G "O5'" 
2324 C "C5'" . DT  C 9   ? 0.7677 1.0049 0.8092 -0.0179 0.1605  -0.0530 9   DT  G "C5'" 
2325 C "C4'" . DT  C 9   ? 0.7889 1.0457 0.8373 -0.0112 0.1899  -0.0266 9   DT  G "C4'" 
2326 O "O4'" . DT  C 9   ? 0.7501 1.0395 0.8803 -0.0246 0.1919  -0.0053 9   DT  G "O4'" 
2327 C "C3'" . DT  C 9   ? 0.8016 1.0769 0.8611 0.0119  0.2151  -0.0295 9   DT  G "C3'" 
2328 O "O3'" . DT  C 9   ? 0.8706 1.1229 0.8476 0.0283  0.2375  -0.0194 9   DT  G "O3'" 
2329 C "C2'" . DT  C 9   ? 0.7642 1.0903 0.9292 0.0061  0.2285  -0.0085 9   DT  G "C2'" 
2330 C "C1'" . DT  C 9   ? 0.7514 1.0726 0.9251 -0.0148 0.2215  0.0132  9   DT  G "C1'" 
2331 N N1    . DT  C 9   ? 0.6949 1.0494 0.9730 -0.0301 0.2178  0.0264  9   DT  G N1    
2332 C C2    . DT  C 9   ? 0.7029 1.0678 1.0051 -0.0394 0.2351  0.0601  9   DT  G C2    
2333 O O2    . DT  C 9   ? 0.7494 1.0994 0.9889 -0.0331 0.2535  0.0800  9   DT  G O2    
2334 N N3    . DT  C 9   ? 0.6630 1.0511 1.0615 -0.0551 0.2287  0.0696  9   DT  G N3    
2335 C C4    . DT  C 9   ? 0.6165 1.0172 1.0853 -0.0609 0.2040  0.0469  9   DT  G C4    
2336 O O4    . DT  C 9   ? 0.5909 1.0053 1.1410 -0.0756 0.1962  0.0558  9   DT  G O4    
2337 C C5    . DT  C 9   ? 0.6089 0.9994 1.0439 -0.0470 0.1868  0.0115  9   DT  G C5    
2338 C C7    . DT  C 9   ? 0.5752 0.9739 1.0713 -0.0465 0.1581  -0.0162 9   DT  G C7    
2339 C C6    . DT  C 9   ? 0.6438 1.0124 0.9877 -0.0331 0.1960  0.0042  9   DT  G C6    
2340 P P     . DA  C 10  ? 1.1250 1.3632 1.0493 0.0585  0.2546  -0.0351 10  DA  G P     
2341 O OP1   . DA  C 10  ? 1.1837 1.3602 0.9890 0.0640  0.2471  -0.0461 10  DA  G OP1   
2342 O OP2   . DA  C 10  ? 1.0787 1.3380 1.0618 0.0628  0.2426  -0.0582 10  DA  G OP2   
2343 O "O5'" . DA  C 10  ? 0.9094 1.1849 0.8605 0.0781  0.2958  -0.0049 10  DA  G "O5'" 
2344 C "C5'" . DA  C 10  ? 0.9542 1.2152 0.8534 0.0826  0.3154  0.0224  10  DA  G "C5'" 
2345 C "C4'" . DA  C 10  ? 0.9345 1.2503 0.9174 0.0854  0.3489  0.0587  10  DA  G "C4'" 
2346 O "O4'" . DA  C 10  ? 0.8664 1.2138 0.9511 0.0551  0.3311  0.0641  10  DA  G "O4'" 
2347 C "C3'" . DA  C 10  ? 0.9239 1.2857 0.9628 0.1082  0.3772  0.0635  10  DA  G "C3'" 
2348 O "O3'" . DA  C 10  ? 0.9943 1.3410 0.9533 0.1435  0.4134  0.0792  10  DA  G "O3'" 
2349 C "C2'" . DA  C 10  ? 0.8801 1.3034 1.0504 0.0892  0.3897  0.0920  10  DA  G "C2'" 
2350 C "C1'" . DA  C 10  ? 0.8460 1.2491 1.0292 0.0561  0.3592  0.0913  10  DA  G "C1'" 
2351 N N9    . DA  C 10  ? 0.7692 1.2029 1.0616 0.0312  0.3334  0.0804  10  DA  G N9    
2352 C C8    . DA  C 10  ? 0.7277 1.1655 1.0496 0.0298  0.3048  0.0460  10  DA  G C8    
2353 N N7    . DA  C 10  ? 0.6753 1.1364 1.0923 0.0084  0.2831  0.0423  10  DA  G N7    
2354 C C5    . DA  C 10  ? 0.6771 1.1496 1.1324 -0.0075 0.2994  0.0774  10  DA  G C5    
2355 C C6    . DA  C 10  ? 0.6419 1.1320 1.1904 -0.0328 0.2889  0.0914  10  DA  G C6    
2356 N N6    . DA  C 10  ? 0.5996 1.0983 1.2198 -0.0460 0.2553  0.0686  10  DA  G N6    
2357 N N1    . DA  C 10  ? 0.6630 1.1553 1.2221 -0.0418 0.3136  0.1297  10  DA  G N1    
2358 C C2    . DA  C 10  ? 0.7119 1.1910 1.1907 -0.0238 0.3459  0.1517  10  DA  G C2    
2359 N N3    . DA  C 10  ? 0.7487 1.2087 1.1331 0.0016  0.3562  0.1398  10  DA  G N3    
2360 C C4    . DA  C 10  ? 0.7315 1.1889 1.1109 0.0072  0.3317  0.1022  10  DA  G C4    
2361 P P     . DA  C 11  ? 0.9016 1.2986 0.9048 0.1762  0.4523  0.0921  11  DA  G P     
2362 O OP1   . DA  C 11  ? 0.9804 1.3308 0.8547 0.2169  0.4751  0.0912  11  DA  G OP1   
2363 O OP2   . DA  C 11  ? 0.8492 1.2829 0.9402 0.1668  0.4298  0.0665  11  DA  G OP2   
2364 O "O5'" . DA  C 11  ? 1.0367 1.4919 1.1335 0.1705  0.4894  0.1406  11  DA  G "O5'" 
2365 C "C5'" . DA  C 11  ? 1.0889 1.5178 1.1258 0.1753  0.5111  0.1716  11  DA  G "C5'" 
2366 C "C4'" . DA  C 11  ? 1.0633 1.5483 1.2143 0.1587  0.5381  0.2149  11  DA  G "C4'" 
2367 O "O4'" . DA  C 11  ? 0.9838 1.4893 1.2374 0.1157  0.5008  0.2015  11  DA  G "O4'" 
2368 C "C3'" . DA  C 11  ? 1.0711 1.6121 1.3050 0.1726  0.5670  0.2369  11  DA  G "C3'" 
2369 O "O3'" . DA  C 11  ? 1.1239 1.6685 1.3699 0.1746  0.5948  0.2791  11  DA  G "O3'" 
2370 C "C2'" . DA  C 11  ? 0.9807 1.5802 1.3608 0.1407  0.5449  0.2252  11  DA  G "C2'" 
2371 C "C1'" . DA  C 11  ? 0.9387 1.5152 1.3329 0.1053  0.5179  0.2217  11  DA  G "C1'" 
2372 N N9    . DA  C 11  ? 0.8551 1.4455 1.3312 0.0754  0.4715  0.1887  11  DA  G N9    
2373 C C8    . DA  C 11  ? 0.8226 1.4105 1.2919 0.0822  0.4423  0.1473  11  DA  G C8    
2374 N N7    . DA  C 11  ? 0.7578 1.3559 1.3042 0.0551  0.4028  0.1247  11  DA  G N7    
2375 C C5    . DA  C 11  ? 0.7397 1.3461 1.3488 0.0271  0.4053  0.1524  11  DA  G C5    
2376 C C6    . DA  C 11  ? 0.6815 1.2935 1.3782 -0.0065 0.3732  0.1467  11  DA  G C6    
2377 N N6    . DA  C 11  ? 0.6350 1.2463 1.3704 -0.0160 0.3301  0.1091  11  DA  G N6    
2378 N N1    . DA  C 11  ? 0.6864 1.2991 1.4227 -0.0268 0.3872  0.1814  11  DA  G N1    
2379 C C2    . DA  C 11  ? 0.7395 1.3499 1.4304 -0.0129 0.4315  0.2200  11  DA  G C2    
2380 N N3    . DA  C 11  ? 0.7972 1.4024 1.4025 0.0206  0.4645  0.2289  11  DA  G N3    
2381 C C4    . DA  C 11  ? 0.7973 1.3999 1.3656 0.0386  0.4484  0.1928  11  DA  G C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  LYS 22  2   ?   ?   ?   A . n 
A 1 23  LYS 23  3   3   LYS LYS A . n 
A 1 24  ASN 24  4   4   ASN ASN A . n 
A 1 25  ARG 25  5   5   ARG ARG A . n 
A 1 26  ALA 26  6   6   ALA ALA A . n 
A 1 27  PHE 27  7   7   PHE PHE A . n 
A 1 28  LEU 28  8   8   LEU LEU A . n 
A 1 29  LYS 29  9   9   LYS LYS A . n 
A 1 30  TRP 30  10  10  TRP TRP A . n 
A 1 31  ALA 31  11  11  ALA ALA A . n 
A 1 32  GLY 32  12  12  GLY GLY A . n 
A 1 33  GLY 33  13  13  GLY GLY A . n 
A 1 34  LYS 34  14  14  LYS LYS A . n 
A 1 35  TYR 35  15  15  TYR TYR A . n 
A 1 36  PRO 36  16  16  PRO PRO A . n 
A 1 37  LEU 37  17  17  LEU LEU A . n 
A 1 38  LEU 38  18  18  LEU LEU A . n 
A 1 39  ASP 39  19  19  ASP ASP A . n 
A 1 40  ASP 40  20  20  ASP ASP A . n 
A 1 41  ILE 41  21  21  ILE ILE A . n 
A 1 42  LYS 42  22  22  LYS LYS A . n 
A 1 43  ARG 43  23  23  ARG ARG A . n 
A 1 44  HIS 44  24  24  HIS HIS A . n 
A 1 45  LEU 45  25  25  LEU LEU A . n 
A 1 46  PRO 46  26  26  PRO PRO A . n 
A 1 47  LYS 47  27  27  LYS LYS A . n 
A 1 48  GLY 48  28  28  GLY GLY A . n 
A 1 49  GLU 49  29  29  GLU GLU A . n 
A 1 50  CYS 50  30  30  CYS CYS A . n 
A 1 51  LEU 51  31  31  LEU LEU A . n 
A 1 52  VAL 52  32  32  VAL VAL A . n 
A 1 53  GLU 53  33  33  GLU GLU A . n 
A 1 54  PRO 54  34  34  PRO PRO A . n 
A 1 55  PHE 55  35  35  PHE PHE A . n 
A 1 56  VAL 56  36  36  VAL VAL A . n 
A 1 57  GLY 57  37  37  GLY GLY A . n 
A 1 58  ALA 58  38  38  ALA ALA A . n 
A 1 59  GLY 59  39  39  GLY GLY A . n 
A 1 60  SER 60  40  40  SER SER A . n 
A 1 61  VAL 61  41  41  VAL VAL A . n 
A 1 62  PHE 62  42  42  PHE PHE A . n 
A 1 63  LEU 63  43  43  LEU LEU A . n 
A 1 64  ASN 64  44  44  ASN ASN A . n 
A 1 65  THR 65  45  45  THR THR A . n 
A 1 66  ASP 66  46  46  ASP ASP A . n 
A 1 67  PHE 67  47  47  PHE PHE A . n 
A 1 68  SER 68  48  48  SER SER A . n 
A 1 69  ARG 69  49  49  ARG ARG A . n 
A 1 70  TYR 70  50  50  TYR TYR A . n 
A 1 71  ILE 71  51  51  ILE ILE A . n 
A 1 72  LEU 72  52  52  LEU LEU A . n 
A 1 73  ALA 73  53  53  ALA ALA A . n 
A 1 74  ASP 74  54  54  ASP ASP A . n 
A 1 75  ILE 75  55  55  ILE ILE A . n 
A 1 76  ASN 76  56  56  ASN ASN A . n 
A 1 77  SER 77  57  57  SER SER A . n 
A 1 78  ASP 78  58  58  ASP ASP A . n 
A 1 79  LEU 79  59  59  LEU LEU A . n 
A 1 80  ILE 80  60  60  ILE ILE A . n 
A 1 81  SER 81  61  61  SER SER A . n 
A 1 82  LEU 82  62  62  LEU LEU A . n 
A 1 83  TYR 83  63  63  TYR TYR A . n 
A 1 84  ASN 84  64  64  ASN ASN A . n 
A 1 85  ILE 85  65  65  ILE ILE A . n 
A 1 86  VAL 86  66  66  VAL VAL A . n 
A 1 87  LYS 87  67  67  LYS LYS A . n 
A 1 88  MET 88  68  68  MET MET A . n 
A 1 89  ARG 89  69  69  ARG ARG A . n 
A 1 90  THR 90  70  70  THR THR A . n 
A 1 91  ASP 91  71  71  ASP ASP A . n 
A 1 92  GLU 92  72  72  GLU GLU A . n 
A 1 93  TYR 93  73  73  TYR TYR A . n 
A 1 94  VAL 94  74  74  VAL VAL A . n 
A 1 95  GLN 95  75  75  GLN GLN A . n 
A 1 96  ALA 96  76  76  ALA ALA A . n 
A 1 97  ALA 97  77  77  ALA ALA A . n 
A 1 98  ARG 98  78  78  ARG ARG A . n 
A 1 99  GLU 99  79  79  GLU GLU A . n 
A 1 100 LEU 100 80  80  LEU LEU A . n 
A 1 101 PHE 101 81  81  PHE PHE A . n 
A 1 102 VAL 102 82  82  VAL VAL A . n 
A 1 103 PRO 103 83  83  PRO PRO A . n 
A 1 104 GLU 104 84  84  GLU GLU A . n 
A 1 105 THR 105 85  85  THR THR A . n 
A 1 106 ASN 106 86  86  ASN ASN A . n 
A 1 107 CYS 107 87  87  CYS CYS A . n 
A 1 108 ALA 108 88  88  ALA ALA A . n 
A 1 109 GLU 109 89  89  GLU GLU A . n 
A 1 110 VAL 110 90  90  VAL VAL A . n 
A 1 111 TYR 111 91  91  TYR TYR A . n 
A 1 112 TYR 112 92  92  TYR TYR A . n 
A 1 113 GLN 113 93  93  GLN GLN A . n 
A 1 114 PHE 114 94  94  PHE PHE A . n 
A 1 115 ARG 115 95  95  ARG ARG A . n 
A 1 116 GLU 116 96  96  GLU GLU A . n 
A 1 117 GLU 117 97  97  GLU GLU A . n 
A 1 118 PHE 118 98  98  PHE PHE A . n 
A 1 119 ASN 119 99  99  ASN ASN A . n 
A 1 120 LYS 120 100 100 LYS LYS A . n 
A 1 121 SER 121 101 101 SER SER A . n 
A 1 122 GLN 122 102 102 GLN GLN A . n 
A 1 123 ASP 123 103 103 ASP ASP A . n 
A 1 124 PRO 124 104 104 PRO PRO A . n 
A 1 125 PHE 125 105 105 PHE PHE A . n 
A 1 126 ARG 126 106 106 ARG ARG A . n 
A 1 127 ARG 127 107 107 ARG ARG A . n 
A 1 128 ALA 128 108 108 ALA ALA A . n 
A 1 129 VAL 129 109 109 VAL VAL A . n 
A 1 130 LEU 130 110 110 LEU LEU A . n 
A 1 131 PHE 131 111 111 PHE PHE A . n 
A 1 132 LEU 132 112 112 LEU LEU A . n 
A 1 133 TYR 133 113 113 TYR TYR A . n 
A 1 134 LEU 134 114 114 LEU LEU A . n 
A 1 135 ASN 135 115 115 ASN ASN A . n 
A 1 136 ARG 136 116 116 ARG ARG A . n 
A 1 137 TYR 137 117 117 TYR TYR A . n 
A 1 138 GLY 138 118 118 GLY GLY A . n 
A 1 139 TYR 139 119 119 TYR TYR A . n 
A 1 140 ASN 140 120 120 ASN ASN A . n 
A 1 141 GLY 141 121 121 GLY GLY A . n 
A 1 142 LEU 142 122 122 LEU LEU A . n 
A 1 143 CYS 143 123 123 CYS CYS A . n 
A 1 144 ARG 144 124 124 ARG ARG A . n 
A 1 145 TYR 145 125 125 TYR TYR A . n 
A 1 146 ASN 146 126 126 ASN ASN A . n 
A 1 147 LEU 147 127 127 LEU LEU A . n 
A 1 148 ARG 148 128 128 ARG ARG A . n 
A 1 149 GLY 149 129 129 GLY GLY A . n 
A 1 150 GLU 150 130 130 GLU GLU A . n 
A 1 151 PHE 151 131 131 PHE PHE A . n 
A 1 152 ASN 152 132 132 ASN ASN A . n 
A 1 153 VAL 153 133 133 VAL VAL A . n 
A 1 154 PRO 154 134 134 PRO PRO A . n 
A 1 155 PHE 155 135 135 PHE PHE A . n 
A 1 156 GLY 156 136 136 GLY GLY A . n 
A 1 157 ARG 157 137 137 ARG ARG A . n 
A 1 158 TYR 158 138 138 TYR TYR A . n 
A 1 159 LYS 159 139 139 LYS LYS A . n 
A 1 160 LYS 160 140 140 LYS LYS A . n 
A 1 161 PRO 161 141 141 PRO PRO A . n 
A 1 162 TYR 162 142 142 TYR TYR A . n 
A 1 163 PHE 163 143 143 PHE PHE A . n 
A 1 164 PRO 164 144 144 PRO PRO A . n 
A 1 165 GLU 165 145 145 GLU GLU A . n 
A 1 166 ALA 166 146 146 ALA ALA A . n 
A 1 167 GLU 167 147 147 GLU GLU A . n 
A 1 168 LEU 168 148 148 LEU LEU A . n 
A 1 169 TYR 169 149 149 TYR TYR A . n 
A 1 170 HIS 170 150 150 HIS HIS A . n 
A 1 171 PHE 171 151 151 PHE PHE A . n 
A 1 172 ALA 172 152 152 ALA ALA A . n 
A 1 173 GLU 173 153 153 GLU GLU A . n 
A 1 174 LYS 174 154 154 LYS LYS A . n 
A 1 175 ALA 175 155 155 ALA ALA A . n 
A 1 176 GLN 176 156 156 GLN GLN A . n 
A 1 177 ASN 177 157 157 ASN ASN A . n 
A 1 178 ALA 178 158 158 ALA ALA A . n 
A 1 179 PHE 179 159 159 PHE PHE A . n 
A 1 180 PHE 180 160 160 PHE PHE A . n 
A 1 181 TYR 181 161 161 TYR TYR A . n 
A 1 182 CYS 182 162 162 CYS CYS A . n 
A 1 183 GLU 183 163 163 GLU GLU A . n 
A 1 184 SER 184 164 164 SER SER A . n 
A 1 185 TYR 185 165 165 TYR TYR A . n 
A 1 186 ALA 186 166 166 ALA ALA A . n 
A 1 187 ASP 187 167 167 ASP ASP A . n 
A 1 188 SER 188 168 168 SER SER A . n 
A 1 189 MET 189 169 169 MET MET A . n 
A 1 190 ALA 190 170 170 ALA ALA A . n 
A 1 191 ARG 191 171 171 ARG ARG A . n 
A 1 192 ALA 192 172 172 ALA ALA A . n 
A 1 193 ASP 193 173 173 ASP ASP A . n 
A 1 194 ASP 194 174 174 ASP ASP A . n 
A 1 195 SER 195 175 175 SER SER A . n 
A 1 196 SER 196 176 176 SER SER A . n 
A 1 197 VAL 197 177 177 VAL VAL A . n 
A 1 198 VAL 198 178 178 VAL VAL A . n 
A 1 199 TYR 199 179 179 TYR TYR A . n 
A 1 200 CYS 200 180 180 CYS CYS A . n 
A 1 201 ASP 201 181 181 ASP ASP A . n 
A 1 202 PRO 202 182 182 PRO PRO A . n 
A 1 203 PRO 203 183 183 PRO PRO A . n 
A 1 204 TYR 204 184 184 TYR TYR A . n 
A 1 205 ALA 205 185 185 ALA ALA A . n 
A 1 206 PRO 206 186 186 PRO PRO A . n 
A 1 207 LEU 207 187 187 LEU LEU A . n 
A 1 208 SER 208 188 188 SER SER A . n 
A 1 209 ALA 209 189 ?   ?   ?   A . n 
A 1 210 THR 210 190 ?   ?   ?   A . n 
A 1 211 ALA 211 191 ?   ?   ?   A . n 
A 1 212 ASN 212 192 ?   ?   ?   A . n 
A 1 213 PHE 213 193 ?   ?   ?   A . n 
A 1 214 THR 214 194 ?   ?   ?   A . n 
A 1 215 ALA 215 195 ?   ?   ?   A . n 
A 1 216 TYR 216 196 ?   ?   ?   A . n 
A 1 217 HIS 217 197 ?   ?   ?   A . n 
A 1 218 THR 218 198 ?   ?   ?   A . n 
A 1 219 ASN 219 199 ?   ?   ?   A . n 
A 1 220 SER 220 200 200 SER SER A . n 
A 1 221 PHE 221 201 201 PHE PHE A . n 
A 1 222 THR 222 202 202 THR THR A . n 
A 1 223 LEU 223 203 203 LEU LEU A . n 
A 1 224 GLU 224 204 204 GLU GLU A . n 
A 1 225 GLN 225 205 205 GLN GLN A . n 
A 1 226 GLN 226 206 206 GLN GLN A . n 
A 1 227 ALA 227 207 207 ALA ALA A . n 
A 1 228 HIS 228 208 208 HIS HIS A . n 
A 1 229 LEU 229 209 209 LEU LEU A . n 
A 1 230 ALA 230 210 210 ALA ALA A . n 
A 1 231 GLU 231 211 211 GLU GLU A . n 
A 1 232 ILE 232 212 212 ILE ILE A . n 
A 1 233 ALA 233 213 213 ALA ALA A . n 
A 1 234 GLU 234 214 214 GLU GLU A . n 
A 1 235 GLY 235 215 215 GLY GLY A . n 
A 1 236 LEU 236 216 216 LEU LEU A . n 
A 1 237 VAL 237 217 217 VAL VAL A . n 
A 1 238 GLU 238 218 218 GLU GLU A . n 
A 1 239 ARG 239 219 219 ARG ARG A . n 
A 1 240 HIS 240 220 220 HIS HIS A . n 
A 1 241 ILE 241 221 221 ILE ILE A . n 
A 1 242 PRO 242 222 222 PRO PRO A . n 
A 1 243 VAL 243 223 223 VAL VAL A . n 
A 1 244 LEU 244 224 224 LEU LEU A . n 
A 1 245 ILE 245 225 225 ILE ILE A . n 
A 1 246 SER 246 226 226 SER SER A . n 
A 1 247 ASN 247 227 227 ASN ASN A . n 
A 1 248 HIS 248 228 228 HIS HIS A . n 
A 1 249 ASP 249 229 229 ASP ASP A . n 
A 1 250 THR 250 230 230 THR THR A . n 
A 1 251 MET 251 231 231 MET MET A . n 
A 1 252 LEU 252 232 232 LEU LEU A . n 
A 1 253 THR 253 233 233 THR THR A . n 
A 1 254 ARG 254 234 234 ARG ARG A . n 
A 1 255 GLU 255 235 235 GLU GLU A . n 
A 1 256 TRP 256 236 236 TRP TRP A . n 
A 1 257 TYR 257 237 237 TYR TYR A . n 
A 1 258 GLN 258 238 238 GLN GLN A . n 
A 1 259 ARG 259 239 239 ARG ARG A . n 
A 1 260 ALA 260 240 240 ALA ALA A . n 
A 1 261 LYS 261 241 241 LYS LYS A . n 
A 1 262 LEU 262 242 242 LEU LEU A . n 
A 1 263 HIS 263 243 243 HIS HIS A . n 
A 1 264 VAL 264 244 244 VAL VAL A . n 
A 1 265 VAL 265 245 245 VAL VAL A . n 
A 1 266 LYS 266 246 246 LYS LYS A . n 
A 1 267 VAL 267 247 247 VAL VAL A . n 
A 1 268 ARG 268 248 ?   ?   ?   A . n 
A 1 269 ARG 269 249 ?   ?   ?   A . n 
A 1 270 SER 270 250 ?   ?   ?   A . n 
A 1 271 ILE 271 251 ?   ?   ?   A . n 
A 1 272 SER 272 252 ?   ?   ?   A . n 
A 1 273 SER 273 253 ?   ?   ?   A . n 
A 1 274 ASN 274 254 ?   ?   ?   A . n 
A 1 275 GLY 275 255 ?   ?   ?   A . n 
A 1 276 GLY 276 256 ?   ?   ?   A . n 
A 1 277 THR 277 257 ?   ?   ?   A . n 
A 1 278 ARG 278 258 ?   ?   ?   A . n 
A 1 279 LYS 279 259 259 LYS LYS A . n 
A 1 280 LYS 280 260 260 LYS LYS A . n 
A 1 281 VAL 281 261 261 VAL VAL A . n 
A 1 282 ASP 282 262 262 ASP ASP A . n 
A 1 283 GLU 283 263 263 GLU GLU A . n 
A 1 284 LEU 284 264 264 LEU LEU A . n 
A 1 285 LEU 285 265 265 LEU LEU A . n 
A 1 286 ALA 286 266 266 ALA ALA A . n 
A 1 287 LEU 287 267 267 LEU LEU A . n 
A 1 288 TYR 288 268 268 TYR TYR A . n 
A 1 289 LYS 289 269 269 LYS LYS A . n 
A 1 290 PRO 290 270 270 PRO PRO A . n 
A 1 291 GLY 291 271 ?   ?   ?   A . n 
A 1 292 VAL 292 272 ?   ?   ?   A . n 
A 1 293 VAL 293 273 ?   ?   ?   A . n 
A 1 294 SER 294 274 ?   ?   ?   A . n 
A 1 295 PRO 295 275 ?   ?   ?   A . n 
A 1 296 ALA 296 276 ?   ?   ?   A . n 
A 1 297 LYS 297 277 ?   ?   ?   A . n 
A 1 298 LYS 298 278 ?   ?   ?   A . n 
B 2 1   DT  1   1   1   DT  DT  F . n 
B 2 2   DT  2   2   2   DT  DT  F . n 
B 2 3   DT  3   3   3   DT  DT  F . n 
B 2 4   DA  4   4   4   DA  DA  F . n 
B 2 5   DA  5   5   5   DA  DA  F . n 
B 2 6   DA  6   6   6   DA  DA  F . n 
B 2 7   DG  7   7   7   DG  DG  F . n 
B 2 8   DA  8   8   8   DA  DA  F . n 
B 2 9   DT  9   9   9   DT  DT  F . n 
B 2 10  DC  10  10  10  DC  DC  F . n 
B 2 11  DG  11  11  11  DG  DG  F . n 
C 3 1   DA  1   1   1   DA  DA  G . n 
C 3 2   DC  2   2   2   DC  DC  G . n 
C 3 3   DG  3   3   3   DG  DG  G . n 
C 3 4   DA  4   4   4   DA  DA  G . n 
C 3 5   DT  5   5   5   DT  DT  G . n 
C 3 6   DC  6   6   6   DC  DC  G . n 
C 3 7   DT  7   7   7   DT  DT  G . n 
C 3 8   DT  8   8   8   DT  DT  G . n 
C 3 9   DT  9   9   9   DT  DT  G . n 
C 3 10  DA  10  10  10  DA  DA  G . n 
C 3 11  DA  11  11  11  DA  DA  G . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-04-15 
2 'Structure model' 1 1 2015-04-22 
3 'Structure model' 1 2 2015-05-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined -13.2432 3.2239  91.8708  0.5254 0.6007 0.6244 0.0367  -0.0704 0.0617  4.0195 1.6041 2.9533 
2.4135  3.4785  2.1766  -0.3338 0.1817  0.1285  0.9983  0.1085  0.9918  -0.3290 0.3062  -0.0146 
'X-RAY DIFFRACTION' 2  ? refined -9.3548  -7.3211 94.4852  0.4408 0.3578 0.6142 -0.0446 -0.1733 0.0590  3.4582 5.0288 4.6851 
-1.1216 -0.7280 0.8093  0.2701  0.0494  -0.2861 0.2842  -0.8442 0.9823  -0.5848 0.4505  -0.6989 
'X-RAY DIFFRACTION' 3  ? refined -10.2912 10.2795 111.1808 0.3948 0.5854 0.4155 0.0805  0.0728  -0.0075 6.4805 6.2796 6.7469 
2.5017  -0.6214 -1.2493 0.0058  0.0037  0.1174  -1.1112 0.3626  0.8017  1.5384  -0.2368 -0.7624 
'X-RAY DIFFRACTION' 4  ? refined -0.2557  12.2130 104.0441 0.2453 0.2480 0.3247 0.0386  -0.0251 -0.0394 6.6091 5.5004 5.5449 
0.0377  -2.4241 -1.8643 -0.0358 0.1250  -0.0911 -0.2346 0.4558  -0.1538 0.4193  -0.3227 0.1338  
'X-RAY DIFFRACTION' 5  ? refined -3.2363  14.5031 99.6244  0.3993 0.2676 0.2601 0.0641  -0.0423 0.0094  4.9641 6.0121 4.4530 
1.0199  -1.6531 -1.0985 -0.0804 0.2287  -0.2134 -0.1527 0.6455  0.0642  0.3011  -0.5269 -0.3012 
'X-RAY DIFFRACTION' 6  ? refined -11.9402 -5.3583 103.0917 0.3835 0.4925 0.5718 -0.1070 -0.0557 0.1245  6.8441 9.0623 4.6974 
-3.1631 0.5412  2.2214  0.0545  -0.0260 -0.0338 -0.6170 -1.3862 1.5877  0.4890  0.6492  -0.6220 
'X-RAY DIFFRACTION' 7  ? refined -0.9195  -9.9871 83.4524  0.7270 0.6336 0.5065 0.1816  -0.0858 -0.1458 5.1120 2.6822 4.9134 
-1.5352 0.6494  1.1736  0.3920  -0.3353 -0.1305 0.8200  -0.6994 0.2002  -0.7492 0.8527  0.4293  
'X-RAY DIFFRACTION' 8  ? refined -5.4756  -6.2965 71.8048  1.3076 1.2669 0.5144 0.4899  -0.1885 -0.2006 1.0218 2.0059 1.8547 
-0.0865 -1.2764 0.9003  0.3326  -0.3748 0.0887  0.6635  -0.2376 0.5412  -1.2095 0.9107  -0.2842 
'X-RAY DIFFRACTION' 9  ? refined -10.0183 -5.2132 75.5983  0.7836 0.9385 0.7124 0.1049  -0.3123 -0.1703 5.4335 9.0025 2.6798 
-3.9621 -0.3654 0.8989  0.6754  -0.6363 0.0830  0.8155  -0.0853 -0.6186 1.0053  0.4369  -0.2058 
'X-RAY DIFFRACTION' 10 ? refined 19.8318  18.7072 85.9639  0.4738 0.8174 0.7701 -0.0473 0.0852  0.1900  2.4968 2.3336 2.6173 
0.2524  -1.9876 -0.5418 -0.4225 0.0259  0.3674  1.2738  0.7669  -0.3663 -0.5194 0.0627  0.0430  
'X-RAY DIFFRACTION' 11 ? refined 17.0019  18.5555 86.1399  0.4834 0.7638 0.7594 -0.0989 0.0752  0.0774  2.2431 4.7734 4.2346 
-2.8375 0.2681  -1.2516 -0.0492 0.1145  0.0914  0.7397  0.9331  -0.6654 -0.6958 -0.0034 0.0502  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 3   A 17  '( CHAIN A AND RESID 3:17 )'    ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 18  A 68  '( CHAIN A AND RESID 18:68 )'   ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 69  A 87  '( CHAIN A AND RESID 69:87 )'   ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 88  A 126 '( CHAIN A AND RESID 88:126 )'  ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 127 A 144 '( CHAIN A AND RESID 127:144 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 145 A 162 '( CHAIN A AND RESID 145:162 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 163 A 228 '( CHAIN A AND RESID 163:228 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 229 A 245 '( CHAIN A AND RESID 229:245 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 246 A 270 '( CHAIN A AND RESID 246:270 )' ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 F 1   F 11  '( CHAIN F AND RESID 1:11 )'    ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 G 1   G 11  '( CHAIN G AND RESID 1:11 )'    ? ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SERGUI   'data collection' .                           ? 1 
GLRF     phasing           .                           ? 2 
PHENIX   refinement        '(phenix.refine: 1.9_1692)' ? 3 
HKL-2000 'data reduction'  .                           ? 4 
HKL-2000 'data scaling'    .                           ? 5 
# 
_pdbx_entry_details.entry_id             4RTP 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
'AUTHOR STATES THAT RESIDUES 175 WERE MODELED AS SER INSTEAD OF ALA BECAUSE OF EXTRA DENSITY.' 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     173 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -127.00 
_pdbx_validate_torsion.psi             -169.24 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 14  ? CG  ? A LYS 34  CG  
2  1 Y 1 A LYS 14  ? CD  ? A LYS 34  CD  
3  1 Y 1 A LYS 14  ? CE  ? A LYS 34  CE  
4  1 Y 1 A LYS 14  ? NZ  ? A LYS 34  NZ  
5  1 Y 1 A ASP 20  ? CG  ? A ASP 40  CG  
6  1 Y 1 A ASP 20  ? OD1 ? A ASP 40  OD1 
7  1 Y 1 A ASP 20  ? OD2 ? A ASP 40  OD2 
8  1 Y 1 A ARG 23  ? CG  ? A ARG 43  CG  
9  1 Y 1 A ARG 23  ? CD  ? A ARG 43  CD  
10 1 Y 1 A ARG 23  ? NE  ? A ARG 43  NE  
11 1 Y 1 A ARG 23  ? CZ  ? A ARG 43  CZ  
12 1 Y 1 A ARG 23  ? NH1 ? A ARG 43  NH1 
13 1 Y 1 A ARG 23  ? NH2 ? A ARG 43  NH2 
14 1 Y 1 A LYS 27  ? CG  ? A LYS 47  CG  
15 1 Y 1 A LYS 27  ? CD  ? A LYS 47  CD  
16 1 Y 1 A LYS 27  ? CE  ? A LYS 47  CE  
17 1 Y 1 A LYS 27  ? NZ  ? A LYS 47  NZ  
18 1 Y 1 A GLU 29  ? CG  ? A GLU 49  CG  
19 1 Y 1 A GLU 29  ? CD  ? A GLU 49  CD  
20 1 Y 1 A GLU 29  ? OE1 ? A GLU 49  OE1 
21 1 Y 1 A GLU 29  ? OE2 ? A GLU 49  OE2 
22 1 Y 1 A GLN 75  ? CG  ? A GLN 95  CG  
23 1 Y 1 A GLN 75  ? CD  ? A GLN 95  CD  
24 1 Y 1 A GLN 75  ? OE1 ? A GLN 95  OE1 
25 1 Y 1 A GLN 75  ? NE2 ? A GLN 95  NE2 
26 1 Y 1 A ARG 137 ? CG  ? A ARG 157 CG  
27 1 Y 1 A ARG 137 ? CD  ? A ARG 157 CD  
28 1 Y 1 A ARG 137 ? NE  ? A ARG 157 NE  
29 1 Y 1 A ARG 137 ? CZ  ? A ARG 157 CZ  
30 1 Y 1 A ARG 137 ? NH1 ? A ARG 157 NH1 
31 1 Y 1 A ARG 137 ? NH2 ? A ARG 157 NH2 
32 1 Y 1 A LYS 139 ? CG  ? A LYS 159 CG  
33 1 Y 1 A LYS 139 ? CD  ? A LYS 159 CD  
34 1 Y 1 A LYS 139 ? CE  ? A LYS 159 CE  
35 1 Y 1 A LYS 139 ? NZ  ? A LYS 159 NZ  
36 1 Y 1 A LYS 140 ? CG  ? A LYS 160 CG  
37 1 Y 1 A LYS 140 ? CD  ? A LYS 160 CD  
38 1 Y 1 A LYS 140 ? CE  ? A LYS 160 CE  
39 1 Y 1 A LYS 140 ? NZ  ? A LYS 160 NZ  
40 1 Y 1 A ASP 174 ? CG  ? A ASP 194 CG  
41 1 Y 1 A ASP 174 ? OD1 ? A ASP 194 OD1 
42 1 Y 1 A ASP 174 ? OD2 ? A ASP 194 OD2 
43 1 Y 1 A SER 175 ? OG  ? A SER 195 OG  
44 1 Y 1 A LEU 187 ? CG  ? A LEU 207 CG  
45 1 Y 1 A LEU 187 ? CD1 ? A LEU 207 CD1 
46 1 Y 1 A LEU 187 ? CD2 ? A LEU 207 CD2 
47 1 Y 1 A SER 188 ? OG  ? A SER 208 OG  
48 1 Y 1 A SER 200 ? OG  ? A SER 220 OG  
49 1 Y 1 A GLU 218 ? CG  ? A GLU 238 CG  
50 1 Y 1 A GLU 218 ? CD  ? A GLU 238 CD  
51 1 Y 1 A GLU 218 ? OE1 ? A GLU 238 OE1 
52 1 Y 1 A GLU 218 ? OE2 ? A GLU 238 OE2 
53 1 Y 1 A ARG 219 ? CG  ? A ARG 239 CG  
54 1 Y 1 A ARG 219 ? CD  ? A ARG 239 CD  
55 1 Y 1 A ARG 219 ? NE  ? A ARG 239 NE  
56 1 Y 1 A ARG 219 ? CZ  ? A ARG 239 CZ  
57 1 Y 1 A ARG 219 ? NH1 ? A ARG 239 NH1 
58 1 Y 1 A ARG 219 ? NH2 ? A ARG 239 NH2 
59 1 Y 1 A MET 231 ? CG  ? A MET 251 CG  
60 1 Y 1 A MET 231 ? SD  ? A MET 251 SD  
61 1 Y 1 A MET 231 ? CE  ? A MET 251 CE  
62 1 Y 1 A GLU 235 ? CG  ? A GLU 255 CG  
63 1 Y 1 A GLU 235 ? CD  ? A GLU 255 CD  
64 1 Y 1 A GLU 235 ? OE1 ? A GLU 255 OE1 
65 1 Y 1 A GLU 235 ? OE2 ? A GLU 255 OE2 
66 1 Y 1 A ARG 239 ? CG  ? A ARG 259 CG  
67 1 Y 1 A ARG 239 ? CD  ? A ARG 259 CD  
68 1 Y 1 A ARG 239 ? NE  ? A ARG 259 NE  
69 1 Y 1 A ARG 239 ? CZ  ? A ARG 259 CZ  
70 1 Y 1 A ARG 239 ? NH1 ? A ARG 259 NH1 
71 1 Y 1 A ARG 239 ? NH2 ? A ARG 259 NH2 
72 1 Y 1 A LYS 241 ? CG  ? A LYS 261 CG  
73 1 Y 1 A LYS 241 ? CD  ? A LYS 261 CD  
74 1 Y 1 A LYS 241 ? CE  ? A LYS 261 CE  
75 1 Y 1 A LYS 241 ? NZ  ? A LYS 261 NZ  
76 1 Y 1 A LYS 246 ? CG  ? A LYS 266 CG  
77 1 Y 1 A LYS 246 ? CD  ? A LYS 266 CD  
78 1 Y 1 A LYS 246 ? CE  ? A LYS 266 CE  
79 1 Y 1 A LYS 246 ? NZ  ? A LYS 266 NZ  
80 1 Y 1 A VAL 247 ? CG1 ? A VAL 267 CG1 
81 1 Y 1 A VAL 247 ? CG2 ? A VAL 267 CG2 
82 1 Y 1 A LYS 259 ? CG  ? A LYS 279 CG  
83 1 Y 1 A LYS 259 ? CD  ? A LYS 279 CD  
84 1 Y 1 A LYS 259 ? CE  ? A LYS 279 CE  
85 1 Y 1 A LYS 259 ? NZ  ? A LYS 279 NZ  
86 1 Y 1 A LYS 260 ? CG  ? A LYS 280 CG  
87 1 Y 1 A LYS 260 ? CD  ? A LYS 280 CD  
88 1 Y 1 A LYS 260 ? CE  ? A LYS 280 CE  
89 1 Y 1 A LYS 260 ? NZ  ? A LYS 280 NZ  
90 1 Y 1 A ASP 262 ? CG  ? A ASP 282 CG  
91 1 Y 1 A ASP 262 ? OD1 ? A ASP 282 OD1 
92 1 Y 1 A ASP 262 ? OD2 ? A ASP 282 OD2 
93 1 Y 1 A LYS 269 ? CG  ? A LYS 289 CG  
94 1 Y 1 A LYS 269 ? CD  ? A LYS 289 CD  
95 1 Y 1 A LYS 269 ? CE  ? A LYS 289 CE  
96 1 Y 1 A LYS 269 ? NZ  ? A LYS 289 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1   
2  1 Y 1 A GLY -18 ? A GLY 2   
3  1 Y 1 A SER -17 ? A SER 3   
4  1 Y 1 A SER -16 ? A SER 4   
5  1 Y 1 A HIS -15 ? A HIS 5   
6  1 Y 1 A HIS -14 ? A HIS 6   
7  1 Y 1 A HIS -13 ? A HIS 7   
8  1 Y 1 A HIS -12 ? A HIS 8   
9  1 Y 1 A HIS -11 ? A HIS 9   
10 1 Y 1 A HIS -10 ? A HIS 10  
11 1 Y 1 A SER -9  ? A SER 11  
12 1 Y 1 A SER -8  ? A SER 12  
13 1 Y 1 A GLY -7  ? A GLY 13  
14 1 Y 1 A LEU -6  ? A LEU 14  
15 1 Y 1 A VAL -5  ? A VAL 15  
16 1 Y 1 A PRO -4  ? A PRO 16  
17 1 Y 1 A ARG -3  ? A ARG 17  
18 1 Y 1 A GLY -2  ? A GLY 18  
19 1 Y 1 A SER -1  ? A SER 19  
20 1 Y 1 A HIS 0   ? A HIS 20  
21 1 Y 1 A MET 1   ? A MET 21  
22 1 Y 1 A LYS 2   ? A LYS 22  
23 1 Y 1 A ALA 189 ? A ALA 209 
24 1 Y 1 A THR 190 ? A THR 210 
25 1 Y 1 A ALA 191 ? A ALA 211 
26 1 Y 1 A ASN 192 ? A ASN 212 
27 1 Y 1 A PHE 193 ? A PHE 213 
28 1 Y 1 A THR 194 ? A THR 214 
29 1 Y 1 A ALA 195 ? A ALA 215 
30 1 Y 1 A TYR 196 ? A TYR 216 
31 1 Y 1 A HIS 197 ? A HIS 217 
32 1 Y 1 A THR 198 ? A THR 218 
33 1 Y 1 A ASN 199 ? A ASN 219 
34 1 Y 1 A ARG 248 ? A ARG 268 
35 1 Y 1 A ARG 249 ? A ARG 269 
36 1 Y 1 A SER 250 ? A SER 270 
37 1 Y 1 A ILE 251 ? A ILE 271 
38 1 Y 1 A SER 252 ? A SER 272 
39 1 Y 1 A SER 253 ? A SER 273 
40 1 Y 1 A ASN 254 ? A ASN 274 
41 1 Y 1 A GLY 255 ? A GLY 275 
42 1 Y 1 A GLY 256 ? A GLY 276 
43 1 Y 1 A THR 257 ? A THR 277 
44 1 Y 1 A ARG 258 ? A ARG 278 
45 1 Y 1 A GLY 271 ? A GLY 291 
46 1 Y 1 A VAL 272 ? A VAL 292 
47 1 Y 1 A VAL 273 ? A VAL 293 
48 1 Y 1 A SER 274 ? A SER 294 
49 1 Y 1 A PRO 275 ? A PRO 295 
50 1 Y 1 A ALA 276 ? A ALA 296 
51 1 Y 1 A LYS 277 ? A LYS 297 
52 1 Y 1 A LYS 278 ? A LYS 298 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4RTP 'double helix'        
4RTP 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 2  1_555 C DA 11 1_555 -0.502 -0.061 -0.188 -18.619 -17.487 -6.559 1  F_DT2:DA11_G F 2  ? G 11 ? 20 1 
1 B DT 3  1_555 C DA 10 1_555 -0.284 0.028  0.132  -6.839  -11.942 8.969  2  F_DT3:DA10_G F 3  ? G 10 ? 20 1 
1 B DA 4  1_555 C DT 9  1_555 0.681  0.037  0.120  3.580   -18.441 10.279 3  F_DA4:DT9_G  F 4  ? G 9  ? 20 1 
1 B DA 5  1_555 C DT 8  1_555 0.128  -0.091 0.388  12.380  -21.152 3.377  4  F_DA5:DT8_G  F 5  ? G 8  ? 20 1 
1 B DA 6  1_555 C DT 7  1_555 0.310  -0.166 0.313  7.287   -13.926 1.134  5  F_DA6:DT7_G  F 6  ? G 7  ? 20 1 
1 B DG 7  1_555 C DC 6  1_555 0.014  -0.165 0.268  -1.983  -29.382 1.905  6  F_DG7:DC6_G  F 7  ? G 6  ? 19 1 
1 B DA 8  1_555 C DT 5  1_555 0.234  -0.030 0.058  -14.164 -10.121 9.847  7  F_DA8:DT5_G  F 8  ? G 5  ? 20 1 
1 B DT 9  1_555 C DA 4  1_555 -0.328 -0.149 0.626  -13.089 -13.957 9.259  8  F_DT9:DA4_G  F 9  ? G 4  ? 20 1 
1 B DC 10 1_555 C DG 3  1_555 0.306  -0.283 -0.040 -0.954  5.682   6.326  9  F_DC10:DG3_G F 10 ? G 3  ? 19 1 
1 B DG 11 1_555 C DC 2  1_555 -0.288 -0.193 0.093  10.515  -11.351 5.171  10 F_DG11:DC2_G F 11 ? G 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 2  1_555 C DA 11 1_555 B DT 3  1_555 C DA 10 1_555 0.788  0.102  3.123 -2.732 5.394  30.741 -0.775 -1.949 3.017 10.054  
5.091  31.315 1 FF_DT2DT3:DA10DA11_GG F 2  ? G 11 ? F 3  ? G 10 ? 
1 B DT 3  1_555 C DA 10 1_555 B DA 4  1_555 C DT 9  1_555 0.097  1.177  3.323 2.520  7.322  35.317 0.809  0.219  3.488 11.893  
-4.094 36.130 2 FF_DT3DA4:DT9DA10_GG  F 3  ? G 10 ? F 4  ? G 9  ? 
1 B DA 4  1_555 C DT 9  1_555 B DA 5  1_555 C DT 8  1_555 -0.197 -0.235 2.932 -1.157 6.529  29.117 -1.666 0.169  2.819 12.778  
2.264  29.847 3 FF_DA4DA5:DT8DT9_GG   F 4  ? G 9  ? F 5  ? G 8  ? 
1 B DA 5  1_555 C DT 8  1_555 B DA 6  1_555 C DT 7  1_555 0.347  -0.892 3.321 0.065  -3.950 34.803 -0.871 -0.567 3.399 -6.577  
-0.108 35.020 4 FF_DA5DA6:DT7DT8_GG   F 5  ? G 8  ? F 6  ? G 7  ? 
1 B DA 6  1_555 C DT 7  1_555 B DG 7  1_555 C DC 6  1_555 0.106  -0.876 3.479 -2.429 7.277  35.195 -2.491 -0.530 3.226 11.861  
3.959  35.996 5 FF_DA6DG7:DC6DT7_GG   F 6  ? G 7  ? F 7  ? G 6  ? 
1 B DG 7  1_555 C DC 6  1_555 B DA 8  1_555 C DT 5  1_555 0.078  -0.355 3.574 -0.279 -7.998 37.605 0.561  -0.157 3.572 -12.237 
0.428  38.417 6 FF_DG7DA8:DT5DC6_GG   F 7  ? G 6  ? F 8  ? G 5  ? 
1 B DA 8  1_555 C DT 5  1_555 B DT 9  1_555 C DA 4  1_555 -0.137 -0.732 3.284 -2.203 2.468  30.285 -1.885 -0.177 3.217 4.706   
4.200  30.461 7 FF_DA8DT9:DA4DT5_GG   F 8  ? G 5  ? F 9  ? G 4  ? 
1 B DT 9  1_555 C DA 4  1_555 B DC 10 1_555 C DG 3  1_555 0.893  1.263  3.158 5.234  6.564  35.162 1.091  -0.686 3.424 10.679  
-8.514 36.119 8 FF_DT9DC10:DG3DA4_GG  F 9  ? G 4  ? F 10 ? G 3  ? 
1 B DC 10 1_555 C DG 3  1_555 B DG 11 1_555 C DC 2  1_555 -0.490 0.736  3.062 -2.535 5.363  31.851 0.412  0.449  3.169 9.668   
4.571  32.385 9 FF_DC10DG11:DC2DG3_GG F 10 ? G 3  ? F 11 ? G 2  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 S-ADENOSYLMETHIONINE SAM 
5 water                HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 SAM 1  301 301 SAM SAM A . 
E 5 HOH 1  401 1   HOH HOH A . 
E 5 HOH 2  402 2   HOH HOH A . 
E 5 HOH 3  403 3   HOH HOH A . 
E 5 HOH 4  404 4   HOH HOH A . 
E 5 HOH 5  405 5   HOH HOH A . 
E 5 HOH 6  406 6   HOH HOH A . 
E 5 HOH 7  407 7   HOH HOH A . 
E 5 HOH 8  408 8   HOH HOH A . 
E 5 HOH 9  409 9   HOH HOH A . 
E 5 HOH 10 410 10  HOH HOH A . 
E 5 HOH 11 411 11  HOH HOH A . 
E 5 HOH 12 412 12  HOH HOH A . 
E 5 HOH 13 413 13  HOH HOH A . 
E 5 HOH 14 414 14  HOH HOH A . 
E 5 HOH 15 415 15  HOH HOH A . 
E 5 HOH 16 416 16  HOH HOH A . 
E 5 HOH 17 417 18  HOH HOH A . 
E 5 HOH 18 418 19  HOH HOH A . 
E 5 HOH 19 419 20  HOH HOH A . 
E 5 HOH 20 420 23  HOH HOH A . 
E 5 HOH 21 421 24  HOH HOH A . 
E 5 HOH 22 422 26  HOH HOH A . 
E 5 HOH 23 423 27  HOH HOH A . 
F 5 HOH 1  101 21  HOH HOH F . 
F 5 HOH 2  102 25  HOH HOH F . 
#