data_4RYD
# 
_entry.id   4RYD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
RCSB  RCSB087948   
PDB   4RYD         
WWPDB D_1000087948 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 4OMC 'X-ray structure of human furin in complex with the competitive inhibitor meta-guanidinomethyl-Phac-RVR-Amba' unspecified 
PDB 4OMD 'X-ray structure of human furin in complex with the competitive inhibitor Phac-RVR-Amba'                      unspecified 
PDB 1P8J 'CRYSTAL STRUCTURE OF THE PROPROTEIN CONVERTASE FURIN'                                                        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4RYD 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dahms, S.O.' 1 
'Than, M.E.'  2 
# 
_citation.id                        primary 
_citation.title                     'Novel Furin Inhibitors with Potent Anti-infectious Activity.' 
_citation.journal_abbrev            Chemmedchem 
_citation.journal_volume            10 
_citation.page_first                1218 
_citation.page_last                 1231 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   DE 
_citation.journal_id_ISSN           1860-7179 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25974265 
_citation.pdbx_database_id_DOI      10.1002/cmdc.201500103 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hardes, K.'       1  
primary 'Becker, G.L.'     2  
primary 'Lu, Y.'           3  
primary 'Dahms, S.O.'      4  
primary 'Kohler, S.'       5  
primary 'Beyer, W.'        6  
primary 'Sandvig, K.'      7  
primary 'Yamamoto, H.'     8  
primary 'Lindberg, I.'     9  
primary 'Walz, L.'         10 
primary 'von Messling, V.' 11 
primary 'Than, M.E.'       12 
primary 'Garten, W.'       13 
primary 'Steinmetzer, T.'  14 
# 
_cell.entry_id           4RYD 
_cell.length_a           141.652 
_cell.length_b           152.701 
_cell.length_c           168.398 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              24 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RYD 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Furin                                                                                 52388.602 6    3.4.21.75 ? 
'UNP residues 108-574' ? 
2 polymer     syn 'para-guanidinomethyl-phenylacetyl-Arg-(3-methylvaline)-Arg-(amidomethyl)benzamidine' 749.953   6    ?         ? 
?                      ? 
3 non-polymer syn 'FORMIC ACID'                                                                         46.025    18   ?         ? 
?                      ? 
4 non-polymer syn 'CALCIUM ION'                                                                         40.078    18   ?         ? 
?                      ? 
5 non-polymer syn 'SODIUM ION'                                                                          22.990    6    ?         ? 
?                      ? 
6 water       nat water                                                                                 18.015    2034 ?         ? 
?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dibasic-processing enzyme, Paired basic amino acid residue-cleaving enzyme, PACE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTASGSLVPRGSHHHH
HH
;
A,B,C,D,E,F ? 
2 'polypeptide(L)' no yes '(2UE)R(TBG)R(00S)' XRVRX H,I,J,K,L,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   VAL n 
1 3   TYR n 
1 4   GLN n 
1 5   GLU n 
1 6   PRO n 
1 7   THR n 
1 8   ASP n 
1 9   PRO n 
1 10  LYS n 
1 11  PHE n 
1 12  PRO n 
1 13  GLN n 
1 14  GLN n 
1 15  TRP n 
1 16  TYR n 
1 17  LEU n 
1 18  SER n 
1 19  GLY n 
1 20  VAL n 
1 21  THR n 
1 22  GLN n 
1 23  ARG n 
1 24  ASP n 
1 25  LEU n 
1 26  ASN n 
1 27  VAL n 
1 28  LYS n 
1 29  ALA n 
1 30  ALA n 
1 31  TRP n 
1 32  ALA n 
1 33  GLN n 
1 34  GLY n 
1 35  TYR n 
1 36  THR n 
1 37  GLY n 
1 38  HIS n 
1 39  GLY n 
1 40  ILE n 
1 41  VAL n 
1 42  VAL n 
1 43  SER n 
1 44  ILE n 
1 45  LEU n 
1 46  ASP n 
1 47  ASP n 
1 48  GLY n 
1 49  ILE n 
1 50  GLU n 
1 51  LYS n 
1 52  ASN n 
1 53  HIS n 
1 54  PRO n 
1 55  ASP n 
1 56  LEU n 
1 57  ALA n 
1 58  GLY n 
1 59  ASN n 
1 60  TYR n 
1 61  ASP n 
1 62  PRO n 
1 63  GLY n 
1 64  ALA n 
1 65  SER n 
1 66  PHE n 
1 67  ASP n 
1 68  VAL n 
1 69  ASN n 
1 70  ASP n 
1 71  GLN n 
1 72  ASP n 
1 73  PRO n 
1 74  ASP n 
1 75  PRO n 
1 76  GLN n 
1 77  PRO n 
1 78  ARG n 
1 79  TYR n 
1 80  THR n 
1 81  GLN n 
1 82  MET n 
1 83  ASN n 
1 84  ASP n 
1 85  ASN n 
1 86  ARG n 
1 87  HIS n 
1 88  GLY n 
1 89  THR n 
1 90  ARG n 
1 91  CYS n 
1 92  ALA n 
1 93  GLY n 
1 94  GLU n 
1 95  VAL n 
1 96  ALA n 
1 97  ALA n 
1 98  VAL n 
1 99  ALA n 
1 100 ASN n 
1 101 ASN n 
1 102 GLY n 
1 103 VAL n 
1 104 CYS n 
1 105 GLY n 
1 106 VAL n 
1 107 GLY n 
1 108 VAL n 
1 109 ALA n 
1 110 TYR n 
1 111 ASN n 
1 112 ALA n 
1 113 ARG n 
1 114 ILE n 
1 115 GLY n 
1 116 GLY n 
1 117 VAL n 
1 118 ARG n 
1 119 MET n 
1 120 LEU n 
1 121 ASP n 
1 122 GLY n 
1 123 GLU n 
1 124 VAL n 
1 125 THR n 
1 126 ASP n 
1 127 ALA n 
1 128 VAL n 
1 129 GLU n 
1 130 ALA n 
1 131 ARG n 
1 132 SER n 
1 133 LEU n 
1 134 GLY n 
1 135 LEU n 
1 136 ASN n 
1 137 PRO n 
1 138 ASN n 
1 139 HIS n 
1 140 ILE n 
1 141 HIS n 
1 142 ILE n 
1 143 TYR n 
1 144 SER n 
1 145 ALA n 
1 146 SER n 
1 147 TRP n 
1 148 GLY n 
1 149 PRO n 
1 150 GLU n 
1 151 ASP n 
1 152 ASP n 
1 153 GLY n 
1 154 LYS n 
1 155 THR n 
1 156 VAL n 
1 157 ASP n 
1 158 GLY n 
1 159 PRO n 
1 160 ALA n 
1 161 ARG n 
1 162 LEU n 
1 163 ALA n 
1 164 GLU n 
1 165 GLU n 
1 166 ALA n 
1 167 PHE n 
1 168 PHE n 
1 169 ARG n 
1 170 GLY n 
1 171 VAL n 
1 172 SER n 
1 173 GLN n 
1 174 GLY n 
1 175 ARG n 
1 176 GLY n 
1 177 GLY n 
1 178 LEU n 
1 179 GLY n 
1 180 SER n 
1 181 ILE n 
1 182 PHE n 
1 183 VAL n 
1 184 TRP n 
1 185 ALA n 
1 186 SER n 
1 187 GLY n 
1 188 ASN n 
1 189 GLY n 
1 190 GLY n 
1 191 ARG n 
1 192 GLU n 
1 193 HIS n 
1 194 ASP n 
1 195 SER n 
1 196 CYS n 
1 197 ASN n 
1 198 CYS n 
1 199 ASP n 
1 200 GLY n 
1 201 TYR n 
1 202 THR n 
1 203 ASN n 
1 204 SER n 
1 205 ILE n 
1 206 TYR n 
1 207 THR n 
1 208 LEU n 
1 209 SER n 
1 210 ILE n 
1 211 SER n 
1 212 SER n 
1 213 ALA n 
1 214 THR n 
1 215 GLN n 
1 216 PHE n 
1 217 GLY n 
1 218 ASN n 
1 219 VAL n 
1 220 PRO n 
1 221 TRP n 
1 222 TYR n 
1 223 SER n 
1 224 GLU n 
1 225 ALA n 
1 226 CYS n 
1 227 SER n 
1 228 SER n 
1 229 THR n 
1 230 LEU n 
1 231 ALA n 
1 232 THR n 
1 233 THR n 
1 234 TYR n 
1 235 SER n 
1 236 SER n 
1 237 GLY n 
1 238 ASN n 
1 239 GLN n 
1 240 ASN n 
1 241 GLU n 
1 242 LYS n 
1 243 GLN n 
1 244 ILE n 
1 245 VAL n 
1 246 THR n 
1 247 THR n 
1 248 ASP n 
1 249 LEU n 
1 250 ARG n 
1 251 GLN n 
1 252 LYS n 
1 253 CYS n 
1 254 THR n 
1 255 GLU n 
1 256 SER n 
1 257 HIS n 
1 258 THR n 
1 259 GLY n 
1 260 THR n 
1 261 SER n 
1 262 ALA n 
1 263 SER n 
1 264 ALA n 
1 265 PRO n 
1 266 LEU n 
1 267 ALA n 
1 268 ALA n 
1 269 GLY n 
1 270 ILE n 
1 271 ILE n 
1 272 ALA n 
1 273 LEU n 
1 274 THR n 
1 275 LEU n 
1 276 GLU n 
1 277 ALA n 
1 278 ASN n 
1 279 LYS n 
1 280 ASN n 
1 281 LEU n 
1 282 THR n 
1 283 TRP n 
1 284 ARG n 
1 285 ASP n 
1 286 MET n 
1 287 GLN n 
1 288 HIS n 
1 289 LEU n 
1 290 VAL n 
1 291 VAL n 
1 292 GLN n 
1 293 THR n 
1 294 SER n 
1 295 LYS n 
1 296 PRO n 
1 297 ALA n 
1 298 HIS n 
1 299 LEU n 
1 300 ASN n 
1 301 ALA n 
1 302 ASN n 
1 303 ASP n 
1 304 TRP n 
1 305 ALA n 
1 306 THR n 
1 307 ASN n 
1 308 GLY n 
1 309 VAL n 
1 310 GLY n 
1 311 ARG n 
1 312 LYS n 
1 313 VAL n 
1 314 SER n 
1 315 HIS n 
1 316 SER n 
1 317 TYR n 
1 318 GLY n 
1 319 TYR n 
1 320 GLY n 
1 321 LEU n 
1 322 LEU n 
1 323 ASP n 
1 324 ALA n 
1 325 GLY n 
1 326 ALA n 
1 327 MET n 
1 328 VAL n 
1 329 ALA n 
1 330 LEU n 
1 331 ALA n 
1 332 GLN n 
1 333 ASN n 
1 334 TRP n 
1 335 THR n 
1 336 THR n 
1 337 VAL n 
1 338 ALA n 
1 339 PRO n 
1 340 GLN n 
1 341 ARG n 
1 342 LYS n 
1 343 CYS n 
1 344 ILE n 
1 345 ILE n 
1 346 ASP n 
1 347 ILE n 
1 348 LEU n 
1 349 THR n 
1 350 GLU n 
1 351 PRO n 
1 352 LYS n 
1 353 ASP n 
1 354 ILE n 
1 355 GLY n 
1 356 LYS n 
1 357 ARG n 
1 358 LEU n 
1 359 GLU n 
1 360 VAL n 
1 361 ARG n 
1 362 LYS n 
1 363 THR n 
1 364 VAL n 
1 365 THR n 
1 366 ALA n 
1 367 CYS n 
1 368 LEU n 
1 369 GLY n 
1 370 GLU n 
1 371 PRO n 
1 372 ASN n 
1 373 HIS n 
1 374 ILE n 
1 375 THR n 
1 376 ARG n 
1 377 LEU n 
1 378 GLU n 
1 379 HIS n 
1 380 ALA n 
1 381 GLN n 
1 382 ALA n 
1 383 ARG n 
1 384 LEU n 
1 385 THR n 
1 386 LEU n 
1 387 SER n 
1 388 TYR n 
1 389 ASN n 
1 390 ARG n 
1 391 ARG n 
1 392 GLY n 
1 393 ASP n 
1 394 LEU n 
1 395 ALA n 
1 396 ILE n 
1 397 HIS n 
1 398 LEU n 
1 399 VAL n 
1 400 SER n 
1 401 PRO n 
1 402 MET n 
1 403 GLY n 
1 404 THR n 
1 405 ARG n 
1 406 SER n 
1 407 THR n 
1 408 LEU n 
1 409 LEU n 
1 410 ALA n 
1 411 ALA n 
1 412 ARG n 
1 413 PRO n 
1 414 HIS n 
1 415 ASP n 
1 416 TYR n 
1 417 SER n 
1 418 ALA n 
1 419 ASP n 
1 420 GLY n 
1 421 PHE n 
1 422 ASN n 
1 423 ASP n 
1 424 TRP n 
1 425 ALA n 
1 426 PHE n 
1 427 MET n 
1 428 THR n 
1 429 THR n 
1 430 HIS n 
1 431 SER n 
1 432 TRP n 
1 433 ASP n 
1 434 GLU n 
1 435 ASP n 
1 436 PRO n 
1 437 SER n 
1 438 GLY n 
1 439 GLU n 
1 440 TRP n 
1 441 VAL n 
1 442 LEU n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 ASN n 
1 447 THR n 
1 448 SER n 
1 449 GLU n 
1 450 ALA n 
1 451 ASN n 
1 452 ASN n 
1 453 TYR n 
1 454 GLY n 
1 455 THR n 
1 456 LEU n 
1 457 THR n 
1 458 LYS n 
1 459 PHE n 
1 460 THR n 
1 461 LEU n 
1 462 VAL n 
1 463 LEU n 
1 464 TYR n 
1 465 GLY n 
1 466 THR n 
1 467 ALA n 
1 468 SER n 
1 469 GLY n 
1 470 SER n 
1 471 LEU n 
1 472 VAL n 
1 473 PRO n 
1 474 ARG n 
1 475 GLY n 
1 476 SER n 
1 477 HIS n 
1 478 HIS n 
1 479 HIS n 
1 480 HIS n 
1 481 HIS n 
1 482 HIS n 
2 1   2UE n 
2 2   ARG n 
2 3   TBG n 
2 4   ARG n 
2 5   00S n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FUR, FURIN, PACE, PCSK3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293S 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pHLsec 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FURIN_HUMAN P09958 1 
;DVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYT
QMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPA
RLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN
EKQIVTTDLRQKCTESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKVSHSYGYG
LLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNHITRLEHAQARLTLSYNRRGDLAIHLVS
PMGTRSTLLAARPHDYSADGFNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTA
;
108 ? 
2 PDB 4RYD        4RYD   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4RYD A 1 ? 467 ? P09958 108 ? 574 ? 108 574 
2  1 4RYD B 1 ? 467 ? P09958 108 ? 574 ? 108 574 
3  1 4RYD C 1 ? 467 ? P09958 108 ? 574 ? 108 574 
4  1 4RYD D 1 ? 467 ? P09958 108 ? 574 ? 108 574 
5  1 4RYD E 1 ? 467 ? P09958 108 ? 574 ? 108 574 
6  1 4RYD F 1 ? 467 ? P09958 108 ? 574 ? 108 574 
7  2 4RYD H 1 ? 5   ? 4RYD   1   ? 5   ? 1   5   
8  2 4RYD I 1 ? 5   ? 4RYD   1   ? 5   ? 1   5   
9  2 4RYD J 1 ? 5   ? 4RYD   1   ? 5   ? 1   5   
10 2 4RYD K 1 ? 5   ? 4RYD   1   ? 5   ? 1   5   
11 2 4RYD L 1 ? 5   ? 4RYD   1   ? 5   ? 1   5   
12 2 4RYD N 1 ? 5   ? 4RYD   1   ? 5   ? 1   5   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4RYD SER A 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 1  
1 4RYD GLY A 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 2  
1 4RYD SER A 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 3  
1 4RYD LEU A 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 4  
1 4RYD VAL A 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 5  
1 4RYD PRO A 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 6  
1 4RYD ARG A 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 7  
1 4RYD GLY A 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 8  
1 4RYD SER A 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 9  
1 4RYD HIS A 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 10 
1 4RYD HIS A 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 11 
1 4RYD HIS A 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 12 
1 4RYD HIS A 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 13 
1 4RYD HIS A 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 14 
1 4RYD HIS A 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 15 
2 4RYD SER B 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 16 
2 4RYD GLY B 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 17 
2 4RYD SER B 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 18 
2 4RYD LEU B 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 19 
2 4RYD VAL B 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 20 
2 4RYD PRO B 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 21 
2 4RYD ARG B 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 22 
2 4RYD GLY B 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 23 
2 4RYD SER B 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 24 
2 4RYD HIS B 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 25 
2 4RYD HIS B 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 26 
2 4RYD HIS B 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 27 
2 4RYD HIS B 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 28 
2 4RYD HIS B 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 29 
2 4RYD HIS B 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 30 
3 4RYD SER C 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 31 
3 4RYD GLY C 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 32 
3 4RYD SER C 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 33 
3 4RYD LEU C 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 34 
3 4RYD VAL C 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 35 
3 4RYD PRO C 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 36 
3 4RYD ARG C 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 37 
3 4RYD GLY C 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 38 
3 4RYD SER C 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 39 
3 4RYD HIS C 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 40 
3 4RYD HIS C 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 41 
3 4RYD HIS C 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 42 
3 4RYD HIS C 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 43 
3 4RYD HIS C 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 44 
3 4RYD HIS C 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 45 
4 4RYD SER D 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 46 
4 4RYD GLY D 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 47 
4 4RYD SER D 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 48 
4 4RYD LEU D 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 49 
4 4RYD VAL D 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 50 
4 4RYD PRO D 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 51 
4 4RYD ARG D 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 52 
4 4RYD GLY D 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 53 
4 4RYD SER D 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 54 
4 4RYD HIS D 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 55 
4 4RYD HIS D 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 56 
4 4RYD HIS D 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 57 
4 4RYD HIS D 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 58 
4 4RYD HIS D 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 59 
4 4RYD HIS D 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 60 
5 4RYD SER E 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 61 
5 4RYD GLY E 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 62 
5 4RYD SER E 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 63 
5 4RYD LEU E 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 64 
5 4RYD VAL E 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 65 
5 4RYD PRO E 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 66 
5 4RYD ARG E 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 67 
5 4RYD GLY E 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 68 
5 4RYD SER E 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 69 
5 4RYD HIS E 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 70 
5 4RYD HIS E 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 71 
5 4RYD HIS E 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 72 
5 4RYD HIS E 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 73 
5 4RYD HIS E 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 74 
5 4RYD HIS E 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 75 
6 4RYD SER F 468 ? UNP P09958 ? ? 'EXPRESSION TAG' 575 76 
6 4RYD GLY F 469 ? UNP P09958 ? ? 'EXPRESSION TAG' 576 77 
6 4RYD SER F 470 ? UNP P09958 ? ? 'EXPRESSION TAG' 577 78 
6 4RYD LEU F 471 ? UNP P09958 ? ? 'EXPRESSION TAG' 578 79 
6 4RYD VAL F 472 ? UNP P09958 ? ? 'EXPRESSION TAG' 579 80 
6 4RYD PRO F 473 ? UNP P09958 ? ? 'EXPRESSION TAG' 580 81 
6 4RYD ARG F 474 ? UNP P09958 ? ? 'EXPRESSION TAG' 581 82 
6 4RYD GLY F 475 ? UNP P09958 ? ? 'EXPRESSION TAG' 582 83 
6 4RYD SER F 476 ? UNP P09958 ? ? 'EXPRESSION TAG' 583 84 
6 4RYD HIS F 477 ? UNP P09958 ? ? 'EXPRESSION TAG' 584 85 
6 4RYD HIS F 478 ? UNP P09958 ? ? 'EXPRESSION TAG' 585 86 
6 4RYD HIS F 479 ? UNP P09958 ? ? 'EXPRESSION TAG' 586 87 
6 4RYD HIS F 480 ? UNP P09958 ? ? 'EXPRESSION TAG' 587 88 
6 4RYD HIS F 481 ? UNP P09958 ? ? 'EXPRESSION TAG' 588 89 
6 4RYD HIS F 482 ? UNP P09958 ? ? 'EXPRESSION TAG' 589 90 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
00S non-polymer         . '4-(aminomethyl)benzenecarboximidamide' ? 'C8 H11 N3'      149.193 
2UE non-polymer         . '1-[4-(2-oxoethyl)benzyl]guanidine'     ? 'C10 H13 N3 O'   191.230 
ALA 'L-peptide linking' y ALANINE                                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                         ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                           ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                                ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'                           ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE                               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                              ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                            ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE                           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                  ? 'C3 H7 N O3'     105.093 
TBG 'L-peptide linking' n 3-methyl-L-valine                       ? 'C6 H13 N O2'    131.173 
THR 'L-peptide linking' y THREONINE                               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4RYD 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.density_percent_sol   56.93 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'50mM Tris, 2.8M sodium formate, 15mM Cymal-7, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-10-31 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'BESSY BEAMLINE 14.1' 
_diffrn_source.pdbx_synchrotron_site       BESSY 
_diffrn_source.pdbx_synchrotron_beamline   14.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.918 
# 
_reflns.entry_id                     4RYD 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.15 
_reflns.number_obs                   194799 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.135 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        29.9 
_reflns.pdbx_redundancy              3.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.number_all                   ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.15 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   97.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.693 
_reflns_shell.meanI_over_sigI_obs    1.95 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      30975 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4RYD 
_refine.ls_number_reflns_obs                     194614 
_refine.ls_number_reflns_all                     197882 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             50.0 
_refine.ls_d_res_high                            2.15 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1862 
_refine.ls_R_factor_R_free                       0.2186 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  9740 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            shells 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        21656 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             2034 
_refine_hist.number_atoms_total               23768 
_refine_hist.d_res_high                       2.15 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
c_bond_d    0.0076  ? ? ? ? 'X-RAY DIFFRACTION' 
c_angle_deg 1.39413 ? ? ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.15 
_refine_ls_shell.d_res_low                        2.25 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.268 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.307 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4RYD 
_struct.title                     
'X-ray structure of human furin in complex with the competitive inhibitor para-guanidinomethyl-Phac-R-Tle-R-Amba' 
_struct.pdbx_descriptor           
'Furin (E.C.3.4.21.75), para-guanidinomethyl-phenylacetyl-Arg-(3-methylvaline)-Arg-(amidomethyl)benzamidine' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4RYD 
_struct_keywords.pdbx_keywords   'Hydrolase/Hydrolase Inhibitor' 
_struct_keywords.text            
'competitive inhibitor, pro-protein convertase, serine protease, Hydrolase-Hydrolase Inhibitor complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 2 ? 
J  N N 2 ? 
K  N N 2 ? 
L  N N 2 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 3 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 5 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 5 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 4 ? 
EA N N 4 ? 
FA N N 4 ? 
GA N N 5 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 5 ? 
OA N N 3 ? 
PA N N 3 ? 
QA N N 3 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 5 ? 
VA N N 3 ? 
WA N N 3 ? 
XA N N 3 ? 
YA N N 4 ? 
ZA N N 4 ? 
AB N N 4 ? 
BB N N 5 ? 
CB N N 6 ? 
DB N N 6 ? 
EB N N 6 ? 
FB N N 6 ? 
GB N N 6 ? 
HB N N 6 ? 
IB N N 6 ? 
JB N N 6 ? 
KB N N 6 ? 
LB N N 6 ? 
MB N N 6 ? 
NB N N 6 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 10  ? GLN A 14  ? LYS A 117 GLN A 121 5 ? 5  
HELX_P HELX_P2  2  ASN A 26  ? GLN A 33  ? ASN A 133 GLN A 140 1 ? 8  
HELX_P HELX_P3  3  ASP A 61  ? SER A 65  ? ASP A 168 SER A 172 5 ? 5  
HELX_P HELX_P4  4  ASN A 83  ? ASN A 85  ? ASN A 190 ASN A 192 5 ? 3  
HELX_P HELX_P5  5  ARG A 86  ? ALA A 97  ? ARG A 193 ALA A 204 1 ? 12 
HELX_P HELX_P6  6  THR A 125 ? GLY A 134 ? THR A 232 GLY A 241 1 ? 10 
HELX_P HELX_P7  7  ALA A 160 ? GLY A 174 ? ALA A 267 GLY A 281 1 ? 15 
HELX_P HELX_P8  8  ARG A 175 ? LEU A 178 ? ARG A 282 LEU A 285 5 ? 4  
HELX_P HELX_P9  9  GLY A 189 ? HIS A 193 ? GLY A 296 HIS A 300 5 ? 5  
HELX_P HELX_P10 10 SER A 195 ? ASP A 199 ? SER A 302 ASP A 306 5 ? 5  
HELX_P HELX_P11 11 GLY A 259 ? ASN A 278 ? GLY A 366 ASN A 385 1 ? 20 
HELX_P HELX_P12 12 THR A 282 ? SER A 294 ? THR A 389 SER A 401 1 ? 13 
HELX_P HELX_P13 13 ASP A 323 ? TRP A 334 ? ASP A 430 TRP A 441 1 ? 12 
HELX_P HELX_P14 14 ARG A 390 ? GLY A 392 ? ARG A 497 GLY A 499 5 ? 3  
HELX_P HELX_P15 15 LYS B 10  ? GLN B 14  ? LYS B 117 GLN B 121 5 ? 5  
HELX_P HELX_P16 16 ASN B 26  ? GLN B 33  ? ASN B 133 GLN B 140 1 ? 8  
HELX_P HELX_P17 17 LEU B 56  ? TYR B 60  ? LEU B 163 TYR B 167 5 ? 5  
HELX_P HELX_P18 18 ASP B 61  ? SER B 65  ? ASP B 168 SER B 172 5 ? 5  
HELX_P HELX_P19 19 ASN B 83  ? ASN B 85  ? ASN B 190 ASN B 192 5 ? 3  
HELX_P HELX_P20 20 ARG B 86  ? ALA B 97  ? ARG B 193 ALA B 204 1 ? 12 
HELX_P HELX_P21 21 THR B 125 ? GLY B 134 ? THR B 232 GLY B 241 1 ? 10 
HELX_P HELX_P22 22 ALA B 160 ? GLY B 174 ? ALA B 267 GLY B 281 1 ? 15 
HELX_P HELX_P23 23 ARG B 175 ? LEU B 178 ? ARG B 282 LEU B 285 5 ? 4  
HELX_P HELX_P24 24 ASN B 188 ? HIS B 193 ? ASN B 295 HIS B 300 5 ? 6  
HELX_P HELX_P25 25 SER B 195 ? ASP B 199 ? SER B 302 ASP B 306 5 ? 5  
HELX_P HELX_P26 26 GLY B 259 ? ASN B 278 ? GLY B 366 ASN B 385 1 ? 20 
HELX_P HELX_P27 27 THR B 282 ? SER B 294 ? THR B 389 SER B 401 1 ? 13 
HELX_P HELX_P28 28 ASP B 323 ? TRP B 334 ? ASP B 430 TRP B 441 1 ? 12 
HELX_P HELX_P29 29 ARG B 390 ? GLY B 392 ? ARG B 497 GLY B 499 5 ? 3  
HELX_P HELX_P30 30 LYS C 10  ? GLN C 14  ? LYS C 117 GLN C 121 5 ? 5  
HELX_P HELX_P31 31 ASN C 26  ? GLN C 33  ? ASN C 133 GLN C 140 1 ? 8  
HELX_P HELX_P32 32 ASP C 61  ? SER C 65  ? ASP C 168 SER C 172 5 ? 5  
HELX_P HELX_P33 33 ASN C 83  ? ASN C 85  ? ASN C 190 ASN C 192 5 ? 3  
HELX_P HELX_P34 34 ARG C 86  ? ALA C 97  ? ARG C 193 ALA C 204 1 ? 12 
HELX_P HELX_P35 35 THR C 125 ? GLY C 134 ? THR C 232 GLY C 241 1 ? 10 
HELX_P HELX_P36 36 ALA C 160 ? GLY C 174 ? ALA C 267 GLY C 281 1 ? 15 
HELX_P HELX_P37 37 ARG C 175 ? LEU C 178 ? ARG C 282 LEU C 285 5 ? 4  
HELX_P HELX_P38 38 ASN C 188 ? HIS C 193 ? ASN C 295 HIS C 300 5 ? 6  
HELX_P HELX_P39 39 SER C 195 ? ASP C 199 ? SER C 302 ASP C 306 5 ? 5  
HELX_P HELX_P40 40 GLY C 259 ? ASN C 278 ? GLY C 366 ASN C 385 1 ? 20 
HELX_P HELX_P41 41 THR C 282 ? SER C 294 ? THR C 389 SER C 401 1 ? 13 
HELX_P HELX_P42 42 ASP C 323 ? TRP C 334 ? ASP C 430 TRP C 441 1 ? 12 
HELX_P HELX_P43 43 ARG C 390 ? GLY C 392 ? ARG C 497 GLY C 499 5 ? 3  
HELX_P HELX_P44 44 LYS D 10  ? GLN D 14  ? LYS D 117 GLN D 121 5 ? 5  
HELX_P HELX_P45 45 ASN D 26  ? GLN D 33  ? ASN D 133 GLN D 140 1 ? 8  
HELX_P HELX_P46 46 ASP D 61  ? SER D 65  ? ASP D 168 SER D 172 5 ? 5  
HELX_P HELX_P47 47 ASN D 83  ? ASN D 85  ? ASN D 190 ASN D 192 5 ? 3  
HELX_P HELX_P48 48 ARG D 86  ? ALA D 97  ? ARG D 193 ALA D 204 1 ? 12 
HELX_P HELX_P49 49 THR D 125 ? GLY D 134 ? THR D 232 GLY D 241 1 ? 10 
HELX_P HELX_P50 50 ALA D 160 ? GLY D 174 ? ALA D 267 GLY D 281 1 ? 15 
HELX_P HELX_P51 51 ARG D 175 ? LEU D 178 ? ARG D 282 LEU D 285 5 ? 4  
HELX_P HELX_P52 52 GLY D 189 ? HIS D 193 ? GLY D 296 HIS D 300 5 ? 5  
HELX_P HELX_P53 53 SER D 195 ? ASP D 199 ? SER D 302 ASP D 306 5 ? 5  
HELX_P HELX_P54 54 GLY D 259 ? ASN D 278 ? GLY D 366 ASN D 385 1 ? 20 
HELX_P HELX_P55 55 THR D 282 ? SER D 294 ? THR D 389 SER D 401 1 ? 13 
HELX_P HELX_P56 56 ASP D 323 ? TRP D 334 ? ASP D 430 TRP D 441 1 ? 12 
HELX_P HELX_P57 57 ARG D 390 ? GLY D 392 ? ARG D 497 GLY D 499 5 ? 3  
HELX_P HELX_P58 58 LYS E 10  ? GLN E 14  ? LYS E 117 GLN E 121 5 ? 5  
HELX_P HELX_P59 59 ASN E 26  ? GLN E 33  ? ASN E 133 GLN E 140 1 ? 8  
HELX_P HELX_P60 60 ASP E 61  ? SER E 65  ? ASP E 168 SER E 172 5 ? 5  
HELX_P HELX_P61 61 ASN E 83  ? ASN E 85  ? ASN E 190 ASN E 192 5 ? 3  
HELX_P HELX_P62 62 ARG E 86  ? ALA E 97  ? ARG E 193 ALA E 204 1 ? 12 
HELX_P HELX_P63 63 THR E 125 ? GLY E 134 ? THR E 232 GLY E 241 1 ? 10 
HELX_P HELX_P64 64 ALA E 160 ? GLY E 174 ? ALA E 267 GLY E 281 1 ? 15 
HELX_P HELX_P65 65 ARG E 175 ? LEU E 178 ? ARG E 282 LEU E 285 5 ? 4  
HELX_P HELX_P66 66 GLY E 189 ? HIS E 193 ? GLY E 296 HIS E 300 5 ? 5  
HELX_P HELX_P67 67 SER E 195 ? ASP E 199 ? SER E 302 ASP E 306 5 ? 5  
HELX_P HELX_P68 68 GLY E 259 ? ASN E 278 ? GLY E 366 ASN E 385 1 ? 20 
HELX_P HELX_P69 69 THR E 282 ? SER E 294 ? THR E 389 SER E 401 1 ? 13 
HELX_P HELX_P70 70 ASP E 323 ? TRP E 334 ? ASP E 430 TRP E 441 1 ? 12 
HELX_P HELX_P71 71 ARG E 390 ? GLY E 392 ? ARG E 497 GLY E 499 5 ? 3  
HELX_P HELX_P72 72 LYS F 10  ? GLN F 14  ? LYS F 117 GLN F 121 5 ? 5  
HELX_P HELX_P73 73 ASN F 26  ? GLN F 33  ? ASN F 133 GLN F 140 1 ? 8  
HELX_P HELX_P74 74 LEU F 56  ? TYR F 60  ? LEU F 163 TYR F 167 5 ? 5  
HELX_P HELX_P75 75 ASP F 61  ? SER F 65  ? ASP F 168 SER F 172 5 ? 5  
HELX_P HELX_P76 76 ASN F 83  ? ASN F 85  ? ASN F 190 ASN F 192 5 ? 3  
HELX_P HELX_P77 77 ARG F 86  ? ALA F 97  ? ARG F 193 ALA F 204 1 ? 12 
HELX_P HELX_P78 78 THR F 125 ? GLY F 134 ? THR F 232 GLY F 241 1 ? 10 
HELX_P HELX_P79 79 ALA F 160 ? GLY F 174 ? ALA F 267 GLY F 281 1 ? 15 
HELX_P HELX_P80 80 ARG F 175 ? LEU F 178 ? ARG F 282 LEU F 285 5 ? 4  
HELX_P HELX_P81 81 GLY F 189 ? HIS F 193 ? GLY F 296 HIS F 300 5 ? 5  
HELX_P HELX_P82 82 SER F 195 ? ASP F 199 ? SER F 302 ASP F 306 5 ? 5  
HELX_P HELX_P83 83 GLY F 259 ? ASN F 278 ? GLY F 366 ASN F 385 1 ? 20 
HELX_P HELX_P84 84 THR F 282 ? SER F 294 ? THR F 389 SER F 401 1 ? 13 
HELX_P HELX_P85 85 ASP F 323 ? TRP F 334 ? ASP F 430 TRP F 441 1 ? 12 
HELX_P HELX_P86 86 ARG F 390 ? GLY F 392 ? ARG F 497 GLY F 499 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? A  CYS 104 SG  ? ? ? 1_555 A  CYS 253 SG  ? ? A CYS 211 A CYS 360 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf2   disulf ? ? A  CYS 196 SG  ? ? ? 1_555 A  CYS 226 SG  ? ? A CYS 303 A CYS 333 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf3   disulf ? ? A  CYS 343 SG  ? ? ? 1_555 A  CYS 367 SG  ? ? A CYS 450 A CYS 474 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf4   disulf ? ? B  CYS 104 SG  ? ? ? 1_555 B  CYS 253 SG  ? ? B CYS 211 B CYS 360 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf5   disulf ? ? B  CYS 196 SG  ? ? ? 1_555 B  CYS 226 SG  ? ? B CYS 303 B CYS 333 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf6   disulf ? ? B  CYS 343 SG  ? ? ? 1_555 B  CYS 367 SG  ? ? B CYS 450 B CYS 474 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf7   disulf ? ? C  CYS 104 SG  ? ? ? 1_555 C  CYS 253 SG  ? ? C CYS 211 C CYS 360 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf8   disulf ? ? C  CYS 196 SG  ? ? ? 1_555 C  CYS 226 SG  ? ? C CYS 303 C CYS 333 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf9   disulf ? ? C  CYS 343 SG  ? ? ? 1_555 C  CYS 367 SG  ? ? C CYS 450 C CYS 474 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf10  disulf ? ? D  CYS 104 SG  ? ? ? 1_555 D  CYS 253 SG  ? ? D CYS 211 D CYS 360 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf11  disulf ? ? D  CYS 196 SG  ? ? ? 1_555 D  CYS 226 SG  ? ? D CYS 303 D CYS 333 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf12  disulf ? ? D  CYS 343 SG  ? ? ? 1_555 D  CYS 367 SG  ? ? D CYS 450 D CYS 474 1_555 ? ? ? ? ? ? ? 2.057 ? 
disulf13  disulf ? ? E  CYS 104 SG  ? ? ? 1_555 E  CYS 253 SG  ? ? E CYS 211 E CYS 360 1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf14  disulf ? ? E  CYS 196 SG  ? ? ? 1_555 E  CYS 226 SG  ? ? E CYS 303 E CYS 333 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf15  disulf ? ? E  CYS 343 SG  ? ? ? 1_555 E  CYS 367 SG  ? ? E CYS 450 E CYS 474 1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf16  disulf ? ? F  CYS 104 SG  ? ? ? 1_555 F  CYS 253 SG  ? ? F CYS 211 F CYS 360 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf17  disulf ? ? F  CYS 196 SG  ? ? ? 1_555 F  CYS 226 SG  ? ? F CYS 303 F CYS 333 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf18  disulf ? ? F  CYS 343 SG  ? ? ? 1_555 F  CYS 367 SG  ? ? F CYS 450 F CYS 474 1_555 ? ? ? ? ? ? ? 2.055 ? 
covale1   covale ? ? G  2UE 1   C2  ? ? ? 1_555 G  ARG 2   N   ? ? H 2UE 1   H ARG 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2   covale ? ? G  ARG 2   C   ? ? ? 1_555 G  TBG 3   N   ? ? H ARG 2   H TBG 3   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale3   covale ? ? G  TBG 3   C   ? ? ? 1_555 G  ARG 4   N   ? ? H TBG 3   H ARG 4   1_555 ? ? ? ? ? ? ? 1.337 ? 
covale4   covale ? ? G  ARG 4   C   ? ? ? 1_555 G  00S 5   N23 ? ? H ARG 4   H 00S 5   1_555 ? ? ? ? ? ? ? 1.324 ? 
covale5   covale ? ? H  2UE 1   C2  ? ? ? 1_555 H  ARG 2   N   ? ? I 2UE 1   I ARG 2   1_555 ? ? ? ? ? ? ? 1.326 ? 
covale6   covale ? ? H  ARG 2   C   ? ? ? 1_555 H  TBG 3   N   ? ? I ARG 2   I TBG 3   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale7   covale ? ? H  TBG 3   C   ? ? ? 1_555 H  ARG 4   N   ? ? I TBG 3   I ARG 4   1_555 ? ? ? ? ? ? ? 1.335 ? 
covale8   covale ? ? H  ARG 4   C   ? ? ? 1_555 H  00S 5   N23 ? ? I ARG 4   I 00S 5   1_555 ? ? ? ? ? ? ? 1.326 ? 
covale9   covale ? ? I  2UE 1   C2  ? ? ? 1_555 I  ARG 2   N   ? ? J 2UE 1   J ARG 2   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale10  covale ? ? I  ARG 2   C   ? ? ? 1_555 I  TBG 3   N   ? ? J ARG 2   J TBG 3   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale11  covale ? ? I  TBG 3   C   ? ? ? 1_555 I  ARG 4   N   ? ? J TBG 3   J ARG 4   1_555 ? ? ? ? ? ? ? 1.337 ? 
covale12  covale ? ? I  ARG 4   C   ? ? ? 1_555 I  00S 5   N23 ? ? J ARG 4   J 00S 5   1_555 ? ? ? ? ? ? ? 1.325 ? 
covale13  covale ? ? J  2UE 1   C2  ? ? ? 1_555 J  ARG 2   N   ? ? K 2UE 1   K ARG 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale14  covale ? ? J  ARG 2   C   ? ? ? 1_555 J  TBG 3   N   ? ? K ARG 2   K TBG 3   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale15  covale ? ? J  TBG 3   C   ? ? ? 1_555 J  ARG 4   N   ? ? K TBG 3   K ARG 4   1_555 ? ? ? ? ? ? ? 1.337 ? 
covale16  covale ? ? J  ARG 4   C   ? ? ? 1_555 J  00S 5   N23 ? ? K ARG 4   K 00S 5   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale17  covale ? ? K  2UE 1   C2  ? ? ? 1_555 K  ARG 2   N   ? ? L 2UE 1   L ARG 2   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale18  covale ? ? K  ARG 2   C   ? ? ? 1_555 K  TBG 3   N   ? ? L ARG 2   L TBG 3   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale19  covale ? ? K  TBG 3   C   ? ? ? 1_555 K  ARG 4   N   ? ? L TBG 3   L ARG 4   1_555 ? ? ? ? ? ? ? 1.337 ? 
covale20  covale ? ? K  ARG 4   C   ? ? ? 1_555 K  00S 5   N23 ? ? L ARG 4   L 00S 5   1_555 ? ? ? ? ? ? ? 1.326 ? 
covale21  covale ? ? L  2UE 1   C2  ? ? ? 1_555 L  ARG 2   N   ? ? N 2UE 1   N ARG 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale22  covale ? ? L  ARG 2   C   ? ? ? 1_555 L  TBG 3   N   ? ? N ARG 2   N TBG 3   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale23  covale ? ? L  TBG 3   C   ? ? ? 1_555 L  ARG 4   N   ? ? N TBG 3   N ARG 4   1_555 ? ? ? ? ? ? ? 1.336 ? 
covale24  covale ? ? L  ARG 4   C   ? ? ? 1_555 L  00S 5   N23 ? ? N ARG 4   N 00S 5   1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc1   metalc ? ? TA CA  .   CA  ? ? ? 1_555 GB HOH .   O   ? ? E CA  606 E HOH 877 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc2   metalc ? ? A  ASP 194 OD2 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 301 A CA  605 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc3   metalc ? ? E  ASP 74  O   ? ? ? 1_555 TA CA  .   CA  ? ? E ASP 181 E CA  606 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc4   metalc ? ? E  SER 204 O   ? ? ? 1_555 UA NA  .   NA  ? ? E SER 311 E NA  607 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc5   metalc ? ? A  SER 204 O   ? ? ? 1_555 S  NA  .   NA  ? ? A SER 311 A NA  607 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc6   metalc ? ? F  ASP 194 OD2 ? ? ? 1_555 ZA CA  .   CA  ? ? F ASP 301 F CA  605 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc7   metalc ? ? B  VAL 98  O   ? ? ? 1_555 W  CA  .   CA  ? ? B VAL 205 B CA  604 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc8   metalc ? ? F  SER 204 O   ? ? ? 1_555 BB NA  .   NA  ? ? F SER 311 F NA  607 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc9   metalc ? ? A  VAL 98  O   ? ? ? 1_555 P  CA  .   CA  ? ? A VAL 205 A CA  604 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc10  metalc ? ? B  ASP 8   OD2 ? ? ? 1_555 W  CA  .   CA  ? ? B ASP 115 B CA  604 1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc11  metalc ? ? F  ASP 8   OD2 ? ? ? 1_555 YA CA  .   CA  ? ? F ASP 115 F CA  604 1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc12  metalc ? ? Q  CA  .   CA  ? ? ? 1_555 CB HOH .   O   ? ? A CA  605 A HOH 852 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc13  metalc ? ? C  VAL 98  O   ? ? ? 1_555 DA CA  .   CA  ? ? C VAL 205 C CA  604 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc14  metalc ? ? D  GLU 224 OE1 ? ? ? 1_555 LA CA  .   CA  ? ? D GLU 331 D CA  605 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc15  metalc ? ? D  ASP 8   OD2 ? ? ? 1_555 KA CA  .   CA  ? ? D ASP 115 D CA  604 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc16  metalc ? ? D  SER 204 O   ? ? ? 1_555 NA NA  .   NA  ? ? D SER 311 D NA  607 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc17  metalc ? ? D  ASP 67  OD2 ? ? ? 1_555 MA CA  .   CA  ? ? D ASP 174 D CA  606 1_555 ? ? ? ? ? ? ? 2.276 ? 
metalc18  metalc ? ? F  ASP 151 OD1 ? ? ? 1_555 ZA CA  .   CA  ? ? F ASP 258 F CA  605 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc19  metalc ? ? D  ASP 151 OD1 ? ? ? 1_555 LA CA  .   CA  ? ? D ASP 258 D CA  605 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc20  metalc ? ? E  VAL 98  O   ? ? ? 1_555 RA CA  .   CA  ? ? E VAL 205 E CA  604 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc21  metalc ? ? A  THR 202 O   ? ? ? 1_555 S  NA  .   NA  ? ? A THR 309 A NA  607 1_555 ? ? ? ? ? ? ? 2.291 ? 
metalc22  metalc ? ? A  ASP 151 OD1 ? ? ? 1_555 Q  CA  .   CA  ? ? A ASP 258 A CA  605 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc23  metalc ? ? F  VAL 98  O   ? ? ? 1_555 YA CA  .   CA  ? ? F VAL 205 F CA  604 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc24  metalc ? ? B  ASP 151 OD1 ? ? ? 1_555 X  CA  .   CA  ? ? B ASP 258 B CA  605 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc25  metalc ? ? D  VAL 98  O   ? ? ? 1_555 KA CA  .   CA  ? ? D VAL 205 D CA  604 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc26  metalc ? ? D  VAL 103 O   ? ? ? 1_555 KA CA  .   CA  ? ? D VAL 210 D CA  604 1_555 ? ? ? ? ? ? ? 2.298 ? 
metalc27  metalc ? ? E  VAL 103 O   ? ? ? 1_555 RA CA  .   CA  ? ? E VAL 210 E CA  604 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc28  metalc ? ? C  THR 207 O   ? ? ? 1_555 GA NA  .   NA  ? ? C THR 314 C NA  607 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc29  metalc ? ? A  ASP 55  OD1 ? ? ? 1_555 P  CA  .   CA  ? ? A ASP 162 A CA  604 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc30  metalc ? ? C  ASP 194 OD2 ? ? ? 1_555 EA CA  .   CA  ? ? C ASP 301 C CA  605 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc31  metalc ? ? R  CA  .   CA  ? ? ? 1_555 CB HOH .   O   ? ? A CA  606 A HOH 734 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc32  metalc ? ? B  ASP 74  O   ? ? ? 1_555 Y  CA  .   CA  ? ? B ASP 181 B CA  606 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc33  metalc ? ? F  VAL 103 O   ? ? ? 1_555 YA CA  .   CA  ? ? F VAL 210 F CA  604 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc34  metalc ? ? C  SER 204 O   ? ? ? 1_555 GA NA  .   NA  ? ? C SER 311 C NA  607 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc35  metalc ? ? B  THR 202 O   ? ? ? 1_555 Z  NA  .   NA  ? ? B THR 309 B NA  607 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc36  metalc ? ? E  ASP 55  OD1 ? ? ? 1_555 RA CA  .   CA  ? ? E ASP 162 E CA  604 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc37  metalc ? ? C  THR 207 OG1 ? ? ? 1_555 GA NA  .   NA  ? ? C THR 314 C NA  607 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc38  metalc ? ? FA CA  .   CA  ? ? ? 1_555 EB HOH .   O   ? ? C CA  606 C HOH 859 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc39  metalc ? ? LA CA  .   CA  ? ? ? 1_555 FB HOH .   O   ? ? D CA  605 D HOH 832 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc40  metalc ? ? D  ASP 74  O   ? ? ? 1_555 MA CA  .   CA  ? ? D ASP 181 D CA  606 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc41  metalc ? ? B  ASP 194 OD2 ? ? ? 1_555 X  CA  .   CA  ? ? B ASP 301 B CA  605 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc42  metalc ? ? E  GLU 224 OE1 ? ? ? 1_555 SA CA  .   CA  ? ? E GLU 331 E CA  605 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc43  metalc ? ? C  ASP 151 OD1 ? ? ? 1_555 EA CA  .   CA  ? ? C ASP 258 C CA  605 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc44  metalc ? ? C  VAL 103 O   ? ? ? 1_555 DA CA  .   CA  ? ? C VAL 210 C CA  604 1_555 ? ? ? ? ? ? ? 2.338 ? 
metalc45  metalc ? ? E  ASP 8   OD2 ? ? ? 1_555 RA CA  .   CA  ? ? E ASP 115 E CA  604 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc46  metalc ? ? E  ASP 194 OD2 ? ? ? 1_555 SA CA  .   CA  ? ? E ASP 301 E CA  605 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc47  metalc ? ? B  GLY 105 O   ? ? ? 1_555 W  CA  .   CA  ? ? B GLY 212 B CA  604 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc48  metalc ? ? B  GLU 224 OE1 ? ? ? 1_555 X  CA  .   CA  ? ? B GLU 331 B CA  605 1_555 ? ? ? ? ? ? ? 2.344 ? 
metalc49  metalc ? ? SA CA  .   CA  ? ? ? 1_555 GB HOH .   O   ? ? E CA  605 E HOH 839 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc50  metalc ? ? F  GLY 105 O   ? ? ? 1_555 YA CA  .   CA  ? ? F GLY 212 F CA  604 1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc51  metalc ? ? R  CA  .   CA  ? ? ? 1_555 CB HOH .   O   ? ? A CA  606 A HOH 729 1_555 ? ? ? ? ? ? ? 2.352 ? 
metalc52  metalc ? ? B  SER 204 O   ? ? ? 1_555 Z  NA  .   NA  ? ? B SER 311 B NA  607 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc53  metalc ? ? B  VAL 103 O   ? ? ? 1_555 W  CA  .   CA  ? ? B VAL 210 B CA  604 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc54  metalc ? ? E  THR 207 O   ? ? ? 1_555 UA NA  .   NA  ? ? E THR 314 E NA  607 1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc55  metalc ? ? C  ASP 8   OD2 ? ? ? 1_555 DA CA  .   CA  ? ? C ASP 115 C CA  604 1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc56  metalc ? ? Q  CA  .   CA  ? ? ? 1_555 CB HOH .   O   ? ? A CA  605 A HOH 756 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc57  metalc ? ? F  ASP 55  OD1 ? ? ? 1_555 YA CA  .   CA  ? ? F ASP 162 F CA  604 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc58  metalc ? ? F  THR 202 O   ? ? ? 1_555 BB NA  .   NA  ? ? F THR 309 F NA  607 1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc59  metalc ? ? D  THR 207 O   ? ? ? 1_555 NA NA  .   NA  ? ? D THR 314 D NA  607 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc60  metalc ? ? F  ASP 74  O   ? ? ? 1_555 AB CA  .   CA  ? ? F ASP 181 F CA  606 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc61  metalc ? ? A  ASP 74  O   ? ? ? 1_555 R  CA  .   CA  ? ? A ASP 181 A CA  606 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc62  metalc ? ? GA NA  .   NA  ? ? ? 1_555 EB HOH .   O   ? ? C NA  607 C HOH 721 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc63  metalc ? ? E  GLY 105 O   ? ? ? 1_555 RA CA  .   CA  ? ? E GLY 212 E CA  604 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc64  metalc ? ? C  ASP 74  O   ? ? ? 1_555 FA CA  .   CA  ? ? C ASP 181 C CA  606 1_555 ? ? ? ? ? ? ? 2.370 ? 
metalc65  metalc ? ? D  GLY 105 O   ? ? ? 1_555 KA CA  .   CA  ? ? D GLY 212 D CA  604 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc66  metalc ? ? B  THR 207 OG1 ? ? ? 1_555 Z  NA  .   NA  ? ? B THR 314 B NA  607 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc67  metalc ? ? A  ASP 8   OD2 ? ? ? 1_555 P  CA  .   CA  ? ? A ASP 115 A CA  604 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc68  metalc ? ? Y  CA  .   CA  ? ? ? 1_555 DB HOH .   O   ? ? B CA  606 B HOH 772 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc69  metalc ? ? Z  NA  .   NA  ? ? ? 1_555 DB HOH .   O   ? ? B NA  607 B HOH 703 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc70  metalc ? ? ZA CA  .   CA  ? ? ? 1_555 HB HOH .   O   ? ? F CA  605 F HOH 704 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc71  metalc ? ? B  ASP 55  OD1 ? ? ? 1_555 W  CA  .   CA  ? ? B ASP 162 B CA  604 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc72  metalc ? ? C  GLY 105 O   ? ? ? 1_555 DA CA  .   CA  ? ? C GLY 212 C CA  604 1_555 ? ? ? ? ? ? ? 2.383 ? 
metalc73  metalc ? ? A  VAL 103 O   ? ? ? 1_555 P  CA  .   CA  ? ? A VAL 210 A CA  604 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc74  metalc ? ? D  ASP 55  OD1 ? ? ? 1_555 KA CA  .   CA  ? ? D ASP 162 D CA  604 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc75  metalc ? ? NA NA  .   NA  ? ? ? 1_555 FB HOH .   O   ? ? D NA  607 D HOH 723 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc76  metalc ? ? E  ASP 151 OD1 ? ? ? 1_555 SA CA  .   CA  ? ? E ASP 258 E CA  605 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc77  metalc ? ? C  THR 202 O   ? ? ? 1_555 GA NA  .   NA  ? ? C THR 309 C NA  607 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc78  metalc ? ? BB NA  .   NA  ? ? ? 1_555 HB HOH .   O   ? ? F NA  607 F HOH 716 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc79  metalc ? ? C  ASP 67  OD2 ? ? ? 1_555 FA CA  .   CA  ? ? C ASP 174 C CA  606 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc80  metalc ? ? B  THR 207 O   ? ? ? 1_555 Z  NA  .   NA  ? ? B THR 314 B NA  607 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc81  metalc ? ? E  THR 202 O   ? ? ? 1_555 UA NA  .   NA  ? ? E THR 309 E NA  607 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc82  metalc ? ? D  ASP 194 OD2 ? ? ? 1_555 LA CA  .   CA  ? ? D ASP 301 D CA  605 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc83  metalc ? ? EA CA  .   CA  ? ? ? 1_555 EB HOH .   O   ? ? C CA  605 C HOH 728 1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc84  metalc ? ? E  THR 207 OG1 ? ? ? 1_555 UA NA  .   NA  ? ? E THR 314 E NA  607 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc85  metalc ? ? F  GLU 224 OE1 ? ? ? 1_555 ZA CA  .   CA  ? ? F GLU 331 F CA  605 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc86  metalc ? ? F  THR 207 O   ? ? ? 1_555 BB NA  .   NA  ? ? F THR 314 F NA  607 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc87  metalc ? ? ZA CA  .   CA  ? ? ? 1_555 HB HOH .   O   ? ? F CA  605 F HOH 770 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc88  metalc ? ? TA CA  .   CA  ? ? ? 1_555 GB HOH .   O   ? ? E CA  606 E HOH 840 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc89  metalc ? ? F  THR 207 OG1 ? ? ? 1_555 BB NA  .   NA  ? ? F THR 314 F NA  607 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc90  metalc ? ? C  ASP 55  OD1 ? ? ? 1_555 DA CA  .   CA  ? ? C ASP 162 C CA  604 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc91  metalc ? ? D  THR 202 O   ? ? ? 1_555 NA NA  .   NA  ? ? D THR 309 D NA  607 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc92  metalc ? ? E  ASP 72  OD2 ? ? ? 1_555 TA CA  .   CA  ? ? E ASP 179 E CA  606 1_555 ? ? ? ? ? ? ? 2.419 ? 
metalc93  metalc ? ? SA CA  .   CA  ? ? ? 1_555 GB HOH .   O   ? ? E CA  605 E HOH 721 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc94  metalc ? ? A  ASP 67  OD2 ? ? ? 1_555 R  CA  .   CA  ? ? A ASP 174 A CA  606 1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc95  metalc ? ? EA CA  .   CA  ? ? ? 1_555 EB HOH .   O   ? ? C CA  605 C HOH 750 1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc96  metalc ? ? MA CA  .   CA  ? ? ? 1_555 FB HOH .   O   ? ? D CA  606 D HOH 722 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc97  metalc ? ? UA NA  .   NA  ? ? ? 1_555 GB HOH .   O   ? ? E NA  607 E HOH 704 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc98  metalc ? ? A  GLY 105 O   ? ? ? 1_555 P  CA  .   CA  ? ? A GLY 212 A CA  604 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc99  metalc ? ? C  ASP 72  OD1 ? ? ? 1_555 FA CA  .   CA  ? ? C ASP 179 C CA  606 1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc100 metalc ? ? LA CA  .   CA  ? ? ? 1_555 FB HOH .   O   ? ? D CA  605 D HOH 710 1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc101 metalc ? ? X  CA  .   CA  ? ? ? 1_555 DB HOH .   O   ? ? B CA  605 B HOH 837 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc102 metalc ? ? X  CA  .   CA  ? ? ? 1_555 DB HOH .   O   ? ? B CA  605 B HOH 744 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc103 metalc ? ? B  ASP 67  OD2 ? ? ? 1_555 Y  CA  .   CA  ? ? B ASP 174 B CA  606 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc104 metalc ? ? A  GLU 224 OE1 ? ? ? 1_555 Q  CA  .   CA  ? ? A GLU 331 A CA  605 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc105 metalc ? ? MA CA  .   CA  ? ? ? 1_555 FB HOH .   O   ? ? D CA  606 D HOH 754 1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc106 metalc ? ? D  ASP 72  OD2 ? ? ? 1_555 MA CA  .   CA  ? ? D ASP 179 D CA  606 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc107 metalc ? ? A  THR 207 O   ? ? ? 1_555 S  NA  .   NA  ? ? A THR 314 A NA  607 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc108 metalc ? ? MA CA  .   CA  ? ? ? 1_555 FB HOH .   O   ? ? D CA  606 D HOH 833 1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc109 metalc ? ? C  GLU 224 OE1 ? ? ? 1_555 EA CA  .   CA  ? ? C GLU 331 C CA  605 1_555 ? ? ? ? ? ? ? 2.469 ? 
metalc110 metalc ? ? A  GLU 224 OE2 ? ? ? 1_555 Q  CA  .   CA  ? ? A GLU 331 A CA  605 1_555 ? ? ? ? ? ? ? 2.472 ? 
metalc111 metalc ? ? AB CA  .   CA  ? ? ? 1_555 HB HOH .   O   ? ? F CA  606 F HOH 748 1_555 ? ? ? ? ? ? ? 2.473 ? 
metalc112 metalc ? ? ZA CA  .   CA  ? ? ? 1_555 HB HOH .   O   ? ? F CA  605 F HOH 722 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc113 metalc ? ? E  GLU 224 OE2 ? ? ? 1_555 SA CA  .   CA  ? ? E GLU 331 E CA  605 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc114 metalc ? ? B  GLU 224 OE2 ? ? ? 1_555 X  CA  .   CA  ? ? B GLU 331 B CA  605 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc115 metalc ? ? D  THR 207 OG1 ? ? ? 1_555 NA NA  .   NA  ? ? D THR 314 D NA  607 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc116 metalc ? ? C  ASN 101 OD1 ? ? ? 1_555 DA CA  .   CA  ? ? C ASN 208 C CA  604 1_555 ? ? ? ? ? ? ? 2.480 ? 
metalc117 metalc ? ? A  THR 207 OG1 ? ? ? 1_555 S  NA  .   NA  ? ? A THR 314 A NA  607 1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc118 metalc ? ? B  ASN 101 OD1 ? ? ? 1_555 W  CA  .   CA  ? ? B ASN 208 B CA  604 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc119 metalc ? ? SA CA  .   CA  ? ? ? 1_555 GB HOH .   O   ? ? E CA  605 E HOH 720 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc120 metalc ? ? F  ASP 67  OD2 ? ? ? 1_555 AB CA  .   CA  ? ? F ASP 174 F CA  606 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc121 metalc ? ? Q  CA  .   CA  ? ? ? 1_555 CB HOH .   O   ? ? A CA  605 A HOH 771 1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc122 metalc ? ? AB CA  .   CA  ? ? ? 1_555 HB HOH .   O   ? ? F CA  606 F HOH 819 1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc123 metalc ? ? S  NA  .   NA  ? ? ? 1_555 CB HOH .   O   ? ? A NA  607 A HOH 784 1_555 ? ? ? ? ? ? ? 2.513 ? 
metalc124 metalc ? ? A  ASN 101 OD1 ? ? ? 1_555 P  CA  .   CA  ? ? A ASN 208 A CA  604 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc125 metalc ? ? D  ASN 101 OD1 ? ? ? 1_555 KA CA  .   CA  ? ? D ASN 208 D CA  604 1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc126 metalc ? ? F  ASN 101 OD1 ? ? ? 1_555 YA CA  .   CA  ? ? F ASN 208 F CA  604 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc127 metalc ? ? B  ASP 72  OD2 ? ? ? 1_555 Y  CA  .   CA  ? ? B ASP 179 B CA  606 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc128 metalc ? ? A  ASP 72  OD2 ? ? ? 1_555 R  CA  .   CA  ? ? A ASP 179 A CA  606 1_555 ? ? ? ? ? ? ? 2.528 ? 
metalc129 metalc ? ? X  CA  .   CA  ? ? ? 1_555 DB HOH .   O   ? ? B CA  605 B HOH 716 1_555 ? ? ? ? ? ? ? 2.531 ? 
metalc130 metalc ? ? FA CA  .   CA  ? ? ? 1_555 EB HOH .   O   ? ? C CA  606 C HOH 800 1_555 ? ? ? ? ? ? ? 2.531 ? 
metalc131 metalc ? ? E  ASN 101 OD1 ? ? ? 1_555 RA CA  .   CA  ? ? E ASN 208 E CA  604 1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc132 metalc ? ? F  ASP 72  OD2 ? ? ? 1_555 AB CA  .   CA  ? ? F ASP 179 F CA  606 1_555 ? ? ? ? ? ? ? 2.542 ? 
metalc133 metalc ? ? EA CA  .   CA  ? ? ? 1_555 EB HOH .   O   ? ? C CA  605 C HOH 791 1_555 ? ? ? ? ? ? ? 2.550 ? 
metalc134 metalc ? ? E  ASP 67  OD2 ? ? ? 1_555 TA CA  .   CA  ? ? E ASP 174 E CA  606 1_555 ? ? ? ? ? ? ? 2.550 ? 
metalc135 metalc ? ? C  ASP 72  OD2 ? ? ? 1_555 FA CA  .   CA  ? ? C ASP 179 C CA  606 1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc136 metalc ? ? C  GLU 224 OE2 ? ? ? 1_555 EA CA  .   CA  ? ? C GLU 331 C CA  605 1_555 ? ? ? ? ? ? ? 2.553 ? 
metalc137 metalc ? ? F  ASP 72  OD1 ? ? ? 1_555 AB CA  .   CA  ? ? F ASP 179 F CA  606 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc138 metalc ? ? D  ASP 72  OD1 ? ? ? 1_555 MA CA  .   CA  ? ? D ASP 179 D CA  606 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc139 metalc ? ? Y  CA  .   CA  ? ? ? 1_555 DB HOH .   O   ? ? B CA  606 B HOH 838 1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc140 metalc ? ? FA CA  .   CA  ? ? ? 1_555 EB HOH .   O   ? ? C CA  606 C HOH 803 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc141 metalc ? ? B  ASP 72  OD1 ? ? ? 1_555 Y  CA  .   CA  ? ? B ASP 179 B CA  606 1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc142 metalc ? ? Y  CA  .   CA  ? ? ? 1_555 DB HOH .   O   ? ? B CA  606 B HOH 810 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc143 metalc ? ? D  GLU 224 OE2 ? ? ? 1_555 LA CA  .   CA  ? ? D GLU 331 D CA  605 1_555 ? ? ? ? ? ? ? 2.596 ? 
metalc144 metalc ? ? F  GLU 224 OE2 ? ? ? 1_555 ZA CA  .   CA  ? ? F GLU 331 F CA  605 1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc145 metalc ? ? E  ASP 72  OD1 ? ? ? 1_555 TA CA  .   CA  ? ? E ASP 179 E CA  606 1_555 ? ? ? ? ? ? ? 2.620 ? 
metalc146 metalc ? ? D  ASP 55  OD2 ? ? ? 1_555 KA CA  .   CA  ? ? D ASP 162 D CA  604 1_555 ? ? ? ? ? ? ? 2.630 ? 
metalc147 metalc ? ? F  ASP 55  OD2 ? ? ? 1_555 YA CA  .   CA  ? ? F ASP 162 F CA  604 1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc148 metalc ? ? LA CA  .   CA  ? ? ? 1_555 FB HOH .   O   ? ? D CA  605 D HOH 727 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc149 metalc ? ? A  ASP 55  OD2 ? ? ? 1_555 P  CA  .   CA  ? ? A ASP 162 A CA  604 1_555 ? ? ? ? ? ? ? 2.645 ? 
metalc150 metalc ? ? C  ASP 55  OD2 ? ? ? 1_555 DA CA  .   CA  ? ? C ASP 162 C CA  604 1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc151 metalc ? ? AB CA  .   CA  ? ? ? 1_555 HB HOH .   O   ? ? F CA  606 F HOH 778 1_555 ? ? ? ? ? ? ? 2.656 ? 
metalc152 metalc ? ? B  ASP 55  OD2 ? ? ? 1_555 W  CA  .   CA  ? ? B ASP 162 B CA  604 1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc153 metalc ? ? A  ASP 72  OD1 ? ? ? 1_555 R  CA  .   CA  ? ? A ASP 179 A CA  606 1_555 ? ? ? ? ? ? ? 2.685 ? 
metalc154 metalc ? ? R  CA  .   CA  ? ? ? 1_555 CB HOH .   O   ? ? A CA  606 A HOH 902 1_555 ? ? ? ? ? ? ? 2.687 ? 
metalc155 metalc ? ? TA CA  .   CA  ? ? ? 1_555 GB HOH .   O   ? ? E CA  606 E HOH 920 1_555 ? ? ? ? ? ? ? 2.734 ? 
metalc156 metalc ? ? E  ASP 55  OD2 ? ? ? 1_555 RA CA  .   CA  ? ? E ASP 162 E CA  604 1_555 ? ? ? ? ? ? ? 2.759 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7 ? 
B  ? 2 ? 
C  ? 2 ? 
D  ? 3 ? 
E  ? 4 ? 
F  ? 4 ? 
G  ? 7 ? 
H  ? 2 ? 
I  ? 2 ? 
J  ? 3 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 7 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 3 ? 
Q  ? 4 ? 
R  ? 4 ? 
S  ? 7 ? 
T  ? 2 ? 
U  ? 2 ? 
V  ? 3 ? 
W  ? 4 ? 
X  ? 4 ? 
Y  ? 7 ? 
Z  ? 2 ? 
AA ? 2 ? 
AB ? 3 ? 
AC ? 4 ? 
AD ? 4 ? 
AE ? 7 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 3 ? 
AI ? 4 ? 
AJ ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? parallel      
A  4 5 ? parallel      
A  5 6 ? parallel      
A  6 7 ? parallel      
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? parallel      
G  2 3 ? parallel      
G  3 4 ? parallel      
G  4 5 ? parallel      
G  5 6 ? parallel      
G  6 7 ? parallel      
H  1 2 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? parallel      
M  2 3 ? parallel      
M  3 4 ? parallel      
M  4 5 ? parallel      
M  5 6 ? parallel      
M  6 7 ? parallel      
N  1 2 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? parallel      
S  3 4 ? parallel      
S  4 5 ? parallel      
S  5 6 ? parallel      
S  6 7 ? parallel      
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Y  3 4 ? parallel      
Y  4 5 ? parallel      
Y  5 6 ? parallel      
Y  6 7 ? parallel      
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AE 3 4 ? parallel      
AE 4 5 ? parallel      
AE 5 6 ? parallel      
AE 6 7 ? parallel      
AF 1 2 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 PHE A 66  ? ASP A 67  ? PHE A 173 ASP A 174 
A  2 ARG A 113 ? ARG A 118 ? ARG A 220 ARG A 225 
A  3 VAL A 41  ? ASP A 46  ? VAL A 148 ASP A 153 
A  4 ILE A 142 ? ALA A 145 ? ILE A 249 ALA A 252 
A  5 ILE A 181 ? ALA A 185 ? ILE A 288 ALA A 292 
A  6 THR A 207 ? ALA A 213 ? THR A 314 ALA A 320 
A  7 ALA A 231 ? TYR A 234 ? ALA A 338 TYR A 341 
B  1 ILE A 244 ? ASP A 248 ? ILE A 351 ASP A 355 
B  2 LYS A 252 ? HIS A 257 ? LYS A 359 HIS A 364 
C  1 ALA A 305 ? THR A 306 ? ALA A 412 THR A 413 
C  2 LYS A 312 ? VAL A 313 ? LYS A 419 VAL A 420 
D  1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
D  2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
D  3 LYS A 352 ? ASP A 353 ? LYS A 459 ASP A 460 
E  1 ARG A 341 ? ASP A 346 ? ARG A 448 ASP A 453 
E  2 GLY A 454 ? THR A 466 ? GLY A 561 THR A 573 
E  3 ARG A 376 ? TYR A 388 ? ARG A 483 TYR A 495 
E  4 PHE A 421 ? THR A 428 ? PHE A 528 THR A 535 
F  1 ARG A 357 ? VAL A 364 ? ARG A 464 VAL A 471 
F  2 GLY A 438 ? ASN A 446 ? GLY A 545 ASN A 553 
F  3 LEU A 394 ? VAL A 399 ? LEU A 501 VAL A 506 
F  4 ARG A 405 ? LEU A 409 ? ARG A 512 LEU A 516 
G  1 PHE B 66  ? ASP B 67  ? PHE B 173 ASP B 174 
G  2 ARG B 113 ? ARG B 118 ? ARG B 220 ARG B 225 
G  3 VAL B 41  ? ASP B 46  ? VAL B 148 ASP B 153 
G  4 ILE B 142 ? ALA B 145 ? ILE B 249 ALA B 252 
G  5 ILE B 181 ? ALA B 185 ? ILE B 288 ALA B 292 
G  6 THR B 207 ? ALA B 213 ? THR B 314 ALA B 320 
G  7 ALA B 231 ? TYR B 234 ? ALA B 338 TYR B 341 
H  1 ILE B 244 ? ASP B 248 ? ILE B 351 ASP B 355 
H  2 LYS B 252 ? HIS B 257 ? LYS B 359 HIS B 364 
I  1 ALA B 305 ? THR B 306 ? ALA B 412 THR B 413 
I  2 LYS B 312 ? VAL B 313 ? LYS B 419 VAL B 420 
J  1 ARG B 341 ? ASP B 346 ? ARG B 448 ASP B 453 
J  2 GLY B 454 ? THR B 466 ? GLY B 561 THR B 573 
J  3 LYS B 352 ? ASP B 353 ? LYS B 459 ASP B 460 
K  1 ARG B 341 ? ASP B 346 ? ARG B 448 ASP B 453 
K  2 GLY B 454 ? THR B 466 ? GLY B 561 THR B 573 
K  3 ARG B 376 ? TYR B 388 ? ARG B 483 TYR B 495 
K  4 PHE B 421 ? THR B 428 ? PHE B 528 THR B 535 
L  1 ARG B 357 ? VAL B 364 ? ARG B 464 VAL B 471 
L  2 GLY B 438 ? ASN B 446 ? GLY B 545 ASN B 553 
L  3 LEU B 394 ? VAL B 399 ? LEU B 501 VAL B 506 
L  4 ARG B 405 ? LEU B 409 ? ARG B 512 LEU B 516 
M  1 PHE C 66  ? ASP C 67  ? PHE C 173 ASP C 174 
M  2 ARG C 113 ? ARG C 118 ? ARG C 220 ARG C 225 
M  3 VAL C 41  ? ASP C 46  ? VAL C 148 ASP C 153 
M  4 ILE C 142 ? ALA C 145 ? ILE C 249 ALA C 252 
M  5 ILE C 181 ? ALA C 185 ? ILE C 288 ALA C 292 
M  6 THR C 207 ? ALA C 213 ? THR C 314 ALA C 320 
M  7 ALA C 231 ? TYR C 234 ? ALA C 338 TYR C 341 
N  1 ILE C 244 ? ASP C 248 ? ILE C 351 ASP C 355 
N  2 LYS C 252 ? HIS C 257 ? LYS C 359 HIS C 364 
O  1 ALA C 305 ? THR C 306 ? ALA C 412 THR C 413 
O  2 LYS C 312 ? VAL C 313 ? LYS C 419 VAL C 420 
P  1 ARG C 341 ? ASP C 346 ? ARG C 448 ASP C 453 
P  2 GLY C 454 ? THR C 466 ? GLY C 561 THR C 573 
P  3 LYS C 352 ? ASP C 353 ? LYS C 459 ASP C 460 
Q  1 ARG C 341 ? ASP C 346 ? ARG C 448 ASP C 453 
Q  2 GLY C 454 ? THR C 466 ? GLY C 561 THR C 573 
Q  3 ARG C 376 ? TYR C 388 ? ARG C 483 TYR C 495 
Q  4 PHE C 421 ? THR C 428 ? PHE C 528 THR C 535 
R  1 ARG C 357 ? VAL C 364 ? ARG C 464 VAL C 471 
R  2 GLY C 438 ? ASN C 446 ? GLY C 545 ASN C 553 
R  3 LEU C 394 ? VAL C 399 ? LEU C 501 VAL C 506 
R  4 ARG C 405 ? LEU C 409 ? ARG C 512 LEU C 516 
S  1 PHE D 66  ? ASP D 67  ? PHE D 173 ASP D 174 
S  2 ARG D 113 ? ARG D 118 ? ARG D 220 ARG D 225 
S  3 VAL D 41  ? ASP D 46  ? VAL D 148 ASP D 153 
S  4 ILE D 142 ? ALA D 145 ? ILE D 249 ALA D 252 
S  5 ILE D 181 ? ALA D 185 ? ILE D 288 ALA D 292 
S  6 THR D 207 ? ALA D 213 ? THR D 314 ALA D 320 
S  7 ALA D 231 ? TYR D 234 ? ALA D 338 TYR D 341 
T  1 ILE D 244 ? ASP D 248 ? ILE D 351 ASP D 355 
T  2 LYS D 252 ? HIS D 257 ? LYS D 359 HIS D 364 
U  1 ALA D 305 ? THR D 306 ? ALA D 412 THR D 413 
U  2 LYS D 312 ? VAL D 313 ? LYS D 419 VAL D 420 
V  1 ARG D 341 ? ASP D 346 ? ARG D 448 ASP D 453 
V  2 GLY D 454 ? THR D 466 ? GLY D 561 THR D 573 
V  3 LYS D 352 ? ASP D 353 ? LYS D 459 ASP D 460 
W  1 ARG D 341 ? ASP D 346 ? ARG D 448 ASP D 453 
W  2 GLY D 454 ? THR D 466 ? GLY D 561 THR D 573 
W  3 ARG D 376 ? TYR D 388 ? ARG D 483 TYR D 495 
W  4 PHE D 421 ? THR D 428 ? PHE D 528 THR D 535 
X  1 ARG D 357 ? VAL D 364 ? ARG D 464 VAL D 471 
X  2 GLY D 438 ? ASN D 446 ? GLY D 545 ASN D 553 
X  3 LEU D 394 ? VAL D 399 ? LEU D 501 VAL D 506 
X  4 ARG D 405 ? LEU D 409 ? ARG D 512 LEU D 516 
Y  1 PHE E 66  ? ASP E 67  ? PHE E 173 ASP E 174 
Y  2 ARG E 113 ? ARG E 118 ? ARG E 220 ARG E 225 
Y  3 VAL E 41  ? ASP E 46  ? VAL E 148 ASP E 153 
Y  4 ILE E 142 ? ALA E 145 ? ILE E 249 ALA E 252 
Y  5 ILE E 181 ? ALA E 185 ? ILE E 288 ALA E 292 
Y  6 THR E 207 ? ALA E 213 ? THR E 314 ALA E 320 
Y  7 ALA E 231 ? TYR E 234 ? ALA E 338 TYR E 341 
Z  1 ILE E 244 ? ASP E 248 ? ILE E 351 ASP E 355 
Z  2 LYS E 252 ? HIS E 257 ? LYS E 359 HIS E 364 
AA 1 ALA E 305 ? THR E 306 ? ALA E 412 THR E 413 
AA 2 LYS E 312 ? VAL E 313 ? LYS E 419 VAL E 420 
AB 1 ARG E 341 ? ASP E 346 ? ARG E 448 ASP E 453 
AB 2 GLY E 454 ? THR E 466 ? GLY E 561 THR E 573 
AB 3 LYS E 352 ? ASP E 353 ? LYS E 459 ASP E 460 
AC 1 ARG E 341 ? ASP E 346 ? ARG E 448 ASP E 453 
AC 2 GLY E 454 ? THR E 466 ? GLY E 561 THR E 573 
AC 3 ARG E 376 ? TYR E 388 ? ARG E 483 TYR E 495 
AC 4 PHE E 421 ? THR E 428 ? PHE E 528 THR E 535 
AD 1 ARG E 357 ? VAL E 364 ? ARG E 464 VAL E 471 
AD 2 GLY E 438 ? ASN E 446 ? GLY E 545 ASN E 553 
AD 3 LEU E 394 ? VAL E 399 ? LEU E 501 VAL E 506 
AD 4 ARG E 405 ? LEU E 409 ? ARG E 512 LEU E 516 
AE 1 PHE F 66  ? ASP F 67  ? PHE F 173 ASP F 174 
AE 2 ARG F 113 ? ARG F 118 ? ARG F 220 ARG F 225 
AE 3 VAL F 41  ? ASP F 46  ? VAL F 148 ASP F 153 
AE 4 ILE F 142 ? ALA F 145 ? ILE F 249 ALA F 252 
AE 5 ILE F 181 ? ALA F 185 ? ILE F 288 ALA F 292 
AE 6 THR F 207 ? ALA F 213 ? THR F 314 ALA F 320 
AE 7 ALA F 231 ? TYR F 234 ? ALA F 338 TYR F 341 
AF 1 ILE F 244 ? ASP F 248 ? ILE F 351 ASP F 355 
AF 2 LYS F 252 ? HIS F 257 ? LYS F 359 HIS F 364 
AG 1 ALA F 305 ? THR F 306 ? ALA F 412 THR F 413 
AG 2 LYS F 312 ? VAL F 313 ? LYS F 419 VAL F 420 
AH 1 ARG F 341 ? ASP F 346 ? ARG F 448 ASP F 453 
AH 2 GLY F 454 ? THR F 466 ? GLY F 561 THR F 573 
AH 3 LYS F 352 ? ASP F 353 ? LYS F 459 ASP F 460 
AI 1 ARG F 341 ? ASP F 346 ? ARG F 448 ASP F 453 
AI 2 GLY F 454 ? THR F 466 ? GLY F 561 THR F 573 
AI 3 ARG F 376 ? TYR F 388 ? ARG F 483 TYR F 495 
AI 4 PHE F 421 ? THR F 428 ? PHE F 528 THR F 535 
AJ 1 ARG F 357 ? VAL F 364 ? ARG F 464 VAL F 471 
AJ 2 GLY F 438 ? ASN F 446 ? GLY F 545 ASN F 553 
AJ 3 LEU F 394 ? VAL F 399 ? LEU F 501 VAL F 506 
AJ 4 ARG F 405 ? LEU F 409 ? ARG F 512 LEU F 516 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N PHE A 66  ? N PHE A 173 O ARG A 118 ? O ARG A 225 
A  2 3 O ARG A 113 ? O ARG A 220 N VAL A 42  ? N VAL A 149 
A  3 4 N SER A 43  ? N SER A 150 O ILE A 142 ? O ILE A 249 
A  4 5 N TYR A 143 ? N TYR A 250 O ILE A 181 ? O ILE A 288 
A  5 6 N TRP A 184 ? N TRP A 291 O ILE A 210 ? O ILE A 317 
A  6 7 N SER A 211 ? N SER A 318 O ALA A 231 ? O ALA A 338 
B  1 2 N ASP A 248 ? N ASP A 355 O LYS A 252 ? O LYS A 359 
C  1 2 N ALA A 305 ? N ALA A 412 O VAL A 313 ? O VAL A 420 
D  1 2 N ILE A 345 ? N ILE A 452 O LEU A 461 ? O LEU A 568 
D  2 3 O LEU A 456 ? O LEU A 563 N LYS A 352 ? N LYS A 459 
E  1 2 N ILE A 345 ? N ILE A 452 O LEU A 461 ? O LEU A 568 
E  2 3 O THR A 460 ? O THR A 567 N ARG A 383 ? N ARG A 490 
E  3 4 N ALA A 382 ? N ALA A 489 O PHE A 426 ? O PHE A 533 
F  1 2 N LEU A 358 ? N LEU A 465 O ILE A 444 ? O ILE A 551 
F  2 3 O GLU A 443 ? O GLU A 550 N HIS A 397 ? N HIS A 504 
F  3 4 N LEU A 398 ? N LEU A 505 O SER A 406 ? O SER A 513 
G  1 2 N PHE B 66  ? N PHE B 173 O ARG B 118 ? O ARG B 225 
G  2 3 O GLY B 115 ? O GLY B 222 N VAL B 42  ? N VAL B 149 
G  3 4 N SER B 43  ? N SER B 150 O ILE B 142 ? O ILE B 249 
G  4 5 N TYR B 143 ? N TYR B 250 O ILE B 181 ? O ILE B 288 
G  5 6 N PHE B 182 ? N PHE B 289 O LEU B 208 ? O LEU B 315 
G  6 7 N SER B 211 ? N SER B 318 O ALA B 231 ? O ALA B 338 
H  1 2 N THR B 246 ? N THR B 353 O THR B 254 ? O THR B 361 
I  1 2 N ALA B 305 ? N ALA B 412 O VAL B 313 ? O VAL B 420 
J  1 2 N ILE B 345 ? N ILE B 452 O LEU B 461 ? O LEU B 568 
J  2 3 O LEU B 456 ? O LEU B 563 N LYS B 352 ? N LYS B 459 
K  1 2 N ILE B 345 ? N ILE B 452 O LEU B 461 ? O LEU B 568 
K  2 3 O THR B 460 ? O THR B 567 N ARG B 383 ? N ARG B 490 
K  3 4 N ALA B 382 ? N ALA B 489 O PHE B 426 ? O PHE B 533 
L  1 2 N LEU B 358 ? N LEU B 465 O ILE B 444 ? O ILE B 551 
L  2 3 O GLU B 443 ? O GLU B 550 N HIS B 397 ? N HIS B 504 
L  3 4 N LEU B 398 ? N LEU B 505 O SER B 406 ? O SER B 513 
M  1 2 N PHE C 66  ? N PHE C 173 O ARG C 118 ? O ARG C 225 
M  2 3 O ARG C 113 ? O ARG C 220 N VAL C 42  ? N VAL C 149 
M  3 4 N SER C 43  ? N SER C 150 O ILE C 142 ? O ILE C 249 
M  4 5 N TYR C 143 ? N TYR C 250 O ILE C 181 ? O ILE C 288 
M  5 6 N TRP C 184 ? N TRP C 291 O ILE C 210 ? O ILE C 317 
M  6 7 N SER C 211 ? N SER C 318 O ALA C 231 ? O ALA C 338 
N  1 2 N ASP C 248 ? N ASP C 355 O LYS C 252 ? O LYS C 359 
O  1 2 N ALA C 305 ? N ALA C 412 O VAL C 313 ? O VAL C 420 
P  1 2 N ILE C 345 ? N ILE C 452 O LEU C 461 ? O LEU C 568 
P  2 3 O LEU C 456 ? O LEU C 563 N LYS C 352 ? N LYS C 459 
Q  1 2 N ILE C 345 ? N ILE C 452 O LEU C 461 ? O LEU C 568 
Q  2 3 O THR C 460 ? O THR C 567 N ARG C 383 ? N ARG C 490 
Q  3 4 N ALA C 382 ? N ALA C 489 O PHE C 426 ? O PHE C 533 
R  1 2 N LEU C 358 ? N LEU C 465 O ILE C 444 ? O ILE C 551 
R  2 3 O VAL C 441 ? O VAL C 548 N VAL C 399 ? N VAL C 506 
R  3 4 N LEU C 398 ? N LEU C 505 O SER C 406 ? O SER C 513 
S  1 2 N PHE D 66  ? N PHE D 173 O ARG D 118 ? O ARG D 225 
S  2 3 O VAL D 117 ? O VAL D 224 N ILE D 44  ? N ILE D 151 
S  3 4 N SER D 43  ? N SER D 150 O ILE D 142 ? O ILE D 249 
S  4 5 N TYR D 143 ? N TYR D 250 O ILE D 181 ? O ILE D 288 
S  5 6 N PHE D 182 ? N PHE D 289 O LEU D 208 ? O LEU D 315 
S  6 7 N SER D 211 ? N SER D 318 O ALA D 231 ? O ALA D 338 
T  1 2 N ASP D 248 ? N ASP D 355 O LYS D 252 ? O LYS D 359 
U  1 2 N ALA D 305 ? N ALA D 412 O VAL D 313 ? O VAL D 420 
V  1 2 N ILE D 345 ? N ILE D 452 O LEU D 461 ? O LEU D 568 
V  2 3 O LEU D 456 ? O LEU D 563 N LYS D 352 ? N LYS D 459 
W  1 2 N ILE D 345 ? N ILE D 452 O LEU D 461 ? O LEU D 568 
W  2 3 O THR D 460 ? O THR D 567 N ARG D 383 ? N ARG D 490 
W  3 4 N ALA D 382 ? N ALA D 489 O PHE D 426 ? O PHE D 533 
X  1 2 N LEU D 358 ? N LEU D 465 O ILE D 444 ? O ILE D 551 
X  2 3 O VAL D 441 ? O VAL D 548 N VAL D 399 ? N VAL D 506 
X  3 4 N LEU D 398 ? N LEU D 505 O SER D 406 ? O SER D 513 
Y  1 2 N PHE E 66  ? N PHE E 173 O ARG E 118 ? O ARG E 225 
Y  2 3 O VAL E 117 ? O VAL E 224 N ILE E 44  ? N ILE E 151 
Y  3 4 N SER E 43  ? N SER E 150 O ILE E 142 ? O ILE E 249 
Y  4 5 N TYR E 143 ? N TYR E 250 O ILE E 181 ? O ILE E 288 
Y  5 6 N PHE E 182 ? N PHE E 289 O LEU E 208 ? O LEU E 315 
Y  6 7 N SER E 211 ? N SER E 318 O ALA E 231 ? O ALA E 338 
Z  1 2 N THR E 246 ? N THR E 353 O THR E 254 ? O THR E 361 
AA 1 2 N ALA E 305 ? N ALA E 412 O VAL E 313 ? O VAL E 420 
AB 1 2 N ILE E 345 ? N ILE E 452 O LEU E 461 ? O LEU E 568 
AB 2 3 O LEU E 456 ? O LEU E 563 N LYS E 352 ? N LYS E 459 
AC 1 2 N ILE E 345 ? N ILE E 452 O LEU E 461 ? O LEU E 568 
AC 2 3 O THR E 460 ? O THR E 567 N ARG E 383 ? N ARG E 490 
AC 3 4 N LEU E 386 ? N LEU E 493 O PHE E 421 ? O PHE E 528 
AD 1 2 N LEU E 358 ? N LEU E 465 O ILE E 444 ? O ILE E 551 
AD 2 3 O GLU E 443 ? O GLU E 550 N HIS E 397 ? N HIS E 504 
AD 3 4 N LEU E 398 ? N LEU E 505 O SER E 406 ? O SER E 513 
AE 1 2 N PHE F 66  ? N PHE F 173 O ARG F 118 ? O ARG F 225 
AE 2 3 O VAL F 117 ? O VAL F 224 N ILE F 44  ? N ILE F 151 
AE 3 4 N SER F 43  ? N SER F 150 O ILE F 142 ? O ILE F 249 
AE 4 5 N TYR F 143 ? N TYR F 250 O ILE F 181 ? O ILE F 288 
AE 5 6 N TRP F 184 ? N TRP F 291 O ILE F 210 ? O ILE F 317 
AE 6 7 N SER F 211 ? N SER F 318 O ALA F 231 ? O ALA F 338 
AF 1 2 N ASP F 248 ? N ASP F 355 O LYS F 252 ? O LYS F 359 
AG 1 2 N ALA F 305 ? N ALA F 412 O VAL F 313 ? O VAL F 420 
AH 1 2 N ILE F 345 ? N ILE F 452 O LEU F 461 ? O LEU F 568 
AH 2 3 O LEU F 456 ? O LEU F 563 N LYS F 352 ? N LYS F 459 
AI 1 2 N ILE F 345 ? N ILE F 452 O LEU F 461 ? O LEU F 568 
AI 2 3 O THR F 460 ? O THR F 567 N ARG F 383 ? N ARG F 490 
AI 3 4 N ALA F 382 ? N ALA F 489 O PHE F 426 ? O PHE F 533 
AJ 1 2 N LEU F 358 ? N LEU F 465 O ILE F 444 ? O ILE F 551 
AJ 2 3 O GLU F 443 ? O GLU F 550 N HIS F 397 ? N HIS F 504 
AJ 3 4 N LEU F 398 ? N LEU F 505 O SER F 406 ? O SER F 513 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT A 601' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT A 602' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT A 603' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 604' 
AC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 605' 
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 606' 
AC7 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA A 607' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT B 601' 
AC9 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT B 602' 
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE FMT B 603' 
BC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 604' 
BC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 605' 
BC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA B 606' 
BC5 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA B 607' 
BC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT C 601' 
BC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT C 602' 
BC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT C 603' 
BC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 604' 
CC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 605' 
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA C 606' 
CC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA C 607' 
CC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT D 601' 
CC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT D 602' 
CC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE FMT D 603' 
CC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 604' 
CC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 605' 
CC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA D 606' 
DC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA D 607' 
DC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE FMT E 601' 
DC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FMT E 602' 
DC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT E 603' 
DC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 604' 
DC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 605' 
DC7 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA E 606' 
DC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA E 607' 
DC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT F 601' 
EC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT F 602' 
EC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE FMT F 603' 
EC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 604' 
EC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 605' 
EC5 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA F 606' 
EC6 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA F 607' 
EC7 Software ? ? ? ? 30 
'BINDING SITE FOR CHAIN H OF PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVALINE)-ARG- (AMIDOMETHYL)BENZAMIDINE' 
EC8 Software ? ? ? ? 28 
'BINDING SITE FOR CHAIN I OF PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVALINE)-ARG- (AMIDOMETHYL)BENZAMIDINE' 
EC9 Software ? ? ? ? 28 
'BINDING SITE FOR CHAIN J OF PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVALINE)-ARG- (AMIDOMETHYL)BENZAMIDINE' 
FC1 Software ? ? ? ? 31 
'BINDING SITE FOR CHAIN K OF PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVALINE)-ARG- (AMIDOMETHYL)BENZAMIDINE' 
FC2 Software ? ? ? ? 28 
'BINDING SITE FOR CHAIN L OF PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVALINE)-ARG- (AMIDOMETHYL)BENZAMIDINE' 
FC3 Software ? ? ? ? 29 
'BINDING SITE FOR CHAIN N OF PARA-GUANIDINOMETHYL-PHENYLACETYL-ARG-(3-METHYLVALINE)-ARG- (AMIDOMETHYL)BENZAMIDINE' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  ASN A  188 ? ASN A 295  . ? 1_555 ? 
2   AC1 5  THR A  258 ? THR A 365  . ? 1_555 ? 
3   AC1 5  GLY A  259 ? GLY A 366  . ? 1_555 ? 
4   AC1 5  HOH CB .   ? HOH A 760  . ? 1_555 ? 
5   AC1 5  ARG E  191 ? ARG E 298  . ? 2_564 ? 
6   AC2 5  TYR A  206 ? TYR A 313  . ? 1_555 ? 
7   AC2 5  GLN A  340 ? GLN A 447  . ? 1_555 ? 
8   AC2 5  FMT O  .   ? FMT A 603  . ? 1_555 ? 
9   AC2 5  ARG B  169 ? ARG B 276  . ? 1_555 ? 
10  AC2 5  GLN B  173 ? GLN B 280  . ? 1_555 ? 
11  AC3 6  PHE A  168 ? PHE A 275  . ? 1_555 ? 
12  AC3 6  TYR A  206 ? TYR A 313  . ? 1_555 ? 
13  AC3 6  LYS A  342 ? LYS A 449  . ? 1_555 ? 
14  AC3 6  TYR A  464 ? TYR A 571  . ? 1_555 ? 
15  AC3 6  FMT N  .   ? FMT A 602  . ? 1_555 ? 
16  AC3 6  ARG B  169 ? ARG B 276  . ? 1_555 ? 
17  AC4 6  ASP A  8   ? ASP A 115  . ? 1_555 ? 
18  AC4 6  ASP A  55  ? ASP A 162  . ? 1_555 ? 
19  AC4 6  VAL A  98  ? VAL A 205  . ? 1_555 ? 
20  AC4 6  ASN A  101 ? ASN A 208  . ? 1_555 ? 
21  AC4 6  VAL A  103 ? VAL A 210  . ? 1_555 ? 
22  AC4 6  GLY A  105 ? GLY A 212  . ? 1_555 ? 
23  AC5 6  ASP A  151 ? ASP A 258  . ? 1_555 ? 
24  AC5 6  ASP A  194 ? ASP A 301  . ? 1_555 ? 
25  AC5 6  GLU A  224 ? GLU A 331  . ? 1_555 ? 
26  AC5 6  HOH CB .   ? HOH A 756  . ? 1_555 ? 
27  AC5 6  HOH CB .   ? HOH A 771  . ? 1_555 ? 
28  AC5 6  HOH CB .   ? HOH A 852  . ? 1_555 ? 
29  AC6 6  ASP A  67  ? ASP A 174  . ? 1_555 ? 
30  AC6 6  ASP A  72  ? ASP A 179  . ? 1_555 ? 
31  AC6 6  ASP A  74  ? ASP A 181  . ? 1_555 ? 
32  AC6 6  HOH CB .   ? HOH A 729  . ? 1_555 ? 
33  AC6 6  HOH CB .   ? HOH A 734  . ? 1_555 ? 
34  AC6 6  HOH CB .   ? HOH A 902  . ? 1_555 ? 
35  AC7 4  THR A  202 ? THR A 309  . ? 1_555 ? 
36  AC7 4  SER A  204 ? SER A 311  . ? 1_555 ? 
37  AC7 4  THR A  207 ? THR A 314  . ? 1_555 ? 
38  AC7 4  HOH CB .   ? HOH A 784  . ? 1_555 ? 
39  AC8 6  ARG A  169 ? ARG A 276  . ? 1_555 ? 
40  AC8 6  GLN A  173 ? GLN A 280  . ? 1_555 ? 
41  AC8 6  TYR B  206 ? TYR B 313  . ? 1_555 ? 
42  AC8 6  GLN B  340 ? GLN B 447  . ? 1_555 ? 
43  AC8 6  FMT U  .   ? FMT B 602  . ? 1_555 ? 
44  AC8 6  HOH DB .   ? HOH B 751  . ? 1_555 ? 
45  AC9 5  ARG A  169 ? ARG A 276  . ? 1_555 ? 
46  AC9 5  PHE B  168 ? PHE B 275  . ? 1_555 ? 
47  AC9 5  TYR B  206 ? TYR B 313  . ? 1_555 ? 
48  AC9 5  LYS B  342 ? LYS B 449  . ? 1_555 ? 
49  AC9 5  FMT T  .   ? FMT B 601  . ? 1_555 ? 
50  BC1 3  THR B  258 ? THR B 365  . ? 1_555 ? 
51  BC1 3  HOH DB .   ? HOH B 831  . ? 1_555 ? 
52  BC1 3  ARG D  191 ? ARG D 298  . ? 2_554 ? 
53  BC2 6  ASP B  8   ? ASP B 115  . ? 1_555 ? 
54  BC2 6  ASP B  55  ? ASP B 162  . ? 1_555 ? 
55  BC2 6  VAL B  98  ? VAL B 205  . ? 1_555 ? 
56  BC2 6  ASN B  101 ? ASN B 208  . ? 1_555 ? 
57  BC2 6  VAL B  103 ? VAL B 210  . ? 1_555 ? 
58  BC2 6  GLY B  105 ? GLY B 212  . ? 1_555 ? 
59  BC3 6  ASP B  151 ? ASP B 258  . ? 1_555 ? 
60  BC3 6  ASP B  194 ? ASP B 301  . ? 1_555 ? 
61  BC3 6  GLU B  224 ? GLU B 331  . ? 1_555 ? 
62  BC3 6  HOH DB .   ? HOH B 716  . ? 1_555 ? 
63  BC3 6  HOH DB .   ? HOH B 744  . ? 1_555 ? 
64  BC3 6  HOH DB .   ? HOH B 837  . ? 1_555 ? 
65  BC4 6  ASP B  67  ? ASP B 174  . ? 1_555 ? 
66  BC4 6  ASP B  72  ? ASP B 179  . ? 1_555 ? 
67  BC4 6  ASP B  74  ? ASP B 181  . ? 1_555 ? 
68  BC4 6  HOH DB .   ? HOH B 772  . ? 1_555 ? 
69  BC4 6  HOH DB .   ? HOH B 810  . ? 1_555 ? 
70  BC4 6  HOH DB .   ? HOH B 838  . ? 1_555 ? 
71  BC5 4  THR B  202 ? THR B 309  . ? 1_555 ? 
72  BC5 4  SER B  204 ? SER B 311  . ? 1_555 ? 
73  BC5 4  THR B  207 ? THR B 314  . ? 1_555 ? 
74  BC5 4  HOH DB .   ? HOH B 703  . ? 1_555 ? 
75  BC6 5  ASN C  188 ? ASN C 295  . ? 1_555 ? 
76  BC6 5  THR C  258 ? THR C 365  . ? 1_555 ? 
77  BC6 5  GLY C  259 ? GLY C 366  . ? 1_555 ? 
78  BC6 5  HOH EB .   ? HOH C 875  . ? 1_555 ? 
79  BC6 5  ARG F  191 ? ARG F 298  . ? 1_555 ? 
80  BC7 6  PHE C  168 ? PHE C 275  . ? 1_555 ? 
81  BC7 6  GLN C  340 ? GLN C 447  . ? 1_555 ? 
82  BC7 6  FMT CA .   ? FMT C 603  . ? 1_555 ? 
83  BC7 6  HOH EB .   ? HOH C 785  . ? 1_555 ? 
84  BC7 6  ARG D  169 ? ARG D 276  . ? 1_555 ? 
85  BC7 6  GLN D  173 ? GLN D 280  . ? 1_555 ? 
86  BC8 6  PHE C  168 ? PHE C 275  . ? 1_555 ? 
87  BC8 6  TYR C  206 ? TYR C 313  . ? 1_555 ? 
88  BC8 6  LYS C  342 ? LYS C 449  . ? 1_555 ? 
89  BC8 6  TYR C  464 ? TYR C 571  . ? 1_555 ? 
90  BC8 6  FMT BA .   ? FMT C 602  . ? 1_555 ? 
91  BC8 6  ARG D  169 ? ARG D 276  . ? 1_555 ? 
92  BC9 6  ASP C  8   ? ASP C 115  . ? 1_555 ? 
93  BC9 6  ASP C  55  ? ASP C 162  . ? 1_555 ? 
94  BC9 6  VAL C  98  ? VAL C 205  . ? 1_555 ? 
95  BC9 6  ASN C  101 ? ASN C 208  . ? 1_555 ? 
96  BC9 6  VAL C  103 ? VAL C 210  . ? 1_555 ? 
97  BC9 6  GLY C  105 ? GLY C 212  . ? 1_555 ? 
98  CC1 6  ASP C  151 ? ASP C 258  . ? 1_555 ? 
99  CC1 6  ASP C  194 ? ASP C 301  . ? 1_555 ? 
100 CC1 6  GLU C  224 ? GLU C 331  . ? 1_555 ? 
101 CC1 6  HOH EB .   ? HOH C 728  . ? 1_555 ? 
102 CC1 6  HOH EB .   ? HOH C 750  . ? 1_555 ? 
103 CC1 6  HOH EB .   ? HOH C 791  . ? 1_555 ? 
104 CC2 6  ASP C  67  ? ASP C 174  . ? 1_555 ? 
105 CC2 6  ASP C  72  ? ASP C 179  . ? 1_555 ? 
106 CC2 6  ASP C  74  ? ASP C 181  . ? 1_555 ? 
107 CC2 6  HOH EB .   ? HOH C 800  . ? 1_555 ? 
108 CC2 6  HOH EB .   ? HOH C 803  . ? 1_555 ? 
109 CC2 6  HOH EB .   ? HOH C 859  . ? 1_555 ? 
110 CC3 4  THR C  202 ? THR C 309  . ? 1_555 ? 
111 CC3 4  SER C  204 ? SER C 311  . ? 1_555 ? 
112 CC3 4  THR C  207 ? THR C 314  . ? 1_555 ? 
113 CC3 4  HOH EB .   ? HOH C 721  . ? 1_555 ? 
114 CC4 6  ARG C  169 ? ARG C 276  . ? 1_555 ? 
115 CC4 6  GLN C  173 ? GLN C 280  . ? 1_555 ? 
116 CC4 6  TYR D  206 ? TYR D 313  . ? 1_555 ? 
117 CC4 6  GLN D  340 ? GLN D 447  . ? 1_555 ? 
118 CC4 6  FMT IA .   ? FMT D 602  . ? 1_555 ? 
119 CC4 6  HOH FB .   ? HOH D 772  . ? 1_555 ? 
120 CC5 5  ARG C  169 ? ARG C 276  . ? 1_555 ? 
121 CC5 5  PHE D  168 ? PHE D 275  . ? 1_555 ? 
122 CC5 5  TYR D  206 ? TYR D 313  . ? 1_555 ? 
123 CC5 5  LYS D  342 ? LYS D 449  . ? 1_555 ? 
124 CC5 5  FMT HA .   ? FMT D 601  . ? 1_555 ? 
125 CC6 4  ARG B  191 ? ARG B 298  . ? 2_555 ? 
126 CC6 4  TRP D  221 ? TRP D 328  . ? 1_555 ? 
127 CC6 4  THR D  258 ? THR D 365  . ? 1_555 ? 
128 CC6 4  GLY D  259 ? GLY D 366  . ? 1_555 ? 
129 CC7 6  ASP D  8   ? ASP D 115  . ? 1_555 ? 
130 CC7 6  ASP D  55  ? ASP D 162  . ? 1_555 ? 
131 CC7 6  VAL D  98  ? VAL D 205  . ? 1_555 ? 
132 CC7 6  ASN D  101 ? ASN D 208  . ? 1_555 ? 
133 CC7 6  VAL D  103 ? VAL D 210  . ? 1_555 ? 
134 CC7 6  GLY D  105 ? GLY D 212  . ? 1_555 ? 
135 CC8 6  ASP D  151 ? ASP D 258  . ? 1_555 ? 
136 CC8 6  ASP D  194 ? ASP D 301  . ? 1_555 ? 
137 CC8 6  GLU D  224 ? GLU D 331  . ? 1_555 ? 
138 CC8 6  HOH FB .   ? HOH D 710  . ? 1_555 ? 
139 CC8 6  HOH FB .   ? HOH D 727  . ? 1_555 ? 
140 CC8 6  HOH FB .   ? HOH D 832  . ? 1_555 ? 
141 CC9 6  ASP D  67  ? ASP D 174  . ? 1_555 ? 
142 CC9 6  ASP D  72  ? ASP D 179  . ? 1_555 ? 
143 CC9 6  ASP D  74  ? ASP D 181  . ? 1_555 ? 
144 CC9 6  HOH FB .   ? HOH D 722  . ? 1_555 ? 
145 CC9 6  HOH FB .   ? HOH D 754  . ? 1_555 ? 
146 CC9 6  HOH FB .   ? HOH D 833  . ? 1_555 ? 
147 DC1 4  THR D  202 ? THR D 309  . ? 1_555 ? 
148 DC1 4  SER D  204 ? SER D 311  . ? 1_555 ? 
149 DC1 4  THR D  207 ? THR D 314  . ? 1_555 ? 
150 DC1 4  HOH FB .   ? HOH D 723  . ? 1_555 ? 
151 DC2 3  THR E  258 ? THR E 365  . ? 1_555 ? 
152 DC2 3  GLY E  259 ? GLY E 366  . ? 1_555 ? 
153 DC2 3  HOH GB .   ? HOH E 912  . ? 1_555 ? 
154 DC3 5  PHE E  168 ? PHE E 275  . ? 1_555 ? 
155 DC3 5  TYR E  206 ? TYR E 313  . ? 1_555 ? 
156 DC3 5  GLN E  340 ? GLN E 447  . ? 1_555 ? 
157 DC3 5  FMT QA .   ? FMT E 603  . ? 1_555 ? 
158 DC3 5  ARG F  169 ? ARG F 276  . ? 1_555 ? 
159 DC4 6  PHE E  168 ? PHE E 275  . ? 1_555 ? 
160 DC4 6  TYR E  206 ? TYR E 313  . ? 1_555 ? 
161 DC4 6  LYS E  342 ? LYS E 449  . ? 1_555 ? 
162 DC4 6  TYR E  464 ? TYR E 571  . ? 1_555 ? 
163 DC4 6  FMT PA .   ? FMT E 602  . ? 1_555 ? 
164 DC4 6  ARG F  169 ? ARG F 276  . ? 1_555 ? 
165 DC5 6  ASP E  8   ? ASP E 115  . ? 1_555 ? 
166 DC5 6  ASP E  55  ? ASP E 162  . ? 1_555 ? 
167 DC5 6  VAL E  98  ? VAL E 205  . ? 1_555 ? 
168 DC5 6  ASN E  101 ? ASN E 208  . ? 1_555 ? 
169 DC5 6  VAL E  103 ? VAL E 210  . ? 1_555 ? 
170 DC5 6  GLY E  105 ? GLY E 212  . ? 1_555 ? 
171 DC6 6  ASP E  151 ? ASP E 258  . ? 1_555 ? 
172 DC6 6  ASP E  194 ? ASP E 301  . ? 1_555 ? 
173 DC6 6  GLU E  224 ? GLU E 331  . ? 1_555 ? 
174 DC6 6  HOH GB .   ? HOH E 720  . ? 1_555 ? 
175 DC6 6  HOH GB .   ? HOH E 721  . ? 1_555 ? 
176 DC6 6  HOH GB .   ? HOH E 839  . ? 1_555 ? 
177 DC7 6  ASP E  67  ? ASP E 174  . ? 1_555 ? 
178 DC7 6  ASP E  72  ? ASP E 179  . ? 1_555 ? 
179 DC7 6  ASP E  74  ? ASP E 181  . ? 1_555 ? 
180 DC7 6  HOH GB .   ? HOH E 840  . ? 1_555 ? 
181 DC7 6  HOH GB .   ? HOH E 877  . ? 1_555 ? 
182 DC7 6  HOH GB .   ? HOH E 920  . ? 1_555 ? 
183 DC8 4  THR E  202 ? THR E 309  . ? 1_555 ? 
184 DC8 4  SER E  204 ? SER E 311  . ? 1_555 ? 
185 DC8 4  THR E  207 ? THR E 314  . ? 1_555 ? 
186 DC8 4  HOH GB .   ? HOH E 704  . ? 1_555 ? 
187 DC9 6  ARG E  169 ? ARG E 276  . ? 1_555 ? 
188 DC9 6  TYR F  206 ? TYR F 313  . ? 1_555 ? 
189 DC9 6  TRP F  283 ? TRP F 390  . ? 1_555 ? 
190 DC9 6  GLN F  340 ? GLN F 447  . ? 1_555 ? 
191 DC9 6  FMT WA .   ? FMT F 602  . ? 1_555 ? 
192 DC9 6  HOH HB .   ? HOH F 891  . ? 1_555 ? 
193 EC1 6  ARG E  169 ? ARG E 276  . ? 1_555 ? 
194 EC1 6  PHE F  168 ? PHE F 275  . ? 1_555 ? 
195 EC1 6  TYR F  206 ? TYR F 313  . ? 1_555 ? 
196 EC1 6  LYS F  342 ? LYS F 449  . ? 1_555 ? 
197 EC1 6  TYR F  464 ? TYR F 571  . ? 1_555 ? 
198 EC1 6  FMT VA .   ? FMT F 601  . ? 1_555 ? 
199 EC2 6  ARG C  191 ? ARG C 298  . ? 1_555 ? 
200 EC2 6  ASN F  188 ? ASN F 295  . ? 1_555 ? 
201 EC2 6  TRP F  221 ? TRP F 328  . ? 1_555 ? 
202 EC2 6  THR F  258 ? THR F 365  . ? 1_555 ? 
203 EC2 6  GLY F  259 ? GLY F 366  . ? 1_555 ? 
204 EC2 6  HOH HB .   ? HOH F 863  . ? 1_555 ? 
205 EC3 6  ASP F  8   ? ASP F 115  . ? 1_555 ? 
206 EC3 6  ASP F  55  ? ASP F 162  . ? 1_555 ? 
207 EC3 6  VAL F  98  ? VAL F 205  . ? 1_555 ? 
208 EC3 6  ASN F  101 ? ASN F 208  . ? 1_555 ? 
209 EC3 6  VAL F  103 ? VAL F 210  . ? 1_555 ? 
210 EC3 6  GLY F  105 ? GLY F 212  . ? 1_555 ? 
211 EC4 6  ASP F  151 ? ASP F 258  . ? 1_555 ? 
212 EC4 6  ASP F  194 ? ASP F 301  . ? 1_555 ? 
213 EC4 6  GLU F  224 ? GLU F 331  . ? 1_555 ? 
214 EC4 6  HOH HB .   ? HOH F 704  . ? 1_555 ? 
215 EC4 6  HOH HB .   ? HOH F 722  . ? 1_555 ? 
216 EC4 6  HOH HB .   ? HOH F 770  . ? 1_555 ? 
217 EC5 6  ASP F  67  ? ASP F 174  . ? 1_555 ? 
218 EC5 6  ASP F  72  ? ASP F 179  . ? 1_555 ? 
219 EC5 6  ASP F  74  ? ASP F 181  . ? 1_555 ? 
220 EC5 6  HOH HB .   ? HOH F 748  . ? 1_555 ? 
221 EC5 6  HOH HB .   ? HOH F 778  . ? 1_555 ? 
222 EC5 6  HOH HB .   ? HOH F 819  . ? 1_555 ? 
223 EC6 4  THR F  202 ? THR F 309  . ? 1_555 ? 
224 EC6 4  SER F  204 ? SER F 311  . ? 1_555 ? 
225 EC6 4  THR F  207 ? THR F 314  . ? 1_555 ? 
226 EC6 4  HOH HB .   ? HOH F 716  . ? 1_555 ? 
227 EC7 30 ASP A  47  ? ASP A 154  . ? 1_555 ? 
228 EC7 30 ASP A  84  ? ASP A 191  . ? 1_555 ? 
229 EC7 30 ASN A  85  ? ASN A 192  . ? 1_555 ? 
230 EC7 30 HIS A  87  ? HIS A 194  . ? 1_555 ? 
231 EC7 30 VAL A  124 ? VAL A 231  . ? 1_555 ? 
232 EC7 30 THR A  125 ? THR A 232  . ? 1_555 ? 
233 EC7 30 ASP A  126 ? ASP A 233  . ? 1_555 ? 
234 EC7 30 GLU A  129 ? GLU A 236  . ? 1_555 ? 
235 EC7 30 SER A  146 ? SER A 253  . ? 1_555 ? 
236 EC7 30 TRP A  147 ? TRP A 254  . ? 1_555 ? 
237 EC7 30 GLY A  148 ? GLY A 255  . ? 1_555 ? 
238 EC7 30 PRO A  149 ? PRO A 256  . ? 1_555 ? 
239 EC7 30 GLU A  150 ? GLU A 257  . ? 1_555 ? 
240 EC7 30 ASP A  151 ? ASP A 258  . ? 1_555 ? 
241 EC7 30 ASP A  157 ? ASP A 264  . ? 1_555 ? 
242 EC7 30 GLY A  158 ? GLY A 265  . ? 1_555 ? 
243 EC7 30 ALA A  160 ? ALA A 267  . ? 1_555 ? 
244 EC7 30 ALA A  185 ? ALA A 292  . ? 1_555 ? 
245 EC7 30 ASP A  199 ? ASP A 306  . ? 1_555 ? 
246 EC7 30 TYR A  201 ? TYR A 308  . ? 1_555 ? 
247 EC7 30 THR A  202 ? THR A 309  . ? 1_555 ? 
248 EC7 30 THR A  260 ? THR A 367  . ? 1_555 ? 
249 EC7 30 SER A  261 ? SER A 368  . ? 1_555 ? 
250 EC7 30 HOH CB .   ? HOH A 715  . ? 1_555 ? 
251 EC7 30 HOH CB .   ? HOH A 948  . ? 1_555 ? 
252 EC7 30 HOH CB .   ? HOH A 987  . ? 1_555 ? 
253 EC7 30 HOH IB .   ? HOH H 101  . ? 1_555 ? 
254 EC7 30 HOH IB .   ? HOH H 102  . ? 1_555 ? 
255 EC7 30 HOH IB .   ? HOH H 103  . ? 1_555 ? 
256 EC7 30 HOH IB .   ? HOH H 104  . ? 1_555 ? 
257 EC8 28 ASP B  47  ? ASP B 154  . ? 1_555 ? 
258 EC8 28 ASP B  84  ? ASP B 191  . ? 1_555 ? 
259 EC8 28 ASN B  85  ? ASN B 192  . ? 1_555 ? 
260 EC8 28 HIS B  87  ? HIS B 194  . ? 1_555 ? 
261 EC8 28 VAL B  124 ? VAL B 231  . ? 1_555 ? 
262 EC8 28 THR B  125 ? THR B 232  . ? 1_555 ? 
263 EC8 28 GLU B  129 ? GLU B 236  . ? 1_555 ? 
264 EC8 28 SER B  146 ? SER B 253  . ? 1_555 ? 
265 EC8 28 TRP B  147 ? TRP B 254  . ? 1_555 ? 
266 EC8 28 GLY B  148 ? GLY B 255  . ? 1_555 ? 
267 EC8 28 PRO B  149 ? PRO B 256  . ? 1_555 ? 
268 EC8 28 GLU B  150 ? GLU B 257  . ? 1_555 ? 
269 EC8 28 ASP B  151 ? ASP B 258  . ? 1_555 ? 
270 EC8 28 ASP B  157 ? ASP B 264  . ? 1_555 ? 
271 EC8 28 GLY B  158 ? GLY B 265  . ? 1_555 ? 
272 EC8 28 ALA B  185 ? ALA B 292  . ? 1_555 ? 
273 EC8 28 ASP B  199 ? ASP B 306  . ? 1_555 ? 
274 EC8 28 TYR B  201 ? TYR B 308  . ? 1_555 ? 
275 EC8 28 THR B  202 ? THR B 309  . ? 1_555 ? 
276 EC8 28 THR B  260 ? THR B 367  . ? 1_555 ? 
277 EC8 28 SER B  261 ? SER B 368  . ? 1_555 ? 
278 EC8 28 HOH DB .   ? HOH B 701  . ? 1_555 ? 
279 EC8 28 HOH DB .   ? HOH B 973  . ? 1_555 ? 
280 EC8 28 HOH DB .   ? HOH B 1022 . ? 1_555 ? 
281 EC8 28 HOH DB .   ? HOH B 1023 . ? 1_555 ? 
282 EC8 28 HOH JB .   ? HOH I 101  . ? 1_555 ? 
283 EC8 28 HOH JB .   ? HOH I 102  . ? 1_555 ? 
284 EC8 28 HOH JB .   ? HOH I 103  . ? 1_555 ? 
285 EC9 28 ASP C  47  ? ASP C 154  . ? 1_555 ? 
286 EC9 28 ASP C  84  ? ASP C 191  . ? 1_555 ? 
287 EC9 28 ASN C  85  ? ASN C 192  . ? 1_555 ? 
288 EC9 28 HIS C  87  ? HIS C 194  . ? 1_555 ? 
289 EC9 28 VAL C  124 ? VAL C 231  . ? 1_555 ? 
290 EC9 28 THR C  125 ? THR C 232  . ? 1_555 ? 
291 EC9 28 GLU C  129 ? GLU C 236  . ? 1_555 ? 
292 EC9 28 SER C  146 ? SER C 253  . ? 1_555 ? 
293 EC9 28 TRP C  147 ? TRP C 254  . ? 1_555 ? 
294 EC9 28 GLY C  148 ? GLY C 255  . ? 1_555 ? 
295 EC9 28 PRO C  149 ? PRO C 256  . ? 1_555 ? 
296 EC9 28 GLU C  150 ? GLU C 257  . ? 1_555 ? 
297 EC9 28 ASP C  151 ? ASP C 258  . ? 1_555 ? 
298 EC9 28 ASP C  157 ? ASP C 264  . ? 1_555 ? 
299 EC9 28 GLY C  158 ? GLY C 265  . ? 1_555 ? 
300 EC9 28 ALA C  185 ? ALA C 292  . ? 1_555 ? 
301 EC9 28 SER C  186 ? SER C 293  . ? 1_555 ? 
302 EC9 28 ASP C  199 ? ASP C 306  . ? 1_555 ? 
303 EC9 28 TYR C  201 ? TYR C 308  . ? 1_555 ? 
304 EC9 28 THR C  202 ? THR C 309  . ? 1_555 ? 
305 EC9 28 THR C  260 ? THR C 367  . ? 1_555 ? 
306 EC9 28 SER C  261 ? SER C 368  . ? 1_555 ? 
307 EC9 28 HOH EB .   ? HOH C 711  . ? 1_555 ? 
308 EC9 28 HOH KB .   ? HOH J 101  . ? 1_555 ? 
309 EC9 28 HOH KB .   ? HOH J 102  . ? 1_555 ? 
310 EC9 28 HOH KB .   ? HOH J 103  . ? 1_555 ? 
311 EC9 28 HOH KB .   ? HOH J 104  . ? 1_555 ? 
312 EC9 28 HOH KB .   ? HOH J 105  . ? 1_555 ? 
313 FC1 31 ASP D  47  ? ASP D 154  . ? 1_555 ? 
314 FC1 31 ASP D  84  ? ASP D 191  . ? 1_555 ? 
315 FC1 31 ASN D  85  ? ASN D 192  . ? 1_555 ? 
316 FC1 31 HIS D  87  ? HIS D 194  . ? 1_555 ? 
317 FC1 31 VAL D  124 ? VAL D 231  . ? 1_555 ? 
318 FC1 31 THR D  125 ? THR D 232  . ? 1_555 ? 
319 FC1 31 ASP D  126 ? ASP D 233  . ? 1_555 ? 
320 FC1 31 GLU D  129 ? GLU D 236  . ? 1_555 ? 
321 FC1 31 SER D  146 ? SER D 253  . ? 1_555 ? 
322 FC1 31 TRP D  147 ? TRP D 254  . ? 1_555 ? 
323 FC1 31 GLY D  148 ? GLY D 255  . ? 1_555 ? 
324 FC1 31 PRO D  149 ? PRO D 256  . ? 1_555 ? 
325 FC1 31 GLU D  150 ? GLU D 257  . ? 1_555 ? 
326 FC1 31 ASP D  151 ? ASP D 258  . ? 1_555 ? 
327 FC1 31 ASP D  157 ? ASP D 264  . ? 1_555 ? 
328 FC1 31 GLY D  158 ? GLY D 265  . ? 1_555 ? 
329 FC1 31 ALA D  185 ? ALA D 292  . ? 1_555 ? 
330 FC1 31 ASP D  199 ? ASP D 306  . ? 1_555 ? 
331 FC1 31 TYR D  201 ? TYR D 308  . ? 1_555 ? 
332 FC1 31 THR D  202 ? THR D 309  . ? 1_555 ? 
333 FC1 31 THR D  260 ? THR D 367  . ? 1_555 ? 
334 FC1 31 SER D  261 ? SER D 368  . ? 1_555 ? 
335 FC1 31 HOH FB .   ? HOH D 1011 . ? 1_555 ? 
336 FC1 31 HOH FB .   ? HOH D 1012 . ? 1_555 ? 
337 FC1 31 HOH LB .   ? HOH K 101  . ? 1_555 ? 
338 FC1 31 HOH LB .   ? HOH K 102  . ? 1_555 ? 
339 FC1 31 HOH LB .   ? HOH K 103  . ? 1_555 ? 
340 FC1 31 HOH LB .   ? HOH K 104  . ? 1_555 ? 
341 FC1 31 HOH LB .   ? HOH K 105  . ? 1_555 ? 
342 FC1 31 HOH LB .   ? HOH K 106  . ? 1_555 ? 
343 FC1 31 HOH LB .   ? HOH K 107  . ? 1_555 ? 
344 FC2 28 ASP E  47  ? ASP E 154  . ? 1_555 ? 
345 FC2 28 ASP E  84  ? ASP E 191  . ? 1_555 ? 
346 FC2 28 ASN E  85  ? ASN E 192  . ? 1_555 ? 
347 FC2 28 HIS E  87  ? HIS E 194  . ? 1_555 ? 
348 FC2 28 VAL E  124 ? VAL E 231  . ? 1_555 ? 
349 FC2 28 THR E  125 ? THR E 232  . ? 1_555 ? 
350 FC2 28 GLU E  129 ? GLU E 236  . ? 1_555 ? 
351 FC2 28 SER E  146 ? SER E 253  . ? 1_555 ? 
352 FC2 28 TRP E  147 ? TRP E 254  . ? 1_555 ? 
353 FC2 28 GLY E  148 ? GLY E 255  . ? 1_555 ? 
354 FC2 28 PRO E  149 ? PRO E 256  . ? 1_555 ? 
355 FC2 28 GLU E  150 ? GLU E 257  . ? 1_555 ? 
356 FC2 28 ASP E  151 ? ASP E 258  . ? 1_555 ? 
357 FC2 28 ASP E  157 ? ASP E 264  . ? 1_555 ? 
358 FC2 28 GLY E  158 ? GLY E 265  . ? 1_555 ? 
359 FC2 28 ALA E  185 ? ALA E 292  . ? 1_555 ? 
360 FC2 28 ASN E  188 ? ASN E 295  . ? 1_555 ? 
361 FC2 28 ASP E  199 ? ASP E 306  . ? 1_555 ? 
362 FC2 28 TYR E  201 ? TYR E 308  . ? 1_555 ? 
363 FC2 28 THR E  202 ? THR E 309  . ? 1_555 ? 
364 FC2 28 THR E  260 ? THR E 367  . ? 1_555 ? 
365 FC2 28 SER E  261 ? SER E 368  . ? 1_555 ? 
366 FC2 28 HOH GB .   ? HOH E 703  . ? 1_555 ? 
367 FC2 28 HOH GB .   ? HOH E 744  . ? 1_555 ? 
368 FC2 28 HOH MB .   ? HOH L 101  . ? 1_555 ? 
369 FC2 28 HOH MB .   ? HOH L 102  . ? 1_555 ? 
370 FC2 28 HOH MB .   ? HOH L 103  . ? 1_555 ? 
371 FC2 28 HOH MB .   ? HOH L 104  . ? 1_555 ? 
372 FC3 29 ASP F  47  ? ASP F 154  . ? 1_555 ? 
373 FC3 29 ASP F  84  ? ASP F 191  . ? 1_555 ? 
374 FC3 29 ASN F  85  ? ASN F 192  . ? 1_555 ? 
375 FC3 29 HIS F  87  ? HIS F 194  . ? 1_555 ? 
376 FC3 29 VAL F  124 ? VAL F 231  . ? 1_555 ? 
377 FC3 29 THR F  125 ? THR F 232  . ? 1_555 ? 
378 FC3 29 ASP F  126 ? ASP F 233  . ? 1_555 ? 
379 FC3 29 GLU F  129 ? GLU F 236  . ? 1_555 ? 
380 FC3 29 SER F  146 ? SER F 253  . ? 1_555 ? 
381 FC3 29 TRP F  147 ? TRP F 254  . ? 1_555 ? 
382 FC3 29 GLY F  148 ? GLY F 255  . ? 1_555 ? 
383 FC3 29 PRO F  149 ? PRO F 256  . ? 1_555 ? 
384 FC3 29 GLU F  150 ? GLU F 257  . ? 1_555 ? 
385 FC3 29 ASP F  151 ? ASP F 258  . ? 1_555 ? 
386 FC3 29 ASP F  157 ? ASP F 264  . ? 1_555 ? 
387 FC3 29 GLY F  158 ? GLY F 265  . ? 1_555 ? 
388 FC3 29 ALA F  185 ? ALA F 292  . ? 1_555 ? 
389 FC3 29 ASP F  199 ? ASP F 306  . ? 1_555 ? 
390 FC3 29 TYR F  201 ? TYR F 308  . ? 1_555 ? 
391 FC3 29 THR F  202 ? THR F 309  . ? 1_555 ? 
392 FC3 29 THR F  260 ? THR F 367  . ? 1_555 ? 
393 FC3 29 SER F  261 ? SER F 368  . ? 1_555 ? 
394 FC3 29 HOH HB .   ? HOH F 701  . ? 1_555 ? 
395 FC3 29 HOH HB .   ? HOH F 999  . ? 1_555 ? 
396 FC3 29 HOH NB .   ? HOH N 101  . ? 1_555 ? 
397 FC3 29 HOH NB .   ? HOH N 102  . ? 1_555 ? 
398 FC3 29 HOH NB .   ? HOH N 103  . ? 1_555 ? 
399 FC3 29 HOH NB .   ? HOH N 104  . ? 1_555 ? 
400 FC3 29 HOH NB .   ? HOH N 105  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4RYD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4RYD 
_atom_sites.fract_transf_matrix[1][1]   0.007060 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006549 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005938 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . VAL A  1 2   ? -0.894  39.156  25.745  1.00   38.47 ? 109  VAL A N   1 
ATOM   2     C  CA  . VAL A  1 2   ? 0.060   40.008  26.510  1.00   36.23 ? 109  VAL A CA  1 
ATOM   3     C  C   . VAL A  1 2   ? 1.318   40.371  25.695  1.00   35.30 ? 109  VAL A C   1 
ATOM   4     O  O   . VAL A  1 2   ? 1.940   41.405  25.935  1.00   37.01 ? 109  VAL A O   1 
ATOM   5     C  CB  . VAL A  1 2   ? 0.454   39.311  27.849  1.00   38.02 ? 109  VAL A CB  1 
ATOM   6     C  CG1 . VAL A  1 2   ? 1.049   37.952  27.575  1.00   39.44 ? 109  VAL A CG1 1 
ATOM   7     C  CG2 . VAL A  1 2   ? 1.419   40.184  28.637  1.00   38.29 ? 109  VAL A CG2 1 
ATOM   8     N  N   . TYR A  1 3   ? 1.673   39.540  24.717  1.00   28.56 ? 110  TYR A N   1 
ATOM   9     C  CA  . TYR A  1 3   ? 2.841   39.794  23.873  1.00   25.18 ? 110  TYR A CA  1 
ATOM   10    C  C   . TYR A  1 3   ? 2.773   41.085  23.036  1.00   23.30 ? 110  TYR A C   1 
ATOM   11    O  O   . TYR A  1 3   ? 1.775   41.348  22.374  1.00   20.99 ? 110  TYR A O   1 
ATOM   12    C  CB  . TYR A  1 3   ? 3.069   38.602  22.927  1.00   23.02 ? 110  TYR A CB  1 
ATOM   13    C  CG  . TYR A  1 3   ? 4.217   38.819  21.965  1.00   24.92 ? 110  TYR A CG  1 
ATOM   14    C  CD1 . TYR A  1 3   ? 5.538   38.852  22.416  1.00   26.69 ? 110  TYR A CD1 1 
ATOM   15    C  CD2 . TYR A  1 3   ? 3.980   39.081  20.617  1.00   25.47 ? 110  TYR A CD2 1 
ATOM   16    C  CE1 . TYR A  1 3   ? 6.588   39.151  21.551  1.00   25.54 ? 110  TYR A CE1 1 
ATOM   17    C  CE2 . TYR A  1 3   ? 5.023   39.383  19.743  1.00   23.09 ? 110  TYR A CE2 1 
ATOM   18    C  CZ  . TYR A  1 3   ? 6.319   39.423  20.214  1.00   24.31 ? 110  TYR A CZ  1 
ATOM   19    O  OH  . TYR A  1 3   ? 7.337   39.774  19.361  1.00   21.09 ? 110  TYR A OH  1 
ATOM   20    N  N   . GLN A  1 4   ? 3.842   41.885  23.066  1.00   22.11 ? 111  GLN A N   1 
ATOM   21    C  CA  . GLN A  1 4   ? 3.911   43.124  22.283  1.00   19.90 ? 111  GLN A CA  1 
ATOM   22    C  C   . GLN A  1 4   ? 4.819   42.902  21.064  1.00   19.21 ? 111  GLN A C   1 
ATOM   23    O  O   . GLN A  1 4   ? 6.018   42.687  21.225  1.00   19.84 ? 111  GLN A O   1 
ATOM   24    C  CB  . GLN A  1 4   ? 4.506   44.280  23.108  1.00   22.17 ? 111  GLN A CB  1 
ATOM   25    C  CG  . GLN A  1 4   ? 3.789   44.618  24.419  1.00   27.67 ? 111  GLN A CG  1 
ATOM   26    C  CD  . GLN A  1 4   ? 2.279   44.716  24.262  1.00   31.72 ? 111  GLN A CD  1 
ATOM   27    O  OE1 . GLN A  1 4   ? 1.542   43.844  24.729  1.00   38.03 ? 111  GLN A OE1 1 
ATOM   28    N  NE2 . GLN A  1 4   ? 1.812   45.768  23.595  1.00   27.11 ? 111  GLN A NE2 1 
ATOM   29    N  N   . GLU A  1 5   ? 4.264   42.984  19.853  1.00   19.27 ? 112  GLU A N   1 
ATOM   30    C  CA  . GLU A  1 5   ? 5.043   42.778  18.614  1.00   19.91 ? 112  GLU A CA  1 
ATOM   31    C  C   . GLU A  1 5   ? 6.035   43.918  18.324  1.00   20.14 ? 112  GLU A C   1 
ATOM   32    O  O   . GLU A  1 5   ? 5.903   45.013  18.869  1.00   22.41 ? 112  GLU A O   1 
ATOM   33    C  CB  . GLU A  1 5   ? 4.103   42.638  17.422  1.00   17.17 ? 112  GLU A CB  1 
ATOM   34    C  CG  . GLU A  1 5   ? 3.459   43.960  17.023  1.00   20.40 ? 112  GLU A CG  1 
ATOM   35    C  CD  . GLU A  1 5   ? 2.468   43.806  15.890  1.00   26.09 ? 112  GLU A CD  1 
ATOM   36    O  OE1 . GLU A  1 5   ? 2.047   44.839  15.323  1.00   27.83 ? 112  GLU A OE1 1 
ATOM   37    O  OE2 . GLU A  1 5   ? 2.106   42.651  15.574  1.00   25.73 ? 112  GLU A OE2 1 
ATOM   38    N  N   . PRO A  1 6   ? 7.025   43.673  17.441  1.00   21.90 ? 113  PRO A N   1 
ATOM   39    C  CA  . PRO A  1 6   ? 8.064   44.644  17.047  1.00   20.47 ? 113  PRO A CA  1 
ATOM   40    C  C   . PRO A  1 6   ? 7.560   46.009  16.600  1.00   22.32 ? 113  PRO A C   1 
ATOM   41    O  O   . PRO A  1 6   ? 6.533   46.109  15.932  1.00   25.67 ? 113  PRO A O   1 
ATOM   42    C  CB  . PRO A  1 6   ? 8.806   43.918  15.932  1.00   20.76 ? 113  PRO A CB  1 
ATOM   43    C  CG  . PRO A  1 6   ? 8.761   42.459  16.416  1.00   17.32 ? 113  PRO A CG  1 
ATOM   44    C  CD  . PRO A  1 6   ? 7.337   42.317  16.936  1.00   17.57 ? 113  PRO A CD  1 
ATOM   45    N  N   . THR A  1 7   ? 8.301   47.052  16.962  1.00   20.90 ? 114  THR A N   1 
ATOM   46    C  CA  . THR A  1 7   ? 7.949   48.423  16.611  1.00   21.18 ? 114  THR A CA  1 
ATOM   47    C  C   . THR A  1 7   ? 8.848   48.970  15.496  1.00   22.77 ? 114  THR A C   1 
ATOM   48    O  O   . THR A  1 7   ? 8.709   50.125  15.081  1.00   23.16 ? 114  THR A O   1 
ATOM   49    C  CB  . THR A  1 7   ? 8.064   49.320  17.839  1.00   20.35 ? 114  THR A CB  1 
ATOM   50    O  OG1 . THR A  1 7   ? 9.363   49.185  18.409  1.00   21.37 ? 114  THR A OG1 1 
ATOM   51    C  CG2 . THR A  1 7   ? 7.048   48.893  18.878  1.00   20.49 ? 114  THR A CG2 1 
ATOM   52    N  N   . ASP A  1 8   ? 9.764   48.129  15.014  1.00   21.96 ? 115  ASP A N   1 
ATOM   53    C  CA  . ASP A  1 8   ? 10.685  48.520  13.952  1.00   21.85 ? 115  ASP A CA  1 
ATOM   54    C  C   . ASP A  1 8   ? 9.923   49.120  12.773  1.00   20.32 ? 115  ASP A C   1 
ATOM   55    O  O   . ASP A  1 8   ? 8.886   48.613  12.361  1.00   18.57 ? 115  ASP A O   1 
ATOM   56    C  CB  . ASP A  1 8   ? 11.525  47.313  13.522  1.00   22.05 ? 115  ASP A CB  1 
ATOM   57    C  CG  . ASP A  1 8   ? 12.284  46.682  14.701  1.00   24.49 ? 115  ASP A CG  1 
ATOM   58    O  OD1 . ASP A  1 8   ? 11.668  45.964  15.515  1.00   20.29 ? 115  ASP A OD1 1 
ATOM   59    O  OD2 . ASP A  1 8   ? 13.499  46.916  14.825  1.00   24.47 ? 115  ASP A OD2 1 
ATOM   60    N  N   . PRO A  1 9   ? 10.452  50.209  12.207  1.00   20.79 ? 116  PRO A N   1 
ATOM   61    C  CA  . PRO A  1 9   ? 9.804   50.887  11.084  1.00   22.95 ? 116  PRO A CA  1 
ATOM   62    C  C   . PRO A  1 9   ? 9.385   50.017  9.901   1.00   21.89 ? 116  PRO A C   1 
ATOM   63    O  O   . PRO A  1 9   ? 8.343   50.265  9.306   1.00   19.96 ? 116  PRO A O   1 
ATOM   64    C  CB  . PRO A  1 9   ? 10.816  51.983  10.711  1.00   22.66 ? 116  PRO A CB  1 
ATOM   65    C  CG  . PRO A  1 9   ? 12.148  51.358  11.107  1.00   23.53 ? 116  PRO A CG  1 
ATOM   66    C  CD  . PRO A  1 9   ? 11.813  50.729  12.435  1.00   20.25 ? 116  PRO A CD  1 
ATOM   67    N  N   . LYS A  1 10  ? 10.162  48.988  9.584   1.00   21.64 ? 117  LYS A N   1 
ATOM   68    C  CA  . LYS A  1 10  ? 9.841   48.143  8.434   1.00   22.90 ? 117  LYS A CA  1 
ATOM   69    C  C   . LYS A  1 10  ? 9.103   46.849  8.774   1.00   22.67 ? 117  LYS A C   1 
ATOM   70    O  O   . LYS A  1 10  ? 8.742   46.083  7.880   1.00   21.45 ? 117  LYS A O   1 
ATOM   71    C  CB  . LYS A  1 10  ? 11.119  47.807  7.663   1.00   25.37 ? 117  LYS A CB  1 
ATOM   72    C  CG  . LYS A  1 10  ? 12.037  48.996  7.463   1.00   27.11 ? 117  LYS A CG  1 
ATOM   73    C  CD  . LYS A  1 10  ? 11.357  50.114  6.724   1.00   31.17 ? 117  LYS A CD  1 
ATOM   74    C  CE  . LYS A  1 10  ? 11.045  49.727  5.295   1.00   35.54 ? 117  LYS A CE  1 
ATOM   75    N  NZ  . LYS A  1 10  ? 10.754  50.940  4.488   1.00   40.41 ? 117  LYS A NZ  1 
ATOM   76    N  N   . PHE A  1 11  ? 8.866   46.599  10.054  1.00   21.60 ? 118  PHE A N   1 
ATOM   77    C  CA  . PHE A  1 11  ? 8.176   45.368  10.443  1.00   20.86 ? 118  PHE A CA  1 
ATOM   78    C  C   . PHE A  1 11  ? 6.843   45.204  9.712   1.00   21.61 ? 118  PHE A C   1 
ATOM   79    O  O   . PHE A  1 11  ? 6.488   44.105  9.300   1.00   19.98 ? 118  PHE A O   1 
ATOM   80    C  CB  . PHE A  1 11  ? 7.950   45.330  11.955  1.00   18.82 ? 118  PHE A CB  1 
ATOM   81    C  CG  . PHE A  1 11  ? 7.115   44.163  12.411  1.00   20.83 ? 118  PHE A CG  1 
ATOM   82    C  CD1 . PHE A  1 11  ? 7.537   42.855  12.181  1.00   14.91 ? 118  PHE A CD1 1 
ATOM   83    C  CD2 . PHE A  1 11  ? 5.872   44.369  13.004  1.00   18.16 ? 118  PHE A CD2 1 
ATOM   84    C  CE1 . PHE A  1 11  ? 6.734   41.764  12.521  1.00   17.00 ? 118  PHE A CE1 1 
ATOM   85    C  CE2 . PHE A  1 11  ? 5.056   43.282  13.354  1.00   20.42 ? 118  PHE A CE2 1 
ATOM   86    C  CZ  . PHE A  1 11  ? 5.492   41.973  13.107  1.00   18.89 ? 118  PHE A CZ  1 
ATOM   87    N  N   . PRO A  1 12  ? 6.082   46.296  9.554   1.00   23.27 ? 119  PRO A N   1 
ATOM   88    C  CA  . PRO A  1 12  ? 4.797   46.184  8.850   1.00   22.20 ? 119  PRO A CA  1 
ATOM   89    C  C   . PRO A  1 12  ? 4.948   45.689  7.410   1.00   23.71 ? 119  PRO A C   1 
ATOM   90    O  O   . PRO A  1 12  ? 4.009   45.133  6.849   1.00   23.48 ? 119  PRO A O   1 
ATOM   91    C  CB  . PRO A  1 12  ? 4.242   47.611  8.913   1.00   22.27 ? 119  PRO A CB  1 
ATOM   92    C  CG  . PRO A  1 12  ? 4.740   48.090  10.257  1.00   22.63 ? 119  PRO A CG  1 
ATOM   93    C  CD  . PRO A  1 12  ? 6.192   47.594  10.255  1.00   22.06 ? 119  PRO A CD  1 
ATOM   94    N  N   . GLN A  1 13  ? 6.118   45.906  6.811   1.00   21.78 ? 120  GLN A N   1 
ATOM   95    C  CA  . GLN A  1 13  ? 6.362   45.469  5.443   1.00   23.33 ? 120  GLN A CA  1 
ATOM   96    C  C   . GLN A  1 13  ? 6.836   44.013  5.401   1.00   25.15 ? 120  GLN A C   1 
ATOM   97    O  O   . GLN A  1 13  ? 6.969   43.420  4.328   1.00   25.35 ? 120  GLN A O   1 
ATOM   98    C  CB  . GLN A  1 13  ? 7.395   46.378  4.768   1.00   26.54 ? 120  GLN A CB  1 
ATOM   99    C  CG  . GLN A  1 13  ? 6.860   47.750  4.354   1.00   29.03 ? 120  GLN A CG  1 
ATOM   100   C  CD  . GLN A  1 13  ? 6.457   48.621  5.529   1.00   37.81 ? 120  GLN A CD  1 
ATOM   101   O  OE1 . GLN A  1 13  ? 7.281   48.964  6.380   1.00   44.12 ? 120  GLN A OE1 1 
ATOM   102   N  NE2 . GLN A  1 13  ? 5.182   48.993  5.581   1.00   42.50 ? 120  GLN A NE2 1 
ATOM   103   N  N   . GLN A  1 14  ? 7.090   43.428  6.566   1.00   21.13 ? 121  GLN A N   1 
ATOM   104   C  CA  . GLN A  1 14  ? 7.543   42.039  6.585   1.00   22.52 ? 121  GLN A CA  1 
ATOM   105   C  C   . GLN A  1 14  ? 6.313   41.134  6.620   1.00   21.08 ? 121  GLN A C   1 
ATOM   106   O  O   . GLN A  1 14  ? 6.025   40.447  7.607   1.00   20.06 ? 121  GLN A O   1 
ATOM   107   C  CB  . GLN A  1 14  ? 8.483   41.804  7.775   1.00   20.12 ? 121  GLN A CB  1 
ATOM   108   C  CG  . GLN A  1 14  ? 9.740   42.695  7.711   1.00   19.05 ? 121  GLN A CG  1 
ATOM   109   C  CD  . GLN A  1 14  ? 10.752  42.405  8.814   1.00   22.80 ? 121  GLN A CD  1 
ATOM   110   O  OE1 . GLN A  1 14  ? 10.525  42.702  9.988   1.00   22.04 ? 121  GLN A OE1 1 
ATOM   111   N  NE2 . GLN A  1 14  ? 11.877  41.820  8.435   1.00   22.24 ? 121  GLN A NE2 1 
ATOM   112   N  N   . TRP A  1 15  ? 5.594   41.166  5.501   1.00   20.30 ? 122  TRP A N   1 
ATOM   113   C  CA  . TRP A  1 15  ? 4.359   40.415  5.294   1.00   19.46 ? 122  TRP A CA  1 
ATOM   114   C  C   . TRP A  1 15  ? 4.455   38.915  5.556   1.00   22.72 ? 122  TRP A C   1 
ATOM   115   O  O   . TRP A  1 15  ? 3.476   38.298  5.967   1.00   22.91 ? 122  TRP A O   1 
ATOM   116   C  CB  . TRP A  1 15  ? 3.883   40.617  3.864   1.00   18.13 ? 122  TRP A CB  1 
ATOM   117   C  CG  . TRP A  1 15  ? 4.920   40.214  2.864   1.00   17.92 ? 122  TRP A CG  1 
ATOM   118   C  CD1 . TRP A  1 15  ? 5.963   40.970  2.411   1.00   17.00 ? 122  TRP A CD1 1 
ATOM   119   C  CD2 . TRP A  1 15  ? 5.008   38.957  2.192   1.00   18.31 ? 122  TRP A CD2 1 
ATOM   120   N  NE1 . TRP A  1 15  ? 6.695   40.262  1.485   1.00   22.10 ? 122  TRP A NE1 1 
ATOM   121   C  CE2 . TRP A  1 15  ? 6.130   39.021  1.331   1.00   21.45 ? 122  TRP A CE2 1 
ATOM   122   C  CE3 . TRP A  1 15  ? 4.247   37.778  2.230   1.00   14.52 ? 122  TRP A CE3 1 
ATOM   123   C  CZ2 . TRP A  1 15  ? 6.509   37.950  0.512   1.00   18.49 ? 122  TRP A CZ2 1 
ATOM   124   C  CZ3 . TRP A  1 15  ? 4.622   36.717  1.420   1.00   13.63 ? 122  TRP A CZ3 1 
ATOM   125   C  CH2 . TRP A  1 15  ? 5.746   36.811  0.569   1.00   16.96 ? 122  TRP A CH2 1 
ATOM   126   N  N   . TYR A  1 16  ? 5.624   38.335  5.296   1.00   21.01 ? 123  TYR A N   1 
ATOM   127   C  CA  . TYR A  1 16  ? 5.842   36.899  5.478   1.00   23.14 ? 123  TYR A CA  1 
ATOM   128   C  C   . TYR A  1 16  ? 5.994   36.479  6.939   1.00   22.91 ? 123  TYR A C   1 
ATOM   129   O  O   . TYR A  1 16  ? 5.895   35.297  7.261   1.00   21.33 ? 123  TYR A O   1 
ATOM   130   C  CB  . TYR A  1 16  ? 7.095   36.478  4.710   1.00   21.61 ? 123  TYR A CB  1 
ATOM   131   C  CG  . TYR A  1 16  ? 8.228   37.469  4.878   1.00   20.83 ? 123  TYR A CG  1 
ATOM   132   C  CD1 . TYR A  1 16  ? 8.290   38.634  4.091   1.00   19.05 ? 123  TYR A CD1 1 
ATOM   133   C  CD2 . TYR A  1 16  ? 9.219   37.273  5.849   1.00   14.89 ? 123  TYR A CD2 1 
ATOM   134   C  CE1 . TYR A  1 16  ? 9.315   39.575  4.266   1.00   13.69 ? 123  TYR A CE1 1 
ATOM   135   C  CE2 . TYR A  1 16  ? 10.244  38.208  6.039   1.00   15.45 ? 123  TYR A CE2 1 
ATOM   136   C  CZ  . TYR A  1 16  ? 10.294  39.359  5.243   1.00   16.92 ? 123  TYR A CZ  1 
ATOM   137   O  OH  . TYR A  1 16  ? 11.333  40.276  5.402   1.00   19.13 ? 123  TYR A OH  1 
ATOM   138   N  N   . LEU A  1 17  ? 6.265   37.436  7.820   1.00   24.47 ? 124  LEU A N   1 
ATOM   139   C  CA  . LEU A  1 17  ? 6.426   37.117  9.239   1.00   24.51 ? 124  LEU A CA  1 
ATOM   140   C  C   . LEU A  1 17  ? 5.075   37.105  9.926   1.00   28.34 ? 124  LEU A C   1 
ATOM   141   O  O   . LEU A  1 17  ? 4.723   36.162  10.638  1.00   27.11 ? 124  LEU A O   1 
ATOM   142   C  CB  . LEU A  1 17  ? 7.322   38.146  9.928   1.00   21.32 ? 124  LEU A CB  1 
ATOM   143   C  CG  . LEU A  1 17  ? 8.771   38.203  9.469   1.00   24.57 ? 124  LEU A CG  1 
ATOM   144   C  CD1 . LEU A  1 17  ? 9.513   39.272  10.275  1.00   20.92 ? 124  LEU A CD1 1 
ATOM   145   C  CD2 . LEU A  1 17  ? 9.418   36.810  9.643   1.00   21.71 ? 124  LEU A CD2 1 
ATOM   146   N  N   . SER A  1 18  ? 4.320   38.172  9.697   1.00   32.90 ? 125  SER A N   1 
ATOM   147   C  CA  . SER A  1 18  ? 3.009   38.331  10.296  1.00   37.60 ? 125  SER A CA  1 
ATOM   148   C  C   . SER A  1 18  ? 2.127   39.144  9.356   1.00   41.46 ? 125  SER A C   1 
ATOM   149   O  O   . SER A  1 18  ? 2.558   40.162  8.805   1.00   41.17 ? 125  SER A O   1 
ATOM   150   C  CB  . SER A  1 18  ? 3.159   39.057  11.636  1.00   36.00 ? 125  SER A CB  1 
ATOM   151   O  OG  . SER A  1 18  ? 1.982   38.999  12.411  1.00   39.48 ? 125  SER A OG  1 
ATOM   152   N  N   . GLY A  1 19  ? 0.894   38.691  9.177   1.00   44.86 ? 126  GLY A N   1 
ATOM   153   C  CA  . GLY A  1 19  ? -0.029  39.387  8.303   1.00   51.81 ? 126  GLY A CA  1 
ATOM   154   C  C   . GLY A  1 19  ? -1.465  39.027  8.623   1.00   56.14 ? 126  GLY A C   1 
ATOM   155   O  O   . GLY A  1 19  ? -1.745  37.953  9.166   1.00   57.79 ? 126  GLY A O   1 
ATOM   156   N  N   . VAL A  1 20  ? -2.382  39.933  8.304   1.00   59.31 ? 127  VAL A N   1 
ATOM   157   C  CA  . VAL A  1 20  ? -3.793  39.686  8.550   1.00   61.05 ? 127  VAL A CA  1 
ATOM   158   C  C   . VAL A  1 20  ? -4.281  38.666  7.519   1.00   62.68 ? 127  VAL A C   1 
ATOM   159   O  O   . VAL A  1 20  ? -5.112  37.808  7.826   1.00   63.45 ? 127  VAL A O   1 
ATOM   160   C  CB  . VAL A  1 20  ? -4.620  40.989  8.415   1.00   60.22 ? 127  VAL A CB  1 
ATOM   161   C  CG1 . VAL A  1 20  ? -4.050  42.064  9.325   0.0000 60.57 ? 127  VAL A CG1 1 
ATOM   162   C  CG2 . VAL A  1 20  ? -4.623  41.464  6.968   0.0000 60.57 ? 127  VAL A CG2 1 
ATOM   163   N  N   . THR A  1 21  ? -3.727  38.755  6.307   1.00   63.03 ? 128  THR A N   1 
ATOM   164   C  CA  . THR A  1 21  ? -4.098  37.880  5.196   1.00   60.86 ? 128  THR A CA  1 
ATOM   165   C  C   . THR A  1 21  ? -3.909  36.382  5.458   1.00   60.81 ? 128  THR A C   1 
ATOM   166   O  O   . THR A  1 21  ? -4.153  35.563  4.566   1.00   61.48 ? 128  THR A O   1 
ATOM   167   C  CB  . THR A  1 21  ? -3.322  38.273  3.914   1.00   59.70 ? 128  THR A CB  1 
ATOM   168   O  OG1 . THR A  1 21  ? -4.155  38.057  2.769   0.0000 60.18 ? 128  THR A OG1 1 
ATOM   169   C  CG2 . THR A  1 21  ? -2.055  37.451  3.777   0.0000 60.18 ? 128  THR A CG2 1 
ATOM   170   N  N   . GLN A  1 22  ? -3.474  36.024  6.667   1.00   59.54 ? 129  GLN A N   1 
ATOM   171   C  CA  . GLN A  1 22  ? -3.275  34.620  7.039   1.00   58.74 ? 129  GLN A CA  1 
ATOM   172   C  C   . GLN A  1 22  ? -2.344  33.848  6.084   1.00   57.80 ? 129  GLN A C   1 
ATOM   173   O  O   . GLN A  1 22  ? -2.279  32.609  6.122   1.00   59.34 ? 129  GLN A O   1 
ATOM   174   C  CB  . GLN A  1 22  ? -4.628  33.901  7.111   1.00   59.94 ? 129  GLN A CB  1 
ATOM   175   C  CG  . GLN A  1 22  ? -5.630  34.557  8.047   0.0000 59.39 ? 129  GLN A CG  1 
ATOM   176   C  CD  . GLN A  1 22  ? -6.989  33.883  8.023   0.0000 59.46 ? 129  GLN A CD  1 
ATOM   177   O  OE1 . GLN A  1 22  ? -7.908  34.295  8.729   0.0000 59.38 ? 129  GLN A OE1 1 
ATOM   178   N  NE2 . GLN A  1 22  ? -7.122  32.843  7.209   0.0000 59.38 ? 129  GLN A NE2 1 
ATOM   179   N  N   . ARG A  1 23  ? -1.632  34.576  5.228   1.00   52.15 ? 130  ARG A N   1 
ATOM   180   C  CA  . ARG A  1 23  ? -0.706  33.958  4.286   1.00   43.78 ? 130  ARG A CA  1 
ATOM   181   C  C   . ARG A  1 23  ? 0.717   34.361  4.687   1.00   39.08 ? 130  ARG A C   1 
ATOM   182   O  O   . ARG A  1 23  ? 1.351   35.202  4.047   1.00   36.26 ? 130  ARG A O   1 
ATOM   183   C  CB  . ARG A  1 23  ? -1.019  34.425  2.864   1.00   45.25 ? 130  ARG A CB  1 
ATOM   184   C  CG  . ARG A  1 23  ? -2.447  34.118  2.393   1.00   46.21 ? 130  ARG A CG  1 
ATOM   185   C  CD  . ARG A  1 23  ? -2.684  32.634  2.212   0.0000 45.80 ? 130  ARG A CD  1 
ATOM   186   N  NE  . ARG A  1 23  ? -4.005  32.360  1.653   0.0000 45.82 ? 130  ARG A NE  1 
ATOM   187   C  CZ  . ARG A  1 23  ? -5.152  32.691  2.238   0.0000 45.75 ? 130  ARG A CZ  1 
ATOM   188   N  NH1 . ARG A  1 23  ? -5.150  33.313  3.409   0.0000 45.73 ? 130  ARG A NH1 1 
ATOM   189   N  NH2 . ARG A  1 23  ? -6.305  32.401  1.649   0.0000 45.73 ? 130  ARG A NH2 1 
ATOM   190   N  N   . ASP A  1 24  ? 1.197   33.767  5.774   1.00   34.19 ? 131  ASP A N   1 
ATOM   191   C  CA  . ASP A  1 24  ? 2.529   34.055  6.288   1.00   30.75 ? 131  ASP A CA  1 
ATOM   192   C  C   . ASP A  1 24  ? 3.126   32.824  6.985   1.00   27.86 ? 131  ASP A C   1 
ATOM   193   O  O   . ASP A  1 24  ? 2.501   31.762  7.023   1.00   24.48 ? 131  ASP A O   1 
ATOM   194   C  CB  . ASP A  1 24  ? 2.464   35.238  7.254   1.00   29.00 ? 131  ASP A CB  1 
ATOM   195   C  CG  . ASP A  1 24  ? 1.494   35.004  8.382   1.00   30.81 ? 131  ASP A CG  1 
ATOM   196   O  OD1 . ASP A  1 24  ? 1.607   33.954  9.057   1.00   30.58 ? 131  ASP A OD1 1 
ATOM   197   O  OD2 . ASP A  1 24  ? 0.621   35.870  8.595   1.00   33.92 ? 131  ASP A OD2 1 
ATOM   198   N  N   . LEU A  1 25  ? 4.331   32.973  7.529   1.00   23.83 ? 132  LEU A N   1 
ATOM   199   C  CA  . LEU A  1 25  ? 5.016   31.867  8.191   1.00   21.17 ? 132  LEU A CA  1 
ATOM   200   C  C   . LEU A  1 25  ? 4.612   31.675  9.658   1.00   20.49 ? 132  LEU A C   1 
ATOM   201   O  O   . LEU A  1 25  ? 5.205   30.874  10.379  1.00   20.98 ? 132  LEU A O   1 
ATOM   202   C  CB  . LEU A  1 25  ? 6.530   32.062  8.056   1.00   21.10 ? 132  LEU A CB  1 
ATOM   203   C  CG  . LEU A  1 25  ? 6.972   32.148  6.584   1.00   18.84 ? 132  LEU A CG  1 
ATOM   204   C  CD1 . LEU A  1 25  ? 8.398   32.622  6.492   1.00   20.26 ? 132  LEU A CD1 1 
ATOM   205   C  CD2 . LEU A  1 25  ? 6.810   30.793  5.909   1.00   19.04 ? 132  LEU A CD2 1 
ATOM   206   N  N   . ASN A  1 26  ? 3.587   32.404  10.084  1.00   19.18 ? 133  ASN A N   1 
ATOM   207   C  CA  . ASN A  1 26  ? 3.065   32.294  11.440  1.00   18.18 ? 133  ASN A CA  1 
ATOM   208   C  C   . ASN A  1 26  ? 4.133   32.430  12.520  1.00   16.75 ? 133  ASN A C   1 
ATOM   209   O  O   . ASN A  1 26  ? 4.123   31.721  13.530  1.00   18.59 ? 133  ASN A O   1 
ATOM   210   C  CB  . ASN A  1 26  ? 2.323   30.962  11.588  1.00   17.08 ? 133  ASN A CB  1 
ATOM   211   C  CG  . ASN A  1 26  ? 1.419   30.933  12.810  1.00   20.32 ? 133  ASN A CG  1 
ATOM   212   O  OD1 . ASN A  1 26  ? 0.928   31.969  13.256  1.00   20.71 ? 133  ASN A OD1 1 
ATOM   213   N  ND2 . ASN A  1 26  ? 1.184   29.744  13.347  1.00   22.67 ? 133  ASN A ND2 1 
ATOM   214   N  N   . VAL A  1 27  ? 5.038   33.375  12.313  1.00   18.75 ? 134  VAL A N   1 
ATOM   215   C  CA  . VAL A  1 27  ? 6.140   33.619  13.242  1.00   19.59 ? 134  VAL A CA  1 
ATOM   216   C  C   . VAL A  1 27  ? 5.718   34.351  14.511  1.00   21.00 ? 134  VAL A C   1 
ATOM   217   O  O   . VAL A  1 27  ? 6.246   34.083  15.588  1.00   20.92 ? 134  VAL A O   1 
ATOM   218   C  CB  . VAL A  1 27  ? 7.255   34.428  12.549  1.00   21.91 ? 134  VAL A CB  1 
ATOM   219   C  CG1 . VAL A  1 27  ? 8.374   34.751  13.527  1.00   16.38 ? 134  VAL A CG1 1 
ATOM   220   C  CG2 . VAL A  1 27  ? 7.786   33.641  11.351  1.00   19.57 ? 134  VAL A CG2 1 
ATOM   221   N  N   . LYS A  1 28  ? 4.780   35.285  14.387  1.00   19.56 ? 135  LYS A N   1 
ATOM   222   C  CA  . LYS A  1 28  ? 4.321   36.022  15.552  1.00   22.03 ? 135  LYS A CA  1 
ATOM   223   C  C   . LYS A  1 28  ? 3.751   35.048  16.585  1.00   21.26 ? 135  LYS A C   1 
ATOM   224   O  O   . LYS A  1 28  ? 3.955   35.231  17.790  1.00   22.59 ? 135  LYS A O   1 
ATOM   225   C  CB  . LYS A  1 28  ? 3.268   37.059  15.149  1.00   23.04 ? 135  LYS A CB  1 
ATOM   226   C  CG  . LYS A  1 28  ? 2.942   38.015  16.259  1.00   25.97 ? 135  LYS A CG  1 
ATOM   227   C  CD  . LYS A  1 28  ? 1.864   39.009  15.870  1.00   29.35 ? 135  LYS A CD  1 
ATOM   228   C  CE  . LYS A  1 28  ? 1.370   39.742  17.111  1.00   30.97 ? 135  LYS A CE  1 
ATOM   229   N  NZ  . LYS A  1 28  ? 0.265   40.693  16.822  1.00   34.59 ? 135  LYS A NZ  1 
ATOM   230   N  N   . ALA A  1 29  ? 3.062   34.008  16.114  1.00   20.76 ? 136  ALA A N   1 
ATOM   231   C  CA  . ALA A  1 29  ? 2.492   32.995  17.009  1.00   23.37 ? 136  ALA A CA  1 
ATOM   232   C  C   . ALA A  1 29  ? 3.601   32.322  17.840  1.00   23.27 ? 136  ALA A C   1 
ATOM   233   O  O   . ALA A  1 29  ? 3.397   31.935  18.996  1.00   22.42 ? 136  ALA A O   1 
ATOM   234   C  CB  . ALA A  1 29  ? 1.735   31.950  16.200  1.00   22.89 ? 136  ALA A CB  1 
ATOM   235   N  N   . ALA A  1 30  ? 4.778   32.180  17.249  1.00   21.04 ? 137  ALA A N   1 
ATOM   236   C  CA  . ALA A  1 30  ? 5.890   31.569  17.971  1.00   20.62 ? 137  ALA A CA  1 
ATOM   237   C  C   . ALA A  1 30  ? 6.443   32.573  18.989  1.00   20.13 ? 137  ALA A C   1 
ATOM   238   O  O   . ALA A  1 30  ? 6.747   32.213  20.125  1.00   19.03 ? 137  ALA A O   1 
ATOM   239   C  CB  . ALA A  1 30  ? 6.982   31.140  17.002  1.00   18.87 ? 137  ALA A CB  1 
ATOM   240   N  N   . TRP A  1 31  ? 6.575   33.830  18.580  1.00   17.59 ? 138  TRP A N   1 
ATOM   241   C  CA  . TRP A  1 31  ? 7.073   34.855  19.495  1.00   20.26 ? 138  TRP A CA  1 
ATOM   242   C  C   . TRP A  1 31  ? 6.112   34.966  20.680  1.00   22.29 ? 138  TRP A C   1 
ATOM   243   O  O   . TRP A  1 31  ? 6.541   35.100  21.823  1.00   22.81 ? 138  TRP A O   1 
ATOM   244   C  CB  . TRP A  1 31  ? 7.138   36.240  18.836  1.00   17.84 ? 138  TRP A CB  1 
ATOM   245   C  CG  . TRP A  1 31  ? 8.059   36.402  17.678  1.00   15.14 ? 138  TRP A CG  1 
ATOM   246   C  CD1 . TRP A  1 31  ? 9.190   35.680  17.401  1.00   12.86 ? 138  TRP A CD1 1 
ATOM   247   C  CD2 . TRP A  1 31  ? 7.973   37.419  16.666  1.00   17.15 ? 138  TRP A CD2 1 
ATOM   248   N  NE1 . TRP A  1 31  ? 9.815   36.190  16.281  1.00   13.27 ? 138  TRP A NE1 1 
ATOM   249   C  CE2 . TRP A  1 31  ? 9.090   37.255  15.810  1.00   11.49 ? 138  TRP A CE2 1 
ATOM   250   C  CE3 . TRP A  1 31  ? 7.060   38.456  16.403  1.00   15.44 ? 138  TRP A CE3 1 
ATOM   251   C  CZ2 . TRP A  1 31  ? 9.318   38.088  14.708  1.00   13.96 ? 138  TRP A CZ2 1 
ATOM   252   C  CZ3 . TRP A  1 31  ? 7.288   39.285  15.306  1.00   16.37 ? 138  TRP A CZ3 1 
ATOM   253   C  CH2 . TRP A  1 31  ? 8.412   39.095  14.471  1.00   13.71 ? 138  TRP A CH2 1 
ATOM   254   N  N   . ALA A  1 32  ? 4.813   34.931  20.391  1.00   22.60 ? 139  ALA A N   1 
ATOM   255   C  CA  . ALA A  1 32  ? 3.797   35.042  21.431  1.00   23.27 ? 139  ALA A CA  1 
ATOM   256   C  C   . ALA A  1 32  ? 3.913   33.893  22.427  1.00   25.51 ? 139  ALA A C   1 
ATOM   257   O  O   . ALA A  1 32  ? 3.633   34.080  23.610  1.00   26.59 ? 139  ALA A O   1 
ATOM   258   C  CB  . ALA A  1 32  ? 2.407   35.067  20.813  1.00   22.42 ? 139  ALA A CB  1 
ATOM   259   N  N   . GLN A  1 33  ? 4.310   32.709  21.953  1.00   23.83 ? 140  GLN A N   1 
ATOM   260   C  CA  . GLN A  1 33  ? 4.488   31.556  22.841  1.00   24.17 ? 140  GLN A CA  1 
ATOM   261   C  C   . GLN A  1 33  ? 5.763   31.737  23.671  1.00   24.64 ? 140  GLN A C   1 
ATOM   262   O  O   . GLN A  1 33  ? 6.064   30.925  24.543  1.00   24.83 ? 140  GLN A O   1 
ATOM   263   C  CB  . GLN A  1 33  ? 4.580   30.253  22.041  1.00   21.96 ? 140  GLN A CB  1 
ATOM   264   C  CG  . GLN A  1 33  ? 3.256   29.808  21.404  1.00   23.45 ? 140  GLN A CG  1 
ATOM   265   C  CD  . GLN A  1 33  ? 3.383   28.526  20.568  1.00   26.92 ? 140  GLN A CD  1 
ATOM   266   O  OE1 . GLN A  1 33  ? 3.734   27.455  21.080  1.00   31.91 ? 140  GLN A OE1 1 
ATOM   267   N  NE2 . GLN A  1 33  ? 3.095   28.637  19.280  1.00   27.31 ? 140  GLN A NE2 1 
ATOM   268   N  N   . GLY A  1 34  ? 6.513   32.802  23.388  1.00   25.80 ? 141  GLY A N   1 
ATOM   269   C  CA  . GLY A  1 34  ? 7.727   33.077  24.140  1.00   25.36 ? 141  GLY A CA  1 
ATOM   270   C  C   . GLY A  1 34  ? 9.054   32.700  23.500  1.00   26.39 ? 141  GLY A C   1 
ATOM   271   O  O   . GLY A  1 34  ? 10.098  32.704  24.172  1.00   28.13 ? 141  GLY A O   1 
ATOM   272   N  N   . TYR A  1 35  ? 9.046   32.395  22.205  1.00   21.75 ? 142  TYR A N   1 
ATOM   273   C  CA  . TYR A  1 35  ? 10.290  32.013  21.539  1.00   22.46 ? 142  TYR A CA  1 
ATOM   274   C  C   . TYR A  1 35  ? 10.806  33.026  20.528  1.00   23.08 ? 142  TYR A C   1 
ATOM   275   O  O   . TYR A  1 35  ? 10.127  33.348  19.556  1.00   22.42 ? 142  TYR A O   1 
ATOM   276   C  CB  . TYR A  1 35  ? 10.110  30.652  20.882  1.00   20.96 ? 142  TYR A CB  1 
ATOM   277   C  CG  . TYR A  1 35  ? 9.657   29.626  21.873  1.00   20.98 ? 142  TYR A CG  1 
ATOM   278   C  CD1 . TYR A  1 35  ? 10.506  29.200  22.897  1.00   21.87 ? 142  TYR A CD1 1 
ATOM   279   C  CD2 . TYR A  1 35  ? 8.350   29.151  21.855  1.00   20.39 ? 142  TYR A CD2 1 
ATOM   280   C  CE1 . TYR A  1 35  ? 10.059  28.331  23.883  1.00   21.92 ? 142  TYR A CE1 1 
ATOM   281   C  CE2 . TYR A  1 35  ? 7.889   28.279  22.835  1.00   24.17 ? 142  TYR A CE2 1 
ATOM   282   C  CZ  . TYR A  1 35  ? 8.746   27.875  23.844  1.00   26.86 ? 142  TYR A CZ  1 
ATOM   283   O  OH  . TYR A  1 35  ? 8.286   27.012  24.810  1.00   29.76 ? 142  TYR A OH  1 
ATOM   284   N  N   . THR A  1 36  ? 12.019  33.521  20.770  1.00   21.87 ? 143  THR A N   1 
ATOM   285   C  CA  . THR A  1 36  ? 12.631  34.516  19.898  1.00   24.69 ? 143  THR A CA  1 
ATOM   286   C  C   . THR A  1 36  ? 14.058  34.127  19.479  1.00   25.18 ? 143  THR A C   1 
ATOM   287   O  O   . THR A  1 36  ? 14.777  34.897  18.830  1.00   20.94 ? 143  THR A O   1 
ATOM   288   C  CB  . THR A  1 36  ? 12.675  35.874  20.594  1.00   25.92 ? 143  THR A CB  1 
ATOM   289   O  OG1 . THR A  1 36  ? 13.392  35.738  21.821  1.00   28.55 ? 143  THR A OG1 1 
ATOM   290   C  CG2 . THR A  1 36  ? 11.271  36.369  20.884  1.00   27.87 ? 143  THR A CG2 1 
ATOM   291   N  N   . GLY A  1 37  ? 14.467  32.923  19.861  1.00   22.18 ? 144  GLY A N   1 
ATOM   292   C  CA  . GLY A  1 37  ? 15.791  32.461  19.501  1.00   21.68 ? 144  GLY A CA  1 
ATOM   293   C  C   . GLY A  1 37  ? 16.859  32.702  20.545  1.00   20.96 ? 144  GLY A C   1 
ATOM   294   O  O   . GLY A  1 37  ? 18.049  32.483  20.285  1.00   17.27 ? 144  GLY A O   1 
ATOM   295   N  N   . HIS A  1 38  ? 16.452  33.142  21.732  1.00   19.97 ? 145  HIS A N   1 
ATOM   296   C  CA  . HIS A  1 38  ? 17.425  33.394  22.776  1.00   18.15 ? 145  HIS A CA  1 
ATOM   297   C  C   . HIS A  1 38  ? 18.260  32.141  23.045  1.00   20.15 ? 145  HIS A C   1 
ATOM   298   O  O   . HIS A  1 38  ? 17.728  31.030  23.173  1.00   18.27 ? 145  HIS A O   1 
ATOM   299   C  CB  . HIS A  1 38  ? 16.729  33.828  24.064  1.00   23.05 ? 145  HIS A CB  1 
ATOM   300   C  CG  . HIS A  1 38  ? 17.544  33.561  25.288  1.00   26.87 ? 145  HIS A CG  1 
ATOM   301   N  ND1 . HIS A  1 38  ? 18.606  34.359  25.658  1.00   30.18 ? 145  HIS A ND1 1 
ATOM   302   C  CD2 . HIS A  1 38  ? 17.539  32.514  26.149  1.00   29.12 ? 145  HIS A CD2 1 
ATOM   303   C  CE1 . HIS A  1 38  ? 19.225  33.810  26.691  1.00   32.90 ? 145  HIS A CE1 1 
ATOM   304   N  NE2 . HIS A  1 38  ? 18.599  32.688  27.006  1.00   31.25 ? 145  HIS A NE2 1 
ATOM   305   N  N   . GLY A  1 39  ? 19.572  32.311  23.121  1.00   18.85 ? 146  GLY A N   1 
ATOM   306   C  CA  . GLY A  1 39  ? 20.437  31.180  23.405  1.00   19.32 ? 146  GLY A CA  1 
ATOM   307   C  C   . GLY A  1 39  ? 20.882  30.333  22.220  1.00   19.18 ? 146  GLY A C   1 
ATOM   308   O  O   . GLY A  1 39  ? 21.730  29.454  22.363  1.00   19.89 ? 146  GLY A O   1 
ATOM   309   N  N   . ILE A  1 40  ? 20.321  30.588  21.047  1.00   19.48 ? 147  ILE A N   1 
ATOM   310   C  CA  . ILE A  1 40  ? 20.667  29.813  19.859  1.00   17.15 ? 147  ILE A CA  1 
ATOM   311   C  C   . ILE A  1 40  ? 21.676  30.567  19.004  1.00   17.13 ? 147  ILE A C   1 
ATOM   312   O  O   . ILE A  1 40  ? 21.617  31.784  18.897  1.00   18.24 ? 147  ILE A O   1 
ATOM   313   C  CB  . ILE A  1 40  ? 19.410  29.506  18.989  1.00   18.62 ? 147  ILE A CB  1 
ATOM   314   C  CG1 . ILE A  1 40  ? 18.327  28.829  19.838  1.00   16.65 ? 147  ILE A CG1 1 
ATOM   315   C  CG2 . ILE A  1 40  ? 19.814  28.618  17.793  1.00   12.08 ? 147  ILE A CG2 1 
ATOM   316   C  CD1 . ILE A  1 40  ? 18.751  27.517  20.459  1.00   17.97 ? 147  ILE A CD1 1 
ATOM   317   N  N   . VAL A  1 41  ? 22.593  29.830  18.383  1.00   15.57 ? 148  VAL A N   1 
ATOM   318   C  CA  . VAL A  1 41  ? 23.633  30.439  17.562  1.00   15.80 ? 148  VAL A CA  1 
ATOM   319   C  C   . VAL A  1 41  ? 23.492  29.984  16.117  1.00   15.09 ? 148  VAL A C   1 
ATOM   320   O  O   . VAL A  1 41  ? 23.492  28.787  15.828  1.00   16.19 ? 148  VAL A O   1 
ATOM   321   C  CB  . VAL A  1 41  ? 25.053  30.046  18.080  1.00   15.77 ? 148  VAL A CB  1 
ATOM   322   C  CG1 . VAL A  1 41  ? 26.138  30.748  17.257  1.00   10.10 ? 148  VAL A CG1 1 
ATOM   323   C  CG2 . VAL A  1 41  ? 25.190  30.396  19.562  1.00   14.13 ? 148  VAL A CG2 1 
ATOM   324   N  N   . VAL A  1 42  ? 23.368  30.948  15.214  1.00   17.70 ? 149  VAL A N   1 
ATOM   325   C  CA  . VAL A  1 42  ? 23.215  30.674  13.788  1.00   14.25 ? 149  VAL A CA  1 
ATOM   326   C  C   . VAL A  1 42  ? 24.353  31.318  13.028  1.00   18.23 ? 149  VAL A C   1 
ATOM   327   O  O   . VAL A  1 42  ? 24.746  32.455  13.320  1.00   20.25 ? 149  VAL A O   1 
ATOM   328   C  CB  . VAL A  1 42  ? 21.893  31.251  13.256  1.00   16.27 ? 149  VAL A CB  1 
ATOM   329   C  CG1 . VAL A  1 42  ? 21.805  31.074  11.754  1.00   15.24 ? 149  VAL A CG1 1 
ATOM   330   C  CG2 . VAL A  1 42  ? 20.724  30.561  13.943  1.00   14.12 ? 149  VAL A CG2 1 
ATOM   331   N  N   . SER A  1 43  ? 24.887  30.599  12.047  1.00   16.57 ? 150  SER A N   1 
ATOM   332   C  CA  . SER A  1 43  ? 25.978  31.136  11.246  1.00   16.73 ? 150  SER A CA  1 
ATOM   333   C  C   . SER A  1 43  ? 25.622  31.128  9.763   1.00   17.08 ? 150  SER A C   1 
ATOM   334   O  O   . SER A  1 43  ? 25.127  30.125  9.236   1.00   18.06 ? 150  SER A O   1 
ATOM   335   C  CB  . SER A  1 43  ? 27.250  30.324  11.468  1.00   17.30 ? 150  SER A CB  1 
ATOM   336   O  OG  . SER A  1 43  ? 28.313  30.860  10.690  1.00   20.90 ? 150  SER A OG  1 
ATOM   337   N  N   . ILE A  1 44  ? 25.879  32.250  9.101   1.00   14.69 ? 151  ILE A N   1 
ATOM   338   C  CA  . ILE A  1 44  ? 25.591  32.412  7.679   1.00   15.71 ? 151  ILE A CA  1 
ATOM   339   C  C   . ILE A  1 44  ? 26.866  32.132  6.868   1.00   17.19 ? 151  ILE A C   1 
ATOM   340   O  O   . ILE A  1 44  ? 27.808  32.923  6.904   1.00   17.13 ? 151  ILE A O   1 
ATOM   341   C  CB  . ILE A  1 44  ? 25.138  33.872  7.375   1.00   17.07 ? 151  ILE A CB  1 
ATOM   342   C  CG1 . ILE A  1 44  ? 23.985  34.275  8.305   1.00   18.28 ? 151  ILE A CG1 1 
ATOM   343   C  CG2 . ILE A  1 44  ? 24.778  34.027  5.880   1.00   11.53 ? 151  ILE A CG2 1 
ATOM   344   C  CD1 . ILE A  1 44  ? 22.729  33.407  8.190   1.00   18.98 ? 151  ILE A CD1 1 
ATOM   345   N  N   . LEU A  1 45  ? 26.915  31.015  6.147   1.00   15.30 ? 152  LEU A N   1 
ATOM   346   C  CA  . LEU A  1 45  ? 28.101  30.710  5.341   1.00   15.54 ? 152  LEU A CA  1 
ATOM   347   C  C   . LEU A  1 45  ? 27.847  31.408  4.008   1.00   18.10 ? 152  LEU A C   1 
ATOM   348   O  O   . LEU A  1 45  ? 27.036  30.949  3.202   1.00   18.13 ? 152  LEU A O   1 
ATOM   349   C  CB  . LEU A  1 45  ? 28.245  29.198  5.140   1.00   14.85 ? 152  LEU A CB  1 
ATOM   350   C  CG  . LEU A  1 45  ? 28.073  28.336  6.393   1.00   16.45 ? 152  LEU A CG  1 
ATOM   351   C  CD1 . LEU A  1 45  ? 28.504  26.909  6.078   1.00   17.60 ? 152  LEU A CD1 1 
ATOM   352   C  CD2 . LEU A  1 45  ? 28.896  28.885  7.539   1.00   15.34 ? 152  LEU A CD2 1 
ATOM   353   N  N   . ASP A  1 46  ? 28.544  32.518  3.775   1.00   17.24 ? 153  ASP A N   1 
ATOM   354   C  CA  . ASP A  1 46  ? 28.302  33.290  2.570   1.00   15.14 ? 153  ASP A CA  1 
ATOM   355   C  C   . ASP A  1 46  ? 29.487  34.170  2.164   1.00   15.64 ? 153  ASP A C   1 
ATOM   356   O  O   . ASP A  1 46  ? 30.643  33.740  2.262   1.00   18.07 ? 153  ASP A O   1 
ATOM   357   C  CB  . ASP A  1 46  ? 27.048  34.144  2.806   1.00   15.89 ? 153  ASP A CB  1 
ATOM   358   C  CG  . ASP A  1 46  ? 26.249  34.375  1.544   1.00   14.97 ? 153  ASP A CG  1 
ATOM   359   O  OD1 . ASP A  1 46  ? 26.546  35.330  0.795   1.00   17.54 ? 153  ASP A OD1 1 
ATOM   360   O  OD2 . ASP A  1 46  ? 25.322  33.584  1.297   1.00   17.46 ? 153  ASP A OD2 1 
ATOM   361   N  N   . ASP A  1 47  ? 29.204  35.398  1.722   1.00   14.55 ? 154  ASP A N   1 
ATOM   362   C  CA  . ASP A  1 47  ? 30.259  36.309  1.277   1.00   16.62 ? 154  ASP A CA  1 
ATOM   363   C  C   . ASP A  1 47  ? 30.689  37.314  2.334   1.00   15.57 ? 154  ASP A C   1 
ATOM   364   O  O   . ASP A  1 47  ? 31.342  38.305  2.033   1.00   14.67 ? 154  ASP A O   1 
ATOM   365   C  CB  . ASP A  1 47  ? 29.849  37.060  -0.012  1.00   16.49 ? 154  ASP A CB  1 
ATOM   366   C  CG  . ASP A  1 47  ? 28.592  37.917  0.163   1.00   19.29 ? 154  ASP A CG  1 
ATOM   367   O  OD1 . ASP A  1 47  ? 28.199  38.186  1.318   1.00   16.76 ? 154  ASP A OD1 1 
ATOM   368   O  OD2 . ASP A  1 47  ? 28.001  38.333  -0.866  1.00   19.00 ? 154  ASP A OD2 1 
ATOM   369   N  N   . GLY A  1 48  ? 30.324  37.046  3.578   1.00   15.74 ? 155  GLY A N   1 
ATOM   370   C  CA  . GLY A  1 48  ? 30.687  37.941  4.656   1.00   15.49 ? 155  GLY A CA  1 
ATOM   371   C  C   . GLY A  1 48  ? 29.463  38.488  5.369   1.00   20.34 ? 155  GLY A C   1 
ATOM   372   O  O   . GLY A  1 48  ? 28.326  38.323  4.904   1.00   19.53 ? 155  GLY A O   1 
ATOM   373   N  N   . ILE A  1 49  ? 29.692  39.137  6.505   1.00   18.14 ? 156  ILE A N   1 
ATOM   374   C  CA  . ILE A  1 49  ? 28.615  39.731  7.269   1.00   20.53 ? 156  ILE A CA  1 
ATOM   375   C  C   . ILE A  1 49  ? 29.066  41.084  7.812   1.00   22.36 ? 156  ILE A C   1 
ATOM   376   O  O   . ILE A  1 49  ? 30.131  41.190  8.419   1.00   26.52 ? 156  ILE A O   1 
ATOM   377   C  CB  . ILE A  1 49  ? 28.185  38.806  8.439   1.00   22.25 ? 156  ILE A CB  1 
ATOM   378   C  CG1 . ILE A  1 49  ? 27.046  39.451  9.228   1.00   22.81 ? 156  ILE A CG1 1 
ATOM   379   C  CG2 . ILE A  1 49  ? 29.381  38.521  9.369   1.00   23.29 ? 156  ILE A CG2 1 
ATOM   380   C  CD1 . ILE A  1 49  ? 26.446  38.551  10.319  1.00   20.41 ? 156  ILE A CD1 1 
ATOM   381   N  N   . GLU A  1 50  ? 28.271  42.124  7.572   1.00   20.32 ? 157  GLU A N   1 
ATOM   382   C  CA  . GLU A  1 50  ? 28.609  43.451  8.070   1.00   20.13 ? 157  GLU A CA  1 
ATOM   383   C  C   . GLU A  1 50  ? 28.290  43.451  9.566   1.00   18.35 ? 157  GLU A C   1 
ATOM   384   O  O   . GLU A  1 50  ? 27.205  43.847  9.972   1.00   19.95 ? 157  GLU A O   1 
ATOM   385   C  CB  . GLU A  1 50  ? 27.780  44.507  7.342   1.00   18.47 ? 157  GLU A CB  1 
ATOM   386   C  CG  . GLU A  1 50  ? 28.230  45.945  7.598   1.00   22.35 ? 157  GLU A CG  1 
ATOM   387   C  CD  . GLU A  1 50  ? 27.586  46.945  6.631   1.00   21.60 ? 157  GLU A CD  1 
ATOM   388   O  OE1 . GLU A  1 50  ? 26.362  47.167  6.715   1.00   24.25 ? 157  GLU A OE1 1 
ATOM   389   O  OE2 . GLU A  1 50  ? 28.304  47.500  5.778   1.00   19.54 ? 157  GLU A OE2 1 
ATOM   390   N  N   . LYS A  1 51  ? 29.243  42.999  10.377  1.00   17.80 ? 158  LYS A N   1 
ATOM   391   C  CA  . LYS A  1 51  ? 29.043  42.895  11.824  1.00   19.94 ? 158  LYS A CA  1 
ATOM   392   C  C   . LYS A  1 51  ? 28.706  44.193  12.541  1.00   22.01 ? 158  LYS A C   1 
ATOM   393   O  O   . LYS A  1 51  ? 28.135  44.174  13.634  1.00   23.94 ? 158  LYS A O   1 
ATOM   394   C  CB  . LYS A  1 51  ? 30.266  42.252  12.484  1.00   21.36 ? 158  LYS A CB  1 
ATOM   395   C  CG  . LYS A  1 51  ? 31.568  43.041  12.381  1.00   23.10 ? 158  LYS A CG  1 
ATOM   396   C  CD  . LYS A  1 51  ? 32.704  42.277  13.076  1.00   25.86 ? 158  LYS A CD  1 
ATOM   397   C  CE  . LYS A  1 51  ? 33.991  43.071  13.092  1.00   27.52 ? 158  LYS A CE  1 
ATOM   398   N  NZ  . LYS A  1 51  ? 34.436  43.464  11.722  1.00   30.36 ? 158  LYS A NZ  1 
ATOM   399   N  N   . ASN A  1 52  ? 29.050  45.318  11.928  1.00   20.47 ? 159  ASN A N   1 
ATOM   400   C  CA  . ASN A  1 52  ? 28.779  46.612  12.530  1.00   23.61 ? 159  ASN A CA  1 
ATOM   401   C  C   . ASN A  1 52  ? 27.475  47.223  12.008  1.00   22.17 ? 159  ASN A C   1 
ATOM   402   O  O   . ASN A  1 52  ? 27.181  48.382  12.271  1.00   26.28 ? 159  ASN A O   1 
ATOM   403   C  CB  . ASN A  1 52  ? 29.959  47.561  12.270  1.00   23.58 ? 159  ASN A CB  1 
ATOM   404   C  CG  . ASN A  1 52  ? 30.224  47.772  10.794  1.00   27.54 ? 159  ASN A CG  1 
ATOM   405   O  OD1 . ASN A  1 52  ? 30.134  46.840  9.992   1.00   29.20 ? 159  ASN A OD1 1 
ATOM   406   N  ND2 . ASN A  1 52  ? 30.569  48.998  10.427  1.00   27.83 ? 159  ASN A ND2 1 
ATOM   407   N  N   . HIS A  1 53  ? 26.689  46.453  11.268  1.00   22.75 ? 160  HIS A N   1 
ATOM   408   C  CA  . HIS A  1 53  ? 25.424  46.979  10.763  1.00   21.11 ? 160  HIS A CA  1 
ATOM   409   C  C   . HIS A  1 53  ? 24.540  47.314  11.970  1.00   22.64 ? 160  HIS A C   1 
ATOM   410   O  O   . HIS A  1 53  ? 24.427  46.516  12.909  1.00   25.66 ? 160  HIS A O   1 
ATOM   411   C  CB  . HIS A  1 53  ? 24.714  45.955  9.880   1.00   17.00 ? 160  HIS A CB  1 
ATOM   412   C  CG  . HIS A  1 53  ? 23.521  46.517  9.173   1.00   19.49 ? 160  HIS A CG  1 
ATOM   413   N  ND1 . HIS A  1 53  ? 22.405  46.968  9.847   1.00   15.65 ? 160  HIS A ND1 1 
ATOM   414   C  CD2 . HIS A  1 53  ? 23.298  46.763  7.860   1.00   16.19 ? 160  HIS A CD2 1 
ATOM   415   C  CE1 . HIS A  1 53  ? 21.547  47.472  8.977   1.00   17.03 ? 160  HIS A CE1 1 
ATOM   416   N  NE2 . HIS A  1 53  ? 22.064  47.360  7.767   1.00   19.48 ? 160  HIS A NE2 1 
ATOM   417   N  N   . PRO A  1 54  ? 23.911  48.503  11.968  1.00   21.32 ? 161  PRO A N   1 
ATOM   418   C  CA  . PRO A  1 54  ? 23.060  48.872  13.104  1.00   20.55 ? 161  PRO A CA  1 
ATOM   419   C  C   . PRO A  1 54  ? 21.970  47.874  13.468  1.00   21.12 ? 161  PRO A C   1 
ATOM   420   O  O   . PRO A  1 54  ? 21.525  47.839  14.613  1.00   23.49 ? 161  PRO A O   1 
ATOM   421   C  CB  . PRO A  1 54  ? 22.514  50.259  12.719  1.00   19.03 ? 161  PRO A CB  1 
ATOM   422   C  CG  . PRO A  1 54  ? 22.878  50.440  11.271  1.00   22.39 ? 161  PRO A CG  1 
ATOM   423   C  CD  . PRO A  1 54  ? 24.133  49.650  11.072  1.00   19.34 ? 161  PRO A CD  1 
ATOM   424   N  N   . ASP A  1 55  ? 21.536  47.045  12.525  1.00   20.44 ? 162  ASP A N   1 
ATOM   425   C  CA  . ASP A  1 55  ? 20.508  46.071  12.879  1.00   21.60 ? 162  ASP A CA  1 
ATOM   426   C  C   . ASP A  1 55  ? 21.077  44.672  13.133  1.00   20.94 ? 162  ASP A C   1 
ATOM   427   O  O   . ASP A  1 55  ? 20.318  43.725  13.352  1.00   20.78 ? 162  ASP A O   1 
ATOM   428   C  CB  . ASP A  1 55  ? 19.408  46.021  11.809  1.00   21.10 ? 162  ASP A CB  1 
ATOM   429   C  CG  . ASP A  1 55  ? 18.005  45.982  12.418  1.00   18.88 ? 162  ASP A CG  1 
ATOM   430   O  OD1 . ASP A  1 55  ? 17.844  46.411  13.579  1.00   19.45 ? 162  ASP A OD1 1 
ATOM   431   O  OD2 . ASP A  1 55  ? 17.056  45.539  11.742  1.00   21.04 ? 162  ASP A OD2 1 
ATOM   432   N  N   . LEU A  1 56  ? 22.408  44.550  13.129  1.00   20.32 ? 163  LEU A N   1 
ATOM   433   C  CA  . LEU A  1 56  ? 23.062  43.260  13.368  1.00   19.47 ? 163  LEU A CA  1 
ATOM   434   C  C   . LEU A  1 56  ? 24.032  43.274  14.548  1.00   20.01 ? 163  LEU A C   1 
ATOM   435   O  O   . LEU A  1 56  ? 24.157  42.280  15.261  1.00   20.19 ? 163  LEU A O   1 
ATOM   436   C  CB  . LEU A  1 56  ? 23.828  42.793  12.119  1.00   17.48 ? 163  LEU A CB  1 
ATOM   437   C  CG  . LEU A  1 56  ? 23.057  42.553  10.814  1.00   20.56 ? 163  LEU A CG  1 
ATOM   438   C  CD1 . LEU A  1 56  ? 24.021  42.134  9.689   1.00   17.67 ? 163  LEU A CD1 1 
ATOM   439   C  CD2 . LEU A  1 56  ? 22.009  41.473  11.034  1.00   14.82 ? 163  LEU A CD2 1 
ATOM   440   N  N   . ALA A  1 57  ? 24.719  44.394  14.761  1.00   22.87 ? 164  ALA A N   1 
ATOM   441   C  CA  . ALA A  1 57  ? 25.708  44.484  15.846  1.00   21.36 ? 164  ALA A CA  1 
ATOM   442   C  C   . ALA A  1 57  ? 25.218  43.934  17.179  1.00   18.82 ? 164  ALA A C   1 
ATOM   443   O  O   . ALA A  1 57  ? 25.940  43.223  17.872  1.00   20.34 ? 164  ALA A O   1 
ATOM   444   C  CB  . ALA A  1 57  ? 26.173  45.924  16.026  1.00   15.68 ? 164  ALA A CB  1 
ATOM   445   N  N   . GLY A  1 58  ? 23.985  44.264  17.529  1.00   19.81 ? 165  GLY A N   1 
ATOM   446   C  CA  . GLY A  1 58  ? 23.429  43.809  18.784  1.00   18.59 ? 165  GLY A CA  1 
ATOM   447   C  C   . GLY A  1 58  ? 23.367  42.303  18.969  1.00   20.66 ? 165  GLY A C   1 
ATOM   448   O  O   . GLY A  1 58  ? 23.364  41.817  20.101  1.00   20.55 ? 165  GLY A O   1 
ATOM   449   N  N   . ASN A  1 59  ? 23.302  41.547  17.878  1.00   19.83 ? 166  ASN A N   1 
ATOM   450   C  CA  . ASN A  1 59  ? 23.255  40.084  17.998  1.00   18.53 ? 166  ASN A CA  1 
ATOM   451   C  C   . ASN A  1 59  ? 24.508  39.402  17.435  1.00   19.13 ? 166  ASN A C   1 
ATOM   452   O  O   . ASN A  1 59  ? 24.636  38.179  17.512  1.00   19.67 ? 166  ASN A O   1 
ATOM   453   C  CB  . ASN A  1 59  ? 22.026  39.508  17.282  1.00   12.90 ? 166  ASN A CB  1 
ATOM   454   C  CG  . ASN A  1 59  ? 20.734  39.820  17.993  1.00   16.68 ? 166  ASN A CG  1 
ATOM   455   O  OD1 . ASN A  1 59  ? 20.701  39.931  19.220  1.00   16.79 ? 166  ASN A OD1 1 
ATOM   456   N  ND2 . ASN A  1 59  ? 19.646  39.938  17.229  1.00   14.80 ? 166  ASN A ND2 1 
ATOM   457   N  N   . TYR A  1 60  ? 25.430  40.185  16.874  1.00   17.83 ? 167  TYR A N   1 
ATOM   458   C  CA  . TYR A  1 60  ? 26.631  39.622  16.281  1.00   16.15 ? 167  TYR A CA  1 
ATOM   459   C  C   . TYR A  1 60  ? 27.433  38.760  17.241  1.00   18.86 ? 167  TYR A C   1 
ATOM   460   O  O   . TYR A  1 60  ? 27.658  39.135  18.388  1.00   21.42 ? 167  TYR A O   1 
ATOM   461   C  CB  . TYR A  1 60  ? 27.533  40.722  15.734  1.00   17.09 ? 167  TYR A CB  1 
ATOM   462   C  CG  . TYR A  1 60  ? 28.782  40.165  15.091  1.00   21.18 ? 167  TYR A CG  1 
ATOM   463   C  CD1 . TYR A  1 60  ? 28.706  39.416  13.911  1.00   15.20 ? 167  TYR A CD1 1 
ATOM   464   C  CD2 . TYR A  1 60  ? 30.040  40.336  15.687  1.00   22.04 ? 167  TYR A CD2 1 
ATOM   465   C  CE1 . TYR A  1 60  ? 29.835  38.850  13.351  1.00   16.88 ? 167  TYR A CE1 1 
ATOM   466   C  CE2 . TYR A  1 60  ? 31.194  39.764  15.122  1.00   21.24 ? 167  TYR A CE2 1 
ATOM   467   C  CZ  . TYR A  1 60  ? 31.079  39.024  13.958  1.00   21.33 ? 167  TYR A CZ  1 
ATOM   468   O  OH  . TYR A  1 60  ? 32.199  38.459  13.392  1.00   22.59 ? 167  TYR A OH  1 
ATOM   469   N  N   . ASP A  1 61  ? 27.871  37.604  16.759  1.00   19.44 ? 168  ASP A N   1 
ATOM   470   C  CA  . ASP A  1 61  ? 28.652  36.681  17.567  1.00   20.64 ? 168  ASP A CA  1 
ATOM   471   C  C   . ASP A  1 61  ? 29.951  36.279  16.873  1.00   20.99 ? 168  ASP A C   1 
ATOM   472   O  O   . ASP A  1 61  ? 29.951  35.506  15.912  1.00   21.95 ? 168  ASP A O   1 
ATOM   473   C  CB  . ASP A  1 61  ? 27.822  35.437  17.890  1.00   20.36 ? 168  ASP A CB  1 
ATOM   474   C  CG  . ASP A  1 61  ? 28.596  34.397  18.693  1.00   23.74 ? 168  ASP A CG  1 
ATOM   475   O  OD1 . ASP A  1 61  ? 29.741  34.660  19.118  1.00   25.45 ? 168  ASP A OD1 1 
ATOM   476   O  OD2 . ASP A  1 61  ? 28.048  33.302  18.910  1.00   23.99 ? 168  ASP A OD2 1 
ATOM   477   N  N   . PRO A  1 62  ? 31.085  36.801  17.363  1.00   21.00 ? 169  PRO A N   1 
ATOM   478   C  CA  . PRO A  1 62  ? 32.420  36.520  16.819  1.00   20.11 ? 169  PRO A CA  1 
ATOM   479   C  C   . PRO A  1 62  ? 32.717  35.024  16.839  1.00   20.98 ? 169  PRO A C   1 
ATOM   480   O  O   . PRO A  1 62  ? 33.406  34.502  15.962  1.00   20.16 ? 169  PRO A O   1 
ATOM   481   C  CB  . PRO A  1 62  ? 33.355  37.275  17.764  1.00   20.63 ? 169  PRO A CB  1 
ATOM   482   C  CG  . PRO A  1 62  ? 32.474  38.344  18.381  1.00   23.71 ? 169  PRO A CG  1 
ATOM   483   C  CD  . PRO A  1 62  ? 31.170  37.633  18.577  1.00   23.09 ? 169  PRO A CD  1 
ATOM   484   N  N   . GLY A  1 63  ? 32.183  34.345  17.852  1.00   20.46 ? 170  GLY A N   1 
ATOM   485   C  CA  . GLY A  1 63  ? 32.393  32.917  17.993  1.00   21.43 ? 170  GLY A CA  1 
ATOM   486   C  C   . GLY A  1 63  ? 31.723  32.086  16.915  1.00   23.97 ? 170  GLY A C   1 
ATOM   487   O  O   . GLY A  1 63  ? 32.051  30.911  16.748  1.00   21.18 ? 170  GLY A O   1 
ATOM   488   N  N   . ALA A  1 64  ? 30.783  32.688  16.187  1.00   22.73 ? 171  ALA A N   1 
ATOM   489   C  CA  . ALA A  1 64  ? 30.079  31.989  15.115  1.00   19.46 ? 171  ALA A CA  1 
ATOM   490   C  C   . ALA A  1 64  ? 30.567  32.527  13.771  1.00   22.21 ? 171  ALA A C   1 
ATOM   491   O  O   . ALA A  1 64  ? 29.936  32.303  12.733  1.00   21.93 ? 171  ALA A O   1 
ATOM   492   C  CB  . ALA A  1 64  ? 28.587  32.223  15.243  1.00   19.41 ? 171  ALA A CB  1 
ATOM   493   N  N   . SER A  1 65  ? 31.701  33.226  13.791  1.00   19.86 ? 172  SER A N   1 
ATOM   494   C  CA  . SER A  1 65  ? 32.223  33.834  12.579  1.00   20.73 ? 172  SER A CA  1 
ATOM   495   C  C   . SER A  1 65  ? 33.683  33.544  12.271  1.00   22.75 ? 172  SER A C   1 
ATOM   496   O  O   . SER A  1 65  ? 34.468  33.170  13.148  1.00   20.22 ? 172  SER A O   1 
ATOM   497   C  CB  . SER A  1 65  ? 32.060  35.355  12.655  1.00   19.29 ? 172  SER A CB  1 
ATOM   498   O  OG  . SER A  1 65  ? 30.744  35.732  13.011  1.00   18.50 ? 172  SER A OG  1 
ATOM   499   N  N   . PHE A  1 66  ? 34.038  33.747  11.006  1.00   20.11 ? 173  PHE A N   1 
ATOM   500   C  CA  . PHE A  1 66  ? 35.409  33.568  10.558  1.00   21.91 ? 173  PHE A CA  1 
ATOM   501   C  C   . PHE A  1 66  ? 35.521  33.968  9.096   1.00   20.28 ? 173  PHE A C   1 
ATOM   502   O  O   . PHE A  1 66  ? 34.521  34.001  8.374   1.00   19.79 ? 173  PHE A O   1 
ATOM   503   C  CB  . PHE A  1 66  ? 35.861  32.120  10.709  1.00   20.63 ? 173  PHE A CB  1 
ATOM   504   C  CG  . PHE A  1 66  ? 37.359  31.968  10.752  1.00   25.06 ? 173  PHE A CG  1 
ATOM   505   C  CD1 . PHE A  1 66  ? 38.062  32.227  11.931  1.00   22.97 ? 173  PHE A CD1 1 
ATOM   506   C  CD2 . PHE A  1 66  ? 38.069  31.606  9.611   1.00   21.87 ? 173  PHE A CD2 1 
ATOM   507   C  CE1 . PHE A  1 66  ? 39.453  32.129  11.980  1.00   24.03 ? 173  PHE A CE1 1 
ATOM   508   C  CE2 . PHE A  1 66  ? 39.462  31.506  9.642   1.00   28.53 ? 173  PHE A CE2 1 
ATOM   509   C  CZ  . PHE A  1 66  ? 40.158  31.768  10.833  1.00   26.45 ? 173  PHE A CZ  1 
ATOM   510   N  N   . ASP A  1 67  ? 36.731  34.305  8.671   1.00   19.27 ? 174  ASP A N   1 
ATOM   511   C  CA  . ASP A  1 67  ? 36.965  34.670  7.280   1.00   20.39 ? 174  ASP A CA  1 
ATOM   512   C  C   . ASP A  1 67  ? 37.869  33.594  6.696   1.00   21.51 ? 174  ASP A C   1 
ATOM   513   O  O   . ASP A  1 67  ? 39.083  33.650  6.849   1.00   25.13 ? 174  ASP A O   1 
ATOM   514   C  CB  . ASP A  1 67  ? 37.645  36.041  7.163   1.00   18.09 ? 174  ASP A CB  1 
ATOM   515   C  CG  . ASP A  1 67  ? 37.952  36.422  5.698   1.00   20.84 ? 174  ASP A CG  1 
ATOM   516   O  OD1 . ASP A  1 67  ? 37.892  35.541  4.814   1.00   19.07 ? 174  ASP A OD1 1 
ATOM   517   O  OD2 . ASP A  1 67  ? 38.265  37.598  5.416   1.00   21.31 ? 174  ASP A OD2 1 
ATOM   518   N  N   . VAL A  1 68  ? 37.268  32.611  6.038   1.00   22.12 ? 175  VAL A N   1 
ATOM   519   C  CA  . VAL A  1 68  ? 38.019  31.516  5.444   1.00   25.11 ? 175  VAL A CA  1 
ATOM   520   C  C   . VAL A  1 68  ? 38.725  31.943  4.165   1.00   24.92 ? 175  VAL A C   1 
ATOM   521   O  O   . VAL A  1 68  ? 39.771  31.404  3.824   1.00   26.48 ? 175  VAL A O   1 
ATOM   522   C  CB  . VAL A  1 68  ? 37.093  30.307  5.139   1.00   24.54 ? 175  VAL A CB  1 
ATOM   523   C  CG1 . VAL A  1 68  ? 37.851  29.246  4.360   1.00   30.82 ? 175  VAL A CG1 1 
ATOM   524   C  CG2 . VAL A  1 68  ? 36.587  29.719  6.423   1.00   24.36 ? 175  VAL A CG2 1 
ATOM   525   N  N   . ASN A  1 69  ? 38.154  32.915  3.462   1.00   25.61 ? 176  ASN A N   1 
ATOM   526   C  CA  . ASN A  1 69  ? 38.753  33.410  2.224   1.00   26.33 ? 176  ASN A CA  1 
ATOM   527   C  C   . ASN A  1 69  ? 40.117  34.070  2.475   1.00   28.44 ? 176  ASN A C   1 
ATOM   528   O  O   . ASN A  1 69  ? 41.069  33.826  1.736   1.00   28.05 ? 176  ASN A O   1 
ATOM   529   C  CB  . ASN A  1 69  ? 37.822  34.420  1.542   1.00   24.19 ? 176  ASN A CB  1 
ATOM   530   C  CG  . ASN A  1 69  ? 36.611  33.766  0.869   1.00   24.00 ? 176  ASN A CG  1 
ATOM   531   O  OD1 . ASN A  1 69  ? 35.512  34.332  0.861   1.00   23.10 ? 176  ASN A OD1 1 
ATOM   532   N  ND2 . ASN A  1 69  ? 36.811  32.592  0.284   1.00   21.20 ? 176  ASN A ND2 1 
ATOM   533   N  N   . ASP A  1 70  ? 40.209  34.907  3.508   1.00   27.29 ? 177  ASP A N   1 
ATOM   534   C  CA  . ASP A  1 70  ? 41.466  35.576  3.822   1.00   29.21 ? 177  ASP A CA  1 
ATOM   535   C  C   . ASP A  1 70  ? 42.162  35.020  5.063   1.00   29.82 ? 177  ASP A C   1 
ATOM   536   O  O   . ASP A  1 70  ? 43.186  35.538  5.487   1.00   30.87 ? 177  ASP A O   1 
ATOM   537   C  CB  . ASP A  1 70  ? 41.257  37.082  3.986   1.00   29.22 ? 177  ASP A CB  1 
ATOM   538   C  CG  . ASP A  1 70  ? 40.997  37.788  2.656   1.00   34.75 ? 177  ASP A CG  1 
ATOM   539   O  OD1 . ASP A  1 70  ? 41.414  37.272  1.595   1.00   37.19 ? 177  ASP A OD1 1 
ATOM   540   O  OD2 . ASP A  1 70  ? 40.386  38.876  2.666   1.00   37.64 ? 177  ASP A OD2 1 
ATOM   541   N  N   . GLN A  1 71  ? 41.601  33.965  5.641   1.00   30.88 ? 178  GLN A N   1 
ATOM   542   C  CA  . GLN A  1 71  ? 42.192  33.335  6.817   1.00   29.07 ? 178  GLN A CA  1 
ATOM   543   C  C   . GLN A  1 71  ? 42.394  34.279  8.001   1.00   28.44 ? 178  GLN A C   1 
ATOM   544   O  O   . GLN A  1 71  ? 43.525  34.527  8.413   1.00   28.82 ? 178  GLN A O   1 
ATOM   545   C  CB  . GLN A  1 71  ? 43.547  32.703  6.471   1.00   28.95 ? 178  GLN A CB  1 
ATOM   546   C  CG  . GLN A  1 71  ? 43.567  31.747  5.267   1.00   33.03 ? 178  GLN A CG  1 
ATOM   547   C  CD  . GLN A  1 71  ? 42.604  30.578  5.404   1.00   31.29 ? 178  GLN A CD  1 
ATOM   548   O  OE1 . GLN A  1 71  ? 42.452  30.010  6.480   0.0000 31.96 ? 178  GLN A OE1 1 
ATOM   549   N  NE2 . GLN A  1 71  ? 41.965  30.206  4.301   0.0000 31.96 ? 178  GLN A NE2 1 
ATOM   550   N  N   . ASP A  1 72  ? 41.304  34.826  8.523   1.00   26.44 ? 179  ASP A N   1 
ATOM   551   C  CA  . ASP A  1 72  ? 41.360  35.672  9.703   1.00   25.95 ? 179  ASP A CA  1 
ATOM   552   C  C   . ASP A  1 72  ? 39.989  35.562  10.340  1.00   26.22 ? 179  ASP A C   1 
ATOM   553   O  O   . ASP A  1 72  ? 39.049  35.080  9.721   1.00   26.90 ? 179  ASP A O   1 
ATOM   554   C  CB  . ASP A  1 72  ? 41.748  37.126  9.380   1.00   25.22 ? 179  ASP A CB  1 
ATOM   555   C  CG  . ASP A  1 72  ? 40.685  37.876  8.631   1.00   26.12 ? 179  ASP A CG  1 
ATOM   556   O  OD1 . ASP A  1 72  ? 39.574  38.018  9.167   1.00   26.17 ? 179  ASP A OD1 1 
ATOM   557   O  OD2 . ASP A  1 72  ? 40.973  38.339  7.506   1.00   27.46 ? 179  ASP A OD2 1 
ATOM   558   N  N   . PRO A  1 73  ? 39.863  35.972  11.598  1.00   26.32 ? 180  PRO A N   1 
ATOM   559   C  CA  . PRO A  1 73  ? 38.561  35.872  12.259  1.00   28.12 ? 180  PRO A CA  1 
ATOM   560   C  C   . PRO A  1 73  ? 37.498  36.918  11.934  1.00   26.14 ? 180  PRO A C   1 
ATOM   561   O  O   . PRO A  1 73  ? 36.365  36.784  12.368  1.00   26.62 ? 180  PRO A O   1 
ATOM   562   C  CB  . PRO A  1 73  ? 38.938  35.873  13.735  1.00   28.93 ? 180  PRO A CB  1 
ATOM   563   C  CG  . PRO A  1 73  ? 40.146  36.752  13.762  1.00   30.00 ? 180  PRO A CG  1 
ATOM   564   C  CD  . PRO A  1 73  ? 40.931  36.328  12.548  1.00   25.37 ? 180  PRO A CD  1 
ATOM   565   N  N   . ASP A  1 74  ? 37.857  37.933  11.158  1.00   27.02 ? 181  ASP A N   1 
ATOM   566   C  CA  . ASP A  1 74  ? 36.945  39.021  10.818  1.00   27.26 ? 181  ASP A CA  1 
ATOM   567   C  C   . ASP A  1 74  ? 36.241  38.837  9.463   1.00   26.53 ? 181  ASP A C   1 
ATOM   568   O  O   . ASP A  1 74  ? 36.839  39.064  8.408   1.00   25.86 ? 181  ASP A O   1 
ATOM   569   C  CB  . ASP A  1 74  ? 37.744  40.319  10.832  1.00   27.53 ? 181  ASP A CB  1 
ATOM   570   C  CG  . ASP A  1 74  ? 36.889  41.527  10.618  1.00   31.68 ? 181  ASP A CG  1 
ATOM   571   O  OD1 . ASP A  1 74  ? 35.644  41.404  10.637  1.00   33.27 ? 181  ASP A OD1 1 
ATOM   572   O  OD2 . ASP A  1 74  ? 37.476  42.606  10.440  1.00   33.92 ? 181  ASP A OD2 1 
ATOM   573   N  N   . PRO A  1 75  ? 34.942  38.477  9.484   1.00   25.32 ? 182  PRO A N   1 
ATOM   574   C  CA  . PRO A  1 75  ? 34.108  38.241  8.297   1.00   24.11 ? 182  PRO A CA  1 
ATOM   575   C  C   . PRO A  1 75  ? 33.567  39.480  7.584   1.00   24.80 ? 182  PRO A C   1 
ATOM   576   O  O   . PRO A  1 75  ? 32.674  39.367  6.738   1.00   21.10 ? 182  PRO A O   1 
ATOM   577   C  CB  . PRO A  1 75  ? 32.980  37.405  8.857   1.00   23.47 ? 182  PRO A CB  1 
ATOM   578   C  CG  . PRO A  1 75  ? 32.707  38.138  10.133  1.00   23.76 ? 182  PRO A CG  1 
ATOM   579   C  CD  . PRO A  1 75  ? 34.116  38.390  10.703  1.00   24.60 ? 182  PRO A CD  1 
ATOM   580   N  N   . GLN A  1 76  ? 34.089  40.657  7.921   1.00   21.64 ? 183  GLN A N   1 
ATOM   581   C  CA  . GLN A  1 76  ? 33.608  41.883  7.289   1.00   22.03 ? 183  GLN A CA  1 
ATOM   582   C  C   . GLN A  1 76  ? 33.617  41.729  5.765   1.00   20.81 ? 183  GLN A C   1 
ATOM   583   O  O   . GLN A  1 76  ? 34.580  41.229  5.195   1.00   17.48 ? 183  GLN A O   1 
ATOM   584   C  CB  . GLN A  1 76  ? 34.494  43.067  7.683   1.00   18.34 ? 183  GLN A CB  1 
ATOM   585   C  CG  . GLN A  1 76  ? 33.876  44.432  7.385   1.00   19.55 ? 183  GLN A CG  1 
ATOM   586   C  CD  . GLN A  1 76  ? 32.780  44.813  8.373   1.00   22.50 ? 183  GLN A CD  1 
ATOM   587   O  OE1 . GLN A  1 76  ? 32.784  44.363  9.516   1.00   24.29 ? 183  GLN A OE1 1 
ATOM   588   N  NE2 . GLN A  1 76  ? 31.855  45.667  7.945   1.00   21.36 ? 183  GLN A NE2 1 
ATOM   589   N  N   . PRO A  1 77  ? 32.540  42.158  5.084   1.00   21.51 ? 184  PRO A N   1 
ATOM   590   C  CA  . PRO A  1 77  ? 32.501  42.032  3.619   1.00   22.28 ? 184  PRO A CA  1 
ATOM   591   C  C   . PRO A  1 77  ? 33.523  42.950  2.954   1.00   21.81 ? 184  PRO A C   1 
ATOM   592   O  O   . PRO A  1 77  ? 33.929  43.958  3.535   1.00   22.38 ? 184  PRO A O   1 
ATOM   593   C  CB  . PRO A  1 77  ? 31.071  42.455  3.269   1.00   21.60 ? 184  PRO A CB  1 
ATOM   594   C  CG  . PRO A  1 77  ? 30.301  42.143  4.506   1.00   24.08 ? 184  PRO A CG  1 
ATOM   595   C  CD  . PRO A  1 77  ? 31.242  42.625  5.595   1.00   22.49 ? 184  PRO A CD  1 
ATOM   596   N  N   . ARG A  1 78  ? 33.944  42.589  1.749   1.00   20.44 ? 185  ARG A N   1 
ATOM   597   C  CA  . ARG A  1 78  ? 34.879  43.397  0.984   1.00   21.17 ? 185  ARG A CA  1 
ATOM   598   C  C   . ARG A  1 78  ? 34.018  44.355  0.182   1.00   22.17 ? 185  ARG A C   1 
ATOM   599   O  O   . ARG A  1 78  ? 33.213  43.925  -0.650  1.00   22.34 ? 185  ARG A O   1 
ATOM   600   C  CB  . ARG A  1 78  ? 35.695  42.525  0.035   1.00   22.04 ? 185  ARG A CB  1 
ATOM   601   C  CG  . ARG A  1 78  ? 36.579  43.321  -0.931  1.00   27.06 ? 185  ARG A CG  1 
ATOM   602   C  CD  . ARG A  1 78  ? 37.475  42.375  -1.735  1.00   24.98 ? 185  ARG A CD  1 
ATOM   603   N  NE  . ARG A  1 78  ? 36.662  41.463  -2.531  1.00   25.14 ? 185  ARG A NE  1 
ATOM   604   C  CZ  . ARG A  1 78  ? 36.206  41.737  -3.747  1.00   23.92 ? 185  ARG A CZ  1 
ATOM   605   N  NH1 . ARG A  1 78  ? 35.452  40.853  -4.395  1.00   20.00 ? 185  ARG A NH1 1 
ATOM   606   N  NH2 . ARG A  1 78  ? 36.529  42.883  -4.325  1.00   23.40 ? 185  ARG A NH2 1 
ATOM   607   N  N   . TYR A  1 79  ? 34.184  45.651  0.422   1.00   23.69 ? 186  TYR A N   1 
ATOM   608   C  CA  . TYR A  1 79  ? 33.381  46.644  -0.276  1.00   26.60 ? 186  TYR A CA  1 
ATOM   609   C  C   . TYR A  1 79  ? 33.854  46.958  -1.688  1.00   27.28 ? 186  TYR A C   1 
ATOM   610   O  O   . TYR A  1 79  ? 35.044  47.118  -1.925  1.00   28.81 ? 186  TYR A O   1 
ATOM   611   C  CB  . TYR A  1 79  ? 33.318  47.945  0.538   1.00   24.80 ? 186  TYR A CB  1 
ATOM   612   C  CG  . TYR A  1 79  ? 32.680  47.774  1.894   1.00   24.82 ? 186  TYR A CG  1 
ATOM   613   C  CD1 . TYR A  1 79  ? 33.432  47.351  2.996   1.00   25.06 ? 186  TYR A CD1 1 
ATOM   614   C  CD2 . TYR A  1 79  ? 31.308  47.962  2.064   1.00   23.64 ? 186  TYR A CD2 1 
ATOM   615   C  CE1 . TYR A  1 79  ? 32.830  47.116  4.235   1.00   23.05 ? 186  TYR A CE1 1 
ATOM   616   C  CE2 . TYR A  1 79  ? 30.688  47.727  3.298   1.00   23.70 ? 186  TYR A CE2 1 
ATOM   617   C  CZ  . TYR A  1 79  ? 31.454  47.303  4.380   1.00   27.40 ? 186  TYR A CZ  1 
ATOM   618   O  OH  . TYR A  1 79  ? 30.843  47.063  5.599   1.00   25.64 ? 186  TYR A OH  1 
ATOM   619   N  N   . THR A  1 80  ? 32.905  47.040  -2.615  1.00   25.55 ? 187  THR A N   1 
ATOM   620   C  CA  . THR A  1 80  ? 33.188  47.368  -4.005  1.00   27.16 ? 187  THR A CA  1 
ATOM   621   C  C   . THR A  1 80  ? 32.043  48.253  -4.511  1.00   31.71 ? 187  THR A C   1 
ATOM   622   O  O   . THR A  1 80  ? 30.958  48.264  -3.929  1.00   30.49 ? 187  THR A O   1 
ATOM   623   C  CB  . THR A  1 80  ? 33.264  46.112  -4.892  1.00   25.47 ? 187  THR A CB  1 
ATOM   624   O  OG1 . THR A  1 80  ? 31.978  45.478  -4.953  1.00   27.05 ? 187  THR A OG1 1 
ATOM   625   C  CG2 . THR A  1 80  ? 34.272  45.134  -4.332  1.00   29.60 ? 187  THR A CG2 1 
ATOM   626   N  N   . GLN A  1 81  ? 32.288  48.990  -5.591  1.00   34.23 ? 188  GLN A N   1 
ATOM   627   C  CA  . GLN A  1 81  ? 31.280  49.875  -6.179  1.00   36.54 ? 188  GLN A CA  1 
ATOM   628   C  C   . GLN A  1 81  ? 29.995  49.131  -6.543  1.00   35.86 ? 188  GLN A C   1 
ATOM   629   O  O   . GLN A  1 81  ? 28.899  49.679  -6.453  1.00   33.93 ? 188  GLN A O   1 
ATOM   630   C  CB  . GLN A  1 81  ? 31.826  50.558  -7.446  1.00   38.33 ? 188  GLN A CB  1 
ATOM   631   C  CG  . GLN A  1 81  ? 32.190  52.041  -7.276  1.00   43.94 ? 188  GLN A CG  1 
ATOM   632   C  CD  . GLN A  1 81  ? 32.518  52.737  -8.599  1.00   41.12 ? 188  GLN A CD  1 
ATOM   633   O  OE1 . GLN A  1 81  ? 33.445  52.343  -9.308  0.0000 42.22 ? 188  GLN A OE1 1 
ATOM   634   N  NE2 . GLN A  1 81  ? 31.756  53.773  -8.927  0.0000 42.22 ? 188  GLN A NE2 1 
ATOM   635   N  N   . MET A  1 82  ? 30.128  47.886  -6.972  1.00   35.18 ? 189  MET A N   1 
ATOM   636   C  CA  . MET A  1 82  ? 28.955  47.111  -7.346  1.00   35.70 ? 189  MET A CA  1 
ATOM   637   C  C   . MET A  1 82  ? 28.246  46.457  -6.155  1.00   33.85 ? 189  MET A C   1 
ATOM   638   O  O   . MET A  1 82  ? 27.173  45.879  -6.317  1.00   34.29 ? 189  MET A O   1 
ATOM   639   C  CB  . MET A  1 82  ? 29.350  46.043  -8.366  1.00   36.81 ? 189  MET A CB  1 
ATOM   640   C  CG  . MET A  1 82  ? 29.596  46.598  -9.757  1.00   44.85 ? 189  MET A CG  1 
ATOM   641   S  SD  . MET A  1 82  ? 30.103  45.332  -10.940 1.00   54.21 ? 189  MET A SD  1 
ATOM   642   C  CE  . MET A  1 82  ? 28.552  44.389  -11.154 1.00   53.12 ? 189  MET A CE  1 
ATOM   643   N  N   . ASN A  1 83  ? 28.840  46.556  -4.966  1.00   30.05 ? 190  ASN A N   1 
ATOM   644   C  CA  . ASN A  1 83  ? 28.268  45.947  -3.769  1.00   28.55 ? 190  ASN A CA  1 
ATOM   645   C  C   . ASN A  1 83  ? 28.038  44.448  -3.956  1.00   27.52 ? 190  ASN A C   1 
ATOM   646   O  O   . ASN A  1 83  ? 27.005  43.903  -3.545  1.00   23.89 ? 190  ASN A O   1 
ATOM   647   C  CB  . ASN A  1 83  ? 26.947  46.614  -3.407  1.00   27.90 ? 190  ASN A CB  1 
ATOM   648   C  CG  . ASN A  1 83  ? 27.129  48.012  -2.890  1.00   29.09 ? 190  ASN A CG  1 
ATOM   649   O  OD1 . ASN A  1 83  ? 27.942  48.259  -1.998  1.00   29.58 ? 190  ASN A OD1 1 
ATOM   650   N  ND2 . ASN A  1 83  ? 26.363  48.939  -3.436  1.00   27.17 ? 190  ASN A ND2 1 
ATOM   651   N  N   . ASP A  1 84  ? 29.015  43.794  -4.573  1.00   28.47 ? 191  ASP A N   1 
ATOM   652   C  CA  . ASP A  1 84  ? 28.962  42.363  -4.836  1.00   30.28 ? 191  ASP A CA  1 
ATOM   653   C  C   . ASP A  1 84  ? 28.798  41.525  -3.577  1.00   28.49 ? 191  ASP A C   1 
ATOM   654   O  O   . ASP A  1 84  ? 28.093  40.511  -3.588  1.00   28.99 ? 191  ASP A O   1 
ATOM   655   C  CB  . ASP A  1 84  ? 30.246  41.897  -5.538  1.00   34.28 ? 191  ASP A CB  1 
ATOM   656   C  CG  . ASP A  1 84  ? 30.566  42.703  -6.770  1.00   38.04 ? 191  ASP A CG  1 
ATOM   657   O  OD1 . ASP A  1 84  ? 31.049  43.849  -6.628  1.00   39.88 ? 191  ASP A OD1 1 
ATOM   658   O  OD2 . ASP A  1 84  ? 30.319  42.190  -7.881  1.00   42.05 ? 191  ASP A OD2 1 
ATOM   659   N  N   . ASN A  1 85  ? 29.442  41.948  -2.493  1.00   23.39 ? 192  ASN A N   1 
ATOM   660   C  CA  . ASN A  1 85  ? 29.400  41.174  -1.260  1.00   21.40 ? 192  ASN A CA  1 
ATOM   661   C  C   . ASN A  1 85  ? 28.362  41.607  -0.236  1.00   20.20 ? 192  ASN A C   1 
ATOM   662   O  O   . ASN A  1 85  ? 28.636  41.644  0.962   1.00   20.48 ? 192  ASN A O   1 
ATOM   663   C  CB  . ASN A  1 85  ? 30.803  41.155  -0.643  1.00   20.93 ? 192  ASN A CB  1 
ATOM   664   C  CG  . ASN A  1 85  ? 31.858  40.649  -1.627  1.00   24.51 ? 192  ASN A CG  1 
ATOM   665   O  OD1 . ASN A  1 85  ? 31.748  39.544  -2.166  1.00   25.76 ? 192  ASN A OD1 1 
ATOM   666   N  ND2 . ASN A  1 85  ? 32.875  41.466  -1.878  1.00   23.97 ? 192  ASN A ND2 1 
ATOM   667   N  N   . ARG A  1 86  ? 27.159  41.916  -0.709  1.00   19.57 ? 193  ARG A N   1 
ATOM   668   C  CA  . ARG A  1 86  ? 26.062  42.337  0.173   1.00   19.38 ? 193  ARG A CA  1 
ATOM   669   C  C   . ARG A  1 86  ? 25.139  41.165  0.513   1.00   21.43 ? 193  ARG A C   1 
ATOM   670   O  O   . ARG A  1 86  ? 24.272  41.274  1.386   1.00   21.35 ? 193  ARG A O   1 
ATOM   671   C  CB  . ARG A  1 86  ? 25.213  43.381  -0.529  1.00   16.53 ? 193  ARG A CB  1 
ATOM   672   C  CG  . ARG A  1 86  ? 24.452  42.778  -1.689  1.00   17.18 ? 193  ARG A CG  1 
ATOM   673   C  CD  . ARG A  1 86  ? 23.642  43.794  -2.440  1.00   25.09 ? 193  ARG A CD  1 
ATOM   674   N  NE  . ARG A  1 86  ? 22.852  43.144  -3.480  1.00   32.21 ? 193  ARG A NE  1 
ATOM   675   C  CZ  . ARG A  1 86  ? 22.050  43.788  -4.323  1.00   40.47 ? 193  ARG A CZ  1 
ATOM   676   N  NH1 . ARG A  1 86  ? 21.942  45.114  -4.248  1.00   41.64 ? 193  ARG A NH1 1 
ATOM   677   N  NH2 . ARG A  1 86  ? 21.343  43.109  -5.228  1.00   39.87 ? 193  ARG A NH2 1 
ATOM   678   N  N   . HIS A  1 87  ? 25.328  40.055  -0.197  1.00   19.18 ? 194  HIS A N   1 
ATOM   679   C  CA  . HIS A  1 87  ? 24.493  38.874  -0.058  1.00   17.49 ? 194  HIS A CA  1 
ATOM   680   C  C   . HIS A  1 87  ? 24.430  38.266  1.339   1.00   16.67 ? 194  HIS A C   1 
ATOM   681   O  O   . HIS A  1 87  ? 23.342  38.033  1.860   1.00   18.08 ? 194  HIS A O   1 
ATOM   682   C  CB  . HIS A  1 87  ? 24.958  37.845  -1.087  1.00   18.79 ? 194  HIS A CB  1 
ATOM   683   C  CG  . HIS A  1 87  ? 24.031  36.689  -1.263  1.00   18.20 ? 194  HIS A CG  1 
ATOM   684   N  ND1 . HIS A  1 87  ? 24.252  35.469  -0.669  1.00   15.55 ? 194  HIS A ND1 1 
ATOM   685   C  CD2 . HIS A  1 87  ? 22.934  36.536  -2.040  1.00   15.72 ? 194  HIS A CD2 1 
ATOM   686   C  CE1 . HIS A  1 87  ? 23.339  34.609  -1.080  1.00   13.80 ? 194  HIS A CE1 1 
ATOM   687   N  NE2 . HIS A  1 87  ? 22.528  35.231  -1.913  1.00   13.43 ? 194  HIS A NE2 1 
ATOM   688   N  N   . GLY A  1 88  ? 25.580  38.017  1.953   1.00   16.98 ? 195  GLY A N   1 
ATOM   689   C  CA  . GLY A  1 88  ? 25.590  37.419  3.279   1.00   15.83 ? 195  GLY A CA  1 
ATOM   690   C  C   . GLY A  1 88  ? 24.901  38.285  4.316   1.00   18.92 ? 195  GLY A C   1 
ATOM   691   O  O   . GLY A  1 88  ? 24.186  37.791  5.190   1.00   18.86 ? 195  GLY A O   1 
ATOM   692   N  N   . THR A  1 89  ? 25.117  39.590  4.220   1.00   18.22 ? 196  THR A N   1 
ATOM   693   C  CA  . THR A  1 89  ? 24.509  40.530  5.156   1.00   17.47 ? 196  THR A CA  1 
ATOM   694   C  C   . THR A  1 89  ? 22.982  40.520  5.033   1.00   16.81 ? 196  THR A C   1 
ATOM   695   O  O   . THR A  1 89  ? 22.257  40.620  6.029   1.00   16.47 ? 196  THR A O   1 
ATOM   696   C  CB  . THR A  1 89  ? 25.062  41.960  4.923   1.00   16.15 ? 196  THR A CB  1 
ATOM   697   O  OG1 . THR A  1 89  ? 26.470  41.959  5.178   1.00   14.69 ? 196  THR A OG1 1 
ATOM   698   C  CG2 . THR A  1 89  ? 24.390  42.961  5.850   1.00   15.71 ? 196  THR A CG2 1 
ATOM   699   N  N   . ARG A  1 90  ? 22.486  40.400  3.811   1.00   16.42 ? 197  ARG A N   1 
ATOM   700   C  CA  . ARG A  1 90  ? 21.050  40.348  3.608   1.00   15.63 ? 197  ARG A CA  1 
ATOM   701   C  C   . ARG A  1 90  ? 20.468  39.074  4.235   1.00   16.57 ? 197  ARG A C   1 
ATOM   702   O  O   . ARG A  1 90  ? 19.416  39.108  4.874   1.00   17.27 ? 197  ARG A O   1 
ATOM   703   C  CB  . ARG A  1 90  ? 20.727  40.404  2.114   1.00   17.56 ? 197  ARG A CB  1 
ATOM   704   C  CG  . ARG A  1 90  ? 20.930  41.792  1.494   1.00   18.90 ? 197  ARG A CG  1 
ATOM   705   C  CD  . ARG A  1 90  ? 20.629  41.801  -0.014  1.00   16.19 ? 197  ARG A CD  1 
ATOM   706   N  NE  . ARG A  1 90  ? 20.705  43.164  -0.539  1.00   20.83 ? 197  ARG A NE  1 
ATOM   707   C  CZ  . ARG A  1 90  ? 19.991  43.622  -1.562  1.00   22.13 ? 197  ARG A CZ  1 
ATOM   708   N  NH1 . ARG A  1 90  ? 20.127  44.884  -1.948  1.00   20.63 ? 197  ARG A NH1 1 
ATOM   709   N  NH2 . ARG A  1 90  ? 19.139  42.823  -2.198  1.00   22.00 ? 197  ARG A NH2 1 
ATOM   710   N  N   . CYS A  1 91  ? 21.156  37.953  4.059   1.00   15.28 ? 198  CYS A N   1 
ATOM   711   C  CA  . CYS A  1 91  ? 20.677  36.697  4.625   1.00   17.34 ? 198  CYS A CA  1 
ATOM   712   C  C   . CYS A  1 91  ? 20.718  36.749  6.159   1.00   18.16 ? 198  CYS A C   1 
ATOM   713   O  O   . CYS A  1 91  ? 19.780  36.297  6.820   1.00   17.94 ? 198  CYS A O   1 
ATOM   714   C  CB  . CYS A  1 91  ? 21.513  35.519  4.086   1.00   12.07 ? 198  CYS A CB  1 
ATOM   715   S  SG  . CYS A  1 91  ? 21.267  35.224  2.288   1.00   19.51 ? 198  CYS A SG  1 
ATOM   716   N  N   . ALA A  1 92  ? 21.792  37.310  6.718   1.00   15.63 ? 199  ALA A N   1 
ATOM   717   C  CA  . ALA A  1 92  ? 21.931  37.436  8.175   1.00   16.32 ? 199  ALA A CA  1 
ATOM   718   C  C   . ALA A  1 92  ? 20.755  38.195  8.823   1.00   16.43 ? 199  ALA A C   1 
ATOM   719   O  O   . ALA A  1 92  ? 20.235  37.783  9.859   1.00   17.27 ? 199  ALA A O   1 
ATOM   720   C  CB  . ALA A  1 92  ? 23.231  38.152  8.511   1.00   8.74  ? 199  ALA A CB  1 
ATOM   721   N  N   . GLY A  1 93  ? 20.356  39.310  8.219   1.00   15.63 ? 200  GLY A N   1 
ATOM   722   C  CA  . GLY A  1 93  ? 19.257  40.098  8.754   1.00   16.75 ? 200  GLY A CA  1 
ATOM   723   C  C   . GLY A  1 93  ? 17.923  39.366  8.798   1.00   19.74 ? 200  GLY A C   1 
ATOM   724   O  O   . GLY A  1 93  ? 17.098  39.634  9.668   1.00   18.40 ? 200  GLY A O   1 
ATOM   725   N  N   . GLU A  1 94  ? 17.703  38.447  7.863   1.00   17.19 ? 201  GLU A N   1 
ATOM   726   C  CA  . GLU A  1 94  ? 16.461  37.682  7.828   1.00   17.69 ? 201  GLU A CA  1 
ATOM   727   C  C   . GLU A  1 94  ? 16.354  36.812  9.057   1.00   18.06 ? 201  GLU A C   1 
ATOM   728   O  O   . GLU A  1 94  ? 15.277  36.620  9.611   1.00   16.50 ? 201  GLU A O   1 
ATOM   729   C  CB  . GLU A  1 94  ? 16.427  36.758  6.619   1.00   16.64 ? 201  GLU A CB  1 
ATOM   730   C  CG  . GLU A  1 94  ? 16.328  37.446  5.288   1.00   17.67 ? 201  GLU A CG  1 
ATOM   731   C  CD  . GLU A  1 94  ? 16.202  36.432  4.189   1.00   17.96 ? 201  GLU A CD  1 
ATOM   732   O  OE1 . GLU A  1 94  ? 17.235  36.117  3.566   1.00   17.49 ? 201  GLU A OE1 1 
ATOM   733   O  OE2 . GLU A  1 94  ? 15.072  35.926  3.983   1.00   12.84 ? 201  GLU A OE2 1 
ATOM   734   N  N   . VAL A  1 95  ? 17.493  36.275  9.469   1.00   18.60 ? 202  VAL A N   1 
ATOM   735   C  CA  . VAL A  1 95  ? 17.542  35.400  10.620  1.00   19.10 ? 202  VAL A CA  1 
ATOM   736   C  C   . VAL A  1 95  ? 17.490  36.132  11.953  1.00   19.37 ? 202  VAL A C   1 
ATOM   737   O  O   . VAL A  1 95  ? 16.666  35.812  12.815  1.00   17.97 ? 202  VAL A O   1 
ATOM   738   C  CB  . VAL A  1 95  ? 18.839  34.556  10.618  1.00   21.48 ? 202  VAL A CB  1 
ATOM   739   C  CG1 . VAL A  1 95  ? 18.914  33.705  11.876  1.00   20.78 ? 202  VAL A CG1 1 
ATOM   740   C  CG2 . VAL A  1 95  ? 18.898  33.697  9.373   1.00   19.31 ? 202  VAL A CG2 1 
ATOM   741   N  N   . ALA A  1 96  ? 18.348  37.136  12.114  1.00   19.66 ? 203  ALA A N   1 
ATOM   742   C  CA  . ALA A  1 96  ? 18.431  37.792  13.410  1.00   18.55 ? 203  ALA A CA  1 
ATOM   743   C  C   . ALA A  1 96  ? 18.595  39.302  13.490  1.00   18.92 ? 203  ALA A C   1 
ATOM   744   O  O   . ALA A  1 96  ? 19.314  39.800  14.369  1.00   18.00 ? 203  ALA A O   1 
ATOM   745   C  CB  . ALA A  1 96  ? 19.544  37.116  14.226  1.00   16.90 ? 203  ALA A CB  1 
ATOM   746   N  N   . ALA A  1 97  ? 17.941  40.043  12.605  1.00   17.79 ? 204  ALA A N   1 
ATOM   747   C  CA  . ALA A  1 97  ? 18.033  41.495  12.687  1.00   17.18 ? 204  ALA A CA  1 
ATOM   748   C  C   . ALA A  1 97  ? 17.460  41.868  14.060  1.00   15.88 ? 204  ALA A C   1 
ATOM   749   O  O   . ALA A  1 97  ? 16.480  41.269  14.512  1.00   14.47 ? 204  ALA A O   1 
ATOM   750   C  CB  . ALA A  1 97  ? 17.214  42.147  11.567  1.00   13.25 ? 204  ALA A CB  1 
ATOM   751   N  N   . VAL A  1 98  ? 18.083  42.837  14.724  1.00   16.81 ? 205  VAL A N   1 
ATOM   752   C  CA  . VAL A  1 98  ? 17.646  43.297  16.045  1.00   17.64 ? 205  VAL A CA  1 
ATOM   753   C  C   . VAL A  1 98  ? 16.229  43.880  16.025  1.00   18.67 ? 205  VAL A C   1 
ATOM   754   O  O   . VAL A  1 98  ? 15.841  44.569  15.079  1.00   18.46 ? 205  VAL A O   1 
ATOM   755   C  CB  . VAL A  1 98  ? 18.641  44.370  16.594  1.00   20.27 ? 205  VAL A CB  1 
ATOM   756   C  CG1 . VAL A  1 98  ? 18.143  44.955  17.931  1.00   13.10 ? 205  VAL A CG1 1 
ATOM   757   C  CG2 . VAL A  1 98  ? 20.029  43.727  16.777  1.00   15.62 ? 205  VAL A CG2 1 
ATOM   758   N  N   . ALA A  1 99  ? 15.470  43.606  17.084  1.00   17.03 ? 206  ALA A N   1 
ATOM   759   C  CA  . ALA A  1 99  ? 14.099  44.082  17.185  1.00   19.21 ? 206  ALA A CA  1 
ATOM   760   C  C   . ALA A  1 99  ? 13.929  45.308  18.089  1.00   20.73 ? 206  ALA A C   1 
ATOM   761   O  O   . ALA A  1 99  ? 14.739  45.549  18.986  1.00   20.28 ? 206  ALA A O   1 
ATOM   762   C  CB  . ALA A  1 99  ? 13.204  42.953  17.686  1.00   20.84 ? 206  ALA A CB  1 
ATOM   763   N  N   . ASN A  1 100 ? 12.869  46.072  17.830  1.00   18.25 ? 207  ASN A N   1 
ATOM   764   C  CA  . ASN A  1 100 ? 12.517  47.245  18.621  1.00   19.11 ? 207  ASN A CA  1 
ATOM   765   C  C   . ASN A  1 100 ? 13.641  48.246  18.807  1.00   20.90 ? 207  ASN A C   1 
ATOM   766   O  O   . ASN A  1 100 ? 13.832  48.772  19.911  1.00   18.84 ? 207  ASN A O   1 
ATOM   767   C  CB  . ASN A  1 100 ? 12.022  46.800  19.997  1.00   17.53 ? 207  ASN A CB  1 
ATOM   768   C  CG  . ASN A  1 100 ? 10.936  45.777  19.899  1.00   18.35 ? 207  ASN A CG  1 
ATOM   769   O  OD1 . ASN A  1 100 ? 10.031  45.925  19.089  1.00   22.75 ? 207  ASN A OD1 1 
ATOM   770   N  ND2 . ASN A  1 100 ? 11.006  44.737  20.720  1.00   18.57 ? 207  ASN A ND2 1 
ATOM   771   N  N   . ASN A  1 101 ? 14.383  48.522  17.740  1.00   18.27 ? 208  ASN A N   1 
ATOM   772   C  CA  . ASN A  1 101 ? 15.487  49.453  17.858  1.00   19.96 ? 208  ASN A CA  1 
ATOM   773   C  C   . ASN A  1 101 ? 15.380  50.566  16.829  1.00   20.67 ? 208  ASN A C   1 
ATOM   774   O  O   . ASN A  1 101 ? 16.370  51.207  16.499  1.00   18.51 ? 208  ASN A O   1 
ATOM   775   C  CB  . ASN A  1 101 ? 16.819  48.708  17.720  1.00   18.44 ? 208  ASN A CB  1 
ATOM   776   C  CG  . ASN A  1 101 ? 17.060  48.212  16.324  1.00   18.28 ? 208  ASN A CG  1 
ATOM   777   O  OD1 . ASN A  1 101 ? 16.121  48.006  15.567  1.00   21.03 ? 208  ASN A OD1 1 
ATOM   778   N  ND2 . ASN A  1 101 ? 18.326  48.010  15.972  1.00   17.78 ? 208  ASN A ND2 1 
ATOM   779   N  N   . GLY A  1 102 ? 14.162  50.783  16.332  1.00   21.80 ? 209  GLY A N   1 
ATOM   780   C  CA  . GLY A  1 102 ? 13.915  51.826  15.352  1.00   18.87 ? 209  GLY A CA  1 
ATOM   781   C  C   . GLY A  1 102 ? 14.711  51.737  14.065  1.00   20.62 ? 209  GLY A C   1 
ATOM   782   O  O   . GLY A  1 102 ? 14.840  52.728  13.351  1.00   21.65 ? 209  GLY A O   1 
ATOM   783   N  N   . VAL A  1 103 ? 15.238  50.558  13.758  1.00   19.18 ? 210  VAL A N   1 
ATOM   784   C  CA  . VAL A  1 103 ? 16.013  50.366  12.543  1.00   18.08 ? 210  VAL A CA  1 
ATOM   785   C  C   . VAL A  1 103 ? 15.467  49.224  11.687  1.00   20.40 ? 210  VAL A C   1 
ATOM   786   O  O   . VAL A  1 103 ? 15.242  48.125  12.195  1.00   19.04 ? 210  VAL A O   1 
ATOM   787   C  CB  . VAL A  1 103 ? 17.486  50.032  12.880  1.00   18.74 ? 210  VAL A CB  1 
ATOM   788   C  CG1 . VAL A  1 103 ? 18.233  49.680  11.617  1.00   13.80 ? 210  VAL A CG1 1 
ATOM   789   C  CG2 . VAL A  1 103 ? 18.151  51.204  13.599  1.00   14.87 ? 210  VAL A CG2 1 
ATOM   790   N  N   . CYS A  1 104 ? 15.256  49.502  10.398  1.00   22.34 ? 211  CYS A N   1 
ATOM   791   C  CA  . CYS A  1 104 ? 14.792  48.511  9.433   1.00   21.21 ? 211  CYS A CA  1 
ATOM   792   C  C   . CYS A  1 104 ? 13.674  47.608  9.990   1.00   21.12 ? 211  CYS A C   1 
ATOM   793   O  O   . CYS A  1 104 ? 12.687  48.100  10.538  1.00   19.06 ? 211  CYS A O   1 
ATOM   794   C  CB  . CYS A  1 104 ? 16.006  47.680  8.998   1.00   24.08 ? 211  CYS A CB  1 
ATOM   795   S  SG  . CYS A  1 104 ? 15.945  46.819  7.382   1.00   29.77 ? 211  CYS A SG  1 
ATOM   796   N  N   . GLY A  1 105 ? 13.833  46.292  9.847   1.00   19.20 ? 212  GLY A N   1 
ATOM   797   C  CA  . GLY A  1 105 ? 12.830  45.359  10.343  1.00   18.45 ? 212  GLY A CA  1 
ATOM   798   C  C   . GLY A  1 105 ? 13.350  44.496  11.489  1.00   19.66 ? 212  GLY A C   1 
ATOM   799   O  O   . GLY A  1 105 ? 14.113  44.974  12.340  1.00   16.79 ? 212  GLY A O   1 
ATOM   800   N  N   . VAL A  1 106 ? 12.933  43.232  11.517  1.00   16.23 ? 213  VAL A N   1 
ATOM   801   C  CA  . VAL A  1 106 ? 13.362  42.289  12.549  1.00   17.81 ? 213  VAL A CA  1 
ATOM   802   C  C   . VAL A  1 106 ? 13.628  40.910  11.960  1.00   16.39 ? 213  VAL A C   1 
ATOM   803   O  O   . VAL A  1 106 ? 13.053  40.541  10.935  1.00   18.60 ? 213  VAL A O   1 
ATOM   804   C  CB  . VAL A  1 106 ? 12.295  42.119  13.674  1.00   19.37 ? 213  VAL A CB  1 
ATOM   805   C  CG1 . VAL A  1 106 ? 12.063  43.439  14.369  1.00   21.02 ? 213  VAL A CG1 1 
ATOM   806   C  CG2 . VAL A  1 106 ? 10.973  41.602  13.086  1.00   20.65 ? 213  VAL A CG2 1 
ATOM   807   N  N   . GLY A  1 107 ? 14.498  40.147  12.609  1.00   16.27 ? 214  GLY A N   1 
ATOM   808   C  CA  . GLY A  1 107 ? 14.780  38.812  12.127  1.00   15.79 ? 214  GLY A CA  1 
ATOM   809   C  C   . GLY A  1 107 ? 13.741  37.851  12.682  1.00   19.35 ? 214  GLY A C   1 
ATOM   810   O  O   . GLY A  1 107 ? 13.024  38.193  13.629  1.00   17.94 ? 214  GLY A O   1 
ATOM   811   N  N   . VAL A  1 108 ? 13.638  36.659  12.096  1.00   17.20 ? 215  VAL A N   1 
ATOM   812   C  CA  . VAL A  1 108 ? 12.697  35.652  12.589  1.00   17.24 ? 215  VAL A CA  1 
ATOM   813   C  C   . VAL A  1 108 ? 13.038  35.309  14.044  1.00   18.16 ? 215  VAL A C   1 
ATOM   814   O  O   . VAL A  1 108 ? 12.146  35.175  14.882  1.00   17.18 ? 215  VAL A O   1 
ATOM   815   C  CB  . VAL A  1 108 ? 12.773  34.371  11.738  1.00   19.65 ? 215  VAL A CB  1 
ATOM   816   C  CG1 . VAL A  1 108 ? 11.983  33.244  12.389  1.00   17.02 ? 215  VAL A CG1 1 
ATOM   817   C  CG2 . VAL A  1 108 ? 12.259  34.667  10.332  1.00   16.79 ? 215  VAL A CG2 1 
ATOM   818   N  N   . ALA A  1 109 ? 14.330  35.160  14.322  1.00   15.38 ? 216  ALA A N   1 
ATOM   819   C  CA  . ALA A  1 109 ? 14.826  34.858  15.668  1.00   16.72 ? 216  ALA A CA  1 
ATOM   820   C  C   . ALA A  1 109 ? 15.621  36.094  16.112  1.00   15.06 ? 216  ALA A C   1 
ATOM   821   O  O   . ALA A  1 109 ? 16.847  36.067  16.170  1.00   17.92 ? 216  ALA A O   1 
ATOM   822   C  CB  . ALA A  1 109 ? 15.735  33.631  15.620  1.00   13.34 ? 216  ALA A CB  1 
ATOM   823   N  N   . TYR A  1 110 ? 14.913  37.172  16.431  1.00   16.19 ? 217  TYR A N   1 
ATOM   824   C  CA  . TYR A  1 110 ? 15.566  38.420  16.786  1.00   17.62 ? 217  TYR A CA  1 
ATOM   825   C  C   . TYR A  1 110 ? 16.387  38.465  18.064  1.00   18.56 ? 217  TYR A C   1 
ATOM   826   O  O   . TYR A  1 110 ? 17.030  39.475  18.354  1.00   20.05 ? 217  TYR A O   1 
ATOM   827   C  CB  . TYR A  1 110 ? 14.554  39.570  16.742  1.00   18.58 ? 217  TYR A CB  1 
ATOM   828   C  CG  . TYR A  1 110 ? 13.356  39.455  17.661  1.00   17.86 ? 217  TYR A CG  1 
ATOM   829   C  CD1 . TYR A  1 110 ? 13.489  39.601  19.051  1.00   18.68 ? 217  TYR A CD1 1 
ATOM   830   C  CD2 . TYR A  1 110 ? 12.074  39.324  17.135  1.00   17.95 ? 217  TYR A CD2 1 
ATOM   831   C  CE1 . TYR A  1 110 ? 12.363  39.643  19.887  1.00   16.26 ? 217  TYR A CE1 1 
ATOM   832   C  CE2 . TYR A  1 110 ? 10.947  39.354  17.954  1.00   14.98 ? 217  TYR A CE2 1 
ATOM   833   C  CZ  . TYR A  1 110 ? 11.095  39.520  19.320  1.00   18.63 ? 217  TYR A CZ  1 
ATOM   834   O  OH  . TYR A  1 110 ? 9.969   39.595  20.101  1.00   15.60 ? 217  TYR A OH  1 
ATOM   835   N  N   . ASN A  1 111 ? 16.377  37.383  18.833  1.00   16.92 ? 218  ASN A N   1 
ATOM   836   C  CA  . ASN A  1 111 ? 17.198  37.335  20.047  1.00   18.86 ? 218  ASN A CA  1 
ATOM   837   C  C   . ASN A  1 111 ? 18.296  36.284  19.905  1.00   20.59 ? 218  ASN A C   1 
ATOM   838   O  O   . ASN A  1 111 ? 19.030  36.003  20.857  1.00   21.30 ? 218  ASN A O   1 
ATOM   839   C  CB  . ASN A  1 111 ? 16.381  36.993  21.283  1.00   20.81 ? 218  ASN A CB  1 
ATOM   840   C  CG  . ASN A  1 111 ? 15.739  38.184  21.889  1.00   22.43 ? 218  ASN A CG  1 
ATOM   841   O  OD1 . ASN A  1 111 ? 16.391  39.201  22.121  1.00   26.85 ? 218  ASN A OD1 1 
ATOM   842   N  ND2 . ASN A  1 111 ? 14.450  38.076  22.164  1.00   21.87 ? 218  ASN A ND2 1 
ATOM   843   N  N   . ALA A  1 112 ? 18.394  35.680  18.727  1.00   18.16 ? 219  ALA A N   1 
ATOM   844   C  CA  . ALA A  1 112 ? 19.435  34.687  18.499  1.00   19.97 ? 219  ALA A CA  1 
ATOM   845   C  C   . ALA A  1 112 ? 20.769  35.388  18.249  1.00   17.57 ? 219  ALA A C   1 
ATOM   846   O  O   . ALA A  1 112 ? 20.812  36.575  17.938  1.00   18.42 ? 219  ALA A O   1 
ATOM   847   C  CB  . ALA A  1 112 ? 19.084  33.820  17.298  1.00   16.57 ? 219  ALA A CB  1 
ATOM   848   N  N   . ARG A  1 113 ? 21.861  34.655  18.409  1.00   17.58 ? 220  ARG A N   1 
ATOM   849   C  CA  . ARG A  1 113 ? 23.166  35.212  18.138  1.00   18.85 ? 220  ARG A CA  1 
ATOM   850   C  C   . ARG A  1 113 ? 23.473  34.832  16.696  1.00   20.07 ? 220  ARG A C   1 
ATOM   851   O  O   . ARG A  1 113 ? 23.257  33.687  16.283  1.00   16.62 ? 220  ARG A O   1 
ATOM   852   C  CB  . ARG A  1 113 ? 24.201  34.646  19.099  1.00   24.85 ? 220  ARG A CB  1 
ATOM   853   C  CG  . ARG A  1 113 ? 24.235  35.405  20.418  1.00   33.02 ? 220  ARG A CG  1 
ATOM   854   C  CD  . ARG A  1 113 ? 24.836  34.545  21.505  1.00   40.99 ? 220  ARG A CD  1 
ATOM   855   N  NE  . ARG A  1 113 ? 26.289  34.423  21.404  1.00   44.88 ? 220  ARG A NE  1 
ATOM   856   C  CZ  . ARG A  1 113 ? 26.995  33.460  21.988  1.00   42.72 ? 220  ARG A CZ  1 
ATOM   857   N  NH1 . ARG A  1 113 ? 28.313  33.429  21.853  1.00   45.57 ? 220  ARG A NH1 1 
ATOM   858   N  NH2 . ARG A  1 113 ? 26.377  32.520  22.695  1.00   42.64 ? 220  ARG A NH2 1 
ATOM   859   N  N   . ILE A  1 114 ? 23.963  35.802  15.930  1.00   17.07 ? 221  ILE A N   1 
ATOM   860   C  CA  . ILE A  1 114 ? 24.233  35.585  14.524  1.00   16.62 ? 221  ILE A CA  1 
ATOM   861   C  C   . ILE A  1 114 ? 25.703  35.802  14.161  1.00   15.24 ? 221  ILE A C   1 
ATOM   862   O  O   . ILE A  1 114 ? 26.349  36.758  14.592  1.00   15.44 ? 221  ILE A O   1 
ATOM   863   C  CB  . ILE A  1 114 ? 23.323  36.517  13.672  1.00   14.26 ? 221  ILE A CB  1 
ATOM   864   C  CG1 . ILE A  1 114 ? 23.511  36.220  12.186  1.00   20.49 ? 221  ILE A CG1 1 
ATOM   865   C  CG2 . ILE A  1 114 ? 23.610  37.971  13.999  1.00   13.11 ? 221  ILE A CG2 1 
ATOM   866   C  CD1 . ILE A  1 114 ? 22.576  35.135  11.660  1.00   13.89 ? 221  ILE A CD1 1 
ATOM   867   N  N   . GLY A  1 115 ? 26.230  34.883  13.372  1.00   18.41 ? 222  GLY A N   1 
ATOM   868   C  CA  . GLY A  1 115 ? 27.605  34.979  12.937  1.00   16.98 ? 222  GLY A CA  1 
ATOM   869   C  C   . GLY A  1 115 ? 27.660  34.795  11.433  1.00   19.96 ? 222  GLY A C   1 
ATOM   870   O  O   . GLY A  1 115 ? 26.648  34.492  10.780  1.00   17.80 ? 222  GLY A O   1 
ATOM   871   N  N   . GLY A  1 116 ? 28.842  34.987  10.866  1.00   18.81 ? 223  GLY A N   1 
ATOM   872   C  CA  . GLY A  1 116 ? 28.975  34.811  9.439   1.00   17.31 ? 223  GLY A CA  1 
ATOM   873   C  C   . GLY A  1 116 ? 30.348  34.285  9.088   1.00   20.96 ? 223  GLY A C   1 
ATOM   874   O  O   . GLY A  1 116 ? 31.346  34.642  9.731   1.00   20.46 ? 223  GLY A O   1 
ATOM   875   N  N   . VAL A  1 117 ? 30.396  33.402  8.096   1.00   17.19 ? 224  VAL A N   1 
ATOM   876   C  CA  . VAL A  1 117 ? 31.660  32.877  7.630   1.00   18.07 ? 224  VAL A CA  1 
ATOM   877   C  C   . VAL A  1 117 ? 31.844  33.428  6.226   1.00   18.88 ? 224  VAL A C   1 
ATOM   878   O  O   . VAL A  1 117 ? 31.018  33.191  5.344   1.00   19.11 ? 224  VAL A O   1 
ATOM   879   C  CB  . VAL A  1 117 ? 31.683  31.335  7.576   1.00   17.01 ? 224  VAL A CB  1 
ATOM   880   C  CG1 . VAL A  1 117 ? 32.985  30.862  6.941   1.00   12.20 ? 224  VAL A CG1 1 
ATOM   881   C  CG2 . VAL A  1 117 ? 31.561  30.774  8.979   1.00   13.52 ? 224  VAL A CG2 1 
ATOM   882   N  N   . ARG A  1 118 ? 32.912  34.193  6.031   1.00   18.00 ? 225  ARG A N   1 
ATOM   883   C  CA  . ARG A  1 118 ? 33.194  34.763  4.729   1.00   19.20 ? 225  ARG A CA  1 
ATOM   884   C  C   . ARG A  1 118 ? 33.929  33.657  3.986   1.00   19.52 ? 225  ARG A C   1 
ATOM   885   O  O   . ARG A  1 118 ? 35.086  33.356  4.307   1.00   19.30 ? 225  ARG A O   1 
ATOM   886   C  CB  . ARG A  1 118 ? 34.073  36.016  4.878   1.00   19.48 ? 225  ARG A CB  1 
ATOM   887   C  CG  . ARG A  1 118 ? 34.479  36.668  3.563   1.00   18.91 ? 225  ARG A CG  1 
ATOM   888   C  CD  . ARG A  1 118 ? 35.109  38.039  3.794   1.00   23.62 ? 225  ARG A CD  1 
ATOM   889   N  NE  . ARG A  1 118 ? 35.504  38.680  2.541   1.00   24.14 ? 225  ARG A NE  1 
ATOM   890   C  CZ  . ARG A  1 118 ? 36.731  38.646  2.026   1.00   26.87 ? 225  ARG A CZ  1 
ATOM   891   N  NH1 . ARG A  1 118 ? 36.986  39.252  0.872   1.00   23.42 ? 225  ARG A NH1 1 
ATOM   892   N  NH2 . ARG A  1 118 ? 37.712  38.027  2.674   1.00   22.74 ? 225  ARG A NH2 1 
ATOM   893   N  N   . MET A  1 119 ? 33.248  33.035  3.021   1.00   15.19 ? 226  MET A N   1 
ATOM   894   C  CA  . MET A  1 119 ? 33.848  31.949  2.265   1.00   17.21 ? 226  MET A CA  1 
ATOM   895   C  C   . MET A  1 119 ? 33.521  31.919  0.774   1.00   17.39 ? 226  MET A C   1 
ATOM   896   O  O   . MET A  1 119 ? 34.093  31.128  0.036   1.00   18.07 ? 226  MET A O   1 
ATOM   897   C  CB  . MET A  1 119 ? 33.501  30.599  2.916   1.00   18.73 ? 226  MET A CB  1 
ATOM   898   C  CG  . MET A  1 119 ? 32.028  30.421  3.335   1.00   20.83 ? 226  MET A CG  1 
ATOM   899   S  SD  . MET A  1 119 ? 30.923  30.080  1.966   1.00   23.82 ? 226  MET A SD  1 
ATOM   900   C  CE  . MET A  1 119 ? 31.526  28.426  1.515   1.00   16.53 ? 226  MET A CE  1 
ATOM   901   N  N   . LEU A  1 120 ? 32.630  32.793  0.321   1.00   17.40 ? 227  LEU A N   1 
ATOM   902   C  CA  . LEU A  1 120 ? 32.278  32.818  -1.096  1.00   18.72 ? 227  LEU A CA  1 
ATOM   903   C  C   . LEU A  1 120 ? 33.087  33.832  -1.897  1.00   20.89 ? 227  LEU A C   1 
ATOM   904   O  O   . LEU A  1 120 ? 33.097  33.786  -3.130  1.00   18.59 ? 227  LEU A O   1 
ATOM   905   C  CB  . LEU A  1 120 ? 30.792  33.136  -1.286  1.00   17.80 ? 227  LEU A CB  1 
ATOM   906   C  CG  . LEU A  1 120 ? 29.747  32.121  -0.827  1.00   20.47 ? 227  LEU A CG  1 
ATOM   907   C  CD1 . LEU A  1 120 ? 28.353  32.654  -1.147  1.00   13.42 ? 227  LEU A CD1 1 
ATOM   908   C  CD2 . LEU A  1 120 ? 29.987  30.776  -1.513  1.00   18.51 ? 227  LEU A CD2 1 
ATOM   909   N  N   . ASP A  1 121 ? 33.757  34.747  -1.200  1.00   20.74 ? 228  ASP A N   1 
ATOM   910   C  CA  . ASP A  1 121 ? 34.523  35.792  -1.863  1.00   21.15 ? 228  ASP A CA  1 
ATOM   911   C  C   . ASP A  1 121 ? 35.980  35.384  -2.077  1.00   22.52 ? 228  ASP A C   1 
ATOM   912   O  O   . ASP A  1 121 ? 36.900  35.926  -1.461  1.00   25.98 ? 228  ASP A O   1 
ATOM   913   C  CB  . ASP A  1 121 ? 34.423  37.082  -1.047  1.00   20.03 ? 228  ASP A CB  1 
ATOM   914   C  CG  . ASP A  1 121 ? 34.834  38.300  -1.838  1.00   23.98 ? 228  ASP A CG  1 
ATOM   915   O  OD1 . ASP A  1 121 ? 34.846  38.217  -3.088  1.00   24.15 ? 228  ASP A OD1 1 
ATOM   916   O  OD2 . ASP A  1 121 ? 35.131  39.340  -1.214  1.00   21.59 ? 228  ASP A OD2 1 
ATOM   917   N  N   . GLY A  1 122 ? 36.171  34.415  -2.962  1.00   21.31 ? 229  GLY A N   1 
ATOM   918   C  CA  . GLY A  1 122 ? 37.492  33.899  -3.267  1.00   23.94 ? 229  GLY A CA  1 
ATOM   919   C  C   . GLY A  1 122 ? 37.309  32.543  -3.922  1.00   26.34 ? 229  GLY A C   1 
ATOM   920   O  O   . GLY A  1 122 ? 36.201  32.201  -4.347  1.00   25.32 ? 229  GLY A O   1 
ATOM   921   N  N   . GLU A  1 123 ? 38.373  31.760  -4.024  1.00   25.29 ? 230  GLU A N   1 
ATOM   922   C  CA  . GLU A  1 123 ? 38.239  30.451  -4.634  1.00   25.45 ? 230  GLU A CA  1 
ATOM   923   C  C   . GLU A  1 123 ? 37.515  29.565  -3.620  1.00   24.32 ? 230  GLU A C   1 
ATOM   924   O  O   . GLU A  1 123 ? 37.998  29.362  -2.507  1.00   24.53 ? 230  GLU A O   1 
ATOM   925   C  CB  . GLU A  1 123 ? 39.610  29.863  -4.952  1.00   27.83 ? 230  GLU A CB  1 
ATOM   926   C  CG  . GLU A  1 123 ? 39.581  28.850  -6.087  1.00   34.08 ? 230  GLU A CG  1 
ATOM   927   C  CD  . GLU A  1 123 ? 40.822  27.956  -6.127  1.00   40.92 ? 230  GLU A CD  1 
ATOM   928   O  OE1 . GLU A  1 123 ? 41.916  28.407  -5.707  1.00   43.41 ? 230  GLU A OE1 1 
ATOM   929   O  OE2 . GLU A  1 123 ? 40.700  26.799  -6.593  1.00   43.43 ? 230  GLU A OE2 1 
ATOM   930   N  N   . VAL A  1 124 ? 36.346  29.059  -3.996  1.00   22.87 ? 231  VAL A N   1 
ATOM   931   C  CA  . VAL A  1 124 ? 35.577  28.200  -3.100  1.00   20.33 ? 231  VAL A CA  1 
ATOM   932   C  C   . VAL A  1 124 ? 35.982  26.742  -3.319  1.00   20.94 ? 231  VAL A C   1 
ATOM   933   O  O   . VAL A  1 124 ? 35.375  26.024  -4.115  1.00   20.33 ? 231  VAL A O   1 
ATOM   934   C  CB  . VAL A  1 124 ? 34.047  28.332  -3.337  1.00   19.08 ? 231  VAL A CB  1 
ATOM   935   C  CG1 . VAL A  1 124 ? 33.299  27.450  -2.342  1.00   18.53 ? 231  VAL A CG1 1 
ATOM   936   C  CG2 . VAL A  1 124 ? 33.598  29.783  -3.181  1.00   16.31 ? 231  VAL A CG2 1 
ATOM   937   N  N   . THR A  1 125 ? 37.013  26.315  -2.600  1.00   20.90 ? 232  THR A N   1 
ATOM   938   C  CA  . THR A  1 125 ? 37.524  24.958  -2.703  1.00   21.04 ? 232  THR A CA  1 
ATOM   939   C  C   . THR A  1 125 ? 36.816  24.034  -1.721  1.00   20.21 ? 232  THR A C   1 
ATOM   940   O  O   . THR A  1 125 ? 36.031  24.467  -0.874  1.00   19.43 ? 232  THR A O   1 
ATOM   941   C  CB  . THR A  1 125 ? 39.025  24.917  -2.357  1.00   23.91 ? 232  THR A CB  1 
ATOM   942   O  OG1 . THR A  1 125 ? 39.194  25.365  -1.004  1.00   23.93 ? 232  THR A OG1 1 
ATOM   943   C  CG2 . THR A  1 125 ? 39.830  25.825  -3.289  1.00   20.81 ? 232  THR A CG2 1 
ATOM   944   N  N   . ASP A  1 126 ? 37.123  22.751  -1.833  1.00   18.91 ? 233  ASP A N   1 
ATOM   945   C  CA  . ASP A  1 126 ? 36.566  21.753  -0.947  1.00   16.22 ? 233  ASP A CA  1 
ATOM   946   C  C   . ASP A  1 126 ? 37.008  22.091  0.486   1.00   16.11 ? 233  ASP A C   1 
ATOM   947   O  O   . ASP A  1 126 ? 36.216  22.030  1.422   1.00   18.58 ? 233  ASP A O   1 
ATOM   948   C  CB  . ASP A  1 126 ? 37.067  20.372  -1.363  1.00   14.47 ? 233  ASP A CB  1 
ATOM   949   C  CG  . ASP A  1 126 ? 36.493  19.263  -0.506  1.00   23.43 ? 233  ASP A CG  1 
ATOM   950   O  OD1 . ASP A  1 126 ? 35.286  19.326  -0.182  1.00   20.78 ? 233  ASP A OD1 1 
ATOM   951   O  OD2 . ASP A  1 126 ? 37.242  18.322  -0.158  1.00   23.98 ? 233  ASP A OD2 1 
ATOM   952   N  N   . ALA A  1 127 ? 38.274  22.459  0.649   1.00   15.52 ? 234  ALA A N   1 
ATOM   953   C  CA  . ALA A  1 127 ? 38.807  22.806  1.967   1.00   16.17 ? 234  ALA A CA  1 
ATOM   954   C  C   . ALA A  1 127 ? 38.092  24.029  2.538   1.00   16.40 ? 234  ALA A C   1 
ATOM   955   O  O   . ALA A  1 127 ? 37.797  24.086  3.733   1.00   17.42 ? 234  ALA A O   1 
ATOM   956   C  CB  . ALA A  1 127 ? 40.303  23.083  1.872   1.00   16.43 ? 234  ALA A CB  1 
ATOM   957   N  N   . VAL A  1 128 ? 37.834  25.015  1.683   1.00   18.26 ? 235  VAL A N   1 
ATOM   958   C  CA  . VAL A  1 128 ? 37.133  26.220  2.111   1.00   16.58 ? 235  VAL A CA  1 
ATOM   959   C  C   . VAL A  1 128 ? 35.743  25.839  2.623   1.00   17.66 ? 235  VAL A C   1 
ATOM   960   O  O   . VAL A  1 128 ? 35.316  26.290  3.688   1.00   17.05 ? 235  VAL A O   1 
ATOM   961   C  CB  . VAL A  1 128 ? 37.015  27.228  0.951   1.00   14.93 ? 235  VAL A CB  1 
ATOM   962   C  CG1 . VAL A  1 128 ? 35.922  28.249  1.229   1.00   11.60 ? 235  VAL A CG1 1 
ATOM   963   C  CG2 . VAL A  1 128 ? 38.351  27.962  0.780   1.00   18.07 ? 235  VAL A CG2 1 
ATOM   964   N  N   . GLU A  1 129 ? 35.049  24.989  1.875   1.00   16.68 ? 236  GLU A N   1 
ATOM   965   C  CA  . GLU A  1 129 ? 33.711  24.563  2.284   1.00   17.34 ? 236  GLU A CA  1 
ATOM   966   C  C   . GLU A  1 129 ? 33.756  23.785  3.592   1.00   17.39 ? 236  GLU A C   1 
ATOM   967   O  O   . GLU A  1 129 ? 32.983  24.059  4.511   1.00   14.27 ? 236  GLU A O   1 
ATOM   968   C  CB  . GLU A  1 129 ? 33.064  23.694  1.191   1.00   16.02 ? 236  GLU A CB  1 
ATOM   969   C  CG  . GLU A  1 129 ? 32.547  24.499  -0.007  1.00   16.58 ? 236  GLU A CG  1 
ATOM   970   C  CD  . GLU A  1 129 ? 32.063  23.621  -1.148  1.00   18.99 ? 236  GLU A CD  1 
ATOM   971   O  OE1 . GLU A  1 129 ? 31.554  22.509  -0.874  1.00   17.88 ? 236  GLU A OE1 1 
ATOM   972   O  OE2 . GLU A  1 129 ? 32.182  24.044  -2.316  1.00   16.86 ? 236  GLU A OE2 1 
ATOM   973   N  N   . ALA A  1 130 ? 34.676  22.825  3.676   1.00   18.82 ? 237  ALA A N   1 
ATOM   974   C  CA  . ALA A  1 130 ? 34.797  21.986  4.863   1.00   18.14 ? 237  ALA A CA  1 
ATOM   975   C  C   . ALA A  1 130 ? 35.101  22.789  6.128   1.00   18.06 ? 237  ALA A C   1 
ATOM   976   O  O   . ALA A  1 130 ? 34.564  22.516  7.196   1.00   15.83 ? 237  ALA A O   1 
ATOM   977   C  CB  . ALA A  1 130 ? 35.860  20.920  4.638   1.00   17.76 ? 237  ALA A CB  1 
ATOM   978   N  N   . ARG A  1 131 ? 35.959  23.791  6.013   1.00   18.30 ? 238  ARG A N   1 
ATOM   979   C  CA  . ARG A  1 131 ? 36.277  24.596  7.182   1.00   20.37 ? 238  ARG A CA  1 
ATOM   980   C  C   . ARG A  1 131 ? 35.081  25.457  7.608   1.00   18.70 ? 238  ARG A C   1 
ATOM   981   O  O   . ARG A  1 131 ? 34.930  25.785  8.779   1.00   20.13 ? 238  ARG A O   1 
ATOM   982   C  CB  . ARG A  1 131 ? 37.503  25.476  6.902   1.00   21.05 ? 238  ARG A CB  1 
ATOM   983   C  CG  . ARG A  1 131 ? 38.762  24.685  6.508   1.00   27.95 ? 238  ARG A CG  1 
ATOM   984   C  CD  . ARG A  1 131 ? 39.977  25.592  6.391   1.00   27.02 ? 238  ARG A CD  1 
ATOM   985   N  NE  . ARG A  1 131 ? 40.292  26.196  7.680   1.00   36.24 ? 238  ARG A NE  1 
ATOM   986   C  CZ  . ARG A  1 131 ? 40.765  27.430  7.830   1.00   41.74 ? 238  ARG A CZ  1 
ATOM   987   N  NH1 . ARG A  1 131 ? 41.026  27.908  9.045   1.00   44.75 ? 238  ARG A NH1 1 
ATOM   988   N  NH2 . ARG A  1 131 ? 40.965  28.194  6.764   1.00   45.29 ? 238  ARG A NH2 1 
ATOM   989   N  N   . SER A  1 132 ? 34.230  25.817  6.653   1.00   17.88 ? 239  SER A N   1 
ATOM   990   C  CA  . SER A  1 132 ? 33.054  26.633  6.943   1.00   15.78 ? 239  SER A CA  1 
ATOM   991   C  C   . SER A  1 132 ? 31.958  25.780  7.590   1.00   16.86 ? 239  SER A C   1 
ATOM   992   O  O   . SER A  1 132 ? 31.417  26.144  8.630   1.00   17.49 ? 239  SER A O   1 
ATOM   993   C  CB  . SER A  1 132 ? 32.528  27.270  5.656   1.00   16.42 ? 239  SER A CB  1 
ATOM   994   O  OG  . SER A  1 132 ? 33.540  28.023  5.006   1.00   16.03 ? 239  SER A OG  1 
ATOM   995   N  N   . LEU A  1 133 ? 31.638  24.644  6.971   1.00   16.67 ? 240  LEU A N   1 
ATOM   996   C  CA  . LEU A  1 133 ? 30.620  23.741  7.498   1.00   17.15 ? 240  LEU A CA  1 
ATOM   997   C  C   . LEU A  1 133 ? 31.027  23.182  8.855   1.00   18.59 ? 240  LEU A C   1 
ATOM   998   O  O   . LEU A  1 133 ? 30.169  22.874  9.691   1.00   17.70 ? 240  LEU A O   1 
ATOM   999   C  CB  . LEU A  1 133 ? 30.381  22.586  6.523   1.00   16.81 ? 240  LEU A CB  1 
ATOM   1000  C  CG  . LEU A  1 133 ? 29.747  23.002  5.193   1.00   16.67 ? 240  LEU A CG  1 
ATOM   1001  C  CD1 . LEU A  1 133 ? 29.873  21.869  4.191   1.00   15.76 ? 240  LEU A CD1 1 
ATOM   1002  C  CD2 . LEU A  1 133 ? 28.289  23.392  5.425   1.00   12.97 ? 240  LEU A CD2 1 
ATOM   1003  N  N   . GLY A  1 134 ? 32.335  23.075  9.077   1.00   17.28 ? 241  GLY A N   1 
ATOM   1004  C  CA  . GLY A  1 134 ? 32.829  22.529  10.329  1.00   17.07 ? 241  GLY A CA  1 
ATOM   1005  C  C   . GLY A  1 134 ? 33.311  23.559  11.340  1.00   19.83 ? 241  GLY A C   1 
ATOM   1006  O  O   . GLY A  1 134 ? 34.008  23.219  12.291  1.00   19.80 ? 241  GLY A O   1 
ATOM   1007  N  N   . LEU A  1 135 ? 32.943  24.817  11.150  1.00   16.09 ? 242  LEU A N   1 
ATOM   1008  C  CA  . LEU A  1 135 ? 33.364  25.850  12.080  1.00   17.92 ? 242  LEU A CA  1 
ATOM   1009  C  C   . LEU A  1 135 ? 32.682  25.702  13.434  1.00   18.81 ? 242  LEU A C   1 
ATOM   1010  O  O   . LEU A  1 135 ? 31.463  25.588  13.500  1.00   19.53 ? 242  LEU A O   1 
ATOM   1011  C  CB  . LEU A  1 135 ? 33.036  27.237  11.509  1.00   16.18 ? 242  LEU A CB  1 
ATOM   1012  C  CG  . LEU A  1 135 ? 33.342  28.430  12.425  1.00   16.05 ? 242  LEU A CG  1 
ATOM   1013  C  CD1 . LEU A  1 135 ? 34.838  28.517  12.633  1.00   16.99 ? 242  LEU A CD1 1 
ATOM   1014  C  CD2 . LEU A  1 135 ? 32.831  29.739  11.806  1.00   15.77 ? 242  LEU A CD2 1 
ATOM   1015  N  N   . ASN A  1 136 ? 33.469  25.680  14.507  1.00   19.37 ? 243  ASN A N   1 
ATOM   1016  C  CA  . ASN A  1 136 ? 32.924  25.626  15.871  1.00   20.70 ? 243  ASN A CA  1 
ATOM   1017  C  C   . ASN A  1 136 ? 31.626  24.828  16.025  1.00   20.05 ? 243  ASN A C   1 
ATOM   1018  O  O   . ASN A  1 136 ? 30.620  25.370  16.486  1.00   22.20 ? 243  ASN A O   1 
ATOM   1019  C  CB  . ASN A  1 136 ? 32.641  27.052  16.326  1.00   23.87 ? 243  ASN A CB  1 
ATOM   1020  C  CG  . ASN A  1 136 ? 33.259  27.382  17.650  1.00   29.14 ? 243  ASN A CG  1 
ATOM   1021  O  OD1 . ASN A  1 136 ? 33.747  26.505  18.368  1.00   32.19 ? 243  ASN A OD1 1 
ATOM   1022  N  ND2 . ASN A  1 136 ? 33.232  28.665  18.000  1.00   31.01 ? 243  ASN A ND2 1 
ATOM   1023  N  N   . PRO A  1 137 ? 31.637  23.536  15.677  1.00   19.20 ? 244  PRO A N   1 
ATOM   1024  C  CA  . PRO A  1 137 ? 30.458  22.661  15.766  1.00   19.05 ? 244  PRO A CA  1 
ATOM   1025  C  C   . PRO A  1 137 ? 29.807  22.569  17.147  1.00   20.33 ? 244  PRO A C   1 
ATOM   1026  O  O   . PRO A  1 137 ? 28.648  22.163  17.266  1.00   21.23 ? 244  PRO A O   1 
ATOM   1027  C  CB  . PRO A  1 137 ? 30.990  21.306  15.312  1.00   21.70 ? 244  PRO A CB  1 
ATOM   1028  C  CG  . PRO A  1 137 ? 32.190  21.645  14.483  1.00   24.56 ? 244  PRO A CG  1 
ATOM   1029  C  CD  . PRO A  1 137 ? 32.822  22.776  15.256  1.00   20.62 ? 244  PRO A CD  1 
ATOM   1030  N  N   . ASN A  1 138 ? 30.542  22.926  18.195  1.00   20.13 ? 245  ASN A N   1 
ATOM   1031  C  CA  . ASN A  1 138 ? 29.961  22.856  19.526  1.00   24.68 ? 245  ASN A CA  1 
ATOM   1032  C  C   . ASN A  1 138 ? 29.504  24.186  20.050  1.00   21.93 ? 245  ASN A C   1 
ATOM   1033  O  O   . ASN A  1 138 ? 29.055  24.272  21.184  1.00   23.80 ? 245  ASN A O   1 
ATOM   1034  C  CB  . ASN A  1 138 ? 30.927  22.218  20.509  1.00   28.99 ? 245  ASN A CB  1 
ATOM   1035  C  CG  . ASN A  1 138 ? 31.171  20.766  20.193  1.00   37.83 ? 245  ASN A CG  1 
ATOM   1036  O  OD1 . ASN A  1 138 ? 30.226  19.960  20.117  1.00   39.23 ? 245  ASN A OD1 1 
ATOM   1037  N  ND2 . ASN A  1 138 ? 32.436  20.416  19.986  1.00   39.11 ? 245  ASN A ND2 1 
ATOM   1038  N  N   . HIS A  1 139 ? 29.626  25.225  19.231  1.00   21.29 ? 246  HIS A N   1 
ATOM   1039  C  CA  . HIS A  1 139 ? 29.152  26.553  19.628  1.00   19.41 ? 246  HIS A CA  1 
ATOM   1040  C  C   . HIS A  1 139 ? 27.980  26.939  18.719  1.00   19.53 ? 246  HIS A C   1 
ATOM   1041  O  O   . HIS A  1 139 ? 26.935  27.381  19.190  1.00   19.94 ? 246  HIS A O   1 
ATOM   1042  C  CB  . HIS A  1 139 ? 30.265  27.589  19.506  1.00   17.81 ? 246  HIS A CB  1 
ATOM   1043  C  CG  . HIS A  1 139 ? 29.818  28.978  19.828  1.00   20.39 ? 246  HIS A CG  1 
ATOM   1044  N  ND1 . HIS A  1 139 ? 29.407  29.352  21.089  1.00   20.35 ? 246  HIS A ND1 1 
ATOM   1045  C  CD2 . HIS A  1 139 ? 29.661  30.070  19.042  1.00   19.79 ? 246  HIS A CD2 1 
ATOM   1046  C  CE1 . HIS A  1 139 ? 29.015  30.614  21.068  1.00   21.59 ? 246  HIS A CE1 1 
ATOM   1047  N  NE2 . HIS A  1 139 ? 29.159  31.072  19.838  1.00   20.85 ? 246  HIS A NE2 1 
ATOM   1048  N  N   . ILE A  1 140 ? 28.165  26.748  17.411  1.00   19.52 ? 247  ILE A N   1 
ATOM   1049  C  CA  . ILE A  1 140 ? 27.144  27.057  16.408  1.00   17.52 ? 247  ILE A CA  1 
ATOM   1050  C  C   . ILE A  1 140 ? 26.101  25.937  16.360  1.00   19.52 ? 247  ILE A C   1 
ATOM   1051  O  O   . ILE A  1 140 ? 26.451  24.755  16.324  1.00   18.49 ? 247  ILE A O   1 
ATOM   1052  C  CB  . ILE A  1 140 ? 27.777  27.188  15.004  1.00   15.61 ? 247  ILE A CB  1 
ATOM   1053  C  CG1 . ILE A  1 140 ? 28.801  28.326  15.004  1.00   15.59 ? 247  ILE A CG1 1 
ATOM   1054  C  CG2 . ILE A  1 140 ? 26.680  27.386  13.940  1.00   12.55 ? 247  ILE A CG2 1 
ATOM   1055  C  CD1 . ILE A  1 140 ? 29.566  28.483  13.707  1.00   13.38 ? 247  ILE A CD1 1 
ATOM   1056  N  N   . HIS A  1 141 ? 24.823  26.299  16.348  1.00   18.37 ? 248  HIS A N   1 
ATOM   1057  C  CA  . HIS A  1 141 ? 23.772  25.290  16.297  1.00   18.82 ? 248  HIS A CA  1 
ATOM   1058  C  C   . HIS A  1 141 ? 23.263  25.067  14.891  1.00   18.10 ? 248  HIS A C   1 
ATOM   1059  O  O   . HIS A  1 141 ? 23.062  23.932  14.469  1.00   20.78 ? 248  HIS A O   1 
ATOM   1060  C  CB  . HIS A  1 141 ? 22.588  25.694  17.179  1.00   19.30 ? 248  HIS A CB  1 
ATOM   1061  C  CG  . HIS A  1 141 ? 22.967  25.938  18.602  1.00   24.40 ? 248  HIS A CG  1 
ATOM   1062  N  ND1 . HIS A  1 141 ? 22.827  27.165  19.210  1.00   24.41 ? 248  HIS A ND1 1 
ATOM   1063  C  CD2 . HIS A  1 141 ? 23.534  25.123  19.525  1.00   26.34 ? 248  HIS A CD2 1 
ATOM   1064  C  CE1 . HIS A  1 141 ? 23.290  27.097  20.444  1.00   23.85 ? 248  HIS A CE1 1 
ATOM   1065  N  NE2 . HIS A  1 141 ? 23.726  25.869  20.660  1.00   23.55 ? 248  HIS A NE2 1 
ATOM   1066  N  N   . ILE A  1 142 ? 23.076  26.161  14.165  1.00   18.10 ? 249  ILE A N   1 
ATOM   1067  C  CA  . ILE A  1 142 ? 22.525  26.109  12.827  1.00   16.95 ? 249  ILE A CA  1 
ATOM   1068  C  C   . ILE A  1 142 ? 23.383  26.818  11.785  1.00   20.35 ? 249  ILE A C   1 
ATOM   1069  O  O   . ILE A  1 142 ? 23.861  27.937  12.006  1.00   21.31 ? 249  ILE A O   1 
ATOM   1070  C  CB  . ILE A  1 142 ? 21.137  26.745  12.838  1.00   17.90 ? 249  ILE A CB  1 
ATOM   1071  C  CG1 . ILE A  1 142 ? 20.231  25.954  13.786  1.00   18.08 ? 249  ILE A CG1 1 
ATOM   1072  C  CG2 . ILE A  1 142 ? 20.550  26.778  11.423  1.00   15.97 ? 249  ILE A CG2 1 
ATOM   1073  C  CD1 . ILE A  1 142 ? 19.032  26.746  14.268  1.00   18.79 ? 249  ILE A CD1 1 
ATOM   1074  N  N   . TYR A  1 143 ? 23.574  26.159  10.649  1.00   17.98 ? 250  TYR A N   1 
ATOM   1075  C  CA  . TYR A  1 143 ? 24.351  26.719  9.556   1.00   18.81 ? 250  TYR A CA  1 
ATOM   1076  C  C   . TYR A  1 143 ? 23.377  26.974  8.417   1.00   20.35 ? 250  TYR A C   1 
ATOM   1077  O  O   . TYR A  1 143 ? 22.578  26.101  8.081   1.00   20.85 ? 250  TYR A O   1 
ATOM   1078  C  CB  . TYR A  1 143 ? 25.417  25.732  9.075   1.00   18.72 ? 250  TYR A CB  1 
ATOM   1079  C  CG  . TYR A  1 143 ? 26.425  25.328  10.120  1.00   20.10 ? 250  TYR A CG  1 
ATOM   1080  C  CD1 . TYR A  1 143 ? 26.102  24.402  11.101  1.00   20.89 ? 250  TYR A CD1 1 
ATOM   1081  C  CD2 . TYR A  1 143 ? 27.704  25.889  10.136  1.00   19.23 ? 250  TYR A CD2 1 
ATOM   1082  C  CE1 . TYR A  1 143 ? 27.028  24.042  12.077  1.00   22.35 ? 250  TYR A CE1 1 
ATOM   1083  C  CE2 . TYR A  1 143 ? 28.638  25.537  11.109  1.00   18.71 ? 250  TYR A CE2 1 
ATOM   1084  C  CZ  . TYR A  1 143 ? 28.291  24.613  12.078  1.00   21.25 ? 250  TYR A CZ  1 
ATOM   1085  O  OH  . TYR A  1 143 ? 29.188  24.260  13.058  1.00   17.71 ? 250  TYR A OH  1 
ATOM   1086  N  N   . SER A  1 144 ? 23.433  28.162  7.826   1.00   19.05 ? 251  SER A N   1 
ATOM   1087  C  CA  . SER A  1 144 ? 22.541  28.490  6.717   1.00   17.36 ? 251  SER A CA  1 
ATOM   1088  C  C   . SER A  1 144 ? 23.381  28.752  5.477   1.00   19.57 ? 251  SER A C   1 
ATOM   1089  O  O   . SER A  1 144 ? 24.333  29.544  5.510   1.00   17.18 ? 251  SER A O   1 
ATOM   1090  C  CB  . SER A  1 144 ? 21.712  29.728  7.048   1.00   17.75 ? 251  SER A CB  1 
ATOM   1091  O  OG  . SER A  1 144 ? 20.788  30.001  6.004   1.00   16.16 ? 251  SER A OG  1 
ATOM   1092  N  N   . ALA A  1 145 ? 23.030  28.098  4.376   1.00   17.22 ? 252  ALA A N   1 
ATOM   1093  C  CA  . ALA A  1 145 ? 23.795  28.274  3.151   1.00   17.47 ? 252  ALA A CA  1 
ATOM   1094  C  C   . ALA A  1 145 ? 22.926  28.601  1.947   1.00   18.11 ? 252  ALA A C   1 
ATOM   1095  O  O   . ALA A  1 145 ? 22.163  27.761  1.478   1.00   19.14 ? 252  ALA A O   1 
ATOM   1096  C  CB  . ALA A  1 145 ? 24.631  27.016  2.873   1.00   15.77 ? 252  ALA A CB  1 
ATOM   1097  N  N   . SER A  1 146 ? 23.057  29.827  1.450   1.00   16.32 ? 253  SER A N   1 
ATOM   1098  C  CA  . SER A  1 146 ? 22.300  30.264  0.288   1.00   19.07 ? 253  SER A CA  1 
ATOM   1099  C  C   . SER A  1 146 ? 23.222  30.305  -0.936  1.00   18.96 ? 253  SER A C   1 
ATOM   1100  O  O   . SER A  1 146 ? 23.403  31.345  -1.573  1.00   16.36 ? 253  SER A O   1 
ATOM   1101  C  CB  . SER A  1 146 ? 21.694  31.647  0.549   1.00   20.72 ? 253  SER A CB  1 
ATOM   1102  O  OG  . SER A  1 146 ? 20.733  31.575  1.593   1.00   22.94 ? 253  SER A OG  1 
ATOM   1103  N  N   . TRP A  1 147 ? 23.808  29.159  -1.254  1.00   17.23 ? 254  TRP A N   1 
ATOM   1104  C  CA  . TRP A  1 147 ? 24.716  29.049  -2.383  1.00   18.12 ? 254  TRP A CA  1 
ATOM   1105  C  C   . TRP A  1 147 ? 24.829  27.590  -2.748  1.00   18.08 ? 254  TRP A C   1 
ATOM   1106  O  O   . TRP A  1 147 ? 24.376  26.730  -1.999  1.00   18.52 ? 254  TRP A O   1 
ATOM   1107  C  CB  . TRP A  1 147 ? 26.114  29.593  -2.033  1.00   16.88 ? 254  TRP A CB  1 
ATOM   1108  C  CG  . TRP A  1 147 ? 26.705  29.020  -0.769  1.00   16.39 ? 254  TRP A CG  1 
ATOM   1109  C  CD1 . TRP A  1 147 ? 26.624  29.556  0.479   1.00   17.63 ? 254  TRP A CD1 1 
ATOM   1110  C  CD2 . TRP A  1 147 ? 27.460  27.801  -0.634  1.00   13.47 ? 254  TRP A CD2 1 
ATOM   1111  N  NE1 . TRP A  1 147 ? 27.284  28.754  1.388   1.00   17.48 ? 254  TRP A NE1 1 
ATOM   1112  C  CE2 . TRP A  1 147 ? 27.802  27.669  0.732   1.00   15.83 ? 254  TRP A CE2 1 
ATOM   1113  C  CE3 . TRP A  1 147 ? 27.881  26.814  -1.532  1.00   12.93 ? 254  TRP A CE3 1 
ATOM   1114  C  CZ2 . TRP A  1 147 ? 28.545  26.584  1.223   1.00   13.05 ? 254  TRP A CZ2 1 
ATOM   1115  C  CZ3 . TRP A  1 147 ? 28.629  25.731  -1.043  1.00   13.84 ? 254  TRP A CZ3 1 
ATOM   1116  C  CH2 . TRP A  1 147 ? 28.949  25.628  0.321   1.00   14.74 ? 254  TRP A CH2 1 
ATOM   1117  N  N   . GLY A  1 148 ? 25.423  27.311  -3.902  1.00   17.33 ? 255  GLY A N   1 
ATOM   1118  C  CA  . GLY A  1 148 ? 25.589  25.931  -4.314  1.00   16.75 ? 255  GLY A CA  1 
ATOM   1119  C  C   . GLY A  1 148 ? 26.151  25.842  -5.715  1.00   17.45 ? 255  GLY A C   1 
ATOM   1120  O  O   . GLY A  1 148 ? 26.646  26.834  -6.252  1.00   18.24 ? 255  GLY A O   1 
ATOM   1121  N  N   . PRO A  1 149 ? 26.095  24.660  -6.336  1.00   17.68 ? 256  PRO A N   1 
ATOM   1122  C  CA  . PRO A  1 149 ? 26.607  24.468  -7.696  1.00   19.20 ? 256  PRO A CA  1 
ATOM   1123  C  C   . PRO A  1 149 ? 25.828  25.344  -8.672  1.00   18.97 ? 256  PRO A C   1 
ATOM   1124  O  O   . PRO A  1 149 ? 24.703  25.742  -8.394  1.00   20.77 ? 256  PRO A O   1 
ATOM   1125  C  CB  . PRO A  1 149 ? 26.365  22.976  -7.958  1.00   18.47 ? 256  PRO A CB  1 
ATOM   1126  C  CG  . PRO A  1 149 ? 26.368  22.378  -6.586  1.00   21.75 ? 256  PRO A CG  1 
ATOM   1127  C  CD  . PRO A  1 149 ? 25.617  23.390  -5.768  1.00   15.70 ? 256  PRO A CD  1 
ATOM   1128  N  N   . GLU A  1 150 ? 26.427  25.628  -9.822  1.00   22.51 ? 257  GLU A N   1 
ATOM   1129  C  CA  . GLU A  1 150 ? 25.797  26.453  -10.833 1.00   22.98 ? 257  GLU A CA  1 
ATOM   1130  C  C   . GLU A  1 150 ? 24.434  25.908  -11.285 1.00   24.74 ? 257  GLU A C   1 
ATOM   1131  O  O   . GLU A  1 150 ? 24.249  24.693  -11.427 1.00   24.22 ? 257  GLU A O   1 
ATOM   1132  C  CB  . GLU A  1 150 ? 26.733  26.595  -12.024 1.00   26.43 ? 257  GLU A CB  1 
ATOM   1133  C  CG  . GLU A  1 150 ? 26.249  27.650  -13.001 1.00   39.38 ? 257  GLU A CG  1 
ATOM   1134  C  CD  . GLU A  1 150 ? 27.289  28.031  -14.030 1.00   44.13 ? 257  GLU A CD  1 
ATOM   1135  O  OE1 . GLU A  1 150 ? 26.973  28.881  -14.896 1.00   46.00 ? 257  GLU A OE1 1 
ATOM   1136  O  OE2 . GLU A  1 150 ? 28.414  27.484  -13.968 1.00   47.18 ? 257  GLU A OE2 1 
ATOM   1137  N  N   . ASP A  1 151 ? 23.481  26.810  -11.505 1.00   20.42 ? 258  ASP A N   1 
ATOM   1138  C  CA  . ASP A  1 151 ? 22.137  26.421  -11.918 1.00   22.05 ? 258  ASP A CA  1 
ATOM   1139  C  C   . ASP A  1 151 ? 21.928  26.542  -13.433 1.00   23.63 ? 258  ASP A C   1 
ATOM   1140  O  O   . ASP A  1 151 ? 20.927  27.108  -13.884 1.00   20.89 ? 258  ASP A O   1 
ATOM   1141  C  CB  . ASP A  1 151 ? 21.094  27.294  -11.207 1.00   17.27 ? 258  ASP A CB  1 
ATOM   1142  C  CG  . ASP A  1 151 ? 21.094  27.106  -9.705  1.00   19.03 ? 258  ASP A CG  1 
ATOM   1143  O  OD1 . ASP A  1 151 ? 21.205  25.949  -9.245  1.00   14.37 ? 258  ASP A OD1 1 
ATOM   1144  O  OD2 . ASP A  1 151 ? 20.956  28.116  -8.988  1.00   16.66 ? 258  ASP A OD2 1 
ATOM   1145  N  N   . ASP A  1 152 ? 22.854  26.014  -14.222 1.00   22.72 ? 259  ASP A N   1 
ATOM   1146  C  CA  . ASP A  1 152 ? 22.702  26.119  -15.670 1.00   22.38 ? 259  ASP A CA  1 
ATOM   1147  C  C   . ASP A  1 152 ? 21.793  25.042  -16.222 1.00   24.05 ? 259  ASP A C   1 
ATOM   1148  O  O   . ASP A  1 152 ? 21.483  25.045  -17.406 1.00   24.82 ? 259  ASP A O   1 
ATOM   1149  C  CB  . ASP A  1 152 ? 24.057  26.056  -16.370 1.00   19.86 ? 259  ASP A CB  1 
ATOM   1150  C  CG  . ASP A  1 152 ? 24.877  24.821  -15.975 1.00   25.45 ? 259  ASP A CG  1 
ATOM   1151  O  OD1 . ASP A  1 152 ? 24.345  23.886  -15.326 1.00   25.14 ? 259  ASP A OD1 1 
ATOM   1152  O  OD2 . ASP A  1 152 ? 26.070  24.785  -16.334 1.00   28.65 ? 259  ASP A OD2 1 
ATOM   1153  N  N   . GLY A  1 153 ? 21.366  24.120  -15.362 1.00   23.84 ? 260  GLY A N   1 
ATOM   1154  C  CA  . GLY A  1 153 ? 20.475  23.066  -15.809 1.00   24.16 ? 260  GLY A CA  1 
ATOM   1155  C  C   . GLY A  1 153 ? 21.174  21.951  -16.562 1.00   24.97 ? 260  GLY A C   1 
ATOM   1156  O  O   . GLY A  1 153 ? 20.534  21.155  -17.252 1.00   25.62 ? 260  GLY A O   1 
ATOM   1157  N  N   . LYS A  1 154 ? 22.492  21.886  -16.446 1.00   24.96 ? 261  LYS A N   1 
ATOM   1158  C  CA  . LYS A  1 154 ? 23.214  20.829  -17.125 1.00   28.61 ? 261  LYS A CA  1 
ATOM   1159  C  C   . LYS A  1 154 ? 24.350  20.274  -16.284 1.00   27.68 ? 261  LYS A C   1 
ATOM   1160  O  O   . LYS A  1 154 ? 25.090  19.406  -16.730 1.00   28.86 ? 261  LYS A O   1 
ATOM   1161  C  CB  . LYS A  1 154 ? 23.726  21.307  -18.486 1.00   27.69 ? 261  LYS A CB  1 
ATOM   1162  C  CG  . LYS A  1 154 ? 24.551  22.556  -18.444 1.00   33.58 ? 261  LYS A CG  1 
ATOM   1163  C  CD  . LYS A  1 154 ? 25.055  22.913  -19.830 1.00   37.18 ? 261  LYS A CD  1 
ATOM   1164  C  CE  . LYS A  1 154 ? 25.996  24.099  -19.767 1.00   40.69 ? 261  LYS A CE  1 
ATOM   1165  N  NZ  . LYS A  1 154 ? 27.139  23.853  -18.844 0.0000 39.31 ? 261  LYS A NZ  1 
ATOM   1166  N  N   . THR A  1 155 ? 24.479  20.748  -15.052 1.00   28.15 ? 262  THR A N   1 
ATOM   1167  C  CA  . THR A  1 155 ? 25.542  20.230  -14.217 1.00   27.31 ? 262  THR A CA  1 
ATOM   1168  C  C   . THR A  1 155 ? 25.021  19.299  -13.130 1.00   25.58 ? 262  THR A C   1 
ATOM   1169  O  O   . THR A  1 155 ? 23.884  19.401  -12.687 1.00   27.05 ? 262  THR A O   1 
ATOM   1170  C  CB  . THR A  1 155 ? 26.363  21.362  -13.539 1.00   26.99 ? 262  THR A CB  1 
ATOM   1171  O  OG1 . THR A  1 155 ? 25.750  21.728  -12.306 1.00   29.89 ? 262  THR A OG1 1 
ATOM   1172  C  CG2 . THR A  1 155 ? 26.440  22.573  -14.415 1.00   24.42 ? 262  THR A CG2 1 
ATOM   1173  N  N   . VAL A  1 156 ? 25.870  18.363  -12.735 1.00   24.98 ? 263  VAL A N   1 
ATOM   1174  C  CA  . VAL A  1 156 ? 25.572  17.421  -11.666 1.00   24.62 ? 263  VAL A CA  1 
ATOM   1175  C  C   . VAL A  1 156 ? 26.804  17.619  -10.807 1.00   25.47 ? 263  VAL A C   1 
ATOM   1176  O  O   . VAL A  1 156 ? 27.927  17.326  -11.234 1.00   22.61 ? 263  VAL A O   1 
ATOM   1177  C  CB  . VAL A  1 156 ? 25.504  15.967  -12.166 1.00   24.80 ? 263  VAL A CB  1 
ATOM   1178  C  CG1 . VAL A  1 156 ? 25.323  15.032  -10.987 1.00   24.07 ? 263  VAL A CG1 1 
ATOM   1179  C  CG2 . VAL A  1 156 ? 24.349  15.813  -13.155 1.00   24.22 ? 263  VAL A CG2 1 
ATOM   1180  N  N   . ASP A  1 157 ? 26.602  18.140  -9.602  1.00   24.18 ? 264  ASP A N   1 
ATOM   1181  C  CA  . ASP A  1 157 ? 27.731  18.444  -8.737  1.00   21.91 ? 264  ASP A CA  1 
ATOM   1182  C  C   . ASP A  1 157 ? 27.263  18.413  -7.286  1.00   20.66 ? 264  ASP A C   1 
ATOM   1183  O  O   . ASP A  1 157 ? 26.070  18.542  -6.998  1.00   18.85 ? 264  ASP A O   1 
ATOM   1184  C  CB  . ASP A  1 157 ? 28.273  19.838  -9.123  1.00   20.84 ? 264  ASP A CB  1 
ATOM   1185  C  CG  . ASP A  1 157 ? 29.662  20.142  -8.550  1.00   24.45 ? 264  ASP A CG  1 
ATOM   1186  O  OD1 . ASP A  1 157 ? 30.320  19.238  -7.990  1.00   25.67 ? 264  ASP A OD1 1 
ATOM   1187  O  OD2 . ASP A  1 157 ? 30.105  21.309  -8.682  1.00   21.61 ? 264  ASP A OD2 1 
ATOM   1188  N  N   . GLY A  1 158 ? 28.215  18.224  -6.385  1.00   19.13 ? 265  GLY A N   1 
ATOM   1189  C  CA  . GLY A  1 158 ? 27.917  18.158  -4.974  1.00   20.51 ? 265  GLY A CA  1 
ATOM   1190  C  C   . GLY A  1 158 ? 29.192  18.341  -4.175  1.00   21.78 ? 265  GLY A C   1 
ATOM   1191  O  O   . GLY A  1 158 ? 30.244  18.628  -4.753  1.00   21.44 ? 265  GLY A O   1 
ATOM   1192  N  N   . PRO A  1 159 ? 29.143  18.162  -2.843  1.00   19.41 ? 266  PRO A N   1 
ATOM   1193  C  CA  . PRO A  1 159 ? 30.337  18.330  -2.012  1.00   16.53 ? 266  PRO A CA  1 
ATOM   1194  C  C   . PRO A  1 159 ? 31.453  17.328  -2.298  1.00   15.18 ? 266  PRO A C   1 
ATOM   1195  O  O   . PRO A  1 159 ? 31.190  16.153  -2.554  1.00   15.18 ? 266  PRO A O   1 
ATOM   1196  C  CB  . PRO A  1 159 ? 29.788  18.177  -0.593  1.00   12.12 ? 266  PRO A CB  1 
ATOM   1197  C  CG  . PRO A  1 159 ? 28.686  17.194  -0.773  1.00   12.46 ? 266  PRO A CG  1 
ATOM   1198  C  CD  . PRO A  1 159 ? 27.999  17.725  -2.023  1.00   16.85 ? 266  PRO A CD  1 
ATOM   1199  N  N   . ALA A  1 160 ? 32.694  17.804  -2.257  1.00   15.38 ? 267  ALA A N   1 
ATOM   1200  C  CA  . ALA A  1 160 ? 33.855  16.940  -2.451  1.00   12.19 ? 267  ALA A CA  1 
ATOM   1201  C  C   . ALA A  1 160 ? 34.095  16.262  -1.090  1.00   15.81 ? 267  ALA A C   1 
ATOM   1202  O  O   . ALA A  1 160 ? 33.363  16.515  -0.129  1.00   15.05 ? 267  ALA A O   1 
ATOM   1203  C  CB  . ALA A  1 160 ? 35.071  17.768  -2.878  1.00   14.13 ? 267  ALA A CB  1 
ATOM   1204  N  N   . ARG A  1 161 ? 35.125  15.428  -0.992  1.00   15.60 ? 268  ARG A N   1 
ATOM   1205  C  CA  . ARG A  1 161 ? 35.365  14.658  0.223   1.00   19.34 ? 268  ARG A CA  1 
ATOM   1206  C  C   . ARG A  1 161 ? 35.433  15.367  1.569   1.00   19.06 ? 268  ARG A C   1 
ATOM   1207  O  O   . ARG A  1 161 ? 34.791  14.926  2.522   1.00   20.40 ? 268  ARG A O   1 
ATOM   1208  C  CB  . ARG A  1 161 ? 36.597  13.772  0.024   1.00   24.18 ? 268  ARG A CB  1 
ATOM   1209  C  CG  . ARG A  1 161 ? 36.403  12.772  -1.129  1.00   35.73 ? 268  ARG A CG  1 
ATOM   1210  C  CD  . ARG A  1 161 ? 37.708  12.103  -1.597  1.00   42.84 ? 268  ARG A CD  1 
ATOM   1211  N  NE  . ARG A  1 161 ? 37.473  11.084  -2.625  1.00   49.55 ? 268  ARG A NE  1 
ATOM   1212  C  CZ  . ARG A  1 161 ? 36.707  10.002  -2.456  1.00   52.66 ? 268  ARG A CZ  1 
ATOM   1213  N  NH1 . ARG A  1 161 ? 36.088  9.785   -1.299  1.00   52.36 ? 268  ARG A NH1 1 
ATOM   1214  N  NH2 . ARG A  1 161 ? 36.566  9.123   -3.441  1.00   52.64 ? 268  ARG A NH2 1 
ATOM   1215  N  N   . LEU A  1 162 ? 36.196  16.453  1.662   1.00   18.15 ? 269  LEU A N   1 
ATOM   1216  C  CA  . LEU A  1 162 ? 36.304  17.165  2.934   1.00   17.89 ? 269  LEU A CA  1 
ATOM   1217  C  C   . LEU A  1 162 ? 34.968  17.750  3.362   1.00   16.34 ? 269  LEU A C   1 
ATOM   1218  O  O   . LEU A  1 162 ? 34.614  17.684  4.538   1.00   18.11 ? 269  LEU A O   1 
ATOM   1219  C  CB  . LEU A  1 162 ? 37.371  18.270  2.854   1.00   14.89 ? 269  LEU A CB  1 
ATOM   1220  C  CG  . LEU A  1 162 ? 38.829  17.788  2.713   1.00   18.77 ? 269  LEU A CG  1 
ATOM   1221  C  CD1 . LEU A  1 162 ? 39.764  18.985  2.573   1.00   15.75 ? 269  LEU A CD1 1 
ATOM   1222  C  CD2 . LEU A  1 162 ? 39.220  16.933  3.932   1.00   12.81 ? 269  LEU A CD2 1 
ATOM   1223  N  N   . ALA A  1 163 ? 34.224  18.323  2.416   1.00   18.56 ? 270  ALA A N   1 
ATOM   1224  C  CA  . ALA A  1 163 ? 32.910  18.888  2.742   1.00   21.88 ? 270  ALA A CA  1 
ATOM   1225  C  C   . ALA A  1 163 ? 31.965  17.774  3.200   1.00   19.96 ? 270  ALA A C   1 
ATOM   1226  O  O   . ALA A  1 163 ? 31.204  17.954  4.149   1.00   22.89 ? 270  ALA A O   1 
ATOM   1227  C  CB  . ALA A  1 163 ? 32.318  19.635  1.531   1.00   18.81 ? 270  ALA A CB  1 
ATOM   1228  N  N   . GLU A  1 164 ? 32.021  16.622  2.541   1.00   20.09 ? 271  GLU A N   1 
ATOM   1229  C  CA  . GLU A  1 164 ? 31.172  15.499  2.931   1.00   21.59 ? 271  GLU A CA  1 
ATOM   1230  C  C   . GLU A  1 164 ? 31.514  15.102  4.350   1.00   20.11 ? 271  GLU A C   1 
ATOM   1231  O  O   . GLU A  1 164 ? 30.630  14.863  5.166   1.00   19.36 ? 271  GLU A O   1 
ATOM   1232  C  CB  . GLU A  1 164 ? 31.408  14.270  2.055   1.00   27.84 ? 271  GLU A CB  1 
ATOM   1233  C  CG  . GLU A  1 164 ? 30.941  14.361  0.629   1.00   34.84 ? 271  GLU A CG  1 
ATOM   1234  C  CD  . GLU A  1 164 ? 30.974  12.994  -0.039  1.00   40.52 ? 271  GLU A CD  1 
ATOM   1235  O  OE1 . GLU A  1 164 ? 30.099  12.161  0.283   1.00   42.80 ? 271  GLU A OE1 1 
ATOM   1236  O  OE2 . GLU A  1 164 ? 31.882  12.747  -0.868  1.00   43.01 ? 271  GLU A OE2 1 
ATOM   1237  N  N   . GLU A  1 165 ? 32.808  14.995  4.636   1.00   18.24 ? 272  GLU A N   1 
ATOM   1238  C  CA  . GLU A  1 165 ? 33.231  14.623  5.978   1.00   17.67 ? 272  GLU A CA  1 
ATOM   1239  C  C   . GLU A  1 165 ? 32.767  15.660  6.991   1.00   16.99 ? 272  GLU A C   1 
ATOM   1240  O  O   . GLU A  1 165 ? 32.405  15.322  8.118   1.00   16.94 ? 272  GLU A O   1 
ATOM   1241  C  CB  . GLU A  1 165 ? 34.751  14.456  6.037   1.00   17.26 ? 272  GLU A CB  1 
ATOM   1242  C  CG  . GLU A  1 165 ? 35.222  13.170  5.368   1.00   19.42 ? 272  GLU A CG  1 
ATOM   1243  C  CD  . GLU A  1 165 ? 36.734  13.048  5.316   1.00   21.24 ? 272  GLU A CD  1 
ATOM   1244  O  OE1 . GLU A  1 165 ? 37.231  11.938  5.050   1.00   21.10 ? 272  GLU A OE1 1 
ATOM   1245  O  OE2 . GLU A  1 165 ? 37.427  14.062  5.528   1.00   21.32 ? 272  GLU A OE2 1 
ATOM   1246  N  N   . ALA A  1 166 ? 32.764  16.927  6.592   1.00   15.95 ? 273  ALA A N   1 
ATOM   1247  C  CA  . ALA A  1 166 ? 32.321  17.977  7.507   1.00   15.83 ? 273  ALA A CA  1 
ATOM   1248  C  C   . ALA A  1 166 ? 30.839  17.777  7.822   1.00   17.33 ? 273  ALA A C   1 
ATOM   1249  O  O   . ALA A  1 166 ? 30.419  17.917  8.971   1.00   16.32 ? 273  ALA A O   1 
ATOM   1250  C  CB  . ALA A  1 166 ? 32.543  19.345  6.887   1.00   15.25 ? 273  ALA A CB  1 
ATOM   1251  N  N   . PHE A  1 167 ? 30.049  17.447  6.801   1.00   16.74 ? 274  PHE A N   1 
ATOM   1252  C  CA  . PHE A  1 167 ? 28.623  17.219  7.009   1.00   18.33 ? 274  PHE A CA  1 
ATOM   1253  C  C   . PHE A  1 167 ? 28.423  16.059  7.982   1.00   19.09 ? 274  PHE A C   1 
ATOM   1254  O  O   . PHE A  1 167 ? 27.648  16.167  8.942   1.00   18.28 ? 274  PHE A O   1 
ATOM   1255  C  CB  . PHE A  1 167 ? 27.913  16.880  5.689   1.00   15.66 ? 274  PHE A CB  1 
ATOM   1256  C  CG  . PHE A  1 167 ? 27.495  18.085  4.883   1.00   18.39 ? 274  PHE A CG  1 
ATOM   1257  C  CD1 . PHE A  1 167 ? 26.716  19.092  5.456   1.00   17.23 ? 274  PHE A CD1 1 
ATOM   1258  C  CD2 . PHE A  1 167 ? 27.811  18.174  3.529   1.00   16.72 ? 274  PHE A CD2 1 
ATOM   1259  C  CE1 . PHE A  1 167 ? 26.249  20.170  4.688   1.00   17.59 ? 274  PHE A CE1 1 
ATOM   1260  C  CE2 . PHE A  1 167 ? 27.348  19.249  2.748   1.00   17.72 ? 274  PHE A CE2 1 
ATOM   1261  C  CZ  . PHE A  1 167 ? 26.564  20.247  3.328   1.00   16.37 ? 274  PHE A CZ  1 
ATOM   1262  N  N   . PHE A  1 168 ? 29.123  14.955  7.724   1.00   15.65 ? 275  PHE A N   1 
ATOM   1263  C  CA  . PHE A  1 168 ? 29.005  13.753  8.538   1.00   18.70 ? 275  PHE A CA  1 
ATOM   1264  C  C   . PHE A  1 168 ? 29.449  13.998  9.980   1.00   16.09 ? 275  PHE A C   1 
ATOM   1265  O  O   . PHE A  1 168 ? 28.785  13.565  10.911  1.00   16.82 ? 275  PHE A O   1 
ATOM   1266  C  CB  . PHE A  1 168 ? 29.831  12.615  7.916   1.00   24.82 ? 275  PHE A CB  1 
ATOM   1267  C  CG  . PHE A  1 168 ? 29.139  11.280  7.911   1.00   33.22 ? 275  PHE A CG  1 
ATOM   1268  C  CD1 . PHE A  1 168 ? 28.362  10.871  8.986   1.00   36.71 ? 275  PHE A CD1 1 
ATOM   1269  C  CD2 . PHE A  1 168 ? 29.307  10.405  6.839   1.00   39.73 ? 275  PHE A CD2 1 
ATOM   1270  C  CE1 . PHE A  1 168 ? 27.760  9.607   9.001   1.00   39.50 ? 275  PHE A CE1 1 
ATOM   1271  C  CE2 . PHE A  1 168 ? 28.710  9.139   6.845   1.00   42.91 ? 275  PHE A CE2 1 
ATOM   1272  C  CZ  . PHE A  1 168 ? 27.936  8.741   7.932   1.00   41.21 ? 275  PHE A CZ  1 
ATOM   1273  N  N   . ARG A  1 169 ? 30.574  14.684  10.165  1.00   15.96 ? 276  ARG A N   1 
ATOM   1274  C  CA  . ARG A  1 169 ? 31.057  14.987  11.514  1.00   17.75 ? 276  ARG A CA  1 
ATOM   1275  C  C   . ARG A  1 169 ? 30.014  15.891  12.175  1.00   18.11 ? 276  ARG A C   1 
ATOM   1276  O  O   . ARG A  1 169 ? 29.731  15.769  13.363  1.00   16.91 ? 276  ARG A O   1 
ATOM   1277  C  CB  . ARG A  1 169 ? 32.396  15.747  11.491  1.00   15.52 ? 276  ARG A CB  1 
ATOM   1278  C  CG  . ARG A  1 169 ? 33.592  15.018  10.935  1.00   17.58 ? 276  ARG A CG  1 
ATOM   1279  C  CD  . ARG A  1 169 ? 34.817  15.951  10.913  1.00   17.79 ? 276  ARG A CD  1 
ATOM   1280  N  NE  . ARG A  1 169 ? 35.368  16.224  12.245  1.00   19.35 ? 276  ARG A NE  1 
ATOM   1281  C  CZ  . ARG A  1 169 ? 36.172  15.399  12.917  1.00   21.13 ? 276  ARG A CZ  1 
ATOM   1282  N  NH1 . ARG A  1 169 ? 36.613  15.737  14.126  1.00   18.78 ? 276  ARG A NH1 1 
ATOM   1283  N  NH2 . ARG A  1 169 ? 36.550  14.243  12.379  1.00   21.80 ? 276  ARG A NH2 1 
ATOM   1284  N  N   . GLY A  1 170 ? 29.463  16.811  11.393  1.00   15.88 ? 277  GLY A N   1 
ATOM   1285  C  CA  . GLY A  1 170 ? 28.469  17.722  11.914  1.00   17.37 ? 277  GLY A CA  1 
ATOM   1286  C  C   . GLY A  1 170 ? 27.228  17.058  12.494  1.00   17.60 ? 277  GLY A C   1 
ATOM   1287  O  O   . GLY A  1 170 ? 26.892  17.283  13.654  1.00   14.57 ? 277  GLY A O   1 
ATOM   1288  N  N   . VAL A  1 171 ? 26.544  16.237  11.706  1.00   15.87 ? 278  VAL A N   1 
ATOM   1289  C  CA  . VAL A  1 171 ? 25.341  15.575  12.208  1.00   20.27 ? 278  VAL A CA  1 
ATOM   1290  C  C   . VAL A  1 171 ? 25.652  14.527  13.277  1.00   21.50 ? 278  VAL A C   1 
ATOM   1291  O  O   . VAL A  1 171 ? 24.789  14.201  14.089  1.00   20.74 ? 278  VAL A O   1 
ATOM   1292  C  CB  . VAL A  1 171 ? 24.529  14.902  11.064  1.00   19.43 ? 278  VAL A CB  1 
ATOM   1293  C  CG1 . VAL A  1 171 ? 24.191  15.941  10.001  1.00   21.38 ? 278  VAL A CG1 1 
ATOM   1294  C  CG2 . VAL A  1 171 ? 25.316  13.738  10.445  1.00   13.64 ? 278  VAL A CG2 1 
ATOM   1295  N  N   . SER A  1 172 ? 26.882  14.017  13.285  1.00   21.24 ? 279  SER A N   1 
ATOM   1296  C  CA  . SER A  1 172 ? 27.281  12.996  14.261  1.00   22.87 ? 279  SER A CA  1 
ATOM   1297  C  C   . SER A  1 172 ? 27.729  13.561  15.593  1.00   21.80 ? 279  SER A C   1 
ATOM   1298  O  O   . SER A  1 172 ? 27.292  13.108  16.644  1.00   21.08 ? 279  SER A O   1 
ATOM   1299  C  CB  . SER A  1 172 ? 28.444  12.162  13.729  1.00   21.32 ? 279  SER A CB  1 
ATOM   1300  O  OG  . SER A  1 172 ? 28.115  11.553  12.507  1.00   32.89 ? 279  SER A OG  1 
ATOM   1301  N  N   . GLN A  1 173 ? 28.602  14.561  15.530  1.00   22.79 ? 280  GLN A N   1 
ATOM   1302  C  CA  . GLN A  1 173 ? 29.198  15.149  16.719  1.00   21.63 ? 280  GLN A CA  1 
ATOM   1303  C  C   . GLN A  1 173 ? 28.800  16.569  17.060  1.00   20.96 ? 280  GLN A C   1 
ATOM   1304  O  O   . GLN A  1 173 ? 28.881  16.964  18.219  1.00   19.94 ? 280  GLN A O   1 
ATOM   1305  C  CB  . GLN A  1 173 ? 30.716  15.053  16.597  1.00   23.07 ? 280  GLN A CB  1 
ATOM   1306  C  CG  . GLN A  1 173 ? 31.213  13.618  16.529  1.00   32.13 ? 280  GLN A CG  1 
ATOM   1307  C  CD  . GLN A  1 173 ? 32.238  13.380  15.425  1.00   39.14 ? 280  GLN A CD  1 
ATOM   1308  O  OE1 . GLN A  1 173 ? 33.212  14.133  15.285  1.00   42.01 ? 280  GLN A OE1 1 
ATOM   1309  N  NE2 . GLN A  1 173 ? 32.030  12.315  14.644  1.00   39.84 ? 280  GLN A NE2 1 
ATOM   1310  N  N   . GLY A  1 174 ? 28.366  17.341  16.071  1.00   19.91 ? 281  GLY A N   1 
ATOM   1311  C  CA  . GLY A  1 174 ? 27.967  18.712  16.345  1.00   19.31 ? 281  GLY A CA  1 
ATOM   1312  C  C   . GLY A  1 174 ? 26.927  18.826  17.447  1.00   19.63 ? 281  GLY A C   1 
ATOM   1313  O  O   . GLY A  1 174 ? 26.216  17.864  17.745  1.00   18.78 ? 281  GLY A O   1 
ATOM   1314  N  N   . ARG A  1 175 ? 26.830  20.008  18.052  1.00   21.17 ? 282  ARG A N   1 
ATOM   1315  C  CA  . ARG A  1 175 ? 25.871  20.258  19.130  1.00   23.46 ? 282  ARG A CA  1 
ATOM   1316  C  C   . ARG A  1 175 ? 25.901  19.159  20.185  1.00   24.53 ? 282  ARG A C   1 
ATOM   1317  O  O   . ARG A  1 175 ? 24.862  18.598  20.538  1.00   25.65 ? 282  ARG A O   1 
ATOM   1318  C  CB  . ARG A  1 175 ? 24.436  20.361  18.587  1.00   24.58 ? 282  ARG A CB  1 
ATOM   1319  C  CG  . ARG A  1 175 ? 24.123  21.559  17.719  1.00   25.95 ? 282  ARG A CG  1 
ATOM   1320  C  CD  . ARG A  1 175 ? 22.769  21.369  17.023  1.00   24.29 ? 282  ARG A CD  1 
ATOM   1321  N  NE  . ARG A  1 175 ? 21.707  21.279  18.001  1.00   23.91 ? 282  ARG A NE  1 
ATOM   1322  C  CZ  . ARG A  1 175 ? 20.661  20.460  17.934  1.00   21.94 ? 282  ARG A CZ  1 
ATOM   1323  N  NH1 . ARG A  1 175 ? 20.489  19.616  16.915  1.00   17.63 ? 282  ARG A NH1 1 
ATOM   1324  N  NH2 . ARG A  1 175 ? 19.785  20.482  18.925  1.00   21.78 ? 282  ARG A NH2 1 
ATOM   1325  N  N   . GLY A  1 176 ? 27.088  18.841  20.682  1.00   26.24 ? 283  GLY A N   1 
ATOM   1326  C  CA  . GLY A  1 176 ? 27.190  17.811  21.698  1.00   24.59 ? 283  GLY A CA  1 
ATOM   1327  C  C   . GLY A  1 176 ? 26.611  16.463  21.302  1.00   24.04 ? 283  GLY A C   1 
ATOM   1328  O  O   . GLY A  1 176 ? 26.104  15.733  22.153  1.00   25.43 ? 283  GLY A O   1 
ATOM   1329  N  N   . GLY A  1 177 ? 26.669  16.121  20.020  1.00   20.25 ? 284  GLY A N   1 
ATOM   1330  C  CA  . GLY A  1 177 ? 26.150  14.830  19.602  1.00   15.85 ? 284  GLY A CA  1 
ATOM   1331  C  C   . GLY A  1 177 ? 24.727  14.860  19.074  1.00   16.31 ? 284  GLY A C   1 
ATOM   1332  O  O   . GLY A  1 177 ? 24.256  13.878  18.504  1.00   18.79 ? 284  GLY A O   1 
ATOM   1333  N  N   . LEU A  1 178 ? 24.030  15.973  19.257  1.00   14.83 ? 285  LEU A N   1 
ATOM   1334  C  CA  . LEU A  1 178 ? 22.663  16.076  18.761  1.00   17.81 ? 285  LEU A CA  1 
ATOM   1335  C  C   . LEU A  1 178 ? 22.689  16.303  17.247  1.00   18.33 ? 285  LEU A C   1 
ATOM   1336  O  O   . LEU A  1 178 ? 21.715  16.005  16.548  1.00   18.51 ? 285  LEU A O   1 
ATOM   1337  C  CB  . LEU A  1 178 ? 21.920  17.223  19.459  1.00   19.06 ? 285  LEU A CB  1 
ATOM   1338  C  CG  . LEU A  1 178 ? 21.748  17.031  20.967  1.00   20.90 ? 285  LEU A CG  1 
ATOM   1339  C  CD1 . LEU A  1 178 ? 21.055  18.244  21.573  1.00   19.95 ? 285  LEU A CD1 1 
ATOM   1340  C  CD2 . LEU A  1 178 ? 20.944  15.766  21.226  1.00   19.22 ? 285  LEU A CD2 1 
ATOM   1341  N  N   . GLY A  1 179 ? 23.812  16.832  16.754  1.00   20.84 ? 286  GLY A N   1 
ATOM   1342  C  CA  . GLY A  1 179 ? 23.981  17.067  15.325  1.00   18.97 ? 286  GLY A CA  1 
ATOM   1343  C  C   . GLY A  1 179 ? 23.713  18.472  14.800  1.00   21.18 ? 286  GLY A C   1 
ATOM   1344  O  O   . GLY A  1 179 ? 22.642  19.037  15.031  1.00   21.76 ? 286  GLY A O   1 
ATOM   1345  N  N   . SER A  1 180 ? 24.691  19.035  14.093  1.00   19.04 ? 287  SER A N   1 
ATOM   1346  C  CA  . SER A  1 180 ? 24.561  20.361  13.484  1.00   18.24 ? 287  SER A CA  1 
ATOM   1347  C  C   . SER A  1 180 ? 23.336  20.394  12.563  1.00   17.74 ? 287  SER A C   1 
ATOM   1348  O  O   . SER A  1 180 ? 22.991  19.389  11.941  1.00   14.99 ? 287  SER A O   1 
ATOM   1349  C  CB  . SER A  1 180 ? 25.801  20.682  12.640  1.00   15.80 ? 287  SER A CB  1 
ATOM   1350  O  OG  . SER A  1 180 ? 26.980  20.730  13.425  1.00   18.84 ? 287  SER A OG  1 
ATOM   1351  N  N   . ILE A  1 181 ? 22.664  21.539  12.489  1.00   17.86 ? 288  ILE A N   1 
ATOM   1352  C  CA  . ILE A  1 181 ? 21.507  21.673  11.601  1.00   16.45 ? 288  ILE A CA  1 
ATOM   1353  C  C   . ILE A  1 181 ? 22.000  22.444  10.370  1.00   16.38 ? 288  ILE A C   1 
ATOM   1354  O  O   . ILE A  1 181 ? 22.433  23.587  10.490  1.00   17.77 ? 288  ILE A O   1 
ATOM   1355  C  CB  . ILE A  1 181 ? 20.348  22.498  12.245  1.00   18.39 ? 288  ILE A CB  1 
ATOM   1356  C  CG1 . ILE A  1 181 ? 19.860  21.837  13.541  1.00   17.27 ? 288  ILE A CG1 1 
ATOM   1357  C  CG2 . ILE A  1 181 ? 19.178  22.640  11.241  1.00   15.24 ? 288  ILE A CG2 1 
ATOM   1358  C  CD1 . ILE A  1 181 ? 19.409  20.429  13.381  1.00   17.69 ? 288  ILE A CD1 1 
ATOM   1359  N  N   . PHE A  1 182 ? 21.936  21.821  9.198   1.00   15.72 ? 289  PHE A N   1 
ATOM   1360  C  CA  . PHE A  1 182 ? 22.370  22.458  7.952   1.00   13.55 ? 289  PHE A CA  1 
ATOM   1361  C  C   . PHE A  1 182 ? 21.154  22.820  7.088   1.00   14.30 ? 289  PHE A C   1 
ATOM   1362  O  O   . PHE A  1 182 ? 20.469  21.937  6.585   1.00   16.91 ? 289  PHE A O   1 
ATOM   1363  C  CB  . PHE A  1 182 ? 23.272  21.504  7.155   1.00   14.03 ? 289  PHE A CB  1 
ATOM   1364  C  CG  . PHE A  1 182 ? 24.572  21.149  7.847   1.00   14.37 ? 289  PHE A CG  1 
ATOM   1365  C  CD1 . PHE A  1 182 ? 25.618  22.074  7.922   1.00   13.01 ? 289  PHE A CD1 1 
ATOM   1366  C  CD2 . PHE A  1 182 ? 24.756  19.882  8.405   1.00   12.50 ? 289  PHE A CD2 1 
ATOM   1367  C  CE1 . PHE A  1 182 ? 26.834  21.741  8.540   1.00   11.88 ? 289  PHE A CE1 1 
ATOM   1368  C  CE2 . PHE A  1 182 ? 25.968  19.534  9.026   1.00   9.55  ? 289  PHE A CE2 1 
ATOM   1369  C  CZ  . PHE A  1 182 ? 27.005  20.463  9.092   1.00   17.74 ? 289  PHE A CZ  1 
ATOM   1370  N  N   . VAL A  1 183 ? 20.903  24.116  6.907   1.00   14.89 ? 290  VAL A N   1 
ATOM   1371  C  CA  . VAL A  1 183 ? 19.769  24.598  6.112   1.00   14.68 ? 290  VAL A CA  1 
ATOM   1372  C  C   . VAL A  1 183 ? 20.300  25.035  4.743   1.00   15.82 ? 290  VAL A C   1 
ATOM   1373  O  O   . VAL A  1 183 ? 21.248  25.811  4.660   1.00   15.52 ? 290  VAL A O   1 
ATOM   1374  C  CB  . VAL A  1 183 ? 19.083  25.807  6.811   1.00   17.16 ? 290  VAL A CB  1 
ATOM   1375  C  CG1 . VAL A  1 183 ? 17.796  26.168  6.114   1.00   14.54 ? 290  VAL A CG1 1 
ATOM   1376  C  CG2 . VAL A  1 183 ? 18.828  25.489  8.259   1.00   12.29 ? 290  VAL A CG2 1 
ATOM   1377  N  N   . TRP A  1 184 ? 19.697  24.533  3.672   1.00   13.69 ? 291  TRP A N   1 
ATOM   1378  C  CA  . TRP A  1 184 ? 20.160  24.848  2.323   1.00   13.87 ? 291  TRP A CA  1 
ATOM   1379  C  C   . TRP A  1 184 ? 19.091  25.425  1.391   1.00   14.01 ? 291  TRP A C   1 
ATOM   1380  O  O   . TRP A  1 184 ? 17.940  24.999  1.405   1.00   16.89 ? 291  TRP A O   1 
ATOM   1381  C  CB  . TRP A  1 184 ? 20.727  23.580  1.673   1.00   13.63 ? 291  TRP A CB  1 
ATOM   1382  C  CG  . TRP A  1 184 ? 21.997  23.828  0.920   1.00   16.81 ? 291  TRP A CG  1 
ATOM   1383  C  CD1 . TRP A  1 184 ? 22.123  24.271  -0.369  1.00   15.40 ? 291  TRP A CD1 1 
ATOM   1384  C  CD2 . TRP A  1 184 ? 23.325  23.758  1.454   1.00   15.72 ? 291  TRP A CD2 1 
ATOM   1385  N  NE1 . TRP A  1 184 ? 23.454  24.491  -0.666  1.00   13.64 ? 291  TRP A NE1 1 
ATOM   1386  C  CE2 . TRP A  1 184 ? 24.212  24.185  0.433   1.00   15.74 ? 291  TRP A CE2 1 
ATOM   1387  C  CE3 . TRP A  1 184 ? 23.853  23.382  2.700   1.00   12.72 ? 291  TRP A CE3 1 
ATOM   1388  C  CZ2 . TRP A  1 184 ? 25.599  24.245  0.619   1.00   14.31 ? 291  TRP A CZ2 1 
ATOM   1389  C  CZ3 . TRP A  1 184 ? 25.238  23.442  2.886   1.00   16.00 ? 291  TRP A CZ3 1 
ATOM   1390  C  CH2 . TRP A  1 184 ? 26.092  23.871  1.850   1.00   14.80 ? 291  TRP A CH2 1 
ATOM   1391  N  N   . ALA A  1 185 ? 19.485  26.390  0.574   1.00   16.86 ? 292  ALA A N   1 
ATOM   1392  C  CA  . ALA A  1 185 ? 18.582  26.988  -0.409  1.00   16.74 ? 292  ALA A CA  1 
ATOM   1393  C  C   . ALA A  1 185 ? 18.537  26.002  -1.585  1.00   17.95 ? 292  ALA A C   1 
ATOM   1394  O  O   . ALA A  1 185 ? 19.584  25.610  -2.092  1.00   16.15 ? 292  ALA A O   1 
ATOM   1395  C  CB  . ALA A  1 185 ? 19.128  28.335  -0.860  1.00   14.54 ? 292  ALA A CB  1 
ATOM   1396  N  N   . SER A  1 186 ? 17.340  25.600  -2.019  1.00   20.37 ? 293  SER A N   1 
ATOM   1397  C  CA  . SER A  1 186 ? 17.236  24.613  -3.098  1.00   19.83 ? 293  SER A CA  1 
ATOM   1398  C  C   . SER A  1 186 ? 17.721  25.021  -4.490  1.00   18.31 ? 293  SER A C   1 
ATOM   1399  O  O   . SER A  1 186 ? 17.986  24.155  -5.315  1.00   21.05 ? 293  SER A O   1 
ATOM   1400  C  CB  . SER A  1 186 ? 15.805  24.056  -3.195  1.00   17.31 ? 293  SER A CB  1 
ATOM   1401  O  OG  . SER A  1 186 ? 14.875  25.070  -3.496  1.00   20.76 ? 293  SER A OG  1 
ATOM   1402  N  N   . GLY A  1 187 ? 17.843  26.312  -4.773  1.00   17.27 ? 294  GLY A N   1 
ATOM   1403  C  CA  . GLY A  1 187 ? 18.352  26.697  -6.086  1.00   18.62 ? 294  GLY A CA  1 
ATOM   1404  C  C   . GLY A  1 187 ? 17.556  27.707  -6.892  1.00   21.09 ? 294  GLY A C   1 
ATOM   1405  O  O   . GLY A  1 187 ? 16.353  27.852  -6.691  1.00   20.89 ? 294  GLY A O   1 
ATOM   1406  N  N   . ASN A  1 188 ? 18.227  28.399  -7.812  1.00   19.84 ? 295  ASN A N   1 
ATOM   1407  C  CA  . ASN A  1 188 ? 17.586  29.402  -8.658  1.00   18.16 ? 295  ASN A CA  1 
ATOM   1408  C  C   . ASN A  1 188 ? 17.549  28.978  -10.125 1.00   18.99 ? 295  ASN A C   1 
ATOM   1409  O  O   . ASN A  1 188 ? 17.419  29.828  -11.003 1.00   19.39 ? 295  ASN A O   1 
ATOM   1410  C  CB  . ASN A  1 188 ? 18.339  30.743  -8.599  1.00   19.43 ? 295  ASN A CB  1 
ATOM   1411  C  CG  . ASN A  1 188 ? 17.962  31.599  -7.403  1.00   19.32 ? 295  ASN A CG  1 
ATOM   1412  O  OD1 . ASN A  1 188 ? 16.862  31.496  -6.858  1.00   17.29 ? 295  ASN A OD1 1 
ATOM   1413  N  ND2 . ASN A  1 188 ? 18.876  32.484  -7.010  1.00   17.54 ? 295  ASN A ND2 1 
ATOM   1414  N  N   . GLY A  1 189 ? 17.660  27.683  -10.404 1.00   19.21 ? 296  GLY A N   1 
ATOM   1415  C  CA  . GLY A  1 189 ? 17.671  27.235  -11.791 1.00   17.32 ? 296  GLY A CA  1 
ATOM   1416  C  C   . GLY A  1 189 ? 16.351  26.983  -12.517 1.00   19.32 ? 296  GLY A C   1 
ATOM   1417  O  O   . GLY A  1 189 ? 16.335  26.325  -13.565 1.00   15.89 ? 296  GLY A O   1 
ATOM   1418  N  N   . GLY A  1 190 ? 15.248  27.500  -11.978 1.00   18.25 ? 297  GLY A N   1 
ATOM   1419  C  CA  . GLY A  1 190 ? 13.954  27.302  -12.602 1.00   17.99 ? 297  GLY A CA  1 
ATOM   1420  C  C   . GLY A  1 190 ? 13.860  27.657  -14.082 1.00   21.11 ? 297  GLY A C   1 
ATOM   1421  O  O   . GLY A  1 190 ? 13.278  26.908  -14.859 1.00   20.82 ? 297  GLY A O   1 
ATOM   1422  N  N   . ARG A  1 191 ? 14.430  28.787  -14.486 1.00   22.78 ? 298  ARG A N   1 
ATOM   1423  C  CA  . ARG A  1 191 ? 14.375  29.193  -15.889 1.00   25.76 ? 298  ARG A CA  1 
ATOM   1424  C  C   . ARG A  1 191 ? 15.160  28.226  -16.789 1.00   25.89 ? 298  ARG A C   1 
ATOM   1425  O  O   . ARG A  1 191 ? 14.844  28.072  -17.969 1.00   27.24 ? 298  ARG A O   1 
ATOM   1426  C  CB  . ARG A  1 191 ? 14.925  30.618  -16.041 1.00   29.25 ? 298  ARG A CB  1 
ATOM   1427  C  CG  . ARG A  1 191 ? 14.509  31.304  -17.330 1.00   37.36 ? 298  ARG A CG  1 
ATOM   1428  C  CD  . ARG A  1 191 ? 15.639  32.132  -17.940 1.00   42.33 ? 298  ARG A CD  1 
ATOM   1429  N  NE  . ARG A  1 191 ? 16.083  33.235  -17.094 1.00   49.36 ? 298  ARG A NE  1 
ATOM   1430  C  CZ  . ARG A  1 191 ? 17.247  33.269  -16.443 1.00   53.95 ? 298  ARG A CZ  1 
ATOM   1431  N  NH1 . ARG A  1 191 ? 17.571  34.320  -15.695 1.00   56.76 ? 298  ARG A NH1 1 
ATOM   1432  N  NH2 . ARG A  1 191 ? 18.095  32.256  -16.533 1.00   56.37 ? 298  ARG A NH2 1 
ATOM   1433  N  N   . GLU A  1 192 ? 16.178  27.574  -16.231 1.00   25.87 ? 299  GLU A N   1 
ATOM   1434  C  CA  . GLU A  1 192 ? 17.001  26.629  -16.988 1.00   25.30 ? 299  GLU A CA  1 
ATOM   1435  C  C   . GLU A  1 192 ? 16.484  25.205  -16.841 1.00   24.65 ? 299  GLU A C   1 
ATOM   1436  O  O   . GLU A  1 192 ? 17.143  24.252  -17.274 1.00   25.77 ? 299  GLU A O   1 
ATOM   1437  C  CB  . GLU A  1 192 ? 18.456  26.671  -16.503 1.00   24.89 ? 299  GLU A CB  1 
ATOM   1438  C  CG  . GLU A  1 192 ? 19.005  28.059  -16.344 1.00   33.02 ? 299  GLU A CG  1 
ATOM   1439  C  CD  . GLU A  1 192 ? 18.695  28.932  -17.533 1.00   40.13 ? 299  GLU A CD  1 
ATOM   1440  O  OE1 . GLU A  1 192 ? 19.073  28.559  -18.668 1.00   45.65 ? 299  GLU A OE1 1 
ATOM   1441  O  OE2 . GLU A  1 192 ? 18.065  29.992  -17.339 1.00   41.27 ? 299  GLU A OE2 1 
ATOM   1442  N  N   . HIS A  1 193 ? 15.314  25.058  -16.222 1.00   23.25 ? 300  HIS A N   1 
ATOM   1443  C  CA  . HIS A  1 193 ? 14.720  23.735  -16.006 1.00   25.42 ? 300  HIS A CA  1 
ATOM   1444  C  C   . HIS A  1 193 ? 15.619  22.836  -15.170 1.00   24.21 ? 300  HIS A C   1 
ATOM   1445  O  O   . HIS A  1 193 ? 15.630  21.609  -15.345 1.00   21.97 ? 300  HIS A O   1 
ATOM   1446  C  CB  . HIS A  1 193 ? 14.435  23.035  -17.338 1.00   30.42 ? 300  HIS A CB  1 
ATOM   1447  C  CG  . HIS A  1 193 ? 13.565  23.831  -18.258 1.00   39.92 ? 300  HIS A CG  1 
ATOM   1448  N  ND1 . HIS A  1 193 ? 14.065  24.527  -19.339 1.00   44.30 ? 300  HIS A ND1 1 
ATOM   1449  C  CD2 . HIS A  1 193 ? 12.240  24.110  -18.209 1.00   41.14 ? 300  HIS A CD2 1 
ATOM   1450  C  CE1 . HIS A  1 193 ? 13.086  25.205  -19.913 1.00   46.43 ? 300  HIS A CE1 1 
ATOM   1451  N  NE2 . HIS A  1 193 ? 11.969  24.971  -19.245 1.00   44.22 ? 300  HIS A NE2 1 
ATOM   1452  N  N   . ASP A  1 194 ? 16.364  23.441  -14.253 1.00   21.26 ? 301  ASP A N   1 
ATOM   1453  C  CA  . ASP A  1 194 ? 17.267  22.682  -13.397 1.00   22.52 ? 301  ASP A CA  1 
ATOM   1454  C  C   . ASP A  1 194 ? 16.505  21.807  -12.388 1.00   21.29 ? 301  ASP A C   1 
ATOM   1455  O  O   . ASP A  1 194 ? 15.339  22.051  -12.088 1.00   23.80 ? 301  ASP A O   1 
ATOM   1456  C  CB  . ASP A  1 194 ? 18.208  23.654  -12.668 1.00   23.78 ? 301  ASP A CB  1 
ATOM   1457  C  CG  . ASP A  1 194 ? 19.464  22.977  -12.125 1.00   23.74 ? 301  ASP A CG  1 
ATOM   1458  O  OD1 . ASP A  1 194 ? 19.728  21.805  -12.457 1.00   20.79 ? 301  ASP A OD1 1 
ATOM   1459  O  OD2 . ASP A  1 194 ? 20.199  23.637  -11.366 1.00   27.36 ? 301  ASP A OD2 1 
ATOM   1460  N  N   . SER A  1 195 ? 17.162  20.769  -11.894 1.00   20.97 ? 302  SER A N   1 
ATOM   1461  C  CA  . SER A  1 195 ? 16.569  19.875  -10.904 1.00   21.82 ? 302  SER A CA  1 
ATOM   1462  C  C   . SER A  1 195 ? 17.441  19.904  -9.655  1.00   23.85 ? 302  SER A C   1 
ATOM   1463  O  O   . SER A  1 195 ? 18.649  19.682  -9.745  1.00   22.98 ? 302  SER A O   1 
ATOM   1464  C  CB  . SER A  1 195 ? 16.528  18.448  -11.432 1.00   24.14 ? 302  SER A CB  1 
ATOM   1465  O  OG  . SER A  1 195 ? 16.381  17.532  -10.363 1.00   23.56 ? 302  SER A OG  1 
ATOM   1466  N  N   . CYS A  1 196 ? 16.851  20.163  -8.491  1.00   23.48 ? 303  CYS A N   1 
ATOM   1467  C  CA  . CYS A  1 196 ? 17.663  20.206  -7.292  1.00   23.00 ? 303  CYS A CA  1 
ATOM   1468  C  C   . CYS A  1 196 ? 18.152  18.847  -6.819  1.00   23.83 ? 303  CYS A C   1 
ATOM   1469  O  O   . CYS A  1 196 ? 18.829  18.751  -5.791  1.00   24.15 ? 303  CYS A O   1 
ATOM   1470  C  CB  . CYS A  1 196 ? 16.959  20.958  -6.154  1.00   23.71 ? 303  CYS A CB  1 
ATOM   1471  S  SG  . CYS A  1 196 ? 15.148  20.803  -6.009  1.00   29.52 ? 303  CYS A SG  1 
ATOM   1472  N  N   . ASN A  1 197 ? 17.826  17.791  -7.559  1.00   22.46 ? 304  ASN A N   1 
ATOM   1473  C  CA  . ASN A  1 197 ? 18.336  16.469  -7.203  1.00   21.46 ? 304  ASN A CA  1 
ATOM   1474  C  C   . ASN A  1 197 ? 19.699  16.267  -7.875  1.00   20.31 ? 304  ASN A C   1 
ATOM   1475  O  O   . ASN A  1 197 ? 20.379  15.280  -7.632  1.00   23.75 ? 304  ASN A O   1 
ATOM   1476  C  CB  . ASN A  1 197 ? 17.361  15.361  -7.624  1.00   23.84 ? 304  ASN A CB  1 
ATOM   1477  C  CG  . ASN A  1 197 ? 16.296  15.071  -6.549  1.00   30.26 ? 304  ASN A CG  1 
ATOM   1478  O  OD1 . ASN A  1 197 ? 16.145  15.830  -5.584  1.00   30.04 ? 304  ASN A OD1 1 
ATOM   1479  N  ND2 . ASN A  1 197 ? 15.552  13.977  -6.723  1.00   29.53 ? 304  ASN A ND2 1 
ATOM   1480  N  N   . CYS A  1 198 ? 20.092  17.210  -8.723  1.00   18.61 ? 305  CYS A N   1 
ATOM   1481  C  CA  . CYS A  1 198 ? 21.380  17.143  -9.398  1.00   18.28 ? 305  CYS A CA  1 
ATOM   1482  C  C   . CYS A  1 198 ? 22.368  18.018  -8.635  1.00   18.90 ? 305  CYS A C   1 
ATOM   1483  O  O   . CYS A  1 198 ? 23.436  18.359  -9.129  1.00   20.35 ? 305  CYS A O   1 
ATOM   1484  C  CB  . CYS A  1 198 ? 21.244  17.636  -10.842 1.00   17.91 ? 305  CYS A CB  1 
ATOM   1485  S  SG  . CYS A  1 198 ? 20.359  16.454  -11.926 1.00   21.55 ? 305  CYS A SG  1 
ATOM   1486  N  N   . ASP A  1 199 ? 21.978  18.382  -7.420  1.00   17.18 ? 306  ASP A N   1 
ATOM   1487  C  CA  . ASP A  1 199 ? 22.771  19.229  -6.534  1.00   16.19 ? 306  ASP A CA  1 
ATOM   1488  C  C   . ASP A  1 199 ? 23.006  18.365  -5.288  1.00   16.19 ? 306  ASP A C   1 
ATOM   1489  O  O   . ASP A  1 199 ? 22.068  18.029  -4.572  1.00   16.19 ? 306  ASP A O   1 
ATOM   1490  C  CB  . ASP A  1 199 ? 21.939  20.468  -6.205  1.00   17.31 ? 306  ASP A CB  1 
ATOM   1491  C  CG  . ASP A  1 199 ? 22.595  21.390  -5.208  1.00   20.18 ? 306  ASP A CG  1 
ATOM   1492  O  OD1 . ASP A  1 199 ? 23.332  20.908  -4.318  1.00   18.86 ? 306  ASP A OD1 1 
ATOM   1493  O  OD2 . ASP A  1 199 ? 22.339  22.614  -5.311  1.00   19.78 ? 306  ASP A OD2 1 
ATOM   1494  N  N   . GLY A  1 200 ? 24.254  17.992  -5.042  1.00   17.76 ? 307  GLY A N   1 
ATOM   1495  C  CA  . GLY A  1 200 ? 24.560  17.132  -3.907  1.00   16.13 ? 307  GLY A CA  1 
ATOM   1496  C  C   . GLY A  1 200 ? 24.409  17.739  -2.524  1.00   20.41 ? 307  GLY A C   1 
ATOM   1497  O  O   . GLY A  1 200 ? 24.379  17.007  -1.531  1.00   19.62 ? 307  GLY A O   1 
ATOM   1498  N  N   . TYR A  1 201 ? 24.334  19.065  -2.438  1.00   18.11 ? 308  TYR A N   1 
ATOM   1499  C  CA  . TYR A  1 201 ? 24.166  19.717  -1.145  1.00   17.64 ? 308  TYR A CA  1 
ATOM   1500  C  C   . TYR A  1 201 ? 22.694  19.658  -0.743  1.00   19.52 ? 308  TYR A C   1 
ATOM   1501  O  O   . TYR A  1 201 ? 22.354  19.265  0.376   1.00   19.68 ? 308  TYR A O   1 
ATOM   1502  C  CB  . TYR A  1 201 ? 24.636  21.173  -1.215  1.00   15.44 ? 308  TYR A CB  1 
ATOM   1503  C  CG  . TYR A  1 201 ? 26.093  21.293  -1.606  1.00   18.92 ? 308  TYR A CG  1 
ATOM   1504  C  CD1 . TYR A  1 201 ? 26.482  21.269  -2.949  1.00   17.36 ? 308  TYR A CD1 1 
ATOM   1505  C  CD2 . TYR A  1 201 ? 27.090  21.376  -0.635  1.00   15.19 ? 308  TYR A CD2 1 
ATOM   1506  C  CE1 . TYR A  1 201 ? 27.822  21.323  -3.313  1.00   18.44 ? 308  TYR A CE1 1 
ATOM   1507  C  CE2 . TYR A  1 201 ? 28.439  21.435  -0.991  1.00   18.23 ? 308  TYR A CE2 1 
ATOM   1508  C  CZ  . TYR A  1 201 ? 28.799  21.406  -2.330  1.00   15.35 ? 308  TYR A CZ  1 
ATOM   1509  O  OH  . TYR A  1 201 ? 30.129  21.431  -2.685  1.00   19.37 ? 308  TYR A OH  1 
ATOM   1510  N  N   . THR A  1 202 ? 21.818  20.050  -1.661  1.00   18.37 ? 309  THR A N   1 
ATOM   1511  C  CA  . THR A  1 202 ? 20.388  20.014  -1.385  1.00   21.12 ? 309  THR A CA  1 
ATOM   1512  C  C   . THR A  1 202 ? 19.902  18.560  -1.272  1.00   19.43 ? 309  THR A C   1 
ATOM   1513  O  O   . THR A  1 202 ? 19.098  18.222  -0.402  1.00   18.07 ? 309  THR A O   1 
ATOM   1514  C  CB  . THR A  1 202 ? 19.599  20.739  -2.504  1.00   20.77 ? 309  THR A CB  1 
ATOM   1515  O  OG1 . THR A  1 202 ? 20.009  20.241  -3.788  1.00   22.05 ? 309  THR A OG1 1 
ATOM   1516  C  CG2 . THR A  1 202 ? 19.864  22.234  -2.453  1.00   20.32 ? 309  THR A CG2 1 
ATOM   1517  N  N   . ASN A  1 203 ? 20.428  17.709  -2.147  1.00   20.54 ? 310  ASN A N   1 
ATOM   1518  C  CA  . ASN A  1 203 ? 20.077  16.288  -2.233  1.00   20.86 ? 310  ASN A CA  1 
ATOM   1519  C  C   . ASN A  1 203 ? 20.520  15.452  -1.019  1.00   21.88 ? 310  ASN A C   1 
ATOM   1520  O  O   . ASN A  1 203 ? 20.053  14.328  -0.822  1.00   21.17 ? 310  ASN A O   1 
ATOM   1521  C  CB  . ASN A  1 203 ? 20.707  15.730  -3.511  1.00   27.85 ? 310  ASN A CB  1 
ATOM   1522  C  CG  . ASN A  1 203 ? 20.082  14.425  -3.975  1.00   30.34 ? 310  ASN A CG  1 
ATOM   1523  O  OD1 . ASN A  1 203 ? 18.867  14.319  -4.146  1.00   32.92 ? 310  ASN A OD1 1 
ATOM   1524  N  ND2 . ASN A  1 203 ? 20.922  13.429  -4.211  1.00   32.21 ? 310  ASN A ND2 1 
ATOM   1525  N  N   . SER A  1 204 ? 21.430  15.998  -0.218  1.00   18.75 ? 311  SER A N   1 
ATOM   1526  C  CA  . SER A  1 204 ? 21.931  15.309  0.966   1.00   18.93 ? 311  SER A CA  1 
ATOM   1527  C  C   . SER A  1 204 ? 20.872  15.131  2.058   1.00   18.92 ? 311  SER A C   1 
ATOM   1528  O  O   . SER A  1 204 ? 20.031  16.012  2.269   1.00   15.21 ? 311  SER A O   1 
ATOM   1529  C  CB  . SER A  1 204 ? 23.108  16.081  1.557   1.00   17.31 ? 311  SER A CB  1 
ATOM   1530  O  OG  . SER A  1 204 ? 23.482  15.511  2.798   1.00   19.37 ? 311  SER A OG  1 
ATOM   1531  N  N   . ILE A  1 205 ? 20.904  13.998  2.756   1.00   17.39 ? 312  ILE A N   1 
ATOM   1532  C  CA  . ILE A  1 205 ? 19.936  13.803  3.833   1.00   17.32 ? 312  ILE A CA  1 
ATOM   1533  C  C   . ILE A  1 205 ? 20.326  14.674  5.028   1.00   16.30 ? 312  ILE A C   1 
ATOM   1534  O  O   . ILE A  1 205 ? 19.487  14.948  5.878   1.00   19.00 ? 312  ILE A O   1 
ATOM   1535  C  CB  . ILE A  1 205 ? 19.840  12.316  4.317   1.00   16.22 ? 312  ILE A CB  1 
ATOM   1536  C  CG1 . ILE A  1 205 ? 21.128  11.883  5.038   1.00   14.86 ? 312  ILE A CG1 1 
ATOM   1537  C  CG2 . ILE A  1 205 ? 19.576  11.418  3.138   1.00   18.16 ? 312  ILE A CG2 1 
ATOM   1538  C  CD1 . ILE A  1 205 ? 21.050  10.466  5.617   1.00   12.12 ? 312  ILE A CD1 1 
ATOM   1539  N  N   . TYR A  1 206 ? 21.582  15.126  5.073   1.00   14.59 ? 313  TYR A N   1 
ATOM   1540  C  CA  . TYR A  1 206 ? 22.072  15.945  6.183   1.00   15.75 ? 313  TYR A CA  1 
ATOM   1541  C  C   . TYR A  1 206 ? 21.619  17.407  6.141   1.00   17.25 ? 313  TYR A C   1 
ATOM   1542  O  O   . TYR A  1 206 ? 21.771  18.139  7.120   1.00   16.85 ? 313  TYR A O   1 
ATOM   1543  C  CB  . TYR A  1 206 ? 23.602  15.917  6.235   1.00   16.06 ? 313  TYR A CB  1 
ATOM   1544  C  CG  . TYR A  1 206 ? 24.205  14.537  6.133   1.00   19.34 ? 313  TYR A CG  1 
ATOM   1545  C  CD1 . TYR A  1 206 ? 23.765  13.492  6.946   1.00   18.79 ? 313  TYR A CD1 1 
ATOM   1546  C  CD2 . TYR A  1 206 ? 25.224  14.277  5.224   1.00   20.26 ? 313  TYR A CD2 1 
ATOM   1547  C  CE1 . TYR A  1 206 ? 24.331  12.224  6.845   1.00   18.24 ? 313  TYR A CE1 1 
ATOM   1548  C  CE2 . TYR A  1 206 ? 25.796  13.024  5.124   1.00   18.27 ? 313  TYR A CE2 1 
ATOM   1549  C  CZ  . TYR A  1 206 ? 25.346  12.005  5.929   1.00   19.44 ? 313  TYR A CZ  1 
ATOM   1550  O  OH  . TYR A  1 206 ? 25.914  10.767  5.790   1.00   21.88 ? 313  TYR A OH  1 
ATOM   1551  N  N   . THR A  1 207 ? 21.076  17.843  5.011   1.00   17.18 ? 314  THR A N   1 
ATOM   1552  C  CA  . THR A  1 207 ? 20.631  19.225  4.899   1.00   17.22 ? 314  THR A CA  1 
ATOM   1553  C  C   . THR A  1 207 ? 19.108  19.331  4.754   1.00   20.20 ? 314  THR A C   1 
ATOM   1554  O  O   . THR A  1 207 ? 18.462  18.441  4.195   1.00   19.07 ? 314  THR A O   1 
ATOM   1555  C  CB  . THR A  1 207 ? 21.243  19.920  3.656   1.00   17.99 ? 314  THR A CB  1 
ATOM   1556  O  OG1 . THR A  1 207 ? 20.700  19.324  2.473   1.00   12.70 ? 314  THR A OG1 1 
ATOM   1557  C  CG2 . THR A  1 207 ? 22.756  19.778  3.630   1.00   12.90 ? 314  THR A CG2 1 
ATOM   1558  N  N   . LEU A  1 208 ? 18.529  20.414  5.272   1.00   18.65 ? 315  LEU A N   1 
ATOM   1559  C  CA  . LEU A  1 208 ? 17.094  20.632  5.099   1.00   18.40 ? 315  LEU A CA  1 
ATOM   1560  C  C   . LEU A  1 208 ? 17.034  21.562  3.899   1.00   18.01 ? 315  LEU A C   1 
ATOM   1561  O  O   . LEU A  1 208 ? 17.351  22.740  4.009   1.00   16.19 ? 315  LEU A O   1 
ATOM   1562  C  CB  . LEU A  1 208 ? 16.443  21.330  6.293   1.00   15.76 ? 315  LEU A CB  1 
ATOM   1563  C  CG  . LEU A  1 208 ? 16.433  20.589  7.611   1.00   16.59 ? 315  LEU A CG  1 
ATOM   1564  C  CD1 . LEU A  1 208 ? 17.746  20.879  8.286   1.00   16.76 ? 315  LEU A CD1 1 
ATOM   1565  C  CD2 . LEU A  1 208 ? 15.257  21.044  8.486   1.00   16.29 ? 315  LEU A CD2 1 
ATOM   1566  N  N   . SER A  1 209 ? 16.667  21.022  2.744   1.00   17.39 ? 316  SER A N   1 
ATOM   1567  C  CA  . SER A  1 209 ? 16.595  21.820  1.540   1.00   15.39 ? 316  SER A CA  1 
ATOM   1568  C  C   . SER A  1 209 ? 15.264  22.570  1.546   1.00   16.03 ? 316  SER A C   1 
ATOM   1569  O  O   . SER A  1 209 ? 14.200  21.966  1.695   1.00   19.59 ? 316  SER A O   1 
ATOM   1570  C  CB  . SER A  1 209 ? 16.714  20.919  0.312   1.00   16.93 ? 316  SER A CB  1 
ATOM   1571  O  OG  . SER A  1 209 ? 16.852  21.687  -0.881  1.00   21.26 ? 316  SER A OG  1 
ATOM   1572  N  N   . ILE A  1 210 ? 15.339  23.884  1.364   1.00   14.20 ? 317  ILE A N   1 
ATOM   1573  C  CA  . ILE A  1 210 ? 14.173  24.769  1.397   1.00   14.07 ? 317  ILE A CA  1 
ATOM   1574  C  C   . ILE A  1 210 ? 13.862  25.472  0.073   1.00   15.68 ? 317  ILE A C   1 
ATOM   1575  O  O   . ILE A  1 210 ? 14.728  26.134  -0.506  1.00   16.10 ? 317  ILE A O   1 
ATOM   1576  C  CB  . ILE A  1 210 ? 14.389  25.873  2.462   1.00   14.34 ? 317  ILE A CB  1 
ATOM   1577  C  CG1 . ILE A  1 210 ? 14.770  25.232  3.806   1.00   14.29 ? 317  ILE A CG1 1 
ATOM   1578  C  CG2 . ILE A  1 210 ? 13.143  26.750  2.573   1.00   15.05 ? 317  ILE A CG2 1 
ATOM   1579  C  CD1 . ILE A  1 210 ? 13.670  24.395  4.443   1.00   12.26 ? 317  ILE A CD1 1 
ATOM   1580  N  N   . SER A  1 211 ? 12.625  25.346  -0.399  1.00   14.68 ? 318  SER A N   1 
ATOM   1581  C  CA  . SER A  1 211 ? 12.223  26.005  -1.638  1.00   19.17 ? 318  SER A CA  1 
ATOM   1582  C  C   . SER A  1 211 ? 11.456  27.300  -1.354  1.00   18.56 ? 318  SER A C   1 
ATOM   1583  O  O   . SER A  1 211 ? 11.276  27.677  -0.199  1.00   16.79 ? 318  SER A O   1 
ATOM   1584  C  CB  . SER A  1 211 ? 11.376  25.073  -2.501  1.00   20.39 ? 318  SER A CB  1 
ATOM   1585  O  OG  . SER A  1 211 ? 12.190  24.050  -3.041  1.00   20.86 ? 318  SER A OG  1 
ATOM   1586  N  N   . SER A  1 212 ? 11.002  27.969  -2.416  1.00   17.48 ? 319  SER A N   1 
ATOM   1587  C  CA  . SER A  1 212 ? 10.303  29.249  -2.280  1.00   18.72 ? 319  SER A CA  1 
ATOM   1588  C  C   . SER A  1 212 ? 8.874   29.300  -2.829  1.00   19.25 ? 319  SER A C   1 
ATOM   1589  O  O   . SER A  1 212 ? 8.492   28.521  -3.701  1.00   18.21 ? 319  SER A O   1 
ATOM   1590  C  CB  . SER A  1 212 ? 11.118  30.352  -2.976  1.00   16.13 ? 319  SER A CB  1 
ATOM   1591  O  OG  . SER A  1 212 ? 12.448  30.427  -2.489  1.00   17.87 ? 319  SER A OG  1 
ATOM   1592  N  N   . ALA A  1 213 ? 8.105   30.254  -2.320  1.00   18.36 ? 320  ALA A N   1 
ATOM   1593  C  CA  . ALA A  1 213 ? 6.730   30.492  -2.758  1.00   20.06 ? 320  ALA A CA  1 
ATOM   1594  C  C   . ALA A  1 213 ? 6.582   32.011  -2.877  1.00   19.72 ? 320  ALA A C   1 
ATOM   1595  O  O   . ALA A  1 213 ? 7.158   32.760  -2.077  1.00   21.87 ? 320  ALA A O   1 
ATOM   1596  C  CB  . ALA A  1 213 ? 5.732   29.955  -1.738  1.00   14.52 ? 320  ALA A CB  1 
ATOM   1597  N  N   . THR A  1 214 ? 5.827   32.470  -3.870  1.00   19.74 ? 321  THR A N   1 
ATOM   1598  C  CA  . THR A  1 214 ? 5.616   33.905  -4.042  1.00   19.79 ? 321  THR A CA  1 
ATOM   1599  C  C   . THR A  1 214 ? 4.518   34.363  -3.081  1.00   19.30 ? 321  THR A C   1 
ATOM   1600  O  O   . THR A  1 214 ? 3.793   33.549  -2.513  1.00   19.51 ? 321  THR A O   1 
ATOM   1601  C  CB  . THR A  1 214 ? 5.195   34.257  -5.487  1.00   18.32 ? 321  THR A CB  1 
ATOM   1602  O  OG1 . THR A  1 214 ? 3.859   33.796  -5.721  1.00   17.59 ? 321  THR A OG1 1 
ATOM   1603  C  CG2 . THR A  1 214 ? 6.127   33.596  -6.484  1.00   16.50 ? 321  THR A CG2 1 
ATOM   1604  N  N   . GLN A  1 215 ? 4.390   35.671  -2.899  1.00   18.20 ? 322  GLN A N   1 
ATOM   1605  C  CA  . GLN A  1 215 ? 3.390   36.186  -1.991  1.00   18.98 ? 322  GLN A CA  1 
ATOM   1606  C  C   . GLN A  1 215 ? 1.984   35.656  -2.287  1.00   20.90 ? 322  GLN A C   1 
ATOM   1607  O  O   . GLN A  1 215 ? 1.241   35.320  -1.362  1.00   21.97 ? 322  GLN A O   1 
ATOM   1608  C  CB  . GLN A  1 215 ? 3.400   37.711  -2.027  1.00   21.88 ? 322  GLN A CB  1 
ATOM   1609  C  CG  . GLN A  1 215 ? 2.334   38.345  -1.181  1.00   17.96 ? 322  GLN A CG  1 
ATOM   1610  C  CD  . GLN A  1 215 ? 2.425   39.846  -1.216  1.00   23.60 ? 322  GLN A CD  1 
ATOM   1611  O  OE1 . GLN A  1 215 ? 2.886   40.431  -2.197  1.00   23.64 ? 322  GLN A OE1 1 
ATOM   1612  N  NE2 . GLN A  1 215 ? 1.984   40.483  -0.152  1.00   25.32 ? 322  GLN A NE2 1 
ATOM   1613  N  N   . PHE A  1 216 ? 1.619   35.564  -3.562  1.00   18.13 ? 323  PHE A N   1 
ATOM   1614  C  CA  . PHE A  1 216 ? 0.288   35.076  -3.912  1.00   19.92 ? 323  PHE A CA  1 
ATOM   1615  C  C   . PHE A  1 216 ? 0.191   33.554  -3.878  1.00   20.90 ? 323  PHE A C   1 
ATOM   1616  O  O   . PHE A  1 216 ? -0.811  32.978  -4.313  1.00   21.17 ? 323  PHE A O   1 
ATOM   1617  C  CB  . PHE A  1 216 ? -0.149  35.604  -5.287  1.00   20.71 ? 323  PHE A CB  1 
ATOM   1618  C  CG  . PHE A  1 216 ? -0.166  37.113  -5.385  1.00   22.70 ? 323  PHE A CG  1 
ATOM   1619  C  CD1 . PHE A  1 216 ? -0.244  37.906  -4.228  1.00   22.05 ? 323  PHE A CD1 1 
ATOM   1620  C  CD2 . PHE A  1 216 ? -0.072  37.744  -6.630  1.00   21.46 ? 323  PHE A CD2 1 
ATOM   1621  C  CE1 . PHE A  1 216 ? -0.222  39.315  -4.306  1.00   22.29 ? 323  PHE A CE1 1 
ATOM   1622  C  CE2 . PHE A  1 216 ? -0.049  39.149  -6.725  1.00   24.33 ? 323  PHE A CE2 1 
ATOM   1623  C  CZ  . PHE A  1 216 ? -0.122  39.939  -5.555  1.00   21.68 ? 323  PHE A CZ  1 
ATOM   1624  N  N   . GLY A  1 217 ? 1.237   32.905  -3.367  1.00   16.98 ? 324  GLY A N   1 
ATOM   1625  C  CA  . GLY A  1 217 ? 1.227   31.458  -3.250  1.00   17.29 ? 324  GLY A CA  1 
ATOM   1626  C  C   . GLY A  1 217 ? 1.539   30.643  -4.494  1.00   20.32 ? 324  GLY A C   1 
ATOM   1627  O  O   . GLY A  1 217 ? 1.045   29.524  -4.645  1.00   21.01 ? 324  GLY A O   1 
ATOM   1628  N  N   . ASN A  1 218 ? 2.371   31.178  -5.379  1.00   18.14 ? 325  ASN A N   1 
ATOM   1629  C  CA  . ASN A  1 218 ? 2.732   30.469  -6.595  1.00   18.64 ? 325  ASN A CA  1 
ATOM   1630  C  C   . ASN A  1 218 ? 4.188   30.005  -6.626  1.00   18.35 ? 325  ASN A C   1 
ATOM   1631  O  O   . ASN A  1 218 ? 5.010   30.432  -5.806  1.00   20.40 ? 325  ASN A O   1 
ATOM   1632  C  CB  . ASN A  1 218 ? 2.447   31.357  -7.810  1.00   17.26 ? 325  ASN A CB  1 
ATOM   1633  C  CG  . ASN A  1 218 ? 0.959   31.553  -8.038  1.00   23.30 ? 325  ASN A CG  1 
ATOM   1634  O  OD1 . ASN A  1 218 ? 0.194   30.589  -8.011  1.00   24.00 ? 325  ASN A OD1 1 
ATOM   1635  N  ND2 . ASN A  1 218 ? 0.542   32.792  -8.261  1.00   21.09 ? 325  ASN A ND2 1 
ATOM   1636  N  N   . VAL A  1 219 ? 4.493   29.115  -7.566  1.00   16.26 ? 326  VAL A N   1 
ATOM   1637  C  CA  . VAL A  1 219 ? 5.854   28.617  -7.735  1.00   17.96 ? 326  VAL A CA  1 
ATOM   1638  C  C   . VAL A  1 219 ? 6.628   29.693  -8.500  1.00   19.12 ? 326  VAL A C   1 
ATOM   1639  O  O   . VAL A  1 219 ? 6.354   29.949  -9.678  1.00   19.86 ? 326  VAL A O   1 
ATOM   1640  C  CB  . VAL A  1 219 ? 5.897   27.305  -8.554  1.00   16.08 ? 326  VAL A CB  1 
ATOM   1641  C  CG1 . VAL A  1 219 ? 7.339   26.814  -8.653  1.00   11.37 ? 326  VAL A CG1 1 
ATOM   1642  C  CG2 . VAL A  1 219 ? 5.041   26.228  -7.887  1.00   12.73 ? 326  VAL A CG2 1 
ATOM   1643  N  N   . PRO A  1 220 ? 7.617   30.323  -7.847  1.00   19.00 ? 327  PRO A N   1 
ATOM   1644  C  CA  . PRO A  1 220 ? 8.431   31.382  -8.464  1.00   17.83 ? 327  PRO A CA  1 
ATOM   1645  C  C   . PRO A  1 220 ? 9.126   30.927  -9.738  1.00   17.71 ? 327  PRO A C   1 
ATOM   1646  O  O   . PRO A  1 220 ? 9.428   29.748  -9.898  1.00   17.36 ? 327  PRO A O   1 
ATOM   1647  C  CB  . PRO A  1 220 ? 9.446   31.731  -7.377  1.00   17.37 ? 327  PRO A CB  1 
ATOM   1648  C  CG  . PRO A  1 220 ? 8.796   31.230  -6.097  1.00   20.13 ? 327  PRO A CG  1 
ATOM   1649  C  CD  . PRO A  1 220 ? 8.147   29.956  -6.525  1.00   18.17 ? 327  PRO A CD  1 
ATOM   1650  N  N   . TRP A  1 221 ? 9.409   31.870  -10.630 1.00   18.31 ? 328  TRP A N   1 
ATOM   1651  C  CA  . TRP A  1 221 ? 10.095  31.541  -11.877 1.00   18.84 ? 328  TRP A CA  1 
ATOM   1652  C  C   . TRP A  1 221 ? 11.446  30.848  -11.660 1.00   20.04 ? 328  TRP A C   1 
ATOM   1653  O  O   . TRP A  1 221 ? 11.834  29.984  -12.443 1.00   20.20 ? 328  TRP A O   1 
ATOM   1654  C  CB  . TRP A  1 221 ? 10.338  32.808  -12.715 1.00   21.12 ? 328  TRP A CB  1 
ATOM   1655  C  CG  . TRP A  1 221 ? 11.357  33.770  -12.139 1.00   17.72 ? 328  TRP A CG  1 
ATOM   1656  C  CD1 . TRP A  1 221 ? 11.116  34.819  -11.293 1.00   20.59 ? 328  TRP A CD1 1 
ATOM   1657  C  CD2 . TRP A  1 221 ? 12.768  33.784  -12.397 1.00   19.77 ? 328  TRP A CD2 1 
ATOM   1658  N  NE1 . TRP A  1 221 ? 12.291  35.494  -11.013 1.00   20.35 ? 328  TRP A NE1 1 
ATOM   1659  C  CE2 . TRP A  1 221 ? 13.318  34.876  -11.677 1.00   20.26 ? 328  TRP A CE2 1 
ATOM   1660  C  CE3 . TRP A  1 221 ? 13.624  32.976  -13.164 1.00   20.50 ? 328  TRP A CE3 1 
ATOM   1661  C  CZ2 . TRP A  1 221 ? 14.680  35.181  -11.703 1.00   18.78 ? 328  TRP A CZ2 1 
ATOM   1662  C  CZ3 . TRP A  1 221 ? 14.985  33.277  -13.191 1.00   20.83 ? 328  TRP A CZ3 1 
ATOM   1663  C  CH2 . TRP A  1 221 ? 15.498  34.373  -12.463 1.00   22.34 ? 328  TRP A CH2 1 
ATOM   1664  N  N   . TYR A  1 222 ? 12.159  31.231  -10.602 1.00   19.45 ? 329  TYR A N   1 
ATOM   1665  C  CA  . TYR A  1 222 ? 13.485  30.673  -10.320 1.00   18.29 ? 329  TYR A CA  1 
ATOM   1666  C  C   . TYR A  1 222 ? 13.490  29.316  -9.630  1.00   18.36 ? 329  TYR A C   1 
ATOM   1667  O  O   . TYR A  1 222 ? 14.525  28.671  -9.547  1.00   18.82 ? 329  TYR A O   1 
ATOM   1668  C  CB  . TYR A  1 222 ? 14.304  31.675  -9.477  1.00   15.32 ? 329  TYR A CB  1 
ATOM   1669  C  CG  . TYR A  1 222 ? 13.603  32.167  -8.203  1.00   13.16 ? 329  TYR A CG  1 
ATOM   1670  C  CD1 . TYR A  1 222 ? 13.598  31.402  -7.036  1.00   15.09 ? 329  TYR A CD1 1 
ATOM   1671  C  CD2 . TYR A  1 222 ? 12.885  33.360  -8.199  1.00   11.40 ? 329  TYR A CD2 1 
ATOM   1672  C  CE1 . TYR A  1 222 ? 12.880  31.811  -5.899  1.00   13.41 ? 329  TYR A CE1 1 
ATOM   1673  C  CE2 . TYR A  1 222 ? 12.162  33.774  -7.084  1.00   14.84 ? 329  TYR A CE2 1 
ATOM   1674  C  CZ  . TYR A  1 222 ? 12.162  32.988  -5.936  1.00   14.58 ? 329  TYR A CZ  1 
ATOM   1675  O  OH  . TYR A  1 222 ? 11.415  33.371  -4.846  1.00   13.84 ? 329  TYR A OH  1 
ATOM   1676  N  N   . SER A  1 223 ? 12.329  28.881  -9.160  1.00   17.29 ? 330  SER A N   1 
ATOM   1677  C  CA  . SER A  1 223 ? 12.207  27.628  -8.432  1.00   17.95 ? 330  SER A CA  1 
ATOM   1678  C  C   . SER A  1 223 ? 12.596  26.341  -9.160  1.00   16.31 ? 330  SER A C   1 
ATOM   1679  O  O   . SER A  1 223 ? 12.260  26.148  -10.328 1.00   18.72 ? 330  SER A O   1 
ATOM   1680  C  CB  . SER A  1 223 ? 10.770  27.503  -7.912  1.00   19.03 ? 330  SER A CB  1 
ATOM   1681  O  OG  . SER A  1 223 ? 10.556  26.264  -7.273  1.00   25.66 ? 330  SER A OG  1 
ATOM   1682  N  N   . GLU A  1 224 ? 13.310  25.463  -8.456  1.00   16.92 ? 331  GLU A N   1 
ATOM   1683  C  CA  . GLU A  1 224 ? 13.700  24.161  -9.016  1.00   18.41 ? 331  GLU A CA  1 
ATOM   1684  C  C   . GLU A  1 224 ? 12.892  23.093  -8.300  1.00   19.91 ? 331  GLU A C   1 
ATOM   1685  O  O   . GLU A  1 224 ? 12.785  23.101  -7.069  1.00   20.53 ? 331  GLU A O   1 
ATOM   1686  C  CB  . GLU A  1 224 ? 15.186  23.855  -8.804  1.00   15.02 ? 331  GLU A CB  1 
ATOM   1687  C  CG  . GLU A  1 224 ? 16.136  24.852  -9.441  1.00   19.45 ? 331  GLU A CG  1 
ATOM   1688  C  CD  . GLU A  1 224 ? 17.605  24.486  -9.252  1.00   19.22 ? 331  GLU A CD  1 
ATOM   1689  O  OE1 . GLU A  1 224 ? 18.450  25.413  -9.252  1.00   19.17 ? 331  GLU A OE1 1 
ATOM   1690  O  OE2 . GLU A  1 224 ? 17.917  23.276  -9.125  1.00   18.90 ? 331  GLU A OE2 1 
ATOM   1691  N  N   . ALA A  1 225 ? 12.327  22.173  -9.068  1.00   20.45 ? 332  ALA A N   1 
ATOM   1692  C  CA  . ALA A  1 225 ? 11.543  21.093  -8.495  1.00   19.48 ? 332  ALA A CA  1 
ATOM   1693  C  C   . ALA A  1 225 ? 12.397  19.830  -8.343  1.00   20.04 ? 332  ALA A C   1 
ATOM   1694  O  O   . ALA A  1 225 ? 13.267  19.562  -9.166  1.00   20.87 ? 332  ALA A O   1 
ATOM   1695  C  CB  . ALA A  1 225 ? 10.348  20.800  -9.401  1.00   20.75 ? 332  ALA A CB  1 
ATOM   1696  N  N   . CYS A  1 226 ? 12.142  19.063  -7.286  1.00   18.62 ? 333  CYS A N   1 
ATOM   1697  C  CA  . CYS A  1 226 ? 12.841  17.807  -7.047  1.00   20.86 ? 333  CYS A CA  1 
ATOM   1698  C  C   . CYS A  1 226 ? 12.254  17.186  -5.788  1.00   19.68 ? 333  CYS A C   1 
ATOM   1699  O  O   . CYS A  1 226 ? 11.604  17.866  -4.996  1.00   16.81 ? 333  CYS A O   1 
ATOM   1700  C  CB  . CYS A  1 226 ? 14.362  18.007  -6.883  1.00   26.88 ? 333  CYS A CB  1 
ATOM   1701  S  SG  . CYS A  1 226 ? 14.820  18.891  -5.373  1.00   27.99 ? 333  CYS A SG  1 
ATOM   1702  N  N   . SER A  1 227 ? 12.473  15.888  -5.624  1.00   17.48 ? 334  SER A N   1 
ATOM   1703  C  CA  . SER A  1 227 ? 11.948  15.152  -4.490  1.00   18.39 ? 334  SER A CA  1 
ATOM   1704  C  C   . SER A  1 227 ? 12.748  15.295  -3.199  1.00   16.68 ? 334  SER A C   1 
ATOM   1705  O  O   . SER A  1 227 ? 12.282  14.870  -2.146  1.00   17.49 ? 334  SER A O   1 
ATOM   1706  C  CB  . SER A  1 227 ? 11.833  13.654  -4.848  1.00   20.88 ? 334  SER A CB  1 
ATOM   1707  O  OG  . SER A  1 227 ? 13.108  13.096  -5.148  1.00   22.47 ? 334  SER A OG  1 
ATOM   1708  N  N   . SER A  1 228 ? 13.943  15.869  -3.270  1.00   16.13 ? 335  SER A N   1 
ATOM   1709  C  CA  . SER A  1 228 ? 14.762  16.006  -2.068  1.00   18.06 ? 335  SER A CA  1 
ATOM   1710  C  C   . SER A  1 228 ? 14.398  17.220  -1.210  1.00   17.52 ? 335  SER A C   1 
ATOM   1711  O  O   . SER A  1 228 ? 14.792  17.295  -0.048  1.00   14.66 ? 335  SER A O   1 
ATOM   1712  C  CB  . SER A  1 228 ? 16.254  16.044  -2.429  1.00   15.61 ? 335  SER A CB  1 
ATOM   1713  O  OG  . SER A  1 228 ? 16.603  17.231  -3.118  1.00   22.30 ? 335  SER A OG  1 
ATOM   1714  N  N   . THR A  1 229 ? 13.642  18.159  -1.776  1.00   19.35 ? 336  THR A N   1 
ATOM   1715  C  CA  . THR A  1 229 ? 13.233  19.347  -1.028  1.00   18.74 ? 336  THR A CA  1 
ATOM   1716  C  C   . THR A  1 229 ? 12.322  18.943  0.139   1.00   19.40 ? 336  THR A C   1 
ATOM   1717  O  O   . THR A  1 229 ? 11.467  18.072  -0.010  1.00   19.91 ? 336  THR A O   1 
ATOM   1718  C  CB  . THR A  1 229 ? 12.498  20.330  -1.946  1.00   20.41 ? 336  THR A CB  1 
ATOM   1719  O  OG1 . THR A  1 229 ? 13.408  20.779  -2.960  1.00   17.99 ? 336  THR A OG1 1 
ATOM   1720  C  CG2 . THR A  1 229 ? 11.961  21.522  -1.148  1.00   17.13 ? 336  THR A CG2 1 
ATOM   1721  N  N   . LEU A  1 230 ? 12.504  19.576  1.296   1.00   17.77 ? 337  LEU A N   1 
ATOM   1722  C  CA  . LEU A  1 230 ? 11.711  19.246  2.477   1.00   15.48 ? 337  LEU A CA  1 
ATOM   1723  C  C   . LEU A  1 230 ? 10.532  20.170  2.752   1.00   18.43 ? 337  LEU A C   1 
ATOM   1724  O  O   . LEU A  1 230 ? 9.429   19.702  3.051   1.00   17.95 ? 337  LEU A O   1 
ATOM   1725  C  CB  . LEU A  1 230 ? 12.618  19.212  3.702   1.00   17.66 ? 337  LEU A CB  1 
ATOM   1726  C  CG  . LEU A  1 230 ? 12.103  18.437  4.909   1.00   19.25 ? 337  LEU A CG  1 
ATOM   1727  C  CD1 . LEU A  1 230 ? 11.959  16.944  4.552   1.00   19.14 ? 337  LEU A CD1 1 
ATOM   1728  C  CD2 . LEU A  1 230 ? 13.078  18.614  6.068   1.00   18.60 ? 337  LEU A CD2 1 
ATOM   1729  N  N   . ALA A  1 231 ? 10.753  21.479  2.647   1.00   16.92 ? 338  ALA A N   1 
ATOM   1730  C  CA  . ALA A  1 231 ? 9.698   22.454  2.908   1.00   15.82 ? 338  ALA A CA  1 
ATOM   1731  C  C   . ALA A  1 231 ? 9.935   23.768  2.178   1.00   16.01 ? 338  ALA A C   1 
ATOM   1732  O  O   . ALA A  1 231 ? 10.902  23.920  1.431   1.00   14.73 ? 338  ALA A O   1 
ATOM   1733  C  CB  . ALA A  1 231 ? 9.561   22.712  4.427   1.00   17.45 ? 338  ALA A CB  1 
ATOM   1734  N  N   . THR A  1 232 ? 9.066   24.735  2.445   1.00   17.01 ? 339  THR A N   1 
ATOM   1735  C  CA  . THR A  1 232 ? 9.106   26.019  1.762   1.00   15.76 ? 339  THR A CA  1 
ATOM   1736  C  C   . THR A  1 232 ? 8.927   27.242  2.665   1.00   15.63 ? 339  THR A C   1 
ATOM   1737  O  O   . THR A  1 232 ? 8.281   27.171  3.717   1.00   15.69 ? 339  THR A O   1 
ATOM   1738  C  CB  . THR A  1 232 ? 7.951   26.054  0.704   1.00   18.01 ? 339  THR A CB  1 
ATOM   1739  O  OG1 . THR A  1 232 ? 8.091   24.958  -0.206  1.00   18.23 ? 339  THR A OG1 1 
ATOM   1740  C  CG2 . THR A  1 232 ? 7.924   27.380  -0.060  1.00   14.97 ? 339  THR A CG2 1 
ATOM   1741  N  N   . THR A  1 233 ? 9.505   28.363  2.248   1.00   13.80 ? 340  THR A N   1 
ATOM   1742  C  CA  . THR A  1 233 ? 9.312   29.630  2.950   1.00   14.42 ? 340  THR A CA  1 
ATOM   1743  C  C   . THR A  1 233 ? 9.099   30.645  1.838   1.00   17.24 ? 340  THR A C   1 
ATOM   1744  O  O   . THR A  1 233 ? 9.511   30.417  0.690   1.00   18.74 ? 340  THR A O   1 
ATOM   1745  C  CB  . THR A  1 233 ? 10.520  30.088  3.783   1.00   15.21 ? 340  THR A CB  1 
ATOM   1746  O  OG1 . THR A  1 233 ? 11.664  30.229  2.933   1.00   14.86 ? 340  THR A OG1 1 
ATOM   1747  C  CG2 . THR A  1 233 ? 10.791  29.113  4.927   1.00   12.99 ? 340  THR A CG2 1 
ATOM   1748  N  N   . TYR A  1 234 ? 8.450   31.756  2.164   1.00   17.83 ? 341  TYR A N   1 
ATOM   1749  C  CA  . TYR A  1 234 ? 8.187   32.795  1.172   1.00   17.12 ? 341  TYR A CA  1 
ATOM   1750  C  C   . TYR A  1 234 ? 9.445   33.492  0.685   1.00   19.01 ? 341  TYR A C   1 
ATOM   1751  O  O   . TYR A  1 234 ? 10.460  33.555  1.389   1.00   17.86 ? 341  TYR A O   1 
ATOM   1752  C  CB  . TYR A  1 234 ? 7.257   33.872  1.743   1.00   17.24 ? 341  TYR A CB  1 
ATOM   1753  C  CG  . TYR A  1 234 ? 5.817   33.453  1.860   1.00   19.35 ? 341  TYR A CG  1 
ATOM   1754  C  CD1 . TYR A  1 234 ? 5.050   33.213  0.719   1.00   20.43 ? 341  TYR A CD1 1 
ATOM   1755  C  CD2 . TYR A  1 234 ? 5.223   33.275  3.109   1.00   19.41 ? 341  TYR A CD2 1 
ATOM   1756  C  CE1 . TYR A  1 234 ? 3.725   32.804  0.812   1.00   19.46 ? 341  TYR A CE1 1 
ATOM   1757  C  CE2 . TYR A  1 234 ? 3.899   32.864  3.223   1.00   20.11 ? 341  TYR A CE2 1 
ATOM   1758  C  CZ  . TYR A  1 234 ? 3.153   32.627  2.066   1.00   23.67 ? 341  TYR A CZ  1 
ATOM   1759  O  OH  . TYR A  1 234 ? 1.849   32.184  2.160   1.00   24.90 ? 341  TYR A OH  1 
ATOM   1760  N  N   . SER A  1 235 ? 9.356   34.009  -0.535  1.00   17.70 ? 342  SER A N   1 
ATOM   1761  C  CA  . SER A  1 235 ? 10.416  34.787  -1.146  1.00   16.81 ? 342  SER A CA  1 
ATOM   1762  C  C   . SER A  1 235 ? 9.781   35.693  -2.203  1.00   18.03 ? 342  SER A C   1 
ATOM   1763  O  O   . SER A  1 235 ? 8.594   36.009  -2.124  1.00   19.52 ? 342  SER A O   1 
ATOM   1764  C  CB  . SER A  1 235 ? 11.482  33.906  -1.782  1.00   17.81 ? 342  SER A CB  1 
ATOM   1765  O  OG  . SER A  1 235 ? 12.564  34.730  -2.178  1.00   19.04 ? 342  SER A OG  1 
ATOM   1766  N  N   . SER A  1 236 ? 10.559  36.108  -3.196  1.00   18.35 ? 343  SER A N   1 
ATOM   1767  C  CA  . SER A  1 236 ? 10.047  37.004  -4.234  1.00   19.11 ? 343  SER A CA  1 
ATOM   1768  C  C   . SER A  1 236 ? 9.292   36.322  -5.375  1.00   17.57 ? 343  SER A C   1 
ATOM   1769  O  O   . SER A  1 236 ? 9.388   35.113  -5.556  1.00   18.09 ? 343  SER A O   1 
ATOM   1770  C  CB  . SER A  1 236 ? 11.201  37.825  -4.823  1.00   17.37 ? 343  SER A CB  1 
ATOM   1771  O  OG  . SER A  1 236 ? 12.162  36.993  -5.447  1.00   16.97 ? 343  SER A OG  1 
ATOM   1772  N  N   . GLY A  1 237 ? 8.546   37.126  -6.135  1.00   18.56 ? 344  GLY A N   1 
ATOM   1773  C  CA  . GLY A  1 237 ? 7.789   36.628  -7.271  1.00   19.23 ? 344  GLY A CA  1 
ATOM   1774  C  C   . GLY A  1 237 ? 7.788   37.680  -8.372  1.00   21.09 ? 344  GLY A C   1 
ATOM   1775  O  O   . GLY A  1 237 ? 8.852   38.157  -8.787  1.00   17.14 ? 344  GLY A O   1 
ATOM   1776  N  N   . ASN A  1 238 ? 6.604   38.055  -8.854  1.00   20.20 ? 345  ASN A N   1 
ATOM   1777  C  CA  . ASN A  1 238 ? 6.525   39.066  -9.905  1.00   18.22 ? 345  ASN A CA  1 
ATOM   1778  C  C   . ASN A  1 238 ? 6.568   40.467  -9.292  1.00   16.85 ? 345  ASN A C   1 
ATOM   1779  O  O   . ASN A  1 238 ? 6.662   40.618  -8.077  1.00   16.77 ? 345  ASN A O   1 
ATOM   1780  C  CB  . ASN A  1 238 ? 5.258   38.875  -10.761 1.00   18.21 ? 345  ASN A CB  1 
ATOM   1781  C  CG  . ASN A  1 238 ? 3.968   39.050  -9.963  1.00   20.51 ? 345  ASN A CG  1 
ATOM   1782  O  OD1 . ASN A  1 238 ? 3.838   39.981  -9.158  1.00   20.94 ? 345  ASN A OD1 1 
ATOM   1783  N  ND2 . ASN A  1 238 ? 2.998   38.158  -10.197 1.00   18.27 ? 345  ASN A ND2 1 
ATOM   1784  N  N   . GLN A  1 239 ? 6.486   41.499  -10.124 1.00   16.13 ? 346  GLN A N   1 
ATOM   1785  C  CA  . GLN A  1 239 ? 6.575   42.855  -9.605  1.00   18.98 ? 346  GLN A CA  1 
ATOM   1786  C  C   . GLN A  1 239 ? 5.348   43.384  -8.886  1.00   21.22 ? 346  GLN A C   1 
ATOM   1787  O  O   . GLN A  1 239 ? 5.369   44.497  -8.381  1.00   20.30 ? 346  GLN A O   1 
ATOM   1788  C  CB  . GLN A  1 239 ? 7.032   43.819  -10.711 1.00   16.71 ? 346  GLN A CB  1 
ATOM   1789  C  CG  . GLN A  1 239 ? 8.364   43.369  -11.330 1.00   20.77 ? 346  GLN A CG  1 
ATOM   1790  C  CD  . GLN A  1 239 ? 8.998   44.392  -12.252 1.00   23.13 ? 346  GLN A CD  1 
ATOM   1791  O  OE1 . GLN A  1 239 ? 9.645   44.034  -13.239 1.00   25.38 ? 346  GLN A OE1 1 
ATOM   1792  N  NE2 . GLN A  1 239 ? 8.838   45.666  -11.927 1.00   21.66 ? 346  GLN A NE2 1 
ATOM   1793  N  N   . ASN A  1 240 ? 4.277   42.596  -8.833  1.00   20.77 ? 347  ASN A N   1 
ATOM   1794  C  CA  . ASN A  1 240 ? 3.081   43.015  -8.102  1.00   20.27 ? 347  ASN A CA  1 
ATOM   1795  C  C   . ASN A  1 240 ? 3.148   42.364  -6.719  1.00   22.07 ? 347  ASN A C   1 
ATOM   1796  O  O   . ASN A  1 240 ? 2.344   42.673  -5.838  1.00   22.15 ? 347  ASN A O   1 
ATOM   1797  C  CB  . ASN A  1 240 ? 1.790   42.558  -8.794  1.00   19.66 ? 347  ASN A CB  1 
ATOM   1798  C  CG  . ASN A  1 240 ? 1.682   43.047  -10.236 1.00   25.96 ? 347  ASN A CG  1 
ATOM   1799  O  OD1 . ASN A  1 240 ? 2.314   42.502  -11.145 1.00   29.20 ? 347  ASN A OD1 1 
ATOM   1800  N  ND2 . ASN A  1 240 ? 0.892   44.084  -10.446 1.00   26.24 ? 347  ASN A ND2 1 
ATOM   1801  N  N   . GLU A  1 241 ? 4.099   41.450  -6.541  1.00   19.73 ? 348  GLU A N   1 
ATOM   1802  C  CA  . GLU A  1 241 ? 4.270   40.760  -5.267  1.00   20.20 ? 348  GLU A CA  1 
ATOM   1803  C  C   . GLU A  1 241 ? 5.411   41.362  -4.450  1.00   19.13 ? 348  GLU A C   1 
ATOM   1804  O  O   . GLU A  1 241 ? 6.431   41.777  -5.007  1.00   19.31 ? 348  GLU A O   1 
ATOM   1805  C  CB  . GLU A  1 241 ? 4.513   39.271  -5.517  1.00   19.18 ? 348  GLU A CB  1 
ATOM   1806  C  CG  . GLU A  1 241 ? 3.290   38.602  -6.097  1.00   20.49 ? 348  GLU A CG  1 
ATOM   1807  C  CD  . GLU A  1 241 ? 3.520   37.171  -6.518  1.00   22.23 ? 348  GLU A CD  1 
ATOM   1808  O  OE1 . GLU A  1 241 ? 2.816   36.284  -5.981  1.00   22.78 ? 348  GLU A OE1 1 
ATOM   1809  O  OE2 . GLU A  1 241 ? 4.390   36.939  -7.390  1.00   21.18 ? 348  GLU A OE2 1 
ATOM   1810  N  N   . LYS A  1 242 ? 5.242   41.411  -3.134  1.00   16.51 ? 349  LYS A N   1 
ATOM   1811  C  CA  . LYS A  1 242 ? 6.273   41.984  -2.279  1.00   20.06 ? 349  LYS A CA  1 
ATOM   1812  C  C   . LYS A  1 242 ? 7.475   41.057  -2.159  1.00   20.47 ? 349  LYS A C   1 
ATOM   1813  O  O   . LYS A  1 242 ? 7.401   39.873  -2.502  1.00   19.62 ? 349  LYS A O   1 
ATOM   1814  C  CB  . LYS A  1 242 ? 5.709   42.309  -0.890  1.00   22.89 ? 349  LYS A CB  1 
ATOM   1815  C  CG  . LYS A  1 242 ? 4.509   43.273  -0.921  1.00   29.07 ? 349  LYS A CG  1 
ATOM   1816  C  CD  . LYS A  1 242 ? 4.223   43.851  0.468   1.00   39.84 ? 349  LYS A CD  1 
ATOM   1817  C  CE  . LYS A  1 242 ? 2.850   44.546  0.571   1.00   44.80 ? 349  LYS A CE  1 
ATOM   1818  N  NZ  . LYS A  1 242 ? 1.672   43.601  0.719   1.00   45.30 ? 349  LYS A NZ  1 
ATOM   1819  N  N   . GLN A  1 243 ? 8.586   41.598  -1.672  1.00   17.72 ? 350  GLN A N   1 
ATOM   1820  C  CA  . GLN A  1 243 ? 9.799   40.805  -1.534  1.00   20.08 ? 350  GLN A CA  1 
ATOM   1821  C  C   . GLN A  1 243 ? 10.287  40.772  -0.085  1.00   21.57 ? 350  GLN A C   1 
ATOM   1822  O  O   . GLN A  1 243 ? 9.525   41.108  0.824   1.00   19.59 ? 350  GLN A O   1 
ATOM   1823  C  CB  . GLN A  1 243 ? 10.856  41.349  -2.494  1.00   20.43 ? 350  GLN A CB  1 
ATOM   1824  C  CG  . GLN A  1 243 ? 10.263  41.489  -3.901  1.00   20.90 ? 350  GLN A CG  1 
ATOM   1825  C  CD  . GLN A  1 243 ? 11.269  41.820  -4.990  1.00   23.99 ? 350  GLN A CD  1 
ATOM   1826  O  OE1 . GLN A  1 243 ? 12.179  42.636  -4.800  1.00   22.24 ? 350  GLN A OE1 1 
ATOM   1827  N  NE2 . GLN A  1 243 ? 11.090  41.208  -6.156  1.00   22.63 ? 350  GLN A NE2 1 
ATOM   1828  N  N   . ILE A  1 244 ? 11.533  40.356  0.133   1.00   19.01 ? 351  ILE A N   1 
ATOM   1829  C  CA  . ILE A  1 244 ? 12.051  40.256  1.483   1.00   18.83 ? 351  ILE A CA  1 
ATOM   1830  C  C   . ILE A  1 244 ? 12.761  41.527  1.973   1.00   19.98 ? 351  ILE A C   1 
ATOM   1831  O  O   . ILE A  1 244 ? 13.617  42.101  1.280   1.00   18.92 ? 351  ILE A O   1 
ATOM   1832  C  CB  . ILE A  1 244 ? 12.989  39.033  1.612   1.00   19.42 ? 351  ILE A CB  1 
ATOM   1833  C  CG1 . ILE A  1 244 ? 12.280  37.768  1.107   1.00   20.91 ? 351  ILE A CG1 1 
ATOM   1834  C  CG2 . ILE A  1 244 ? 13.410  38.845  3.062   1.00   20.67 ? 351  ILE A CG2 1 
ATOM   1835  C  CD1 . ILE A  1 244 ? 10.861  37.542  1.653   1.00   19.14 ? 351  ILE A CD1 1 
ATOM   1836  N  N   . VAL A  1 245 ? 12.380  41.957  3.176   1.00   17.93 ? 352  VAL A N   1 
ATOM   1837  C  CA  . VAL A  1 245 ? 12.932  43.148  3.819   1.00   17.06 ? 352  VAL A CA  1 
ATOM   1838  C  C   . VAL A  1 245 ? 14.019  42.728  4.788   1.00   18.03 ? 352  VAL A C   1 
ATOM   1839  O  O   . VAL A  1 245 ? 13.771  41.934  5.696   1.00   19.22 ? 352  VAL A O   1 
ATOM   1840  C  CB  . VAL A  1 245 ? 11.844  43.905  4.615   1.00   19.66 ? 352  VAL A CB  1 
ATOM   1841  C  CG1 . VAL A  1 245 ? 12.462  45.094  5.370   1.00   19.56 ? 352  VAL A CG1 1 
ATOM   1842  C  CG2 . VAL A  1 245 ? 10.736  44.353  3.677   1.00   18.57 ? 352  VAL A CG2 1 
ATOM   1843  N  N   . THR A  1 246 ? 15.218  43.275  4.618   1.00   18.65 ? 353  THR A N   1 
ATOM   1844  C  CA  . THR A  1 246 ? 16.327  42.903  5.486   1.00   17.75 ? 353  THR A CA  1 
ATOM   1845  C  C   . THR A  1 246 ? 17.465  43.929  5.479   1.00   19.44 ? 353  THR A C   1 
ATOM   1846  O  O   . THR A  1 246 ? 17.397  44.962  4.798   1.00   16.74 ? 353  THR A O   1 
ATOM   1847  C  CB  . THR A  1 246 ? 16.882  41.509  5.059   1.00   18.04 ? 353  THR A CB  1 
ATOM   1848  O  OG1 . THR A  1 246 ? 17.866  41.069  5.997   1.00   15.53 ? 353  THR A OG1 1 
ATOM   1849  C  CG2 . THR A  1 246 ? 17.502  41.583  3.651   1.00   14.62 ? 353  THR A CG2 1 
ATOM   1850  N  N   . THR A  1 247 ? 18.507  43.631  6.252   1.00   16.98 ? 354  THR A N   1 
ATOM   1851  C  CA  . THR A  1 247 ? 19.691  44.477  6.361   1.00   17.99 ? 354  THR A CA  1 
ATOM   1852  C  C   . THR A  1 247 ? 20.524  44.408  5.080   1.00   18.95 ? 354  THR A C   1 
ATOM   1853  O  O   . THR A  1 247 ? 20.721  43.333  4.529   1.00   18.06 ? 354  THR A O   1 
ATOM   1854  C  CB  . THR A  1 247 ? 20.569  44.014  7.540   1.00   19.00 ? 354  THR A CB  1 
ATOM   1855  O  OG1 . THR A  1 247 ? 20.793  42.597  7.447   1.00   15.71 ? 354  THR A OG1 1 
ATOM   1856  C  CG2 . THR A  1 247 ? 19.881  44.322  8.863   1.00   15.78 ? 354  THR A CG2 1 
ATOM   1857  N  N   . ASP A  1 248 ? 21.020  45.553  4.619   1.00   18.00 ? 355  ASP A N   1 
ATOM   1858  C  CA  . ASP A  1 248 ? 21.816  45.593  3.399   1.00   17.32 ? 355  ASP A CA  1 
ATOM   1859  C  C   . ASP A  1 248 ? 23.187  46.173  3.686   1.00   18.63 ? 355  ASP A C   1 
ATOM   1860  O  O   . ASP A  1 248 ? 23.383  46.855  4.692   1.00   19.87 ? 355  ASP A O   1 
ATOM   1861  C  CB  . ASP A  1 248 ? 21.110  46.444  2.346   1.00   18.84 ? 355  ASP A CB  1 
ATOM   1862  C  CG  . ASP A  1 248 ? 21.550  46.124  0.931   1.00   19.11 ? 355  ASP A CG  1 
ATOM   1863  O  OD1 . ASP A  1 248 ? 22.311  45.156  0.733   1.00   20.40 ? 355  ASP A OD1 1 
ATOM   1864  O  OD2 . ASP A  1 248 ? 21.109  46.839  0.010   1.00   20.69 ? 355  ASP A OD2 1 
ATOM   1865  N  N   . LEU A  1 249 ? 24.136  45.888  2.797   1.00   20.45 ? 356  LEU A N   1 
ATOM   1866  C  CA  . LEU A  1 249 ? 25.508  46.375  2.911   1.00   19.18 ? 356  LEU A CA  1 
ATOM   1867  C  C   . LEU A  1 249 ? 25.529  47.897  3.067   1.00   20.08 ? 356  LEU A C   1 
ATOM   1868  O  O   . LEU A  1 249 ? 24.615  48.600  2.622   1.00   22.31 ? 356  LEU A O   1 
ATOM   1869  C  CB  . LEU A  1 249 ? 26.295  45.971  1.660   1.00   21.25 ? 356  LEU A CB  1 
ATOM   1870  C  CG  . LEU A  1 249 ? 27.826  45.937  1.689   1.00   21.64 ? 356  LEU A CG  1 
ATOM   1871  C  CD1 . LEU A  1 249 ? 28.311  44.985  2.780   1.00   15.36 ? 356  LEU A CD1 1 
ATOM   1872  C  CD2 . LEU A  1 249 ? 28.350  45.487  0.312   1.00   21.31 ? 356  LEU A CD2 1 
ATOM   1873  N  N   . ARG A  1 250 ? 26.575  48.398  3.714   1.00   21.11 ? 357  ARG A N   1 
ATOM   1874  C  CA  . ARG A  1 250 ? 26.744  49.826  3.953   1.00   20.26 ? 357  ARG A CA  1 
ATOM   1875  C  C   . ARG A  1 250 ? 25.680  50.352  4.918   1.00   21.63 ? 357  ARG A C   1 
ATOM   1876  O  O   . ARG A  1 250 ? 25.191  51.475  4.798   1.00   19.51 ? 357  ARG A O   1 
ATOM   1877  C  CB  . ARG A  1 250 ? 26.740  50.595  2.622   1.00   18.34 ? 357  ARG A CB  1 
ATOM   1878  C  CG  . ARG A  1 250 ? 27.909  50.207  1.720   1.00   18.86 ? 357  ARG A CG  1 
ATOM   1879  C  CD  . ARG A  1 250 ? 27.798  50.847  0.339   1.00   23.12 ? 357  ARG A CD  1 
ATOM   1880  N  NE  . ARG A  1 250 ? 28.714  50.249  -0.636  1.00   24.49 ? 357  ARG A NE  1 
ATOM   1881  C  CZ  . ARG A  1 250 ? 30.041  50.400  -0.640  1.00   28.03 ? 357  ARG A CZ  1 
ATOM   1882  N  NH1 . ARG A  1 250 ? 30.775  49.807  -1.577  1.00   28.29 ? 357  ARG A NH1 1 
ATOM   1883  N  NH2 . ARG A  1 250 ? 30.644  51.148  0.275   1.00   26.93 ? 357  ARG A NH2 1 
ATOM   1884  N  N   . GLN A  1 251 ? 25.330  49.508  5.884   1.00   22.15 ? 358  GLN A N   1 
ATOM   1885  C  CA  . GLN A  1 251 ? 24.375  49.861  6.926   1.00   23.32 ? 358  GLN A CA  1 
ATOM   1886  C  C   . GLN A  1 251 ? 23.031  50.362  6.420   1.00   21.62 ? 358  GLN A C   1 
ATOM   1887  O  O   . GLN A  1 251 ? 22.427  51.248  7.019   1.00   20.91 ? 358  GLN A O   1 
ATOM   1888  C  CB  . GLN A  1 251 ? 25.025  50.903  7.838   1.00   25.07 ? 358  GLN A CB  1 
ATOM   1889  C  CG  . GLN A  1 251 ? 26.368  50.407  8.347   1.00   28.58 ? 358  GLN A CG  1 
ATOM   1890  C  CD  . GLN A  1 251 ? 27.075  51.387  9.238   1.00   33.11 ? 358  GLN A CD  1 
ATOM   1891  O  OE1 . GLN A  1 251 ? 26.482  51.954  10.147  1.00   35.04 ? 358  GLN A OE1 1 
ATOM   1892  N  NE2 . GLN A  1 251 ? 28.363  51.583  8.993   1.00   36.80 ? 358  GLN A NE2 1 
ATOM   1893  N  N   . LYS A  1 252 ? 22.563  49.783  5.323   1.00   21.45 ? 359  LYS A N   1 
ATOM   1894  C  CA  . LYS A  1 252 ? 21.281  50.167  4.745   1.00   23.37 ? 359  LYS A CA  1 
ATOM   1895  C  C   . LYS A  1 252 ? 20.210  49.115  4.995   1.00   24.07 ? 359  LYS A C   1 
ATOM   1896  O  O   . LYS A  1 252 ? 20.463  48.061  5.589   1.00   20.58 ? 359  LYS A O   1 
ATOM   1897  C  CB  . LYS A  1 252 ? 21.429  50.393  3.241   1.00   25.30 ? 359  LYS A CB  1 
ATOM   1898  C  CG  . LYS A  1 252 ? 22.270  51.605  2.915   1.00   30.43 ? 359  LYS A CG  1 
ATOM   1899  C  CD  . LYS A  1 252 ? 22.545  51.664  1.441   1.00   39.26 ? 359  LYS A CD  1 
ATOM   1900  C  CE  . LYS A  1 252 ? 23.566  52.739  1.127   1.00   45.31 ? 359  LYS A CE  1 
ATOM   1901  N  NZ  . LYS A  1 252 ? 24.045  52.624  -0.281  1.00   50.09 ? 359  LYS A NZ  1 
ATOM   1902  N  N   . CYS A  1 253 ? 19.007  49.414  4.531   1.00   22.40 ? 360  CYS A N   1 
ATOM   1903  C  CA  . CYS A  1 253 ? 17.886  48.511  4.683   1.00   26.20 ? 360  CYS A CA  1 
ATOM   1904  C  C   . CYS A  1 253 ? 17.373  48.270  3.271   1.00   27.31 ? 360  CYS A C   1 
ATOM   1905  O  O   . CYS A  1 253 ? 17.305  49.200  2.484   1.00   30.89 ? 360  CYS A O   1 
ATOM   1906  C  CB  . CYS A  1 253 ? 16.821  49.186  5.554   1.00   28.19 ? 360  CYS A CB  1 
ATOM   1907  S  SG  . CYS A  1 253 ? 15.332  48.228  6.033   1.00   37.69 ? 360  CYS A SG  1 
ATOM   1908  N  N   . THR A  1 254 ? 17.042  47.032  2.930   1.00   24.71 ? 361  THR A N   1 
ATOM   1909  C  CA  . THR A  1 254 ? 16.535  46.770  1.598   1.00   21.85 ? 361  THR A CA  1 
ATOM   1910  C  C   . THR A  1 254 ? 15.190  46.066  1.667   1.00   25.95 ? 361  THR A C   1 
ATOM   1911  O  O   . THR A  1 254 ? 14.900  45.321  2.609   1.00   25.19 ? 361  THR A O   1 
ATOM   1912  C  CB  . THR A  1 254 ? 17.491  45.890  0.781   1.00   22.43 ? 361  THR A CB  1 
ATOM   1913  O  OG1 . THR A  1 254 ? 16.942  45.709  -0.532  1.00   23.10 ? 361  THR A OG1 1 
ATOM   1914  C  CG2 . THR A  1 254 ? 17.662  44.525  1.446   1.00   16.62 ? 361  THR A CG2 1 
ATOM   1915  N  N   . GLU A  1 255 ? 14.362  46.305  0.663   1.00   27.02 ? 362  GLU A N   1 
ATOM   1916  C  CA  . GLU A  1 255 ? 13.057  45.662  0.619   1.00   30.52 ? 362  GLU A CA  1 
ATOM   1917  C  C   . GLU A  1 255 ? 13.036  44.782  -0.615  1.00   28.79 ? 362  GLU A C   1 
ATOM   1918  O  O   . GLU A  1 255 ? 11.979  44.285  -1.028  1.00   29.97 ? 362  GLU A O   1 
ATOM   1919  C  CB  . GLU A  1 255 ? 11.941  46.721  0.562   1.00   32.56 ? 362  GLU A CB  1 
ATOM   1920  C  CG  . GLU A  1 255 ? 11.876  47.594  1.827   1.00   38.65 ? 362  GLU A CG  1 
ATOM   1921  C  CD  . GLU A  1 255 ? 10.819  48.689  1.756   1.00   44.01 ? 362  GLU A CD  1 
ATOM   1922  O  OE1 . GLU A  1 255 ? 9.638   48.361  1.527   1.00   47.73 ? 362  GLU A OE1 1 
ATOM   1923  O  OE2 . GLU A  1 255 ? 11.164  49.878  1.938   1.00   45.96 ? 362  GLU A OE2 1 
ATOM   1924  N  N   . SER A  1 256 ? 14.217  44.571  -1.190  1.00   26.11 ? 363  SER A N   1 
ATOM   1925  C  CA  . SER A  1 256 ? 14.312  43.774  -2.401  1.00   24.77 ? 363  SER A CA  1 
ATOM   1926  C  C   . SER A  1 256 ? 15.273  42.595  -2.361  1.00   24.67 ? 363  SER A C   1 
ATOM   1927  O  O   . SER A  1 256 ? 16.033  42.392  -3.320  1.00   21.05 ? 363  SER A O   1 
ATOM   1928  C  CB  . SER A  1 256 ? 14.698  44.661  -3.595  1.00   28.63 ? 363  SER A CB  1 
ATOM   1929  O  OG  . SER A  1 256 ? 14.132  45.952  -3.521  1.00   33.86 ? 363  SER A OG  1 
ATOM   1930  N  N   . HIS A  1 257 ? 15.269  41.829  -1.267  1.00   22.07 ? 364  HIS A N   1 
ATOM   1931  C  CA  . HIS A  1 257 ? 16.119  40.641  -1.193  1.00   22.10 ? 364  HIS A CA  1 
ATOM   1932  C  C   . HIS A  1 257 ? 15.245  39.600  -1.918  1.00   22.38 ? 364  HIS A C   1 
ATOM   1933  O  O   . HIS A  1 257 ? 14.050  39.484  -1.629  1.00   24.60 ? 364  HIS A O   1 
ATOM   1934  C  CB  . HIS A  1 257 ? 16.373  40.255  0.261   1.00   20.78 ? 364  HIS A CB  1 
ATOM   1935  C  CG  . HIS A  1 257 ? 17.341  39.124  0.427   1.00   19.47 ? 364  HIS A CG  1 
ATOM   1936  N  ND1 . HIS A  1 257 ? 18.358  38.880  -0.469  1.00   18.07 ? 364  HIS A ND1 1 
ATOM   1937  C  CD2 . HIS A  1 257 ? 17.487  38.212  1.420   1.00   17.96 ? 364  HIS A CD2 1 
ATOM   1938  C  CE1 . HIS A  1 257 ? 19.091  37.866  -0.037  1.00   21.02 ? 364  HIS A CE1 1 
ATOM   1939  N  NE2 . HIS A  1 257 ? 18.583  37.443  1.108   1.00   21.42 ? 364  HIS A NE2 1 
ATOM   1940  N  N   . THR A  1 258 ? 15.829  38.864  -2.863  1.00   19.12 ? 365  THR A N   1 
ATOM   1941  C  CA  . THR A  1 258 ? 15.056  37.936  -3.679  1.00   18.59 ? 365  THR A CA  1 
ATOM   1942  C  C   . THR A  1 258 ? 15.602  36.517  -3.894  1.00   19.96 ? 365  THR A C   1 
ATOM   1943  O  O   . THR A  1 258 ? 16.681  36.161  -3.434  1.00   23.18 ? 365  THR A O   1 
ATOM   1944  C  CB  . THR A  1 258 ? 14.872  38.544  -5.085  1.00   17.63 ? 365  THR A CB  1 
ATOM   1945  O  OG1 . THR A  1 258 ? 16.142  38.565  -5.748  1.00   20.05 ? 365  THR A OG1 1 
ATOM   1946  C  CG2 . THR A  1 258 ? 14.378  39.993  -5.016  1.00   14.58 ? 365  THR A CG2 1 
ATOM   1947  N  N   . GLY A  1 259 ? 14.822  35.718  -4.615  1.00   20.68 ? 366  GLY A N   1 
ATOM   1948  C  CA  . GLY A  1 259 ? 15.219  34.366  -4.967  1.00   16.87 ? 366  GLY A CA  1 
ATOM   1949  C  C   . GLY A  1 259 ? 15.314  33.323  -3.879  1.00   19.69 ? 366  GLY A C   1 
ATOM   1950  O  O   . GLY A  1 259 ? 14.880  33.523  -2.732  1.00   16.45 ? 366  GLY A O   1 
ATOM   1951  N  N   . THR A  1 260 ? 15.890  32.185  -4.258  1.00   17.52 ? 367  THR A N   1 
ATOM   1952  C  CA  . THR A  1 260 ? 16.057  31.077  -3.342  1.00   16.81 ? 367  THR A CA  1 
ATOM   1953  C  C   . THR A  1 260 ? 16.894  31.502  -2.137  1.00   17.74 ? 367  THR A C   1 
ATOM   1954  O  O   . THR A  1 260 ? 16.733  30.955  -1.043  1.00   17.64 ? 367  THR A O   1 
ATOM   1955  C  CB  . THR A  1 260 ? 16.734  29.880  -4.049  1.00   17.48 ? 367  THR A CB  1 
ATOM   1956  O  OG1 . THR A  1 260 ? 16.784  28.764  -3.157  1.00   15.69 ? 367  THR A OG1 1 
ATOM   1957  C  CG2 . THR A  1 260 ? 18.150  30.245  -4.479  1.00   14.90 ? 367  THR A CG2 1 
ATOM   1958  N  N   . SER A  1 261 ? 17.775  32.484  -2.335  1.00   17.18 ? 368  SER A N   1 
ATOM   1959  C  CA  . SER A  1 261 ? 18.651  32.970  -1.259  1.00   19.67 ? 368  SER A CA  1 
ATOM   1960  C  C   . SER A  1 261 ? 17.898  33.428  -0.022  1.00   19.32 ? 368  SER A C   1 
ATOM   1961  O  O   . SER A  1 261 ? 18.383  33.248  1.096   1.00   18.25 ? 368  SER A O   1 
ATOM   1962  C  CB  . SER A  1 261 ? 19.510  34.157  -1.717  1.00   20.10 ? 368  SER A CB  1 
ATOM   1963  O  OG  . SER A  1 261 ? 20.322  33.867  -2.838  1.00   22.13 ? 368  SER A OG  1 
ATOM   1964  N  N   . ALA A  1 262 ? 16.723  34.028  -0.224  1.00   17.73 ? 369  ALA A N   1 
ATOM   1965  C  CA  . ALA A  1 262 ? 15.943  34.549  0.895   1.00   16.88 ? 369  ALA A CA  1 
ATOM   1966  C  C   . ALA A  1 262 ? 15.145  33.503  1.669   1.00   18.18 ? 369  ALA A C   1 
ATOM   1967  O  O   . ALA A  1 262 ? 14.743  33.749  2.806   1.00   18.85 ? 369  ALA A O   1 
ATOM   1968  C  CB  . ALA A  1 262 ? 15.005  35.656  0.403   1.00   16.10 ? 369  ALA A CB  1 
ATOM   1969  N  N   . SER A  1 263 ? 14.926  32.335  1.079   1.00   16.48 ? 370  SER A N   1 
ATOM   1970  C  CA  . SER A  1 263 ? 14.147  31.316  1.763   1.00   17.39 ? 370  SER A CA  1 
ATOM   1971  C  C   . SER A  1 263 ? 14.874  30.547  2.843   1.00   15.91 ? 370  SER A C   1 
ATOM   1972  O  O   . SER A  1 263 ? 14.343  30.373  3.930   1.00   18.92 ? 370  SER A O   1 
ATOM   1973  C  CB  . SER A  1 263 ? 13.545  30.347  0.745   1.00   18.96 ? 370  SER A CB  1 
ATOM   1974  O  OG  . SER A  1 263 ? 12.503  31.001  0.043   1.00   23.16 ? 370  SER A OG  1 
ATOM   1975  N  N   . ALA A  1 264 ? 16.087  30.087  2.565   1.00   16.81 ? 371  ALA A N   1 
ATOM   1976  C  CA  . ALA A  1 264 ? 16.823  29.317  3.568   1.00   17.35 ? 371  ALA A CA  1 
ATOM   1977  C  C   . ALA A  1 264 ? 16.996  30.057  4.908   1.00   14.53 ? 371  ALA A C   1 
ATOM   1978  O  O   . ALA A  1 264 ? 16.795  29.479  5.983   1.00   18.97 ? 371  ALA A O   1 
ATOM   1979  C  CB  . ALA A  1 264 ? 18.189  28.894  3.014   1.00   14.28 ? 371  ALA A CB  1 
ATOM   1980  N  N   . PRO A  1 265 ? 17.376  31.340  4.863   1.00   13.09 ? 372  PRO A N   1 
ATOM   1981  C  CA  . PRO A  1 265 ? 17.555  32.086  6.113   1.00   15.75 ? 372  PRO A CA  1 
ATOM   1982  C  C   . PRO A  1 265 ? 16.283  32.138  6.973   1.00   16.60 ? 372  PRO A C   1 
ATOM   1983  O  O   . PRO A  1 265 ? 16.351  32.065  8.202   1.00   16.71 ? 372  PRO A O   1 
ATOM   1984  C  CB  . PRO A  1 265 ? 17.984  33.479  5.630   1.00   15.24 ? 372  PRO A CB  1 
ATOM   1985  C  CG  . PRO A  1 265 ? 18.678  33.184  4.305   1.00   16.36 ? 372  PRO A CG  1 
ATOM   1986  C  CD  . PRO A  1 265 ? 17.741  32.167  3.695   1.00   14.23 ? 372  PRO A CD  1 
ATOM   1987  N  N   . LEU A  1 266 ? 15.127  32.276  6.331   1.00   16.34 ? 373  LEU A N   1 
ATOM   1988  C  CA  . LEU A  1 266 ? 13.866  32.326  7.073   1.00   16.30 ? 373  LEU A CA  1 
ATOM   1989  C  C   . LEU A  1 266 ? 13.641  30.979  7.755   1.00   15.58 ? 373  LEU A C   1 
ATOM   1990  O  O   . LEU A  1 266 ? 13.182  30.902  8.898   1.00   17.53 ? 373  LEU A O   1 
ATOM   1991  C  CB  . LEU A  1 266 ? 12.706  32.660  6.138   1.00   14.55 ? 373  LEU A CB  1 
ATOM   1992  C  CG  . LEU A  1 266 ? 12.728  34.075  5.542   1.00   17.79 ? 373  LEU A CG  1 
ATOM   1993  C  CD1 . LEU A  1 266 ? 11.508  34.286  4.640   1.00   14.75 ? 373  LEU A CD1 1 
ATOM   1994  C  CD2 . LEU A  1 266 ? 12.734  35.104  6.660   1.00   14.26 ? 373  LEU A CD2 1 
ATOM   1995  N  N   . ALA A  1 267 ? 13.988  29.914  7.051   1.00   14.69 ? 374  ALA A N   1 
ATOM   1996  C  CA  . ALA A  1 267 ? 13.853  28.586  7.601   1.00   13.40 ? 374  ALA A CA  1 
ATOM   1997  C  C   . ALA A  1 267 ? 14.832  28.457  8.766   1.00   15.07 ? 374  ALA A C   1 
ATOM   1998  O  O   . ALA A  1 267 ? 14.478  27.942  9.830   1.00   13.84 ? 374  ALA A O   1 
ATOM   1999  C  CB  . ALA A  1 267 ? 14.149  27.547  6.527   1.00   10.89 ? 374  ALA A CB  1 
ATOM   2000  N  N   . ALA A  1 268 ? 16.065  28.931  8.570   1.00   12.73 ? 375  ALA A N   1 
ATOM   2001  C  CA  . ALA A  1 268 ? 17.059  28.848  9.639   1.00   13.90 ? 375  ALA A CA  1 
ATOM   2002  C  C   . ALA A  1 268 ? 16.544  29.572  10.884  1.00   14.10 ? 375  ALA A C   1 
ATOM   2003  O  O   . ALA A  1 268 ? 16.732  29.112  12.010  1.00   13.52 ? 375  ALA A O   1 
ATOM   2004  C  CB  . ALA A  1 268 ? 18.380  29.448  9.181   1.00   13.21 ? 375  ALA A CB  1 
ATOM   2005  N  N   . GLY A  1 269 ? 15.888  30.710  10.676  1.00   14.61 ? 376  GLY A N   1 
ATOM   2006  C  CA  . GLY A  1 269 ? 15.353  31.452  11.807  1.00   15.97 ? 376  GLY A CA  1 
ATOM   2007  C  C   . GLY A  1 269 ? 14.276  30.671  12.543  1.00   17.59 ? 376  GLY A C   1 
ATOM   2008  O  O   . GLY A  1 269 ? 14.289  30.572  13.773  1.00   19.48 ? 376  GLY A O   1 
ATOM   2009  N  N   . ILE A  1 270 ? 13.342  30.099  11.788  1.00   16.83 ? 377  ILE A N   1 
ATOM   2010  C  CA  . ILE A  1 270 ? 12.256  29.337  12.396  1.00   15.78 ? 377  ILE A CA  1 
ATOM   2011  C  C   . ILE A  1 270 ? 12.817  28.149  13.175  1.00   17.95 ? 377  ILE A C   1 
ATOM   2012  O  O   . ILE A  1 270 ? 12.340  27.815  14.259  1.00   18.42 ? 377  ILE A O   1 
ATOM   2013  C  CB  . ILE A  1 270 ? 11.242  28.881  11.315  1.00   13.86 ? 377  ILE A CB  1 
ATOM   2014  C  CG1 . ILE A  1 270 ? 10.446  30.101  10.845  1.00   16.53 ? 377  ILE A CG1 1 
ATOM   2015  C  CG2 . ILE A  1 270 ? 10.281  27.809  11.870  1.00   13.94 ? 377  ILE A CG2 1 
ATOM   2016  C  CD1 . ILE A  1 270 ? 9.539   29.851  9.642   1.00   14.37 ? 377  ILE A CD1 1 
ATOM   2017  N  N   . ILE A  1 271 ? 13.851  27.525  12.631  1.00   17.06 ? 378  ILE A N   1 
ATOM   2018  C  CA  . ILE A  1 271 ? 14.477  26.396  13.294  1.00   18.83 ? 378  ILE A CA  1 
ATOM   2019  C  C   . ILE A  1 271 ? 15.139  26.857  14.602  1.00   19.72 ? 378  ILE A C   1 
ATOM   2020  O  O   . ILE A  1 271 ? 15.161  26.116  15.587  1.00   19.32 ? 378  ILE A O   1 
ATOM   2021  C  CB  . ILE A  1 271 ? 15.497  25.722  12.340  1.00   19.27 ? 378  ILE A CB  1 
ATOM   2022  C  CG1 . ILE A  1 271 ? 14.725  25.000  11.226  1.00   19.22 ? 378  ILE A CG1 1 
ATOM   2023  C  CG2 . ILE A  1 271 ? 16.370  24.719  13.092  1.00   19.05 ? 378  ILE A CG2 1 
ATOM   2024  C  CD1 . ILE A  1 271 ? 15.558  24.590  10.030  1.00   16.41 ? 378  ILE A CD1 1 
ATOM   2025  N  N   . ALA A  1 272 ? 15.671  28.079  14.613  1.00   17.62 ? 379  ALA A N   1 
ATOM   2026  C  CA  . ALA A  1 272 ? 16.288  28.622  15.817  1.00   17.27 ? 379  ALA A CA  1 
ATOM   2027  C  C   . ALA A  1 272 ? 15.218  28.762  16.910  1.00   18.66 ? 379  ALA A C   1 
ATOM   2028  O  O   . ALA A  1 272 ? 15.468  28.467  18.077  1.00   19.94 ? 379  ALA A O   1 
ATOM   2029  C  CB  . ALA A  1 272 ? 16.910  29.979  15.520  1.00   13.09 ? 379  ALA A CB  1 
ATOM   2030  N  N   . LEU A  1 273 ? 14.028  29.218  16.533  1.00   18.09 ? 380  LEU A N   1 
ATOM   2031  C  CA  . LEU A  1 273 ? 12.954  29.366  17.507  1.00   19.99 ? 380  LEU A CA  1 
ATOM   2032  C  C   . LEU A  1 273 ? 12.599  27.986  18.044  1.00   19.60 ? 380  LEU A C   1 
ATOM   2033  O  O   . LEU A  1 273 ? 12.338  27.805  19.230  1.00   19.61 ? 380  LEU A O   1 
ATOM   2034  C  CB  . LEU A  1 273 ? 11.703  29.980  16.859  1.00   17.01 ? 380  LEU A CB  1 
ATOM   2035  C  CG  . LEU A  1 273 ? 11.801  31.330  16.131  1.00   21.70 ? 380  LEU A CG  1 
ATOM   2036  C  CD1 . LEU A  1 273 ? 10.387  31.767  15.701  1.00   14.51 ? 380  LEU A CD1 1 
ATOM   2037  C  CD2 . LEU A  1 273 ? 12.438  32.400  17.026  1.00   15.31 ? 380  LEU A CD2 1 
ATOM   2038  N  N   . THR A  1 274 ? 12.618  27.004  17.157  1.00   18.08 ? 381  THR A N   1 
ATOM   2039  C  CA  . THR A  1 274 ? 12.271  25.644  17.524  1.00   19.50 ? 381  THR A CA  1 
ATOM   2040  C  C   . THR A  1 274 ? 13.275  25.041  18.500  1.00   22.48 ? 381  THR A C   1 
ATOM   2041  O  O   . THR A  1 274 ? 12.884  24.351  19.443  1.00   22.84 ? 381  THR A O   1 
ATOM   2042  C  CB  . THR A  1 274 ? 12.145  24.767  16.252  1.00   20.58 ? 381  THR A CB  1 
ATOM   2043  O  OG1 . THR A  1 274 ? 11.232  25.397  15.341  1.00   18.69 ? 381  THR A OG1 1 
ATOM   2044  C  CG2 . THR A  1 274 ? 11.596  23.387  16.582  1.00   16.50 ? 381  THR A CG2 1 
ATOM   2045  N  N   . LEU A  1 275 ? 14.565  25.299  18.283  1.00   23.25 ? 382  LEU A N   1 
ATOM   2046  C  CA  . LEU A  1 275 ? 15.583  24.779  19.183  1.00   21.26 ? 382  LEU A CA  1 
ATOM   2047  C  C   . LEU A  1 275 ? 15.456  25.436  20.554  1.00   20.63 ? 382  LEU A C   1 
ATOM   2048  O  O   . LEU A  1 275 ? 15.725  24.799  21.567  1.00   19.05 ? 382  LEU A O   1 
ATOM   2049  C  CB  . LEU A  1 275 ? 16.992  25.000  18.618  1.00   19.33 ? 382  LEU A CB  1 
ATOM   2050  C  CG  . LEU A  1 275 ? 17.430  23.962  17.572  1.00   22.41 ? 382  LEU A CG  1 
ATOM   2051  C  CD1 . LEU A  1 275 ? 18.822  24.315  17.052  1.00   24.73 ? 382  LEU A CD1 1 
ATOM   2052  C  CD2 . LEU A  1 275 ? 17.448  22.550  18.179  1.00   18.92 ? 382  LEU A CD2 1 
ATOM   2053  N  N   . GLU A  1 276 ? 15.038  26.699  20.595  1.00   17.17 ? 383  GLU A N   1 
ATOM   2054  C  CA  . GLU A  1 276 ? 14.886  27.357  21.892  1.00   18.12 ? 383  GLU A CA  1 
ATOM   2055  C  C   . GLU A  1 276 ? 13.756  26.646  22.644  1.00   17.35 ? 383  GLU A C   1 
ATOM   2056  O  O   . GLU A  1 276 ? 13.856  26.406  23.839  1.00   14.26 ? 383  GLU A O   1 
ATOM   2057  C  CB  . GLU A  1 276 ? 14.557  28.853  21.747  1.00   18.56 ? 383  GLU A CB  1 
ATOM   2058  C  CG  . GLU A  1 276 ? 14.469  29.537  23.109  1.00   19.88 ? 383  GLU A CG  1 
ATOM   2059  C  CD  . GLU A  1 276 ? 14.031  30.991  23.040  1.00   24.38 ? 383  GLU A CD  1 
ATOM   2060  O  OE1 . GLU A  1 276 ? 13.683  31.480  21.940  1.00   25.52 ? 383  GLU A OE1 1 
ATOM   2061  O  OE2 . GLU A  1 276 ? 14.034  31.648  24.102  1.00   23.50 ? 383  GLU A OE2 1 
ATOM   2062  N  N   . ALA A  1 277 ? 12.691  26.302  21.923  1.00   15.31 ? 384  ALA A N   1 
ATOM   2063  C  CA  . ALA A  1 277 ? 11.557  25.595  22.504  1.00   15.05 ? 384  ALA A CA  1 
ATOM   2064  C  C   . ALA A  1 277 ? 11.969  24.213  23.026  1.00   19.44 ? 384  ALA A C   1 
ATOM   2065  O  O   . ALA A  1 277 ? 11.377  23.706  23.974  1.00   18.87 ? 384  ALA A O   1 
ATOM   2066  C  CB  . ALA A  1 277 ? 10.456  25.446  21.467  1.00   13.10 ? 384  ALA A CB  1 
ATOM   2067  N  N   . ASN A  1 278 ? 12.964  23.599  22.390  1.00   17.83 ? 385  ASN A N   1 
ATOM   2068  C  CA  . ASN A  1 278 ? 13.455  22.287  22.814  1.00   22.65 ? 385  ASN A CA  1 
ATOM   2069  C  C   . ASN A  1 278 ? 14.898  22.111  22.335  1.00   23.14 ? 385  ASN A C   1 
ATOM   2070  O  O   . ASN A  1 278 ? 15.131  21.692  21.199  1.00   24.83 ? 385  ASN A O   1 
ATOM   2071  C  CB  . ASN A  1 278 ? 12.571  21.172  22.236  1.00   20.48 ? 385  ASN A CB  1 
ATOM   2072  C  CG  . ASN A  1 278 ? 12.964  19.789  22.740  1.00   20.82 ? 385  ASN A CG  1 
ATOM   2073  O  OD1 . ASN A  1 278 ? 14.069  19.589  23.234  1.00   21.99 ? 385  ASN A OD1 1 
ATOM   2074  N  ND2 . ASN A  1 278 ? 12.069  18.827  22.594  1.00   17.67 ? 385  ASN A ND2 1 
ATOM   2075  N  N   . LYS A  1 279 ? 15.852  22.433  23.208  1.00   22.13 ? 386  LYS A N   1 
ATOM   2076  C  CA  . LYS A  1 279 ? 17.272  22.350  22.891  1.00   21.67 ? 386  LYS A CA  1 
ATOM   2077  C  C   . LYS A  1 279 ? 17.803  20.931  22.725  1.00   22.71 ? 386  LYS A C   1 
ATOM   2078  O  O   . LYS A  1 279 ? 18.939  20.747  22.296  1.00   24.43 ? 386  LYS A O   1 
ATOM   2079  C  CB  . LYS A  1 279 ? 18.097  23.065  23.972  1.00   25.62 ? 386  LYS A CB  1 
ATOM   2080  C  CG  . LYS A  1 279 ? 17.805  24.560  24.124  1.00   28.52 ? 386  LYS A CG  1 
ATOM   2081  C  CD  . LYS A  1 279 ? 18.670  25.204  25.201  0.0000 27.67 ? 386  LYS A CD  1 
ATOM   2082  C  CE  . LYS A  1 279 ? 20.130  25.315  24.778  0.0000 27.97 ? 386  LYS A CE  1 
ATOM   2083  N  NZ  . LYS A  1 279 ? 20.783  23.995  24.557  0.0000 27.87 ? 386  LYS A NZ  1 
ATOM   2084  N  N   . ASN A  1 280 ? 16.996  19.932  23.056  1.00   21.13 ? 387  ASN A N   1 
ATOM   2085  C  CA  . ASN A  1 280 ? 17.437  18.549  22.937  1.00   25.17 ? 387  ASN A CA  1 
ATOM   2086  C  C   . ASN A  1 280 ? 17.066  17.867  21.633  1.00   23.29 ? 387  ASN A C   1 
ATOM   2087  O  O   . ASN A  1 280 ? 17.310  16.672  21.469  1.00   21.50 ? 387  ASN A O   1 
ATOM   2088  C  CB  . ASN A  1 280 ? 16.915  17.720  24.116  1.00   30.65 ? 387  ASN A CB  1 
ATOM   2089  C  CG  . ASN A  1 280 ? 17.843  17.780  25.316  1.00   38.94 ? 387  ASN A CG  1 
ATOM   2090  O  OD1 . ASN A  1 280 ? 17.505  17.316  26.414  1.00   47.17 ? 387  ASN A OD1 1 
ATOM   2091  N  ND2 . ASN A  1 280 ? 19.028  18.354  25.112  1.00   40.09 ? 387  ASN A ND2 1 
ATOM   2092  N  N   . LEU A  1 281 ? 16.474  18.612  20.705  1.00   19.92 ? 388  LEU A N   1 
ATOM   2093  C  CA  . LEU A  1 281 ? 16.099  18.035  19.413  1.00   18.83 ? 388  LEU A CA  1 
ATOM   2094  C  C   . LEU A  1 281 ? 17.352  17.666  18.618  1.00   18.89 ? 388  LEU A C   1 
ATOM   2095  O  O   . LEU A  1 281 ? 18.283  18.456  18.544  1.00   18.90 ? 388  LEU A O   1 
ATOM   2096  C  CB  . LEU A  1 281 ? 15.268  19.041  18.603  1.00   18.43 ? 388  LEU A CB  1 
ATOM   2097  C  CG  . LEU A  1 281 ? 13.864  19.428  19.127  1.00   19.92 ? 388  LEU A CG  1 
ATOM   2098  C  CD1 . LEU A  1 281 ? 13.301  20.601  18.326  1.00   16.91 ? 388  LEU A CD1 1 
ATOM   2099  C  CD2 . LEU A  1 281 ? 12.914  18.236  19.037  1.00   14.66 ? 388  LEU A CD2 1 
ATOM   2100  N  N   . THR A  1 282 ? 17.374  16.472  18.026  1.00   17.82 ? 389  THR A N   1 
ATOM   2101  C  CA  . THR A  1 282 ? 18.516  16.036  17.222  1.00   14.41 ? 389  THR A CA  1 
ATOM   2102  C  C   . THR A  1 282 ? 18.306  16.555  15.794  1.00   15.21 ? 389  THR A C   1 
ATOM   2103  O  O   . THR A  1 282 ? 17.238  17.084  15.477  1.00   16.53 ? 389  THR A O   1 
ATOM   2104  C  CB  . THR A  1 282 ? 18.603  14.501  17.157  1.00   16.94 ? 389  THR A CB  1 
ATOM   2105  O  OG1 . THR A  1 282 ? 17.461  14.001  16.451  1.00   16.37 ? 389  THR A OG1 1 
ATOM   2106  C  CG2 . THR A  1 282 ? 18.626  13.886  18.571  1.00   12.09 ? 389  THR A CG2 1 
ATOM   2107  N  N   . TRP A  1 283 ? 19.312  16.409  14.935  1.00   15.08 ? 390  TRP A N   1 
ATOM   2108  C  CA  . TRP A  1 283 ? 19.183  16.856  13.549  1.00   14.39 ? 390  TRP A CA  1 
ATOM   2109  C  C   . TRP A  1 283 ? 18.029  16.112  12.849  1.00   16.90 ? 390  TRP A C   1 
ATOM   2110  O  O   . TRP A  1 283 ? 17.370  16.667  11.972  1.00   15.64 ? 390  TRP A O   1 
ATOM   2111  C  CB  . TRP A  1 283 ? 20.504  16.648  12.777  1.00   16.18 ? 390  TRP A CB  1 
ATOM   2112  C  CG  . TRP A  1 283 ? 20.890  15.216  12.518  1.00   15.42 ? 390  TRP A CG  1 
ATOM   2113  C  CD1 . TRP A  1 283 ? 21.497  14.358  13.391  1.00   16.63 ? 390  TRP A CD1 1 
ATOM   2114  C  CD2 . TRP A  1 283 ? 20.679  14.474  11.304  1.00   14.42 ? 390  TRP A CD2 1 
ATOM   2115  N  NE1 . TRP A  1 283 ? 21.678  13.128  12.795  1.00   14.87 ? 390  TRP A NE1 1 
ATOM   2116  C  CE2 . TRP A  1 283 ? 21.187  13.171  11.517  1.00   15.58 ? 390  TRP A CE2 1 
ATOM   2117  C  CE3 . TRP A  1 283 ? 20.105  14.784  10.060  1.00   15.25 ? 390  TRP A CE3 1 
ATOM   2118  C  CZ2 . TRP A  1 283 ? 21.141  12.168  10.524  1.00   15.54 ? 390  TRP A CZ2 1 
ATOM   2119  C  CZ3 . TRP A  1 283 ? 20.054  13.792  9.072   1.00   18.12 ? 390  TRP A CZ3 1 
ATOM   2120  C  CH2 . TRP A  1 283 ? 20.573  12.496  9.314   1.00   18.39 ? 390  TRP A CH2 1 
ATOM   2121  N  N   . ARG A  1 284 ? 17.776  14.860  13.230  1.00   16.89 ? 391  ARG A N   1 
ATOM   2122  C  CA  . ARG A  1 284 ? 16.675  14.113  12.630  1.00   17.46 ? 391  ARG A CA  1 
ATOM   2123  C  C   . ARG A  1 284 ? 15.339  14.561  13.213  1.00   18.81 ? 391  ARG A C   1 
ATOM   2124  O  O   . ARG A  1 284 ? 14.354  14.660  12.481  1.00   17.22 ? 391  ARG A O   1 
ATOM   2125  C  CB  . ARG A  1 284 ? 16.861  12.599  12.827  1.00   20.38 ? 391  ARG A CB  1 
ATOM   2126  C  CG  . ARG A  1 284 ? 17.874  11.990  11.867  1.00   19.57 ? 391  ARG A CG  1 
ATOM   2127  C  CD  . ARG A  1 284 ? 18.302  10.586  12.287  1.00   17.36 ? 391  ARG A CD  1 
ATOM   2128  N  NE  . ARG A  1 284 ? 17.165  9.668   12.351  1.00   20.93 ? 391  ARG A NE  1 
ATOM   2129  C  CZ  . ARG A  1 284 ? 16.877  8.927   13.414  1.00   19.59 ? 391  ARG A CZ  1 
ATOM   2130  N  NH1 . ARG A  1 284 ? 15.823  8.119   13.407  1.00   18.01 ? 391  ARG A NH1 1 
ATOM   2131  N  NH2 . ARG A  1 284 ? 17.655  8.996   14.486  1.00   14.83 ? 391  ARG A NH2 1 
ATOM   2132  N  N   . ASP A  1 285 ? 15.291  14.837  14.518  1.00   19.16 ? 392  ASP A N   1 
ATOM   2133  C  CA  . ASP A  1 285 ? 14.040  15.298  15.129  1.00   18.25 ? 392  ASP A CA  1 
ATOM   2134  C  C   . ASP A  1 285 ? 13.562  16.539  14.388  1.00   18.92 ? 392  ASP A C   1 
ATOM   2135  O  O   . ASP A  1 285 ? 12.368  16.694  14.093  1.00   18.05 ? 392  ASP A O   1 
ATOM   2136  C  CB  . ASP A  1 285 ? 14.225  15.688  16.605  1.00   21.05 ? 392  ASP A CB  1 
ATOM   2137  C  CG  . ASP A  1 285 ? 14.419  14.488  17.522  1.00   20.46 ? 392  ASP A CG  1 
ATOM   2138  O  OD1 . ASP A  1 285 ? 13.814  13.415  17.271  1.00   20.81 ? 392  ASP A OD1 1 
ATOM   2139  O  OD2 . ASP A  1 285 ? 15.168  14.637  18.511  1.00   24.48 ? 392  ASP A OD2 1 
ATOM   2140  N  N   . MET A  1 286 ? 14.501  17.431  14.088  1.00   19.40 ? 393  MET A N   1 
ATOM   2141  C  CA  . MET A  1 286 ? 14.159  18.677  13.416  1.00   18.40 ? 393  MET A CA  1 
ATOM   2142  C  C   . MET A  1 286 ? 13.493  18.432  12.067  1.00   19.11 ? 393  MET A C   1 
ATOM   2143  O  O   . MET A  1 286 ? 12.545  19.134  11.703  1.00   17.47 ? 393  MET A O   1 
ATOM   2144  C  CB  . MET A  1 286 ? 15.402  19.553  13.228  1.00   18.77 ? 393  MET A CB  1 
ATOM   2145  C  CG  . MET A  1 286 ? 15.075  20.974  12.762  1.00   17.46 ? 393  MET A CG  1 
ATOM   2146  S  SD  . MET A  1 286 ? 14.036  21.896  13.928  1.00   18.58 ? 393  MET A SD  1 
ATOM   2147  C  CE  . MET A  1 286 ? 15.120  21.999  15.364  1.00   18.43 ? 393  MET A CE  1 
ATOM   2148  N  N   . GLN A  1 287 ? 13.984  17.453  11.313  1.00   15.50 ? 394  GLN A N   1 
ATOM   2149  C  CA  . GLN A  1 287 ? 13.369  17.171  10.027  1.00   16.01 ? 394  GLN A CA  1 
ATOM   2150  C  C   . GLN A  1 287 ? 11.964  16.578  10.229  1.00   17.62 ? 394  GLN A C   1 
ATOM   2151  O  O   . GLN A  1 287 ? 11.043  16.868  9.456   1.00   14.61 ? 394  GLN A O   1 
ATOM   2152  C  CB  . GLN A  1 287 ? 14.273  16.254  9.186   1.00   14.55 ? 394  GLN A CB  1 
ATOM   2153  C  CG  . GLN A  1 287 ? 15.499  17.010  8.635   1.00   16.34 ? 394  GLN A CG  1 
ATOM   2154  C  CD  . GLN A  1 287 ? 16.345  16.212  7.617   1.00   18.77 ? 394  GLN A CD  1 
ATOM   2155  O  OE1 . GLN A  1 287 ? 15.817  15.511  6.742   1.00   14.20 ? 394  GLN A OE1 1 
ATOM   2156  N  NE2 . GLN A  1 287 ? 17.663  16.348  7.720   1.00   14.74 ? 394  GLN A NE2 1 
ATOM   2157  N  N   . HIS A  1 288 ? 11.784  15.785  11.285  1.00   17.03 ? 395  HIS A N   1 
ATOM   2158  C  CA  . HIS A  1 288 ? 10.472  15.206  11.565  1.00   19.57 ? 395  HIS A CA  1 
ATOM   2159  C  C   . HIS A  1 288 ? 9.475   16.328  11.850  1.00   18.21 ? 395  HIS A C   1 
ATOM   2160  O  O   . HIS A  1 288 ? 8.359   16.326  11.328  1.00   19.33 ? 395  HIS A O   1 
ATOM   2161  C  CB  . HIS A  1 288 ? 10.534  14.264  12.766  1.00   17.51 ? 395  HIS A CB  1 
ATOM   2162  C  CG  . HIS A  1 288 ? 10.975  12.882  12.420  1.00   17.59 ? 395  HIS A CG  1 
ATOM   2163  N  ND1 . HIS A  1 288 ? 10.092  11.898  12.031  1.00   18.12 ? 395  HIS A ND1 1 
ATOM   2164  C  CD2 . HIS A  1 288 ? 12.201  12.309  12.426  1.00   18.20 ? 395  HIS A CD2 1 
ATOM   2165  C  CE1 . HIS A  1 288 ? 10.756  10.776  11.819  1.00   19.41 ? 395  HIS A CE1 1 
ATOM   2166  N  NE2 . HIS A  1 288 ? 12.037  10.995  12.053  1.00   14.36 ? 395  HIS A NE2 1 
ATOM   2167  N  N   . LEU A  1 289 ? 9.889   17.290  12.669  1.00   19.11 ? 396  LEU A N   1 
ATOM   2168  C  CA  . LEU A  1 289 ? 9.027   18.426  13.009  1.00   16.89 ? 396  LEU A CA  1 
ATOM   2169  C  C   . LEU A  1 289 ? 8.572   19.190  11.768  1.00   16.99 ? 396  LEU A C   1 
ATOM   2170  O  O   . LEU A  1 289 ? 7.404   19.559  11.639  1.00   20.35 ? 396  LEU A O   1 
ATOM   2171  C  CB  . LEU A  1 289 ? 9.753   19.375  13.956  1.00   15.68 ? 396  LEU A CB  1 
ATOM   2172  C  CG  . LEU A  1 289 ? 10.031  18.839  15.360  1.00   22.85 ? 396  LEU A CG  1 
ATOM   2173  C  CD1 . LEU A  1 289 ? 10.622  19.949  16.210  1.00   22.66 ? 396  LEU A CD1 1 
ATOM   2174  C  CD2 . LEU A  1 289 ? 8.749   18.346  15.987  1.00   22.50 ? 396  LEU A CD2 1 
ATOM   2175  N  N   . VAL A  1 290 ? 9.499   19.424  10.847  1.00   17.79 ? 397  VAL A N   1 
ATOM   2176  C  CA  . VAL A  1 290 ? 9.194   20.140  9.610   1.00   18.06 ? 397  VAL A CA  1 
ATOM   2177  C  C   . VAL A  1 290 ? 8.180   19.370  8.760   1.00   18.86 ? 397  VAL A C   1 
ATOM   2178  O  O   . VAL A  1 290 ? 7.240   19.955  8.204   1.00   19.28 ? 397  VAL A O   1 
ATOM   2179  C  CB  . VAL A  1 290 ? 10.486  20.382  8.772   1.00   15.65 ? 397  VAL A CB  1 
ATOM   2180  C  CG1 . VAL A  1 290 ? 10.128  20.927  7.375   1.00   9.96  ? 397  VAL A CG1 1 
ATOM   2181  C  CG2 . VAL A  1 290 ? 11.395  21.381  9.505   1.00   13.32 ? 397  VAL A CG2 1 
ATOM   2182  N  N   . VAL A  1 291 ? 8.377   18.063  8.649   1.00   18.44 ? 398  VAL A N   1 
ATOM   2183  C  CA  . VAL A  1 291 ? 7.477   17.232  7.862   1.00   17.29 ? 398  VAL A CA  1 
ATOM   2184  C  C   . VAL A  1 291 ? 6.081   17.265  8.462   1.00   19.57 ? 398  VAL A C   1 
ATOM   2185  O  O   . VAL A  1 291 ? 5.090   17.423  7.746   1.00   16.68 ? 398  VAL A O   1 
ATOM   2186  C  CB  . VAL A  1 291 ? 7.958   15.750  7.812   1.00   19.96 ? 398  VAL A CB  1 
ATOM   2187  C  CG1 . VAL A  1 291 ? 6.834   14.845  7.281   1.00   19.59 ? 398  VAL A CG1 1 
ATOM   2188  C  CG2 . VAL A  1 291 ? 9.179   15.622  6.899   1.00   17.49 ? 398  VAL A CG2 1 
ATOM   2189  N  N   . GLN A  1 292 ? 6.005   17.135  9.782   1.00   19.25 ? 399  GLN A N   1 
ATOM   2190  C  CA  . GLN A  1 292 ? 4.711   17.108  10.448  1.00   20.81 ? 399  GLN A CA  1 
ATOM   2191  C  C   . GLN A  1 292 ? 3.952   18.423  10.507  1.00   21.50 ? 399  GLN A C   1 
ATOM   2192  O  O   . GLN A  1 292 ? 2.735   18.429  10.394  1.00   24.14 ? 399  GLN A O   1 
ATOM   2193  C  CB  . GLN A  1 292 ? 4.856   16.539  11.861  1.00   19.90 ? 399  GLN A CB  1 
ATOM   2194  C  CG  . GLN A  1 292 ? 4.930   15.032  11.859  1.00   19.35 ? 399  GLN A CG  1 
ATOM   2195  C  CD  . GLN A  1 292 ? 4.732   14.432  13.227  1.00   23.74 ? 399  GLN A CD  1 
ATOM   2196  O  OE1 . GLN A  1 292 ? 3.972   14.956  14.044  1.00   22.80 ? 399  GLN A OE1 1 
ATOM   2197  N  NE2 . GLN A  1 292 ? 5.397   13.310  13.482  1.00   21.05 ? 399  GLN A NE2 1 
ATOM   2198  N  N   . THR A  1 293 ? 4.659   19.536  10.633  1.00   19.91 ? 400  THR A N   1 
ATOM   2199  C  CA  . THR A  1 293 ? 3.986   20.816  10.773  1.00   18.48 ? 400  THR A CA  1 
ATOM   2200  C  C   . THR A  1 293 ? 3.849   21.693  9.541   1.00   20.38 ? 400  THR A C   1 
ATOM   2201  O  O   . THR A  1 293 ? 3.105   22.672  9.571   1.00   20.15 ? 400  THR A O   1 
ATOM   2202  C  CB  . THR A  1 293 ? 4.655   21.647  11.868  1.00   16.04 ? 400  THR A CB  1 
ATOM   2203  O  OG1 . THR A  1 293 ? 6.003   21.945  11.485  1.00   17.12 ? 400  THR A OG1 1 
ATOM   2204  C  CG2 . THR A  1 293 ? 4.664   20.873  13.178  1.00   11.91 ? 400  THR A CG2 1 
ATOM   2205  N  N   . SER A  1 294 ? 4.543   21.364  8.461   1.00   21.57 ? 401  SER A N   1 
ATOM   2206  C  CA  . SER A  1 294 ? 4.453   22.203  7.269   1.00   22.86 ? 401  SER A CA  1 
ATOM   2207  C  C   . SER A  1 294 ? 3.088   22.138  6.601   1.00   24.71 ? 401  SER A C   1 
ATOM   2208  O  O   . SER A  1 294 ? 2.473   21.074  6.513   1.00   25.45 ? 401  SER A O   1 
ATOM   2209  C  CB  . SER A  1 294 ? 5.566   21.852  6.290   1.00   21.10 ? 401  SER A CB  1 
ATOM   2210  O  OG  . SER A  1 294 ? 6.819   22.160  6.878   1.00   13.80 ? 401  SER A OG  1 
ATOM   2211  N  N   . LYS A  1 295 ? 2.629   23.297  6.129   1.00   25.77 ? 402  LYS A N   1 
ATOM   2212  C  CA  . LYS A  1 295 ? 1.304   23.451  5.530   1.00   26.16 ? 402  LYS A CA  1 
ATOM   2213  C  C   . LYS A  1 295 ? 1.233   23.655  4.018   1.00   26.61 ? 402  LYS A C   1 
ATOM   2214  O  O   . LYS A  1 295 ? 1.829   24.577  3.476   1.00   26.20 ? 402  LYS A O   1 
ATOM   2215  C  CB  . LYS A  1 295 ? 0.596   24.643  6.180   1.00   25.88 ? 402  LYS A CB  1 
ATOM   2216  C  CG  . LYS A  1 295 ? 0.588   24.664  7.699   1.00   29.98 ? 402  LYS A CG  1 
ATOM   2217  C  CD  . LYS A  1 295 ? -0.325  23.578  8.272   1.00   32.80 ? 402  LYS A CD  1 
ATOM   2218  C  CE  . LYS A  1 295 ? -0.607  23.805  9.752   1.00   30.32 ? 402  LYS A CE  1 
ATOM   2219  N  NZ  . LYS A  1 295 ? 0.637   23.805  10.563  1.00   30.40 ? 402  LYS A NZ  1 
ATOM   2220  N  N   . PRO A  1 296 ? 0.508   22.784  3.317   1.00   26.68 ? 403  PRO A N   1 
ATOM   2221  C  CA  . PRO A  1 296 ? 0.387   22.943  1.867   1.00   28.90 ? 403  PRO A CA  1 
ATOM   2222  C  C   . PRO A  1 296 ? -0.631  24.037  1.536   1.00   32.88 ? 403  PRO A C   1 
ATOM   2223  O  O   . PRO A  1 296 ? -0.419  24.863  0.648   1.00   32.68 ? 403  PRO A O   1 
ATOM   2224  C  CB  . PRO A  1 296 ? -0.073  21.562  1.394   1.00   27.04 ? 403  PRO A CB  1 
ATOM   2225  C  CG  . PRO A  1 296 ? -0.645  20.933  2.603   1.00   30.77 ? 403  PRO A CG  1 
ATOM   2226  C  CD  . PRO A  1 296 ? 0.237   21.397  3.717   1.00   24.45 ? 403  PRO A CD  1 
ATOM   2227  N  N   . ALA A  1 297 ? -1.725  24.048  2.288   1.00   37.18 ? 404  ALA A N   1 
ATOM   2228  C  CA  . ALA A  1 297 ? -2.809  24.993  2.071   1.00   41.34 ? 404  ALA A CA  1 
ATOM   2229  C  C   . ALA A  1 297 ? -2.302  26.376  1.752   1.00   41.64 ? 404  ALA A C   1 
ATOM   2230  O  O   . ALA A  1 297 ? -1.394  26.880  2.414   1.00   47.10 ? 404  ALA A O   1 
ATOM   2231  C  CB  . ALA A  1 297 ? -3.715  25.035  3.286   1.00   44.81 ? 404  ALA A CB  1 
ATOM   2232  N  N   . HIS A  1 298 ? -2.894  26.964  0.721   1.00   41.31 ? 405  HIS A N   1 
ATOM   2233  C  CA  . HIS A  1 298 ? -2.562  28.304  0.247   1.00   40.93 ? 405  HIS A CA  1 
ATOM   2234  C  C   . HIS A  1 298 ? -1.486  28.306  -0.833  1.00   38.91 ? 405  HIS A C   1 
ATOM   2235  O  O   . HIS A  1 298 ? -1.271  29.327  -1.488  1.00   43.55 ? 405  HIS A O   1 
ATOM   2236  C  CB  . HIS A  1 298 ? -2.139  29.205  1.417   1.00   42.17 ? 405  HIS A CB  1 
ATOM   2237  C  CG  . HIS A  1 298 ? -3.209  29.393  2.449   0.0000 41.82 ? 405  HIS A CG  1 
ATOM   2238  N  ND1 . HIS A  1 298 ? -2.997  30.076  3.626   0.0000 41.93 ? 405  HIS A ND1 1 
ATOM   2239  C  CD2 . HIS A  1 298 ? -4.503  28.993  2.473   0.0000 41.93 ? 405  HIS A CD2 1 
ATOM   2240  C  CE1 . HIS A  1 298 ? -4.114  30.092  4.332   0.0000 41.91 ? 405  HIS A CE1 1 
ATOM   2241  N  NE2 . HIS A  1 298 ? -5.043  29.441  3.654   0.0000 41.91 ? 405  HIS A NE2 1 
ATOM   2242  N  N   . LEU A  1 299 ? -0.821  27.170  -1.027  1.00   31.03 ? 406  LEU A N   1 
ATOM   2243  C  CA  . LEU A  1 299 ? 0.229   27.062  -2.035  1.00   25.96 ? 406  LEU A CA  1 
ATOM   2244  C  C   . LEU A  1 299 ? -0.284  26.374  -3.295  1.00   25.07 ? 406  LEU A C   1 
ATOM   2245  O  O   . LEU A  1 299 ? -0.828  25.278  -3.226  1.00   26.97 ? 406  LEU A O   1 
ATOM   2246  C  CB  . LEU A  1 299 ? 1.415   26.290  -1.450  1.00   22.99 ? 406  LEU A CB  1 
ATOM   2247  C  CG  . LEU A  1 299 ? 2.709   27.030  -1.085  1.00   24.46 ? 406  LEU A CG  1 
ATOM   2248  C  CD1 . LEU A  1 299 ? 2.446   28.405  -0.518  1.00   19.19 ? 406  LEU A CD1 1 
ATOM   2249  C  CD2 . LEU A  1 299 ? 3.493   26.179  -0.112  1.00   26.29 ? 406  LEU A CD2 1 
ATOM   2250  N  N   . ASN A  1 300 ? -0.109  27.011  -4.448  1.00   23.03 ? 407  ASN A N   1 
ATOM   2251  C  CA  . ASN A  1 300 ? -0.572  26.426  -5.704  1.00   22.89 ? 407  ASN A CA  1 
ATOM   2252  C  C   . ASN A  1 300 ? 0.533   25.677  -6.439  1.00   23.28 ? 407  ASN A C   1 
ATOM   2253  O  O   . ASN A  1 300 ? 1.644   26.179  -6.605  1.00   23.96 ? 407  ASN A O   1 
ATOM   2254  C  CB  . ASN A  1 300 ? -1.146  27.517  -6.612  1.00   23.70 ? 407  ASN A CB  1 
ATOM   2255  C  CG  . ASN A  1 300 ? -2.142  28.413  -5.875  1.00   29.39 ? 407  ASN A CG  1 
ATOM   2256  O  OD1 . ASN A  1 300 ? -3.066  27.923  -5.216  1.00   34.28 ? 407  ASN A OD1 1 
ATOM   2257  N  ND2 . ASN A  1 300 ? -1.956  29.725  -5.975  1.00   29.43 ? 407  ASN A ND2 1 
ATOM   2258  N  N   . ALA A  1 301 ? 0.210   24.468  -6.874  1.00   22.45 ? 408  ALA A N   1 
ATOM   2259  C  CA  . ALA A  1 301 ? 1.142   23.627  -7.606  1.00   26.02 ? 408  ALA A CA  1 
ATOM   2260  C  C   . ALA A  1 301 ? 0.305   22.624  -8.381  1.00   27.51 ? 408  ALA A C   1 
ATOM   2261  O  O   . ALA A  1 301 ? -0.800  22.278  -7.970  1.00   28.90 ? 408  ALA A O   1 
ATOM   2262  C  CB  . ALA A  1 301 ? 2.073   22.901  -6.645  1.00   23.70 ? 408  ALA A CB  1 
ATOM   2263  N  N   . ASN A  1 302 ? 0.827   22.146  -9.497  1.00   28.51 ? 409  ASN A N   1 
ATOM   2264  C  CA  . ASN A  1 302 ? 0.079   21.193  -10.287 1.00   30.79 ? 409  ASN A CA  1 
ATOM   2265  C  C   . ASN A  1 302 ? 0.428   19.762  -9.941  1.00   29.37 ? 409  ASN A C   1 
ATOM   2266  O  O   . ASN A  1 302 ? -0.097  18.841  -10.556 1.00   29.64 ? 409  ASN A O   1 
ATOM   2267  C  CB  . ASN A  1 302 ? 0.319   21.463  -11.775 1.00   35.70 ? 409  ASN A CB  1 
ATOM   2268  C  CG  . ASN A  1 302 ? -0.050  22.902  -12.164 1.00   45.35 ? 409  ASN A CG  1 
ATOM   2269  O  OD1 . ASN A  1 302 ? -1.154  23.385  -11.855 1.00   45.87 ? 409  ASN A OD1 1 
ATOM   2270  N  ND2 . ASN A  1 302 ? 0.875   23.594  -12.834 1.00   47.82 ? 409  ASN A ND2 1 
ATOM   2271  N  N   . ASP A  1 303 ? 1.290   19.563  -8.945  1.00   26.31 ? 410  ASP A N   1 
ATOM   2272  C  CA  . ASP A  1 303 ? 1.670   18.201  -8.590  1.00   25.85 ? 410  ASP A CA  1 
ATOM   2273  C  C   . ASP A  1 303 ? 1.422   17.796  -7.147  1.00   24.42 ? 410  ASP A C   1 
ATOM   2274  O  O   . ASP A  1 303 ? 2.035   16.853  -6.669  1.00   24.85 ? 410  ASP A O   1 
ATOM   2275  C  CB  . ASP A  1 303 ? 3.140   17.955  -8.946  1.00   26.48 ? 410  ASP A CB  1 
ATOM   2276  C  CG  . ASP A  1 303 ? 4.098   18.746  -8.063  1.00   27.68 ? 410  ASP A CG  1 
ATOM   2277  O  OD1 . ASP A  1 303 ? 3.702   19.828  -7.584  1.00   22.23 ? 410  ASP A OD1 1 
ATOM   2278  O  OD2 . ASP A  1 303 ? 5.249   18.289  -7.859  1.00   27.19 ? 410  ASP A OD2 1 
ATOM   2279  N  N   . TRP A  1 304 ? 0.538   18.497  -6.441  1.00   22.66 ? 411  TRP A N   1 
ATOM   2280  C  CA  . TRP A  1 304 ? 0.261   18.093  -5.067  1.00   24.50 ? 411  TRP A CA  1 
ATOM   2281  C  C   . TRP A  1 304 ? -0.260  16.663  -5.117  1.00   25.50 ? 411  TRP A C   1 
ATOM   2282  O  O   . TRP A  1 304 ? -1.123  16.347  -5.927  1.00   27.17 ? 411  TRP A O   1 
ATOM   2283  C  CB  . TRP A  1 304 ? -0.799  18.984  -4.419  1.00   22.23 ? 411  TRP A CB  1 
ATOM   2284  C  CG  . TRP A  1 304 ? -0.265  20.281  -3.899  1.00   22.25 ? 411  TRP A CG  1 
ATOM   2285  C  CD1 . TRP A  1 304 ? -0.589  21.539  -4.332  1.00   18.64 ? 411  TRP A CD1 1 
ATOM   2286  C  CD2 . TRP A  1 304 ? 0.666   20.450  -2.829  1.00   20.77 ? 411  TRP A CD2 1 
ATOM   2287  N  NE1 . TRP A  1 304 ? 0.083   22.480  -3.594  1.00   23.07 ? 411  TRP A NE1 1 
ATOM   2288  C  CE2 . TRP A  1 304 ? 0.861   21.842  -2.663  1.00   21.59 ? 411  TRP A CE2 1 
ATOM   2289  C  CE3 . TRP A  1 304 ? 1.352   19.560  -1.989  1.00   19.79 ? 411  TRP A CE3 1 
ATOM   2290  C  CZ2 . TRP A  1 304 ? 1.722   22.370  -1.687  1.00   20.17 ? 411  TRP A CZ2 1 
ATOM   2291  C  CZ3 . TRP A  1 304 ? 2.209   20.083  -1.017  1.00   19.39 ? 411  TRP A CZ3 1 
ATOM   2292  C  CH2 . TRP A  1 304 ? 2.384   21.481  -0.877  1.00   20.15 ? 411  TRP A CH2 1 
ATOM   2293  N  N   . ALA A  1 305 ? 0.268   15.799  -4.261  1.00   24.49 ? 412  ALA A N   1 
ATOM   2294  C  CA  . ALA A  1 305 ? -0.169  14.412  -4.225  1.00   24.26 ? 412  ALA A CA  1 
ATOM   2295  C  C   . ALA A  1 305 ? -0.116  13.939  -2.784  1.00   25.16 ? 412  ALA A C   1 
ATOM   2296  O  O   . ALA A  1 305 ? 0.734   14.385  -2.012  1.00   25.81 ? 412  ALA A O   1 
ATOM   2297  C  CB  . ALA A  1 305 ? 0.737   13.546  -5.105  1.00   22.03 ? 412  ALA A CB  1 
ATOM   2298  N  N   . THR A  1 306 ? -1.028  13.044  -2.420  1.00   23.89 ? 413  THR A N   1 
ATOM   2299  C  CA  . THR A  1 306 ? -1.076  12.528  -1.058  1.00   25.98 ? 413  THR A CA  1 
ATOM   2300  C  C   . THR A  1 306 ? -0.216  11.273  -0.972  1.00   27.00 ? 413  THR A C   1 
ATOM   2301  O  O   . THR A  1 306 ? -0.350  10.367  -1.788  1.00   27.38 ? 413  THR A O   1 
ATOM   2302  C  CB  . THR A  1 306 ? -2.515  12.200  -0.663  1.00   26.89 ? 413  THR A CB  1 
ATOM   2303  O  OG1 . THR A  1 306 ? -3.331  13.350  -0.908  1.00   27.87 ? 413  THR A OG1 1 
ATOM   2304  C  CG2 . THR A  1 306 ? -2.592  11.827  0.816   1.00   24.65 ? 413  THR A CG2 1 
ATOM   2305  N  N   . ASN A  1 307 ? 0.684   11.221  0.002   1.00   26.03 ? 414  ASN A N   1 
ATOM   2306  C  CA  . ASN A  1 307 ? 1.542   10.059  0.113   1.00   25.73 ? 414  ASN A CA  1 
ATOM   2307  C  C   . ASN A  1 307 ? 0.899   8.953   0.936   1.00   25.81 ? 414  ASN A C   1 
ATOM   2308  O  O   . ASN A  1 307 ? -0.263  9.054   1.332   1.00   28.78 ? 414  ASN A O   1 
ATOM   2309  C  CB  . ASN A  1 307 ? 2.909   10.442  0.690   1.00   20.41 ? 414  ASN A CB  1 
ATOM   2310  C  CG  . ASN A  1 307 ? 2.829   10.935  2.111   1.00   21.25 ? 414  ASN A CG  1 
ATOM   2311  O  OD1 . ASN A  1 307 ? 1.779   10.848  2.755   1.00   20.90 ? 414  ASN A OD1 1 
ATOM   2312  N  ND2 . ASN A  1 307 ? 3.953   11.448  2.623   1.00   20.35 ? 414  ASN A ND2 1 
ATOM   2313  N  N   . GLY A  1 308 ? 1.669   7.902   1.187   1.00   26.66 ? 415  GLY A N   1 
ATOM   2314  C  CA  . GLY A  1 308 ? 1.171   6.753   1.924   1.00   26.82 ? 415  GLY A CA  1 
ATOM   2315  C  C   . GLY A  1 308 ? 0.645   6.998   3.318   1.00   27.00 ? 415  GLY A C   1 
ATOM   2316  O  O   . GLY A  1 308 ? -0.087  6.170   3.844   1.00   26.79 ? 415  GLY A O   1 
ATOM   2317  N  N   . VAL A  1 309 ? 1.004   8.123   3.924   1.00   26.16 ? 416  VAL A N   1 
ATOM   2318  C  CA  . VAL A  1 309 ? 0.535   8.409   5.273   1.00   25.67 ? 416  VAL A CA  1 
ATOM   2319  C  C   . VAL A  1 309 ? -0.419  9.589   5.317   1.00   24.75 ? 416  VAL A C   1 
ATOM   2320  O  O   . VAL A  1 309 ? -0.641  10.186  6.369   1.00   24.99 ? 416  VAL A O   1 
ATOM   2321  C  CB  . VAL A  1 309 ? 1.717   8.641   6.258   1.00   28.30 ? 416  VAL A CB  1 
ATOM   2322  C  CG1 . VAL A  1 309 ? 2.554   7.367   6.344   1.00   25.15 ? 416  VAL A CG1 1 
ATOM   2323  C  CG2 . VAL A  1 309 ? 2.576   9.814   5.804   1.00   26.70 ? 416  VAL A CG2 1 
ATOM   2324  N  N   . GLY A  1 310 ? -0.983  9.922   4.163   1.00   23.55 ? 417  GLY A N   1 
ATOM   2325  C  CA  . GLY A  1 310 ? -1.958  10.998  4.106   1.00   23.60 ? 417  GLY A CA  1 
ATOM   2326  C  C   . GLY A  1 310 ? -1.468  12.430  4.065   1.00   25.16 ? 417  GLY A C   1 
ATOM   2327  O  O   . GLY A  1 310 ? -2.257  13.354  4.262   1.00   26.47 ? 417  GLY A O   1 
ATOM   2328  N  N   . ARG A  1 311 ? -0.181  12.639  3.814   1.00   25.11 ? 418  ARG A N   1 
ATOM   2329  C  CA  . ARG A  1 311 ? 0.323   13.997  3.756   1.00   22.50 ? 418  ARG A CA  1 
ATOM   2330  C  C   . ARG A  1 311 ? 0.484   14.443  2.309   1.00   22.81 ? 418  ARG A C   1 
ATOM   2331  O  O   . ARG A  1 311 ? 0.852   13.651  1.440   1.00   21.83 ? 418  ARG A O   1 
ATOM   2332  C  CB  . ARG A  1 311 ? 1.643   14.116  4.532   1.00   21.28 ? 418  ARG A CB  1 
ATOM   2333  C  CG  . ARG A  1 311 ? 1.443   13.960  6.034   1.00   24.85 ? 418  ARG A CG  1 
ATOM   2334  C  CD  . ARG A  1 311 ? 2.624   14.433  6.882   1.00   27.96 ? 418  ARG A CD  1 
ATOM   2335  N  NE  . ARG A  1 311 ? 3.552   13.349  7.151   1.00   33.92 ? 418  ARG A NE  1 
ATOM   2336  C  CZ  . ARG A  1 311 ? 3.775   12.810  8.346   1.00   27.63 ? 418  ARG A CZ  1 
ATOM   2337  N  NH1 . ARG A  1 311 ? 4.642   11.823  8.445   1.00   30.03 ? 418  ARG A NH1 1 
ATOM   2338  N  NH2 . ARG A  1 311 ? 3.155   13.250  9.432   1.00   23.14 ? 418  ARG A NH2 1 
ATOM   2339  N  N   . LYS A  1 312 ? 0.157   15.705  2.047   1.00   20.18 ? 419  LYS A N   1 
ATOM   2340  C  CA  . LYS A  1 312 ? 0.294   16.271  0.714   1.00   22.92 ? 419  LYS A CA  1 
ATOM   2341  C  C   . LYS A  1 312 ? 1.749   16.661  0.478   1.00   21.08 ? 419  LYS A C   1 
ATOM   2342  O  O   . LYS A  1 312 ? 2.388   17.243  1.349   1.00   21.61 ? 419  LYS A O   1 
ATOM   2343  C  CB  . LYS A  1 312 ? -0.561  17.526  0.579   1.00   26.32 ? 419  LYS A CB  1 
ATOM   2344  C  CG  . LYS A  1 312 ? -2.045  17.291  0.550   1.00   28.23 ? 419  LYS A CG  1 
ATOM   2345  C  CD  . LYS A  1 312 ? -2.458  16.655  -0.743  1.00   35.05 ? 419  LYS A CD  1 
ATOM   2346  C  CE  . LYS A  1 312 ? -3.687  17.347  -1.307  1.00   41.36 ? 419  LYS A CE  1 
ATOM   2347  N  NZ  . LYS A  1 312 ? -4.812  17.351  -0.336  1.00   44.19 ? 419  LYS A NZ  1 
ATOM   2348  N  N   . VAL A  1 313 ? 2.265   16.347  -0.701  1.00   18.44 ? 420  VAL A N   1 
ATOM   2349  C  CA  . VAL A  1 313 ? 3.643   16.685  -1.031  1.00   21.55 ? 420  VAL A CA  1 
ATOM   2350  C  C   . VAL A  1 313 ? 3.717   17.156  -2.483  1.00   20.15 ? 420  VAL A C   1 
ATOM   2351  O  O   . VAL A  1 313 ? 2.960   16.692  -3.341  1.00   19.14 ? 420  VAL A O   1 
ATOM   2352  C  CB  . VAL A  1 313 ? 4.607   15.466  -0.869  1.00   23.87 ? 420  VAL A CB  1 
ATOM   2353  C  CG1 . VAL A  1 313 ? 6.018   15.965  -0.706  1.00   23.76 ? 420  VAL A CG1 1 
ATOM   2354  C  CG2 . VAL A  1 313 ? 4.228   14.629  0.323   1.00   24.12 ? 420  VAL A CG2 1 
ATOM   2355  N  N   . SER A  1 314 ? 4.627   18.086  -2.741  1.00   18.77 ? 421  SER A N   1 
ATOM   2356  C  CA  . SER A  1 314 ? 4.836   18.632  -4.078  1.00   19.35 ? 421  SER A CA  1 
ATOM   2357  C  C   . SER A  1 314 ? 6.343   18.696  -4.324  1.00   19.15 ? 421  SER A C   1 
ATOM   2358  O  O   . SER A  1 314 ? 7.119   18.901  -3.386  1.00   19.71 ? 421  SER A O   1 
ATOM   2359  C  CB  . SER A  1 314 ? 4.245   20.041  -4.169  1.00   18.14 ? 421  SER A CB  1 
ATOM   2360  O  OG  . SER A  1 314 ? 4.727   20.729  -5.310  1.00   18.87 ? 421  SER A OG  1 
ATOM   2361  N  N   . HIS A  1 315 ? 6.757   18.515  -5.571  1.00   16.63 ? 422  HIS A N   1 
ATOM   2362  C  CA  . HIS A  1 315 ? 8.174   18.580  -5.879  1.00   18.73 ? 422  HIS A CA  1 
ATOM   2363  C  C   . HIS A  1 315 ? 8.673   20.030  -5.880  1.00   19.20 ? 422  HIS A C   1 
ATOM   2364  O  O   . HIS A  1 315 ? 9.879   20.284  -5.883  1.00   20.46 ? 422  HIS A O   1 
ATOM   2365  C  CB  . HIS A  1 315 ? 8.461   17.899  -7.222  1.00   20.20 ? 422  HIS A CB  1 
ATOM   2366  C  CG  . HIS A  1 315 ? 8.310   16.406  -7.185  1.00   20.57 ? 422  HIS A CG  1 
ATOM   2367  N  ND1 . HIS A  1 315 ? 7.081   15.781  -7.128  1.00   22.09 ? 422  HIS A ND1 1 
ATOM   2368  C  CD2 . HIS A  1 315 ? 9.235   15.415  -7.177  1.00   19.45 ? 422  HIS A CD2 1 
ATOM   2369  C  CE1 . HIS A  1 315 ? 7.256   14.471  -7.086  1.00   21.64 ? 422  HIS A CE1 1 
ATOM   2370  N  NE2 . HIS A  1 315 ? 8.554   14.222  -7.114  1.00   17.99 ? 422  HIS A NE2 1 
ATOM   2371  N  N   . SER A  1 316 ? 7.742   20.979  -5.863  1.00   17.30 ? 423  SER A N   1 
ATOM   2372  C  CA  . SER A  1 316 ? 8.111   22.387  -5.835  1.00   18.29 ? 423  SER A CA  1 
ATOM   2373  C  C   . SER A  1 316 ? 8.172   22.912  -4.411  1.00   18.25 ? 423  SER A C   1 
ATOM   2374  O  O   . SER A  1 316 ? 8.870   23.887  -4.147  1.00   18.34 ? 423  SER A O   1 
ATOM   2375  C  CB  . SER A  1 316 ? 7.085   23.245  -6.594  1.00   18.51 ? 423  SER A CB  1 
ATOM   2376  O  OG  . SER A  1 316 ? 7.173   23.056  -7.991  1.00   21.32 ? 423  SER A OG  1 
ATOM   2377  N  N   . TYR A  1 317 ? 7.461   22.249  -3.499  1.00   16.40 ? 424  TYR A N   1 
ATOM   2378  C  CA  . TYR A  1 317 ? 7.357   22.719  -2.114  1.00   16.52 ? 424  TYR A CA  1 
ATOM   2379  C  C   . TYR A  1 317 ? 7.688   21.758  -0.987  1.00   17.15 ? 424  TYR A C   1 
ATOM   2380  O  O   . TYR A  1 317 ? 7.729   22.173  0.178   1.00   20.90 ? 424  TYR A O   1 
ATOM   2381  C  CB  . TYR A  1 317 ? 5.925   23.194  -1.842  1.00   14.42 ? 424  TYR A CB  1 
ATOM   2382  C  CG  . TYR A  1 317 ? 5.372   24.247  -2.766  1.00   11.75 ? 424  TYR A CG  1 
ATOM   2383  C  CD1 . TYR A  1 317 ? 6.008   25.482  -2.903  1.00   18.01 ? 424  TYR A CD1 1 
ATOM   2384  C  CD2 . TYR A  1 317 ? 4.147   24.057  -3.417  1.00   16.22 ? 424  TYR A CD2 1 
ATOM   2385  C  CE1 . TYR A  1 317 ? 5.439   26.510  -3.657  1.00   18.05 ? 424  TYR A CE1 1 
ATOM   2386  C  CE2 . TYR A  1 317 ? 3.558   25.091  -4.178  1.00   17.70 ? 424  TYR A CE2 1 
ATOM   2387  C  CZ  . TYR A  1 317 ? 4.211   26.309  -4.285  1.00   18.58 ? 424  TYR A CZ  1 
ATOM   2388  O  OH  . TYR A  1 317 ? 3.632   27.351  -4.972  1.00   18.34 ? 424  TYR A OH  1 
ATOM   2389  N  N   . GLY A  1 318 ? 7.895   20.486  -1.298  1.00   17.24 ? 425  GLY A N   1 
ATOM   2390  C  CA  . GLY A  1 318 ? 8.144   19.539  -0.235  1.00   15.23 ? 425  GLY A CA  1 
ATOM   2391  C  C   . GLY A  1 318 ? 6.814   19.383  0.489   1.00   16.72 ? 425  GLY A C   1 
ATOM   2392  O  O   . GLY A  1 318 ? 5.782   19.224  -0.152  1.00   17.89 ? 425  GLY A O   1 
ATOM   2393  N  N   . TYR A  1 319 ? 6.812   19.467  1.813   1.00   17.16 ? 426  TYR A N   1 
ATOM   2394  C  CA  . TYR A  1 319 ? 5.571   19.316  2.552   1.00   18.64 ? 426  TYR A CA  1 
ATOM   2395  C  C   . TYR A  1 319 ? 4.796   20.612  2.708   1.00   19.91 ? 426  TYR A C   1 
ATOM   2396  O  O   . TYR A  1 319 ? 3.768   20.651  3.373   1.00   20.61 ? 426  TYR A O   1 
ATOM   2397  C  CB  . TYR A  1 319 ? 5.850   18.685  3.912   1.00   18.99 ? 426  TYR A CB  1 
ATOM   2398  C  CG  . TYR A  1 319 ? 6.168   17.213  3.772   1.00   20.70 ? 426  TYR A CG  1 
ATOM   2399  C  CD1 . TYR A  1 319 ? 7.454   16.780  3.479   1.00   17.88 ? 426  TYR A CD1 1 
ATOM   2400  C  CD2 . TYR A  1 319 ? 5.156   16.254  3.854   1.00   20.80 ? 426  TYR A CD2 1 
ATOM   2401  C  CE1 . TYR A  1 319 ? 7.726   15.423  3.267   1.00   20.78 ? 426  TYR A CE1 1 
ATOM   2402  C  CE2 . TYR A  1 319 ? 5.414   14.901  3.637   1.00   19.77 ? 426  TYR A CE2 1 
ATOM   2403  C  CZ  . TYR A  1 319 ? 6.694   14.491  3.345   1.00   20.91 ? 426  TYR A CZ  1 
ATOM   2404  O  OH  . TYR A  1 319 ? 6.938   13.152  3.120   1.00   20.16 ? 426  TYR A OH  1 
ATOM   2405  N  N   . GLY A  1 320 ? 5.285   21.676  2.085   1.00   18.36 ? 427  GLY A N   1 
ATOM   2406  C  CA  . GLY A  1 320 ? 4.588   22.939  2.190   1.00   18.32 ? 427  GLY A CA  1 
ATOM   2407  C  C   . GLY A  1 320 ? 5.315   24.038  2.942   1.00   19.28 ? 427  GLY A C   1 
ATOM   2408  O  O   . GLY A  1 320 ? 6.515   23.963  3.204   1.00   17.77 ? 427  GLY A O   1 
ATOM   2409  N  N   . LEU A  1 321 ? 4.555   25.069  3.286   1.00   18.98 ? 428  LEU A N   1 
ATOM   2410  C  CA  . LEU A  1 321 ? 5.051   26.243  3.992   1.00   19.10 ? 428  LEU A CA  1 
ATOM   2411  C  C   . LEU A  1 321 ? 5.375   25.951  5.467   1.00   20.15 ? 428  LEU A C   1 
ATOM   2412  O  O   . LEU A  1 321 ? 4.604   25.283  6.151   1.00   16.76 ? 428  LEU A O   1 
ATOM   2413  C  CB  . LEU A  1 321 ? 3.979   27.318  3.904   1.00   21.20 ? 428  LEU A CB  1 
ATOM   2414  C  CG  . LEU A  1 321 ? 4.285   28.799  3.728   1.00   27.03 ? 428  LEU A CG  1 
ATOM   2415  C  CD1 . LEU A  1 321 ? 5.249   29.036  2.570   1.00   21.50 ? 428  LEU A CD1 1 
ATOM   2416  C  CD2 . LEU A  1 321 ? 2.949   29.512  3.480   1.00   23.63 ? 428  LEU A CD2 1 
ATOM   2417  N  N   . LEU A  1 322 ? 6.516   26.443  5.952   1.00   17.37 ? 429  LEU A N   1 
ATOM   2418  C  CA  . LEU A  1 322 ? 6.873   26.247  7.354   1.00   17.40 ? 429  LEU A CA  1 
ATOM   2419  C  C   . LEU A  1 322 ? 5.873   27.037  8.203   1.00   17.47 ? 429  LEU A C   1 
ATOM   2420  O  O   . LEU A  1 322 ? 5.403   28.104  7.798   1.00   16.96 ? 429  LEU A O   1 
ATOM   2421  C  CB  . LEU A  1 322 ? 8.295   26.762  7.637   1.00   16.41 ? 429  LEU A CB  1 
ATOM   2422  C  CG  . LEU A  1 322 ? 9.470   26.048  6.969   1.00   15.79 ? 429  LEU A CG  1 
ATOM   2423  C  CD1 . LEU A  1 322 ? 10.775  26.752  7.361   1.00   16.49 ? 429  LEU A CD1 1 
ATOM   2424  C  CD2 . LEU A  1 322 ? 9.481   24.582  7.369   1.00   9.28  ? 429  LEU A CD2 1 
ATOM   2425  N  N   . ASP A  1 323 ? 5.567   26.508  9.380   1.00   17.10 ? 430  ASP A N   1 
ATOM   2426  C  CA  . ASP A  1 323 ? 4.622   27.124  10.309  1.00   16.65 ? 430  ASP A CA  1 
ATOM   2427  C  C   . ASP A  1 323 ? 5.348   27.241  11.647  1.00   18.79 ? 430  ASP A C   1 
ATOM   2428  O  O   . ASP A  1 323 ? 5.395   26.270  12.406  1.00   17.33 ? 430  ASP A O   1 
ATOM   2429  C  CB  . ASP A  1 323 ? 3.404   26.214  10.456  1.00   20.25 ? 430  ASP A CB  1 
ATOM   2430  C  CG  . ASP A  1 323 ? 2.339   26.799  11.358  1.00   22.75 ? 430  ASP A CG  1 
ATOM   2431  O  OD1 . ASP A  1 323 ? 2.674   27.551  12.304  1.00   22.89 ? 430  ASP A OD1 1 
ATOM   2432  O  OD2 . ASP A  1 323 ? 1.159   26.484  11.123  1.00   25.59 ? 430  ASP A OD2 1 
ATOM   2433  N  N   . ALA A  1 324 ? 5.907   28.420  11.933  1.00   16.54 ? 431  ALA A N   1 
ATOM   2434  C  CA  . ALA A  1 324 ? 6.672   28.620  13.157  1.00   16.71 ? 431  ALA A CA  1 
ATOM   2435  C  C   . ALA A  1 324 ? 5.904   28.311  14.434  1.00   17.95 ? 431  ALA A C   1 
ATOM   2436  O  O   . ALA A  1 324 ? 6.427   27.654  15.333  1.00   19.50 ? 431  ALA A O   1 
ATOM   2437  C  CB  . ALA A  1 324 ? 7.213   30.043  13.203  1.00   17.00 ? 431  ALA A CB  1 
ATOM   2438  N  N   . GLY A  1 325 ? 4.670   28.796  14.521  1.00   19.69 ? 432  GLY A N   1 
ATOM   2439  C  CA  . GLY A  1 325 ? 3.865   28.533  15.700  1.00   17.47 ? 432  GLY A CA  1 
ATOM   2440  C  C   . GLY A  1 325 ? 3.690   27.042  15.939  1.00   17.75 ? 432  GLY A C   1 
ATOM   2441  O  O   . GLY A  1 325 ? 3.829   26.559  17.074  1.00   18.20 ? 432  GLY A O   1 
ATOM   2442  N  N   . ALA A  1 326 ? 3.389   26.301  14.874  1.00   16.29 ? 433  ALA A N   1 
ATOM   2443  C  CA  . ALA A  1 326 ? 3.208   24.854  14.992  1.00   17.05 ? 433  ALA A CA  1 
ATOM   2444  C  C   . ALA A  1 326 ? 4.539   24.163  15.329  1.00   17.17 ? 433  ALA A C   1 
ATOM   2445  O  O   . ALA A  1 326 ? 4.582   23.211  16.100  1.00   17.79 ? 433  ALA A O   1 
ATOM   2446  C  CB  . ALA A  1 326 ? 2.629   24.294  13.695  1.00   15.43 ? 433  ALA A CB  1 
ATOM   2447  N  N   . MET A  1 327 ? 5.626   24.654  14.746  1.00   19.71 ? 434  MET A N   1 
ATOM   2448  C  CA  . MET A  1 327 ? 6.948   24.088  14.993  1.00   19.64 ? 434  MET A CA  1 
ATOM   2449  C  C   . MET A  1 327 ? 7.323   24.164  16.478  1.00   18.65 ? 434  MET A C   1 
ATOM   2450  O  O   . MET A  1 327 ? 7.708   23.157  17.079  1.00   18.23 ? 434  MET A O   1 
ATOM   2451  C  CB  . MET A  1 327 ? 8.009   24.826  14.165  1.00   19.77 ? 434  MET A CB  1 
ATOM   2452  C  CG  . MET A  1 327 ? 8.090   24.434  12.684  1.00   17.57 ? 434  MET A CG  1 
ATOM   2453  S  SD  . MET A  1 327 ? 8.862   22.805  12.395  1.00   21.52 ? 434  MET A SD  1 
ATOM   2454  C  CE  . MET A  1 327 ? 10.631  23.171  12.737  1.00   19.43 ? 434  MET A CE  1 
ATOM   2455  N  N   . VAL A  1 328 ? 7.208   25.350  17.069  1.00   15.38 ? 435  VAL A N   1 
ATOM   2456  C  CA  . VAL A  1 328 ? 7.568   25.498  18.474  1.00   16.27 ? 435  VAL A CA  1 
ATOM   2457  C  C   . VAL A  1 328 ? 6.591   24.771  19.382  1.00   19.02 ? 435  VAL A C   1 
ATOM   2458  O  O   . VAL A  1 328 ? 6.978   24.265  20.436  1.00   16.77 ? 435  VAL A O   1 
ATOM   2459  C  CB  . VAL A  1 328 ? 7.665   26.988  18.882  1.00   20.71 ? 435  VAL A CB  1 
ATOM   2460  C  CG1 . VAL A  1 328 ? 8.824   27.641  18.146  1.00   15.11 ? 435  VAL A CG1 1 
ATOM   2461  C  CG2 . VAL A  1 328 ? 6.353   27.713  18.583  1.00   17.53 ? 435  VAL A CG2 1 
ATOM   2462  N  N   . ALA A  1 329 ? 5.324   24.697  18.975  1.00   18.85 ? 436  ALA A N   1 
ATOM   2463  C  CA  . ALA A  1 329 ? 4.335   23.997  19.796  1.00   20.18 ? 436  ALA A CA  1 
ATOM   2464  C  C   . ALA A  1 329 ? 4.659   22.498  19.858  1.00   20.97 ? 436  ALA A C   1 
ATOM   2465  O  O   . ALA A  1 329 ? 4.739   21.914  20.940  1.00   23.73 ? 436  ALA A O   1 
ATOM   2466  C  CB  . ALA A  1 329 ? 2.933   24.199  19.235  1.00   17.51 ? 436  ALA A CB  1 
ATOM   2467  N  N   . LEU A  1 330 ? 4.850   21.880  18.695  1.00   19.76 ? 437  LEU A N   1 
ATOM   2468  C  CA  . LEU A  1 330 ? 5.161   20.457  18.642  1.00   19.20 ? 437  LEU A CA  1 
ATOM   2469  C  C   . LEU A  1 330 ? 6.514   20.109  19.282  1.00   20.74 ? 437  LEU A C   1 
ATOM   2470  O  O   . LEU A  1 330 ? 6.677   19.035  19.861  1.00   16.16 ? 437  LEU A O   1 
ATOM   2471  C  CB  . LEU A  1 330 ? 5.136   19.968  17.194  1.00   20.32 ? 437  LEU A CB  1 
ATOM   2472  C  CG  . LEU A  1 330 ? 5.320   18.461  16.957  1.00   26.49 ? 437  LEU A CG  1 
ATOM   2473  C  CD1 . LEU A  1 330 ? 4.265   17.687  17.732  1.00   24.91 ? 437  LEU A CD1 1 
ATOM   2474  C  CD2 . LEU A  1 330 ? 5.200   18.144  15.470  1.00   24.92 ? 437  LEU A CD2 1 
ATOM   2475  N  N   . ALA A  1 331 ? 7.472   21.028  19.175  1.00   17.45 ? 438  ALA A N   1 
ATOM   2476  C  CA  . ALA A  1 331 ? 8.797   20.812  19.734  1.00   19.99 ? 438  ALA A CA  1 
ATOM   2477  C  C   . ALA A  1 331 ? 8.782   20.567  21.235  1.00   19.36 ? 438  ALA A C   1 
ATOM   2478  O  O   . ALA A  1 331 ? 9.456   19.693  21.729  1.00   18.87 ? 438  ALA A O   1 
ATOM   2479  C  CB  . ALA A  1 331 ? 9.683   21.986  19.425  1.00   17.78 ? 438  ALA A CB  1 
ATOM   2480  N  N   . GLN A  1 332 ? 7.987   21.332  21.958  1.00   24.22 ? 439  GLN A N   1 
ATOM   2481  C  CA  . GLN A  1 332 ? 7.928   21.202  23.400  1.00   29.71 ? 439  GLN A CA  1 
ATOM   2482  C  C   . GLN A  1 332 ? 7.566   19.817  23.894  1.00   32.88 ? 439  GLN A C   1 
ATOM   2483  O  O   . GLN A  1 332 ? 8.133   19.327  24.866  1.00   38.48 ? 439  GLN A O   1 
ATOM   2484  C  CB  . GLN A  1 332 ? 6.958   22.230  23.955  1.00   27.18 ? 439  GLN A CB  1 
ATOM   2485  C  CG  . GLN A  1 332 ? 7.367   23.631  23.584  1.00   28.06 ? 439  GLN A CG  1 
ATOM   2486  C  CD  . GLN A  1 332 ? 6.358   24.633  24.032  1.00   30.37 ? 439  GLN A CD  1 
ATOM   2487  O  OE1 . GLN A  1 332 ? 6.105   24.771  25.226  1.00   32.50 ? 439  GLN A OE1 1 
ATOM   2488  N  NE2 . GLN A  1 332 ? 5.759   25.341  23.082  1.00   29.73 ? 439  GLN A NE2 1 
ATOM   2489  N  N   . ASN A  1 333 ? 6.642   19.173  23.202  1.00   34.34 ? 440  ASN A N   1 
ATOM   2490  C  CA  . ASN A  1 333 ? 6.173   17.840  23.584  1.00   39.19 ? 440  ASN A CA  1 
ATOM   2491  C  C   . ASN A  1 333 ? 6.898   16.676  22.881  1.00   38.48 ? 440  ASN A C   1 
ATOM   2492  O  O   . ASN A  1 333 ? 6.628   15.525  23.174  1.00   43.06 ? 440  ASN A O   1 
ATOM   2493  C  CB  . ASN A  1 333 ? 4.668   17.779  23.257  1.00   42.60 ? 440  ASN A CB  1 
ATOM   2494  C  CG  . ASN A  1 333 ? 3.796   17.273  24.374  1.00   43.63 ? 440  ASN A CG  1 
ATOM   2495  O  OD1 . ASN A  1 333 ? 3.433   16.096  24.399  0.0000 43.18 ? 440  ASN A OD1 1 
ATOM   2496  N  ND2 . ASN A  1 333 ? 3.439   18.160  25.302  0.0000 43.18 ? 440  ASN A ND2 1 
ATOM   2497  N  N   . TRP A  1 334 ? 7.824   16.982  21.981  1.00   34.76 ? 441  TRP A N   1 
ATOM   2498  C  CA  . TRP A  1 334 ? 8.508   15.963  21.197  1.00   28.64 ? 441  TRP A CA  1 
ATOM   2499  C  C   . TRP A  1 334 ? 9.396   14.967  21.912  1.00   26.84 ? 441  TRP A C   1 
ATOM   2500  O  O   . TRP A  1 334 ? 10.239  15.327  22.708  1.00   27.40 ? 441  TRP A O   1 
ATOM   2501  C  CB  . TRP A  1 334 ? 9.327   16.633  20.096  1.00   28.15 ? 441  TRP A CB  1 
ATOM   2502  C  CG  . TRP A  1 334 ? 9.802   15.687  19.071  1.00   21.77 ? 441  TRP A CG  1 
ATOM   2503  C  CD1 . TRP A  1 334 ? 11.061  15.198  18.938  1.00   22.06 ? 441  TRP A CD1 1 
ATOM   2504  C  CD2 . TRP A  1 334 ? 9.031   15.128  18.009  1.00   21.74 ? 441  TRP A CD2 1 
ATOM   2505  N  NE1 . TRP A  1 334 ? 11.127  14.368  17.849  1.00   24.11 ? 441  TRP A NE1 1 
ATOM   2506  C  CE2 . TRP A  1 334 ? 9.893   14.309  17.259  1.00   21.59 ? 441  TRP A CE2 1 
ATOM   2507  C  CE3 . TRP A  1 334 ? 7.694   15.247  17.615  1.00   23.72 ? 441  TRP A CE3 1 
ATOM   2508  C  CZ2 . TRP A  1 334 ? 9.468   13.604  16.139  1.00   22.74 ? 441  TRP A CZ2 1 
ATOM   2509  C  CZ3 . TRP A  1 334 ? 7.268   14.546  16.498  1.00   23.30 ? 441  TRP A CZ3 1 
ATOM   2510  C  CH2 . TRP A  1 334 ? 8.157   13.734  15.770  1.00   24.03 ? 441  TRP A CH2 1 
ATOM   2511  N  N   . THR A  1 335 ? 9.217   13.697  21.581  1.00   26.58 ? 442  THR A N   1 
ATOM   2512  C  CA  . THR A  1 335 ? 10.024  12.609  22.135  1.00   26.60 ? 442  THR A CA  1 
ATOM   2513  C  C   . THR A  1 335 ? 11.085  12.276  21.086  1.00   24.69 ? 442  THR A C   1 
ATOM   2514  O  O   . THR A  1 335 ? 10.752  12.003  19.950  1.00   26.27 ? 442  THR A O   1 
ATOM   2515  C  CB  . THR A  1 335 ? 9.120   11.381  22.413  1.00   29.05 ? 442  THR A CB  1 
ATOM   2516  O  OG1 . THR A  1 335 ? 8.240   11.699  23.499  1.00   34.65 ? 442  THR A OG1 1 
ATOM   2517  C  CG2 . THR A  1 335 ? 9.922   10.161  22.782  1.00   30.41 ? 442  THR A CG2 1 
ATOM   2518  N  N   . THR A  1 336 ? 12.356  12.302  21.464  1.00   26.59 ? 443  THR A N   1 
ATOM   2519  C  CA  . THR A  1 336 ? 13.428  12.018  20.516  1.00   28.46 ? 443  THR A CA  1 
ATOM   2520  C  C   . THR A  1 336 ? 13.225  10.712  19.774  1.00   25.84 ? 443  THR A C   1 
ATOM   2521  O  O   . THR A  1 336 ? 12.898  9.694   20.367  1.00   24.49 ? 443  THR A O   1 
ATOM   2522  C  CB  . THR A  1 336 ? 14.806  12.009  21.199  1.00   31.23 ? 443  THR A CB  1 
ATOM   2523  O  OG1 . THR A  1 336 ? 15.115  13.342  21.619  1.00   42.16 ? 443  THR A OG1 1 
ATOM   2524  C  CG2 . THR A  1 336 ? 15.885  11.536  20.226  1.00   29.64 ? 443  THR A CG2 1 
ATOM   2525  N  N   . VAL A  1 337 ? 13.401  10.754  18.460  1.00   23.72 ? 444  VAL A N   1 
ATOM   2526  C  CA  . VAL A  1 337 ? 13.205  9.557   17.656  1.00   23.86 ? 444  VAL A CA  1 
ATOM   2527  C  C   . VAL A  1 337 ? 14.257  8.490   17.939  1.00   23.95 ? 444  VAL A C   1 
ATOM   2528  O  O   . VAL A  1 337 ? 15.361  8.788   18.418  1.00   22.84 ? 444  VAL A O   1 
ATOM   2529  C  CB  . VAL A  1 337 ? 13.203  9.893   16.143  1.00   25.41 ? 444  VAL A CB  1 
ATOM   2530  C  CG1 . VAL A  1 337 ? 12.062  10.868  15.842  1.00   20.34 ? 444  VAL A CG1 1 
ATOM   2531  C  CG2 . VAL A  1 337 ? 14.549  10.486  15.727  1.00   23.56 ? 444  VAL A CG2 1 
ATOM   2532  N  N   . ALA A  1 338 ? 13.902  7.243   17.650  1.00   22.14 ? 445  ALA A N   1 
ATOM   2533  C  CA  . ALA A  1 338 ? 14.803  6.119   17.867  1.00   22.48 ? 445  ALA A CA  1 
ATOM   2534  C  C   . ALA A  1 338 ? 16.037  6.257   16.996  1.00   23.51 ? 445  ALA A C   1 
ATOM   2535  O  O   . ALA A  1 338 ? 16.054  7.036   16.039  1.00   24.87 ? 445  ALA A O   1 
ATOM   2536  C  CB  . ALA A  1 338 ? 14.093  4.806   17.545  1.00   20.34 ? 445  ALA A CB  1 
ATOM   2537  N  N   . PRO A  1 339 ? 17.097  5.502   17.322  1.00   24.03 ? 446  PRO A N   1 
ATOM   2538  C  CA  . PRO A  1 339 ? 18.343  5.550   16.547  1.00   25.11 ? 446  PRO A CA  1 
ATOM   2539  C  C   . PRO A  1 339 ? 18.088  5.302   15.063  1.00   22.53 ? 446  PRO A C   1 
ATOM   2540  O  O   . PRO A  1 339 ? 17.215  4.524   14.689  1.00   24.96 ? 446  PRO A O   1 
ATOM   2541  C  CB  . PRO A  1 339 ? 19.187  4.455   17.194  1.00   24.33 ? 446  PRO A CB  1 
ATOM   2542  C  CG  . PRO A  1 339 ? 18.759  4.559   18.648  1.00   25.14 ? 446  PRO A CG  1 
ATOM   2543  C  CD  . PRO A  1 339 ? 17.254  4.659   18.519  1.00   22.23 ? 446  PRO A CD  1 
ATOM   2544  N  N   . GLN A  1 340 ? 18.851  5.977   14.220  1.00   21.88 ? 447  GLN A N   1 
ATOM   2545  C  CA  . GLN A  1 340 ? 18.680  5.839   12.787  1.00   23.21 ? 447  GLN A CA  1 
ATOM   2546  C  C   . GLN A  1 340 ? 19.203  4.502   12.256  1.00   23.37 ? 447  GLN A C   1 
ATOM   2547  O  O   . GLN A  1 340 ? 20.338  4.113   12.530  1.00   25.15 ? 447  GLN A O   1 
ATOM   2548  C  CB  . GLN A  1 340 ? 19.400  6.986   12.070  1.00   22.12 ? 447  GLN A CB  1 
ATOM   2549  C  CG  . GLN A  1 340 ? 19.235  6.961   10.555  1.00   23.12 ? 447  GLN A CG  1 
ATOM   2550  C  CD  . GLN A  1 340 ? 20.397  7.633   9.851   1.00   26.84 ? 447  GLN A CD  1 
ATOM   2551  O  OE1 . GLN A  1 340 ? 21.542  7.205   9.986   1.00   27.18 ? 447  GLN A OE1 1 
ATOM   2552  N  NE2 . GLN A  1 340 ? 20.112  8.690   9.102   1.00   22.88 ? 447  GLN A NE2 1 
ATOM   2553  N  N   . ARG A  1 341 ? 18.370  3.803   11.497  1.00   21.90 ? 448  ARG A N   1 
ATOM   2554  C  CA  . ARG A  1 341 ? 18.770  2.542   10.890  1.00   21.44 ? 448  ARG A CA  1 
ATOM   2555  C  C   . ARG A  1 341 ? 18.967  2.788   9.406   1.00   20.48 ? 448  ARG A C   1 
ATOM   2556  O  O   . ARG A  1 341 ? 18.411  3.734   8.841   1.00   18.46 ? 448  ARG A O   1 
ATOM   2557  C  CB  . ARG A  1 341 ? 17.694  1.485   11.091  1.00   26.27 ? 448  ARG A CB  1 
ATOM   2558  C  CG  . ARG A  1 341 ? 17.401  1.197   12.542  1.00   26.08 ? 448  ARG A CG  1 
ATOM   2559  C  CD  . ARG A  1 341 ? 16.331  0.130   12.669  1.00   29.01 ? 448  ARG A CD  1 
ATOM   2560  N  NE  . ARG A  1 341 ? 16.077  -0.182  14.071  1.00   26.13 ? 448  ARG A NE  1 
ATOM   2561  C  CZ  . ARG A  1 341 ? 15.520  -1.310  14.486  1.00   28.55 ? 448  ARG A CZ  1 
ATOM   2562  N  NH1 . ARG A  1 341 ? 15.330  -1.520  15.779  1.00   30.58 ? 448  ARG A NH1 1 
ATOM   2563  N  NH2 . ARG A  1 341 ? 15.154  -2.227  13.605  1.00   25.86 ? 448  ARG A NH2 1 
ATOM   2564  N  N   . LYS A  1 342 ? 19.762  1.935   8.779   1.00   21.17 ? 449  LYS A N   1 
ATOM   2565  C  CA  . LYS A  1 342 ? 20.055  2.069   7.362   1.00   21.67 ? 449  LYS A CA  1 
ATOM   2566  C  C   . LYS A  1 342 ? 19.983  0.707   6.703   1.00   21.25 ? 449  LYS A C   1 
ATOM   2567  O  O   . LYS A  1 342 ? 20.759  -0.183  7.036   1.00   20.34 ? 449  LYS A O   1 
ATOM   2568  C  CB  . LYS A  1 342 ? 21.456  2.658   7.172   1.00   17.98 ? 449  LYS A CB  1 
ATOM   2569  C  CG  . LYS A  1 342 ? 21.800  2.977   5.723   1.00   17.86 ? 449  LYS A CG  1 
ATOM   2570  C  CD  . LYS A  1 342 ? 23.252  3.404   5.609   1.00   16.01 ? 449  LYS A CD  1 
ATOM   2571  C  CE  . LYS A  1 342 ? 23.563  4.045   4.264   1.00   17.88 ? 449  LYS A CE  1 
ATOM   2572  N  NZ  . LYS A  1 342 ? 24.949  4.590   4.269   1.00   15.98 ? 449  LYS A NZ  1 
ATOM   2573  N  N   . CYS A  1 343 ? 19.058  0.553   5.761   1.00   19.97 ? 450  CYS A N   1 
ATOM   2574  C  CA  . CYS A  1 343 ? 18.899  -0.713  5.063   1.00   21.74 ? 450  CYS A CA  1 
ATOM   2575  C  C   . CYS A  1 343 ? 19.318  -0.559  3.606   1.00   20.33 ? 450  CYS A C   1 
ATOM   2576  O  O   . CYS A  1 343 ? 18.738  0.234   2.858   1.00   22.10 ? 450  CYS A O   1 
ATOM   2577  C  CB  . CYS A  1 343 ? 17.442  -1.184  5.185   1.00   24.03 ? 450  CYS A CB  1 
ATOM   2578  S  SG  . CYS A  1 343 ? 17.079  -2.778  4.391   1.00   29.43 ? 450  CYS A SG  1 
ATOM   2579  N  N   . ILE A  1 344 ? 20.341  -1.312  3.213   1.00   21.06 ? 451  ILE A N   1 
ATOM   2580  C  CA  . ILE A  1 344 ? 20.874  -1.266  1.854   1.00   19.63 ? 451  ILE A CA  1 
ATOM   2581  C  C   . ILE A  1 344 ? 20.361  -2.439  1.029   1.00   20.55 ? 451  ILE A C   1 
ATOM   2582  O  O   . ILE A  1 344 ? 20.519  -3.585  1.426   1.00   22.45 ? 451  ILE A O   1 
ATOM   2583  C  CB  . ILE A  1 344 ? 22.415  -1.318  1.876   1.00   17.05 ? 451  ILE A CB  1 
ATOM   2584  C  CG1 . ILE A  1 344 ? 22.960  -0.141  2.694   1.00   18.99 ? 451  ILE A CG1 1 
ATOM   2585  C  CG2 . ILE A  1 344 ? 22.954  -1.327  0.452   1.00   13.48 ? 451  ILE A CG2 1 
ATOM   2586  C  CD1 . ILE A  1 344 ? 24.453  -0.225  2.998   1.00   20.62 ? 451  ILE A CD1 1 
ATOM   2587  N  N   . ILE A  1 345 ? 19.763  -2.146  -0.121  1.00   20.93 ? 452  ILE A N   1 
ATOM   2588  C  CA  . ILE A  1 345 ? 19.219  -3.176  -0.992  1.00   21.62 ? 452  ILE A CA  1 
ATOM   2589  C  C   . ILE A  1 345 ? 19.687  -2.975  -2.431  1.00   23.39 ? 452  ILE A C   1 
ATOM   2590  O  O   . ILE A  1 345 ? 19.218  -2.070  -3.113  1.00   21.30 ? 452  ILE A O   1 
ATOM   2591  C  CB  . ILE A  1 345 ? 17.677  -3.135  -0.981  1.00   22.41 ? 452  ILE A CB  1 
ATOM   2592  C  CG1 . ILE A  1 345 ? 17.173  -3.167  0.459   1.00   23.07 ? 452  ILE A CG1 1 
ATOM   2593  C  CG2 . ILE A  1 345 ? 17.112  -4.306  -1.770  1.00   19.67 ? 452  ILE A CG2 1 
ATOM   2594  C  CD1 . ILE A  1 345 ? 15.749  -2.698  0.606   1.00   23.24 ? 452  ILE A CD1 1 
ATOM   2595  N  N   . ASP A  1 346 ? 20.612  -3.810  -2.890  1.00   25.38 ? 453  ASP A N   1 
ATOM   2596  C  CA  . ASP A  1 346 ? 21.109  -3.705  -4.261  1.00   30.00 ? 453  ASP A CA  1 
ATOM   2597  C  C   . ASP A  1 346 ? 20.082  -4.432  -5.118  1.00   29.63 ? 453  ASP A C   1 
ATOM   2598  O  O   . ASP A  1 346 ? 19.852  -5.617  -4.934  1.00   32.26 ? 453  ASP A O   1 
ATOM   2599  C  CB  . ASP A  1 346 ? 22.485  -4.360  -4.373  1.00   29.51 ? 453  ASP A CB  1 
ATOM   2600  C  CG  . ASP A  1 346 ? 23.410  -3.602  -5.300  1.00   34.67 ? 453  ASP A CG  1 
ATOM   2601  O  OD1 . ASP A  1 346 ? 23.029  -2.502  -5.762  1.00   33.36 ? 453  ASP A OD1 1 
ATOM   2602  O  OD2 . ASP A  1 346 ? 24.523  -4.105  -5.561  1.00   38.01 ? 453  ASP A OD2 1 
ATOM   2603  N  N   . ILE A  1 347 ? 19.462  -3.715  -6.047  1.00   31.79 ? 454  ILE A N   1 
ATOM   2604  C  CA  . ILE A  1 347 ? 18.398  -4.273  -6.878  1.00   31.82 ? 454  ILE A CA  1 
ATOM   2605  C  C   . ILE A  1 347 ? 18.748  -5.095  -8.124  1.00   31.44 ? 454  ILE A C   1 
ATOM   2606  O  O   . ILE A  1 347 ? 18.203  -6.171  -8.309  1.00   27.99 ? 454  ILE A O   1 
ATOM   2607  C  CB  . ILE A  1 347 ? 17.429  -3.154  -7.326  1.00   32.66 ? 454  ILE A CB  1 
ATOM   2608  C  CG1 . ILE A  1 347 ? 17.087  -2.239  -6.140  1.00   34.06 ? 454  ILE A CG1 1 
ATOM   2609  C  CG2 . ILE A  1 347 ? 16.185  -3.767  -7.916  1.00   31.16 ? 454  ILE A CG2 1 
ATOM   2610  C  CD1 . ILE A  1 347 ? 16.343  -2.908  -5.008  1.00   32.70 ? 454  ILE A CD1 1 
ATOM   2611  N  N   . LEU A  1 348 ? 19.645  -4.602  -8.977  1.00   31.96 ? 455  LEU A N   1 
ATOM   2612  C  CA  . LEU A  1 348 ? 19.969  -5.326  -10.208 1.00   33.98 ? 455  LEU A CA  1 
ATOM   2613  C  C   . LEU A  1 348 ? 20.809  -6.589  -10.112 1.00   37.42 ? 455  LEU A C   1 
ATOM   2614  O  O   . LEU A  1 348 ? 21.788  -6.648  -9.373  1.00   37.33 ? 455  LEU A O   1 
ATOM   2615  C  CB  . LEU A  1 348 ? 20.655  -4.399  -11.203 1.00   30.73 ? 455  LEU A CB  1 
ATOM   2616  C  CG  . LEU A  1 348 ? 19.947  -3.113  -11.586 1.00   29.53 ? 455  LEU A CG  1 
ATOM   2617  C  CD1 . LEU A  1 348 ? 20.742  -2.459  -12.692 1.00   27.60 ? 455  LEU A CD1 1 
ATOM   2618  C  CD2 . LEU A  1 348 ? 18.530  -3.410  -12.039 1.00   28.92 ? 455  LEU A CD2 1 
ATOM   2619  N  N   . THR A  1 349 ? 20.421  -7.600  -10.889 1.00   40.00 ? 456  THR A N   1 
ATOM   2620  C  CA  . THR A  1 349 ? 21.169  -8.848  -10.942 1.00   40.92 ? 456  THR A CA  1 
ATOM   2621  C  C   . THR A  1 349 ? 21.881  -8.882  -12.292 1.00   42.88 ? 456  THR A C   1 
ATOM   2622  O  O   . THR A  1 349 ? 22.668  -9.785  -12.570 1.00   44.16 ? 456  THR A O   1 
ATOM   2623  C  CB  . THR A  1 349 ? 20.256  -10.088 -10.816 1.00   41.91 ? 456  THR A CB  1 
ATOM   2624  O  OG1 . THR A  1 349 ? 19.319  -10.113 -11.899 1.00   45.52 ? 456  THR A OG1 1 
ATOM   2625  C  CG2 . THR A  1 349 ? 19.506  -10.068 -9.489  1.00   38.05 ? 456  THR A CG2 1 
ATOM   2626  N  N   . GLU A  1 350 ? 21.600  -7.879  -13.122 1.00   42.48 ? 457  GLU A N   1 
ATOM   2627  C  CA  . GLU A  1 350 ? 22.209  -7.755  -14.442 1.00   44.06 ? 457  GLU A CA  1 
ATOM   2628  C  C   . GLU A  1 350 ? 21.918  -6.365  -15.011 1.00   42.71 ? 457  GLU A C   1 
ATOM   2629  O  O   . GLU A  1 350 ? 20.935  -5.727  -14.643 1.00   43.12 ? 457  GLU A O   1 
ATOM   2630  C  CB  . GLU A  1 350 ? 21.646  -8.816  -15.385 1.00   47.85 ? 457  GLU A CB  1 
ATOM   2631  C  CG  . GLU A  1 350 ? 20.130  -8.819  -15.426 1.00   58.04 ? 457  GLU A CG  1 
ATOM   2632  C  CD  . GLU A  1 350 ? 19.580  -9.202  -16.784 1.00   63.03 ? 457  GLU A CD  1 
ATOM   2633  O  OE1 . GLU A  1 350 ? 19.923  -8.524  -17.779 1.00   65.98 ? 457  GLU A OE1 1 
ATOM   2634  O  OE2 . GLU A  1 350 ? 18.799  -10.174 -16.854 1.00   67.08 ? 457  GLU A OE2 1 
ATOM   2635  N  N   . PRO A  1 351 ? 22.771  -5.881  -15.921 1.00   40.25 ? 458  PRO A N   1 
ATOM   2636  C  CA  . PRO A  1 351 ? 22.565  -4.559  -16.518 1.00   40.08 ? 458  PRO A CA  1 
ATOM   2637  C  C   . PRO A  1 351 ? 21.234  -4.540  -17.247 1.00   41.04 ? 458  PRO A C   1 
ATOM   2638  O  O   . PRO A  1 351 ? 20.757  -5.581  -17.693 1.00   42.78 ? 458  PRO A O   1 
ATOM   2639  C  CB  . PRO A  1 351 ? 23.733  -4.426  -17.492 1.00   39.80 ? 458  PRO A CB  1 
ATOM   2640  C  CG  . PRO A  1 351 ? 24.775  -5.353  -16.938 1.00   42.32 ? 458  PRO A CG  1 
ATOM   2641  C  CD  . PRO A  1 351 ? 23.964  -6.533  -16.482 1.00   40.37 ? 458  PRO A CD  1 
ATOM   2642  N  N   . LYS A  1 352 ? 20.639  -3.359  -17.372 1.00   40.51 ? 459  LYS A N   1 
ATOM   2643  C  CA  . LYS A  1 352 ? 19.362  -3.206  -18.057 1.00   37.09 ? 459  LYS A CA  1 
ATOM   2644  C  C   . LYS A  1 352 ? 19.457  -2.155  -19.154 1.00   36.23 ? 459  LYS A C   1 
ATOM   2645  O  O   . LYS A  1 352 ? 19.933  -1.042  -18.927 1.00   36.37 ? 459  LYS A O   1 
ATOM   2646  C  CB  . LYS A  1 352 ? 18.274  -2.791  -17.067 1.00   39.01 ? 459  LYS A CB  1 
ATOM   2647  C  CG  . LYS A  1 352 ? 17.470  -3.923  -16.452 1.00   44.33 ? 459  LYS A CG  1 
ATOM   2648  C  CD  . LYS A  1 352 ? 18.291  -4.785  -15.528 1.00   47.60 ? 459  LYS A CD  1 
ATOM   2649  C  CE  . LYS A  1 352 ? 17.412  -5.824  -14.844 1.00   50.39 ? 459  LYS A CE  1 
ATOM   2650  N  NZ  . LYS A  1 352 ? 16.746  -6.736  -15.809 1.00   50.53 ? 459  LYS A NZ  1 
ATOM   2651  N  N   . ASP A  1 353 ? 19.013  -2.515  -20.349 1.00   34.13 ? 460  ASP A N   1 
ATOM   2652  C  CA  . ASP A  1 353 ? 19.028  -1.588  -21.466 1.00   37.43 ? 460  ASP A CA  1 
ATOM   2653  C  C   . ASP A  1 353 ? 17.907  -0.590  -21.190 1.00   35.96 ? 460  ASP A C   1 
ATOM   2654  O  O   . ASP A  1 353 ? 16.816  -0.974  -20.783 1.00   37.19 ? 460  ASP A O   1 
ATOM   2655  C  CB  . ASP A  1 353 ? 18.768  -2.343  -22.774 1.00   39.92 ? 460  ASP A CB  1 
ATOM   2656  C  CG  . ASP A  1 353 ? 18.697  -1.426  -23.973 1.00   45.01 ? 460  ASP A CG  1 
ATOM   2657  O  OD1 . ASP A  1 353 ? 19.727  -0.793  -24.312 1.00   44.53 ? 460  ASP A OD1 1 
ATOM   2658  O  OD2 . ASP A  1 353 ? 17.601  -1.339  -24.574 1.00   47.50 ? 460  ASP A OD2 1 
ATOM   2659  N  N   . ILE A  1 354 ? 18.169  0.690   -21.401 1.00   35.52 ? 461  ILE A N   1 
ATOM   2660  C  CA  . ILE A  1 354 ? 17.147  1.689   -21.137 1.00   36.94 ? 461  ILE A CA  1 
ATOM   2661  C  C   . ILE A  1 354 ? 16.187  1.874   -22.314 1.00   39.59 ? 461  ILE A C   1 
ATOM   2662  O  O   . ILE A  1 354 ? 14.962  1.761   -22.156 1.00   38.08 ? 461  ILE A O   1 
ATOM   2663  C  CB  . ILE A  1 354 ? 17.803  3.033   -20.742 1.00   34.44 ? 461  ILE A CB  1 
ATOM   2664  C  CG1 . ILE A  1 354 ? 18.570  2.839   -19.426 1.00   31.14 ? 461  ILE A CG1 1 
ATOM   2665  C  CG2 . ILE A  1 354 ? 16.744  4.122   -20.586 1.00   31.98 ? 461  ILE A CG2 1 
ATOM   2666  C  CD1 . ILE A  1 354 ? 19.314  4.060   -18.938 1.00   29.15 ? 461  ILE A CD1 1 
ATOM   2667  N  N   . GLY A  1 355 ? 16.737  2.143   -23.492 1.00   39.05 ? 462  GLY A N   1 
ATOM   2668  C  CA  . GLY A  1 355 ? 15.883  2.328   -24.647 1.00   41.58 ? 462  GLY A CA  1 
ATOM   2669  C  C   . GLY A  1 355 ? 14.929  3.496   -24.486 1.00   42.82 ? 462  GLY A C   1 
ATOM   2670  O  O   . GLY A  1 355 ? 15.328  4.577   -24.038 1.00   43.06 ? 462  GLY A O   1 
ATOM   2671  N  N   . LYS A  1 356 ? 13.667  3.285   -24.851 1.00   42.72 ? 463  LYS A N   1 
ATOM   2672  C  CA  . LYS A  1 356 ? 12.673  4.346   -24.762 1.00   42.56 ? 463  LYS A CA  1 
ATOM   2673  C  C   . LYS A  1 356 ? 12.098  4.401   -23.357 1.00   42.16 ? 463  LYS A C   1 
ATOM   2674  O  O   . LYS A  1 356 ? 11.709  5.464   -22.874 1.00   42.09 ? 463  LYS A O   1 
ATOM   2675  C  CB  . LYS A  1 356 ? 11.549  4.105   -25.778 1.00   43.42 ? 463  LYS A CB  1 
ATOM   2676  C  CG  . LYS A  1 356 ? 11.002  5.376   -26.440 1.00   47.43 ? 463  LYS A CG  1 
ATOM   2677  C  CD  . LYS A  1 356 ? 10.401  6.351   -25.432 1.00   49.69 ? 463  LYS A CD  1 
ATOM   2678  C  CE  . LYS A  1 356 ? 9.758   7.564   -26.111 1.00   50.87 ? 463  LYS A CE  1 
ATOM   2679  N  NZ  . LYS A  1 356 ? 10.741  8.435   -26.825 1.00   52.52 ? 463  LYS A NZ  1 
ATOM   2680  N  N   . ARG A  1 357 ? 12.037  3.247   -22.707 1.00   40.09 ? 464  ARG A N   1 
ATOM   2681  C  CA  . ARG A  1 357 ? 11.516  3.182   -21.355 1.00   39.40 ? 464  ARG A CA  1 
ATOM   2682  C  C   . ARG A  1 357 ? 11.955  1.913   -20.640 1.00   39.60 ? 464  ARG A C   1 
ATOM   2683  O  O   . ARG A  1 357 ? 12.006  0.830   -21.227 1.00   39.59 ? 464  ARG A O   1 
ATOM   2684  C  CB  . ARG A  1 357 ? 9.995   3.254   -21.353 1.00   40.21 ? 464  ARG A CB  1 
ATOM   2685  C  CG  . ARG A  1 357 ? 9.423   3.219   -19.960 1.00   42.57 ? 464  ARG A CG  1 
ATOM   2686  C  CD  . ARG A  1 357 ? 7.934   3.004   -19.976 1.00   48.69 ? 464  ARG A CD  1 
ATOM   2687  N  NE  . ARG A  1 357 ? 7.446   2.548   -18.674 1.00   55.83 ? 464  ARG A NE  1 
ATOM   2688  C  CZ  . ARG A  1 357 ? 7.217   3.341   -17.629 1.00   59.13 ? 464  ARG A CZ  1 
ATOM   2689  N  NH1 . ARG A  1 357 ? 7.424   4.654   -17.717 1.00   56.57 ? 464  ARG A NH1 1 
ATOM   2690  N  NH2 . ARG A  1 357 ? 6.781   2.815   -16.489 1.00   61.49 ? 464  ARG A NH2 1 
ATOM   2691  N  N   . LEU A  1 358 ? 12.271  2.056   -19.361 1.00   36.56 ? 465  LEU A N   1 
ATOM   2692  C  CA  . LEU A  1 358 ? 12.698  0.931   -18.554 1.00   33.38 ? 465  LEU A CA  1 
ATOM   2693  C  C   . LEU A  1 358 ? 11.962  0.976   -17.235 1.00   32.99 ? 465  LEU A C   1 
ATOM   2694  O  O   . LEU A  1 358 ? 11.765  2.042   -16.650 1.00   33.95 ? 465  LEU A O   1 
ATOM   2695  C  CB  . LEU A  1 358 ? 14.209  0.986   -18.308 1.00   32.48 ? 465  LEU A CB  1 
ATOM   2696  C  CG  . LEU A  1 358 ? 14.772  0.070   -17.213 1.00   33.52 ? 465  LEU A CG  1 
ATOM   2697  C  CD1 . LEU A  1 358 ? 14.460  -1.394  -17.522 1.00   35.09 ? 465  LEU A CD1 1 
ATOM   2698  C  CD2 . LEU A  1 358 ? 16.276  0.292   -17.101 1.00   32.86 ? 465  LEU A CD2 1 
ATOM   2699  N  N   . GLU A  1 359 ? 11.540  -0.189  -16.779 1.00   31.14 ? 466  GLU A N   1 
ATOM   2700  C  CA  . GLU A  1 359 ? 10.837  -0.296  -15.522 1.00   32.54 ? 466  GLU A CA  1 
ATOM   2701  C  C   . GLU A  1 359 ? 11.449  -1.446  -14.742 1.00   34.58 ? 466  GLU A C   1 
ATOM   2702  O  O   . GLU A  1 359 ? 11.592  -2.557  -15.255 1.00   37.08 ? 466  GLU A O   1 
ATOM   2703  C  CB  . GLU A  1 359 ? 9.352   -0.543  -15.770 1.00   35.49 ? 466  GLU A CB  1 
ATOM   2704  C  CG  . GLU A  1 359 ? 8.564   -0.868  -14.515 1.00   41.86 ? 466  GLU A CG  1 
ATOM   2705  C  CD  . GLU A  1 359 ? 7.068   -0.720  -14.722 1.00   44.97 ? 466  GLU A CD  1 
ATOM   2706  O  OE1 . GLU A  1 359 ? 6.302   -1.423  -14.029 1.00   46.66 ? 466  GLU A OE1 1 
ATOM   2707  O  OE2 . GLU A  1 359 ? 6.665   0.111   -15.569 1.00   46.80 ? 466  GLU A OE2 1 
ATOM   2708  N  N   . VAL A  1 360 ? 11.833  -1.169  -13.505 1.00   33.41 ? 467  VAL A N   1 
ATOM   2709  C  CA  . VAL A  1 360 ? 12.436  -2.175  -12.657 1.00   30.25 ? 467  VAL A CA  1 
ATOM   2710  C  C   . VAL A  1 360 ? 11.590  -2.311  -11.401 1.00   32.08 ? 467  VAL A C   1 
ATOM   2711  O  O   . VAL A  1 360 ? 11.384  -1.339  -10.675 1.00   32.04 ? 467  VAL A O   1 
ATOM   2712  C  CB  . VAL A  1 360 ? 13.869  -1.784  -12.244 1.00   28.42 ? 467  VAL A CB  1 
ATOM   2713  C  CG1 . VAL A  1 360 ? 14.398  -2.796  -11.229 1.00   29.18 ? 467  VAL A CG1 1 
ATOM   2714  C  CG2 . VAL A  1 360 ? 14.781  -1.716  -13.459 1.00   24.54 ? 467  VAL A CG2 1 
ATOM   2715  N  N   . ARG A  1 361 ? 11.097  -3.523  -11.159 1.00   31.66 ? 468  ARG A N   1 
ATOM   2716  C  CA  . ARG A  1 361 ? 10.276  -3.811  -9.993  1.00   31.92 ? 468  ARG A CA  1 
ATOM   2717  C  C   . ARG A  1 361 ? 11.021  -4.721  -9.041  1.00   32.42 ? 468  ARG A C   1 
ATOM   2718  O  O   . ARG A  1 361 ? 11.760  -5.609  -9.459  1.00   33.43 ? 468  ARG A O   1 
ATOM   2719  C  CB  . ARG A  1 361 ? 8.978   -4.490  -10.409 1.00   32.40 ? 468  ARG A CB  1 
ATOM   2720  C  CG  . ARG A  1 361 ? 7.992   -3.541  -11.004 1.00   36.02 ? 468  ARG A CG  1 
ATOM   2721  C  CD  . ARG A  1 361 ? 6.811   -4.254  -11.620 1.00   41.45 ? 468  ARG A CD  1 
ATOM   2722  N  NE  . ARG A  1 361 ? 5.878   -3.269  -12.151 1.00   46.00 ? 468  ARG A NE  1 
ATOM   2723  C  CZ  . ARG A  1 361 ? 4.951   -2.657  -11.425 1.00   49.65 ? 468  ARG A CZ  1 
ATOM   2724  N  NH1 . ARG A  1 361 ? 4.153   -1.756  -11.989 1.00   52.01 ? 468  ARG A NH1 1 
ATOM   2725  N  NH2 . ARG A  1 361 ? 4.801   -2.972  -10.143 1.00   49.81 ? 468  ARG A NH2 1 
ATOM   2726  N  N   . LYS A  1 362 ? 10.815  -4.509  -7.752  1.00   32.94 ? 469  LYS A N   1 
ATOM   2727  C  CA  . LYS A  1 362 ? 11.480  -5.322  -6.755  1.00   32.08 ? 469  LYS A CA  1 
ATOM   2728  C  C   . LYS A  1 362 ? 10.720  -5.269  -5.441  1.00   30.68 ? 469  LYS A C   1 
ATOM   2729  O  O   . LYS A  1 362 ? 10.416  -4.198  -4.929  1.00   28.56 ? 469  LYS A O   1 
ATOM   2730  C  CB  . LYS A  1 362 ? 12.907  -4.818  -6.553  1.00   34.08 ? 469  LYS A CB  1 
ATOM   2731  C  CG  . LYS A  1 362 ? 13.631  -5.428  -5.371  1.00   38.71 ? 469  LYS A CG  1 
ATOM   2732  C  CD  . LYS A  1 362 ? 14.042  -6.853  -5.651  1.00   42.91 ? 469  LYS A CD  1 
ATOM   2733  C  CE  . LYS A  1 362 ? 14.958  -7.372  -4.556  1.00   46.72 ? 469  LYS A CE  1 
ATOM   2734  N  NZ  . LYS A  1 362 ? 15.457  -8.739  -4.868  1.00   47.90 ? 469  LYS A NZ  1 
ATOM   2735  N  N   . THR A  1 363 ? 10.396  -6.436  -4.907  1.00   28.27 ? 470  THR A N   1 
ATOM   2736  C  CA  . THR A  1 363 ? 9.695   -6.515  -3.637  1.00   27.36 ? 470  THR A CA  1 
ATOM   2737  C  C   . THR A  1 363 ? 10.776  -6.647  -2.577  1.00   27.73 ? 470  THR A C   1 
ATOM   2738  O  O   . THR A  1 363 ? 11.635  -7.525  -2.664  1.00   30.29 ? 470  THR A O   1 
ATOM   2739  C  CB  . THR A  1 363 ? 8.761   -7.738  -3.600  1.00   29.67 ? 470  THR A CB  1 
ATOM   2740  O  OG1 . THR A  1 363 ? 7.742   -7.577  -4.594  1.00   30.19 ? 470  THR A OG1 1 
ATOM   2741  C  CG2 . THR A  1 363 ? 8.104   -7.877  -2.235  1.00   26.39 ? 470  THR A CG2 1 
ATOM   2742  N  N   . VAL A  1 364 ? 10.756  -5.765  -1.586  1.00   25.81 ? 471  VAL A N   1 
ATOM   2743  C  CA  . VAL A  1 364 ? 11.782  -5.799  -0.550  1.00   23.20 ? 471  VAL A CA  1 
ATOM   2744  C  C   . VAL A  1 364 ? 11.164  -6.055  0.813   1.00   21.40 ? 471  VAL A C   1 
ATOM   2745  O  O   . VAL A  1 364 ? 9.976   -5.839  1.013   1.00   22.73 ? 471  VAL A O   1 
ATOM   2746  C  CB  . VAL A  1 364 ? 12.596  -4.452  -0.502  1.00   24.18 ? 471  VAL A CB  1 
ATOM   2747  C  CG1 . VAL A  1 364 ? 13.051  -4.052  -1.902  1.00   19.31 ? 471  VAL A CG1 1 
ATOM   2748  C  CG2 . VAL A  1 364 ? 11.760  -3.345  0.117   1.00   13.87 ? 471  VAL A CG2 1 
ATOM   2749  N  N   . THR A  1 365 ? 11.981  -6.518  1.745   1.00   22.02 ? 472  THR A N   1 
ATOM   2750  C  CA  . THR A  1 365 ? 11.519  -6.786  3.100   1.00   24.52 ? 472  THR A CA  1 
ATOM   2751  C  C   . THR A  1 365 ? 12.004  -5.705  4.052   1.00   25.96 ? 472  THR A C   1 
ATOM   2752  O  O   . THR A  1 365 ? 11.668  -5.722  5.236   1.00   27.27 ? 472  THR A O   1 
ATOM   2753  C  CB  . THR A  1 365 ? 12.055  -8.121  3.628   1.00   24.77 ? 472  THR A CB  1 
ATOM   2754  O  OG1 . THR A  1 365 ? 13.484  -8.062  3.686   1.00   27.92 ? 472  THR A OG1 1 
ATOM   2755  C  CG2 . THR A  1 365 ? 11.646  -9.260  2.729   1.00   23.94 ? 472  THR A CG2 1 
ATOM   2756  N  N   . ALA A  1 366 ? 12.811  -4.779  3.533   1.00   27.86 ? 473  ALA A N   1 
ATOM   2757  C  CA  . ALA A  1 366 ? 13.351  -3.674  4.327   1.00   25.74 ? 473  ALA A CA  1 
ATOM   2758  C  C   . ALA A  1 366 ? 14.139  -4.183  5.532   1.00   26.21 ? 473  ALA A C   1 
ATOM   2759  O  O   . ALA A  1 366 ? 13.982  -3.690  6.648   1.00   25.95 ? 473  ALA A O   1 
ATOM   2760  C  CB  . ALA A  1 366 ? 12.222  -2.756  4.782   1.00   22.91 ? 473  ALA A CB  1 
ATOM   2761  N  N   . CYS A  1 367 ? 14.978  -5.186  5.293   1.00   24.97 ? 474  CYS A N   1 
ATOM   2762  C  CA  . CYS A  1 367 ? 15.818  -5.751  6.334   1.00   28.34 ? 474  CYS A CA  1 
ATOM   2763  C  C   . CYS A  1 367 ? 15.061  -6.409  7.483   1.00   29.27 ? 474  CYS A C   1 
ATOM   2764  O  O   . CYS A  1 367 ? 15.508  -6.394  8.637   1.00   30.25 ? 474  CYS A O   1 
ATOM   2765  C  CB  . CYS A  1 367 ? 16.770  -4.661  6.854   1.00   28.08 ? 474  CYS A CB  1 
ATOM   2766  S  SG  . CYS A  1 367 ? 18.004  -4.135  5.602   1.00   29.58 ? 474  CYS A SG  1 
ATOM   2767  N  N   . LEU A  1 368 ? 13.915  -6.997  7.162   1.00   30.52 ? 475  LEU A N   1 
ATOM   2768  C  CA  . LEU A  1 368 ? 13.113  -7.681  8.166   1.00   30.73 ? 475  LEU A CA  1 
ATOM   2769  C  C   . LEU A  1 368 ? 13.960  -8.729  8.886   1.00   29.93 ? 475  LEU A C   1 
ATOM   2770  O  O   . LEU A  1 368 ? 14.751  -9.433  8.268   1.00   27.66 ? 475  LEU A O   1 
ATOM   2771  C  CB  . LEU A  1 368 ? 11.922  -8.369  7.505   1.00   29.00 ? 475  LEU A CB  1 
ATOM   2772  C  CG  . LEU A  1 368 ? 11.179  -9.308  8.451   1.00   31.77 ? 475  LEU A CG  1 
ATOM   2773  C  CD1 . LEU A  1 368 ? 10.490  -8.503  9.563   1.00   30.53 ? 475  LEU A CD1 1 
ATOM   2774  C  CD2 . LEU A  1 368 ? 10.178  -10.117 7.640   1.00   32.76 ? 475  LEU A CD2 1 
ATOM   2775  N  N   . GLY A  1 369 ? 13.796  -8.826  10.198  1.00   33.37 ? 476  GLY A N   1 
ATOM   2776  C  CA  . GLY A  1 369 ? 14.553  -9.807  10.948  1.00   37.68 ? 476  GLY A CA  1 
ATOM   2777  C  C   . GLY A  1 369 ? 15.990  -9.415  11.239  1.00   41.42 ? 476  GLY A C   1 
ATOM   2778  O  O   . GLY A  1 369 ? 16.697  -10.151 11.930  1.00   42.35 ? 476  GLY A O   1 
ATOM   2779  N  N   . GLU A  1 370 ? 16.434  -8.271  10.718  1.00   40.07 ? 477  GLU A N   1 
ATOM   2780  C  CA  . GLU A  1 370 ? 17.801  -7.812  10.962  1.00   38.07 ? 477  GLU A CA  1 
ATOM   2781  C  C   . GLU A  1 370 ? 17.779  -6.579  11.863  1.00   38.12 ? 477  GLU A C   1 
ATOM   2782  O  O   . GLU A  1 370 ? 16.727  -5.975  12.080  1.00   36.09 ? 477  GLU A O   1 
ATOM   2783  C  CB  . GLU A  1 370 ? 18.497  -7.453  9.651   1.00   39.21 ? 477  GLU A CB  1 
ATOM   2784  C  CG  . GLU A  1 370 ? 18.389  -8.478  8.545   1.00   44.18 ? 477  GLU A CG  1 
ATOM   2785  C  CD  . GLU A  1 370 ? 18.970  -7.970  7.219   1.00   48.32 ? 477  GLU A CD  1 
ATOM   2786  O  OE1 . GLU A  1 370 ? 18.774  -8.641  6.178   1.00   50.81 ? 477  GLU A OE1 1 
ATOM   2787  O  OE2 . GLU A  1 370 ? 19.623  -6.901  7.215   1.00   48.86 ? 477  GLU A OE2 1 
ATOM   2788  N  N   . PRO A  1 371 ? 18.950  -6.177  12.389  1.00   39.15 ? 478  PRO A N   1 
ATOM   2789  C  CA  . PRO A  1 371 ? 19.058  -5.009  13.274  1.00   36.54 ? 478  PRO A CA  1 
ATOM   2790  C  C   . PRO A  1 371 ? 18.621  -3.695  12.616  1.00   33.52 ? 478  PRO A C   1 
ATOM   2791  O  O   . PRO A  1 371 ? 18.178  -2.776  13.294  1.00   30.19 ? 478  PRO A O   1 
ATOM   2792  C  CB  . PRO A  1 371 ? 20.541  -4.989  13.650  1.00   40.13 ? 478  PRO A CB  1 
ATOM   2793  C  CG  . PRO A  1 371 ? 20.983  -6.413  13.461  1.00   41.84 ? 478  PRO A CG  1 
ATOM   2794  C  CD  . PRO A  1 371 ? 20.270  -6.805  12.195  1.00   41.39 ? 478  PRO A CD  1 
ATOM   2795  N  N   . ASN A  1 372 ? 18.758  -3.614  11.299  1.00   30.02 ? 479  ASN A N   1 
ATOM   2796  C  CA  . ASN A  1 372 ? 18.379  -2.413  10.571  1.00   32.55 ? 479  ASN A CA  1 
ATOM   2797  C  C   . ASN A  1 372 ? 17.013  -2.494  9.891   1.00   32.26 ? 479  ASN A C   1 
ATOM   2798  O  O   . ASN A  1 372 ? 16.772  -1.819  8.890   1.00   28.70 ? 479  ASN A O   1 
ATOM   2799  C  CB  . ASN A  1 372 ? 19.452  -2.054  9.535   1.00   36.88 ? 479  ASN A CB  1 
ATOM   2800  C  CG  . ASN A  1 372 ? 20.002  -3.268  8.800   1.00   48.01 ? 479  ASN A CG  1 
ATOM   2801  O  OD1 . ASN A  1 372 ? 20.971  -3.154  8.044   1.00   54.15 ? 479  ASN A OD1 1 
ATOM   2802  N  ND2 . ASN A  1 372 ? 19.395  -4.434  9.015   1.00   51.19 ? 479  ASN A ND2 1 
ATOM   2803  N  N   . HIS A  1 373 ? 16.127  -3.322  10.439  1.00   29.19 ? 480  HIS A N   1 
ATOM   2804  C  CA  . HIS A  1 373 ? 14.780  -3.478  9.907   1.00   27.55 ? 480  HIS A CA  1 
ATOM   2805  C  C   . HIS A  1 373 ? 14.076  -2.123  10.028  1.00   27.15 ? 480  HIS A C   1 
ATOM   2806  O  O   . HIS A  1 373 ? 14.105  -1.495  11.089  1.00   27.87 ? 480  HIS A O   1 
ATOM   2807  C  CB  . HIS A  1 373 ? 14.046  -4.565  10.709  1.00   27.54 ? 480  HIS A CB  1 
ATOM   2808  C  CG  . HIS A  1 373 ? 12.583  -4.681  10.402  1.00   30.41 ? 480  HIS A CG  1 
ATOM   2809  N  ND1 . HIS A  1 373 ? 12.078  -4.623  9.119   1.00   31.63 ? 480  HIS A ND1 1 
ATOM   2810  C  CD2 . HIS A  1 373 ? 11.520  -4.882  11.216  1.00   26.33 ? 480  HIS A CD2 1 
ATOM   2811  C  CE1 . HIS A  1 373 ? 10.766  -4.781  9.157   1.00   27.89 ? 480  HIS A CE1 1 
ATOM   2812  N  NE2 . HIS A  1 373 ? 10.404  -4.940  10.417  1.00   30.79 ? 480  HIS A NE2 1 
ATOM   2813  N  N   . ILE A  1 374 ? 13.462  -1.663  8.940   1.00   23.47 ? 481  ILE A N   1 
ATOM   2814  C  CA  . ILE A  1 374 ? 12.774  -0.375  8.961   1.00   22.22 ? 481  ILE A CA  1 
ATOM   2815  C  C   . ILE A  1 374 ? 11.294  -0.470  8.623   1.00   20.98 ? 481  ILE A C   1 
ATOM   2816  O  O   . ILE A  1 374 ? 10.917  -0.972  7.568   1.00   22.77 ? 481  ILE A O   1 
ATOM   2817  C  CB  . ILE A  1 374 ? 13.435  0.639   7.988   1.00   22.82 ? 481  ILE A CB  1 
ATOM   2818  C  CG1 . ILE A  1 374 ? 14.898  0.875   8.403   1.00   23.01 ? 481  ILE A CG1 1 
ATOM   2819  C  CG2 . ILE A  1 374 ? 12.648  1.959   8.010   1.00   18.85 ? 481  ILE A CG2 1 
ATOM   2820  C  CD1 . ILE A  1 374 ? 15.709  1.754   7.450   1.00   21.12 ? 481  ILE A CD1 1 
ATOM   2821  N  N   . THR A  1 375 ? 10.455  0.017   9.530   1.00   20.93 ? 482  THR A N   1 
ATOM   2822  C  CA  . THR A  1 375 ? 9.018   0.005   9.315   1.00   22.23 ? 482  THR A CA  1 
ATOM   2823  C  C   . THR A  1 375 ? 8.502   1.428   9.156   1.00   25.06 ? 482  THR A C   1 
ATOM   2824  O  O   . THR A  1 375 ? 7.390   1.651   8.670   1.00   25.68 ? 482  THR A O   1 
ATOM   2825  C  CB  . THR A  1 375 ? 8.294   -0.650  10.481  1.00   21.07 ? 482  THR A CB  1 
ATOM   2826  O  OG1 . THR A  1 375 ? 8.605   0.063   11.682  1.00   25.30 ? 482  THR A OG1 1 
ATOM   2827  C  CG2 . THR A  1 375 ? 8.733   -2.099  10.620  1.00   19.91 ? 482  THR A CG2 1 
ATOM   2828  N  N   . ARG A  1 376 ? 9.323   2.390   9.556   1.00   25.43 ? 483  ARG A N   1 
ATOM   2829  C  CA  . ARG A  1 376 ? 8.954   3.795   9.455   1.00   25.69 ? 483  ARG A CA  1 
ATOM   2830  C  C   . ARG A  1 376 ? 10.092  4.526   8.732   1.00   23.45 ? 483  ARG A C   1 
ATOM   2831  O  O   . ARG A  1 376 ? 11.128  4.857   9.311   1.00   21.67 ? 483  ARG A O   1 
ATOM   2832  C  CB  . ARG A  1 376 ? 8.729   4.373   10.852  1.00   31.94 ? 483  ARG A CB  1 
ATOM   2833  C  CG  . ARG A  1 376 ? 8.537   5.864   10.852  1.00   44.04 ? 483  ARG A CG  1 
ATOM   2834  C  CD  . ARG A  1 376 ? 8.427   6.419   12.254  1.00   52.18 ? 483  ARG A CD  1 
ATOM   2835  N  NE  . ARG A  1 376 ? 7.061   6.354   12.753  1.00   59.87 ? 483  ARG A NE  1 
ATOM   2836  C  CZ  . ARG A  1 376 ? 6.452   7.362   13.370  1.00   63.51 ? 483  ARG A CZ  1 
ATOM   2837  N  NH1 . ARG A  1 376 ? 5.201   7.215   13.791  1.00   66.70 ? 483  ARG A NH1 1 
ATOM   2838  N  NH2 . ARG A  1 376 ? 7.090   8.516   13.566  1.00   62.13 ? 483  ARG A NH2 1 
ATOM   2839  N  N   . LEU A  1 377 ? 9.886   4.772   7.450   1.00   21.54 ? 484  LEU A N   1 
ATOM   2840  C  CA  . LEU A  1 377 ? 10.894  5.408   6.619   1.00   21.04 ? 484  LEU A CA  1 
ATOM   2841  C  C   . LEU A  1 377 ? 11.122  6.893   6.885   1.00   22.92 ? 484  LEU A C   1 
ATOM   2842  O  O   . LEU A  1 377 ? 10.217  7.620   7.321   1.00   21.71 ? 484  LEU A O   1 
ATOM   2843  C  CB  . LEU A  1 377 ? 10.508  5.224   5.149   1.00   23.06 ? 484  LEU A CB  1 
ATOM   2844  C  CG  . LEU A  1 377 ? 11.490  5.619   4.052   1.00   20.70 ? 484  LEU A CG  1 
ATOM   2845  C  CD1 . LEU A  1 377 ? 12.629  4.607   4.006   1.00   19.57 ? 484  LEU A CD1 1 
ATOM   2846  C  CD2 . LEU A  1 377 ? 10.758  5.663   2.720   1.00   21.80 ? 484  LEU A CD2 1 
ATOM   2847  N  N   . GLU A  1 378 ? 12.352  7.330   6.637   1.00   21.54 ? 485  GLU A N   1 
ATOM   2848  C  CA  . GLU A  1 378 ? 12.703  8.735   6.748   1.00   19.69 ? 485  GLU A CA  1 
ATOM   2849  C  C   . GLU A  1 378 ? 13.127  9.060   5.324   1.00   19.79 ? 485  GLU A C   1 
ATOM   2850  O  O   . GLU A  1 378 ? 12.267  9.108   4.459   1.00   17.08 ? 485  GLU A O   1 
ATOM   2851  C  CB  . GLU A  1 378 ? 13.814  8.948   7.784   1.00   20.78 ? 485  GLU A CB  1 
ATOM   2852  C  CG  . GLU A  1 378 ? 13.244  8.814   9.201   1.00   19.76 ? 485  GLU A CG  1 
ATOM   2853  C  CD  . GLU A  1 378 ? 14.267  8.955   10.292  1.00   21.53 ? 485  GLU A CD  1 
ATOM   2854  O  OE1 . GLU A  1 378 ? 13.878  8.822   11.477  1.00   21.38 ? 485  GLU A OE1 1 
ATOM   2855  O  OE2 . GLU A  1 378 ? 15.452  9.199   9.978   1.00   23.03 ? 485  GLU A OE2 1 
ATOM   2856  N  N   . HIS A  1 379 ? 14.416  9.251   5.056   1.00   19.20 ? 486  HIS A N   1 
ATOM   2857  C  CA  . HIS A  1 379 ? 14.857  9.529   3.688   1.00   19.01 ? 486  HIS A CA  1 
ATOM   2858  C  C   . HIS A  1 379 ? 15.031  8.211   2.934   1.00   18.52 ? 486  HIS A C   1 
ATOM   2859  O  O   . HIS A  1 379 ? 15.214  7.172   3.549   1.00   18.34 ? 486  HIS A O   1 
ATOM   2860  C  CB  . HIS A  1 379 ? 16.239  10.213  3.660   1.00   15.73 ? 486  HIS A CB  1 
ATOM   2861  C  CG  . HIS A  1 379 ? 16.396  11.328  4.636   1.00   17.37 ? 486  HIS A CG  1 
ATOM   2862  N  ND1 . HIS A  1 379 ? 16.724  11.118  5.958   1.00   14.51 ? 486  HIS A ND1 1 
ATOM   2863  C  CD2 . HIS A  1 379 ? 16.274  12.671  4.483   1.00   14.19 ? 486  HIS A CD2 1 
ATOM   2864  C  CE1 . HIS A  1 379 ? 16.800  12.281  6.578   1.00   15.11 ? 486  HIS A CE1 1 
ATOM   2865  N  NE2 . HIS A  1 379 ? 16.530  13.238  5.705   1.00   17.92 ? 486  HIS A NE2 1 
ATOM   2866  N  N   . ALA A  1 380 ? 14.984  8.265   1.605   1.00   19.12 ? 487  ALA A N   1 
ATOM   2867  C  CA  . ALA A  1 380 ? 15.259  7.083   0.786   1.00   19.79 ? 487  ALA A CA  1 
ATOM   2868  C  C   . ALA A  1 380 ? 16.118  7.576   -0.370  1.00   19.67 ? 487  ALA A C   1 
ATOM   2869  O  O   . ALA A  1 380 ? 15.883  8.668   -0.892  1.00   20.26 ? 487  ALA A O   1 
ATOM   2870  C  CB  . ALA A  1 380 ? 13.976  6.457   0.250   1.00   18.02 ? 487  ALA A CB  1 
ATOM   2871  N  N   . GLN A  1 381 ? 17.131  6.797   -0.744  1.00   19.87 ? 488  GLN A N   1 
ATOM   2872  C  CA  . GLN A  1 381 ? 17.990  7.147   -1.872  1.00   20.42 ? 488  GLN A CA  1 
ATOM   2873  C  C   . GLN A  1 381 ? 17.952  6.027   -2.904  1.00   21.38 ? 488  GLN A C   1 
ATOM   2874  O  O   . GLN A  1 381 ? 17.860  4.850   -2.557  1.00   18.83 ? 488  GLN A O   1 
ATOM   2875  C  CB  . GLN A  1 381 ? 19.456  7.309   -1.451  1.00   22.21 ? 488  GLN A CB  1 
ATOM   2876  C  CG  . GLN A  1 381 ? 19.758  8.396   -0.434  1.00   21.86 ? 488  GLN A CG  1 
ATOM   2877  C  CD  . GLN A  1 381 ? 21.170  8.254   0.091   1.00   25.48 ? 488  GLN A CD  1 
ATOM   2878  O  OE1 . GLN A  1 381 ? 21.573  7.168   0.507   1.00   27.08 ? 488  GLN A OE1 1 
ATOM   2879  N  NE2 . GLN A  1 381 ? 21.929  9.340   0.076   1.00   22.44 ? 488  GLN A NE2 1 
ATOM   2880  N  N   . ALA A  1 382 ? 18.013  6.407   -4.173  1.00   20.90 ? 489  ALA A N   1 
ATOM   2881  C  CA  . ALA A  1 382 ? 18.077  5.442   -5.253  1.00   20.95 ? 489  ALA A CA  1 
ATOM   2882  C  C   . ALA A  1 382 ? 19.445  5.789   -5.848  1.00   22.26 ? 489  ALA A C   1 
ATOM   2883  O  O   . ALA A  1 382 ? 19.596  6.817   -6.523  1.00   22.10 ? 489  ALA A O   1 
ATOM   2884  C  CB  . ALA A  1 382 ? 16.975  5.689   -6.264  1.00   16.74 ? 489  ALA A CB  1 
ATOM   2885  N  N   . ARG A  1 383 ? 20.451  4.968   -5.552  1.00   19.08 ? 490  ARG A N   1 
ATOM   2886  C  CA  . ARG A  1 383 ? 21.788  5.218   -6.075  1.00   22.15 ? 490  ARG A CA  1 
ATOM   2887  C  C   . ARG A  1 383 ? 21.886  4.573   -7.445  1.00   24.08 ? 490  ARG A C   1 
ATOM   2888  O  O   . ARG A  1 383 ? 21.911  3.345   -7.565  1.00   24.01 ? 490  ARG A O   1 
ATOM   2889  C  CB  . ARG A  1 383 ? 22.842  4.648   -5.133  1.00   22.31 ? 490  ARG A CB  1 
ATOM   2890  C  CG  . ARG A  1 383 ? 22.678  5.102   -3.670  1.00   21.48 ? 490  ARG A CG  1 
ATOM   2891  C  CD  . ARG A  1 383 ? 23.901  4.706   -2.848  1.00   18.86 ? 490  ARG A CD  1 
ATOM   2892  N  NE  . ARG A  1 383 ? 25.056  5.483   -3.286  1.00   25.65 ? 490  ARG A NE  1 
ATOM   2893  C  CZ  . ARG A  1 383 ? 25.556  6.533   -2.636  1.00   28.11 ? 490  ARG A CZ  1 
ATOM   2894  N  NH1 . ARG A  1 383 ? 26.599  7.183   -3.139  1.00   28.07 ? 490  ARG A NH1 1 
ATOM   2895  N  NH2 . ARG A  1 383 ? 25.041  6.914   -1.469  1.00   27.34 ? 490  ARG A NH2 1 
ATOM   2896  N  N   . LEU A  1 384 ? 21.934  5.407   -8.479  1.00   25.09 ? 491  LEU A N   1 
ATOM   2897  C  CA  . LEU A  1 384 ? 21.990  4.909   -9.843  1.00   25.19 ? 491  LEU A CA  1 
ATOM   2898  C  C   . LEU A  1 384 ? 23.300  5.147   -10.578 1.00   26.67 ? 491  LEU A C   1 
ATOM   2899  O  O   . LEU A  1 384 ? 23.950  6.179   -10.429 1.00   26.37 ? 491  LEU A O   1 
ATOM   2900  C  CB  . LEU A  1 384 ? 20.856  5.525   -10.666 1.00   25.25 ? 491  LEU A CB  1 
ATOM   2901  C  CG  . LEU A  1 384 ? 19.464  5.612   -10.020 1.00   26.24 ? 491  LEU A CG  1 
ATOM   2902  C  CD1 . LEU A  1 384 ? 18.496  6.220   -11.016 1.00   22.94 ? 491  LEU A CD1 1 
ATOM   2903  C  CD2 . LEU A  1 384 ? 18.980  4.239   -9.592  1.00   23.94 ? 491  LEU A CD2 1 
ATOM   2904  N  N   . THR A  1 385 ? 23.675  4.162   -11.377 1.00   27.82 ? 492  THR A N   1 
ATOM   2905  C  CA  . THR A  1 385 ? 24.855  4.242   -12.218 1.00   28.19 ? 492  THR A CA  1 
ATOM   2906  C  C   . THR A  1 385 ? 24.320  3.833   -13.583 1.00   27.75 ? 492  THR A C   1 
ATOM   2907  O  O   . THR A  1 385 ? 23.783  2.739   -13.741 1.00   27.05 ? 492  THR A O   1 
ATOM   2908  C  CB  . THR A  1 385 ? 25.950  3.270   -11.768 1.00   27.15 ? 492  THR A CB  1 
ATOM   2909  O  OG1 . THR A  1 385 ? 26.433  3.668   -10.482 1.00   26.21 ? 492  THR A OG1 1 
ATOM   2910  C  CG2 . THR A  1 385 ? 27.104  3.285   -12.737 1.00   26.80 ? 492  THR A CG2 1 
ATOM   2911  N  N   . LEU A  1 386 ? 24.429  4.725   -14.558 1.00   29.47 ? 493  LEU A N   1 
ATOM   2912  C  CA  . LEU A  1 386 ? 23.918  4.427   -15.886 1.00   28.89 ? 493  LEU A CA  1 
ATOM   2913  C  C   . LEU A  1 386 ? 24.607  5.264   -16.931 1.00   30.52 ? 493  LEU A C   1 
ATOM   2914  O  O   . LEU A  1 386 ? 25.171  6.325   -16.632 1.00   31.71 ? 493  LEU A O   1 
ATOM   2915  C  CB  . LEU A  1 386 ? 22.414  4.690   -15.941 1.00   24.46 ? 493  LEU A CB  1 
ATOM   2916  C  CG  . LEU A  1 386 ? 22.021  6.143   -15.723 1.00   21.42 ? 493  LEU A CG  1 
ATOM   2917  C  CD1 . LEU A  1 386 ? 22.039  6.884   -17.053 1.00   23.61 ? 493  LEU A CD1 1 
ATOM   2918  C  CD2 . LEU A  1 386 ? 20.639  6.186   -15.114 1.00   23.13 ? 493  LEU A CD2 1 
ATOM   2919  N  N   . SER A  1 387 ? 24.554  4.771   -18.161 1.00   30.15 ? 494  SER A N   1 
ATOM   2920  C  CA  . SER A  1 387 ? 25.143  5.458   -19.294 1.00   29.80 ? 494  SER A CA  1 
ATOM   2921  C  C   . SER A  1 387 ? 23.982  5.870   -20.183 1.00   27.79 ? 494  SER A C   1 
ATOM   2922  O  O   . SER A  1 387 ? 22.947  5.200   -20.206 1.00   24.86 ? 494  SER A O   1 
ATOM   2923  C  CB  . SER A  1 387 ? 26.083  4.512   -20.051 1.00   30.29 ? 494  SER A CB  1 
ATOM   2924  O  OG  . SER A  1 387 ? 25.442  3.272   -20.311 1.00   32.31 ? 494  SER A OG  1 
ATOM   2925  N  N   . TYR A  1 388 ? 24.142  6.985   -20.886 1.00   26.77 ? 495  TYR A N   1 
ATOM   2926  C  CA  . TYR A  1 388 ? 23.104  7.456   -21.792 1.00   28.87 ? 495  TYR A CA  1 
ATOM   2927  C  C   . TYR A  1 388 ? 23.761  8.467   -22.717 1.00   28.30 ? 495  TYR A C   1 
ATOM   2928  O  O   . TYR A  1 388 ? 24.733  9.124   -22.335 1.00   28.27 ? 495  TYR A O   1 
ATOM   2929  C  CB  . TYR A  1 388 ? 21.953  8.110   -21.020 1.00   29.98 ? 495  TYR A CB  1 
ATOM   2930  C  CG  . TYR A  1 388 ? 20.626  7.962   -21.715 1.00   32.44 ? 495  TYR A CG  1 
ATOM   2931  C  CD1 . TYR A  1 388 ? 20.057  6.706   -21.884 1.00   34.63 ? 495  TYR A CD1 1 
ATOM   2932  C  CD2 . TYR A  1 388 ? 19.945  9.067   -22.225 1.00   33.80 ? 495  TYR A CD2 1 
ATOM   2933  C  CE1 . TYR A  1 388 ? 18.839  6.545   -22.545 1.00   37.07 ? 495  TYR A CE1 1 
ATOM   2934  C  CE2 . TYR A  1 388 ? 18.720  8.920   -22.891 1.00   34.78 ? 495  TYR A CE2 1 
ATOM   2935  C  CZ  . TYR A  1 388 ? 18.175  7.654   -23.046 1.00   37.73 ? 495  TYR A CZ  1 
ATOM   2936  O  OH  . TYR A  1 388 ? 16.970  7.474   -23.690 1.00   38.47 ? 495  TYR A OH  1 
ATOM   2937  N  N   . ASN A  1 389 ? 23.232  8.604   -23.925 1.00   25.76 ? 496  ASN A N   1 
ATOM   2938  C  CA  . ASN A  1 389 ? 23.826  9.522   -24.881 1.00   27.80 ? 496  ASN A CA  1 
ATOM   2939  C  C   . ASN A  1 389 ? 23.470  10.984  -24.649 1.00   28.36 ? 496  ASN A C   1 
ATOM   2940  O  O   . ASN A  1 389 ? 24.276  11.863  -24.940 1.00   30.38 ? 496  ASN A O   1 
ATOM   2941  C  CB  . ASN A  1 389 ? 23.449  9.102   -26.306 1.00   27.87 ? 496  ASN A CB  1 
ATOM   2942  C  CG  . ASN A  1 389 ? 21.966  9.154   -26.548 1.00   29.40 ? 496  ASN A CG  1 
ATOM   2943  O  OD1 . ASN A  1 389 ? 21.176  8.542   -25.821 1.00   30.62 ? 496  ASN A OD1 1 
ATOM   2944  N  ND2 . ASN A  1 389 ? 21.570  9.893   -27.577 1.00   30.92 ? 496  ASN A ND2 1 
ATOM   2945  N  N   . ARG A  1 390 ? 22.270  11.242  -24.128 1.00   30.20 ? 497  ARG A N   1 
ATOM   2946  C  CA  . ARG A  1 390 ? 21.815  12.609  -23.867 1.00   29.03 ? 497  ARG A CA  1 
ATOM   2947  C  C   . ARG A  1 390 ? 21.079  12.643  -22.528 1.00   28.54 ? 497  ARG A C   1 
ATOM   2948  O  O   . ARG A  1 390 ? 19.858  12.493  -22.461 1.00   27.05 ? 497  ARG A O   1 
ATOM   2949  C  CB  . ARG A  1 390 ? 20.889  13.063  -24.988 1.00   31.62 ? 497  ARG A CB  1 
ATOM   2950  C  CG  . ARG A  1 390 ? 21.118  14.485  -25.400 1.00   32.14 ? 497  ARG A CG  1 
ATOM   2951  C  CD  . ARG A  1 390 ? 19.866  15.286  -25.296 1.00   33.81 ? 497  ARG A CD  1 
ATOM   2952  N  NE  . ARG A  1 390 ? 20.170  16.689  -25.510 1.00   36.67 ? 497  ARG A NE  1 
ATOM   2953  C  CZ  . ARG A  1 390 ? 19.559  17.679  -24.877 1.00   40.03 ? 497  ARG A CZ  1 
ATOM   2954  N  NH1 . ARG A  1 390 ? 19.909  18.933  -25.138 1.00   41.45 ? 497  ARG A NH1 1 
ATOM   2955  N  NH2 . ARG A  1 390 ? 18.606  17.413  -23.983 1.00   37.51 ? 497  ARG A NH2 1 
ATOM   2956  N  N   . ARG A  1 391 ? 21.842  12.862  -21.464 1.00   29.08 ? 498  ARG A N   1 
ATOM   2957  C  CA  . ARG A  1 391 ? 21.313  12.856  -20.100 1.00   28.06 ? 498  ARG A CA  1 
ATOM   2958  C  C   . ARG A  1 391 ? 20.012  13.627  -19.836 1.00   25.87 ? 498  ARG A C   1 
ATOM   2959  O  O   . ARG A  1 391 ? 19.095  13.108  -19.193 1.00   24.68 ? 498  ARG A O   1 
ATOM   2960  C  CB  . ARG A  1 391 ? 22.410  13.326  -19.143 1.00   23.32 ? 498  ARG A CB  1 
ATOM   2961  C  CG  . ARG A  1 391 ? 22.175  12.941  -17.698 1.00   23.94 ? 498  ARG A CG  1 
ATOM   2962  C  CD  . ARG A  1 391 ? 23.454  13.107  -16.901 1.00   20.02 ? 498  ARG A CD  1 
ATOM   2963  N  NE  . ARG A  1 391 ? 23.923  14.487  -16.955 1.00   23.21 ? 498  ARG A NE  1 
ATOM   2964  C  CZ  . ARG A  1 391 ? 25.102  14.891  -16.493 1.00   23.23 ? 498  ARG A CZ  1 
ATOM   2965  N  NH1 . ARG A  1 391 ? 25.450  16.168  -16.585 1.00   24.12 ? 498  ARG A NH1 1 
ATOM   2966  N  NH2 . ARG A  1 391 ? 25.931  14.017  -15.938 1.00   22.98 ? 498  ARG A NH2 1 
ATOM   2967  N  N   . GLY A  1 392 ? 19.937  14.855  -20.335 1.00   24.77 ? 499  GLY A N   1 
ATOM   2968  C  CA  . GLY A  1 392 ? 18.760  15.677  -20.121 1.00   26.06 ? 499  GLY A CA  1 
ATOM   2969  C  C   . GLY A  1 392 ? 17.438  15.147  -20.653 1.00   26.81 ? 499  GLY A C   1 
ATOM   2970  O  O   . GLY A  1 392 ? 16.385  15.651  -20.273 1.00   25.32 ? 499  GLY A O   1 
ATOM   2971  N  N   . ASP A  1 393 ? 17.473  14.146  -21.531 1.00   26.11 ? 500  ASP A N   1 
ATOM   2972  C  CA  . ASP A  1 393 ? 16.237  13.595  -22.074 1.00   25.01 ? 500  ASP A CA  1 
ATOM   2973  C  C   . ASP A  1 393 ? 15.599  12.600  -21.118 1.00   27.42 ? 500  ASP A C   1 
ATOM   2974  O  O   . ASP A  1 393 ? 14.447  12.187  -21.295 1.00   26.17 ? 500  ASP A O   1 
ATOM   2975  C  CB  . ASP A  1 393 ? 16.485  12.893  -23.404 1.00   25.15 ? 500  ASP A CB  1 
ATOM   2976  C  CG  . ASP A  1 393 ? 16.758  13.853  -24.535 1.00   27.41 ? 500  ASP A CG  1 
ATOM   2977  O  OD1 . ASP A  1 393 ? 16.412  15.050  -24.408 1.00   25.53 ? 500  ASP A OD1 1 
ATOM   2978  O  OD2 . ASP A  1 393 ? 17.308  13.392  -25.561 1.00   25.84 ? 500  ASP A OD2 1 
ATOM   2979  N  N   . LEU A  1 394 ? 16.345  12.213  -20.092 1.00   26.29 ? 501  LEU A N   1 
ATOM   2980  C  CA  . LEU A  1 394 ? 15.827  11.246  -19.135 1.00   27.79 ? 501  LEU A CA  1 
ATOM   2981  C  C   . LEU A  1 394 ? 14.930  11.850  -18.068 1.00   25.86 ? 501  LEU A C   1 
ATOM   2982  O  O   . LEU A  1 394 ? 15.080  13.007  -17.686 1.00   26.76 ? 501  LEU A O   1 
ATOM   2983  C  CB  . LEU A  1 394 ? 16.983  10.522  -18.436 1.00   27.31 ? 501  LEU A CB  1 
ATOM   2984  C  CG  . LEU A  1 394 ? 17.908  9.641   -19.281 1.00   30.70 ? 501  LEU A CG  1 
ATOM   2985  C  CD1 . LEU A  1 394 ? 19.133  9.301   -18.457 1.00   30.79 ? 501  LEU A CD1 1 
ATOM   2986  C  CD2 . LEU A  1 394 ? 17.195  8.370   -19.733 1.00   26.61 ? 501  LEU A CD2 1 
ATOM   2987  N  N   . ALA A  1 395 ? 13.988  11.042  -17.605 1.00   23.43 ? 502  ALA A N   1 
ATOM   2988  C  CA  . ALA A  1 395 ? 13.093  11.416  -16.520 1.00   23.71 ? 502  ALA A CA  1 
ATOM   2989  C  C   . ALA A  1 395 ? 13.084  10.117  -15.719 1.00   23.45 ? 502  ALA A C   1 
ATOM   2990  O  O   . ALA A  1 395 ? 12.910  9.031   -16.282 1.00   21.27 ? 502  ALA A O   1 
ATOM   2991  C  CB  . ALA A  1 395 ? 11.697  11.752  -17.032 1.00   19.74 ? 502  ALA A CB  1 
ATOM   2992  N  N   . ILE A  1 396 ? 13.292  10.225  -14.414 1.00   22.56 ? 503  ILE A N   1 
ATOM   2993  C  CA  . ILE A  1 396 ? 13.354  9.049   -13.562 1.00   21.06 ? 503  ILE A CA  1 
ATOM   2994  C  C   . ILE A  1 396 ? 12.384  9.177   -12.404 1.00   22.48 ? 503  ILE A C   1 
ATOM   2995  O  O   . ILE A  1 396 ? 12.362  10.197  -11.710 1.00   22.12 ? 503  ILE A O   1 
ATOM   2996  C  CB  . ILE A  1 396 ? 14.785  8.863   -13.001 1.00   21.87 ? 503  ILE A CB  1 
ATOM   2997  C  CG1 . ILE A  1 396 ? 15.789  8.818   -14.153 1.00   22.85 ? 503  ILE A CG1 1 
ATOM   2998  C  CG2 . ILE A  1 396 ? 14.865  7.590   -12.156 1.00   23.43 ? 503  ILE A CG2 1 
ATOM   2999  C  CD1 . ILE A  1 396 ? 17.233  8.593   -13.714 1.00   25.88 ? 503  ILE A CD1 1 
ATOM   3000  N  N   . HIS A  1 397 ? 11.589  8.132   -12.193 1.00   21.36 ? 504  HIS A N   1 
ATOM   3001  C  CA  . HIS A  1 397 ? 10.601  8.127   -11.127 1.00   22.04 ? 504  HIS A CA  1 
ATOM   3002  C  C   . HIS A  1 397 ? 10.767  6.907   -10.233 1.00   22.72 ? 504  HIS A C   1 
ATOM   3003  O  O   . HIS A  1 397 ? 11.208  5.850   -10.678 1.00   23.76 ? 504  HIS A O   1 
ATOM   3004  C  CB  . HIS A  1 397 ? 9.209   8.135   -11.746 1.00   24.29 ? 504  HIS A CB  1 
ATOM   3005  C  CG  . HIS A  1 397 ? 9.030   9.192   -12.791 1.00   27.82 ? 504  HIS A CG  1 
ATOM   3006  N  ND1 . HIS A  1 397 ? 8.769   10.510  -12.481 1.00   30.84 ? 504  HIS A ND1 1 
ATOM   3007  C  CD2 . HIS A  1 397 ? 9.139   9.137   -14.139 1.00   28.54 ? 504  HIS A CD2 1 
ATOM   3008  C  CE1 . HIS A  1 397 ? 8.726   11.222  -13.594 1.00   29.23 ? 504  HIS A CE1 1 
ATOM   3009  N  NE2 . HIS A  1 397 ? 8.948   10.413  -14.613 1.00   28.89 ? 504  HIS A NE2 1 
ATOM   3010  N  N   . LEU A  1 398 ? 10.409  7.061   -8.967  1.00   20.95 ? 505  LEU A N   1 
ATOM   3011  C  CA  . LEU A  1 398 ? 10.510  5.974   -8.009  1.00   23.58 ? 505  LEU A CA  1 
ATOM   3012  C  C   . LEU A  1 398 ? 9.180   5.877   -7.267  1.00   24.25 ? 505  LEU A C   1 
ATOM   3013  O  O   . LEU A  1 398 ? 8.737   6.856   -6.656  1.00   24.32 ? 505  LEU A O   1 
ATOM   3014  C  CB  . LEU A  1 398 ? 11.642  6.243   -7.011  1.00   20.30 ? 505  LEU A CB  1 
ATOM   3015  C  CG  . LEU A  1 398 ? 11.744  5.226   -5.877  1.00   19.49 ? 505  LEU A CG  1 
ATOM   3016  C  CD1 . LEU A  1 398 ? 12.233  3.896   -6.438  1.00   22.19 ? 505  LEU A CD1 1 
ATOM   3017  C  CD2 . LEU A  1 398 ? 12.690  5.729   -4.807  1.00   20.98 ? 505  LEU A CD2 1 
ATOM   3018  N  N   . VAL A  1 399 ? 8.550   4.703   -7.316  1.00   22.77 ? 506  VAL A N   1 
ATOM   3019  C  CA  . VAL A  1 399 ? 7.265   4.506   -6.663  1.00   22.70 ? 506  VAL A CA  1 
ATOM   3020  C  C   . VAL A  1 399 ? 7.413   3.610   -5.453  1.00   22.06 ? 506  VAL A C   1 
ATOM   3021  O  O   . VAL A  1 399 ? 7.928   2.495   -5.559  1.00   21.69 ? 506  VAL A O   1 
ATOM   3022  C  CB  . VAL A  1 399 ? 6.258   3.878   -7.623  1.00   24.45 ? 506  VAL A CB  1 
ATOM   3023  C  CG1 . VAL A  1 399 ? 4.936   3.665   -6.921  1.00   24.47 ? 506  VAL A CG1 1 
ATOM   3024  C  CG2 . VAL A  1 399 ? 6.097   4.772   -8.843  1.00   25.69 ? 506  VAL A CG2 1 
ATOM   3025  N  N   . SER A  1 400 ? 6.970   4.103   -4.300  1.00   20.74 ? 507  SER A N   1 
ATOM   3026  C  CA  . SER A  1 400 ? 7.069   3.340   -3.057  1.00   20.69 ? 507  SER A CA  1 
ATOM   3027  C  C   . SER A  1 400 ? 5.967   2.296   -3.005  1.00   22.46 ? 507  SER A C   1 
ATOM   3028  O  O   . SER A  1 400 ? 4.973   2.396   -3.733  1.00   23.09 ? 507  SER A O   1 
ATOM   3029  C  CB  . SER A  1 400 ? 6.913   4.262   -1.853  1.00   22.05 ? 507  SER A CB  1 
ATOM   3030  O  OG  . SER A  1 400 ? 5.567   4.715   -1.755  1.00   19.14 ? 507  SER A OG  1 
ATOM   3031  N  N   . PRO A  1 401 ? 6.128   1.272   -2.146  1.00   24.53 ? 508  PRO A N   1 
ATOM   3032  C  CA  . PRO A  1 401 ? 5.108   0.230   -2.032  1.00   24.34 ? 508  PRO A CA  1 
ATOM   3033  C  C   . PRO A  1 401 ? 3.727   0.816   -1.761  1.00   25.94 ? 508  PRO A C   1 
ATOM   3034  O  O   . PRO A  1 401 ? 2.725   0.272   -2.214  1.00   27.18 ? 508  PRO A O   1 
ATOM   3035  C  CB  . PRO A  1 401 ? 5.624   -0.622  -0.879  1.00   21.96 ? 508  PRO A CB  1 
ATOM   3036  C  CG  . PRO A  1 401 ? 7.106   -0.578  -1.117  1.00   21.77 ? 508  PRO A CG  1 
ATOM   3037  C  CD  . PRO A  1 401 ? 7.321   0.906   -1.360  1.00   21.31 ? 508  PRO A CD  1 
ATOM   3038  N  N   . MET A  1 402 ? 3.672   1.932   -1.038  1.00   25.69 ? 509  MET A N   1 
ATOM   3039  C  CA  . MET A  1 402 ? 2.389   2.543   -0.731  1.00   23.51 ? 509  MET A CA  1 
ATOM   3040  C  C   . MET A  1 402 ? 1.877   3.467   -1.831  1.00   24.69 ? 509  MET A C   1 
ATOM   3041  O  O   . MET A  1 402 ? 0.936   4.233   -1.620  1.00   24.55 ? 509  MET A O   1 
ATOM   3042  C  CB  . MET A  1 402 ? 2.455   3.276   0.603   1.00   25.23 ? 509  MET A CB  1 
ATOM   3043  C  CG  . MET A  1 402 ? 2.783   2.351   1.737   1.00   28.22 ? 509  MET A CG  1 
ATOM   3044  S  SD  . MET A  1 402 ? 2.705   3.191   3.309   1.00   30.86 ? 509  MET A SD  1 
ATOM   3045  C  CE  . MET A  1 402 ? 2.796   1.843   4.427   1.00   38.85 ? 509  MET A CE  1 
ATOM   3046  N  N   . GLY A  1 403 ? 2.494   3.379   -3.007  1.00   22.78 ? 510  GLY A N   1 
ATOM   3047  C  CA  . GLY A  1 403 ? 2.057   4.166   -4.145  1.00   23.05 ? 510  GLY A CA  1 
ATOM   3048  C  C   . GLY A  1 403 ? 2.524   5.601   -4.298  1.00   26.16 ? 510  GLY A C   1 
ATOM   3049  O  O   . GLY A  1 403 ? 1.995   6.321   -5.147  1.00   28.60 ? 510  GLY A O   1 
ATOM   3050  N  N   . THR A  1 404 ? 3.495   6.036   -3.502  1.00   25.95 ? 511  THR A N   1 
ATOM   3051  C  CA  . THR A  1 404 ? 3.977   7.411   -3.624  1.00   24.32 ? 511  THR A CA  1 
ATOM   3052  C  C   . THR A  1 404 ? 5.000   7.519   -4.750  1.00   24.81 ? 511  THR A C   1 
ATOM   3053  O  O   . THR A  1 404 ? 6.037   6.861   -4.729  1.00   26.01 ? 511  THR A O   1 
ATOM   3054  C  CB  . THR A  1 404 ? 4.603   7.888   -2.320  1.00   24.80 ? 511  THR A CB  1 
ATOM   3055  O  OG1 . THR A  1 404 ? 3.632   7.773   -1.277  1.00   25.96 ? 511  THR A OG1 1 
ATOM   3056  C  CG2 . THR A  1 404 ? 5.044   9.343   -2.437  1.00   21.45 ? 511  THR A CG2 1 
ATOM   3057  N  N   . ARG A  1 405 ? 4.695   8.347   -5.742  1.00   24.32 ? 512  ARG A N   1 
ATOM   3058  C  CA  . ARG A  1 405 ? 5.580   8.531   -6.883  1.00   24.53 ? 512  ARG A CA  1 
ATOM   3059  C  C   . ARG A  1 405 ? 6.523   9.715   -6.727  1.00   24.97 ? 512  ARG A C   1 
ATOM   3060  O  O   . ARG A  1 405 ? 6.104   10.871  -6.801  1.00   21.69 ? 512  ARG A O   1 
ATOM   3061  C  CB  . ARG A  1 405 ? 4.768   8.728   -8.159  1.00   25.98 ? 512  ARG A CB  1 
ATOM   3062  C  CG  . ARG A  1 405 ? 3.958   7.536   -8.596  1.00   33.64 ? 512  ARG A CG  1 
ATOM   3063  C  CD  . ARG A  1 405 ? 3.193   7.883   -9.871  1.00   36.89 ? 512  ARG A CD  1 
ATOM   3064  N  NE  . ARG A  1 405 ? 4.112   8.259   -10.940 1.00   37.79 ? 512  ARG A NE  1 
ATOM   3065  C  CZ  . ARG A  1 405 ? 4.815   7.386   -11.652 1.00   37.93 ? 512  ARG A CZ  1 
ATOM   3066  N  NH1 . ARG A  1 405 ? 4.689   6.086   -11.406 1.00   35.75 ? 512  ARG A NH1 1 
ATOM   3067  N  NH2 . ARG A  1 405 ? 5.648   7.811   -12.597 1.00   35.08 ? 512  ARG A NH2 1 
ATOM   3068  N  N   . SER A  1 406 ? 7.801   9.419   -6.523  1.00   23.26 ? 513  SER A N   1 
ATOM   3069  C  CA  . SER A  1 406 ? 8.805   10.463  -6.387  1.00   21.34 ? 513  SER A CA  1 
ATOM   3070  C  C   . SER A  1 406 ? 9.524   10.630  -7.710  1.00   21.54 ? 513  SER A C   1 
ATOM   3071  O  O   . SER A  1 406 ? 10.063  9.667   -8.257  1.00   21.39 ? 513  SER A O   1 
ATOM   3072  C  CB  . SER A  1 406 ? 9.836   10.089  -5.314  1.00   19.63 ? 513  SER A CB  1 
ATOM   3073  O  OG  . SER A  1 406 ? 9.258   10.036  -4.027  1.00   17.41 ? 513  SER A OG  1 
ATOM   3074  N  N   . THR A  1 407 ? 9.519   11.839  -8.248  1.00   21.62 ? 514  THR A N   1 
ATOM   3075  C  CA  . THR A  1 407 ? 10.250  12.069  -9.482  1.00   20.76 ? 514  THR A CA  1 
ATOM   3076  C  C   . THR A  1 407 ? 11.674  12.429  -9.069  1.00   20.14 ? 514  THR A C   1 
ATOM   3077  O  O   . THR A  1 407 ? 11.935  13.541  -8.600  1.00   19.42 ? 514  THR A O   1 
ATOM   3078  C  CB  . THR A  1 407 ? 9.643   13.215  -10.313 1.00   20.86 ? 514  THR A CB  1 
ATOM   3079  O  OG1 . THR A  1 407 ? 8.345   12.828  -10.773 1.00   25.51 ? 514  THR A OG1 1 
ATOM   3080  C  CG2 . THR A  1 407 ? 10.503  13.509  -11.525 1.00   21.05 ? 514  THR A CG2 1 
ATOM   3081  N  N   . LEU A  1 408 ? 12.578  11.463  -9.221  1.00   20.52 ? 515  LEU A N   1 
ATOM   3082  C  CA  . LEU A  1 408 ? 13.984  11.642  -8.877  1.00   19.01 ? 515  LEU A CA  1 
ATOM   3083  C  C   . LEU A  1 408 ? 14.673  12.588  -9.853  1.00   20.26 ? 515  LEU A C   1 
ATOM   3084  O  O   . LEU A  1 408 ? 15.593  13.295  -9.477  1.00   19.09 ? 515  LEU A O   1 
ATOM   3085  C  CB  . LEU A  1 408 ? 14.702  10.292  -8.885  1.00   15.87 ? 515  LEU A CB  1 
ATOM   3086  C  CG  . LEU A  1 408 ? 14.101  9.194   -7.999  1.00   14.55 ? 515  LEU A CG  1 
ATOM   3087  C  CD1 . LEU A  1 408 ? 14.998  7.984   -8.014  1.00   14.25 ? 515  LEU A CD1 1 
ATOM   3088  C  CD2 . LEU A  1 408 ? 13.949  9.693   -6.564  1.00   19.99 ? 515  LEU A CD2 1 
ATOM   3089  N  N   . LEU A  1 409 ? 14.213  12.604  -11.103 1.00   21.00 ? 516  LEU A N   1 
ATOM   3090  C  CA  . LEU A  1 409 ? 14.802  13.466  -12.115 1.00   19.63 ? 516  LEU A CA  1 
ATOM   3091  C  C   . LEU A  1 409 ? 13.809  13.813  -13.219 1.00   22.61 ? 516  LEU A C   1 
ATOM   3092  O  O   . LEU A  1 409 ? 13.233  12.930  -13.860 1.00   20.00 ? 516  LEU A O   1 
ATOM   3093  C  CB  . LEU A  1 409 ? 16.007  12.781  -12.754 1.00   16.92 ? 516  LEU A CB  1 
ATOM   3094  C  CG  . LEU A  1 409 ? 16.678  13.570  -13.880 1.00   17.57 ? 516  LEU A CG  1 
ATOM   3095  C  CD1 . LEU A  1 409 ? 17.513  14.713  -13.270 1.00   16.05 ? 516  LEU A CD1 1 
ATOM   3096  C  CD2 . LEU A  1 409 ? 17.572  12.630  -14.699 1.00   14.69 ? 516  LEU A CD2 1 
ATOM   3097  N  N   . ALA A  1 410 ? 13.608  15.103  -13.440 1.00   22.87 ? 517  ALA A N   1 
ATOM   3098  C  CA  . ALA A  1 410 ? 12.721  15.531  -14.512 1.00   25.16 ? 517  ALA A CA  1 
ATOM   3099  C  C   . ALA A  1 410 ? 13.641  15.871  -15.677 1.00   23.39 ? 517  ALA A C   1 
ATOM   3100  O  O   . ALA A  1 410 ? 14.844  16.071  -15.485 1.00   25.82 ? 517  ALA A O   1 
ATOM   3101  C  CB  . ALA A  1 410 ? 11.921  16.763  -14.081 1.00   23.08 ? 517  ALA A CB  1 
ATOM   3102  N  N   . ALA A  1 411 ? 13.094  15.921  -16.882 1.00   22.68 ? 518  ALA A N   1 
ATOM   3103  C  CA  . ALA A  1 411 ? 13.887  16.255  -18.056 1.00   23.14 ? 518  ALA A CA  1 
ATOM   3104  C  C   . ALA A  1 411 ? 14.601  17.598  -17.895 1.00   22.87 ? 518  ALA A C   1 
ATOM   3105  O  O   . ALA A  1 411 ? 14.050  18.545  -17.329 1.00   25.41 ? 518  ALA A O   1 
ATOM   3106  C  CB  . ALA A  1 411 ? 12.992  16.287  -19.299 1.00   21.12 ? 518  ALA A CB  1 
ATOM   3107  N  N   . ARG A  1 412 ? 15.835  17.669  -18.384 1.00   22.28 ? 519  ARG A N   1 
ATOM   3108  C  CA  . ARG A  1 412 ? 16.618  18.897  -18.322 1.00   22.99 ? 519  ARG A CA  1 
ATOM   3109  C  C   . ARG A  1 412 ? 17.067  19.155  -19.747 1.00   25.30 ? 519  ARG A C   1 
ATOM   3110  O  O   . ARG A  1 412 ? 18.108  18.661  -20.184 1.00   29.47 ? 519  ARG A O   1 
ATOM   3111  C  CB  . ARG A  1 412 ? 17.833  18.739  -17.400 1.00   18.61 ? 519  ARG A CB  1 
ATOM   3112  C  CG  . ARG A  1 412 ? 17.469  18.572  -15.919 1.00   19.87 ? 519  ARG A CG  1 
ATOM   3113  C  CD  . ARG A  1 412 ? 18.606  19.033  -15.006 1.00   18.82 ? 519  ARG A CD  1 
ATOM   3114  N  NE  . ARG A  1 412 ? 19.827  18.264  -15.234 1.00   17.17 ? 519  ARG A NE  1 
ATOM   3115  C  CZ  . ARG A  1 412 ? 21.018  18.567  -14.723 1.00   19.83 ? 519  ARG A CZ  1 
ATOM   3116  N  NH1 . ARG A  1 412 ? 22.067  17.800  -14.994 1.00   15.11 ? 519  ARG A NH1 1 
ATOM   3117  N  NH2 . ARG A  1 412 ? 21.167  19.635  -13.945 1.00   16.31 ? 519  ARG A NH2 1 
ATOM   3118  N  N   . PRO A  1 413 ? 16.264  19.916  -20.504 1.00   25.76 ? 520  PRO A N   1 
ATOM   3119  C  CA  . PRO A  1 413 ? 16.562  20.246  -21.900 1.00   25.91 ? 520  PRO A CA  1 
ATOM   3120  C  C   . PRO A  1 413 ? 17.975  20.738  -22.226 1.00   25.66 ? 520  PRO A C   1 
ATOM   3121  O  O   . PRO A  1 413 ? 18.487  20.445  -23.302 1.00   27.57 ? 520  PRO A O   1 
ATOM   3122  C  CB  . PRO A  1 413 ? 15.463  21.257  -22.268 1.00   25.22 ? 520  PRO A CB  1 
ATOM   3123  C  CG  . PRO A  1 413 ? 14.889  21.686  -20.953 1.00   27.28 ? 520  PRO A CG  1 
ATOM   3124  C  CD  . PRO A  1 413 ? 14.958  20.464  -20.112 1.00   23.77 ? 520  PRO A CD  1 
ATOM   3125  N  N   . HIS A  1 414 ? 18.622  21.453  -21.311 1.00   24.19 ? 521  HIS A N   1 
ATOM   3126  C  CA  . HIS A  1 414 ? 19.967  21.949  -21.585 1.00   22.84 ? 521  HIS A CA  1 
ATOM   3127  C  C   . HIS A  1 414 ? 21.066  20.927  -21.284 1.00   24.29 ? 521  HIS A C   1 
ATOM   3128  O  O   . HIS A  1 414 ? 22.234  21.153  -21.605 1.00   25.80 ? 521  HIS A O   1 
ATOM   3129  C  CB  . HIS A  1 414 ? 20.251  23.211  -20.766 1.00   24.96 ? 521  HIS A CB  1 
ATOM   3130  C  CG  . HIS A  1 414 ? 19.290  24.332  -21.010 1.00   27.36 ? 521  HIS A CG  1 
ATOM   3131  N  ND1 . HIS A  1 414 ? 19.053  24.855  -22.262 1.00   29.32 ? 521  HIS A ND1 1 
ATOM   3132  C  CD2 . HIS A  1 414 ? 18.528  25.051  -20.151 1.00   30.05 ? 521  HIS A CD2 1 
ATOM   3133  C  CE1 . HIS A  1 414 ? 18.187  25.849  -22.163 1.00   31.89 ? 521  HIS A CE1 1 
ATOM   3134  N  NE2 . HIS A  1 414 ? 17.853  25.987  -20.893 1.00   30.57 ? 521  HIS A NE2 1 
ATOM   3135  N  N   . ASP A  1 415 ? 20.710  19.810  -20.661 1.00   23.37 ? 522  ASP A N   1 
ATOM   3136  C  CA  . ASP A  1 415 ? 21.705  18.803  -20.316 1.00   23.49 ? 522  ASP A CA  1 
ATOM   3137  C  C   . ASP A  1 415 ? 21.985  17.831  -21.468 1.00   25.43 ? 522  ASP A C   1 
ATOM   3138  O  O   . ASP A  1 415 ? 21.297  16.816  -21.634 1.00   23.41 ? 522  ASP A O   1 
ATOM   3139  C  CB  . ASP A  1 415 ? 21.252  18.037  -19.062 1.00   25.06 ? 522  ASP A CB  1 
ATOM   3140  C  CG  . ASP A  1 415 ? 22.317  17.084  -18.535 1.00   26.17 ? 522  ASP A CG  1 
ATOM   3141  O  OD1 . ASP A  1 415 ? 23.452  17.101  -19.062 1.00   25.47 ? 522  ASP A OD1 1 
ATOM   3142  O  OD2 . ASP A  1 415 ? 22.022  16.320  -17.586 1.00   26.05 ? 522  ASP A OD2 1 
ATOM   3143  N  N   . TYR A  1 416 ? 23.008  18.144  -22.256 1.00   26.97 ? 523  TYR A N   1 
ATOM   3144  C  CA  . TYR A  1 416 ? 23.381  17.308  -23.389 1.00   31.07 ? 523  TYR A CA  1 
ATOM   3145  C  C   . TYR A  1 416 ? 24.528  16.365  -23.051 1.00   31.75 ? 523  TYR A C   1 
ATOM   3146  O  O   . TYR A  1 416 ? 25.116  15.750  -23.937 1.00   32.09 ? 523  TYR A O   1 
ATOM   3147  C  CB  . TYR A  1 416 ? 23.767  18.179  -24.589 1.00   35.54 ? 523  TYR A CB  1 
ATOM   3148  C  CG  . TYR A  1 416 ? 24.898  19.149  -24.320 1.00   41.87 ? 523  TYR A CG  1 
ATOM   3149  C  CD1 . TYR A  1 416 ? 24.670  20.348  -23.648 1.00   45.69 ? 523  TYR A CD1 1 
ATOM   3150  C  CD2 . TYR A  1 416 ? 26.205  18.858  -24.723 1.00   45.36 ? 523  TYR A CD2 1 
ATOM   3151  C  CE1 . TYR A  1 416 ? 25.717  21.239  -23.379 1.00   47.20 ? 523  TYR A CE1 1 
ATOM   3152  C  CE2 . TYR A  1 416 ? 27.257  19.736  -24.461 1.00   47.86 ? 523  TYR A CE2 1 
ATOM   3153  C  CZ  . TYR A  1 416 ? 27.005  20.924  -23.787 1.00   49.57 ? 523  TYR A CZ  1 
ATOM   3154  O  OH  . TYR A  1 416 ? 28.039  21.791  -23.505 1.00   55.81 ? 523  TYR A OH  1 
ATOM   3155  N  N   . SER A  1 417 ? 24.838  16.245  -21.764 1.00   30.61 ? 524  SER A N   1 
ATOM   3156  C  CA  . SER A  1 417 ? 25.924  15.380  -21.316 1.00   29.61 ? 524  SER A CA  1 
ATOM   3157  C  C   . SER A  1 417 ? 25.782  13.926  -21.748 1.00   28.13 ? 524  SER A C   1 
ATOM   3158  O  O   . SER A  1 417 ? 24.687  13.362  -21.771 1.00   28.90 ? 524  SER A O   1 
ATOM   3159  C  CB  . SER A  1 417 ? 26.051  15.421  -19.792 1.00   28.86 ? 524  SER A CB  1 
ATOM   3160  O  OG  . SER A  1 417 ? 27.001  14.468  -19.333 1.00   27.97 ? 524  SER A OG  1 
ATOM   3161  N  N   . ALA A  1 418 ? 26.915  13.321  -22.079 1.00   27.67 ? 525  ALA A N   1 
ATOM   3162  C  CA  . ALA A  1 418 ? 26.950  11.929  -22.484 1.00   28.30 ? 525  ALA A CA  1 
ATOM   3163  C  C   . ALA A  1 418 ? 27.612  11.128  -21.369 1.00   29.08 ? 525  ALA A C   1 
ATOM   3164  O  O   . ALA A  1 418 ? 27.915  9.948   -21.536 1.00   29.33 ? 525  ALA A O   1 
ATOM   3165  C  CB  . ALA A  1 418 ? 27.748  11.789  -23.774 1.00   28.01 ? 525  ALA A CB  1 
ATOM   3166  N  N   . ASP A  1 419 ? 27.819  11.769  -20.222 1.00   30.42 ? 526  ASP A N   1 
ATOM   3167  C  CA  . ASP A  1 419 ? 28.471  11.114  -19.092 1.00   30.86 ? 526  ASP A CA  1 
ATOM   3168  C  C   . ASP A  1 419 ? 27.579  10.305  -18.160 1.00   29.52 ? 526  ASP A C   1 
ATOM   3169  O  O   . ASP A  1 419 ? 28.084  9.620   -17.276 1.00   29.05 ? 526  ASP A O   1 
ATOM   3170  C  CB  . ASP A  1 419 ? 29.238  12.133  -18.252 1.00   34.67 ? 526  ASP A CB  1 
ATOM   3171  C  CG  . ASP A  1 419 ? 30.259  12.901  -19.054 1.00   38.64 ? 526  ASP A CG  1 
ATOM   3172  O  OD1 . ASP A  1 419 ? 30.892  12.309  -19.950 1.00   42.48 ? 526  ASP A OD1 1 
ATOM   3173  O  OD2 . ASP A  1 419 ? 30.436  14.104  -18.779 1.00   44.46 ? 526  ASP A OD2 1 
ATOM   3174  N  N   . GLY A  1 420 ? 26.265  10.378  -18.342 1.00   26.51 ? 527  GLY A N   1 
ATOM   3175  C  CA  . GLY A  1 420 ? 25.371  9.618   -17.487 1.00   22.33 ? 527  GLY A CA  1 
ATOM   3176  C  C   . GLY A  1 420 ? 25.499  9.940   -16.003 1.00   23.91 ? 527  GLY A C   1 
ATOM   3177  O  O   . GLY A  1 420 ? 25.866  11.056  -15.634 1.00   18.90 ? 527  GLY A O   1 
ATOM   3178  N  N   . PHE A  1 421 ? 25.182  8.958   -15.155 1.00   22.28 ? 528  PHE A N   1 
ATOM   3179  C  CA  . PHE A  1 421 ? 25.264  9.109   -13.706 1.00   23.07 ? 528  PHE A CA  1 
ATOM   3180  C  C   . PHE A  1 421 ? 26.158  8.018   -13.131 1.00   25.90 ? 528  PHE A C   1 
ATOM   3181  O  O   . PHE A  1 421 ? 26.031  6.841   -13.475 1.00   23.02 ? 528  PHE A O   1 
ATOM   3182  C  CB  . PHE A  1 421 ? 23.875  9.011   -13.070 1.00   19.23 ? 528  PHE A CB  1 
ATOM   3183  C  CG  . PHE A  1 421 ? 23.025  10.226  -13.285 1.00   21.14 ? 528  PHE A CG  1 
ATOM   3184  C  CD1 . PHE A  1 421 ? 23.291  11.412  -12.593 1.00   19.85 ? 528  PHE A CD1 1 
ATOM   3185  C  CD2 . PHE A  1 421 ? 21.984  10.208  -14.212 1.00   19.54 ? 528  PHE A CD2 1 
ATOM   3186  C  CE1 . PHE A  1 421 ? 22.534  12.573  -12.822 1.00   20.55 ? 528  PHE A CE1 1 
ATOM   3187  C  CE2 . PHE A  1 421 ? 21.219  11.360  -14.452 1.00   19.63 ? 528  PHE A CE2 1 
ATOM   3188  C  CZ  . PHE A  1 421 ? 21.495  12.545  -13.754 1.00   20.72 ? 528  PHE A CZ  1 
ATOM   3189  N  N   . ASN A  1 422 ? 27.060  8.413   -12.244 1.00   26.30 ? 529  ASN A N   1 
ATOM   3190  C  CA  . ASN A  1 422 ? 27.976  7.466   -11.641 1.00   26.28 ? 529  ASN A CA  1 
ATOM   3191  C  C   . ASN A  1 422 ? 27.690  7.346   -10.149 1.00   24.99 ? 529  ASN A C   1 
ATOM   3192  O  O   . ASN A  1 422 ? 28.169  8.135   -9.337  1.00   21.39 ? 529  ASN A O   1 
ATOM   3193  C  CB  . ASN A  1 422 ? 29.415  7.914   -11.896 1.00   31.09 ? 529  ASN A CB  1 
ATOM   3194  C  CG  . ASN A  1 422 ? 30.435  6.953   -11.311 1.00   38.55 ? 529  ASN A CG  1 
ATOM   3195  O  OD1 . ASN A  1 422 ? 30.203  5.741   -11.237 1.00   41.00 ? 529  ASN A OD1 1 
ATOM   3196  N  ND2 . ASN A  1 422 ? 31.580  7.489   -10.899 1.00   42.85 ? 529  ASN A ND2 1 
ATOM   3197  N  N   . ASP A  1 423 ? 26.911  6.331   -9.800  1.00   24.19 ? 530  ASP A N   1 
ATOM   3198  C  CA  . ASP A  1 423 ? 26.507  6.098   -8.418  1.00   23.83 ? 530  ASP A CA  1 
ATOM   3199  C  C   . ASP A  1 423 ? 25.981  7.397   -7.808  1.00   25.10 ? 530  ASP A C   1 
ATOM   3200  O  O   . ASP A  1 423 ? 26.404  7.795   -6.725  1.00   22.48 ? 530  ASP A O   1 
ATOM   3201  C  CB  . ASP A  1 423 ? 27.675  5.557   -7.578  1.00   25.10 ? 530  ASP A CB  1 
ATOM   3202  C  CG  . ASP A  1 423 ? 27.248  5.159   -6.149  1.00   26.86 ? 530  ASP A CG  1 
ATOM   3203  O  OD1 . ASP A  1 423 ? 26.106  4.694   -5.964  1.00   23.39 ? 530  ASP A OD1 1 
ATOM   3204  O  OD2 . ASP A  1 423 ? 28.056  5.293   -5.204  1.00   28.77 ? 530  ASP A OD2 1 
ATOM   3205  N  N   . TRP A  1 424 ? 25.064  8.059   -8.513  1.00   21.58 ? 531  TRP A N   1 
ATOM   3206  C  CA  . TRP A  1 424 ? 24.490  9.299   -8.017  1.00   20.82 ? 531  TRP A CA  1 
ATOM   3207  C  C   . TRP A  1 424 ? 23.316  8.940   -7.109  1.00   22.06 ? 531  TRP A C   1 
ATOM   3208  O  O   . TRP A  1 424 ? 22.443  8.160   -7.494  1.00   20.81 ? 531  TRP A O   1 
ATOM   3209  C  CB  . TRP A  1 424 ? 24.022  10.177  -9.176  1.00   19.58 ? 531  TRP A CB  1 
ATOM   3210  C  CG  . TRP A  1 424 ? 23.561  11.512  -8.710  1.00   19.06 ? 531  TRP A CG  1 
ATOM   3211  C  CD1 . TRP A  1 424 ? 22.274  11.932  -8.579  1.00   19.46 ? 531  TRP A CD1 1 
ATOM   3212  C  CD2 . TRP A  1 424 ? 24.387  12.570  -8.200  1.00   18.66 ? 531  TRP A CD2 1 
ATOM   3213  N  NE1 . TRP A  1 424 ? 22.239  13.187  -8.008  1.00   23.34 ? 531  TRP A NE1 1 
ATOM   3214  C  CE2 . TRP A  1 424 ? 23.521  13.603  -7.763  1.00   19.40 ? 531  TRP A CE2 1 
ATOM   3215  C  CE3 . TRP A  1 424 ? 25.771  12.742  -8.066  1.00   15.29 ? 531  TRP A CE3 1 
ATOM   3216  C  CZ2 . TRP A  1 424 ? 23.994  14.801  -7.194  1.00   20.76 ? 531  TRP A CZ2 1 
ATOM   3217  C  CZ3 . TRP A  1 424 ? 26.251  13.944  -7.495  1.00   19.42 ? 531  TRP A CZ3 1 
ATOM   3218  C  CH2 . TRP A  1 424 ? 25.358  14.955  -7.068  1.00   18.95 ? 531  TRP A CH2 1 
ATOM   3219  N  N   . ALA A  1 425 ? 23.289  9.516   -5.908  1.00   20.67 ? 532  ALA A N   1 
ATOM   3220  C  CA  . ALA A  1 425 ? 22.248  9.192   -4.933  1.00   23.05 ? 532  ALA A CA  1 
ATOM   3221  C  C   . ALA A  1 425 ? 21.009  10.084  -4.931  1.00   22.44 ? 532  ALA A C   1 
ATOM   3222  O  O   . ALA A  1 425 ? 20.872  10.958  -4.078  1.00   24.97 ? 532  ALA A O   1 
ATOM   3223  C  CB  . ALA A  1 425 ? 22.859  9.151   -3.514  1.00   18.58 ? 532  ALA A CB  1 
ATOM   3224  N  N   . PHE A  1 426 ? 20.106  9.853   -5.876  1.00   22.18 ? 533  PHE A N   1 
ATOM   3225  C  CA  . PHE A  1 426 ? 18.862  10.614  -5.952  1.00   19.82 ? 533  PHE A CA  1 
ATOM   3226  C  C   . PHE A  1 426 ? 18.117  10.377  -4.633  1.00   20.43 ? 533  PHE A C   1 
ATOM   3227  O  O   . PHE A  1 426 ? 17.950  9.233   -4.207  1.00   21.58 ? 533  PHE A O   1 
ATOM   3228  C  CB  . PHE A  1 426 ? 18.028  10.113  -7.135  1.00   18.67 ? 533  PHE A CB  1 
ATOM   3229  C  CG  . PHE A  1 426 ? 18.687  10.334  -8.476  1.00   16.69 ? 533  PHE A CG  1 
ATOM   3230  C  CD1 . PHE A  1 426 ? 18.564  11.553  -9.131  1.00   17.31 ? 533  PHE A CD1 1 
ATOM   3231  C  CD2 . PHE A  1 426 ? 19.449  9.326   -9.067  1.00   16.24 ? 533  PHE A CD2 1 
ATOM   3232  C  CE1 . PHE A  1 426 ? 19.189  11.777  -10.368 1.00   17.63 ? 533  PHE A CE1 1 
ATOM   3233  C  CE2 . PHE A  1 426 ? 20.075  9.533   -10.292 1.00   16.94 ? 533  PHE A CE2 1 
ATOM   3234  C  CZ  . PHE A  1 426 ? 19.944  10.770  -10.950 1.00   18.88 ? 533  PHE A CZ  1 
ATOM   3235  N  N   . MET A  1 427 ? 17.662  11.448  -3.991  1.00   18.97 ? 534  MET A N   1 
ATOM   3236  C  CA  . MET A  1 427 ? 16.988  11.310  -2.712  1.00   17.86 ? 534  MET A CA  1 
ATOM   3237  C  C   . MET A  1 427 ? 15.568  11.849  -2.714  1.00   17.50 ? 534  MET A C   1 
ATOM   3238  O  O   . MET A  1 427 ? 15.266  12.814  -3.414  1.00   19.13 ? 534  MET A O   1 
ATOM   3239  C  CB  . MET A  1 427 ? 17.824  12.012  -1.630  1.00   17.17 ? 534  MET A CB  1 
ATOM   3240  C  CG  . MET A  1 427 ? 17.376  11.758  -0.186  1.00   15.22 ? 534  MET A CG  1 
ATOM   3241  S  SD  . MET A  1 427 ? 16.050  12.879  0.377   1.00   18.37 ? 534  MET A SD  1 
ATOM   3242  C  CE  . MET A  1 427 ? 16.979  14.311  0.912   1.00   13.42 ? 534  MET A CE  1 
ATOM   3243  N  N   . THR A  1 428 ? 14.688  11.210  -1.945  1.00   14.66 ? 535  THR A N   1 
ATOM   3244  C  CA  . THR A  1 428 ? 13.302  11.670  -1.850  1.00   16.60 ? 535  THR A CA  1 
ATOM   3245  C  C   . THR A  1 428 ? 12.846  11.677  -0.402  1.00   18.65 ? 535  THR A C   1 
ATOM   3246  O  O   . THR A  1 428 ? 13.172  10.774  0.379   1.00   18.08 ? 535  THR A O   1 
ATOM   3247  C  CB  . THR A  1 428 ? 12.299  10.790  -2.652  1.00   19.42 ? 535  THR A CB  1 
ATOM   3248  O  OG1 . THR A  1 428 ? 10.981  11.337  -2.506  1.00   19.50 ? 535  THR A OG1 1 
ATOM   3249  C  CG2 . THR A  1 428 ? 12.286  9.345   -2.133  1.00   17.16 ? 535  THR A CG2 1 
ATOM   3250  N  N   . THR A  1 429 ? 12.096  12.714  -0.053  1.00   17.36 ? 536  THR A N   1 
ATOM   3251  C  CA  . THR A  1 429 ? 11.562  12.870  1.291   1.00   17.63 ? 536  THR A CA  1 
ATOM   3252  C  C   . THR A  1 429 ? 10.060  12.580  1.280   1.00   18.57 ? 536  THR A C   1 
ATOM   3253  O  O   . THR A  1 429 ? 9.411   12.601  2.324   1.00   17.29 ? 536  THR A O   1 
ATOM   3254  C  CB  . THR A  1 429 ? 11.707  14.311  1.769   1.00   18.65 ? 536  THR A CB  1 
ATOM   3255  O  OG1 . THR A  1 429 ? 10.997  15.171  0.861   1.00   18.65 ? 536  THR A OG1 1 
ATOM   3256  C  CG2 . THR A  1 429 ? 13.176  14.724  1.843   1.00   15.59 ? 536  THR A CG2 1 
ATOM   3257  N  N   . HIS A  1 430 ? 9.518   12.303  0.099   1.00   18.01 ? 537  HIS A N   1 
ATOM   3258  C  CA  . HIS A  1 430 ? 8.079   12.085  -0.051  1.00   20.19 ? 537  HIS A CA  1 
ATOM   3259  C  C   . HIS A  1 430 ? 7.441   10.865  0.586   1.00   18.21 ? 537  HIS A C   1 
ATOM   3260  O  O   . HIS A  1 430 ? 6.226   10.828  0.740   1.00   20.59 ? 537  HIS A O   1 
ATOM   3261  C  CB  . HIS A  1 430 ? 7.693   12.136  -1.540  1.00   18.77 ? 537  HIS A CB  1 
ATOM   3262  C  CG  . HIS A  1 430 ? 7.907   13.476  -2.168  1.00   19.60 ? 537  HIS A CG  1 
ATOM   3263  N  ND1 . HIS A  1 430 ? 7.093   13.971  -3.165  1.00   19.59 ? 537  HIS A ND1 1 
ATOM   3264  C  CD2 . HIS A  1 430 ? 8.851   14.424  -1.946  1.00   19.98 ? 537  HIS A CD2 1 
ATOM   3265  C  CE1 . HIS A  1 430 ? 7.526   15.165  -3.530  1.00   23.09 ? 537  HIS A CE1 1 
ATOM   3266  N  NE2 . HIS A  1 430 ? 8.593   15.464  -2.806  1.00   19.15 ? 537  HIS A NE2 1 
ATOM   3267  N  N   . SER A  1 431 ? 8.235   9.871   0.956   1.00   18.06 ? 538  SER A N   1 
ATOM   3268  C  CA  . SER A  1 431 ? 7.672   8.687   1.573   1.00   18.69 ? 538  SER A CA  1 
ATOM   3269  C  C   . SER A  1 431 ? 7.972   8.638   3.059   1.00   20.83 ? 538  SER A C   1 
ATOM   3270  O  O   . SER A  1 431 ? 7.912   7.580   3.680   1.00   21.98 ? 538  SER A O   1 
ATOM   3271  C  CB  . SER A  1 431 ? 8.198   7.427   0.890   1.00   19.28 ? 538  SER A CB  1 
ATOM   3272  O  OG  . SER A  1 431 ? 7.727   7.351   -0.442  1.00   22.04 ? 538  SER A OG  1 
ATOM   3273  N  N   . TRP A  1 432 ? 8.294   9.796   3.620   1.00   18.84 ? 539  TRP A N   1 
ATOM   3274  C  CA  . TRP A  1 432 ? 8.591   9.915   5.041   1.00   20.25 ? 539  TRP A CA  1 
ATOM   3275  C  C   . TRP A  1 432 ? 7.447   9.312   5.871   1.00   21.74 ? 539  TRP A C   1 
ATOM   3276  O  O   . TRP A  1 432 ? 6.271   9.636   5.662   1.00   20.94 ? 539  TRP A O   1 
ATOM   3277  C  CB  . TRP A  1 432 ? 8.769   11.392  5.375   1.00   16.82 ? 539  TRP A CB  1 
ATOM   3278  C  CG  . TRP A  1 432 ? 9.450   11.663  6.655   1.00   18.01 ? 539  TRP A CG  1 
ATOM   3279  C  CD1 . TRP A  1 432 ? 8.895   11.667  7.904   1.00   18.03 ? 539  TRP A CD1 1 
ATOM   3280  C  CD2 . TRP A  1 432 ? 10.819  12.045  6.817   1.00   18.02 ? 539  TRP A CD2 1 
ATOM   3281  N  NE1 . TRP A  1 432 ? 9.839   12.038  8.835   1.00   18.97 ? 539  TRP A NE1 1 
ATOM   3282  C  CE2 . TRP A  1 432 ? 11.028  12.276  8.192   1.00   19.83 ? 539  TRP A CE2 1 
ATOM   3283  C  CE3 . TRP A  1 432 ? 11.890  12.219  5.927   1.00   17.66 ? 539  TRP A CE3 1 
ATOM   3284  C  CZ2 . TRP A  1 432 ? 12.273  12.680  8.707   1.00   18.64 ? 539  TRP A CZ2 1 
ATOM   3285  C  CZ3 . TRP A  1 432 ? 13.129  12.620  6.438   1.00   19.64 ? 539  TRP A CZ3 1 
ATOM   3286  C  CH2 . TRP A  1 432 ? 13.307  12.846  7.815   1.00   17.42 ? 539  TRP A CH2 1 
ATOM   3287  N  N   . ASP A  1 433 ? 7.811   8.449   6.814   1.00   19.64 ? 540  ASP A N   1 
ATOM   3288  C  CA  . ASP A  1 433 ? 6.879   7.744   7.703   1.00   20.77 ? 540  ASP A CA  1 
ATOM   3289  C  C   . ASP A  1 433 ? 6.126   6.561   7.082   1.00   21.06 ? 540  ASP A C   1 
ATOM   3290  O  O   . ASP A  1 433 ? 5.369   5.882   7.764   1.00   21.26 ? 540  ASP A O   1 
ATOM   3291  C  CB  . ASP A  1 433 ? 5.876   8.708   8.357   1.00   19.59 ? 540  ASP A CB  1 
ATOM   3292  C  CG  . ASP A  1 433 ? 6.481   9.475   9.527   1.00   24.23 ? 540  ASP A CG  1 
ATOM   3293  O  OD1 . ASP A  1 433 ? 7.355   8.911   10.216  1.00   19.69 ? 540  ASP A OD1 1 
ATOM   3294  O  OD2 . ASP A  1 433 ? 6.075   10.635  9.779   1.00   18.16 ? 540  ASP A OD2 1 
ATOM   3295  N  N   . GLU A  1 434 ? 6.327   6.306   5.799   1.00   20.85 ? 541  GLU A N   1 
ATOM   3296  C  CA  . GLU A  1 434 ? 5.681   5.161   5.165   1.00   22.81 ? 541  GLU A CA  1 
ATOM   3297  C  C   . GLU A  1 434 ? 6.390   3.860   5.566   1.00   25.19 ? 541  GLU A C   1 
ATOM   3298  O  O   . GLU A  1 434 ? 7.536   3.876   6.027   1.00   24.04 ? 541  GLU A O   1 
ATOM   3299  C  CB  . GLU A  1 434 ? 5.760   5.264   3.642   1.00   22.10 ? 541  GLU A CB  1 
ATOM   3300  C  CG  . GLU A  1 434 ? 4.898   6.340   3.032   1.00   24.30 ? 541  GLU A CG  1 
ATOM   3301  C  CD  . GLU A  1 434 ? 4.954   6.324   1.514   1.00   26.31 ? 541  GLU A CD  1 
ATOM   3302  O  OE1 . GLU A  1 434 ? 5.581   5.405   0.933   1.00   23.96 ? 541  GLU A OE1 1 
ATOM   3303  O  OE2 . GLU A  1 434 ? 4.361   7.235   0.905   1.00   25.90 ? 541  GLU A OE2 1 
ATOM   3304  N  N   . ASP A  1 435 ? 5.696   2.735   5.397   1.00   24.90 ? 542  ASP A N   1 
ATOM   3305  C  CA  . ASP A  1 435 ? 6.304   1.443   5.659   1.00   23.04 ? 542  ASP A CA  1 
ATOM   3306  C  C   . ASP A  1 435 ? 6.951   1.156   4.319   1.00   21.60 ? 542  ASP A C   1 
ATOM   3307  O  O   . ASP A  1 435 ? 6.272   1.140   3.294   1.00   23.20 ? 542  ASP A O   1 
ATOM   3308  C  CB  . ASP A  1 435 ? 5.266   0.372   5.950   1.00   25.04 ? 542  ASP A CB  1 
ATOM   3309  C  CG  . ASP A  1 435 ? 5.903   -0.955  6.259   1.00   27.65 ? 542  ASP A CG  1 
ATOM   3310  O  OD1 . ASP A  1 435 ? 6.800   -1.370  5.486   1.00   28.69 ? 542  ASP A OD1 1 
ATOM   3311  O  OD2 . ASP A  1 435 ? 5.520   -1.570  7.271   1.00   29.60 ? 542  ASP A OD2 1 
ATOM   3312  N  N   . PRO A  1 436 ? 8.270   0.933   4.303   1.00   21.99 ? 543  PRO A N   1 
ATOM   3313  C  CA  . PRO A  1 436 ? 8.994   0.663   3.056   1.00   20.92 ? 543  PRO A CA  1 
ATOM   3314  C  C   . PRO A  1 436 ? 8.982   -0.760  2.507   1.00   23.85 ? 543  PRO A C   1 
ATOM   3315  O  O   . PRO A  1 436 ? 9.493   -0.999  1.411   1.00   23.75 ? 543  PRO A O   1 
ATOM   3316  C  CB  . PRO A  1 436 ? 10.401  1.128   3.387   1.00   21.62 ? 543  PRO A CB  1 
ATOM   3317  C  CG  . PRO A  1 436 ? 10.533  0.668   4.834   1.00   20.58 ? 543  PRO A CG  1 
ATOM   3318  C  CD  . PRO A  1 436 ? 9.195   1.056   5.447   1.00   21.37 ? 543  PRO A CD  1 
ATOM   3319  N  N   . SER A  1 437 ? 8.416   -1.709  3.239   1.00   23.64 ? 544  SER A N   1 
ATOM   3320  C  CA  . SER A  1 437 ? 8.411   -3.080  2.728   1.00   27.14 ? 544  SER A CA  1 
ATOM   3321  C  C   . SER A  1 437 ? 7.360   -3.245  1.645   1.00   25.24 ? 544  SER A C   1 
ATOM   3322  O  O   . SER A  1 437 ? 6.277   -2.673  1.720   1.00   25.10 ? 544  SER A O   1 
ATOM   3323  C  CB  . SER A  1 437 ? 8.174   -4.094  3.853   1.00   25.82 ? 544  SER A CB  1 
ATOM   3324  O  OG  . SER A  1 437 ? 6.929   -3.889  4.475   1.00   30.84 ? 544  SER A OG  1 
ATOM   3325  N  N   . GLY A  1 438 ? 7.689   -4.026  0.626   1.00   26.77 ? 545  GLY A N   1 
ATOM   3326  C  CA  . GLY A  1 438 ? 6.755   -4.218  -0.464  1.00   25.97 ? 545  GLY A CA  1 
ATOM   3327  C  C   . GLY A  1 438 ? 7.444   -3.965  -1.788  1.00   29.00 ? 545  GLY A C   1 
ATOM   3328  O  O   . GLY A  1 438 ? 8.678   -3.924  -1.854  1.00   26.81 ? 545  GLY A O   1 
ATOM   3329  N  N   . GLU A  1 439 ? 6.654   -3.769  -2.840  1.00   26.09 ? 546  GLU A N   1 
ATOM   3330  C  CA  . GLU A  1 439 ? 7.214   -3.553  -4.160  1.00   27.42 ? 546  GLU A CA  1 
ATOM   3331  C  C   . GLU A  1 439 ? 7.520   -2.093  -4.491  1.00   28.09 ? 546  GLU A C   1 
ATOM   3332  O  O   . GLU A  1 439 ? 6.646   -1.226  -4.406  1.00   26.91 ? 546  GLU A O   1 
ATOM   3333  C  CB  . GLU A  1 439 ? 6.266   -4.110  -5.223  1.00   29.79 ? 546  GLU A CB  1 
ATOM   3334  C  CG  . GLU A  1 439 ? 6.922   -4.342  -6.579  1.00   35.13 ? 546  GLU A CG  1 
ATOM   3335  C  CD  . GLU A  1 439 ? 5.913   -4.526  -7.709  1.00   39.59 ? 546  GLU A CD  1 
ATOM   3336  O  OE1 . GLU A  1 439 ? 6.273   -5.141  -8.741  1.00   40.02 ? 546  GLU A OE1 1 
ATOM   3337  O  OE2 . GLU A  1 439 ? 4.767   -4.038  -7.572  1.00   40.86 ? 546  GLU A OE2 1 
ATOM   3338  N  N   . TRP A  1 440 ? 8.775   -1.838  -4.860  1.00   25.20 ? 547  TRP A N   1 
ATOM   3339  C  CA  . TRP A  1 440 ? 9.225   -0.513  -5.262  1.00   23.58 ? 547  TRP A CA  1 
ATOM   3340  C  C   . TRP A  1 440 ? 9.364   -0.615  -6.768  1.00   22.27 ? 547  TRP A C   1 
ATOM   3341  O  O   . TRP A  1 440 ? 9.697   -1.680  -7.280  1.00   22.73 ? 547  TRP A O   1 
ATOM   3342  C  CB  . TRP A  1 440 ? 10.602  -0.170  -4.664  1.00   21.20 ? 547  TRP A CB  1 
ATOM   3343  C  CG  . TRP A  1 440 ? 10.586  0.175   -3.211  1.00   20.56 ? 547  TRP A CG  1 
ATOM   3344  C  CD1 . TRP A  1 440 ? 10.538  -0.694  -2.161  1.00   20.66 ? 547  TRP A CD1 1 
ATOM   3345  C  CD2 . TRP A  1 440 ? 10.579  1.492   -2.644  1.00   20.45 ? 547  TRP A CD2 1 
ATOM   3346  N  NE1 . TRP A  1 440 ? 10.499  -0.001  -0.971  1.00   18.66 ? 547  TRP A NE1 1 
ATOM   3347  C  CE2 . TRP A  1 440 ? 10.523  1.341   -1.237  1.00   19.16 ? 547  TRP A CE2 1 
ATOM   3348  C  CE3 . TRP A  1 440 ? 10.613  2.783   -3.186  1.00   19.68 ? 547  TRP A CE3 1 
ATOM   3349  C  CZ2 . TRP A  1 440 ? 10.499  2.434   -0.362  1.00   22.64 ? 547  TRP A CZ2 1 
ATOM   3350  C  CZ3 . TRP A  1 440 ? 10.588  3.877   -2.315  1.00   22.61 ? 547  TRP A CZ3 1 
ATOM   3351  C  CH2 . TRP A  1 440 ? 10.532  3.693   -0.916  1.00   21.51 ? 547  TRP A CH2 1 
ATOM   3352  N  N   . VAL A  1 441 ? 9.110   0.481   -7.473  1.00   22.12 ? 548  VAL A N   1 
ATOM   3353  C  CA  . VAL A  1 441 ? 9.229   0.492   -8.927  1.00   23.77 ? 548  VAL A CA  1 
ATOM   3354  C  C   . VAL A  1 441 ? 10.049  1.694   -9.392  1.00   24.53 ? 548  VAL A C   1 
ATOM   3355  O  O   . VAL A  1 441 ? 9.768   2.831   -9.016  1.00   24.89 ? 548  VAL A O   1 
ATOM   3356  C  CB  . VAL A  1 441 ? 7.847   0.568   -9.609  1.00   24.04 ? 548  VAL A CB  1 
ATOM   3357  C  CG1 . VAL A  1 441 ? 8.006   0.520   -11.127 1.00   26.32 ? 548  VAL A CG1 1 
ATOM   3358  C  CG2 . VAL A  1 441 ? 6.969   -0.573  -9.125  1.00   24.86 ? 548  VAL A CG2 1 
ATOM   3359  N  N   . LEU A  1 442 ? 11.069  1.430   -10.196 1.00   22.03 ? 549  LEU A N   1 
ATOM   3360  C  CA  . LEU A  1 442 ? 11.911  2.488   -10.728 1.00   24.23 ? 549  LEU A CA  1 
ATOM   3361  C  C   . LEU A  1 442 ? 11.539  2.621   -12.194 1.00   23.77 ? 549  LEU A C   1 
ATOM   3362  O  O   . LEU A  1 442 ? 11.467  1.626   -12.905 1.00   23.51 ? 549  LEU A O   1 
ATOM   3363  C  CB  . LEU A  1 442 ? 13.396  2.119   -10.605 1.00   20.16 ? 549  LEU A CB  1 
ATOM   3364  C  CG  . LEU A  1 442 ? 14.401  3.139   -11.144 1.00   22.48 ? 549  LEU A CG  1 
ATOM   3365  C  CD1 . LEU A  1 442 ? 14.511  4.307   -10.173 1.00   22.50 ? 549  LEU A CD1 1 
ATOM   3366  C  CD2 . LEU A  1 442 ? 15.763  2.474   -11.330 1.00   23.14 ? 549  LEU A CD2 1 
ATOM   3367  N  N   . GLU A  1 443 ? 11.293  3.843   -12.643 1.00   25.13 ? 550  GLU A N   1 
ATOM   3368  C  CA  . GLU A  1 443 ? 10.933  4.072   -14.027 1.00   26.16 ? 550  GLU A CA  1 
ATOM   3369  C  C   . GLU A  1 443 ? 11.908  5.041   -14.648 1.00   26.52 ? 550  GLU A C   1 
ATOM   3370  O  O   . GLU A  1 443 ? 12.146  6.114   -14.099 1.00   30.08 ? 550  GLU A O   1 
ATOM   3371  C  CB  . GLU A  1 443 ? 9.537   4.672   -14.125 1.00   29.23 ? 550  GLU A CB  1 
ATOM   3372  C  CG  . GLU A  1 443 ? 8.482   3.973   -13.314 1.00   34.66 ? 550  GLU A CG  1 
ATOM   3373  C  CD  . GLU A  1 443 ? 7.155   4.710   -13.358 1.00   39.84 ? 550  GLU A CD  1 
ATOM   3374  O  OE1 . GLU A  1 443 ? 6.244   4.328   -12.598 1.00   43.17 ? 550  GLU A OE1 1 
ATOM   3375  O  OE2 . GLU A  1 443 ? 7.021   5.670   -14.153 1.00   42.87 ? 550  GLU A OE2 1 
ATOM   3376  N  N   . ILE A  1 444 ? 12.472  4.666   -15.787 1.00   25.67 ? 551  ILE A N   1 
ATOM   3377  C  CA  . ILE A  1 444 ? 13.393  5.534   -16.504 1.00   27.76 ? 551  ILE A CA  1 
ATOM   3378  C  C   . ILE A  1 444 ? 12.812  5.667   -17.910 1.00   30.55 ? 551  ILE A C   1 
ATOM   3379  O  O   . ILE A  1 444 ? 12.559  4.664   -18.577 1.00   33.95 ? 551  ILE A O   1 
ATOM   3380  C  CB  . ILE A  1 444 ? 14.794  4.922   -16.573 1.00   27.64 ? 551  ILE A CB  1 
ATOM   3381  C  CG1 . ILE A  1 444 ? 15.327  4.713   -15.153 1.00   23.30 ? 551  ILE A CG1 1 
ATOM   3382  C  CG2 . ILE A  1 444 ? 15.727  5.829   -17.370 1.00   25.93 ? 551  ILE A CG2 1 
ATOM   3383  C  CD1 . ILE A  1 444 ? 16.679  4.051   -15.103 1.00   23.13 ? 551  ILE A CD1 1 
ATOM   3384  N  N   . GLU A  1 445 ? 12.586  6.895   -18.357 1.00   29.82 ? 552  GLU A N   1 
ATOM   3385  C  CA  . GLU A  1 445 ? 12.001  7.093   -19.665 1.00   31.21 ? 552  GLU A CA  1 
ATOM   3386  C  C   . GLU A  1 445 ? 12.721  8.144   -20.478 1.00   33.49 ? 552  GLU A C   1 
ATOM   3387  O  O   . GLU A  1 445 ? 13.278  9.107   -19.934 1.00   33.58 ? 552  GLU A O   1 
ATOM   3388  C  CB  . GLU A  1 445 ? 10.540  7.515   -19.522 1.00   34.18 ? 552  GLU A CB  1 
ATOM   3389  C  CG  . GLU A  1 445 ? 10.390  8.911   -18.914 1.00   40.55 ? 552  GLU A CG  1 
ATOM   3390  C  CD  . GLU A  1 445 ? 8.936   9.371   -18.762 1.00   46.69 ? 552  GLU A CD  1 
ATOM   3391  O  OE1 . GLU A  1 445 ? 8.163   9.232   -19.737 1.00   49.57 ? 552  GLU A OE1 1 
ATOM   3392  O  OE2 . GLU A  1 445 ? 8.569   9.886   -17.674 1.00   45.36 ? 552  GLU A OE2 1 
ATOM   3393  N  N   . ASN A  1 446 ? 12.698  7.946   -21.791 1.00   33.92 ? 553  ASN A N   1 
ATOM   3394  C  CA  . ASN A  1 446 ? 13.282  8.882   -22.723 1.00   32.85 ? 553  ASN A CA  1 
ATOM   3395  C  C   . ASN A  1 446 ? 12.121  9.814   -23.047 1.00   33.34 ? 553  ASN A C   1 
ATOM   3396  O  O   . ASN A  1 446 ? 11.149  9.399   -23.678 1.00   34.77 ? 553  ASN A O   1 
ATOM   3397  C  CB  . ASN A  1 446 ? 13.752  8.146   -23.971 1.00   32.96 ? 553  ASN A CB  1 
ATOM   3398  C  CG  . ASN A  1 446 ? 14.244  9.078   -25.037 1.00   34.33 ? 553  ASN A CG  1 
ATOM   3399  O  OD1 . ASN A  1 446 ? 14.572  10.231  -24.759 1.00   33.52 ? 553  ASN A OD1 1 
ATOM   3400  N  ND2 . ASN A  1 446 ? 14.314  8.584   -26.270 1.00   34.82 ? 553  ASN A ND2 1 
ATOM   3401  N  N   . THR A  1 447 ? 12.211  11.059  -22.593 1.00   31.24 ? 554  THR A N   1 
ATOM   3402  C  CA  . THR A  1 447 ? 11.153  12.031  -22.821 1.00   31.79 ? 554  THR A CA  1 
ATOM   3403  C  C   . THR A  1 447 ? 11.210  12.698  -24.195 1.00   32.23 ? 554  THR A C   1 
ATOM   3404  O  O   . THR A  1 447 ? 10.315  13.461  -24.544 1.00   33.15 ? 554  THR A O   1 
ATOM   3405  C  CB  . THR A  1 447 ? 11.185  13.126  -21.745 1.00   31.45 ? 554  THR A CB  1 
ATOM   3406  O  OG1 . THR A  1 447 ? 12.425  13.836  -21.834 1.00   33.82 ? 554  THR A OG1 1 
ATOM   3407  C  CG2 . THR A  1 447 ? 11.072  12.502  -20.351 1.00   29.45 ? 554  THR A CG2 1 
ATOM   3408  N  N   . SER A  1 448 ? 12.257  12.425  -24.970 1.00   32.83 ? 555  SER A N   1 
ATOM   3409  C  CA  . SER A  1 448 ? 12.373  13.023  -26.300 1.00   35.21 ? 555  SER A CA  1 
ATOM   3410  C  C   . SER A  1 448 ? 11.967  12.023  -27.380 1.00   34.67 ? 555  SER A C   1 
ATOM   3411  O  O   . SER A  1 448 ? 11.767  10.838  -27.107 1.00   33.75 ? 555  SER A O   1 
ATOM   3412  C  CB  . SER A  1 448 ? 13.807  13.482  -26.562 1.00   35.58 ? 555  SER A CB  1 
ATOM   3413  O  OG  . SER A  1 448 ? 14.628  12.390  -26.938 1.00   40.81 ? 555  SER A OG  1 
ATOM   3414  N  N   . GLU A  1 449 ? 11.832  12.506  -28.609 1.00   36.14 ? 556  GLU A N   1 
ATOM   3415  C  CA  . GLU A  1 449 ? 11.465  11.626  -29.710 1.00   36.79 ? 556  GLU A CA  1 
ATOM   3416  C  C   . GLU A  1 449 ? 12.737  11.051  -30.324 1.00   36.08 ? 556  GLU A C   1 
ATOM   3417  O  O   . GLU A  1 449 ? 12.685  10.124  -31.126 1.00   36.88 ? 556  GLU A O   1 
ATOM   3418  C  CB  . GLU A  1 449 ? 10.666  12.390  -30.769 1.00   37.36 ? 556  GLU A CB  1 
ATOM   3419  C  CG  . GLU A  1 449 ? 9.267   12.803  -30.321 1.00   38.30 ? 556  GLU A CG  1 
ATOM   3420  C  CD  . GLU A  1 449 ? 8.375   11.620  -29.995 1.00   38.16 ? 556  GLU A CD  1 
ATOM   3421  O  OE1 . GLU A  1 449 ? 8.127   10.793  -30.897 0.0000 38.22 ? 556  GLU A OE1 1 
ATOM   3422  O  OE2 . GLU A  1 449 ? 7.920   11.522  -28.836 0.0000 38.22 ? 556  GLU A OE2 1 
ATOM   3423  N  N   . ALA A  1 450 ? 13.881  11.603  -29.940 1.00   36.27 ? 557  ALA A N   1 
ATOM   3424  C  CA  . ALA A  1 450 ? 15.159  11.136  -30.464 1.00   37.55 ? 557  ALA A CA  1 
ATOM   3425  C  C   . ALA A  1 450 ? 15.398  9.687   -30.088 1.00   38.54 ? 557  ALA A C   1 
ATOM   3426  O  O   . ALA A  1 450 ? 14.907  9.213   -29.066 1.00   40.25 ? 557  ALA A O   1 
ATOM   3427  C  CB  . ALA A  1 450 ? 16.290  11.995  -29.932 1.00   37.86 ? 557  ALA A CB  1 
ATOM   3428  N  N   . ASN A  1 451 ? 16.153  8.982   -30.922 1.00   40.50 ? 558  ASN A N   1 
ATOM   3429  C  CA  . ASN A  1 451 ? 16.464  7.586   -30.656 1.00   43.23 ? 558  ASN A CA  1 
ATOM   3430  C  C   . ASN A  1 451 ? 17.676  7.543   -29.741 1.00   44.14 ? 558  ASN A C   1 
ATOM   3431  O  O   . ASN A  1 451 ? 18.809  7.397   -30.205 1.00   43.22 ? 558  ASN A O   1 
ATOM   3432  C  CB  . ASN A  1 451 ? 16.781  6.836   -31.953 1.00   47.14 ? 558  ASN A CB  1 
ATOM   3433  C  CG  . ASN A  1 451 ? 15.577  6.697   -32.859 1.00   50.98 ? 558  ASN A CG  1 
ATOM   3434  O  OD1 . ASN A  1 451 ? 14.550  6.138   -32.470 1.00   53.97 ? 558  ASN A OD1 1 
ATOM   3435  N  ND2 . ASN A  1 451 ? 15.698  7.203   -34.081 1.00   54.03 ? 558  ASN A ND2 1 
ATOM   3436  N  N   . ASN A  1 452 ? 17.439  7.683   -28.440 1.00   43.88 ? 559  ASN A N   1 
ATOM   3437  C  CA  . ASN A  1 452 ? 18.528  7.664   -27.471 1.00   41.10 ? 559  ASN A CA  1 
ATOM   3438  C  C   . ASN A  1 452 ? 18.824  6.250   -27.009 1.00   40.47 ? 559  ASN A C   1 
ATOM   3439  O  O   . ASN A  1 452 ? 18.004  5.345   -27.174 1.00   42.05 ? 559  ASN A O   1 
ATOM   3440  C  CB  . ASN A  1 452 ? 18.188  8.540   -26.264 1.00   39.40 ? 559  ASN A CB  1 
ATOM   3441  C  CG  . ASN A  1 452 ? 18.113  10.003  -26.615 1.00   37.60 ? 559  ASN A CG  1 
ATOM   3442  O  OD1 . ASN A  1 452 ? 18.854  10.481  -27.475 1.00   35.31 ? 559  ASN A OD1 1 
ATOM   3443  N  ND2 . ASN A  1 452 ? 17.228  10.732  -25.939 1.00   36.23 ? 559  ASN A ND2 1 
ATOM   3444  N  N   . TYR A  1 453 ? 19.996  6.062   -26.416 1.00   38.64 ? 560  TYR A N   1 
ATOM   3445  C  CA  . TYR A  1 453 ? 20.392  4.744   -25.948 1.00   36.25 ? 560  TYR A CA  1 
ATOM   3446  C  C   . TYR A  1 453 ? 21.274  4.811   -24.711 1.00   36.14 ? 560  TYR A C   1 
ATOM   3447  O  O   . TYR A  1 453 ? 21.988  5.793   -24.489 1.00   35.17 ? 560  TYR A O   1 
ATOM   3448  C  CB  . TYR A  1 453 ? 21.156  4.015   -27.047 1.00   35.04 ? 560  TYR A CB  1 
ATOM   3449  C  CG  . TYR A  1 453 ? 22.322  4.821   -27.573 1.00   35.43 ? 560  TYR A CG  1 
ATOM   3450  C  CD1 . TYR A  1 453 ? 22.131  5.814   -28.530 1.00   36.90 ? 560  TYR A CD1 1 
ATOM   3451  C  CD2 . TYR A  1 453 ? 23.612  4.619   -27.086 1.00   36.42 ? 560  TYR A CD2 1 
ATOM   3452  C  CE1 . TYR A  1 453 ? 23.192  6.589   -28.992 1.00   37.17 ? 560  TYR A CE1 1 
ATOM   3453  C  CE2 . TYR A  1 453 ? 24.684  5.396   -27.542 1.00   37.04 ? 560  TYR A CE2 1 
ATOM   3454  C  CZ  . TYR A  1 453 ? 24.462  6.377   -28.494 1.00   37.94 ? 560  TYR A CZ  1 
ATOM   3455  O  OH  . TYR A  1 453 ? 25.503  7.162   -28.942 1.00   40.72 ? 560  TYR A OH  1 
ATOM   3456  N  N   . GLY A  1 454 ? 21.238  3.743   -23.923 1.00   33.56 ? 561  GLY A N   1 
ATOM   3457  C  CA  . GLY A  1 454 ? 22.044  3.690   -22.722 1.00   32.60 ? 561  GLY A CA  1 
ATOM   3458  C  C   . GLY A  1 454 ? 21.736  2.455   -21.902 1.00   31.69 ? 561  GLY A C   1 
ATOM   3459  O  O   . GLY A  1 454 ? 20.834  1.684   -22.233 1.00   29.72 ? 561  GLY A O   1 
ATOM   3460  N  N   . THR A  1 455 ? 22.477  2.280   -20.815 1.00   31.47 ? 562  THR A N   1 
ATOM   3461  C  CA  . THR A  1 455 ? 22.302  1.116   -19.954 1.00   31.05 ? 562  THR A CA  1 
ATOM   3462  C  C   . THR A  1 455 ? 22.343  1.457   -18.466 1.00   29.28 ? 562  THR A C   1 
ATOM   3463  O  O   . THR A  1 455 ? 23.176  2.242   -18.021 1.00   29.43 ? 562  THR A O   1 
ATOM   3464  C  CB  . THR A  1 455 ? 23.420  0.084   -20.202 1.00   30.41 ? 562  THR A CB  1 
ATOM   3465  O  OG1 . THR A  1 455 ? 23.421  -0.302  -21.579 1.00   35.44 ? 562  THR A OG1 1 
ATOM   3466  C  CG2 . THR A  1 455 ? 23.227  -1.143  -19.321 1.00   27.10 ? 562  THR A CG2 1 
ATOM   3467  N  N   . LEU A  1 456 ? 21.439  0.855   -17.707 1.00   27.30 ? 563  LEU A N   1 
ATOM   3468  C  CA  . LEU A  1 456 ? 21.396  1.050   -16.269 1.00   27.09 ? 563  LEU A CA  1 
ATOM   3469  C  C   . LEU A  1 456 ? 22.185  -0.126  -15.706 1.00   28.67 ? 563  LEU A C   1 
ATOM   3470  O  O   . LEU A  1 456 ? 21.753  -1.277  -15.813 1.00   28.40 ? 563  LEU A O   1 
ATOM   3471  C  CB  . LEU A  1 456 ? 19.956  0.994   -15.749 1.00   24.33 ? 563  LEU A CB  1 
ATOM   3472  C  CG  . LEU A  1 456 ? 19.799  0.955   -14.221 1.00   21.33 ? 563  LEU A CG  1 
ATOM   3473  C  CD1 . LEU A  1 456 ? 20.086  2.340   -13.623 1.00   20.51 ? 563  LEU A CD1 1 
ATOM   3474  C  CD2 . LEU A  1 456 ? 18.397  0.530   -13.877 1.00   23.73 ? 563  LEU A CD2 1 
ATOM   3475  N  N   . THR A  1 457 ? 23.337  0.155   -15.106 1.00   28.13 ? 564  THR A N   1 
ATOM   3476  C  CA  . THR A  1 457 ? 24.168  -0.909  -14.566 1.00   28.32 ? 564  THR A CA  1 
ATOM   3477  C  C   . THR A  1 457 ? 24.073  -1.100  -13.064 1.00   29.81 ? 564  THR A C   1 
ATOM   3478  O  O   . THR A  1 457 ? 24.496  -2.126  -12.548 1.00   31.04 ? 564  THR A O   1 
ATOM   3479  C  CB  . THR A  1 457 ? 25.647  -0.711  -14.934 1.00   30.56 ? 564  THR A CB  1 
ATOM   3480  O  OG1 . THR A  1 457 ? 26.136  0.508   -14.356 1.00   30.17 ? 564  THR A OG1 1 
ATOM   3481  C  CG2 . THR A  1 457 ? 25.811  -0.666  -16.455 1.00   30.05 ? 564  THR A CG2 1 
ATOM   3482  N  N   . LYS A  1 458 ? 23.523  -0.126  -12.351 1.00   28.97 ? 565  LYS A N   1 
ATOM   3483  C  CA  . LYS A  1 458 ? 23.393  -0.274  -10.907 1.00   26.45 ? 565  LYS A CA  1 
ATOM   3484  C  C   . LYS A  1 458 ? 22.236  0.527   -10.352 1.00   25.47 ? 565  LYS A C   1 
ATOM   3485  O  O   . LYS A  1 458 ? 22.026  1.682   -10.728 1.00   23.46 ? 565  LYS A O   1 
ATOM   3486  C  CB  . LYS A  1 458 ? 24.673  0.167   -10.190 1.00   29.58 ? 565  LYS A CB  1 
ATOM   3487  C  CG  . LYS A  1 458 ? 24.745  -0.303  -8.737  1.00   32.62 ? 565  LYS A CG  1 
ATOM   3488  C  CD  . LYS A  1 458 ? 25.824  0.433   -7.937  1.00   38.39 ? 565  LYS A CD  1 
ATOM   3489  C  CE  . LYS A  1 458 ? 25.318  1.783   -7.345  1.00   42.30 ? 565  LYS A CE  1 
ATOM   3490  N  NZ  . LYS A  1 458 ? 24.866  2.852   -8.315  1.00   34.56 ? 565  LYS A NZ  1 
ATOM   3491  N  N   . PHE A  1 459 ? 21.485  -0.107  -9.458  1.00   23.03 ? 566  PHE A N   1 
ATOM   3492  C  CA  . PHE A  1 459 ? 20.361  0.523   -8.790  1.00   21.31 ? 566  PHE A CA  1 
ATOM   3493  C  C   . PHE A  1 459 ? 20.367  -0.011  -7.374  1.00   23.96 ? 566  PHE A C   1 
ATOM   3494  O  O   . PHE A  1 459 ? 19.997  -1.163  -7.121  1.00   23.83 ? 566  PHE A O   1 
ATOM   3495  C  CB  . PHE A  1 459 ? 19.037  0.188   -9.487  1.00   23.97 ? 566  PHE A CB  1 
ATOM   3496  C  CG  . PHE A  1 459 ? 17.811  0.524   -8.670  1.00   24.88 ? 566  PHE A CG  1 
ATOM   3497  C  CD1 . PHE A  1 459 ? 17.818  1.585   -7.762  1.00   25.23 ? 566  PHE A CD1 1 
ATOM   3498  C  CD2 . PHE A  1 459 ? 16.638  -0.208  -8.829  1.00   23.63 ? 566  PHE A CD2 1 
ATOM   3499  C  CE1 . PHE A  1 459 ? 16.672  1.912   -7.021  1.00   24.75 ? 566  PHE A CE1 1 
ATOM   3500  C  CE2 . PHE A  1 459 ? 15.488  0.111   -8.098  1.00   28.03 ? 566  PHE A CE2 1 
ATOM   3501  C  CZ  . PHE A  1 459 ? 15.502  1.173   -7.191  1.00   25.13 ? 566  PHE A CZ  1 
ATOM   3502  N  N   . THR A  1 460 ? 20.814  0.827   -6.448  1.00   22.98 ? 567  THR A N   1 
ATOM   3503  C  CA  . THR A  1 460 ? 20.872  0.446   -5.045  1.00   23.77 ? 567  THR A CA  1 
ATOM   3504  C  C   . THR A  1 460 ? 19.869  1.305   -4.291  1.00   24.29 ? 567  THR A C   1 
ATOM   3505  O  O   . THR A  1 460 ? 19.911  2.535   -4.359  1.00   24.23 ? 567  THR A O   1 
ATOM   3506  C  CB  . THR A  1 460 ? 22.287  0.680   -4.441  1.00   23.89 ? 567  THR A CB  1 
ATOM   3507  O  OG1 . THR A  1 460 ? 23.268  -0.040  -5.192  1.00   25.62 ? 567  THR A OG1 1 
ATOM   3508  C  CG2 . THR A  1 460 ? 22.342  0.200   -2.993  1.00   22.36 ? 567  THR A CG2 1 
ATOM   3509  N  N   . LEU A  1 461 ? 18.962  0.653   -3.579  1.00   22.87 ? 568  LEU A N   1 
ATOM   3510  C  CA  . LEU A  1 461 ? 17.952  1.364   -2.821  1.00   21.70 ? 568  LEU A CA  1 
ATOM   3511  C  C   . LEU A  1 461 ? 18.434  1.458   -1.380  1.00   21.70 ? 568  LEU A C   1 
ATOM   3512  O  O   . LEU A  1 461 ? 18.707  0.442   -0.736  1.00   22.19 ? 568  LEU A O   1 
ATOM   3513  C  CB  . LEU A  1 461 ? 16.620  0.610   -2.878  1.00   23.23 ? 568  LEU A CB  1 
ATOM   3514  C  CG  . LEU A  1 461 ? 15.419  1.334   -2.257  1.00   22.30 ? 568  LEU A CG  1 
ATOM   3515  C  CD1 . LEU A  1 461 ? 15.154  2.618   -3.043  1.00   20.55 ? 568  LEU A CD1 1 
ATOM   3516  C  CD2 . LEU A  1 461 ? 14.193  0.407   -2.267  1.00   20.66 ? 568  LEU A CD2 1 
ATOM   3517  N  N   . VAL A  1 462 ? 18.555  2.677   -0.875  1.00   19.30 ? 569  VAL A N   1 
ATOM   3518  C  CA  . VAL A  1 462 ? 19.014  2.859   0.493   1.00   20.20 ? 569  VAL A CA  1 
ATOM   3519  C  C   . VAL A  1 462 ? 17.906  3.475   1.313   1.00   18.91 ? 569  VAL A C   1 
ATOM   3520  O  O   . VAL A  1 462 ? 17.432  4.563   1.010   1.00   22.56 ? 569  VAL A O   1 
ATOM   3521  C  CB  . VAL A  1 462 ? 20.275  3.759   0.563   1.00   19.27 ? 569  VAL A CB  1 
ATOM   3522  C  CG1 . VAL A  1 462 ? 20.698  3.955   2.025   1.00   16.94 ? 569  VAL A CG1 1 
ATOM   3523  C  CG2 . VAL A  1 462 ? 21.413  3.105   -0.218  1.00   19.42 ? 569  VAL A CG2 1 
ATOM   3524  N  N   . LEU A  1 463 ? 17.501  2.768   2.359   1.00   21.93 ? 570  LEU A N   1 
ATOM   3525  C  CA  . LEU A  1 463 ? 16.431  3.232   3.230   1.00   20.89 ? 570  LEU A CA  1 
ATOM   3526  C  C   . LEU A  1 463 ? 16.969  3.639   4.596   1.00   21.74 ? 570  LEU A C   1 
ATOM   3527  O  O   . LEU A  1 463 ? 17.774  2.915   5.195   1.00   22.64 ? 570  LEU A O   1 
ATOM   3528  C  CB  . LEU A  1 463 ? 15.390  2.112   3.414   1.00   23.01 ? 570  LEU A CB  1 
ATOM   3529  C  CG  . LEU A  1 463 ? 14.833  1.368   2.185   1.00   23.88 ? 570  LEU A CG  1 
ATOM   3530  C  CD1 . LEU A  1 463 ? 13.938  0.237   2.640   1.00   22.14 ? 570  LEU A CD1 1 
ATOM   3531  C  CD2 . LEU A  1 463 ? 14.055  2.323   1.284   1.00   18.99 ? 570  LEU A CD2 1 
ATOM   3532  N  N   . TYR A  1 464 ? 16.536  4.802   5.077   1.00   19.17 ? 571  TYR A N   1 
ATOM   3533  C  CA  . TYR A  1 464 ? 16.913  5.286   6.410   1.00   21.44 ? 571  TYR A CA  1 
ATOM   3534  C  C   . TYR A  1 464 ? 15.620  5.345   7.212   1.00   23.22 ? 571  TYR A C   1 
ATOM   3535  O  O   . TYR A  1 464 ? 14.551  5.640   6.658   1.00   23.05 ? 571  TYR A O   1 
ATOM   3536  C  CB  . TYR A  1 464 ? 17.516  6.693   6.349   1.00   18.33 ? 571  TYR A CB  1 
ATOM   3537  C  CG  . TYR A  1 464 ? 18.842  6.784   5.627   1.00   20.39 ? 571  TYR A CG  1 
ATOM   3538  C  CD1 . TYR A  1 464 ? 20.046  6.553   6.301   1.00   20.08 ? 571  TYR A CD1 1 
ATOM   3539  C  CD2 . TYR A  1 464 ? 18.895  7.120   4.269   1.00   17.84 ? 571  TYR A CD2 1 
ATOM   3540  C  CE1 . TYR A  1 464 ? 21.279  6.659   5.638   1.00   22.68 ? 571  TYR A CE1 1 
ATOM   3541  C  CE2 . TYR A  1 464 ? 20.118  7.229   3.597   1.00   21.75 ? 571  TYR A CE2 1 
ATOM   3542  C  CZ  . TYR A  1 464 ? 21.302  7.001   4.286   1.00   23.50 ? 571  TYR A CZ  1 
ATOM   3543  O  OH  . TYR A  1 464 ? 22.501  7.157   3.632   1.00   29.52 ? 571  TYR A OH  1 
ATOM   3544  N  N   . GLY A  1 465 ? 15.699  5.072   8.509   1.00   23.27 ? 572  GLY A N   1 
ATOM   3545  C  CA  . GLY A  1 465 ? 14.491  5.118   9.308   1.00   23.30 ? 572  GLY A CA  1 
ATOM   3546  C  C   . GLY A  1 465 ? 14.564  4.371   10.627  1.00   25.10 ? 572  GLY A C   1 
ATOM   3547  O  O   . GLY A  1 465 ? 15.644  4.070   11.134  1.00   23.42 ? 572  GLY A O   1 
ATOM   3548  N  N   . THR A  1 466 ? 13.392  4.062   11.171  1.00   25.07 ? 573  THR A N   1 
ATOM   3549  C  CA  . THR A  1 466 ? 13.278  3.383   12.455  1.00   25.78 ? 573  THR A CA  1 
ATOM   3550  C  C   . THR A  1 466 ? 12.241  2.250   12.403  1.00   26.90 ? 573  THR A C   1 
ATOM   3551  O  O   . THR A  1 466 ? 11.533  2.076   11.403  1.00   21.33 ? 573  THR A O   1 
ATOM   3552  C  CB  . THR A  1 466 ? 12.825  4.383   13.540  1.00   21.02 ? 573  THR A CB  1 
ATOM   3553  O  OG1 . THR A  1 466 ? 11.502  4.831   13.226  1.00   25.01 ? 573  THR A OG1 1 
ATOM   3554  C  CG2 . THR A  1 466 ? 13.742  5.608   13.575  1.00   18.00 ? 573  THR A CG2 1 
ATOM   3555  N  N   . ALA A  1 467 ? 12.157  1.506   13.503  1.00   27.86 ? 574  ALA A N   1 
ATOM   3556  C  CA  . ALA A  1 467 ? 11.213  0.407   13.643  1.00   34.07 ? 574  ALA A CA  1 
ATOM   3557  C  C   . ALA A  1 467 ? 10.318  0.695   14.853  1.00   39.45 ? 574  ALA A C   1 
ATOM   3558  O  O   . ALA A  1 467 ? 10.305  1.861   15.298  1.00   45.64 ? 574  ALA A O   1 
ATOM   3559  C  CB  . ALA A  1 467 ? 11.958  -0.896  13.838  1.00   31.58 ? 574  ALA A CB  1 
ATOM   3560  N  N   . TYR B  1 3   ? 48.153  -19.530 37.083  1.00   50.71 ? 110  TYR B N   1 
ATOM   3561  C  CA  . TYR B  1 3   ? 47.564  -19.663 35.711  1.00   49.97 ? 110  TYR B CA  1 
ATOM   3562  C  C   . TYR B  1 3   ? 48.104  -20.886 34.973  1.00   49.04 ? 110  TYR B C   1 
ATOM   3563  O  O   . TYR B  1 3   ? 49.320  -21.041 34.819  1.00   47.69 ? 110  TYR B O   1 
ATOM   3564  C  CB  . TYR B  1 3   ? 47.863  -18.415 34.852  1.00   47.64 ? 110  TYR B CB  1 
ATOM   3565  C  CG  . TYR B  1 3   ? 47.411  -18.575 33.409  1.00   42.68 ? 110  TYR B CG  1 
ATOM   3566  C  CD1 . TYR B  1 3   ? 46.063  -18.529 33.082  1.00   39.97 ? 110  TYR B CD1 1 
ATOM   3567  C  CD2 . TYR B  1 3   ? 48.326  -18.886 32.391  1.00   39.80 ? 110  TYR B CD2 1 
ATOM   3568  C  CE1 . TYR B  1 3   ? 45.623  -18.802 31.788  1.00   41.82 ? 110  TYR B CE1 1 
ATOM   3569  C  CE2 . TYR B  1 3   ? 47.898  -19.161 31.093  1.00   38.01 ? 110  TYR B CE2 1 
ATOM   3570  C  CZ  . TYR B  1 3   ? 46.539  -19.123 30.800  1.00   40.67 ? 110  TYR B CZ  1 
ATOM   3571  O  OH  . TYR B  1 3   ? 46.072  -19.457 29.545  1.00   39.33 ? 110  TYR B OH  1 
ATOM   3572  N  N   . GLN B  1 4   ? 47.198  -21.745 34.509  1.00   48.41 ? 111  GLN B N   1 
ATOM   3573  C  CA  . GLN B  1 4   ? 47.600  -22.935 33.759  1.00   47.94 ? 111  GLN B CA  1 
ATOM   3574  C  C   . GLN B  1 4   ? 47.380  -22.691 32.273  1.00   45.33 ? 111  GLN B C   1 
ATOM   3575  O  O   . GLN B  1 4   ? 46.254  -22.431 31.844  1.00   43.20 ? 111  GLN B O   1 
ATOM   3576  C  CB  . GLN B  1 4   ? 46.796  -24.173 34.191  1.00   49.02 ? 111  GLN B CB  1 
ATOM   3577  C  CG  . GLN B  1 4   ? 47.236  -24.825 35.502  1.00   48.35 ? 111  GLN B CG  1 
ATOM   3578  C  CD  . GLN B  1 4   ? 46.548  -26.159 35.733  0.0000 48.50 ? 111  GLN B CD  1 
ATOM   3579  O  OE1 . GLN B  1 4   ? 46.420  -26.619 36.868  0.0000 48.42 ? 111  GLN B OE1 1 
ATOM   3580  N  NE2 . GLN B  1 4   ? 46.110  -26.793 34.650  0.0000 48.42 ? 111  GLN B NE2 1 
ATOM   3581  N  N   . GLU B  1 5   ? 48.453  -22.787 31.493  1.00   42.13 ? 112  GLU B N   1 
ATOM   3582  C  CA  . GLU B  1 5   ? 48.364  -22.571 30.049  1.00   42.06 ? 112  GLU B CA  1 
ATOM   3583  C  C   . GLU B  1 5   ? 47.580  -23.692 29.353  1.00   40.22 ? 112  GLU B C   1 
ATOM   3584  O  O   . GLU B  1 5   ? 47.448  -24.790 29.886  1.00   40.78 ? 112  GLU B O   1 
ATOM   3585  C  CB  . GLU B  1 5   ? 49.770  -22.463 29.441  1.00   41.00 ? 112  GLU B CB  1 
ATOM   3586  C  CG  . GLU B  1 5   ? 50.517  -23.780 29.327  1.00   41.79 ? 112  GLU B CG  1 
ATOM   3587  C  CD  . GLU B  1 5   ? 51.946  -23.604 28.840  1.00   44.00 ? 112  GLU B CD  1 
ATOM   3588  O  OE1 . GLU B  1 5   ? 52.554  -24.601 28.394  1.00   47.46 ? 112  GLU B OE1 1 
ATOM   3589  O  OE2 . GLU B  1 5   ? 52.467  -22.471 28.908  1.00   43.44 ? 112  GLU B OE2 1 
ATOM   3590  N  N   . PRO B  1 6   ? 47.049  -23.419 28.147  1.00   39.48 ? 113  PRO B N   1 
ATOM   3591  C  CA  . PRO B  1 6   ? 46.273  -24.394 27.369  1.00   36.87 ? 113  PRO B CA  1 
ATOM   3592  C  C   . PRO B  1 6   ? 46.918  -25.774 27.248  1.00   35.12 ? 113  PRO B C   1 
ATOM   3593  O  O   . PRO B  1 6   ? 48.135  -25.902 27.186  1.00   34.76 ? 113  PRO B O   1 
ATOM   3594  C  CB  . PRO B  1 6   ? 46.119  -23.701 26.022  1.00   35.48 ? 113  PRO B CB  1 
ATOM   3595  C  CG  . PRO B  1 6   ? 45.985  -22.253 26.434  1.00   35.24 ? 113  PRO B CG  1 
ATOM   3596  C  CD  . PRO B  1 6   ? 47.094  -22.115 27.452  1.00   36.20 ? 113  PRO B CD  1 
ATOM   3597  N  N   . THR B  1 7   ? 46.081  -26.802 27.209  1.00   34.64 ? 114  THR B N   1 
ATOM   3598  C  CA  . THR B  1 7   ? 46.551  -28.179 27.096  1.00   33.85 ? 114  THR B CA  1 
ATOM   3599  C  C   . THR B  1 7   ? 46.344  -28.714 25.681  1.00   33.09 ? 114  THR B C   1 
ATOM   3600  O  O   . THR B  1 7   ? 46.718  -29.846 25.379  1.00   32.55 ? 114  THR B O   1 
ATOM   3601  C  CB  . THR B  1 7   ? 45.788  -29.095 28.062  1.00   32.59 ? 114  THR B CB  1 
ATOM   3602  O  OG1 . THR B  1 7   ? 44.383  -28.948 27.833  1.00   31.37 ? 114  THR B OG1 1 
ATOM   3603  C  CG2 . THR B  1 7   ? 46.100  -28.742 29.504  1.00   30.15 ? 114  THR B CG2 1 
ATOM   3604  N  N   . ASP B  1 8   ? 45.742  -27.901 24.821  1.00   32.14 ? 115  ASP B N   1 
ATOM   3605  C  CA  . ASP B  1 8   ? 45.483  -28.305 23.441  1.00   31.35 ? 115  ASP B CA  1 
ATOM   3606  C  C   . ASP B  1 8   ? 46.722  -28.905 22.802  1.00   31.38 ? 115  ASP B C   1 
ATOM   3607  O  O   . ASP B  1 8   ? 47.831  -28.405 22.981  1.00   31.31 ? 115  ASP B O   1 
ATOM   3608  C  CB  . ASP B  1 8   ? 45.000  -27.109 22.634  1.00   27.58 ? 115  ASP B CB  1 
ATOM   3609  C  CG  . ASP B  1 8   ? 43.805  -26.466 23.255  1.00   25.92 ? 115  ASP B CG  1 
ATOM   3610  O  OD1 . ASP B  1 8   ? 43.953  -25.932 24.373  1.00   27.78 ? 115  ASP B OD1 1 
ATOM   3611  O  OD2 . ASP B  1 8   ? 42.720  -26.507 22.644  1.00   25.88 ? 115  ASP B OD2 1 
ATOM   3612  N  N   . PRO B  1 9   ? 46.544  -29.989 22.038  1.00   31.05 ? 116  PRO B N   1 
ATOM   3613  C  CA  . PRO B  1 9   ? 47.651  -30.676 21.369  1.00   31.12 ? 116  PRO B CA  1 
ATOM   3614  C  C   . PRO B  1 9   ? 48.589  -29.817 20.523  1.00   31.58 ? 116  PRO B C   1 
ATOM   3615  O  O   . PRO B  1 9   ? 49.792  -30.074 20.481  1.00   28.92 ? 116  PRO B O   1 
ATOM   3616  C  CB  . PRO B  1 9   ? 46.946  -31.762 20.556  1.00   29.25 ? 116  PRO B CB  1 
ATOM   3617  C  CG  . PRO B  1 9   ? 45.584  -31.190 20.316  1.00   32.52 ? 116  PRO B CG  1 
ATOM   3618  C  CD  . PRO B  1 9   ? 45.248  -30.566 21.644  1.00   32.63 ? 116  PRO B CD  1 
ATOM   3619  N  N   . LYS B  1 10  ? 48.054  -28.795 19.864  1.00   32.18 ? 117  LYS B N   1 
ATOM   3620  C  CA  . LYS B  1 10  ? 48.885  -27.939 19.016  1.00   31.95 ? 117  LYS B CA  1 
ATOM   3621  C  C   . LYS B  1 10  ? 49.374  -26.642 19.655  1.00   30.62 ? 117  LYS B C   1 
ATOM   3622  O  O   . LYS B  1 10  ? 50.121  -25.888 19.029  1.00   28.57 ? 117  LYS B O   1 
ATOM   3623  C  CB  . LYS B  1 10  ? 48.142  -27.606 17.722  1.00   33.26 ? 117  LYS B CB  1 
ATOM   3624  C  CG  . LYS B  1 10  ? 47.879  -28.811 16.849  1.00   35.42 ? 117  LYS B CG  1 
ATOM   3625  C  CD  . LYS B  1 10  ? 49.189  -29.474 16.494  1.00   41.19 ? 117  LYS B CD  1 
ATOM   3626  C  CE  . LYS B  1 10  ? 49.012  -30.565 15.452  1.00   44.20 ? 117  LYS B CE  1 
ATOM   3627  N  NZ  . LYS B  1 10  ? 50.308  -31.264 15.205  1.00   47.69 ? 117  LYS B NZ  1 
ATOM   3628  N  N   . PHE B  1 11  ? 48.964  -26.373 20.891  1.00   30.06 ? 118  PHE B N   1 
ATOM   3629  C  CA  . PHE B  1 11  ? 49.391  -25.142 21.550  1.00   29.06 ? 118  PHE B CA  1 
ATOM   3630  C  C   . PHE B  1 11  ? 50.913  -24.992 21.566  1.00   30.64 ? 118  PHE B C   1 
ATOM   3631  O  O   . PHE B  1 11  ? 51.432  -23.896 21.383  1.00   30.10 ? 118  PHE B O   1 
ATOM   3632  C  CB  . PHE B  1 11  ? 48.880  -25.075 22.986  1.00   28.23 ? 118  PHE B CB  1 
ATOM   3633  C  CG  . PHE B  1 11  ? 49.357  -23.863 23.729  1.00   28.62 ? 118  PHE B CG  1 
ATOM   3634  C  CD1 . PHE B  1 11  ? 48.884  -22.597 23.396  1.00   30.88 ? 118  PHE B CD1 1 
ATOM   3635  C  CD2 . PHE B  1 11  ? 50.291  -23.978 24.745  1.00   27.88 ? 118  PHE B CD2 1 
ATOM   3636  C  CE1 . PHE B  1 11  ? 49.338  -21.462 24.070  1.00   32.27 ? 118  PHE B CE1 1 
ATOM   3637  C  CE2 . PHE B  1 11  ? 50.752  -22.850 25.424  1.00   31.16 ? 118  PHE B CE2 1 
ATOM   3638  C  CZ  . PHE B  1 11  ? 50.272  -21.589 25.084  1.00   30.40 ? 118  PHE B CZ  1 
ATOM   3639  N  N   . PRO B  1 12  ? 51.650  -26.088 21.813  1.00   31.18 ? 119  PRO B N   1 
ATOM   3640  C  CA  . PRO B  1 12  ? 53.111  -25.966 21.829  1.00   29.77 ? 119  PRO B CA  1 
ATOM   3641  C  C   . PRO B  1 12  ? 53.685  -25.477 20.494  1.00   29.74 ? 119  PRO B C   1 
ATOM   3642  O  O   . PRO B  1 12  ? 54.770  -24.899 20.457  1.00   27.65 ? 119  PRO B O   1 
ATOM   3643  C  CB  . PRO B  1 12  ? 53.566  -27.378 22.180  1.00   30.61 ? 119  PRO B CB  1 
ATOM   3644  C  CG  . PRO B  1 12  ? 52.453  -27.851 23.091  1.00   30.73 ? 119  PRO B CG  1 
ATOM   3645  C  CD  . PRO B  1 12  ? 51.227  -27.403 22.336  1.00   31.74 ? 119  PRO B CD  1 
ATOM   3646  N  N   . GLN B  1 13  ? 52.961  -25.703 19.402  1.00   29.41 ? 120  GLN B N   1 
ATOM   3647  C  CA  . GLN B  1 13  ? 53.427  -25.249 18.094  1.00   31.23 ? 120  GLN B CA  1 
ATOM   3648  C  C   . GLN B  1 13  ? 53.030  -23.803 17.798  1.00   30.81 ? 120  GLN B C   1 
ATOM   3649  O  O   . GLN B  1 13  ? 53.455  -23.233 16.793  1.00   30.44 ? 120  GLN B O   1 
ATOM   3650  C  CB  . GLN B  1 13  ? 52.906  -26.165 16.990  1.00   34.15 ? 120  GLN B CB  1 
ATOM   3651  C  CG  . GLN B  1 13  ? 53.544  -27.536 17.034  1.00   42.78 ? 120  GLN B CG  1 
ATOM   3652  C  CD  . GLN B  1 13  ? 52.507  -28.637 17.110  1.00   51.46 ? 120  GLN B CD  1 
ATOM   3653  O  OE1 . GLN B  1 13  ? 51.964  -29.071 16.082  1.00   54.06 ? 120  GLN B OE1 1 
ATOM   3654  N  NE2 . GLN B  1 13  ? 52.206  -29.083 18.331  1.00   50.68 ? 120  GLN B NE2 1 
ATOM   3655  N  N   . GLN B  1 14  ? 52.217  -23.206 18.664  1.00   27.95 ? 121  GLN B N   1 
ATOM   3656  C  CA  . GLN B  1 14  ? 51.818  -21.822 18.460  1.00   27.18 ? 121  GLN B CA  1 
ATOM   3657  C  C   . GLN B  1 14  ? 52.875  -20.922 19.097  1.00   28.49 ? 121  GLN B C   1 
ATOM   3658  O  O   . GLN B  1 14  ? 52.642  -20.236 20.097  1.00   29.30 ? 121  GLN B O   1 
ATOM   3659  C  CB  . GLN B  1 14  ? 50.425  -21.593 19.041  1.00   25.87 ? 121  GLN B CB  1 
ATOM   3660  C  CG  . GLN B  1 14  ? 49.382  -22.394 18.269  1.00   28.27 ? 121  GLN B CG  1 
ATOM   3661  C  CD  . GLN B  1 14  ? 47.961  -22.202 18.758  1.00   30.78 ? 121  GLN B CD  1 
ATOM   3662  O  OE1 . GLN B  1 14  ? 47.619  -22.548 19.894  1.00   27.66 ? 121  GLN B OE1 1 
ATOM   3663  N  NE2 . GLN B  1 14  ? 47.115  -21.659 17.890  1.00   31.63 ? 121  GLN B NE2 1 
ATOM   3664  N  N   . TRP B  1 15  ? 54.055  -20.961 18.486  1.00   28.82 ? 122  TRP B N   1 
ATOM   3665  C  CA  . TRP B  1 15  ? 55.229  -20.203 18.911  1.00   26.89 ? 122  TRP B CA  1 
ATOM   3666  C  C   . TRP B  1 15  ? 55.002  -18.700 19.087  1.00   28.43 ? 122  TRP B C   1 
ATOM   3667  O  O   . TRP B  1 15  ? 55.636  -18.068 19.924  1.00   27.91 ? 122  TRP B O   1 
ATOM   3668  C  CB  . TRP B  1 15  ? 56.354  -20.404 17.895  1.00   25.06 ? 122  TRP B CB  1 
ATOM   3669  C  CG  . TRP B  1 15  ? 55.941  -20.056 16.489  1.00   24.58 ? 122  TRP B CG  1 
ATOM   3670  C  CD1 . TRP B  1 15  ? 55.198  -20.826 15.638  1.00   24.75 ? 122  TRP B CD1 1 
ATOM   3671  C  CD2 . TRP B  1 15  ? 56.180  -18.820 15.807  1.00   23.51 ? 122  TRP B CD2 1 
ATOM   3672  N  NE1 . TRP B  1 15  ? 54.953  -20.145 14.471  1.00   26.19 ? 122  TRP B NE1 1 
ATOM   3673  C  CE2 . TRP B  1 15  ? 55.542  -18.909 14.547  1.00   25.20 ? 122  TRP B CE2 1 
ATOM   3674  C  CE3 . TRP B  1 15  ? 56.865  -17.642 16.139  1.00   23.34 ? 122  TRP B CE3 1 
ATOM   3675  C  CZ2 . TRP B  1 15  ? 55.566  -17.859 13.613  1.00   24.70 ? 122  TRP B CZ2 1 
ATOM   3676  C  CZ3 . TRP B  1 15  ? 56.888  -16.595 15.211  1.00   24.35 ? 122  TRP B CZ3 1 
ATOM   3677  C  CH2 . TRP B  1 15  ? 56.239  -16.716 13.962  1.00   23.73 ? 122  TRP B CH2 1 
ATOM   3678  N  N   . TYR B  1 16  ? 54.121  -18.128 18.276  1.00   28.26 ? 123  TYR B N   1 
ATOM   3679  C  CA  . TYR B  1 16  ? 53.836  -16.697 18.324  1.00   27.86 ? 123  TYR B CA  1 
ATOM   3680  C  C   . TYR B  1 16  ? 52.988  -16.272 19.532  1.00   30.28 ? 123  TYR B C   1 
ATOM   3681  O  O   . TYR B  1 16  ? 52.945  -15.089 19.886  1.00   26.58 ? 123  TYR B O   1 
ATOM   3682  C  CB  . TYR B  1 16  ? 53.133  -16.279 17.030  1.00   25.18 ? 123  TYR B CB  1 
ATOM   3683  C  CG  . TYR B  1 16  ? 52.069  -17.265 16.591  1.00   22.26 ? 123  TYR B CG  1 
ATOM   3684  C  CD1 . TYR B  1 16  ? 52.409  -18.452 15.935  1.00   22.28 ? 123  TYR B CD1 1 
ATOM   3685  C  CD2 . TYR B  1 16  ? 50.732  -17.044 16.888  1.00   21.08 ? 123  TYR B CD2 1 
ATOM   3686  C  CE1 . TYR B  1 16  ? 51.428  -19.395 15.592  1.00   21.49 ? 123  TYR B CE1 1 
ATOM   3687  C  CE2 . TYR B  1 16  ? 49.751  -17.972 16.551  1.00   20.70 ? 123  TYR B CE2 1 
ATOM   3688  C  CZ  . TYR B  1 16  ? 50.098  -19.146 15.907  1.00   21.07 ? 123  TYR B CZ  1 
ATOM   3689  O  OH  . TYR B  1 16  ? 49.110  -20.061 15.597  1.00   20.42 ? 123  TYR B OH  1 
ATOM   3690  N  N   . LEU B  1 17  ? 52.300  -17.225 20.152  1.00   30.71 ? 124  LEU B N   1 
ATOM   3691  C  CA  . LEU B  1 17  ? 51.474  -16.911 21.309  1.00   34.16 ? 124  LEU B CA  1 
ATOM   3692  C  C   . LEU B  1 17  ? 52.331  -16.887 22.564  1.00   39.82 ? 124  LEU B C   1 
ATOM   3693  O  O   . LEU B  1 17  ? 52.302  -15.929 23.341  1.00   41.23 ? 124  LEU B O   1 
ATOM   3694  C  CB  . LEU B  1 17  ? 50.370  -17.947 21.478  1.00   28.86 ? 124  LEU B CB  1 
ATOM   3695  C  CG  . LEU B  1 17  ? 49.276  -17.970 20.415  1.00   27.61 ? 124  LEU B CG  1 
ATOM   3696  C  CD1 . LEU B  1 17  ? 48.263  -19.062 20.754  1.00   24.52 ? 124  LEU B CD1 1 
ATOM   3697  C  CD2 . LEU B  1 17  ? 48.596  -16.618 20.352  1.00   22.57 ? 124  LEU B CD2 1 
ATOM   3698  N  N   . SER B  1 18  ? 53.098  -17.954 22.753  1.00   44.84 ? 125  SER B N   1 
ATOM   3699  C  CA  . SER B  1 18  ? 53.972  -18.084 23.909  1.00   49.68 ? 125  SER B CA  1 
ATOM   3700  C  C   . SER B  1 18  ? 55.194  -18.903 23.535  1.00   51.98 ? 125  SER B C   1 
ATOM   3701  O  O   . SER B  1 18  ? 55.085  -19.927 22.867  1.00   52.08 ? 125  SER B O   1 
ATOM   3702  C  CB  . SER B  1 18  ? 53.230  -18.771 25.061  1.00   51.41 ? 125  SER B CB  1 
ATOM   3703  O  OG  . SER B  1 18  ? 54.075  -18.941 26.189  1.00   51.54 ? 125  SER B OG  1 
ATOM   3704  N  N   . GLY B  1 19  ? 56.357  -18.440 23.970  1.00   56.30 ? 126  GLY B N   1 
ATOM   3705  C  CA  . GLY B  1 19  ? 57.588  -19.143 23.674  1.00   62.52 ? 126  GLY B CA  1 
ATOM   3706  C  C   . GLY B  1 19  ? 58.682  -18.770 24.653  1.00   65.97 ? 126  GLY B C   1 
ATOM   3707  O  O   . GLY B  1 19  ? 58.663  -17.683 25.239  1.00   67.45 ? 126  GLY B O   1 
ATOM   3708  N  N   . VAL B  1 20  ? 59.631  -19.679 24.844  1.00   68.85 ? 127  VAL B N   1 
ATOM   3709  C  CA  . VAL B  1 20  ? 60.744  -19.426 25.749  1.00   69.97 ? 127  VAL B CA  1 
ATOM   3710  C  C   . VAL B  1 20  ? 61.685  -18.420 25.083  1.00   71.65 ? 127  VAL B C   1 
ATOM   3711  O  O   . VAL B  1 20  ? 62.289  -17.578 25.755  1.00   72.42 ? 127  VAL B O   1 
ATOM   3712  C  CB  . VAL B  1 20  ? 61.525  -20.730 26.058  1.00   68.26 ? 127  VAL B CB  1 
ATOM   3713  C  CG1 . VAL B  1 20  ? 60.609  -21.737 26.733  0.0000 69.00 ? 127  VAL B CG1 1 
ATOM   3714  C  CG2 . VAL B  1 20  ? 62.100  -21.313 24.776  0.0000 69.00 ? 127  VAL B CG2 1 
ATOM   3715  N  N   . THR B  1 21  ? 61.772  -18.504 23.754  1.00   72.30 ? 128  THR B N   1 
ATOM   3716  C  CA  . THR B  1 21  ? 62.642  -17.641 22.956  1.00   71.31 ? 128  THR B CA  1 
ATOM   3717  C  C   . THR B  1 21  ? 62.355  -16.146 23.081  1.00   71.58 ? 128  THR B C   1 
ATOM   3718  O  O   . THR B  1 21  ? 63.013  -15.333 22.431  1.00   73.04 ? 128  THR B O   1 
ATOM   3719  C  CB  . THR B  1 21  ? 62.593  -18.033 21.461  1.00   70.60 ? 128  THR B CB  1 
ATOM   3720  O  OG1 . THR B  1 21  ? 63.494  -17.203 20.717  0.0000 70.88 ? 128  THR B OG1 1 
ATOM   3721  C  CG2 . THR B  1 21  ? 61.196  -17.868 20.913  0.0000 70.88 ? 128  THR B CG2 1 
ATOM   3722  N  N   . GLN B  1 22  ? 61.382  -15.784 23.914  1.00   70.17 ? 129  GLN B N   1 
ATOM   3723  C  CA  . GLN B  1 22  ? 61.035  -14.377 24.133  1.00   67.63 ? 129  GLN B CA  1 
ATOM   3724  C  C   . GLN B  1 22  ? 60.693  -13.620 22.843  1.00   65.48 ? 129  GLN B C   1 
ATOM   3725  O  O   . GLN B  1 22  ? 60.633  -12.384 22.830  1.00   67.88 ? 129  GLN B O   1 
ATOM   3726  C  CB  . GLN B  1 22  ? 62.189  -13.664 24.849  1.00   67.87 ? 129  GLN B CB  1 
ATOM   3727  C  CG  . GLN B  1 22  ? 62.612  -14.325 26.151  0.0000 67.56 ? 129  GLN B CG  1 
ATOM   3728  C  CD  . GLN B  1 22  ? 63.812  -13.648 26.782  0.0000 67.49 ? 129  GLN B CD  1 
ATOM   3729  O  OE1 . GLN B  1 22  ? 64.883  -13.573 26.179  0.0000 67.42 ? 129  GLN B OE1 1 
ATOM   3730  N  NE2 . GLN B  1 22  ? 63.640  -13.150 28.001  0.0000 67.42 ? 129  GLN B NE2 1 
ATOM   3731  N  N   . ARG B  1 23  ? 60.475  -14.358 21.760  1.00   59.52 ? 130  ARG B N   1 
ATOM   3732  C  CA  . ARG B  1 23  ? 60.125  -13.741 20.485  1.00   52.81 ? 130  ARG B CA  1 
ATOM   3733  C  C   . ARG B  1 23  ? 58.695  -14.158 20.143  1.00   47.21 ? 130  ARG B C   1 
ATOM   3734  O  O   . ARG B  1 23  ? 58.465  -15.012 19.287  1.00   44.22 ? 130  ARG B O   1 
ATOM   3735  C  CB  . ARG B  1 23  ? 61.128  -14.184 19.417  1.00   53.91 ? 130  ARG B CB  1 
ATOM   3736  C  CG  . ARG B  1 23  ? 62.555  -14.104 19.979  1.00   55.46 ? 130  ARG B CG  1 
ATOM   3737  C  CD  . ARG B  1 23  ? 63.537  -13.300 19.148  1.00   55.26 ? 130  ARG B CD  1 
ATOM   3738  N  NE  . ARG B  1 23  ? 63.976  -14.023 17.960  0.0000 54.74 ? 130  ARG B NE  1 
ATOM   3739  C  CZ  . ARG B  1 23  ? 65.207  -13.959 17.465  0.0000 54.53 ? 130  ARG B CZ  1 
ATOM   3740  N  NH1 . ARG B  1 23  ? 66.123  -13.207 18.059  0.0000 54.37 ? 130  ARG B NH1 1 
ATOM   3741  N  NH2 . ARG B  1 23  ? 65.523  -14.644 16.375  0.0000 54.37 ? 130  ARG B NH2 1 
ATOM   3742  N  N   . ASP B  1 24  ? 57.741  -13.557 20.856  1.00   41.06 ? 131  ASP B N   1 
ATOM   3743  C  CA  . ASP B  1 24  ? 56.320  -13.840 20.661  1.00   34.98 ? 131  ASP B CA  1 
ATOM   3744  C  C   . ASP B  1 24  ? 55.465  -12.604 20.969  1.00   30.79 ? 131  ASP B C   1 
ATOM   3745  O  O   . ASP B  1 24  ? 55.996  -11.546 21.314  1.00   28.55 ? 131  ASP B O   1 
ATOM   3746  C  CB  . ASP B  1 24  ? 55.883  -15.027 21.534  1.00   36.81 ? 131  ASP B CB  1 
ATOM   3747  C  CG  . ASP B  1 24  ? 56.129  -14.796 23.034  1.00   39.83 ? 131  ASP B CG  1 
ATOM   3748  O  OD1 . ASP B  1 24  ? 55.564  -13.832 23.604  1.00   33.84 ? 131  ASP B OD1 1 
ATOM   3749  O  OD2 . ASP B  1 24  ? 56.879  -15.595 23.644  1.00   39.72 ? 131  ASP B OD2 1 
ATOM   3750  N  N   . LEU B  1 25  ? 54.146  -12.745 20.841  1.00   25.85 ? 132  LEU B N   1 
ATOM   3751  C  CA  . LEU B  1 25  ? 53.220  -11.640 21.070  1.00   22.80 ? 132  LEU B CA  1 
ATOM   3752  C  C   . LEU B  1 25  ? 52.878  -11.413 22.550  1.00   24.58 ? 132  LEU B C   1 
ATOM   3753  O  O   . LEU B  1 25  ? 52.023  -10.591 22.884  1.00   20.99 ? 132  LEU B O   1 
ATOM   3754  C  CB  . LEU B  1 25  ? 51.947  -11.867 20.244  1.00   21.32 ? 132  LEU B CB  1 
ATOM   3755  C  CG  . LEU B  1 25  ? 52.185  -11.938 18.726  1.00   16.48 ? 132  LEU B CG  1 
ATOM   3756  C  CD1 . LEU B  1 25  ? 50.927  -12.367 18.020  1.00   15.61 ? 132  LEU B CD1 1 
ATOM   3757  C  CD2 . LEU B  1 25  ? 52.648  -10.584 18.222  1.00   18.31 ? 132  LEU B CD2 1 
ATOM   3758  N  N   . ASN B  1 26  ? 53.550  -12.153 23.431  1.00   25.66 ? 133  ASN B N   1 
ATOM   3759  C  CA  . ASN B  1 26  ? 53.360  -12.007 24.872  1.00   22.65 ? 133  ASN B CA  1 
ATOM   3760  C  C   . ASN B  1 26  ? 51.908  -12.153 25.288  1.00   22.11 ? 133  ASN B C   1 
ATOM   3761  O  O   . ASN B  1 26  ? 51.426  -11.425 26.155  1.00   21.87 ? 133  ASN B O   1 
ATOM   3762  C  CB  . ASN B  1 26  ? 53.895  -10.637 25.301  1.00   24.90 ? 133  ASN B CB  1 
ATOM   3763  C  CG  . ASN B  1 26  ? 54.092  -10.515 26.803  1.00   27.30 ? 133  ASN B CG  1 
ATOM   3764  O  OD1 . ASN B  1 26  ? 54.487  -11.469 27.469  1.00   25.56 ? 133  ASN B OD1 1 
ATOM   3765  N  ND2 . ASN B  1 26  ? 53.850  -9.320  27.337  1.00   25.23 ? 133  ASN B ND2 1 
ATOM   3766  N  N   . VAL B  1 27  ? 51.214  -13.099 24.667  1.00   22.24 ? 134  VAL B N   1 
ATOM   3767  C  CA  . VAL B  1 27  ? 49.807  -13.341 24.960  1.00   22.65 ? 134  VAL B CA  1 
ATOM   3768  C  C   . VAL B  1 27  ? 49.559  -14.049 26.296  1.00   24.87 ? 134  VAL B C   1 
ATOM   3769  O  O   . VAL B  1 27  ? 48.599  -13.744 27.001  1.00   23.18 ? 134  VAL B O   1 
ATOM   3770  C  CB  . VAL B  1 27  ? 49.155  -14.165 23.830  1.00   22.97 ? 134  VAL B CB  1 
ATOM   3771  C  CG1 . VAL B  1 27  ? 47.732  -14.538 24.220  1.00   20.73 ? 134  VAL B CG1 1 
ATOM   3772  C  CG2 . VAL B  1 27  ? 49.150  -13.353 22.546  1.00   22.45 ? 134  VAL B CG2 1 
ATOM   3773  N  N   . LYS B  1 28  ? 50.421  -14.997 26.640  1.00   27.69 ? 135  LYS B N   1 
ATOM   3774  C  CA  . LYS B  1 28  ? 50.270  -15.737 27.888  1.00   31.85 ? 135  LYS B CA  1 
ATOM   3775  C  C   . LYS B  1 28  ? 50.239  -14.744 29.061  1.00   31.84 ? 135  LYS B C   1 
ATOM   3776  O  O   . LYS B  1 28  ? 49.447  -14.896 29.999  1.00   28.69 ? 135  LYS B O   1 
ATOM   3777  C  CB  . LYS B  1 28  ? 51.428  -16.726 28.021  1.00   35.40 ? 135  LYS B CB  1 
ATOM   3778  C  CG  . LYS B  1 28  ? 51.342  -17.744 29.146  1.00   39.95 ? 135  LYS B CG  1 
ATOM   3779  C  CD  . LYS B  1 28  ? 52.619  -18.601 29.119  1.00   45.00 ? 135  LYS B CD  1 
ATOM   3780  C  CE  . LYS B  1 28  ? 52.809  -19.417 30.385  1.00   48.94 ? 135  LYS B CE  1 
ATOM   3781  N  NZ  . LYS B  1 28  ? 51.761  -20.456 30.509  1.00   54.02 ? 135  LYS B NZ  1 
ATOM   3782  N  N   . ALA B  1 29  ? 51.081  -13.714 28.986  1.00   28.63 ? 136  ALA B N   1 
ATOM   3783  C  CA  . ALA B  1 29  ? 51.133  -12.688 30.018  1.00   27.74 ? 136  ALA B CA  1 
ATOM   3784  C  C   . ALA B  1 29  ? 49.772  -11.997 30.171  1.00   29.74 ? 136  ALA B C   1 
ATOM   3785  O  O   . ALA B  1 29  ? 49.412  -11.547 31.263  1.00   31.44 ? 136  ALA B O   1 
ATOM   3786  C  CB  . ALA B  1 29  ? 52.205  -11.660 29.680  1.00   23.50 ? 136  ALA B CB  1 
ATOM   3787  N  N   . ALA B  1 30  ? 49.018  -11.903 29.079  1.00   29.10 ? 137  ALA B N   1 
ATOM   3788  C  CA  . ALA B  1 30  ? 47.701  -11.281 29.138  1.00   29.93 ? 137  ALA B CA  1 
ATOM   3789  C  C   . ALA B  1 30  ? 46.722  -12.263 29.772  1.00   30.12 ? 137  ALA B C   1 
ATOM   3790  O  O   . ALA B  1 30  ? 45.903  -11.881 30.608  1.00   30.87 ? 137  ALA B O   1 
ATOM   3791  C  CB  . ALA B  1 30  ? 47.236  -10.897 27.746  1.00   29.57 ? 137  ALA B CB  1 
ATOM   3792  N  N   . TRP B  1 31  ? 46.805  -13.529 29.367  1.00   28.54 ? 138  TRP B N   1 
ATOM   3793  C  CA  . TRP B  1 31  ? 45.933  -14.557 29.934  1.00   28.92 ? 138  TRP B CA  1 
ATOM   3794  C  C   . TRP B  1 31  ? 46.185  -14.637 31.440  1.00   27.59 ? 138  TRP B C   1 
ATOM   3795  O  O   . TRP B  1 31  ? 45.252  -14.709 32.224  1.00   29.89 ? 138  TRP B O   1 
ATOM   3796  C  CB  . TRP B  1 31  ? 46.226  -15.935 29.328  1.00   27.29 ? 138  TRP B CB  1 
ATOM   3797  C  CG  . TRP B  1 31  ? 45.956  -16.055 27.879  1.00   25.40 ? 138  TRP B CG  1 
ATOM   3798  C  CD1 . TRP B  1 31  ? 45.044  -15.343 27.150  1.00   25.43 ? 138  TRP B CD1 1 
ATOM   3799  C  CD2 . TRP B  1 31  ? 46.521  -17.021 26.984  1.00   24.26 ? 138  TRP B CD2 1 
ATOM   3800  N  NE1 . TRP B  1 31  ? 45.000  -15.812 25.857  1.00   23.31 ? 138  TRP B NE1 1 
ATOM   3801  C  CE2 . TRP B  1 31  ? 45.896  -16.841 25.726  1.00   22.66 ? 138  TRP B CE2 1 
ATOM   3802  C  CE3 . TRP B  1 31  ? 47.493  -18.023 27.123  1.00   22.88 ? 138  TRP B CE3 1 
ATOM   3803  C  CZ2 . TRP B  1 31  ? 46.210  -17.629 24.610  1.00   21.15 ? 138  TRP B CZ2 1 
ATOM   3804  C  CZ3 . TRP B  1 31  ? 47.810  -18.807 26.012  1.00   23.08 ? 138  TRP B CZ3 1 
ATOM   3805  C  CH2 . TRP B  1 31  ? 47.167  -18.604 24.769  1.00   21.89 ? 138  TRP B CH2 1 
ATOM   3806  N  N   . ALA B  1 32  ? 47.459  -14.626 31.825  1.00   28.90 ? 139  ALA B N   1 
ATOM   3807  C  CA  . ALA B  1 32  ? 47.850  -14.706 33.227  1.00   30.33 ? 139  ALA B CA  1 
ATOM   3808  C  C   . ALA B  1 32  ? 47.253  -13.564 34.039  1.00   31.31 ? 139  ALA B C   1 
ATOM   3809  O  O   . ALA B  1 32  ? 46.955  -13.730 35.213  1.00   32.44 ? 139  ALA B O   1 
ATOM   3810  C  CB  . ALA B  1 32  ? 49.366  -14.695 33.348  1.00   28.43 ? 139  ALA B CB  1 
ATOM   3811  N  N   . GLN B  1 33  ? 47.090  -12.400 33.416  1.00   33.27 ? 140  GLN B N   1 
ATOM   3812  C  CA  . GLN B  1 33  ? 46.500  -11.255 34.106  1.00   32.75 ? 140  GLN B CA  1 
ATOM   3813  C  C   . GLN B  1 33  ? 44.984  -11.436 34.215  1.00   30.81 ? 140  GLN B C   1 
ATOM   3814  O  O   . GLN B  1 33  ? 44.295  -10.609 34.801  1.00   29.11 ? 140  GLN B O   1 
ATOM   3815  C  CB  . GLN B  1 33  ? 46.825  -9.951  33.364  1.00   31.24 ? 140  GLN B CB  1 
ATOM   3816  C  CG  . GLN B  1 33  ? 48.229  -9.435  33.626  1.00   36.36 ? 140  GLN B CG  1 
ATOM   3817  C  CD  . GLN B  1 33  ? 48.579  -8.212  32.789  1.00   40.30 ? 140  GLN B CD  1 
ATOM   3818  O  OE1 . GLN B  1 33  ? 49.276  -8.321  31.777  1.00   43.45 ? 140  GLN B OE1 1 
ATOM   3819  N  NE2 . GLN B  1 33  ? 48.088  -7.044  33.201  1.00   36.05 ? 140  GLN B NE2 1 
ATOM   3820  N  N   . GLY B  1 34  ? 44.475  -12.519 33.630  1.00   30.78 ? 141  GLY B N   1 
ATOM   3821  C  CA  . GLY B  1 34  ? 43.053  -12.806 33.685  1.00   27.86 ? 141  GLY B CA  1 
ATOM   3822  C  C   . GLY B  1 34  ? 42.221  -12.440 32.465  1.00   31.26 ? 141  GLY B C   1 
ATOM   3823  O  O   . GLY B  1 34  ? 40.990  -12.448 32.529  1.00   32.85 ? 141  GLY B O   1 
ATOM   3824  N  N   . TYR B  1 35  ? 42.863  -12.143 31.341  1.00   29.90 ? 142  TYR B N   1 
ATOM   3825  C  CA  . TYR B  1 35  ? 42.109  -11.753 30.156  1.00   27.86 ? 142  TYR B CA  1 
ATOM   3826  C  C   . TYR B  1 35  ? 42.173  -12.785 29.039  1.00   27.94 ? 142  TYR B C   1 
ATOM   3827  O  O   . TYR B  1 35  ? 43.251  -13.132 28.553  1.00   28.64 ? 142  TYR B O   1 
ATOM   3828  C  CB  . TYR B  1 35  ? 42.604  -10.382 29.685  1.00   25.39 ? 142  TYR B CB  1 
ATOM   3829  C  CG  . TYR B  1 35  ? 42.476  -9.330  30.778  1.00   26.96 ? 142  TYR B CG  1 
ATOM   3830  C  CD1 . TYR B  1 35  ? 41.226  -8.828  31.144  1.00   26.50 ? 142  TYR B CD1 1 
ATOM   3831  C  CD2 . TYR B  1 35  ? 43.593  -8.892  31.491  1.00   25.57 ? 142  TYR B CD2 1 
ATOM   3832  C  CE1 . TYR B  1 35  ? 41.089  -7.921  32.197  1.00   28.57 ? 142  TYR B CE1 1 
ATOM   3833  C  CE2 . TYR B  1 35  ? 43.470  -7.986  32.542  1.00   29.00 ? 142  TYR B CE2 1 
ATOM   3834  C  CZ  . TYR B  1 35  ? 42.212  -7.505  32.890  1.00   30.68 ? 142  TYR B CZ  1 
ATOM   3835  O  OH  . TYR B  1 35  ? 42.078  -6.594  33.919  1.00   34.04 ? 142  TYR B OH  1 
ATOM   3836  N  N   . THR B  1 36  ? 41.002  -13.273 28.643  1.00   28.77 ? 143  THR B N   1 
ATOM   3837  C  CA  . THR B  1 36  ? 40.898  -14.282 27.598  1.00   28.60 ? 143  THR B CA  1 
ATOM   3838  C  C   . THR B  1 36  ? 39.855  -13.926 26.546  1.00   28.72 ? 143  THR B C   1 
ATOM   3839  O  O   . THR B  1 36  ? 39.566  -14.733 25.657  1.00   28.54 ? 143  THR B O   1 
ATOM   3840  C  CB  . THR B  1 36  ? 40.550  -15.660 28.200  1.00   30.43 ? 143  THR B CB  1 
ATOM   3841  O  OG1 . THR B  1 36  ? 39.344  -15.557 28.965  1.00   27.99 ? 143  THR B OG1 1 
ATOM   3842  C  CG2 . THR B  1 36  ? 41.672  -16.137 29.099  1.00   29.65 ? 143  THR B CG2 1 
ATOM   3843  N  N   . GLY B  1 37  ? 39.286  -12.727 26.655  1.00   27.39 ? 144  GLY B N   1 
ATOM   3844  C  CA  . GLY B  1 37  ? 38.301  -12.283 25.683  1.00   27.99 ? 144  GLY B CA  1 
ATOM   3845  C  C   . GLY B  1 37  ? 36.852  -12.512 26.067  1.00   28.34 ? 144  GLY B C   1 
ATOM   3846  O  O   . GLY B  1 37  ? 35.939  -12.295 25.269  1.00   24.81 ? 144  GLY B O   1 
ATOM   3847  N  N   . HIS B  1 38  ? 36.620  -12.938 27.296  1.00   29.50 ? 145  HIS B N   1 
ATOM   3848  C  CA  . HIS B  1 38  ? 35.261  -13.181 27.701  1.00   32.41 ? 145  HIS B CA  1 
ATOM   3849  C  C   . HIS B  1 38  ? 34.397  -11.938 27.558  1.00   30.67 ? 145  HIS B C   1 
ATOM   3850  O  O   . HIS B  1 38  ? 34.768  -10.868 27.994  1.00   33.21 ? 145  HIS B O   1 
ATOM   3851  C  CB  . HIS B  1 38  ? 35.211  -13.644 29.138  1.00   39.70 ? 145  HIS B CB  1 
ATOM   3852  C  CG  . HIS B  1 38  ? 33.848  -14.092 29.546  1.00   49.07 ? 145  HIS B CG  1 
ATOM   3853  N  ND1 . HIS B  1 38  ? 33.299  -15.276 29.104  1.00   51.89 ? 145  HIS B ND1 1 
ATOM   3854  C  CD2 . HIS B  1 38  ? 32.892  -13.479 30.283  1.00   53.10 ? 145  HIS B CD2 1 
ATOM   3855  C  CE1 . HIS B  1 38  ? 32.057  -15.375 29.551  1.00   54.16 ? 145  HIS B CE1 1 
ATOM   3856  N  NE2 . HIS B  1 38  ? 31.787  -14.299 30.268  1.00   56.78 ? 145  HIS B NE2 1 
ATOM   3857  N  N   . GLY B  1 39  ? 33.232  -12.094 26.950  1.00   29.72 ? 146  GLY B N   1 
ATOM   3858  C  CA  . GLY B  1 39  ? 32.327  -10.972 26.777  1.00   28.10 ? 146  GLY B CA  1 
ATOM   3859  C  C   . GLY B  1 39  ? 32.541  -10.124 25.532  1.00   28.82 ? 146  GLY B C   1 
ATOM   3860  O  O   . GLY B  1 39  ? 31.729  -9.249  25.236  1.00   25.63 ? 146  GLY B O   1 
ATOM   3861  N  N   . ILE B  1 40  ? 33.623  -10.376 24.798  1.00   27.30 ? 147  ILE B N   1 
ATOM   3862  C  CA  . ILE B  1 40  ? 33.905  -9.604  23.593  1.00   26.05 ? 147  ILE B CA  1 
ATOM   3863  C  C   . ILE B  1 40  ? 33.429  -10.364 22.352  1.00   27.30 ? 147  ILE B C   1 
ATOM   3864  O  O   . ILE B  1 40  ? 33.521  -11.597 22.292  1.00   28.38 ? 147  ILE B O   1 
ATOM   3865  C  CB  . ILE B  1 40  ? 35.418  -9.307  23.477  1.00   26.53 ? 147  ILE B CB  1 
ATOM   3866  C  CG1 . ILE B  1 40  ? 35.921  -8.711  24.791  1.00   25.23 ? 147  ILE B CG1 1 
ATOM   3867  C  CG2 . ILE B  1 40  ? 35.688  -8.345  22.316  1.00   25.66 ? 147  ILE B CG2 1 
ATOM   3868  C  CD1 . ILE B  1 40  ? 35.194  -7.460  25.202  1.00   23.11 ? 147  ILE B CD1 1 
ATOM   3869  N  N   . VAL B  1 41  ? 32.909  -9.630  21.370  1.00   24.17 ? 148  VAL B N   1 
ATOM   3870  C  CA  . VAL B  1 41  ? 32.418  -10.243 20.135  1.00   22.80 ? 148  VAL B CA  1 
ATOM   3871  C  C   . VAL B  1 41  ? 33.256  -9.803  18.935  1.00   22.43 ? 148  VAL B C   1 
ATOM   3872  O  O   . VAL B  1 41  ? 33.401  -8.606  18.668  1.00   22.83 ? 148  VAL B O   1 
ATOM   3873  C  CB  . VAL B  1 41  ? 30.947  -9.855  19.873  1.00   25.01 ? 148  VAL B CB  1 
ATOM   3874  C  CG1 . VAL B  1 41  ? 30.478  -10.434 18.544  1.00   19.54 ? 148  VAL B CG1 1 
ATOM   3875  C  CG2 . VAL B  1 41  ? 30.070  -10.327 21.029  1.00   24.18 ? 148  VAL B CG2 1 
ATOM   3876  N  N   . VAL B  1 42  ? 33.803  -10.776 18.218  1.00   19.98 ? 149  VAL B N   1 
ATOM   3877  C  CA  . VAL B  1 42  ? 34.631  -10.509 17.048  1.00   19.94 ? 149  VAL B CA  1 
ATOM   3878  C  C   . VAL B  1 42  ? 34.004  -11.163 15.830  1.00   20.69 ? 149  VAL B C   1 
ATOM   3879  O  O   . VAL B  1 42  ? 33.522  -12.292 15.907  1.00   22.08 ? 149  VAL B O   1 
ATOM   3880  C  CB  . VAL B  1 42  ? 36.043  -11.094 17.216  1.00   18.60 ? 149  VAL B CB  1 
ATOM   3881  C  CG1 . VAL B  1 42  ? 36.920  -10.696 16.035  1.00   18.16 ? 149  VAL B CG1 1 
ATOM   3882  C  CG2 . VAL B  1 42  ? 36.640  -10.635 18.545  1.00   17.26 ? 149  VAL B CG2 1 
ATOM   3883  N  N   . SER B  1 43  ? 34.016  -10.456 14.707  1.00   19.25 ? 150  SER B N   1 
ATOM   3884  C  CA  . SER B  1 43  ? 33.449  -10.984 13.474  1.00   19.92 ? 150  SER B CA  1 
ATOM   3885  C  C   . SER B  1 43  ? 34.481  -10.975 12.352  1.00   18.92 ? 150  SER B C   1 
ATOM   3886  O  O   . SER B  1 43  ? 35.143  -9.964  12.119  1.00   18.13 ? 150  SER B O   1 
ATOM   3887  C  CB  . SER B  1 43  ? 32.238  -10.153 13.056  1.00   20.19 ? 150  SER B CB  1 
ATOM   3888  O  OG  . SER B  1 43  ? 31.559  -10.750 11.969  1.00   23.02 ? 150  SER B OG  1 
ATOM   3889  N  N   . ILE B  1 44  ? 34.603  -12.108 11.663  1.00   18.67 ? 151  ILE B N   1 
ATOM   3890  C  CA  . ILE B  1 44  ? 35.544  -12.268 10.554  1.00   19.36 ? 151  ILE B CA  1 
ATOM   3891  C  C   . ILE B  1 44  ? 34.838  -12.028 9.221   1.00   20.70 ? 151  ILE B C   1 
ATOM   3892  O  O   . ILE B  1 44  ? 34.015  -12.846 8.803   1.00   21.89 ? 151  ILE B O   1 
ATOM   3893  C  CB  . ILE B  1 44  ? 36.128  -13.693 10.544  1.00   20.24 ? 151  ILE B CB  1 
ATOM   3894  C  CG1 . ILE B  1 44  ? 36.771  -13.991 11.904  1.00   19.88 ? 151  ILE B CG1 1 
ATOM   3895  C  CG2 . ILE B  1 44  ? 37.110  -13.864 9.384   1.00   16.31 ? 151  ILE B CG2 1 
ATOM   3896  C  CD1 . ILE B  1 44  ? 37.829  -12.993 12.345  1.00   21.79 ? 151  ILE B CD1 1 
ATOM   3897  N  N   . LEU B  1 45  ? 35.138  -10.907 8.563   1.00   19.91 ? 152  LEU B N   1 
ATOM   3898  C  CA  . LEU B  1 45  ? 34.515  -10.598 7.270   1.00   21.60 ? 152  LEU B CA  1 
ATOM   3899  C  C   . LEU B  1 45  ? 35.382  -11.302 6.249   1.00   24.17 ? 152  LEU B C   1 
ATOM   3900  O  O   . LEU B  1 45  ? 36.493  -10.849 5.962   1.00   25.65 ? 152  LEU B O   1 
ATOM   3901  C  CB  . LEU B  1 45  ? 34.525  -9.094  6.999   1.00   18.73 ? 152  LEU B CB  1 
ATOM   3902  C  CG  . LEU B  1 45  ? 33.997  -8.196  8.115   1.00   25.25 ? 152  LEU B CG  1 
ATOM   3903  C  CD1 . LEU B  1 45  ? 33.716  -6.811  7.541   1.00   25.50 ? 152  LEU B CD1 1 
ATOM   3904  C  CD2 . LEU B  1 45  ? 32.728  -8.775  8.700   1.00   25.46 ? 152  LEU B CD2 1 
ATOM   3905  N  N   . ASP B  1 46  ? 34.879  -12.399 5.689   1.00   22.96 ? 153  ASP B N   1 
ATOM   3906  C  CA  . ASP B  1 46  ? 35.688  -13.174 4.759   1.00   24.48 ? 153  ASP B CA  1 
ATOM   3907  C  C   . ASP B  1 46  ? 34.834  -14.061 3.835   1.00   25.20 ? 153  ASP B C   1 
ATOM   3908  O  O   . ASP B  1 46  ? 33.770  -13.646 3.375   1.00   23.72 ? 153  ASP B O   1 
ATOM   3909  C  CB  . ASP B  1 46  ? 36.665  -14.016 5.600   1.00   25.70 ? 153  ASP B CB  1 
ATOM   3910  C  CG  . ASP B  1 46  ? 37.975  -14.302 4.895   1.00   28.10 ? 153  ASP B CG  1 
ATOM   3911  O  OD1 . ASP B  1 46  ? 37.986  -15.118 3.946   1.00   28.93 ? 153  ASP B OD1 1 
ATOM   3912  O  OD2 . ASP B  1 46  ? 39.001  -13.710 5.304   1.00   27.60 ? 153  ASP B OD2 1 
ATOM   3913  N  N   . ASP B  1 47  ? 35.302  -15.282 3.578   1.00   25.35 ? 154  ASP B N   1 
ATOM   3914  C  CA  . ASP B  1 47  ? 34.593  -16.205 2.698   1.00   23.78 ? 154  ASP B CA  1 
ATOM   3915  C  C   . ASP B  1 47  ? 33.718  -17.220 3.423   1.00   22.83 ? 154  ASP B C   1 
ATOM   3916  O  O   . ASP B  1 47  ? 33.331  -18.235 2.852   1.00   22.12 ? 154  ASP B O   1 
ATOM   3917  C  CB  . ASP B  1 47  ? 35.578  -16.941 1.769   1.00   22.04 ? 154  ASP B CB  1 
ATOM   3918  C  CG  . ASP B  1 47  ? 36.561  -17.835 2.512   1.00   23.55 ? 154  ASP B CG  1 
ATOM   3919  O  OD1 . ASP B  1 47  ? 36.354  -18.159 3.703   1.00   20.86 ? 154  ASP B OD1 1 
ATOM   3920  O  OD2 . ASP B  1 47  ? 37.555  -18.231 1.870   1.00   27.60 ? 154  ASP B OD2 1 
ATOM   3921  N  N   . GLY B  1 48  ? 33.404  -16.931 4.679   1.00   24.93 ? 155  GLY B N   1 
ATOM   3922  C  CA  . GLY B  1 48  ? 32.563  -17.811 5.463   1.00   23.34 ? 155  GLY B CA  1 
ATOM   3923  C  C   . GLY B  1 48  ? 33.282  -18.364 6.675   1.00   26.27 ? 155  GLY B C   1 
ATOM   3924  O  O   . GLY B  1 48  ? 34.493  -18.184 6.826   1.00   25.19 ? 155  GLY B O   1 
ATOM   3925  N  N   . ILE B  1 49  ? 32.533  -19.034 7.544   1.00   26.07 ? 156  ILE B N   1 
ATOM   3926  C  CA  . ILE B  1 49  ? 33.112  -19.625 8.738   1.00   27.02 ? 156  ILE B CA  1 
ATOM   3927  C  C   . ILE B  1 49  ? 32.434  -20.971 9.010   1.00   30.11 ? 156  ILE B C   1 
ATOM   3928  O  O   . ILE B  1 49  ? 31.210  -21.070 8.994   1.00   29.62 ? 156  ILE B O   1 
ATOM   3929  C  CB  . ILE B  1 49  ? 32.933  -18.691 9.952   1.00   25.36 ? 156  ILE B CB  1 
ATOM   3930  C  CG1 . ILE B  1 49  ? 33.617  -19.289 11.181  1.00   25.24 ? 156  ILE B CG1 1 
ATOM   3931  C  CG2 . ILE B  1 49  ? 31.446  -18.441 10.201  1.00   29.19 ? 156  ILE B CG2 1 
ATOM   3932  C  CD1 . ILE B  1 49  ? 33.490  -18.420 12.425  1.00   21.34 ? 156  ILE B CD1 1 
ATOM   3933  N  N   . GLU B  1 50  ? 33.237  -22.010 9.233   1.00   31.37 ? 157  GLU B N   1 
ATOM   3934  C  CA  . GLU B  1 50  ? 32.704  -23.339 9.521   1.00   28.64 ? 157  GLU B CA  1 
ATOM   3935  C  C   . GLU B  1 50  ? 32.275  -23.322 10.980  1.00   29.20 ? 157  GLU B C   1 
ATOM   3936  O  O   . GLU B  1 50  ? 33.044  -23.705 11.866  1.00   27.62 ? 157  GLU B O   1 
ATOM   3937  C  CB  . GLU B  1 50  ? 33.790  -24.386 9.300   1.00   29.60 ? 157  GLU B CB  1 
ATOM   3938  C  CG  . GLU B  1 50  ? 33.285  -25.803 9.292   1.00   30.19 ? 157  GLU B CG  1 
ATOM   3939  C  CD  . GLU B  1 50  ? 34.329  -26.766 8.764   1.00   34.36 ? 157  GLU B CD  1 
ATOM   3940  O  OE1 . GLU B  1 50  ? 35.250  -27.138 9.530   1.00   33.71 ? 157  GLU B OE1 1 
ATOM   3941  O  OE2 . GLU B  1 50  ? 34.236  -27.135 7.572   1.00   32.30 ? 157  GLU B OE2 1 
ATOM   3942  N  N   . LYS B  1 51  ? 31.044  -22.867 11.220  1.00   28.90 ? 158  LYS B N   1 
ATOM   3943  C  CA  . LYS B  1 51  ? 30.505  -22.738 12.570  1.00   30.32 ? 158  LYS B CA  1 
ATOM   3944  C  C   . LYS B  1 51  ? 30.447  -24.027 13.373  1.00   31.84 ? 158  LYS B C   1 
ATOM   3945  O  O   . LYS B  1 51  ? 30.420  -23.995 14.603  1.00   30.48 ? 158  LYS B O   1 
ATOM   3946  C  CB  . LYS B  1 51  ? 29.114  -22.100 12.519  1.00   32.98 ? 158  LYS B CB  1 
ATOM   3947  C  CG  . LYS B  1 51  ? 28.105  -22.832 11.647  1.00   34.02 ? 158  LYS B CG  1 
ATOM   3948  C  CD  . LYS B  1 51  ? 26.802  -22.049 11.563  1.00   35.70 ? 158  LYS B CD  1 
ATOM   3949  C  CE  . LYS B  1 51  ? 25.713  -22.868 10.898  1.00   36.96 ? 158  LYS B CE  1 
ATOM   3950  N  NZ  . LYS B  1 51  ? 26.165  -23.414 9.584   1.00   36.97 ? 158  LYS B NZ  1 
ATOM   3951  N  N   . ASN B  1 52  ? 30.437  -25.159 12.676  1.00   33.22 ? 159  ASN B N   1 
ATOM   3952  C  CA  . ASN B  1 52  ? 30.388  -26.458 13.332  1.00   35.69 ? 159  ASN B CA  1 
ATOM   3953  C  C   . ASN B  1 52  ? 31.787  -27.064 13.528  1.00   35.23 ? 159  ASN B C   1 
ATOM   3954  O  O   . ASN B  1 52  ? 31.916  -28.220 13.920  1.00   36.96 ? 159  ASN B O   1 
ATOM   3955  C  CB  . ASN B  1 52  ? 29.509  -27.410 12.513  1.00   33.25 ? 159  ASN B CB  1 
ATOM   3956  C  CG  . ASN B  1 52  ? 29.991  -27.557 11.093  1.00   37.04 ? 159  ASN B CG  1 
ATOM   3957  O  OD1 . ASN B  1 52  ? 30.315  -26.569 10.431  1.00   40.80 ? 159  ASN B OD1 1 
ATOM   3958  N  ND2 . ASN B  1 52  ? 30.038  -28.792 10.607  1.00   38.77 ? 159  ASN B ND2 1 
ATOM   3959  N  N   . HIS B  1 53  ? 32.835  -26.294 13.255  1.00   33.94 ? 160  HIS B N   1 
ATOM   3960  C  CA  . HIS B  1 53  ? 34.187  -26.815 13.437  1.00   31.43 ? 160  HIS B CA  1 
ATOM   3961  C  C   . HIS B  1 53  ? 34.346  -27.148 14.920  1.00   32.63 ? 160  HIS B C   1 
ATOM   3962  O  O   . HIS B  1 53  ? 33.951  -26.364 15.790  1.00   31.17 ? 160  HIS B O   1 
ATOM   3963  C  CB  . HIS B  1 53  ? 35.233  -25.771 13.017  1.00   29.59 ? 160  HIS B CB  1 
ATOM   3964  C  CG  . HIS B  1 53  ? 36.618  -26.322 12.882  1.00   26.88 ? 160  HIS B CG  1 
ATOM   3965  N  ND1 . HIS B  1 53  ? 37.343  -26.789 13.957  1.00   26.51 ? 160  HIS B ND1 1 
ATOM   3966  C  CD2 . HIS B  1 53  ? 37.393  -26.527 11.789  1.00   25.39 ? 160  HIS B CD2 1 
ATOM   3967  C  CE1 . HIS B  1 53  ? 38.500  -27.263 13.532  1.00   24.43 ? 160  HIS B CE1 1 
ATOM   3968  N  NE2 . HIS B  1 53  ? 38.555  -27.117 12.220  1.00   25.11 ? 160  HIS B NE2 1 
ATOM   3969  N  N   . PRO B  1 54  ? 34.924  -28.318 15.232  1.00   30.88 ? 161  PRO B N   1 
ATOM   3970  C  CA  . PRO B  1 54  ? 35.102  -28.696 16.635  1.00   30.98 ? 161  PRO B CA  1 
ATOM   3971  C  C   . PRO B  1 54  ? 35.866  -27.696 17.497  1.00   29.62 ? 161  PRO B C   1 
ATOM   3972  O  O   . PRO B  1 54  ? 35.698  -27.686 18.715  1.00   31.68 ? 161  PRO B O   1 
ATOM   3973  C  CB  . PRO B  1 54  ? 35.789  -30.065 16.547  1.00   30.63 ? 161  PRO B CB  1 
ATOM   3974  C  CG  . PRO B  1 54  ? 36.484  -30.030 15.223  1.00   33.36 ? 161  PRO B CG  1 
ATOM   3975  C  CD  . PRO B  1 54  ? 35.481  -29.338 14.332  1.00   31.60 ? 161  PRO B CD  1 
ATOM   3976  N  N   . ASP B  1 55  ? 36.695  -26.851 16.892  1.00   29.64 ? 162  ASP B N   1 
ATOM   3977  C  CA  . ASP B  1 55  ? 37.431  -25.875 17.693  1.00   30.16 ? 162  ASP B CA  1 
ATOM   3978  C  C   . ASP B  1 55  ? 36.820  -24.471 17.618  1.00   30.45 ? 162  ASP B C   1 
ATOM   3979  O  O   . ASP B  1 55  ? 37.392  -23.511 18.136  1.00   30.22 ? 162  ASP B O   1 
ATOM   3980  C  CB  . ASP B  1 55  ? 38.908  -25.838 17.275  1.00   31.80 ? 162  ASP B CB  1 
ATOM   3981  C  CG  . ASP B  1 55  ? 39.854  -25.796 18.473  1.00   34.18 ? 162  ASP B CG  1 
ATOM   3982  O  OD1 . ASP B  1 55  ? 39.424  -26.187 19.583  1.00   35.17 ? 162  ASP B OD1 1 
ATOM   3983  O  OD2 . ASP B  1 55  ? 41.031  -25.395 18.303  1.00   33.83 ? 162  ASP B OD2 1 
ATOM   3984  N  N   . LEU B  1 56  ? 35.650  -24.360 16.991  1.00   28.92 ? 163  LEU B N   1 
ATOM   3985  C  CA  . LEU B  1 56  ? 34.972  -23.070 16.864  1.00   28.94 ? 163  LEU B CA  1 
ATOM   3986  C  C   . LEU B  1 56  ? 33.544  -23.069 17.403  1.00   29.74 ? 163  LEU B C   1 
ATOM   3987  O  O   . LEU B  1 56  ? 33.079  -22.067 17.936  1.00   30.93 ? 163  LEU B O   1 
ATOM   3988  C  CB  . LEU B  1 56  ? 34.919  -22.626 15.403  1.00   25.42 ? 163  LEU B CB  1 
ATOM   3989  C  CG  . LEU B  1 56  ? 36.222  -22.296 14.699  1.00   24.33 ? 163  LEU B CG  1 
ATOM   3990  C  CD1 . LEU B  1 56  ? 35.892  -21.864 13.287  1.00   20.56 ? 163  LEU B CD1 1 
ATOM   3991  C  CD2 . LEU B  1 56  ? 36.979  -21.208 15.461  1.00   20.87 ? 163  LEU B CD2 1 
ATOM   3992  N  N   . ALA B  1 57  ? 32.842  -24.185 17.248  1.00   32.21 ? 164  ALA B N   1 
ATOM   3993  C  CA  . ALA B  1 57  ? 31.453  -24.285 17.691  1.00   31.26 ? 164  ALA B CA  1 
ATOM   3994  C  C   . ALA B  1 57  ? 31.223  -23.723 19.088  1.00   29.20 ? 164  ALA B C   1 
ATOM   3995  O  O   . ALA B  1 57  ? 30.263  -22.989 19.319  1.00   27.61 ? 164  ALA B O   1 
ATOM   3996  C  CB  . ALA B  1 57  ? 30.989  -25.740 17.628  1.00   32.34 ? 164  ALA B CB  1 
ATOM   3997  N  N   . GLY B  1 58  ? 32.111  -24.064 20.010  1.00   29.03 ? 165  GLY B N   1 
ATOM   3998  C  CA  . GLY B  1 58  ? 31.978  -23.596 21.375  1.00   29.46 ? 165  GLY B CA  1 
ATOM   3999  C  C   . GLY B  1 58  ? 31.938  -22.089 21.557  1.00   29.57 ? 165  GLY B C   1 
ATOM   4000  O  O   . GLY B  1 58  ? 31.378  -21.604 22.545  1.00   29.61 ? 165  GLY B O   1 
ATOM   4001  N  N   . ASN B  1 59  ? 32.525  -21.340 20.628  1.00   26.54 ? 166  ASN B N   1 
ATOM   4002  C  CA  . ASN B  1 59  ? 32.529  -19.887 20.748  1.00   27.13 ? 166  ASN B CA  1 
ATOM   4003  C  C   . ASN B  1 59  ? 31.724  -19.216 19.641  1.00   28.18 ? 166  ASN B C   1 
ATOM   4004  O  O   . ASN B  1 59  ? 31.570  -17.988 19.632  1.00   28.59 ? 166  ASN B O   1 
ATOM   4005  C  CB  . ASN B  1 59  ? 33.963  -19.336 20.738  1.00   25.40 ? 166  ASN B CB  1 
ATOM   4006  C  CG  . ASN B  1 59  ? 34.738  -19.675 22.006  1.00   27.93 ? 166  ASN B CG  1 
ATOM   4007  O  OD1 . ASN B  1 59  ? 34.171  -19.756 23.088  1.00   31.59 ? 166  ASN B OD1 1 
ATOM   4008  N  ND2 . ASN B  1 59  ? 36.048  -19.851 21.875  1.00   28.12 ? 166  ASN B ND2 1 
ATOM   4009  N  N   . TYR B  1 60  ? 31.197  -20.012 18.716  1.00   27.14 ? 167  TYR B N   1 
ATOM   4010  C  CA  . TYR B  1 60  ? 30.435  -19.446 17.610  1.00   27.75 ? 167  TYR B CA  1 
ATOM   4011  C  C   . TYR B  1 60  ? 29.268  -18.589 18.049  1.00   30.48 ? 167  TYR B C   1 
ATOM   4012  O  O   . TYR B  1 60  ? 28.517  -18.964 18.947  1.00   32.26 ? 167  TYR B O   1 
ATOM   4013  C  CB  . TYR B  1 60  ? 29.911  -20.527 16.679  1.00   27.52 ? 167  TYR B CB  1 
ATOM   4014  C  CG  . TYR B  1 60  ? 29.166  -19.934 15.503  1.00   28.16 ? 167  TYR B CG  1 
ATOM   4015  C  CD1 . TYR B  1 60  ? 29.827  -19.135 14.566  1.00   27.22 ? 167  TYR B CD1 1 
ATOM   4016  C  CD2 . TYR B  1 60  ? 27.801  -20.158 15.331  1.00   28.32 ? 167  TYR B CD2 1 
ATOM   4017  C  CE1 . TYR B  1 60  ? 29.149  -18.576 13.487  1.00   29.81 ? 167  TYR B CE1 1 
ATOM   4018  C  CE2 . TYR B  1 60  ? 27.111  -19.602 14.254  1.00   28.42 ? 167  TYR B CE2 1 
ATOM   4019  C  CZ  . TYR B  1 60  ? 27.788  -18.817 13.335  1.00   29.67 ? 167  TYR B CZ  1 
ATOM   4020  O  OH  . TYR B  1 60  ? 27.114  -18.298 12.253  1.00   33.19 ? 167  TYR B OH  1 
ATOM   4021  N  N   . ASP B  1 61  ? 29.114  -17.437 17.401  1.00   31.52 ? 168  ASP B N   1 
ATOM   4022  C  CA  . ASP B  1 61  ? 28.035  -16.513 17.724  1.00   31.57 ? 168  ASP B CA  1 
ATOM   4023  C  C   . ASP B  1 61  ? 27.256  -16.125 16.467  1.00   32.90 ? 168  ASP B C   1 
ATOM   4024  O  O   . ASP B  1 61  ? 27.746  -15.384 15.614  1.00   31.77 ? 168  ASP B O   1 
ATOM   4025  C  CB  . ASP B  1 61  ? 28.600  -15.261 18.399  1.00   30.95 ? 168  ASP B CB  1 
ATOM   4026  C  CG  . ASP B  1 61  ? 27.518  -14.276 18.806  1.00   34.04 ? 168  ASP B CG  1 
ATOM   4027  O  OD1 . ASP B  1 61  ? 26.335  -14.523 18.490  1.00   34.96 ? 168  ASP B OD1 1 
ATOM   4028  O  OD2 . ASP B  1 61  ? 27.847  -13.251 19.440  1.00   32.13 ? 168  ASP B OD2 1 
ATOM   4029  N  N   . PRO B  1 62  ? 26.016  -16.617 16.346  1.00   33.06 ? 169  PRO B N   1 
ATOM   4030  C  CA  . PRO B  1 62  ? 25.146  -16.338 15.199  1.00   32.08 ? 169  PRO B CA  1 
ATOM   4031  C  C   . PRO B  1 62  ? 24.873  -14.837 15.074  1.00   30.18 ? 169  PRO B C   1 
ATOM   4032  O  O   . PRO B  1 62  ? 24.688  -14.307 13.973  1.00   26.87 ? 169  PRO B O   1 
ATOM   4033  C  CB  . PRO B  1 62  ? 23.874  -17.121 15.529  1.00   31.16 ? 169  PRO B CB  1 
ATOM   4034  C  CG  . PRO B  1 62  ? 24.358  -18.206 16.444  1.00   36.51 ? 169  PRO B CG  1 
ATOM   4035  C  CD  . PRO B  1 62  ? 25.332  -17.476 17.323  1.00   32.96 ? 169  PRO B CD  1 
ATOM   4036  N  N   . GLY B  1 63  ? 24.846  -14.165 16.219  1.00   27.87 ? 170  GLY B N   1 
ATOM   4037  C  CA  . GLY B  1 63  ? 24.588  -12.735 16.239  1.00   27.65 ? 170  GLY B CA  1 
ATOM   4038  C  C   . GLY B  1 63  ? 25.684  -11.908 15.595  1.00   26.76 ? 170  GLY B C   1 
ATOM   4039  O  O   . GLY B  1 63  ? 25.458  -10.758 15.220  1.00   24.84 ? 170  GLY B O   1 
ATOM   4040  N  N   . ALA B  1 64  ? 26.872  -12.491 15.468  1.00   25.21 ? 171  ALA B N   1 
ATOM   4041  C  CA  . ALA B  1 64  ? 28.004  -11.809 14.852  1.00   22.89 ? 171  ALA B CA  1 
ATOM   4042  C  C   . ALA B  1 64  ? 28.229  -12.373 13.446  1.00   25.25 ? 171  ALA B C   1 
ATOM   4043  O  O   . ALA B  1 64  ? 29.291  -12.182 12.853  1.00   24.55 ? 171  ALA B O   1 
ATOM   4044  C  CB  . ALA B  1 64  ? 29.246  -12.021 15.697  1.00   17.62 ? 171  ALA B CB  1 
ATOM   4045  N  N   . SER B  1 65  ? 27.227  -13.067 12.913  1.00   23.87 ? 172  SER B N   1 
ATOM   4046  C  CA  . SER B  1 65  ? 27.371  -13.682 11.603  1.00   25.73 ? 172  SER B CA  1 
ATOM   4047  C  C   . SER B  1 65  ? 26.240  -13.397 10.622  1.00   27.70 ? 172  SER B C   1 
ATOM   4048  O  O   . SER B  1 65  ? 25.136  -13.010 11.009  1.00   28.66 ? 172  SER B O   1 
ATOM   4049  C  CB  . SER B  1 65  ? 27.492  -15.194 11.770  1.00   26.07 ? 172  SER B CB  1 
ATOM   4050  O  OG  . SER B  1 65  ? 28.486  -15.523 12.722  1.00   27.58 ? 172  SER B OG  1 
ATOM   4051  N  N   . PHE B  1 66  ? 26.537  -13.605 9.343   1.00   26.63 ? 173  PHE B N   1 
ATOM   4052  C  CA  . PHE B  1 66  ? 25.562  -13.432 8.289   1.00   25.34 ? 173  PHE B CA  1 
ATOM   4053  C  C   . PHE B  1 66  ? 26.174  -13.842 6.957   1.00   26.71 ? 173  PHE B C   1 
ATOM   4054  O  O   . PHE B  1 66  ? 27.395  -13.878 6.810   1.00   27.92 ? 173  PHE B O   1 
ATOM   4055  C  CB  . PHE B  1 66  ? 25.105  -11.981 8.206   1.00   27.12 ? 173  PHE B CB  1 
ATOM   4056  C  CG  . PHE B  1 66  ? 23.788  -11.816 7.515   1.00   28.61 ? 173  PHE B CG  1 
ATOM   4057  C  CD1 . PHE B  1 66  ? 22.600  -12.086 8.192   1.00   29.96 ? 173  PHE B CD1 1 
ATOM   4058  C  CD2 . PHE B  1 66  ? 23.730  -11.421 6.180   1.00   29.64 ? 173  PHE B CD2 1 
ATOM   4059  C  CE1 . PHE B  1 66  ? 21.364  -11.965 7.555   1.00   30.70 ? 173  PHE B CE1 1 
ATOM   4060  C  CE2 . PHE B  1 66  ? 22.498  -11.295 5.527   1.00   30.69 ? 173  PHE B CE2 1 
ATOM   4061  C  CZ  . PHE B  1 66  ? 21.312  -11.567 6.216   1.00   31.55 ? 173  PHE B CZ  1 
ATOM   4062  N  N   . ASP B  1 67  ? 25.324  -14.177 5.994   1.00   25.77 ? 174  ASP B N   1 
ATOM   4063  C  CA  . ASP B  1 67  ? 25.797  -14.547 4.664   1.00   26.84 ? 174  ASP B CA  1 
ATOM   4064  C  C   . ASP B  1 67  ? 25.306  -13.466 3.702   1.00   25.76 ? 174  ASP B C   1 
ATOM   4065  O  O   . ASP B  1 67  ? 24.174  -13.502 3.235   1.00   26.42 ? 174  ASP B O   1 
ATOM   4066  C  CB  . ASP B  1 67  ? 25.239  -15.909 4.230   1.00   26.95 ? 174  ASP B CB  1 
ATOM   4067  C  CG  . ASP B  1 67  ? 25.727  -16.319 2.846   1.00   26.37 ? 174  ASP B CG  1 
ATOM   4068  O  OD1 . ASP B  1 67  ? 26.065  -15.420 2.043   1.00   27.82 ? 174  ASP B OD1 1 
ATOM   4069  O  OD2 . ASP B  1 67  ? 25.762  -17.530 2.550   1.00   21.49 ? 174  ASP B OD2 1 
ATOM   4070  N  N   . VAL B  1 68  ? 26.160  -12.490 3.424   1.00   25.77 ? 175  VAL B N   1 
ATOM   4071  C  CA  . VAL B  1 68  ? 25.802  -11.393 2.528   1.00   25.74 ? 175  VAL B CA  1 
ATOM   4072  C  C   . VAL B  1 68  ? 25.815  -11.840 1.068   1.00   25.76 ? 175  VAL B C   1 
ATOM   4073  O  O   . VAL B  1 68  ? 25.086  -11.291 0.244   1.00   27.10 ? 175  VAL B O   1 
ATOM   4074  C  CB  . VAL B  1 68  ? 26.774  -10.185 2.712   1.00   24.66 ? 175  VAL B CB  1 
ATOM   4075  C  CG1 . VAL B  1 68  ? 26.515  -9.123  1.670   1.00   26.77 ? 175  VAL B CG1 1 
ATOM   4076  C  CG2 . VAL B  1 68  ? 26.604  -9.589  4.094   1.00   22.40 ? 175  VAL B CG2 1 
ATOM   4077  N  N   . ASN B  1 69  ? 26.638  -12.838 0.750   1.00   25.03 ? 176  ASN B N   1 
ATOM   4078  C  CA  . ASN B  1 69  ? 26.726  -13.346 -0.618  1.00   27.22 ? 176  ASN B CA  1 
ATOM   4079  C  C   . ASN B  1 69  ? 25.423  -14.012 -1.080  1.00   30.85 ? 176  ASN B C   1 
ATOM   4080  O  O   . ASN B  1 69  ? 24.969  -13.777 -2.200  1.00   33.21 ? 176  ASN B O   1 
ATOM   4081  C  CB  . ASN B  1 69  ? 27.882  -14.334 -0.732  1.00   24.61 ? 176  ASN B CB  1 
ATOM   4082  C  CG  . ASN B  1 69  ? 29.243  -13.648 -0.731  1.00   28.20 ? 176  ASN B CG  1 
ATOM   4083  O  OD1 . ASN B  1 69  ? 30.224  -14.209 -0.236  1.00   27.20 ? 176  ASN B OD1 1 
ATOM   4084  N  ND2 . ASN B  1 69  ? 29.313  -12.438 -1.299  1.00   22.55 ? 176  ASN B ND2 1 
ATOM   4085  N  N   . ASP B  1 70  ? 24.824  -14.835 -0.219  1.00   33.33 ? 177  ASP B N   1 
ATOM   4086  C  CA  . ASP B  1 70  ? 23.573  -15.517 -0.552  1.00   35.95 ? 177  ASP B CA  1 
ATOM   4087  C  C   . ASP B  1 70  ? 22.361  -14.941 0.177   1.00   36.12 ? 177  ASP B C   1 
ATOM   4088  O  O   . ASP B  1 70  ? 21.255  -15.448 0.036   1.00   39.91 ? 177  ASP B O   1 
ATOM   4089  C  CB  . ASP B  1 70  ? 23.663  -17.018 -0.243  1.00   36.82 ? 177  ASP B CB  1 
ATOM   4090  C  CG  . ASP B  1 70  ? 24.561  -17.770 -1.209  1.00   38.89 ? 177  ASP B CG  1 
ATOM   4091  O  OD1 . ASP B  1 70  ? 24.821  -17.260 -2.319  1.00   40.61 ? 177  ASP B OD1 1 
ATOM   4092  O  OD2 . ASP B  1 70  ? 24.996  -18.888 -0.860  1.00   43.25 ? 177  ASP B OD2 1 
ATOM   4093  N  N   . GLN B  1 71  ? 22.570  -13.895 0.965   1.00   36.12 ? 178  GLN B N   1 
ATOM   4094  C  CA  . GLN B  1 71  ? 21.479  -13.263 1.696   1.00   36.62 ? 178  GLN B CA  1 
ATOM   4095  C  C   . GLN B  1 71  ? 20.725  -14.189 2.643   1.00   37.62 ? 178  GLN B C   1 
ATOM   4096  O  O   . GLN B  1 71  ? 19.528  -14.419 2.471   1.00   38.25 ? 178  GLN B O   1 
ATOM   4097  C  CB  . GLN B  1 71  ? 20.478  -12.638 0.725   1.00   37.25 ? 178  GLN B CB  1 
ATOM   4098  C  CG  . GLN B  1 71  ? 21.057  -11.529 -0.128  1.00   42.04 ? 178  GLN B CG  1 
ATOM   4099  C  CD  . GLN B  1 71  ? 21.617  -10.396 0.706   1.00   44.03 ? 178  GLN B CD  1 
ATOM   4100  O  OE1 . GLN B  1 71  ? 20.905  -9.786  1.505   0.0000 43.25 ? 178  GLN B OE1 1 
ATOM   4101  N  NE2 . GLN B  1 71  ? 22.898  -10.108 0.522   0.0000 43.25 ? 178  GLN B NE2 1 
ATOM   4102  N  N   . ASP B  1 72  ? 21.427  -14.732 3.628   1.00   35.60 ? 179  ASP B N   1 
ATOM   4103  C  CA  . ASP B  1 72  ? 20.805  -15.578 4.636   1.00   34.79 ? 179  ASP B CA  1 
ATOM   4104  C  C   . ASP B  1 72  ? 21.695  -15.452 5.862   1.00   31.91 ? 179  ASP B C   1 
ATOM   4105  O  O   . ASP B  1 72  ? 22.815  -14.975 5.770   1.00   32.53 ? 179  ASP B O   1 
ATOM   4106  C  CB  . ASP B  1 72  ? 20.664  -17.036 4.162   1.00   35.25 ? 179  ASP B CB  1 
ATOM   4107  C  CG  . ASP B  1 72  ? 21.991  -17.741 4.006   1.00   35.86 ? 179  ASP B CG  1 
ATOM   4108  O  OD1 . ASP B  1 72  ? 22.715  -17.890 5.013   1.00   37.38 ? 179  ASP B OD1 1 
ATOM   4109  O  OD2 . ASP B  1 72  ? 22.304  -18.156 2.870   1.00   38.86 ? 179  ASP B OD2 1 
ATOM   4110  N  N   . PRO B  1 73  ? 21.204  -15.857 7.028   1.00   31.77 ? 180  PRO B N   1 
ATOM   4111  C  CA  . PRO B  1 73  ? 22.024  -15.740 8.232   1.00   32.50 ? 180  PRO B CA  1 
ATOM   4112  C  C   . PRO B  1 73  ? 23.099  -16.786 8.455   1.00   31.59 ? 180  PRO B C   1 
ATOM   4113  O  O   . PRO B  1 73  ? 23.886  -16.658 9.381   1.00   35.93 ? 180  PRO B O   1 
ATOM   4114  C  CB  . PRO B  1 73  ? 20.982  -15.746 9.345   1.00   31.80 ? 180  PRO B CB  1 
ATOM   4115  C  CG  . PRO B  1 73  ? 19.949  -16.653 8.805   1.00   32.72 ? 180  PRO B CG  1 
ATOM   4116  C  CD  . PRO B  1 73  ? 19.817  -16.208 7.371   1.00   31.83 ? 180  PRO B CD  1 
ATOM   4117  N  N   . ASP B  1 74  ? 23.151  -17.806 7.608   1.00   33.97 ? 181  ASP B N   1 
ATOM   4118  C  CA  . ASP B  1 74  ? 24.117  -18.887 7.774   1.00   31.64 ? 181  ASP B CA  1 
ATOM   4119  C  C   . ASP B  1 74  ? 25.380  -18.712 6.943   1.00   32.06 ? 181  ASP B C   1 
ATOM   4120  O  O   . ASP B  1 74  ? 25.371  -18.920 5.736   1.00   33.74 ? 181  ASP B O   1 
ATOM   4121  C  CB  . ASP B  1 74  ? 23.438  -20.212 7.443   1.00   35.60 ? 181  ASP B CB  1 
ATOM   4122  C  CG  . ASP B  1 74  ? 24.373  -21.386 7.550   1.00   37.46 ? 181  ASP B CG  1 
ATOM   4123  O  OD1 . ASP B  1 74  ? 25.458  -21.240 8.157   1.00   39.67 ? 181  ASP B OD1 1 
ATOM   4124  O  OD2 . ASP B  1 74  ? 24.010  -22.461 7.032   1.00   42.01 ? 181  ASP B OD2 1 
ATOM   4125  N  N   . PRO B  1 75  ? 26.499  -18.360 7.600   1.00   31.41 ? 182  PRO B N   1 
ATOM   4126  C  CA  . PRO B  1 75  ? 27.807  -18.133 6.978   1.00   30.11 ? 182  PRO B CA  1 
ATOM   4127  C  C   . PRO B  1 75  ? 28.639  -19.372 6.641   1.00   31.91 ? 182  PRO B C   1 
ATOM   4128  O  O   . PRO B  1 75  ? 29.833  -19.257 6.349   1.00   30.56 ? 182  PRO B O   1 
ATOM   4129  C  CB  . PRO B  1 75  ? 28.499  -17.249 7.997   1.00   31.77 ? 182  PRO B CB  1 
ATOM   4130  C  CG  . PRO B  1 75  ? 28.042  -17.869 9.299   1.00   30.64 ? 182  PRO B CG  1 
ATOM   4131  C  CD  . PRO B  1 75  ? 26.565  -18.133 9.058   1.00   30.63 ? 182  PRO B CD  1 
ATOM   4132  N  N   . GLN B  1 76  ? 28.023  -20.551 6.678   1.00   29.31 ? 183  GLN B N   1 
ATOM   4133  C  CA  . GLN B  1 76  ? 28.749  -21.780 6.375   1.00   28.06 ? 183  GLN B CA  1 
ATOM   4134  C  C   . GLN B  1 76  ? 29.474  -21.629 5.030   1.00   28.49 ? 183  GLN B C   1 
ATOM   4135  O  O   . GLN B  1 76  ? 28.906  -21.123 4.065   1.00   26.73 ? 183  GLN B O   1 
ATOM   4136  C  CB  . GLN B  1 76  ? 27.778  -22.960 6.304   1.00   29.53 ? 183  GLN B CB  1 
ATOM   4137  C  CG  . GLN B  1 76  ? 28.438  -24.339 6.351   1.00   32.22 ? 183  GLN B CG  1 
ATOM   4138  C  CD  . GLN B  1 76  ? 29.039  -24.653 7.714   1.00   30.41 ? 183  GLN B CD  1 
ATOM   4139  O  OE1 . GLN B  1 76  ? 28.505  -24.244 8.745   1.00   32.42 ? 183  GLN B OE1 1 
ATOM   4140  N  NE2 . GLN B  1 76  ? 30.140  -25.397 7.726   1.00   30.19 ? 183  GLN B NE2 1 
ATOM   4141  N  N   . PRO B  1 77  ? 30.746  -22.054 4.956   1.00   26.63 ? 184  PRO B N   1 
ATOM   4142  C  CA  . PRO B  1 77  ? 31.496  -21.939 3.701   1.00   26.73 ? 184  PRO B CA  1 
ATOM   4143  C  C   . PRO B  1 77  ? 30.907  -22.847 2.635   1.00   28.60 ? 184  PRO B C   1 
ATOM   4144  O  O   . PRO B  1 77  ? 30.235  -23.828 2.949   1.00   29.56 ? 184  PRO B O   1 
ATOM   4145  C  CB  . PRO B  1 77  ? 32.902  -22.399 4.080   1.00   22.70 ? 184  PRO B CB  1 
ATOM   4146  C  CG  . PRO B  1 77  ? 32.971  -22.192 5.561   1.00   26.01 ? 184  PRO B CG  1 
ATOM   4147  C  CD  . PRO B  1 77  ? 31.601  -22.571 6.037   1.00   27.08 ? 184  PRO B CD  1 
ATOM   4148  N  N   . ARG B  1 78  ? 31.172  -22.518 1.378   1.00   29.78 ? 185  ARG B N   1 
ATOM   4149  C  CA  . ARG B  1 78  ? 30.720  -23.327 0.255   1.00   29.95 ? 185  ARG B CA  1 
ATOM   4150  C  C   . ARG B  1 78  ? 31.864  -24.298 -0.021  1.00   30.47 ? 185  ARG B C   1 
ATOM   4151  O  O   . ARG B  1 78  ? 32.973  -23.879 -0.354  1.00   30.03 ? 185  ARG B O   1 
ATOM   4152  C  CB  . ARG B  1 78  ? 30.473  -22.444 -0.969  1.00   30.69 ? 185  ARG B CB  1 
ATOM   4153  C  CG  . ARG B  1 78  ? 30.124  -23.195 -2.240  1.00   30.31 ? 185  ARG B CG  1 
ATOM   4154  C  CD  . ARG B  1 78  ? 29.735  -22.210 -3.335  1.00   30.61 ? 185  ARG B CD  1 
ATOM   4155  N  NE  . ARG B  1 78  ? 30.833  -21.313 -3.662  1.00   28.81 ? 185  ARG B NE  1 
ATOM   4156  C  CZ  . ARG B  1 78  ? 31.812  -21.610 -4.511  1.00   31.61 ? 185  ARG B CZ  1 
ATOM   4157  N  NH1 . ARG B  1 78  ? 32.784  -20.735 -4.743  1.00   27.20 ? 185  ARG B NH1 1 
ATOM   4158  N  NH2 . ARG B  1 78  ? 31.810  -22.775 -5.143  1.00   30.59 ? 185  ARG B NH2 1 
ATOM   4159  N  N   . TYR B  1 79  ? 31.603  -25.592 0.125   1.00   31.81 ? 186  TYR B N   1 
ATOM   4160  C  CA  . TYR B  1 79  ? 32.644  -26.592 -0.094  1.00   31.44 ? 186  TYR B CA  1 
ATOM   4161  C  C   . TYR B  1 79  ? 32.905  -26.926 -1.552  1.00   33.43 ? 186  TYR B C   1 
ATOM   4162  O  O   . TYR B  1 79  ? 31.983  -27.090 -2.338  1.00   34.31 ? 186  TYR B O   1 
ATOM   4163  C  CB  . TYR B  1 79  ? 32.313  -27.872 0.668   1.00   29.20 ? 186  TYR B CB  1 
ATOM   4164  C  CG  . TYR B  1 79  ? 32.190  -27.642 2.152   1.00   29.46 ? 186  TYR B CG  1 
ATOM   4165  C  CD1 . TYR B  1 79  ? 30.998  -27.179 2.709   1.00   31.70 ? 186  TYR B CD1 1 
ATOM   4166  C  CD2 . TYR B  1 79  ? 33.282  -27.822 2.995   1.00   27.69 ? 186  TYR B CD2 1 
ATOM   4167  C  CE1 . TYR B  1 79  ? 30.902  -26.897 4.068   1.00   30.52 ? 186  TYR B CE1 1 
ATOM   4168  C  CE2 . TYR B  1 79  ? 33.195  -27.545 4.351   1.00   27.86 ? 186  TYR B CE2 1 
ATOM   4169  C  CZ  . TYR B  1 79  ? 32.006  -27.079 4.879   1.00   27.55 ? 186  TYR B CZ  1 
ATOM   4170  O  OH  . TYR B  1 79  ? 31.929  -26.747 6.211   1.00   31.89 ? 186  TYR B OH  1 
ATOM   4171  N  N   . THR B  1 80  ? 34.184  -27.012 -1.897  1.00   35.77 ? 187  THR B N   1 
ATOM   4172  C  CA  . THR B  1 80  ? 34.618  -27.342 -3.242  1.00   37.22 ? 187  THR B CA  1 
ATOM   4173  C  C   . THR B  1 80  ? 35.868  -28.207 -3.116  1.00   40.53 ? 187  THR B C   1 
ATOM   4174  O  O   . THR B  1 80  ? 36.534  -28.190 -2.080  1.00   41.13 ? 187  THR B O   1 
ATOM   4175  C  CB  . THR B  1 80  ? 34.963  -26.079 -4.048  1.00   37.57 ? 187  THR B CB  1 
ATOM   4176  O  OG1 . THR B  1 80  ? 36.149  -25.465 -3.520  1.00   36.02 ? 187  THR B OG1 1 
ATOM   4177  C  CG2 . THR B  1 80  ? 33.804  -25.092 -3.977  1.00   36.90 ? 187  THR B CG2 1 
ATOM   4178  N  N   . GLN B  1 81  ? 36.179  -28.963 -4.165  1.00   41.80 ? 188  GLN B N   1 
ATOM   4179  C  CA  . GLN B  1 81  ? 37.355  -29.829 -4.175  1.00   43.59 ? 188  GLN B CA  1 
ATOM   4180  C  C   . GLN B  1 81  ? 38.651  -29.096 -3.856  1.00   42.93 ? 188  GLN B C   1 
ATOM   4181  O  O   . GLN B  1 81  ? 39.551  -29.649 -3.230  1.00   43.82 ? 188  GLN B O   1 
ATOM   4182  C  CB  . GLN B  1 81  ? 37.526  -30.487 -5.540  1.00   45.52 ? 188  GLN B CB  1 
ATOM   4183  C  CG  . GLN B  1 81  ? 36.937  -31.853 -5.666  1.00   50.28 ? 188  GLN B CG  1 
ATOM   4184  C  CD  . GLN B  1 81  ? 37.626  -32.647 -6.747  1.00   51.77 ? 188  GLN B CD  1 
ATOM   4185  O  OE1 . GLN B  1 81  ? 37.776  -32.180 -7.879  1.00   54.15 ? 188  GLN B OE1 1 
ATOM   4186  N  NE2 . GLN B  1 81  ? 38.052  -33.855 -6.407  1.00   50.42 ? 188  GLN B NE2 1 
ATOM   4187  N  N   . MET B  1 82  ? 38.755  -27.855 -4.306  1.00   43.19 ? 189  MET B N   1 
ATOM   4188  C  CA  . MET B  1 82  ? 39.962  -27.081 -4.073  1.00   41.40 ? 189  MET B CA  1 
ATOM   4189  C  C   . MET B  1 82  ? 39.992  -26.413 -2.708  1.00   37.93 ? 189  MET B C   1 
ATOM   4190  O  O   . MET B  1 82  ? 41.003  -25.834 -2.324  1.00   35.78 ? 189  MET B O   1 
ATOM   4191  C  CB  . MET B  1 82  ? 40.122  -26.039 -5.177  1.00   46.09 ? 189  MET B CB  1 
ATOM   4192  C  CG  . MET B  1 82  ? 40.229  -26.679 -6.553  1.00   55.45 ? 189  MET B CG  1 
ATOM   4193  S  SD  . MET B  1 82  ? 40.629  -25.531 -7.878  1.00   66.38 ? 189  MET B SD  1 
ATOM   4194  C  CE  . MET B  1 82  ? 42.425  -25.732 -7.981  1.00   63.74 ? 189  MET B CE  1 
ATOM   4195  N  N   . ASN B  1 83  ? 38.892  -26.507 -1.970  1.00   34.84 ? 190  ASN B N   1 
ATOM   4196  C  CA  . ASN B  1 83  ? 38.812  -25.890 -0.648  1.00   34.12 ? 190  ASN B CA  1 
ATOM   4197  C  C   . ASN B  1 83  ? 39.123  -24.400 -0.715  1.00   34.34 ? 190  ASN B C   1 
ATOM   4198  O  O   . ASN B  1 83  ? 39.858  -23.862 0.114   1.00   32.34 ? 190  ASN B O   1 
ATOM   4199  C  CB  . ASN B  1 83  ? 39.779  -26.565 0.320   1.00   33.59 ? 190  ASN B CB  1 
ATOM   4200  C  CG  . ASN B  1 83  ? 39.369  -27.983 0.655   1.00   36.27 ? 190  ASN B CG  1 
ATOM   4201  O  OD1 . ASN B  1 83  ? 38.207  -28.251 0.961   1.00   35.28 ? 190  ASN B OD1 1 
ATOM   4202  N  ND2 . ASN B  1 83  ? 40.324  -28.897 0.613   1.00   35.53 ? 190  ASN B ND2 1 
ATOM   4203  N  N   . ASP B  1 84  ? 38.546  -23.746 -1.712  1.00   33.77 ? 191  ASP B N   1 
ATOM   4204  C  CA  . ASP B  1 84  ? 38.722  -22.322 -1.930  1.00   34.48 ? 191  ASP B CA  1 
ATOM   4205  C  C   . ASP B  1 84  ? 38.249  -21.478 -0.758  1.00   32.52 ? 191  ASP B C   1 
ATOM   4206  O  O   . ASP B  1 84  ? 38.862  -20.463 -0.430  1.00   35.98 ? 191  ASP B O   1 
ATOM   4207  C  CB  . ASP B  1 84  ? 37.940  -21.891 -3.172  1.00   35.36 ? 191  ASP B CB  1 
ATOM   4208  C  CG  . ASP B  1 84  ? 38.292  -22.711 -4.385  1.00   39.19 ? 191  ASP B CG  1 
ATOM   4209  O  OD1 . ASP B  1 84  ? 39.367  -22.465 -4.976  1.00   43.27 ? 191  ASP B OD1 1 
ATOM   4210  O  OD2 . ASP B  1 84  ? 37.505  -23.614 -4.736  1.00   41.17 ? 191  ASP B OD2 1 
ATOM   4211  N  N   . ASN B  1 85  ? 37.164  -21.894 -0.124  1.00   29.45 ? 192  ASN B N   1 
ATOM   4212  C  CA  . ASN B  1 85  ? 36.602  -21.110 0.963   1.00   29.37 ? 192  ASN B CA  1 
ATOM   4213  C  C   . ASN B  1 85  ? 37.006  -21.524 2.367   1.00   28.28 ? 192  ASN B C   1 
ATOM   4214  O  O   . ASN B  1 85  ? 36.184  -21.543 3.277   1.00   30.15 ? 192  ASN B O   1 
ATOM   4215  C  CB  . ASN B  1 85  ? 35.081  -21.093 0.808   1.00   26.86 ? 192  ASN B CB  1 
ATOM   4216  C  CG  . ASN B  1 85  ? 34.658  -20.654 -0.588  1.00   31.37 ? 192  ASN B CG  1 
ATOM   4217  O  OD1 . ASN B  1 85  ? 34.999  -19.550 -1.032  1.00   27.60 ? 192  ASN B OD1 1 
ATOM   4218  N  ND2 . ASN B  1 85  ? 33.929  -21.518 -1.294  1.00   25.17 ? 192  ASN B ND2 1 
ATOM   4219  N  N   . ARG B  1 86  ? 38.287  -21.821 2.544   1.00   28.83 ? 193  ARG B N   1 
ATOM   4220  C  CA  . ARG B  1 86  ? 38.811  -22.231 3.846   1.00   28.72 ? 193  ARG B CA  1 
ATOM   4221  C  C   . ARG B  1 86  ? 39.450  -21.053 4.576   1.00   26.20 ? 193  ARG B C   1 
ATOM   4222  O  O   . ARG B  1 86  ? 39.770  -21.140 5.756   1.00   27.97 ? 193  ARG B O   1 
ATOM   4223  C  CB  . ARG B  1 86  ? 39.872  -23.307 3.655   1.00   26.78 ? 193  ARG B CB  1 
ATOM   4224  C  CG  . ARG B  1 86  ? 41.160  -22.812 3.014   1.00   30.08 ? 193  ARG B CG  1 
ATOM   4225  C  CD  . ARG B  1 86  ? 42.074  -23.987 2.723   1.00   33.05 ? 193  ARG B CD  1 
ATOM   4226  N  NE  . ARG B  1 86  ? 43.462  -23.599 2.504   1.00   38.07 ? 193  ARG B NE  1 
ATOM   4227  C  CZ  . ARG B  1 86  ? 43.978  -23.266 1.327   1.00   42.96 ? 193  ARG B CZ  1 
ATOM   4228  N  NH1 . ARG B  1 86  ? 43.212  -23.269 0.233   1.00   45.80 ? 193  ARG B NH1 1 
ATOM   4229  N  NH2 . ARG B  1 86  ? 45.268  -22.946 1.242   1.00   39.96 ? 193  ARG B NH2 1 
ATOM   4230  N  N   . HIS B  1 87  ? 39.618  -19.955 3.853   1.00   25.22 ? 194  HIS B N   1 
ATOM   4231  C  CA  . HIS B  1 87  ? 40.262  -18.760 4.365   1.00   21.12 ? 194  HIS B CA  1 
ATOM   4232  C  C   . HIS B  1 87  ? 39.653  -18.141 5.620   1.00   20.43 ? 194  HIS B C   1 
ATOM   4233  O  O   . HIS B  1 87  ? 40.368  -17.906 6.603   1.00   20.54 ? 194  HIS B O   1 
ATOM   4234  C  CB  . HIS B  1 87  ? 40.351  -17.743 3.231   1.00   22.87 ? 194  HIS B CB  1 
ATOM   4235  C  CG  . HIS B  1 87  ? 41.265  -16.595 3.510   1.00   21.18 ? 194  HIS B CG  1 
ATOM   4236  N  ND1 . HIS B  1 87  ? 40.809  -15.374 3.957   1.00   21.09 ? 194  HIS B ND1 1 
ATOM   4237  C  CD2 . HIS B  1 87  ? 42.607  -16.471 3.377   1.00   22.72 ? 194  HIS B CD2 1 
ATOM   4238  C  CE1 . HIS B  1 87  ? 41.829  -14.544 4.081   1.00   20.75 ? 194  HIS B CE1 1 
ATOM   4239  N  NE2 . HIS B  1 87  ? 42.932  -15.185 3.735   1.00   24.79 ? 194  HIS B NE2 1 
ATOM   4240  N  N   . GLY B  1 88  ? 38.349  -17.885 5.602   1.00   19.19 ? 195  GLY B N   1 
ATOM   4241  C  CA  . GLY B  1 88  ? 37.706  -17.285 6.755   1.00   17.66 ? 195  GLY B CA  1 
ATOM   4242  C  C   . GLY B  1 88  ? 37.787  -18.145 8.001   1.00   21.64 ? 195  GLY B C   1 
ATOM   4243  O  O   . GLY B  1 88  ? 37.954  -17.643 9.119   1.00   18.60 ? 195  GLY B O   1 
ATOM   4244  N  N   . THR B  1 89  ? 37.665  -19.454 7.811   1.00   22.23 ? 196  THR B N   1 
ATOM   4245  C  CA  . THR B  1 89  ? 37.723  -20.392 8.922   1.00   22.24 ? 196  THR B CA  1 
ATOM   4246  C  C   . THR B  1 89  ? 39.099  -20.366 9.574   1.00   23.42 ? 196  THR B C   1 
ATOM   4247  O  O   . THR B  1 89  ? 39.222  -20.438 10.801  1.00   23.76 ? 196  THR B O   1 
ATOM   4248  C  CB  . THR B  1 89  ? 37.380  -21.814 8.438   1.00   22.33 ? 196  THR B CB  1 
ATOM   4249  O  OG1 . THR B  1 89  ? 35.998  -21.851 8.071   1.00   26.26 ? 196  THR B OG1 1 
ATOM   4250  C  CG2 . THR B  1 89  ? 37.656  -22.848 9.517   1.00   20.19 ? 196  THR B CG2 1 
ATOM   4251  N  N   . ARG B  1 90  ? 40.137  -20.256 8.754   1.00   24.34 ? 197  ARG B N   1 
ATOM   4252  C  CA  . ARG B  1 90  ? 41.488  -20.203 9.290   1.00   23.75 ? 197  ARG B CA  1 
ATOM   4253  C  C   . ARG B  1 90  ? 41.700  -18.924 10.107  1.00   24.40 ? 197  ARG B C   1 
ATOM   4254  O  O   . ARG B  1 90  ? 42.320  -18.957 11.171  1.00   24.37 ? 197  ARG B O   1 
ATOM   4255  C  CB  . ARG B  1 90  ? 42.506  -20.285 8.160   1.00   23.67 ? 197  ARG B CB  1 
ATOM   4256  C  CG  . ARG B  1 90  ? 42.517  -21.637 7.481   1.00   24.80 ? 197  ARG B CG  1 
ATOM   4257  C  CD  . ARG B  1 90  ? 43.627  -21.735 6.453   1.00   24.69 ? 197  ARG B CD  1 
ATOM   4258  N  NE  . ARG B  1 90  ? 43.794  -23.113 6.001   1.00   29.03 ? 197  ARG B NE  1 
ATOM   4259  C  CZ  . ARG B  1 90  ? 44.859  -23.561 5.346   1.00   26.27 ? 197  ARG B CZ  1 
ATOM   4260  N  NH1 . ARG B  1 90  ? 44.918  -24.833 4.984   1.00   25.58 ? 197  ARG B NH1 1 
ATOM   4261  N  NH2 . ARG B  1 90  ? 45.859  -22.739 5.052   1.00   26.68 ? 197  ARG B NH2 1 
ATOM   4262  N  N   . CYS B  1 91  ? 41.177  -17.804 9.617   1.00   21.92 ? 198  CYS B N   1 
ATOM   4263  C  CA  . CYS B  1 91  ? 41.328  -16.542 10.333  1.00   22.10 ? 198  CYS B CA  1 
ATOM   4264  C  C   . CYS B  1 91  ? 40.545  -16.564 11.639  1.00   21.42 ? 198  CYS B C   1 
ATOM   4265  O  O   . CYS B  1 91  ? 41.018  -16.045 12.653  1.00   20.74 ? 198  CYS B O   1 
ATOM   4266  C  CB  . CYS B  1 91  ? 40.870  -15.363 9.461   1.00   20.37 ? 198  CYS B CB  1 
ATOM   4267  S  SG  . CYS B  1 91  ? 41.920  -15.052 7.982   1.00   24.90 ? 198  CYS B SG  1 
ATOM   4268  N  N   . ALA B  1 92  ? 39.364  -17.186 11.623  1.00   22.00 ? 199  ALA B N   1 
ATOM   4269  C  CA  . ALA B  1 92  ? 38.520  -17.264 12.817  1.00   21.58 ? 199  ALA B CA  1 
ATOM   4270  C  C   . ALA B  1 92  ? 39.224  -18.007 13.955  1.00   23.69 ? 199  ALA B C   1 
ATOM   4271  O  O   . ALA B  1 92  ? 39.211  -17.557 15.103  1.00   23.48 ? 199  ALA B O   1 
ATOM   4272  C  CB  . ALA B  1 92  ? 37.201  -17.948 12.482  1.00   21.87 ? 199  ALA B CB  1 
ATOM   4273  N  N   . GLY B  1 93  ? 39.850  -19.136 13.629  1.00   24.62 ? 200  GLY B N   1 
ATOM   4274  C  CA  . GLY B  1 93  ? 40.550  -19.914 14.640  1.00   24.21 ? 200  GLY B CA  1 
ATOM   4275  C  C   . GLY B  1 93  ? 41.668  -19.157 15.338  1.00   26.30 ? 200  GLY B C   1 
ATOM   4276  O  O   . GLY B  1 93  ? 41.927  -19.369 16.531  1.00   23.56 ? 200  GLY B O   1 
ATOM   4277  N  N   . GLU B  1 94  ? 42.339  -18.274 14.601  1.00   23.82 ? 201  GLU B N   1 
ATOM   4278  C  CA  . GLU B  1 94  ? 43.427  -17.492 15.177  1.00   24.27 ? 201  GLU B CA  1 
ATOM   4279  C  C   . GLU B  1 94  ? 42.927  -16.611 16.308  1.00   24.89 ? 201  GLU B C   1 
ATOM   4280  O  O   . GLU B  1 94  ? 43.610  -16.415 17.321  1.00   22.34 ? 201  GLU B O   1 
ATOM   4281  C  CB  . GLU B  1 94  ? 44.048  -16.584 14.133  1.00   24.04 ? 201  GLU B CB  1 
ATOM   4282  C  CG  . GLU B  1 94  ? 44.821  -17.281 13.065  1.00   24.03 ? 201  GLU B CG  1 
ATOM   4283  C  CD  . GLU B  1 94  ? 45.478  -16.277 12.153  1.00   22.62 ? 201  GLU B CD  1 
ATOM   4284  O  OE1 . GLU B  1 94  ? 44.881  -15.917 11.121  1.00   21.70 ? 201  GLU B OE1 1 
ATOM   4285  O  OE2 . GLU B  1 94  ? 46.586  -15.832 12.493  1.00   24.18 ? 201  GLU B OE2 1 
ATOM   4286  N  N   . VAL B  1 95  ? 41.726  -16.079 16.119  1.00   25.30 ? 202  VAL B N   1 
ATOM   4287  C  CA  . VAL B  1 95  ? 41.133  -15.197 17.095  1.00   25.65 ? 202  VAL B CA  1 
ATOM   4288  C  C   . VAL B  1 95  ? 40.522  -15.914 18.287  1.00   28.02 ? 202  VAL B C   1 
ATOM   4289  O  O   . VAL B  1 95  ? 40.832  -15.585 19.440  1.00   25.76 ? 202  VAL B O   1 
ATOM   4290  C  CB  . VAL B  1 95  ? 40.029  -14.318 16.454  1.00   25.37 ? 202  VAL B CB  1 
ATOM   4291  C  CG1 . VAL B  1 95  ? 39.444  -13.384 17.495  1.00   25.41 ? 202  VAL B CG1 1 
ATOM   4292  C  CG2 . VAL B  1 95  ? 40.601  -13.519 15.302  1.00   21.91 ? 202  VAL B CG2 1 
ATOM   4293  N  N   . ALA B  1 96  ? 39.673  -16.903 18.017  1.00   27.03 ? 203  ALA B N   1 
ATOM   4294  C  CA  . ALA B  1 96  ? 38.987  -17.566 19.111  1.00   26.87 ? 203  ALA B CA  1 
ATOM   4295  C  C   . ALA B  1 96  ? 38.808  -19.075 19.104  1.00   26.89 ? 203  ALA B C   1 
ATOM   4296  O  O   . ALA B  1 96  ? 37.754  -19.562 19.524  1.00   27.82 ? 203  ALA B O   1 
ATOM   4297  C  CB  . ALA B  1 96  ? 37.634  -16.907 19.301  1.00   23.43 ? 203  ALA B CB  1 
ATOM   4298  N  N   . ALA B  1 97  ? 39.802  -19.827 18.644  1.00   26.89 ? 204  ALA B N   1 
ATOM   4299  C  CA  . ALA B  1 97  ? 39.675  -21.284 18.686  1.00   26.44 ? 204  ALA B CA  1 
ATOM   4300  C  C   . ALA B  1 97  ? 39.512  -21.656 20.174  1.00   28.09 ? 204  ALA B C   1 
ATOM   4301  O  O   . ALA B  1 97  ? 40.140  -21.045 21.054  1.00   25.07 ? 204  ALA B O   1 
ATOM   4302  C  CB  . ALA B  1 97  ? 40.920  -21.948 18.102  1.00   23.77 ? 204  ALA B CB  1 
ATOM   4303  N  N   . VAL B  1 98  ? 38.657  -22.638 20.453  1.00   28.09 ? 205  VAL B N   1 
ATOM   4304  C  CA  . VAL B  1 98  ? 38.405  -23.077 21.824  1.00   26.64 ? 205  VAL B CA  1 
ATOM   4305  C  C   . VAL B  1 98  ? 39.646  -23.661 22.501  1.00   26.59 ? 205  VAL B C   1 
ATOM   4306  O  O   . VAL B  1 98  ? 40.436  -24.372 21.879  1.00   25.76 ? 205  VAL B O   1 
ATOM   4307  C  CB  . VAL B  1 98  ? 37.276  -24.120 21.861  1.00   28.56 ? 205  VAL B CB  1 
ATOM   4308  C  CG1 . VAL B  1 98  ? 37.109  -24.645 23.279  1.00   28.52 ? 205  VAL B CG1 1 
ATOM   4309  C  CG2 . VAL B  1 98  ? 35.981  -23.488 21.369  1.00   27.45 ? 205  VAL B CG2 1 
ATOM   4310  N  N   . ALA B  1 99  ? 39.809  -23.363 23.786  1.00   25.47 ? 206  ALA B N   1 
ATOM   4311  C  CA  . ALA B  1 99  ? 40.963  -23.848 24.539  1.00   27.58 ? 206  ALA B CA  1 
ATOM   4312  C  C   . ALA B  1 99  ? 40.665  -25.060 25.428  1.00   28.37 ? 206  ALA B C   1 
ATOM   4313  O  O   . ALA B  1 99  ? 39.521  -25.309 25.807  1.00   29.47 ? 206  ALA B O   1 
ATOM   4314  C  CB  . ALA B  1 99  ? 41.534  -22.717 25.401  1.00   27.97 ? 206  ALA B CB  1 
ATOM   4315  N  N   . ASN B  1 100 ? 41.720  -25.800 25.753  1.00   29.43 ? 207  ASN B N   1 
ATOM   4316  C  CA  . ASN B  1 100 ? 41.643  -26.973 26.615  1.00   30.40 ? 207  ASN B CA  1 
ATOM   4317  C  C   . ASN B  1 100 ? 40.554  -27.957 26.217  1.00   32.48 ? 207  ASN B C   1 
ATOM   4318  O  O   . ASN B  1 100 ? 39.814  -28.449 27.077  1.00   32.60 ? 207  ASN B O   1 
ATOM   4319  C  CB  . ASN B  1 100 ? 41.388  -26.545 28.059  1.00   29.12 ? 207  ASN B CB  1 
ATOM   4320  C  CG  . ASN B  1 100 ? 42.400  -25.554 28.570  1.00   29.32 ? 207  ASN B CG  1 
ATOM   4321  O  OD1 . ASN B  1 100 ? 43.589  -25.859 28.680  1.00   34.09 ? 207  ASN B OD1 1 
ATOM   4322  N  ND2 . ASN B  1 100 ? 41.931  -24.356 28.901  1.00   24.44 ? 207  ASN B ND2 1 
ATOM   4323  N  N   . ASN B  1 101 ? 40.447  -28.260 24.930  1.00   31.62 ? 208  ASN B N   1 
ATOM   4324  C  CA  . ASN B  1 101 ? 39.407  -29.177 24.489  1.00   30.52 ? 208  ASN B CA  1 
ATOM   4325  C  C   . ASN B  1 101 ? 39.991  -30.304 23.653  1.00   31.88 ? 208  ASN B C   1 
ATOM   4326  O  O   . ASN B  1 101 ? 39.284  -30.946 22.879  1.00   31.73 ? 208  ASN B O   1 
ATOM   4327  C  CB  . ASN B  1 101 ? 38.342  -28.408 23.697  1.00   32.38 ? 208  ASN B CB  1 
ATOM   4328  C  CG  . ASN B  1 101 ? 38.843  -27.925 22.337  1.00   32.48 ? 208  ASN B CG  1 
ATOM   4329  O  OD1 . ASN B  1 101 ? 40.040  -27.696 22.140  1.00   32.36 ? 208  ASN B OD1 1 
ATOM   4330  N  ND2 . ASN B  1 101 ? 37.918  -27.755 21.399  1.00   29.27 ? 208  ASN B ND2 1 
ATOM   4331  N  N   . GLY B  1 102 ? 41.293  -30.527 23.812  1.00   31.76 ? 209  GLY B N   1 
ATOM   4332  C  CA  . GLY B  1 102 ? 41.974  -31.585 23.086  1.00   32.25 ? 209  GLY B CA  1 
ATOM   4333  C  C   . GLY B  1 102 ? 41.930  -31.487 21.575  1.00   33.38 ? 209  GLY B C   1 
ATOM   4334  O  O   . GLY B  1 102 ? 42.203  -32.462 20.883  1.00   34.87 ? 209  GLY B O   1 
ATOM   4335  N  N   . VAL B  1 103 ? 41.599  -30.311 21.055  1.00   34.14 ? 210  VAL B N   1 
ATOM   4336  C  CA  . VAL B  1 103 ? 41.527  -30.125 19.614  1.00   32.55 ? 210  VAL B CA  1 
ATOM   4337  C  C   . VAL B  1 103 ? 42.418  -28.991 19.113  1.00   34.73 ? 210  VAL B C   1 
ATOM   4338  O  O   . VAL B  1 103 ? 42.363  -27.869 19.626  1.00   34.22 ? 210  VAL B O   1 
ATOM   4339  C  CB  . VAL B  1 103 ? 40.078  -29.834 19.169  1.00   34.67 ? 210  VAL B CB  1 
ATOM   4340  C  CG1 . VAL B  1 103 ? 40.018  -29.628 17.658  1.00   33.93 ? 210  VAL B CG1 1 
ATOM   4341  C  CG2 . VAL B  1 103 ? 39.169  -30.987 19.576  1.00   32.71 ? 210  VAL B CG2 1 
ATOM   4342  N  N   . CYS B  1 104 ? 43.245  -29.304 18.118  1.00   33.00 ? 211  CYS B N   1 
ATOM   4343  C  CA  . CYS B  1 104 ? 44.123  -28.327 17.493  1.00   33.98 ? 211  CYS B CA  1 
ATOM   4344  C  C   . CYS B  1 104 ? 44.820  -27.424 18.522  1.00   33.26 ? 211  CYS B C   1 
ATOM   4345  O  O   . CYS B  1 104 ? 45.422  -27.918 19.481  1.00   32.44 ? 211  CYS B O   1 
ATOM   4346  C  CB  . CYS B  1 104 ? 43.279  -27.508 16.514  1.00   36.41 ? 211  CYS B CB  1 
ATOM   4347  S  SG  . CYS B  1 104 ? 44.144  -26.702 15.133  1.00   45.11 ? 211  CYS B SG  1 
ATOM   4348  N  N   . GLY B  1 105 ? 44.743  -26.108 18.323  1.00   31.92 ? 212  GLY B N   1 
ATOM   4349  C  CA  . GLY B  1 105 ? 45.376  -25.172 19.245  1.00   29.35 ? 212  GLY B CA  1 
ATOM   4350  C  C   . GLY B  1 105 ? 44.370  -24.290 19.962  1.00   29.07 ? 212  GLY B C   1 
ATOM   4351  O  O   . GLY B  1 105 ? 43.294  -24.759 20.334  1.00   27.93 ? 212  GLY B O   1 
ATOM   4352  N  N   . VAL B  1 106 ? 44.723  -23.020 20.174  1.00   29.62 ? 213  VAL B N   1 
ATOM   4353  C  CA  . VAL B  1 106 ? 43.825  -22.066 20.834  1.00   28.42 ? 213  VAL B CA  1 
ATOM   4354  C  C   . VAL B  1 106 ? 43.885  -20.692 20.167  1.00   28.31 ? 213  VAL B C   1 
ATOM   4355  O  O   . VAL B  1 106 ? 44.870  -20.351 19.506  1.00   23.37 ? 213  VAL B O   1 
ATOM   4356  C  CB  . VAL B  1 106 ? 44.175  -21.871 22.315  1.00   28.58 ? 213  VAL B CB  1 
ATOM   4357  C  CG1 . VAL B  1 106 ? 44.305  -23.222 22.999  1.00   30.27 ? 213  VAL B CG1 1 
ATOM   4358  C  CG2 . VAL B  1 106 ? 45.444  -21.059 22.452  1.00   24.60 ? 213  VAL B CG2 1 
ATOM   4359  N  N   . GLY B  1 107 ? 42.820  -19.914 20.333  1.00   29.56 ? 214  GLY B N   1 
ATOM   4360  C  CA  . GLY B  1 107 ? 42.793  -18.576 19.765  1.00   29.37 ? 214  GLY B CA  1 
ATOM   4361  C  C   . GLY B  1 107 ? 43.422  -17.614 20.761  1.00   29.37 ? 214  GLY B C   1 
ATOM   4362  O  O   . GLY B  1 107 ? 43.584  -17.959 21.935  1.00   28.02 ? 214  GLY B O   1 
ATOM   4363  N  N   . VAL B  1 108 ? 43.791  -16.416 20.307  1.00   29.12 ? 215  VAL B N   1 
ATOM   4364  C  CA  . VAL B  1 108 ? 44.381  -15.420 21.195  1.00   23.74 ? 215  VAL B CA  1 
ATOM   4365  C  C   . VAL B  1 108 ? 43.375  -15.071 22.290  1.00   25.46 ? 215  VAL B C   1 
ATOM   4366  O  O   . VAL B  1 108 ? 43.740  -14.896 23.453  1.00   25.40 ? 215  VAL B O   1 
ATOM   4367  C  CB  . VAL B  1 108 ? 44.744  -14.133 20.433  1.00   23.46 ? 215  VAL B CB  1 
ATOM   4368  C  CG1 . VAL B  1 108 ? 45.177  -13.048 21.421  1.00   18.83 ? 215  VAL B CG1 1 
ATOM   4369  C  CG2 . VAL B  1 108 ? 45.854  -14.412 19.447  1.00   19.83 ? 215  VAL B CG2 1 
ATOM   4370  N  N   . ALA B  1 109 ? 42.111  -14.950 21.897  1.00   24.75 ? 216  ALA B N   1 
ATOM   4371  C  CA  . ALA B  1 109 ? 41.025  -14.647 22.823  1.00   25.73 ? 216  ALA B CA  1 
ATOM   4372  C  C   . ALA B  1 109 ? 40.124  -15.878 22.827  1.00   25.70 ? 216  ALA B C   1 
ATOM   4373  O  O   . ALA B  1 109 ? 39.005  -15.846 22.304  1.00   26.19 ? 216  ALA B O   1 
ATOM   4374  C  CB  . ALA B  1 109 ? 40.251  -13.433 22.342  1.00   23.07 ? 216  ALA B CB  1 
ATOM   4375  N  N   . TYR B  1 110 ? 40.607  -16.959 23.435  1.00   25.82 ? 217  TYR B N   1 
ATOM   4376  C  CA  . TYR B  1 110 ? 39.860  -18.205 23.439  1.00   27.94 ? 217  TYR B CA  1 
ATOM   4377  C  C   . TYR B  1 110 ? 38.523  -18.247 24.156  1.00   28.35 ? 217  TYR B C   1 
ATOM   4378  O  O   . TYR B  1 110 ? 37.823  -19.261 24.080  1.00   29.49 ? 217  TYR B O   1 
ATOM   4379  C  CB  . TYR B  1 110 ? 40.754  -19.361 23.893  1.00   27.87 ? 217  TYR B CB  1 
ATOM   4380  C  CG  . TYR B  1 110 ? 41.399  -19.210 25.248  1.00   28.25 ? 217  TYR B CG  1 
ATOM   4381  C  CD1 . TYR B  1 110 ? 40.641  -19.285 26.416  1.00   29.65 ? 217  TYR B CD1 1 
ATOM   4382  C  CD2 . TYR B  1 110 ? 42.783  -19.085 25.364  1.00   28.98 ? 217  TYR B CD2 1 
ATOM   4383  C  CE1 . TYR B  1 110 ? 41.250  -19.254 27.668  1.00   30.89 ? 217  TYR B CE1 1 
ATOM   4384  C  CE2 . TYR B  1 110 ? 43.402  -19.052 26.611  1.00   31.11 ? 217  TYR B CE2 1 
ATOM   4385  C  CZ  . TYR B  1 110 ? 42.630  -19.141 27.755  1.00   31.55 ? 217  TYR B CZ  1 
ATOM   4386  O  OH  . TYR B  1 110 ? 43.243  -19.147 28.982  1.00   35.79 ? 217  TYR B OH  1 
ATOM   4387  N  N   . ASN B  1 111 ? 38.155  -17.165 24.836  1.00   28.10 ? 218  ASN B N   1 
ATOM   4388  C  CA  . ASN B  1 111 ? 36.855  -17.117 25.497  1.00   29.92 ? 218  ASN B CA  1 
ATOM   4389  C  C   . ASN B  1 111 ? 35.955  -16.067 24.853  1.00   30.79 ? 218  ASN B C   1 
ATOM   4390  O  O   . ASN B  1 111 ? 34.860  -15.789 25.342  1.00   33.55 ? 218  ASN B O   1 
ATOM   4391  C  CB  . ASN B  1 111 ? 36.994  -16.831 26.997  1.00   31.87 ? 218  ASN B CB  1 
ATOM   4392  C  CG  . ASN B  1 111 ? 37.369  -18.068 27.790  1.00   32.78 ? 218  ASN B CG  1 
ATOM   4393  O  OD1 . ASN B  1 111 ? 36.898  -19.170 27.500  1.00   33.65 ? 218  ASN B OD1 1 
ATOM   4394  N  ND2 . ASN B  1 111 ? 38.209  -17.893 28.802  1.00   35.07 ? 218  ASN B ND2 1 
ATOM   4395  N  N   . ALA B  1 112 ? 36.418  -15.479 23.756  1.00   29.69 ? 219  ALA B N   1 
ATOM   4396  C  CA  . ALA B  1 112 ? 35.623  -14.476 23.051  1.00   29.51 ? 219  ALA B CA  1 
ATOM   4397  C  C   . ALA B  1 112 ? 34.593  -15.188 22.185  1.00   30.27 ? 219  ALA B C   1 
ATOM   4398  O  O   . ALA B  1 112 ? 34.710  -16.393 21.926  1.00   30.02 ? 219  ALA B O   1 
ATOM   4399  C  CB  . ALA B  1 112 ? 36.523  -13.608 22.176  1.00   25.32 ? 219  ALA B CB  1 
ATOM   4400  N  N   . ARG B  1 113 ? 33.576  -14.456 21.754  1.00   29.35 ? 220  ARG B N   1 
ATOM   4401  C  CA  . ARG B  1 113 ? 32.570  -15.036 20.883  1.00   31.34 ? 220  ARG B CA  1 
ATOM   4402  C  C   . ARG B  1 113 ? 33.005  -14.663 19.487  1.00   29.98 ? 220  ARG B C   1 
ATOM   4403  O  O   . ARG B  1 113 ? 33.406  -13.525 19.231  1.00   28.67 ? 220  ARG B O   1 
ATOM   4404  C  CB  . ARG B  1 113 ? 31.188  -14.487 21.213  1.00   35.94 ? 220  ARG B CB  1 
ATOM   4405  C  CG  . ARG B  1 113 ? 30.640  -15.113 22.485  1.00   43.50 ? 220  ARG B CG  1 
ATOM   4406  C  CD  . ARG B  1 113 ? 29.715  -14.154 23.181  1.00   50.75 ? 220  ARG B CD  1 
ATOM   4407  N  NE  . ARG B  1 113 ? 28.462  -14.000 22.452  1.00   52.40 ? 220  ARG B NE  1 
ATOM   4408  C  CZ  . ARG B  1 113 ? 27.632  -12.978 22.614  1.00   51.04 ? 220  ARG B CZ  1 
ATOM   4409  N  NH1 . ARG B  1 113 ? 26.510  -12.931 21.910  1.00   54.62 ? 220  ARG B NH1 1 
ATOM   4410  N  NH2 . ARG B  1 113 ? 27.936  -11.999 23.463  1.00   48.09 ? 220  ARG B NH2 1 
ATOM   4411  N  N   . ILE B  1 114 ? 32.944  -15.633 18.584  1.00   29.62 ? 221  ILE B N   1 
ATOM   4412  C  CA  . ILE B  1 114 ? 33.390  -15.418 17.221  1.00   26.06 ? 221  ILE B CA  1 
ATOM   4413  C  C   . ILE B  1 114 ? 32.297  -15.629 16.190  1.00   26.96 ? 221  ILE B C   1 
ATOM   4414  O  O   . ILE B  1 114 ? 31.551  -16.604 16.245  1.00   29.22 ? 221  ILE B O   1 
ATOM   4415  C  CB  . ILE B  1 114 ? 34.583  -16.360 16.907  1.00   28.19 ? 221  ILE B CB  1 
ATOM   4416  C  CG1 . ILE B  1 114 ? 35.121  -16.088 15.501  1.00   26.33 ? 221  ILE B CG1 1 
ATOM   4417  C  CG2 . ILE B  1 114 ? 34.161  -17.822 17.067  1.00   23.45 ? 221  ILE B CG2 1 
ATOM   4418  C  CD1 . ILE B  1 114 ? 35.921  -14.838 15.406  1.00   25.62 ? 221  ILE B CD1 1 
ATOM   4419  N  N   . GLY B  1 115 ? 32.202  -14.698 15.250  1.00   26.41 ? 222  GLY B N   1 
ATOM   4420  C  CA  . GLY B  1 115 ? 31.213  -14.811 14.200  1.00   25.45 ? 222  GLY B CA  1 
ATOM   4421  C  C   . GLY B  1 115 ? 31.891  -14.633 12.853  1.00   25.99 ? 222  GLY B C   1 
ATOM   4422  O  O   . GLY B  1 115 ? 33.074  -14.302 12.776  1.00   23.76 ? 222  GLY B O   1 
ATOM   4423  N  N   . GLY B  1 116 ? 31.146  -14.851 11.780  1.00   26.08 ? 223  GLY B N   1 
ATOM   4424  C  CA  . GLY B  1 116 ? 31.729  -14.686 10.466  1.00   24.67 ? 223  GLY B CA  1 
ATOM   4425  C  C   . GLY B  1 116 ? 30.720  -14.160 9.474   1.00   23.27 ? 223  GLY B C   1 
ATOM   4426  O  O   . GLY B  1 116 ? 29.546  -14.511 9.538   1.00   25.76 ? 223  GLY B O   1 
ATOM   4427  N  N   . VAL B  1 117 ? 31.163  -13.281 8.584   1.00   24.47 ? 224  VAL B N   1 
ATOM   4428  C  CA  . VAL B  1 117 ? 30.279  -12.768 7.551   1.00   24.04 ? 224  VAL B CA  1 
ATOM   4429  C  C   . VAL B  1 117 ? 30.803  -13.332 6.244   1.00   25.10 ? 224  VAL B C   1 
ATOM   4430  O  O   . VAL B  1 117 ? 31.953  -13.100 5.874   1.00   23.35 ? 224  VAL B O   1 
ATOM   4431  C  CB  . VAL B  1 117 ? 30.281  -11.227 7.453   1.00   23.77 ? 224  VAL B CB  1 
ATOM   4432  C  CG1 . VAL B  1 117 ? 29.524  -10.789 6.195   1.00   19.90 ? 224  VAL B CG1 1 
ATOM   4433  C  CG2 . VAL B  1 117 ? 29.619  -10.627 8.685   1.00   24.88 ? 224  VAL B CG2 1 
ATOM   4434  N  N   . ARG B  1 118 ? 29.966  -14.105 5.564   1.00   23.61 ? 225  ARG B N   1 
ATOM   4435  C  CA  . ARG B  1 118 ? 30.358  -14.669 4.286   1.00   22.50 ? 225  ARG B CA  1 
ATOM   4436  C  C   . ARG B  1 118 ? 30.096  -13.558 3.270   1.00   22.63 ? 225  ARG B C   1 
ATOM   4437  O  O   . ARG B  1 118 ? 28.942  -13.243 2.969   1.00   21.78 ? 225  ARG B O   1 
ATOM   4438  C  CB  . ARG B  1 118 ? 29.515  -15.917 3.983   1.00   22.03 ? 225  ARG B CB  1 
ATOM   4439  C  CG  . ARG B  1 118 ? 29.836  -16.588 2.662   1.00   22.86 ? 225  ARG B CG  1 
ATOM   4440  C  CD  . ARG B  1 118 ? 29.248  -17.992 2.585   1.00   25.79 ? 225  ARG B CD  1 
ATOM   4441  N  NE  . ARG B  1 118 ? 29.481  -18.606 1.275   1.00   28.27 ? 225  ARG B NE  1 
ATOM   4442  C  CZ  . ARG B  1 118 ? 28.622  -18.571 0.258   1.00   27.33 ? 225  ARG B CZ  1 
ATOM   4443  N  NH1 . ARG B  1 118 ? 28.939  -19.150 -0.893  1.00   24.90 ? 225  ARG B NH1 1 
ATOM   4444  N  NH2 . ARG B  1 118 ? 27.437  -17.983 0.395   1.00   28.30 ? 225  ARG B NH2 1 
ATOM   4445  N  N   . MET B  1 119 ? 31.163  -12.939 2.768   1.00   20.53 ? 226  MET B N   1 
ATOM   4446  C  CA  . MET B  1 119 ? 31.002  -11.858 1.800   1.00   20.14 ? 226  MET B CA  1 
ATOM   4447  C  C   . MET B  1 119 ? 32.011  -11.839 0.664   1.00   18.93 ? 226  MET B C   1 
ATOM   4448  O  O   . MET B  1 119 ? 31.879  -11.051 -0.268  1.00   16.93 ? 226  MET B O   1 
ATOM   4449  C  CB  . MET B  1 119 ? 30.977  -10.495 2.511   1.00   19.10 ? 226  MET B CB  1 
ATOM   4450  C  CG  . MET B  1 119 ? 32.050  -10.272 3.578   1.00   23.18 ? 226  MET B CG  1 
ATOM   4451  S  SD  . MET B  1 119 ? 33.678  -9.854  2.931   1.00   28.12 ? 226  MET B SD  1 
ATOM   4452  C  CE  . MET B  1 119 ? 33.361  -8.245  2.277   1.00   24.73 ? 226  MET B CE  1 
ATOM   4453  N  N   . LEU B  1 120 ? 33.010  -12.712 0.719   1.00   19.34 ? 227  LEU B N   1 
ATOM   4454  C  CA  . LEU B  1 120 ? 33.994  -12.749 -0.359  1.00   22.51 ? 227  LEU B CA  1 
ATOM   4455  C  C   . LEU B  1 120 ? 33.668  -13.783 -1.447  1.00   23.56 ? 227  LEU B C   1 
ATOM   4456  O  O   . LEU B  1 120 ? 34.228  -13.730 -2.540  1.00   24.86 ? 227  LEU B O   1 
ATOM   4457  C  CB  . LEU B  1 120 ? 35.391  -13.035 0.199   1.00   20.83 ? 227  LEU B CB  1 
ATOM   4458  C  CG  . LEU B  1 120 ? 36.028  -11.930 1.048   1.00   21.09 ? 227  LEU B CG  1 
ATOM   4459  C  CD1 . LEU B  1 120 ? 37.360  -12.431 1.603   1.00   15.46 ? 227  LEU B CD1 1 
ATOM   4460  C  CD2 . LEU B  1 120 ? 36.222  -10.660 0.210   1.00   16.97 ? 227  LEU B CD2 1 
ATOM   4461  N  N   . ASP B  1 121 ? 32.760  -14.709 -1.154  1.00   24.33 ? 228  ASP B N   1 
ATOM   4462  C  CA  . ASP B  1 121 ? 32.412  -15.764 -2.109  1.00   26.25 ? 228  ASP B CA  1 
ATOM   4463  C  C   . ASP B  1 121 ? 31.249  -15.361 -3.004  1.00   25.91 ? 228  ASP B C   1 
ATOM   4464  O  O   . ASP B  1 121 ? 30.144  -15.885 -2.877  1.00   26.66 ? 228  ASP B O   1 
ATOM   4465  C  CB  . ASP B  1 121 ? 32.080  -17.055 -1.351  1.00   26.36 ? 228  ASP B CB  1 
ATOM   4466  C  CG  . ASP B  1 121 ? 32.127  -18.292 -2.248  1.00   29.31 ? 228  ASP B CG  1 
ATOM   4467  O  OD1 . ASP B  1 121 ? 32.719  -18.215 -3.347  1.00   29.15 ? 228  ASP B OD1 1 
ATOM   4468  O  OD2 . ASP B  1 121 ? 31.590  -19.347 -1.845  1.00   25.45 ? 228  ASP B OD2 1 
ATOM   4469  N  N   . GLY B  1 122 ? 31.519  -14.416 -3.899  1.00   25.30 ? 229  GLY B N   1 
ATOM   4470  C  CA  . GLY B  1 122 ? 30.516  -13.901 -4.814  1.00   25.52 ? 229  GLY B CA  1 
ATOM   4471  C  C   . GLY B  1 122 ? 30.993  -12.547 -5.311  1.00   27.55 ? 229  GLY B C   1 
ATOM   4472  O  O   . GLY B  1 122 ? 32.168  -12.216 -5.151  1.00   31.34 ? 229  GLY B O   1 
ATOM   4473  N  N   . GLU B  1 123 ? 30.113  -11.759 -5.917  1.00   26.18 ? 230  GLU B N   1 
ATOM   4474  C  CA  . GLU B  1 123 ? 30.520  -10.446 -6.395  1.00   27.18 ? 230  GLU B CA  1 
ATOM   4475  C  C   . GLU B  1 123 ? 30.652  -9.545  -5.165  1.00   25.08 ? 230  GLU B C   1 
ATOM   4476  O  O   . GLU B  1 123 ? 29.687  -9.337  -4.436  1.00   24.48 ? 230  GLU B O   1 
ATOM   4477  C  CB  . GLU B  1 123 ? 29.477  -9.879  -7.365  1.00   31.80 ? 230  GLU B CB  1 
ATOM   4478  C  CG  . GLU B  1 123 ? 30.023  -8.770  -8.268  1.00   41.46 ? 230  GLU B CG  1 
ATOM   4479  C  CD  . GLU B  1 123 ? 28.978  -8.205  -9.226  1.00   48.06 ? 230  GLU B CD  1 
ATOM   4480  O  OE1 . GLU B  1 123 ? 28.400  -8.987  -10.018 1.00   53.87 ? 230  GLU B OE1 1 
ATOM   4481  O  OE2 . GLU B  1 123 ? 28.737  -6.977  -9.191  1.00   50.45 ? 230  GLU B OE2 1 
ATOM   4482  N  N   . VAL B  1 124 ? 31.852  -9.031  -4.928  1.00   24.98 ? 231  VAL B N   1 
ATOM   4483  C  CA  . VAL B  1 124 ? 32.094  -8.169  -3.777  1.00   25.00 ? 231  VAL B CA  1 
ATOM   4484  C  C   . VAL B  1 124 ? 31.830  -6.716  -4.162  1.00   24.25 ? 231  VAL B C   1 
ATOM   4485  O  O   . VAL B  1 124 ? 32.736  -5.980  -4.560  1.00   23.93 ? 231  VAL B O   1 
ATOM   4486  C  CB  . VAL B  1 124 ? 33.540  -8.334  -3.289  1.00   22.38 ? 231  VAL B CB  1 
ATOM   4487  C  CG1 . VAL B  1 124 ? 33.744  -7.626  -1.969  1.00   23.61 ? 231  VAL B CG1 1 
ATOM   4488  C  CG2 . VAL B  1 124 ? 33.850  -9.812  -3.165  1.00   24.83 ? 231  VAL B CG2 1 
ATOM   4489  N  N   . THR B  1 125 ? 30.573  -6.308  -4.053  1.00   21.11 ? 232  THR B N   1 
ATOM   4490  C  CA  . THR B  1 125 ? 30.193  -4.947  -4.397  1.00   21.23 ? 232  THR B CA  1 
ATOM   4491  C  C   . THR B  1 125 ? 30.325  -4.012  -3.205  1.00   19.64 ? 232  THR B C   1 
ATOM   4492  O  O   . THR B  1 125 ? 30.578  -4.443  -2.081  1.00   18.57 ? 232  THR B O   1 
ATOM   4493  C  CB  . THR B  1 125 ? 28.741  -4.885  -4.845  1.00   19.58 ? 232  THR B CB  1 
ATOM   4494  O  OG1 . THR B  1 125 ? 27.917  -5.345  -3.771  1.00   19.69 ? 232  THR B OG1 1 
ATOM   4495  C  CG2 . THR B  1 125 ? 28.512  -5.767  -6.087  1.00   21.80 ? 232  THR B CG2 1 
ATOM   4496  N  N   . ASP B  1 126 ? 30.130  -2.725  -3.468  1.00   20.25 ? 233  ASP B N   1 
ATOM   4497  C  CA  . ASP B  1 126 ? 30.189  -1.712  -2.433  1.00   17.79 ? 233  ASP B CA  1 
ATOM   4498  C  C   . ASP B  1 126 ? 29.117  -2.057  -1.399  1.00   18.49 ? 233  ASP B C   1 
ATOM   4499  O  O   . ASP B  1 126 ? 29.377  -2.024  -0.191  1.00   18.96 ? 233  ASP B O   1 
ATOM   4500  C  CB  . ASP B  1 126 ? 29.948  -0.333  -3.066  1.00   17.64 ? 233  ASP B CB  1 
ATOM   4501  C  CG  . ASP B  1 126 ? 30.065  0.814   -2.069  1.00   21.88 ? 233  ASP B CG  1 
ATOM   4502  O  OD1 . ASP B  1 126 ? 30.855  0.706   -1.102  1.00   20.84 ? 233  ASP B OD1 1 
ATOM   4503  O  OD2 . ASP B  1 126 ? 29.374  1.833   -2.272  1.00   20.61 ? 233  ASP B OD2 1 
ATOM   4504  N  N   . ALA B  1 127 ? 27.922  -2.414  -1.873  1.00   17.16 ? 234  ALA B N   1 
ATOM   4505  C  CA  . ALA B  1 127 ? 26.811  -2.760  -0.977  1.00   17.43 ? 234  ALA B CA  1 
ATOM   4506  C  C   . ALA B  1 127 ? 27.159  -3.973  -0.103  1.00   19.38 ? 234  ALA B C   1 
ATOM   4507  O  O   . ALA B  1 127 ? 26.840  -4.014  1.093   1.00   20.10 ? 234  ALA B O   1 
ATOM   4508  C  CB  . ALA B  1 127 ? 25.551  -3.044  -1.789  1.00   14.48 ? 234  ALA B CB  1 
ATOM   4509  N  N   . VAL B  1 128 ? 27.806  -4.963  -0.710  1.00   17.31 ? 235  VAL B N   1 
ATOM   4510  C  CA  . VAL B  1 128 ? 28.218  -6.161  0.009   1.00   18.82 ? 235  VAL B CA  1 
ATOM   4511  C  C   . VAL B  1 128 ? 29.186  -5.781  1.135   1.00   20.38 ? 235  VAL B C   1 
ATOM   4512  O  O   . VAL B  1 128 ? 29.069  -6.252  2.268   1.00   18.65 ? 235  VAL B O   1 
ATOM   4513  C  CB  . VAL B  1 128 ? 28.913  -7.155  -0.952  1.00   17.10 ? 235  VAL B CB  1 
ATOM   4514  C  CG1 . VAL B  1 128 ? 29.753  -8.150  -0.176  1.00   15.15 ? 235  VAL B CG1 1 
ATOM   4515  C  CG2 . VAL B  1 128 ? 27.862  -7.893  -1.780  1.00   15.69 ? 235  VAL B CG2 1 
ATOM   4516  N  N   . GLU B  1 129 ? 30.140  -4.919  0.814   1.00   19.46 ? 236  GLU B N   1 
ATOM   4517  C  CA  . GLU B  1 129 ? 31.114  -4.479  1.800   1.00   21.01 ? 236  GLU B CA  1 
ATOM   4518  C  C   . GLU B  1 129 ? 30.439  -3.691  2.924   1.00   20.73 ? 236  GLU B C   1 
ATOM   4519  O  O   . GLU B  1 129 ? 30.669  -3.957  4.110   1.00   21.91 ? 236  GLU B O   1 
ATOM   4520  C  CB  . GLU B  1 129 ? 32.184  -3.610  1.132   1.00   17.15 ? 236  GLU B CB  1 
ATOM   4521  C  CG  . GLU B  1 129 ? 33.146  -4.368  0.212   1.00   17.61 ? 236  GLU B CG  1 
ATOM   4522  C  CD  . GLU B  1 129 ? 34.217  -3.462  -0.398  1.00   21.81 ? 236  GLU B CD  1 
ATOM   4523  O  OE1 . GLU B  1 129 ? 34.420  -2.333  0.116   1.00   18.68 ? 236  GLU B OE1 1 
ATOM   4524  O  OE2 . GLU B  1 129 ? 34.867  -3.878  -1.388  1.00   20.77 ? 236  GLU B OE2 1 
ATOM   4525  N  N   . ALA B  1 130 ? 29.602  -2.730  2.544   1.00   18.99 ? 237  ALA B N   1 
ATOM   4526  C  CA  . ALA B  1 130 ? 28.914  -1.890  3.517   1.00   19.05 ? 237  ALA B CA  1 
ATOM   4527  C  C   . ALA B  1 130 ? 28.053  -2.690  4.487   1.00   18.97 ? 237  ALA B C   1 
ATOM   4528  O  O   . ALA B  1 130 ? 28.051  -2.424  5.690   1.00   18.81 ? 237  ALA B O   1 
ATOM   4529  C  CB  . ALA B  1 130 ? 28.072  -0.842  2.795   1.00   16.35 ? 237  ALA B CB  1 
ATOM   4530  N  N   . ARG B  1 131 ? 27.338  -3.685  3.976   1.00   20.52 ? 238  ARG B N   1 
ATOM   4531  C  CA  . ARG B  1 131 ? 26.484  -4.492  4.838   1.00   23.90 ? 238  ARG B CA  1 
ATOM   4532  C  C   . ARG B  1 131 ? 27.311  -5.347  5.800   1.00   22.90 ? 238  ARG B C   1 
ATOM   4533  O  O   . ARG B  1 131 ? 26.873  -5.653  6.915   1.00   22.95 ? 238  ARG B O   1 
ATOM   4534  C  CB  . ARG B  1 131 ? 25.556  -5.368  3.992   1.00   22.86 ? 238  ARG B CB  1 
ATOM   4535  C  CG  . ARG B  1 131 ? 24.645  -4.564  3.062   1.00   27.53 ? 238  ARG B CG  1 
ATOM   4536  C  CD  . ARG B  1 131 ? 23.716  -5.475  2.278   1.00   32.56 ? 238  ARG B CD  1 
ATOM   4537  N  NE  . ARG B  1 131 ? 22.831  -6.198  3.182   1.00   38.02 ? 238  ARG B NE  1 
ATOM   4538  C  CZ  . ARG B  1 131 ? 22.443  -7.457  3.005   1.00   43.00 ? 238  ARG B CZ  1 
ATOM   4539  N  NH1 . ARG B  1 131 ? 21.635  -8.038  3.889   1.00   44.25 ? 238  ARG B NH1 1 
ATOM   4540  N  NH2 . ARG B  1 131 ? 22.869  -8.139  1.948   1.00   46.43 ? 238  ARG B NH2 1 
ATOM   4541  N  N   . SER B  1 132 ? 28.517  -5.706  5.380   1.00   21.55 ? 239  SER B N   1 
ATOM   4542  C  CA  . SER B  1 132 ? 29.400  -6.512  6.216   1.00   19.85 ? 239  SER B CA  1 
ATOM   4543  C  C   . SER B  1 132 ? 30.037  -5.662  7.313   1.00   22.14 ? 239  SER B C   1 
ATOM   4544  O  O   . SER B  1 132 ? 29.999  -6.022  8.485   1.00   22.61 ? 239  SER B O   1 
ATOM   4545  C  CB  . SER B  1 132 ? 30.480  -7.150  5.356   1.00   16.14 ? 239  SER B CB  1 
ATOM   4546  O  OG  . SER B  1 132 ? 29.888  -7.966  4.363   1.00   22.76 ? 239  SER B OG  1 
ATOM   4547  N  N   . LEU B  1 133 ? 30.614  -4.529  6.925   1.00   22.09 ? 240  LEU B N   1 
ATOM   4548  C  CA  . LEU B  1 133 ? 31.245  -3.624  7.872   1.00   20.50 ? 240  LEU B CA  1 
ATOM   4549  C  C   . LEU B  1 133 ? 30.217  -3.053  8.841   1.00   21.02 ? 240  LEU B C   1 
ATOM   4550  O  O   . LEU B  1 133 ? 30.541  -2.737  9.990   1.00   22.37 ? 240  LEU B O   1 
ATOM   4551  C  CB  . LEU B  1 133 ? 31.940  -2.489  7.109   1.00   20.71 ? 240  LEU B CB  1 
ATOM   4552  C  CG  . LEU B  1 133 ? 33.115  -2.954  6.232   1.00   16.97 ? 240  LEU B CG  1 
ATOM   4553  C  CD1 . LEU B  1 133 ? 33.563  -1.848  5.284   1.00   14.76 ? 240  LEU B CD1 1 
ATOM   4554  C  CD2 . LEU B  1 133 ? 34.254  -3.391  7.134   1.00   12.22 ? 240  LEU B CD2 1 
ATOM   4555  N  N   . GLY B  1 134 ? 28.974  -2.940  8.381   1.00   18.00 ? 241  GLY B N   1 
ATOM   4556  C  CA  . GLY B  1 134 ? 27.924  -2.394  9.229   1.00   20.32 ? 241  GLY B CA  1 
ATOM   4557  C  C   . GLY B  1 134 ? 27.026  -3.428  9.893   1.00   21.79 ? 241  GLY B C   1 
ATOM   4558  O  O   . GLY B  1 134 ? 25.944  -3.104  10.386  1.00   22.41 ? 241  GLY B O   1 
ATOM   4559  N  N   . LEU B  1 135 ? 27.462  -4.678  9.926   1.00   20.21 ? 242  LEU B N   1 
ATOM   4560  C  CA  . LEU B  1 135 ? 26.641  -5.714  10.543  1.00   21.85 ? 242  LEU B CA  1 
ATOM   4561  C  C   . LEU B  1 135 ? 26.556  -5.570  12.061  1.00   22.39 ? 242  LEU B C   1 
ATOM   4562  O  O   . LEU B  1 135 ? 27.584  -5.479  12.725  1.00   24.75 ? 242  LEU B O   1 
ATOM   4563  C  CB  . LEU B  1 135 ? 27.204  -7.095  10.220  1.00   18.38 ? 242  LEU B CB  1 
ATOM   4564  C  CG  . LEU B  1 135 ? 26.455  -8.240  10.898  1.00   22.71 ? 242  LEU B CG  1 
ATOM   4565  C  CD1 . LEU B  1 135 ? 25.088  -8.391  10.238  1.00   21.84 ? 242  LEU B CD1 1 
ATOM   4566  C  CD2 . LEU B  1 135 ? 27.255  -9.522  10.795  1.00   20.11 ? 242  LEU B CD2 1 
ATOM   4567  N  N   . ASN B  1 136 ? 25.338  -5.529  12.600  1.00   22.39 ? 243  ASN B N   1 
ATOM   4568  C  CA  . ASN B  1 136 ? 25.128  -5.467  14.045  1.00   25.16 ? 243  ASN B CA  1 
ATOM   4569  C  C   . ASN B  1 136 ? 26.183  -4.687  14.821  1.00   24.19 ? 243  ASN B C   1 
ATOM   4570  O  O   . ASN B  1 136 ? 26.809  -5.238  15.721  1.00   23.27 ? 243  ASN B O   1 
ATOM   4571  C  CB  . ASN B  1 136 ? 25.108  -6.890  14.584  1.00   29.44 ? 243  ASN B CB  1 
ATOM   4572  C  CG  . ASN B  1 136 ? 24.032  -7.111  15.618  1.00   34.08 ? 243  ASN B CG  1 
ATOM   4573  O  OD1 . ASN B  1 136 ? 23.858  -8.227  16.101  1.00   37.61 ? 243  ASN B OD1 1 
ATOM   4574  N  ND2 . ASN B  1 136 ? 23.301  -6.052  15.967  1.00   33.99 ? 243  ASN B ND2 1 
ATOM   4575  N  N   . PRO B  1 137 ? 26.359  -3.393  14.510  1.00   24.74 ? 244  PRO B N   1 
ATOM   4576  C  CA  . PRO B  1 137 ? 27.335  -2.494  15.143  1.00   23.03 ? 244  PRO B CA  1 
ATOM   4577  C  C   . PRO B  1 137 ? 27.241  -2.391  16.662  1.00   25.30 ? 244  PRO B C   1 
ATOM   4578  O  O   . PRO B  1 137 ? 28.207  -1.983  17.318  1.00   22.40 ? 244  PRO B O   1 
ATOM   4579  C  CB  . PRO B  1 137 ? 27.063  -1.148  14.473  1.00   25.53 ? 244  PRO B CB  1 
ATOM   4580  C  CG  . PRO B  1 137 ? 26.389  -1.523  13.177  1.00   26.53 ? 244  PRO B CG  1 
ATOM   4581  C  CD  . PRO B  1 137 ? 25.498  -2.658  13.570  1.00   21.53 ? 244  PRO B CD  1 
ATOM   4582  N  N   . ASN B  1 138 ? 26.085  -2.739  17.224  1.00   25.00 ? 245  ASN B N   1 
ATOM   4583  C  CA  . ASN B  1 138 ? 25.940  -2.664  18.672  1.00   28.32 ? 245  ASN B CA  1 
ATOM   4584  C  C   . ASN B  1 138 ? 26.076  -3.998  19.372  1.00   27.94 ? 245  ASN B C   1 
ATOM   4585  O  O   . ASN B  1 138 ? 25.930  -4.083  20.591  1.00   29.99 ? 245  ASN B O   1 
ATOM   4586  C  CB  . ASN B  1 138 ? 24.628  -1.974  19.041  1.00   30.28 ? 245  ASN B CB  1 
ATOM   4587  C  CG  . ASN B  1 138 ? 24.652  -0.495  18.675  1.00   37.66 ? 245  ASN B CG  1 
ATOM   4588  O  OD1 . ASN B  1 138 ? 25.615  0.221   19.006  1.00   37.20 ? 245  ASN B OD1 1 
ATOM   4589  N  ND2 . ASN B  1 138 ? 23.613  -0.030  17.983  1.00   35.26 ? 245  ASN B ND2 1 
ATOM   4590  N  N   . HIS B  1 139 ? 26.371  -5.036  18.598  1.00   25.70 ? 246  HIS B N   1 
ATOM   4591  C  CA  . HIS B  1 139 ? 26.587  -6.355  19.168  1.00   27.63 ? 246  HIS B CA  1 
ATOM   4592  C  C   . HIS B  1 139 ? 28.055  -6.728  18.966  1.00   28.01 ? 246  HIS B C   1 
ATOM   4593  O  O   . HIS B  1 139 ? 28.737  -7.152  19.901  1.00   28.51 ? 246  HIS B O   1 
ATOM   4594  C  CB  . HIS B  1 139 ? 25.699  -7.395  18.492  1.00   27.02 ? 246  HIS B CB  1 
ATOM   4595  C  CG  . HIS B  1 139 ? 25.959  -8.794  18.958  1.00   30.41 ? 246  HIS B CG  1 
ATOM   4596  N  ND1 . HIS B  1 139 ? 25.771  -9.188  20.267  1.00   30.16 ? 246  HIS B ND1 1 
ATOM   4597  C  CD2 . HIS B  1 139 ? 26.405  -9.890  18.298  1.00   29.26 ? 246  HIS B CD2 1 
ATOM   4598  C  CE1 . HIS B  1 139 ? 26.089  -10.464 20.391  1.00   29.43 ? 246  HIS B CE1 1 
ATOM   4599  N  NE2 . HIS B  1 139 ? 26.477  -10.915 19.211  1.00   29.06 ? 246  HIS B NE2 1 
ATOM   4600  N  N   . ILE B  1 140 ? 28.529  -6.558  17.733  1.00   27.05 ? 247  ILE B N   1 
ATOM   4601  C  CA  . ILE B  1 140 ? 29.911  -6.861  17.370  1.00   25.12 ? 247  ILE B CA  1 
ATOM   4602  C  C   . ILE B  1 140 ? 30.843  -5.739  17.832  1.00   24.38 ? 247  ILE B C   1 
ATOM   4603  O  O   . ILE B  1 140 ? 30.561  -4.563  17.611  1.00   25.21 ? 247  ILE B O   1 
ATOM   4604  C  CB  . ILE B  1 140 ? 30.046  -7.009  15.841  1.00   25.13 ? 247  ILE B CB  1 
ATOM   4605  C  CG1 . ILE B  1 140 ? 29.117  -8.126  15.352  1.00   26.20 ? 247  ILE B CG1 1 
ATOM   4606  C  CG2 . ILE B  1 140 ? 31.514  -7.259  15.465  1.00   22.22 ? 247  ILE B CG2 1 
ATOM   4607  C  CD1 . ILE B  1 140 ? 28.980  -8.226  13.842  1.00   20.91 ? 247  ILE B CD1 1 
ATOM   4608  N  N   . HIS B  1 141 ? 31.953  -6.094  18.468  1.00   24.33 ? 248  HIS B N   1 
ATOM   4609  C  CA  . HIS B  1 141 ? 32.898  -5.074  18.933  1.00   22.01 ? 248  HIS B CA  1 
ATOM   4610  C  C   . HIS B  1 141 ? 34.046  -4.865  17.944  1.00   20.75 ? 248  HIS B C   1 
ATOM   4611  O  O   . HIS B  1 141 ? 34.450  -3.735  17.665  1.00   16.99 ? 248  HIS B O   1 
ATOM   4612  C  CB  . HIS B  1 141 ? 33.536  -5.460  20.276  1.00   22.43 ? 248  HIS B CB  1 
ATOM   4613  C  CG  . HIS B  1 141 ? 32.557  -5.764  21.363  1.00   25.60 ? 248  HIS B CG  1 
ATOM   4614  N  ND1 . HIS B  1 141 ? 32.171  -7.050  21.676  1.00   27.84 ? 248  HIS B ND1 1 
ATOM   4615  C  CD2 . HIS B  1 141 ? 31.869  -4.949  22.198  1.00   28.98 ? 248  HIS B CD2 1 
ATOM   4616  C  CE1 . HIS B  1 141 ? 31.286  -7.015  22.657  1.00   28.58 ? 248  HIS B CE1 1 
ATOM   4617  N  NE2 . HIS B  1 141 ? 31.084  -5.753  22.991  1.00   29.91 ? 248  HIS B NE2 1 
ATOM   4618  N  N   . ILE B  1 142 ? 34.556  -5.972  17.421  1.00   19.56 ? 249  ILE B N   1 
ATOM   4619  C  CA  . ILE B  1 142 ? 35.703  -5.957  16.536  1.00   19.94 ? 249  ILE B CA  1 
ATOM   4620  C  C   . ILE B  1 142 ? 35.463  -6.651  15.204  1.00   21.93 ? 249  ILE B C   1 
ATOM   4621  O  O   . ILE B  1 142 ? 34.945  -7.768  15.160  1.00   22.85 ? 249  ILE B O   1 
ATOM   4622  C  CB  . ILE B  1 142 ? 36.879  -6.649  17.255  1.00   19.70 ? 249  ILE B CB  1 
ATOM   4623  C  CG1 . ILE B  1 142 ? 37.097  -5.988  18.621  1.00   19.28 ? 249  ILE B CG1 1 
ATOM   4624  C  CG2 . ILE B  1 142 ? 38.132  -6.618  16.415  1.00   17.17 ? 249  ILE B CG2 1 
ATOM   4625  C  CD1 . ILE B  1 142 ? 38.096  -6.739  19.517  1.00   18.68 ? 249  ILE B CD1 1 
ATOM   4626  N  N   . TYR B  1 143 ? 35.848  -5.990  14.119  1.00   20.75 ? 250  TYR B N   1 
ATOM   4627  C  CA  . TYR B  1 143 ? 35.704  -6.573  12.790  1.00   20.87 ? 250  TYR B CA  1 
ATOM   4628  C  C   . TYR B  1 143 ? 37.118  -6.829  12.276  1.00   18.62 ? 250  TYR B C   1 
ATOM   4629  O  O   . TYR B  1 143 ? 37.974  -5.954  12.374  1.00   20.95 ? 250  TYR B O   1 
ATOM   4630  C  CB  . TYR B  1 143 ? 34.982  -5.606  11.840  1.00   18.85 ? 250  TYR B CB  1 
ATOM   4631  C  CG  . TYR B  1 143 ? 33.595  -5.209  12.286  1.00   24.51 ? 250  TYR B CG  1 
ATOM   4632  C  CD1 . TYR B  1 143 ? 33.408  -4.321  13.343  1.00   22.70 ? 250  TYR B CD1 1 
ATOM   4633  C  CD2 . TYR B  1 143 ? 32.461  -5.716  11.645  1.00   23.02 ? 250  TYR B CD2 1 
ATOM   4634  C  CE1 . TYR B  1 143 ? 32.129  -3.940  13.751  1.00   23.85 ? 250  TYR B CE1 1 
ATOM   4635  C  CE2 . TYR B  1 143 ? 31.171  -5.342  12.048  1.00   23.70 ? 250  TYR B CE2 1 
ATOM   4636  C  CZ  . TYR B  1 143 ? 31.017  -4.451  13.103  1.00   24.28 ? 250  TYR B CZ  1 
ATOM   4637  O  OH  . TYR B  1 143 ? 29.755  -4.052  13.499  1.00   24.65 ? 250  TYR B OH  1 
ATOM   4638  N  N   . SER B  1 144 ? 37.365  -8.017  11.737  1.00   16.17 ? 251  SER B N   1 
ATOM   4639  C  CA  . SER B  1 144 ? 38.681  -8.347  11.207  1.00   18.31 ? 251  SER B CA  1 
ATOM   4640  C  C   . SER B  1 144 ? 38.561  -8.627  9.707   1.00   17.71 ? 251  SER B C   1 
ATOM   4641  O  O   . SER B  1 144 ? 37.737  -9.431  9.290   1.00   19.86 ? 251  SER B O   1 
ATOM   4642  C  CB  . SER B  1 144 ? 39.245  -9.579  11.921  1.00   18.15 ? 251  SER B CB  1 
ATOM   4643  O  OG  . SER B  1 144 ? 40.587  -9.835  11.521  1.00   16.81 ? 251  SER B OG  1 
ATOM   4644  N  N   . ALA B  1 145 ? 39.379  -7.961  8.899   1.00   18.47 ? 252  ALA B N   1 
ATOM   4645  C  CA  . ALA B  1 145 ? 39.316  -8.156  7.455   1.00   17.43 ? 252  ALA B CA  1 
ATOM   4646  C  C   . ALA B  1 145 ? 40.672  -8.476  6.856   1.00   18.95 ? 252  ALA B C   1 
ATOM   4647  O  O   . ALA B  1 145 ? 41.580  -7.634  6.843   1.00   19.09 ? 252  ALA B O   1 
ATOM   4648  C  CB  . ALA B  1 145 ? 38.716  -6.902  6.773   1.00   14.44 ? 252  ALA B CB  1 
ATOM   4649  N  N   . SER B  1 146 ? 40.809  -9.707  6.372   1.00   19.70 ? 253  SER B N   1 
ATOM   4650  C  CA  . SER B  1 146 ? 42.035  -10.150 5.733   1.00   18.54 ? 253  SER B CA  1 
ATOM   4651  C  C   . SER B  1 146 ? 41.810  -10.222 4.223   1.00   20.51 ? 253  SER B C   1 
ATOM   4652  O  O   . SER B  1 146 ? 41.963  -11.284 3.599   1.00   20.50 ? 253  SER B O   1 
ATOM   4653  C  CB  . SER B  1 146 ? 42.450  -11.519 6.271   1.00   20.77 ? 253  SER B CB  1 
ATOM   4654  O  OG  . SER B  1 146 ? 42.869  -11.401 7.618   1.00   22.65 ? 253  SER B OG  1 
ATOM   4655  N  N   . TRP B  1 147 ? 41.439  -9.081  3.646   1.00   18.57 ? 254  TRP B N   1 
ATOM   4656  C  CA  . TRP B  1 147 ? 41.199  -8.968  2.210   1.00   17.63 ? 254  TRP B CA  1 
ATOM   4657  C  C   . TRP B  1 147 ? 41.298  -7.510  1.811   1.00   16.88 ? 254  TRP B C   1 
ATOM   4658  O  O   . TRP B  1 147 ? 41.343  -6.631  2.664   1.00   19.30 ? 254  TRP B O   1 
ATOM   4659  C  CB  . TRP B  1 147 ? 39.811  -9.506  1.833   1.00   18.12 ? 254  TRP B CB  1 
ATOM   4660  C  CG  . TRP B  1 147 ? 38.660  -8.905  2.603   1.00   17.01 ? 254  TRP B CG  1 
ATOM   4661  C  CD1 . TRP B  1 147 ? 38.090  -9.402  3.740   1.00   19.09 ? 254  TRP B CD1 1 
ATOM   4662  C  CD2 . TRP B  1 147 ? 37.947  -7.700  2.293   1.00   19.60 ? 254  TRP B CD2 1 
ATOM   4663  N  NE1 . TRP B  1 147 ? 37.068  -8.587  4.158   1.00   17.15 ? 254  TRP B NE1 1 
ATOM   4664  C  CE2 . TRP B  1 147 ? 36.958  -7.532  3.289   1.00   20.82 ? 254  TRP B CE2 1 
ATOM   4665  C  CE3 . TRP B  1 147 ? 38.044  -6.746  1.270   1.00   20.01 ? 254  TRP B CE3 1 
ATOM   4666  C  CZ2 . TRP B  1 147 ? 36.072  -6.446  3.295   1.00   19.84 ? 254  TRP B CZ2 1 
ATOM   4667  C  CZ3 . TRP B  1 147 ? 37.158  -5.664  1.275   1.00   22.18 ? 254  TRP B CZ3 1 
ATOM   4668  C  CH2 . TRP B  1 147 ? 36.187  -5.526  2.284   1.00   19.28 ? 254  TRP B CH2 1 
ATOM   4669  N  N   . GLY B  1 148 ? 41.332  -7.251  0.513   1.00   18.92 ? 255  GLY B N   1 
ATOM   4670  C  CA  . GLY B  1 148 ? 41.408  -5.880  0.047   1.00   19.09 ? 255  GLY B CA  1 
ATOM   4671  C  C   . GLY B  1 148 ? 41.585  -5.822  -1.460  1.00   20.30 ? 255  GLY B C   1 
ATOM   4672  O  O   . GLY B  1 148 ? 41.385  -6.824  -2.158  1.00   17.44 ? 255  GLY B O   1 
ATOM   4673  N  N   . PRO B  1 149 ? 41.946  -4.648  -1.992  1.00   18.63 ? 256  PRO B N   1 
ATOM   4674  C  CA  . PRO B  1 149 ? 42.158  -4.460  -3.425  1.00   17.76 ? 256  PRO B CA  1 
ATOM   4675  C  C   . PRO B  1 149 ? 43.330  -5.335  -3.871  1.00   21.32 ? 256  PRO B C   1 
ATOM   4676  O  O   . PRO B  1 149 ? 44.188  -5.712  -3.066  1.00   20.51 ? 256  PRO B O   1 
ATOM   4677  C  CB  . PRO B  1 149 ? 42.489  -2.977  -3.538  1.00   16.92 ? 256  PRO B CB  1 
ATOM   4678  C  CG  . PRO B  1 149 ? 41.823  -2.384  -2.346  1.00   23.32 ? 256  PRO B CG  1 
ATOM   4679  C  CD  . PRO B  1 149 ? 42.132  -3.381  -1.271  1.00   20.28 ? 256  PRO B CD  1 
ATOM   4680  N  N   . GLU B  1 150 ? 43.366  -5.647  -5.156  1.00   20.11 ? 257  GLU B N   1 
ATOM   4681  C  CA  . GLU B  1 150 ? 44.418  -6.474  -5.715  1.00   24.15 ? 257  GLU B CA  1 
ATOM   4682  C  C   . GLU B  1 150 ? 45.830  -5.915  -5.457  1.00   22.95 ? 257  GLU B C   1 
ATOM   4683  O  O   . GLU B  1 150 ? 46.064  -4.706  -5.536  1.00   23.54 ? 257  GLU B O   1 
ATOM   4684  C  CB  . GLU B  1 150 ? 44.175  -6.627  -7.216  1.00   27.49 ? 257  GLU B CB  1 
ATOM   4685  C  CG  . GLU B  1 150 ? 45.036  -7.687  -7.844  1.00   39.95 ? 257  GLU B CG  1 
ATOM   4686  C  CD  . GLU B  1 150 ? 44.713  -7.880  -9.300  1.00   48.60 ? 257  GLU B CD  1 
ATOM   4687  O  OE1 . GLU B  1 150 ? 45.478  -8.598  -9.989  1.00   51.27 ? 257  GLU B OE1 1 
ATOM   4688  O  OE2 . GLU B  1 150 ? 43.687  -7.308  -9.747  1.00   52.88 ? 257  GLU B OE2 1 
ATOM   4689  N  N   . ASP B  1 151 ? 46.770  -6.806  -5.155  1.00   23.23 ? 258  ASP B N   1 
ATOM   4690  C  CA  . ASP B  1 151 ? 48.152  -6.407  -4.872  1.00   22.93 ? 258  ASP B CA  1 
ATOM   4691  C  C   . ASP B  1 151 ? 49.077  -6.526  -6.092  1.00   23.58 ? 258  ASP B C   1 
ATOM   4692  O  O   . ASP B  1 151 ? 50.190  -7.057  -5.980  1.00   22.37 ? 258  ASP B O   1 
ATOM   4693  C  CB  . ASP B  1 151 ? 48.743  -7.267  -3.740  1.00   21.26 ? 258  ASP B CB  1 
ATOM   4694  C  CG  . ASP B  1 151 ? 48.029  -7.076  -2.406  1.00   24.28 ? 258  ASP B CG  1 
ATOM   4695  O  OD1 . ASP B  1 151 ? 47.641  -5.934  -2.077  1.00   17.52 ? 258  ASP B OD1 1 
ATOM   4696  O  OD2 . ASP B  1 151 ? 47.879  -8.077  -1.677  1.00   21.87 ? 258  ASP B OD2 1 
ATOM   4697  N  N   . ASP B  1 152 ? 48.643  -6.042  -7.250  1.00   20.36 ? 259  ASP B N   1 
ATOM   4698  C  CA  . ASP B  1 152 ? 49.491  -6.144  -8.436  1.00   21.87 ? 259  ASP B CA  1 
ATOM   4699  C  C   . ASP B  1 152 ? 50.554  -5.055  -8.483  1.00   21.18 ? 259  ASP B C   1 
ATOM   4700  O  O   . ASP B  1 152 ? 51.411  -5.059  -9.364  1.00   21.45 ? 259  ASP B O   1 
ATOM   4701  C  CB  . ASP B  1 152 ? 48.646  -6.091  -9.711  1.00   24.59 ? 259  ASP B CB  1 
ATOM   4702  C  CG  . ASP B  1 152 ? 47.739  -4.878  -9.763  1.00   28.84 ? 259  ASP B CG  1 
ATOM   4703  O  OD1 . ASP B  1 152 ? 47.883  -3.972  -8.904  1.00   29.85 ? 259  ASP B OD1 1 
ATOM   4704  O  OD2 . ASP B  1 152 ? 46.888  -4.833  -10.675 1.00   28.70 ? 259  ASP B OD2 1 
ATOM   4705  N  N   . GLY B  1 153 ? 50.497  -4.125  -7.532  1.00   20.27 ? 260  GLY B N   1 
ATOM   4706  C  CA  . GLY B  1 153 ? 51.474  -3.053  -7.491  1.00   22.24 ? 260  GLY B CA  1 
ATOM   4707  C  C   . GLY B  1 153 ? 51.239  -1.958  -8.513  1.00   24.01 ? 260  GLY B C   1 
ATOM   4708  O  O   . GLY B  1 153 ? 52.144  -1.176  -8.831  1.00   21.71 ? 260  GLY B O   1 
ATOM   4709  N  N   . LYS B  1 154 ? 50.028  -1.893  -9.049  1.00   25.12 ? 261  LYS B N   1 
ATOM   4710  C  CA  . LYS B  1 154 ? 49.737  -0.849  -10.015 1.00   28.90 ? 261  LYS B CA  1 
ATOM   4711  C  C   . LYS B  1 154 ? 48.339  -0.283  -9.841  1.00   28.99 ? 261  LYS B C   1 
ATOM   4712  O  O   . LYS B  1 154 ? 47.901  0.576   -10.608 1.00   28.58 ? 261  LYS B O   1 
ATOM   4713  C  CB  . LYS B  1 154 ? 49.932  -1.368  -11.443 1.00   30.80 ? 261  LYS B CB  1 
ATOM   4714  C  CG  . LYS B  1 154 ? 49.078  -2.553  -11.820 1.00   31.87 ? 261  LYS B CG  1 
ATOM   4715  C  CD  . LYS B  1 154 ? 49.361  -2.960  -13.269 1.00   38.90 ? 261  LYS B CD  1 
ATOM   4716  C  CE  . LYS B  1 154 ? 48.379  -4.019  -13.752 1.00   41.82 ? 261  LYS B CE  1 
ATOM   4717  N  NZ  . LYS B  1 154 ? 48.417  -4.180  -15.229 0.0000 40.66 ? 261  LYS B NZ  1 
ATOM   4718  N  N   . THR B  1 155 ? 47.633  -0.738  -8.817  1.00   26.26 ? 262  THR B N   1 
ATOM   4719  C  CA  . THR B  1 155 ? 46.298  -0.226  -8.624  1.00   24.95 ? 262  THR B CA  1 
ATOM   4720  C  C   . THR B  1 155 ? 46.228  0.708   -7.426  1.00   24.00 ? 262  THR B C   1 
ATOM   4721  O  O   . THR B  1 155 ? 47.020  0.600   -6.488  1.00   22.79 ? 262  THR B O   1 
ATOM   4722  C  CB  . THR B  1 155 ? 45.260  -1.368  -8.435  1.00   27.04 ? 262  THR B CB  1 
ATOM   4723  O  OG1 . THR B  1 155 ? 45.299  -1.844  -7.093  1.00   35.06 ? 262  THR B OG1 1 
ATOM   4724  C  CG2 . THR B  1 155 ? 45.556  -2.517  -9.355  1.00   25.88 ? 262  THR B CG2 1 
ATOM   4725  N  N   . VAL B  1 156 ? 45.298  1.656   -7.502  1.00   21.28 ? 263  VAL B N   1 
ATOM   4726  C  CA  . VAL B  1 156 ? 45.035  2.598   -6.425  1.00   20.81 ? 263  VAL B CA  1 
ATOM   4727  C  C   . VAL B  1 156 ? 43.544  2.407   -6.263  1.00   21.70 ? 263  VAL B C   1 
ATOM   4728  O  O   . VAL B  1 156 ? 42.776  2.737   -7.160  1.00   22.21 ? 263  VAL B O   1 
ATOM   4729  C  CB  . VAL B  1 156 ? 45.312  4.054   -6.815  1.00   21.77 ? 263  VAL B CB  1 
ATOM   4730  C  CG1 . VAL B  1 156 ? 44.999  4.964   -5.609  1.00   16.38 ? 263  VAL B CG1 1 
ATOM   4731  C  CG2 . VAL B  1 156 ? 46.762  4.215   -7.241  1.00   16.51 ? 263  VAL B CG2 1 
ATOM   4732  N  N   . ASP B  1 157 ? 43.131  1.861   -5.126  1.00   21.16 ? 264  ASP B N   1 
ATOM   4733  C  CA  . ASP B  1 157 ? 41.722  1.565   -4.914  1.00   20.68 ? 264  ASP B CA  1 
ATOM   4734  C  C   . ASP B  1 157 ? 41.410  1.598   -3.422  1.00   21.46 ? 264  ASP B C   1 
ATOM   4735  O  O   . ASP B  1 157 ? 42.306  1.456   -2.585  1.00   21.33 ? 264  ASP B O   1 
ATOM   4736  C  CB  . ASP B  1 157 ? 41.440  0.173   -5.511  1.00   21.08 ? 264  ASP B CB  1 
ATOM   4737  C  CG  . ASP B  1 157 ? 39.953  -0.142  -5.645  1.00   23.11 ? 264  ASP B CG  1 
ATOM   4738  O  OD1 . ASP B  1 157 ? 39.104  0.742   -5.390  1.00   23.74 ? 264  ASP B OD1 1 
ATOM   4739  O  OD2 . ASP B  1 157 ? 39.642  -1.296  -6.019  1.00   24.33 ? 264  ASP B OD2 1 
ATOM   4740  N  N   . GLY B  1 158 ? 40.137  1.797   -3.099  1.00   21.67 ? 265  GLY B N   1 
ATOM   4741  C  CA  . GLY B  1 158 ? 39.710  1.863   -1.713  1.00   19.37 ? 265  GLY B CA  1 
ATOM   4742  C  C   . GLY B  1 158 ? 38.205  1.700   -1.647  1.00   20.18 ? 265  GLY B C   1 
ATOM   4743  O  O   . GLY B  1 158 ? 37.578  1.430   -2.664  1.00   20.02 ? 265  GLY B O   1 
ATOM   4744  N  N   . PRO B  1 159 ? 37.589  1.877   -0.475  1.00   18.10 ? 266  PRO B N   1 
ATOM   4745  C  CA  . PRO B  1 159 ? 36.136  1.729   -0.336  1.00   20.05 ? 266  PRO B CA  1 
ATOM   4746  C  C   . PRO B  1 159 ? 35.297  2.708   -1.143  1.00   19.95 ? 266  PRO B C   1 
ATOM   4747  O  O   . PRO B  1 159 ? 35.655  3.875   -1.270  1.00   22.76 ? 266  PRO B O   1 
ATOM   4748  C  CB  . PRO B  1 159 ? 35.913  1.915   1.162   1.00   17.64 ? 266  PRO B CB  1 
ATOM   4749  C  CG  . PRO B  1 159 ? 36.994  2.904   1.520   1.00   21.06 ? 266  PRO B CG  1 
ATOM   4750  C  CD  . PRO B  1 159 ? 38.194  2.342   0.784   1.00   16.32 ? 266  PRO B CD  1 
ATOM   4751  N  N   . ALA B  1 160 ? 34.184  2.230   -1.694  1.00   18.99 ? 267  ALA B N   1 
ATOM   4752  C  CA  . ALA B  1 160 ? 33.285  3.104   -2.436  1.00   18.42 ? 267  ALA B CA  1 
ATOM   4753  C  C   . ALA B  1 160 ? 32.406  3.806   -1.381  1.00   18.96 ? 267  ALA B C   1 
ATOM   4754  O  O   . ALA B  1 160 ? 32.569  3.565   -0.188  1.00   18.06 ? 267  ALA B O   1 
ATOM   4755  C  CB  . ALA B  1 160 ? 32.446  2.295   -3.414  1.00   19.28 ? 267  ALA B CB  1 
ATOM   4756  N  N   . ARG B  1 161 ? 31.474  4.657   -1.807  1.00   21.76 ? 268  ARG B N   1 
ATOM   4757  C  CA  . ARG B  1 161 ? 30.651  5.424   -0.865  1.00   24.01 ? 268  ARG B CA  1 
ATOM   4758  C  C   . ARG B  1 161 ? 29.943  4.710   0.282   1.00   23.13 ? 268  ARG B C   1 
ATOM   4759  O  O   . ARG B  1 161 ? 30.038  5.148   1.434   1.00   20.62 ? 268  ARG B O   1 
ATOM   4760  C  CB  . ARG B  1 161 ? 29.621  6.277   -1.616  1.00   28.58 ? 268  ARG B CB  1 
ATOM   4761  C  CG  . ARG B  1 161 ? 30.150  7.600   -2.182  1.00   38.96 ? 268  ARG B CG  1 
ATOM   4762  C  CD  . ARG B  1 161 ? 30.999  7.406   -3.439  1.00   44.58 ? 268  ARG B CD  1 
ATOM   4763  N  NE  . ARG B  1 161 ? 31.427  8.674   -4.021  0.0000 42.79 ? 268  ARG B NE  1 
ATOM   4764  C  CZ  . ARG B  1 161 ? 32.136  8.781   -5.140  0.0000 43.22 ? 268  ARG B CZ  1 
ATOM   4765  N  NH1 . ARG B  1 161 ? 32.500  7.691   -5.802  0.0000 43.01 ? 268  ARG B NH1 1 
ATOM   4766  N  NH2 . ARG B  1 161 ? 32.479  9.977   -5.599  0.0000 43.01 ? 268  ARG B NH2 1 
ATOM   4767  N  N   . LEU B  1 162 ? 29.223  3.629   -0.008  1.00   20.31 ? 269  LEU B N   1 
ATOM   4768  C  CA  . LEU B  1 162 ? 28.531  2.918   1.061   1.00   21.15 ? 269  LEU B CA  1 
ATOM   4769  C  C   . LEU B  1 162 ? 29.494  2.350   2.092   1.00   20.39 ? 269  LEU B C   1 
ATOM   4770  O  O   . LEU B  1 162 ? 29.231  2.422   3.299   1.00   19.88 ? 269  LEU B O   1 
ATOM   4771  C  CB  . LEU B  1 162 ? 27.661  1.801   0.479   1.00   21.53 ? 269  LEU B CB  1 
ATOM   4772  C  CG  . LEU B  1 162 ? 26.525  2.358   -0.379  1.00   23.15 ? 269  LEU B CG  1 
ATOM   4773  C  CD1 . LEU B  1 162 ? 25.723  1.237   -0.998  1.00   22.01 ? 269  LEU B CD1 1 
ATOM   4774  C  CD2 . LEU B  1 162 ? 25.642  3.248   0.490   1.00   20.81 ? 269  LEU B CD2 1 
ATOM   4775  N  N   . ALA B  1 163 ? 30.608  1.789   1.625   1.00   18.65 ? 270  ALA B N   1 
ATOM   4776  C  CA  . ALA B  1 163 ? 31.598  1.211   2.538   1.00   17.93 ? 270  ALA B CA  1 
ATOM   4777  C  C   . ALA B  1 163 ? 32.203  2.315   3.401   1.00   19.37 ? 270  ALA B C   1 
ATOM   4778  O  O   . ALA B  1 163 ? 32.426  2.128   4.602   1.00   19.44 ? 270  ALA B O   1 
ATOM   4779  C  CB  . ALA B  1 163 ? 32.688  0.495   1.752   1.00   15.22 ? 270  ALA B CB  1 
ATOM   4780  N  N   . GLU B  1 164 ? 32.459  3.471   2.793   1.00   18.34 ? 271  GLU B N   1 
ATOM   4781  C  CA  . GLU B  1 164 ? 33.006  4.597   3.537   1.00   19.30 ? 271  GLU B CA  1 
ATOM   4782  C  C   . GLU B  1 164 ? 32.027  5.002   4.610   1.00   16.38 ? 271  GLU B C   1 
ATOM   4783  O  O   . GLU B  1 164 ? 32.417  5.239   5.750   1.00   18.92 ? 271  GLU B O   1 
ATOM   4784  C  CB  . GLU B  1 164 ? 33.228  5.820   2.655   1.00   18.82 ? 271  GLU B CB  1 
ATOM   4785  C  CG  . GLU B  1 164 ? 34.336  5.724   1.654   1.00   27.43 ? 271  GLU B CG  1 
ATOM   4786  C  CD  . GLU B  1 164 ? 34.731  7.099   1.155   1.00   31.43 ? 271  GLU B CD  1 
ATOM   4787  O  OE1 . GLU B  1 164 ? 35.795  7.603   1.580   1.00   34.75 ? 271  GLU B OE1 1 
ATOM   4788  O  OE2 . GLU B  1 164 ? 33.961  7.683   0.355   1.00   35.52 ? 271  GLU B OE2 1 
ATOM   4789  N  N   . GLU B  1 165 ? 30.756  5.101   4.234   1.00   16.48 ? 272  GLU B N   1 
ATOM   4790  C  CA  . GLU B  1 165 ? 29.725  5.495   5.186   1.00   17.49 ? 272  GLU B CA  1 
ATOM   4791  C  C   . GLU B  1 165 ? 29.631  4.463   6.303   1.00   17.14 ? 272  GLU B C   1 
ATOM   4792  O  O   . GLU B  1 165 ? 29.431  4.820   7.460   1.00   16.85 ? 272  GLU B O   1 
ATOM   4793  C  CB  . GLU B  1 165 ? 28.378  5.673   4.467   1.00   17.82 ? 272  GLU B CB  1 
ATOM   4794  C  CG  . GLU B  1 165 ? 28.365  6.931   3.580   1.00   21.22 ? 272  GLU B CG  1 
ATOM   4795  C  CD  . GLU B  1 165 ? 27.089  7.114   2.761   1.00   24.64 ? 272  GLU B CD  1 
ATOM   4796  O  OE1 . GLU B  1 165 ? 26.823  8.253   2.322   1.00   22.20 ? 272  GLU B OE1 1 
ATOM   4797  O  OE2 . GLU B  1 165 ? 26.360  6.127   2.541   1.00   21.67 ? 272  GLU B OE2 1 
ATOM   4798  N  N   . ALA B  1 166 ? 29.808  3.189   5.963   1.00   16.00 ? 273  ALA B N   1 
ATOM   4799  C  CA  . ALA B  1 166 ? 29.753  2.141   6.980   1.00   19.25 ? 273  ALA B CA  1 
ATOM   4800  C  C   . ALA B  1 166 ? 30.893  2.353   7.980   1.00   17.54 ? 273  ALA B C   1 
ATOM   4801  O  O   . ALA B  1 166 ? 30.695  2.247   9.186   1.00   18.28 ? 273  ALA B O   1 
ATOM   4802  C  CB  . ALA B  1 166 ? 29.858  0.755   6.331   1.00   17.62 ? 273  ALA B CB  1 
ATOM   4803  N  N   . PHE B  1 167 ? 32.083  2.662   7.471   1.00   18.32 ? 274  PHE B N   1 
ATOM   4804  C  CA  . PHE B  1 167 ? 33.235  2.905   8.335   1.00   18.17 ? 274  PHE B CA  1 
ATOM   4805  C  C   . PHE B  1 167 ? 32.932  4.074   9.269   1.00   17.71 ? 274  PHE B C   1 
ATOM   4806  O  O   . PHE B  1 167 ? 33.143  3.985   10.485  1.00   16.38 ? 274  PHE B O   1 
ATOM   4807  C  CB  . PHE B  1 167 ? 34.472  3.260   7.509   1.00   14.59 ? 274  PHE B CB  1 
ATOM   4808  C  CG  . PHE B  1 167 ? 35.242  2.072   6.994   1.00   18.57 ? 274  PHE B CG  1 
ATOM   4809  C  CD1 . PHE B  1 167 ? 35.696  1.080   7.865   1.00   18.16 ? 274  PHE B CD1 1 
ATOM   4810  C  CD2 . PHE B  1 167 ? 35.595  1.989   5.646   1.00   18.59 ? 274  PHE B CD2 1 
ATOM   4811  C  CE1 . PHE B  1 167 ? 36.502  0.022   7.405   1.00   15.63 ? 274  PHE B CE1 1 
ATOM   4812  C  CE2 . PHE B  1 167 ? 36.394  0.945   5.176   1.00   20.04 ? 274  PHE B CE2 1 
ATOM   4813  C  CZ  . PHE B  1 167 ? 36.853  -0.044  6.064   1.00   19.48 ? 274  PHE B CZ  1 
ATOM   4814  N  N   . PHE B  1 168 ? 32.436  5.167   8.691   1.00   15.51 ? 275  PHE B N   1 
ATOM   4815  C  CA  . PHE B  1 168 ? 32.134  6.345   9.482   1.00   19.19 ? 275  PHE B CA  1 
ATOM   4816  C  C   . PHE B  1 168 ? 31.040  6.130   10.524  1.00   18.06 ? 275  PHE B C   1 
ATOM   4817  O  O   . PHE B  1 168 ? 31.173  6.571   11.666  1.00   18.64 ? 275  PHE B O   1 
ATOM   4818  C  CB  . PHE B  1 168 ? 31.784  7.532   8.590   1.00   20.95 ? 275  PHE B CB  1 
ATOM   4819  C  CG  . PHE B  1 168 ? 31.935  8.847   9.296   1.00   30.25 ? 275  PHE B CG  1 
ATOM   4820  C  CD1 . PHE B  1 168 ? 30.972  9.270   10.227  1.00   36.49 ? 275  PHE B CD1 1 
ATOM   4821  C  CD2 . PHE B  1 168 ? 33.067  9.634   9.093   1.00   30.32 ? 275  PHE B CD2 1 
ATOM   4822  C  CE1 . PHE B  1 168 ? 31.141  10.464  10.950  1.00   36.82 ? 275  PHE B CE1 1 
ATOM   4823  C  CE2 . PHE B  1 168 ? 33.254  10.827  9.804   1.00   31.78 ? 275  PHE B CE2 1 
ATOM   4824  C  CZ  . PHE B  1 168 ? 32.292  11.245  10.736  1.00   36.76 ? 275  PHE B CZ  1 
ATOM   4825  N  N   . ARG B  1 169 ? 29.964  5.453   10.138  1.00   17.19 ? 276  ARG B N   1 
ATOM   4826  C  CA  . ARG B  1 169 ? 28.883  5.168   11.073  1.00   18.23 ? 276  ARG B CA  1 
ATOM   4827  C  C   . ARG B  1 169 ? 29.470  4.281   12.171  1.00   18.29 ? 276  ARG B C   1 
ATOM   4828  O  O   . ARG B  1 169 ? 29.153  4.437   13.345  1.00   20.87 ? 276  ARG B O   1 
ATOM   4829  C  CB  . ARG B  1 169 ? 27.738  4.407   10.383  1.00   16.73 ? 276  ARG B CB  1 
ATOM   4830  C  CG  . ARG B  1 169 ? 27.020  5.156   9.266   1.00   19.52 ? 276  ARG B CG  1 
ATOM   4831  C  CD  . ARG B  1 169 ? 25.985  4.253   8.573   1.00   23.37 ? 276  ARG B CD  1 
ATOM   4832  N  NE  . ARG B  1 169 ? 24.836  3.934   9.429   1.00   22.78 ? 276  ARG B NE  1 
ATOM   4833  C  CZ  . ARG B  1 169 ? 23.800  4.743   9.631   1.00   22.89 ? 276  ARG B CZ  1 
ATOM   4834  N  NH1 . ARG B  1 169 ? 22.816  4.372   10.428  1.00   24.05 ? 276  ARG B NH1 1 
ATOM   4835  N  NH2 . ARG B  1 169 ? 23.731  5.912   9.014   1.00   21.27 ? 276  ARG B NH2 1 
ATOM   4836  N  N   . GLY B  1 170 ? 30.328  3.350   11.770  1.00   18.67 ? 277  GLY B N   1 
ATOM   4837  C  CA  . GLY B  1 170 ? 30.955  2.436   12.717  1.00   17.26 ? 277  GLY B CA  1 
ATOM   4838  C  C   . GLY B  1 170 ? 31.758  3.098   13.830  1.00   17.77 ? 277  GLY B C   1 
ATOM   4839  O  O   . GLY B  1 170 ? 31.495  2.852   15.008  1.00   16.13 ? 277  GLY B O   1 
ATOM   4840  N  N   . VAL B  1 171 ? 32.734  3.937   13.477  1.00   16.51 ? 278  VAL B N   1 
ATOM   4841  C  CA  . VAL B  1 171 ? 33.535  4.595   14.500  1.00   17.86 ? 278  VAL B CA  1 
ATOM   4842  C  C   . VAL B  1 171 ? 32.743  5.647   15.274  1.00   20.35 ? 278  VAL B C   1 
ATOM   4843  O  O   . VAL B  1 171 ? 33.089  5.983   16.409  1.00   20.79 ? 278  VAL B O   1 
ATOM   4844  C  CB  . VAL B  1 171 ? 34.821  5.258   13.908  1.00   16.93 ? 278  VAL B CB  1 
ATOM   4845  C  CG1 . VAL B  1 171 ? 35.666  4.199   13.177  1.00   15.91 ? 278  VAL B CG1 1 
ATOM   4846  C  CG2 . VAL B  1 171 ? 34.453  6.422   12.978  1.00   16.12 ? 278  VAL B CG2 1 
ATOM   4847  N  N   . SER B  1 172 ? 31.673  6.152   14.670  1.00   21.61 ? 279  SER B N   1 
ATOM   4848  C  CA  . SER B  1 172 ? 30.854  7.180   15.313  1.00   23.28 ? 279  SER B CA  1 
ATOM   4849  C  C   . SER B  1 172 ? 29.805  6.618   16.251  1.00   24.09 ? 279  SER B C   1 
ATOM   4850  O  O   . SER B  1 172 ? 29.667  7.072   17.385  1.00   21.54 ? 279  SER B O   1 
ATOM   4851  C  CB  . SER B  1 172 ? 30.127  8.017   14.256  1.00   22.26 ? 279  SER B CB  1 
ATOM   4852  O  OG  . SER B  1 172 ? 31.048  8.636   13.381  1.00   28.81 ? 279  SER B OG  1 
ATOM   4853  N  N   . GLN B  1 173 ? 29.067  5.623   15.765  1.00   25.24 ? 280  GLN B N   1 
ATOM   4854  C  CA  . GLN B  1 173 ? 27.970  5.042   16.530  1.00   27.67 ? 280  GLN B CA  1 
ATOM   4855  C  C   . GLN B  1 173 ? 28.159  3.616   17.045  1.00   27.00 ? 280  GLN B C   1 
ATOM   4856  O  O   . GLN B  1 173 ? 27.530  3.231   18.031  1.00   28.45 ? 280  GLN B O   1 
ATOM   4857  C  CB  . GLN B  1 173 ? 26.697  5.112   15.687  1.00   28.52 ? 280  GLN B CB  1 
ATOM   4858  C  CG  . GLN B  1 173 ? 26.568  6.407   14.920  1.00   36.62 ? 280  GLN B CG  1 
ATOM   4859  C  CD  . GLN B  1 173 ? 25.472  6.363   13.867  1.00   43.58 ? 280  GLN B CD  1 
ATOM   4860  O  OE1 . GLN B  1 173 ? 25.165  5.302   13.299  1.00   45.19 ? 280  GLN B OE1 1 
ATOM   4861  N  NE2 . GLN B  1 173 ? 24.888  7.522   13.584  1.00   44.78 ? 280  GLN B NE2 1 
ATOM   4862  N  N   . GLY B  1 174 ? 29.011  2.830   16.391  1.00   25.83 ? 281  GLY B N   1 
ATOM   4863  C  CA  . GLY B  1 174 ? 29.236  1.465   16.840  1.00   20.84 ? 281  GLY B CA  1 
ATOM   4864  C  C   . GLY B  1 174 ? 29.585  1.371   18.318  1.00   22.64 ? 281  GLY B C   1 
ATOM   4865  O  O   . GLY B  1 174 ? 30.024  2.350   18.931  1.00   20.88 ? 281  GLY B O   1 
ATOM   4866  N  N   . ARG B  1 175 ? 29.388  0.188   18.898  1.00   22.76 ? 282  ARG B N   1 
ATOM   4867  C  CA  . ARG B  1 175 ? 29.683  -0.045  20.315  1.00   26.09 ? 282  ARG B CA  1 
ATOM   4868  C  C   . ARG B  1 175 ? 29.149  1.067   21.209  1.00   23.59 ? 282  ARG B C   1 
ATOM   4869  O  O   . ARG B  1 175 ? 29.884  1.630   22.024  1.00   26.72 ? 282  ARG B O   1 
ATOM   4870  C  CB  . ARG B  1 175 ? 31.200  -0.189  20.549  1.00   25.97 ? 282  ARG B CB  1 
ATOM   4871  C  CG  . ARG B  1 175 ? 31.797  -1.525  20.132  1.00   28.88 ? 282  ARG B CG  1 
ATOM   4872  C  CD  . ARG B  1 175 ? 33.334  -1.466  20.117  1.00   30.57 ? 282  ARG B CD  1 
ATOM   4873  N  NE  . ARG B  1 175 ? 33.850  -1.254  21.461  1.00   32.19 ? 282  ARG B NE  1 
ATOM   4874  C  CZ  . ARG B  1 175 ? 34.701  -0.299  21.811  1.00   26.60 ? 282  ARG B CZ  1 
ATOM   4875  N  NH1 . ARG B  1 175 ? 35.168  0.566   20.919  1.00   26.30 ? 282  ARG B NH1 1 
ATOM   4876  N  NH2 . ARG B  1 175 ? 35.069  -0.203  23.076  1.00   27.78 ? 282  ARG B NH2 1 
ATOM   4877  N  N   . GLY B  1 176 ? 27.870  1.386   21.051  1.00   26.11 ? 283  GLY B N   1 
ATOM   4878  C  CA  . GLY B  1 176 ? 27.259  2.425   21.861  1.00   24.06 ? 283  GLY B CA  1 
ATOM   4879  C  C   . GLY B  1 176 ? 27.960  3.773   21.803  1.00   24.04 ? 283  GLY B C   1 
ATOM   4880  O  O   . GLY B  1 176 ? 27.981  4.502   22.794  1.00   25.06 ? 283  GLY B O   1 
ATOM   4881  N  N   . GLY B  1 177 ? 28.537  4.113   20.654  1.00   19.53 ? 284  GLY B N   1 
ATOM   4882  C  CA  . GLY B  1 177 ? 29.206  5.397   20.536  1.00   20.63 ? 284  GLY B CA  1 
ATOM   4883  C  C   . GLY B  1 177 ? 30.712  5.377   20.747  1.00   20.76 ? 284  GLY B C   1 
ATOM   4884  O  O   . GLY B  1 177 ? 31.389  6.360   20.434  1.00   22.55 ? 284  GLY B O   1 
ATOM   4885  N  N   . LEU B  1 178 ? 31.239  4.279   21.287  1.00   20.52 ? 285  LEU B N   1 
ATOM   4886  C  CA  . LEU B  1 178 ? 32.680  4.151   21.512  1.00   20.63 ? 285  LEU B CA  1 
ATOM   4887  C  C   . LEU B  1 178 ? 33.399  3.916   20.187  1.00   22.33 ? 285  LEU B C   1 
ATOM   4888  O  O   . LEU B  1 178 ? 34.590  4.203   20.062  1.00   24.04 ? 285  LEU B O   1 
ATOM   4889  C  CB  . LEU B  1 178 ? 32.970  2.996   22.460  1.00   19.60 ? 285  LEU B CB  1 
ATOM   4890  C  CG  . LEU B  1 178 ? 32.329  3.223   23.830  1.00   24.34 ? 285  LEU B CG  1 
ATOM   4891  C  CD1 . LEU B  1 178 ? 32.730  2.111   24.799  1.00   21.54 ? 285  LEU B CD1 1 
ATOM   4892  C  CD2 . LEU B  1 178 ? 32.776  4.577   24.354  1.00   18.37 ? 285  LEU B CD2 1 
ATOM   4893  N  N   . GLY B  1 179 ? 32.663  3.388   19.211  1.00   22.91 ? 286  GLY B N   1 
ATOM   4894  C  CA  . GLY B  1 179 ? 33.206  3.138   17.886  1.00   22.82 ? 286  GLY B CA  1 
ATOM   4895  C  C   . GLY B  1 179 ? 33.683  1.722   17.593  1.00   22.75 ? 286  GLY B C   1 
ATOM   4896  O  O   . GLY B  1 179 ? 34.450  1.153   18.362  1.00   23.26 ? 286  GLY B O   1 
ATOM   4897  N  N   . SER B  1 180 ? 33.224  1.168   16.471  1.00   19.95 ? 287  SER B N   1 
ATOM   4898  C  CA  . SER B  1 180 ? 33.607  -0.168  16.017  1.00   18.84 ? 287  SER B CA  1 
ATOM   4899  C  C   . SER B  1 180 ? 35.123  -0.220  15.816  1.00   17.44 ? 287  SER B C   1 
ATOM   4900  O  O   . SER B  1 180 ? 35.737  0.763   15.409  1.00   17.84 ? 287  SER B O   1 
ATOM   4901  C  CB  . SER B  1 180 ? 32.954  -0.488  14.665  1.00   18.34 ? 287  SER B CB  1 
ATOM   4902  O  OG  . SER B  1 180 ? 31.542  -0.478  14.720  1.00   20.74 ? 287  SER B OG  1 
ATOM   4903  N  N   . ILE B  1 181 ? 35.725  -1.365  16.101  1.00   18.82 ? 288  ILE B N   1 
ATOM   4904  C  CA  . ILE B  1 181 ? 37.170  -1.518  15.911  1.00   20.26 ? 288  ILE B CA  1 
ATOM   4905  C  C   . ILE B  1 181 ? 37.375  -2.290  14.605  1.00   19.23 ? 288  ILE B C   1 
ATOM   4906  O  O   . ILE B  1 181 ? 36.977  -3.455  14.521  1.00   16.75 ? 288  ILE B O   1 
ATOM   4907  C  CB  . ILE B  1 181 ? 37.826  -2.347  17.042  1.00   18.31 ? 288  ILE B CB  1 
ATOM   4908  C  CG1 . ILE B  1 181 ? 37.450  -1.784  18.411  1.00   20.00 ? 288  ILE B CG1 1 
ATOM   4909  C  CG2 . ILE B  1 181 ? 39.341  -2.371  16.842  1.00   17.33 ? 288  ILE B CG2 1 
ATOM   4910  C  CD1 . ILE B  1 181 ? 38.129  -0.488  18.735  1.00   22.75 ? 288  ILE B CD1 1 
ATOM   4911  N  N   . PHE B  1 182 ? 37.982  -1.644  13.605  1.00   18.04 ? 289  PHE B N   1 
ATOM   4912  C  CA  . PHE B  1 182 ? 38.243  -2.280  12.310  1.00   18.17 ? 289  PHE B CA  1 
ATOM   4913  C  C   . PHE B  1 182 ? 39.720  -2.645  12.149  1.00   18.29 ? 289  PHE B C   1 
ATOM   4914  O  O   . PHE B  1 182 ? 40.578  -1.766  12.030  1.00   19.70 ? 289  PHE B O   1 
ATOM   4915  C  CB  . PHE B  1 182 ? 37.838  -1.353  11.156  1.00   15.57 ? 289  PHE B CB  1 
ATOM   4916  C  CG  . PHE B  1 182 ? 36.369  -1.029  11.117  1.00   19.64 ? 289  PHE B CG  1 
ATOM   4917  C  CD1 . PHE B  1 182 ? 35.442  -1.983  10.711  1.00   18.60 ? 289  PHE B CD1 1 
ATOM   4918  C  CD2 . PHE B  1 182 ? 35.912  0.233   11.495  1.00   18.29 ? 289  PHE B CD2 1 
ATOM   4919  C  CE1 . PHE B  1 182 ? 34.083  -1.691  10.682  1.00   15.94 ? 289  PHE B CE1 1 
ATOM   4920  C  CE2 . PHE B  1 182 ? 34.549  0.532   11.466  1.00   15.35 ? 289  PHE B CE2 1 
ATOM   4921  C  CZ  . PHE B  1 182 ? 33.637  -0.437  11.058  1.00   19.41 ? 289  PHE B CZ  1 
ATOM   4922  N  N   . VAL B  1 183 ? 40.008  -3.945  12.131  1.00   20.27 ? 290  VAL B N   1 
ATOM   4923  C  CA  . VAL B  1 183 ? 41.375  -4.440  11.983  1.00   18.88 ? 290  VAL B CA  1 
ATOM   4924  C  C   . VAL B  1 183 ? 41.579  -4.897  10.542  1.00   20.18 ? 290  VAL B C   1 
ATOM   4925  O  O   . VAL B  1 183 ? 40.790  -5.688  10.025  1.00   20.05 ? 290  VAL B O   1 
ATOM   4926  C  CB  . VAL B  1 183 ? 41.631  -5.605  12.938  1.00   20.41 ? 290  VAL B CB  1 
ATOM   4927  C  CG1 . VAL B  1 183 ? 43.099  -5.999  12.900  1.00   20.82 ? 290  VAL B CG1 1 
ATOM   4928  C  CG2 . VAL B  1 183 ? 41.212  -5.202  14.349  1.00   15.89 ? 290  VAL B CG2 1 
ATOM   4929  N  N   . TRP B  1 184 ? 42.633  -4.397  9.897   1.00   18.34 ? 291  TRP B N   1 
ATOM   4930  C  CA  . TRP B  1 184 ? 42.887  -4.721  8.497   1.00   18.69 ? 291  TRP B CA  1 
ATOM   4931  C  C   . TRP B  1 184 ? 44.277  -5.298  8.219   1.00   18.18 ? 291  TRP B C   1 
ATOM   4932  O  O   . TRP B  1 184 ? 45.262  -4.864  8.810   1.00   20.98 ? 291  TRP B O   1 
ATOM   4933  C  CB  . TRP B  1 184 ? 42.680  -3.450  7.647   1.00   15.68 ? 291  TRP B CB  1 
ATOM   4934  C  CG  . TRP B  1 184 ? 41.918  -3.711  6.392   1.00   15.98 ? 291  TRP B CG  1 
ATOM   4935  C  CD1 . TRP B  1 184 ? 42.417  -4.194  5.215   1.00   15.36 ? 291  TRP B CD1 1 
ATOM   4936  C  CD2 . TRP B  1 184 ? 40.494  -3.639  6.223   1.00   17.31 ? 291  TRP B CD2 1 
ATOM   4937  N  NE1 . TRP B  1 184 ? 41.395  -4.438  4.329   1.00   16.62 ? 291  TRP B NE1 1 
ATOM   4938  C  CE2 . TRP B  1 184 ? 40.202  -4.109  4.920   1.00   18.39 ? 291  TRP B CE2 1 
ATOM   4939  C  CE3 . TRP B  1 184 ? 39.435  -3.231  7.049   1.00   14.05 ? 291  TRP B CE3 1 
ATOM   4940  C  CZ2 . TRP B  1 184 ? 38.889  -4.186  4.421   1.00   19.19 ? 291  TRP B CZ2 1 
ATOM   4941  C  CZ3 . TRP B  1 184 ? 38.125  -3.311  6.555   1.00   14.66 ? 291  TRP B CZ3 1 
ATOM   4942  C  CH2 . TRP B  1 184 ? 37.866  -3.785  5.253   1.00   16.92 ? 291  TRP B CH2 1 
ATOM   4943  N  N   . ALA B  1 185 ? 44.343  -6.279  7.322   1.00   16.15 ? 292  ALA B N   1 
ATOM   4944  C  CA  . ALA B  1 185 ? 45.609  -6.878  6.922   1.00   15.39 ? 292  ALA B CA  1 
ATOM   4945  C  C   . ALA B  1 185 ? 46.207  -5.893  5.912   1.00   15.31 ? 292  ALA B C   1 
ATOM   4946  O  O   . ALA B  1 185 ? 45.526  -5.506  4.967   1.00   19.84 ? 292  ALA B O   1 
ATOM   4947  C  CB  . ALA B  1 185 ? 45.357  -8.236  6.263   1.00   14.94 ? 292  ALA B CB  1 
ATOM   4948  N  N   . SER B  1 186 ? 47.466  -5.501  6.085   1.00   15.31 ? 293  SER B N   1 
ATOM   4949  C  CA  . SER B  1 186 ? 48.066  -4.511  5.183   1.00   18.58 ? 293  SER B CA  1 
ATOM   4950  C  C   . SER B  1 186 ? 48.324  -4.920  3.728   1.00   19.23 ? 293  SER B C   1 
ATOM   4951  O  O   . SER B  1 186 ? 48.484  -4.048  2.875   1.00   21.26 ? 293  SER B O   1 
ATOM   4952  C  CB  . SER B  1 186 ? 49.355  -3.936  5.794   1.00   16.28 ? 293  SER B CB  1 
ATOM   4953  O  OG  . SER B  1 186 ? 50.343  -4.925  5.953   1.00   20.55 ? 293  SER B OG  1 
ATOM   4954  N  N   . GLY B  1 187 ? 48.371  -6.219  3.432   1.00   18.70 ? 294  GLY B N   1 
ATOM   4955  C  CA  . GLY B  1 187 ? 48.581  -6.631  2.048   1.00   20.51 ? 294  GLY B CA  1 
ATOM   4956  C  C   . GLY B  1 187 ? 49.683  -7.640  1.737   1.00   22.20 ? 294  GLY B C   1 
ATOM   4957  O  O   . GLY B  1 187 ? 50.668  -7.776  2.484   1.00   19.50 ? 294  GLY B O   1 
ATOM   4958  N  N   . ASN B  1 188 ? 49.522  -8.347  0.618   1.00   18.96 ? 295  ASN B N   1 
ATOM   4959  C  CA  . ASN B  1 188 ? 50.500  -9.353  0.191   1.00   20.13 ? 295  ASN B CA  1 
ATOM   4960  C  C   . ASN B  1 188 ? 51.265  -8.935  -1.075  1.00   21.51 ? 295  ASN B C   1 
ATOM   4961  O  O   . ASN B  1 188 ? 51.835  -9.787  -1.759  1.00   23.16 ? 295  ASN B O   1 
ATOM   4962  C  CB  . ASN B  1 188 ? 49.810  -10.704 -0.090  1.00   18.76 ? 295  ASN B CB  1 
ATOM   4963  C  CG  . ASN B  1 188 ? 49.562  -11.538 1.175   1.00   19.51 ? 295  ASN B CG  1 
ATOM   4964  O  OD1 . ASN B  1 188 ? 50.224  -11.365 2.195   1.00   20.92 ? 295  ASN B OD1 1 
ATOM   4965  N  ND2 . ASN B  1 188 ? 48.616  -12.471 1.090   1.00   18.26 ? 295  ASN B ND2 1 
ATOM   4966  N  N   . GLY B  1 189 ? 51.298  -7.639  -1.381  1.00   18.96 ? 296  GLY B N   1 
ATOM   4967  C  CA  . GLY B  1 189 ? 51.964  -7.192  -2.594  1.00   15.99 ? 296  GLY B CA  1 
ATOM   4968  C  C   . GLY B  1 189 ? 53.463  -6.965  -2.575  1.00   18.36 ? 296  GLY B C   1 
ATOM   4969  O  O   . GLY B  1 189 ? 53.999  -6.339  -3.497  1.00   16.67 ? 296  GLY B O   1 
ATOM   4970  N  N   . GLY B  1 190 ? 54.152  -7.473  -1.556  1.00   17.09 ? 297  GLY B N   1 
ATOM   4971  C  CA  . GLY B  1 190 ? 55.593  -7.274  -1.477  1.00   19.22 ? 297  GLY B CA  1 
ATOM   4972  C  C   . GLY B  1 190 ? 56.416  -7.629  -2.709  1.00   22.07 ? 297  GLY B C   1 
ATOM   4973  O  O   . GLY B  1 190 ? 57.332  -6.897  -3.080  1.00   22.77 ? 297  GLY B O   1 
ATOM   4974  N  N   . ARG B  1 191 ? 56.105  -8.751  -3.349  1.00   24.73 ? 298  ARG B N   1 
ATOM   4975  C  CA  . ARG B  1 191 ? 56.852  -9.159  -4.528  1.00   27.26 ? 298  ARG B CA  1 
ATOM   4976  C  C   . ARG B  1 191 ? 56.597  -8.209  -5.710  1.00   26.35 ? 298  ARG B C   1 
ATOM   4977  O  O   . ARG B  1 191 ? 57.452  -8.040  -6.576  1.00   26.02 ? 298  ARG B O   1 
ATOM   4978  C  CB  . ARG B  1 191 ? 56.489  -10.605 -4.903  1.00   31.43 ? 298  ARG B CB  1 
ATOM   4979  C  CG  . ARG B  1 191 ? 57.418  -11.224 -5.932  1.00   35.83 ? 298  ARG B CG  1 
ATOM   4980  C  CD  . ARG B  1 191 ? 56.969  -12.618 -6.283  1.00   42.79 ? 298  ARG B CD  1 
ATOM   4981  N  NE  . ARG B  1 191 ? 55.534  -12.645 -6.533  1.00   49.64 ? 298  ARG B NE  1 
ATOM   4982  C  CZ  . ARG B  1 191 ? 54.825  -13.754 -6.715  1.00   54.12 ? 298  ARG B CZ  1 
ATOM   4983  N  NH1 . ARG B  1 191 ? 53.519  -13.678 -6.933  1.00   56.18 ? 298  ARG B NH1 1 
ATOM   4984  N  NH2 . ARG B  1 191 ? 55.418  -14.941 -6.681  1.00   55.98 ? 298  ARG B NH2 1 
ATOM   4985  N  N   . GLU B  1 192 ? 55.431  -7.572  -5.736  1.00   27.28 ? 299  GLU B N   1 
ATOM   4986  C  CA  . GLU B  1 192 ? 55.109  -6.639  -6.820  1.00   27.36 ? 299  GLU B CA  1 
ATOM   4987  C  C   . GLU B  1 192 ? 55.480  -5.205  -6.436  1.00   26.76 ? 299  GLU B C   1 
ATOM   4988  O  O   . GLU B  1 192 ? 55.125  -4.259  -7.138  1.00   24.79 ? 299  GLU B O   1 
ATOM   4989  C  CB  . GLU B  1 192 ? 53.611  -6.681  -7.162  1.00   28.67 ? 299  GLU B CB  1 
ATOM   4990  C  CG  . GLU B  1 192 ? 53.013  -8.064  -7.406  1.00   34.79 ? 299  GLU B CG  1 
ATOM   4991  C  CD  . GLU B  1 192 ? 54.041  -9.124  -7.739  1.00   39.34 ? 299  GLU B CD  1 
ATOM   4992  O  OE1 . GLU B  1 192 ? 54.727  -9.002  -8.774  1.00   43.34 ? 299  GLU B OE1 1 
ATOM   4993  O  OE2 . GLU B  1 192 ? 54.157  -10.086 -6.953  1.00   42.66 ? 299  GLU B OE2 1 
ATOM   4994  N  N   . HIS B  1 193 ? 56.190  -5.046  -5.321  1.00   24.37 ? 300  HIS B N   1 
ATOM   4995  C  CA  . HIS B  1 193 ? 56.589  -3.721  -4.849  1.00   25.97 ? 300  HIS B CA  1 
ATOM   4996  C  C   . HIS B  1 193 ? 55.391  -2.819  -4.567  1.00   25.00 ? 300  HIS B C   1 
ATOM   4997  O  O   . HIS B  1 193 ? 55.456  -1.605  -4.761  1.00   23.06 ? 300  HIS B O   1 
ATOM   4998  C  CB  . HIS B  1 193 ? 57.500  -3.036  -5.872  1.00   29.82 ? 300  HIS B CB  1 
ATOM   4999  C  CG  . HIS B  1 193 ? 58.841  -3.679  -5.995  1.00   35.52 ? 300  HIS B CG  1 
ATOM   5000  N  ND1 . HIS B  1 193 ? 59.016  -4.929  -6.548  1.00   39.01 ? 300  HIS B ND1 1 
ATOM   5001  C  CD2 . HIS B  1 193 ? 60.064  -3.273  -5.581  1.00   36.76 ? 300  HIS B CD2 1 
ATOM   5002  C  CE1 . HIS B  1 193 ? 60.292  -5.266  -6.469  1.00   38.95 ? 300  HIS B CE1 1 
ATOM   5003  N  NE2 . HIS B  1 193 ? 60.948  -4.279  -5.885  1.00   40.11 ? 300  HIS B NE2 1 
ATOM   5004  N  N   . ASP B  1 194 ? 54.305  -3.414  -4.094  1.00   22.64 ? 301  ASP B N   1 
ATOM   5005  C  CA  . ASP B  1 194 ? 53.095  -2.665  -3.800  1.00   22.62 ? 301  ASP B CA  1 
ATOM   5006  C  C   . ASP B  1 194 ? 53.271  -1.786  -2.550  1.00   25.51 ? 301  ASP B C   1 
ATOM   5007  O  O   . ASP B  1 194 ? 54.126  -2.044  -1.700  1.00   26.39 ? 301  ASP B O   1 
ATOM   5008  C  CB  . ASP B  1 194 ? 51.936  -3.645  -3.598  1.00   18.83 ? 301  ASP B CB  1 
ATOM   5009  C  CG  . ASP B  1 194 ? 50.571  -3.020  -3.867  1.00   19.81 ? 301  ASP B CG  1 
ATOM   5010  O  OD1 . ASP B  1 194 ? 50.509  -1.860  -4.328  1.00   18.70 ? 301  ASP B OD1 1 
ATOM   5011  O  OD2 . ASP B  1 194 ? 49.555  -3.709  -3.636  1.00   17.30 ? 301  ASP B OD2 1 
ATOM   5012  N  N   . SER B  1 195 ? 52.463  -0.737  -2.458  1.00   24.04 ? 302  SER B N   1 
ATOM   5013  C  CA  . SER B  1 195 ? 52.488  0.183   -1.320  1.00   23.96 ? 302  SER B CA  1 
ATOM   5014  C  C   . SER B  1 195 ? 51.122  0.146   -0.667  1.00   21.72 ? 302  SER B C   1 
ATOM   5015  O  O   . SER B  1 195 ? 50.107  0.352   -1.342  1.00   17.70 ? 302  SER B O   1 
ATOM   5016  C  CB  . SER B  1 195 ? 52.764  1.615   -1.785  1.00   26.52 ? 302  SER B CB  1 
ATOM   5017  O  OG  . SER B  1 195 ? 52.328  2.553   -0.813  1.00   29.93 ? 302  SER B OG  1 
ATOM   5018  N  N   . CYS B  1 196 ? 51.073  -0.100  0.638   1.00   19.04 ? 303  CYS B N   1 
ATOM   5019  C  CA  . CYS B  1 196 ? 49.768  -0.148  1.268   1.00   19.02 ? 303  CYS B CA  1 
ATOM   5020  C  C   . CYS B  1 196 ? 49.096  1.208   1.418   1.00   17.30 ? 303  CYS B C   1 
ATOM   5021  O  O   . CYS B  1 196 ? 47.993  1.289   1.944   1.00   20.59 ? 303  CYS B O   1 
ATOM   5022  C  CB  . CYS B  1 196 ? 49.805  -0.909  2.607   1.00   20.67 ? 303  CYS B CB  1 
ATOM   5023  S  SG  . CYS B  1 196 ? 51.310  -0.813  3.620   1.00   25.64 ? 303  CYS B SG  1 
ATOM   5024  N  N   . ASN B  1 197 ? 49.744  2.276   0.958   1.00   15.18 ? 304  ASN B N   1 
ATOM   5025  C  CA  . ASN B  1 197 ? 49.108  3.592   1.016   1.00   14.95 ? 304  ASN B CA  1 
ATOM   5026  C  C   . ASN B  1 197 ? 48.254  3.778   -0.232  1.00   15.87 ? 304  ASN B C   1 
ATOM   5027  O  O   . ASN B  1 197 ? 47.516  4.755   -0.342  1.00   15.81 ? 304  ASN B O   1 
ATOM   5028  C  CB  . ASN B  1 197 ? 50.136  4.729   1.122   1.00   15.40 ? 304  ASN B CB  1 
ATOM   5029  C  CG  . ASN B  1 197 ? 50.554  5.000   2.561   1.00   22.00 ? 304  ASN B CG  1 
ATOM   5030  O  OD1 . ASN B  1 197 ? 50.323  4.178   3.454   1.00   24.19 ? 304  ASN B OD1 1 
ATOM   5031  N  ND2 . ASN B  1 197 ? 51.184  6.147   2.792   1.00   21.42 ? 304  ASN B ND2 1 
ATOM   5032  N  N   . CYS B  1 198 ? 48.359  2.841   -1.174  1.00   15.60 ? 305  CYS B N   1 
ATOM   5033  C  CA  . CYS B  1 198 ? 47.560  2.898   -2.399  1.00   16.87 ? 305  CYS B CA  1 
ATOM   5034  C  C   . CYS B  1 198 ? 46.320  2.027   -2.229  1.00   18.00 ? 305  CYS B C   1 
ATOM   5035  O  O   . CYS B  1 198 ? 45.628  1.705   -3.194  1.00   18.57 ? 305  CYS B O   1 
ATOM   5036  C  CB  . CYS B  1 198 ? 48.368  2.400   -3.598  1.00   16.36 ? 305  CYS B CB  1 
ATOM   5037  S  SG  . CYS B  1 198 ? 49.655  3.557   -4.086  1.00   20.83 ? 305  CYS B SG  1 
ATOM   5038  N  N   . ASP B  1 199 ? 46.064  1.652   -0.984  1.00   17.56 ? 306  ASP B N   1 
ATOM   5039  C  CA  . ASP B  1 199 ? 44.942  0.811   -0.589  1.00   16.70 ? 306  ASP B CA  1 
ATOM   5040  C  C   . ASP B  1 199 ? 44.152  1.691   0.383   1.00   18.08 ? 306  ASP B C   1 
ATOM   5041  O  O   . ASP B  1 199 ? 44.651  2.032   1.464   1.00   17.79 ? 306  ASP B O   1 
ATOM   5042  C  CB  . ASP B  1 199 ? 45.520  -0.415  0.123   1.00   18.11 ? 306  ASP B CB  1 
ATOM   5043  C  CG  . ASP B  1 199 ? 44.467  -1.346  0.676   1.00   16.33 ? 306  ASP B CG  1 
ATOM   5044  O  OD1 . ASP B  1 199 ? 43.330  -0.910  1.010   1.00   17.06 ? 306  ASP B OD1 1 
ATOM   5045  O  OD2 . ASP B  1 199 ? 44.818  -2.534  0.800   1.00   13.94 ? 306  ASP B OD2 1 
ATOM   5046  N  N   . GLY B  1 200 ? 42.937  2.072   -0.003  1.00   17.95 ? 307  GLY B N   1 
ATOM   5047  C  CA  . GLY B  1 200 ? 42.135  2.946   0.841   1.00   15.97 ? 307  GLY B CA  1 
ATOM   5048  C  C   . GLY B  1 200 ? 41.572  2.342   2.118   1.00   15.99 ? 307  GLY B C   1 
ATOM   5049  O  O   . GLY B  1 200 ? 41.076  3.067   2.977   1.00   16.31 ? 307  GLY B O   1 
ATOM   5050  N  N   . TYR B  1 201 ? 41.616  1.018   2.245   1.00   19.19 ? 308  TYR B N   1 
ATOM   5051  C  CA  . TYR B  1 201 ? 41.106  0.371   3.455   1.00   20.09 ? 308  TYR B CA  1 
ATOM   5052  C  C   . TYR B  1 201 ? 42.186  0.441   4.537   1.00   18.24 ? 308  TYR B C   1 
ATOM   5053  O  O   . TYR B  1 201 ? 41.924  0.846   5.671   1.00   18.05 ? 308  TYR B O   1 
ATOM   5054  C  CB  . TYR B  1 201 ? 40.721  -1.097  3.180   1.00   17.76 ? 308  TYR B CB  1 
ATOM   5055  C  CG  . TYR B  1 201 ? 39.651  -1.262  2.116   1.00   18.70 ? 308  TYR B CG  1 
ATOM   5056  C  CD1 . TYR B  1 201 ? 39.976  -1.279  0.751   1.00   18.71 ? 308  TYR B CD1 1 
ATOM   5057  C  CD2 . TYR B  1 201 ? 38.306  -1.350  2.470   1.00   17.91 ? 308  TYR B CD2 1 
ATOM   5058  C  CE1 . TYR B  1 201 ? 38.977  -1.379  -0.234  1.00   17.73 ? 308  TYR B CE1 1 
ATOM   5059  C  CE2 . TYR B  1 201 ? 37.306  -1.444  1.500   1.00   20.53 ? 308  TYR B CE2 1 
ATOM   5060  C  CZ  . TYR B  1 201 ? 37.644  -1.456  0.155   1.00   17.83 ? 308  TYR B CZ  1 
ATOM   5061  O  OH  . TYR B  1 201 ? 36.636  -1.504  -0.779  1.00   18.35 ? 308  TYR B OH  1 
ATOM   5062  N  N   . THR B  1 202 ? 43.405  0.063   4.173   1.00   17.19 ? 309  THR B N   1 
ATOM   5063  C  CA  . THR B  1 202 ? 44.524  0.091   5.115   1.00   17.82 ? 309  THR B CA  1 
ATOM   5064  C  C   . THR B  1 202 ? 44.893  1.535   5.442   1.00   18.17 ? 309  THR B C   1 
ATOM   5065  O  O   . THR B  1 202 ? 45.177  1.880   6.589   1.00   16.76 ? 309  THR B O   1 
ATOM   5066  C  CB  . THR B  1 202 ? 45.759  -0.608  4.512   1.00   19.78 ? 309  THR B CB  1 
ATOM   5067  O  OG1 . THR B  1 202 ? 46.001  -0.091  3.198   1.00   19.31 ? 309  THR B OG1 1 
ATOM   5068  C  CG2 . THR B  1 202 ? 45.537  -2.108  4.411   1.00   20.04 ? 309  THR B CG2 1 
ATOM   5069  N  N   . ASN B  1 203 ? 44.863  2.371   4.413   1.00   17.61 ? 310  ASN B N   1 
ATOM   5070  C  CA  . ASN B  1 203 ? 45.205  3.796   4.487   1.00   20.00 ? 310  ASN B CA  1 
ATOM   5071  C  C   . ASN B  1 203 ? 44.223  4.637   5.338   1.00   20.12 ? 310  ASN B C   1 
ATOM   5072  O  O   . ASN B  1 203 ? 44.535  5.766   5.754   1.00   16.99 ? 310  ASN B O   1 
ATOM   5073  C  CB  . ASN B  1 203 ? 45.258  4.317   3.038   1.00   24.48 ? 310  ASN B CB  1 
ATOM   5074  C  CG  . ASN B  1 203 ? 45.990  5.629   2.887   1.00   30.11 ? 310  ASN B CG  1 
ATOM   5075  O  OD1 . ASN B  1 203 ? 47.173  5.761   3.245   1.00   31.74 ? 310  ASN B OD1 1 
ATOM   5076  N  ND2 . ASN B  1 203 ? 45.297  6.612   2.320   1.00   29.88 ? 310  ASN B ND2 1 
ATOM   5077  N  N   . SER B  1 204 ? 43.041  4.088   5.590   1.00   17.87 ? 311  SER B N   1 
ATOM   5078  C  CA  . SER B  1 204 ? 42.022  4.787   6.366   1.00   17.11 ? 311  SER B CA  1 
ATOM   5079  C  C   . SER B  1 204 ? 42.406  4.981   7.831   1.00   18.56 ? 311  SER B C   1 
ATOM   5080  O  O   . SER B  1 204 ? 43.033  4.113   8.437   1.00   17.96 ? 311  SER B O   1 
ATOM   5081  C  CB  . SER B  1 204 ? 40.710  4.014   6.299   1.00   14.28 ? 311  SER B CB  1 
ATOM   5082  O  OG  . SER B  1 204 ? 39.773  4.545   7.212   1.00   16.22 ? 311  SER B OG  1 
ATOM   5083  N  N   . ILE B  1 205 ? 42.025  6.112   8.414   1.00   18.19 ? 312  ILE B N   1 
ATOM   5084  C  CA  . ILE B  1 205 ? 42.337  6.319   9.820   1.00   18.75 ? 312  ILE B CA  1 
ATOM   5085  C  C   . ILE B  1 205 ? 41.418  5.453   10.673  1.00   17.05 ? 312  ILE B C   1 
ATOM   5086  O  O   . ILE B  1 205 ? 41.739  5.161   11.822  1.00   19.29 ? 312  ILE B O   1 
ATOM   5087  C  CB  . ILE B  1 205 ? 42.181  7.806   10.254  1.00   17.72 ? 312  ILE B CB  1 
ATOM   5088  C  CG1 . ILE B  1 205 ? 40.712  8.222   10.209  1.00   16.98 ? 312  ILE B CG1 1 
ATOM   5089  C  CG2 . ILE B  1 205 ? 43.040  8.699   9.345   1.00   14.18 ? 312  ILE B CG2 1 
ATOM   5090  C  CD1 . ILE B  1 205 ? 40.456  9.591   10.814  1.00   19.82 ? 312  ILE B CD1 1 
ATOM   5091  N  N   . TYR B  1 206 ? 40.296  5.013   10.098  1.00   15.29 ? 313  TYR B N   1 
ATOM   5092  C  CA  . TYR B  1 206 ? 39.325  4.197   10.833  1.00   16.81 ? 313  TYR B CA  1 
ATOM   5093  C  C   . TYR B  1 206 ? 39.738  2.739   11.027  1.00   17.69 ? 313  TYR B C   1 
ATOM   5094  O  O   . TYR B  1 206 ? 39.115  2.010   11.805  1.00   19.59 ? 313  TYR B O   1 
ATOM   5095  C  CB  . TYR B  1 206 ? 37.962  4.219   10.141  1.00   15.25 ? 313  TYR B CB  1 
ATOM   5096  C  CG  . TYR B  1 206 ? 37.476  5.592   9.731   1.00   17.91 ? 313  TYR B CG  1 
ATOM   5097  C  CD1 . TYR B  1 206 ? 37.476  6.662   10.626  1.00   16.42 ? 313  TYR B CD1 1 
ATOM   5098  C  CD2 . TYR B  1 206 ? 37.008  5.815   8.438   1.00   17.66 ? 313  TYR B CD2 1 
ATOM   5099  C  CE1 . TYR B  1 206 ? 37.022  7.927   10.235  1.00   14.66 ? 313  TYR B CE1 1 
ATOM   5100  C  CE2 . TYR B  1 206 ? 36.557  7.063   8.036   1.00   17.33 ? 313  TYR B CE2 1 
ATOM   5101  C  CZ  . TYR B  1 206 ? 36.564  8.118   8.931   1.00   19.90 ? 313  TYR B CZ  1 
ATOM   5102  O  OH  . TYR B  1 206 ? 36.126  9.358   8.493   1.00   20.17 ? 313  TYR B OH  1 
ATOM   5103  N  N   . THR B  1 207 ? 40.780  2.307   10.324  1.00   16.86 ? 314  THR B N   1 
ATOM   5104  C  CA  . THR B  1 207 ? 41.238  0.923   10.443  1.00   17.95 ? 314  THR B CA  1 
ATOM   5105  C  C   . THR B  1 207 ? 42.625  0.828   11.078  1.00   17.41 ? 314  THR B C   1 
ATOM   5106  O  O   . THR B  1 207 ? 43.458  1.714   10.897  1.00   17.51 ? 314  THR B O   1 
ATOM   5107  C  CB  . THR B  1 207 ? 41.353  0.236   9.052   1.00   16.91 ? 314  THR B CB  1 
ATOM   5108  O  OG1 . THR B  1 207 ? 42.413  0.852   8.304   1.00   13.98 ? 314  THR B OG1 1 
ATOM   5109  C  CG2 . THR B  1 207 ? 40.067  0.372   8.250   1.00   13.86 ? 314  THR B CG2 1 
ATOM   5110  N  N   . LEU B  1 208 ? 42.866  -0.231  11.846  1.00   18.82 ? 315  LEU B N   1 
ATOM   5111  C  CA  . LEU B  1 208 ? 44.201  -0.447  12.398  1.00   19.00 ? 315  LEU B CA  1 
ATOM   5112  C  C   . LEU B  1 208 ? 44.839  -1.390  11.387  1.00   19.30 ? 315  LEU B C   1 
ATOM   5113  O  O   . LEU B  1 208 ? 44.495  -2.574  11.333  1.00   20.23 ? 315  LEU B O   1 
ATOM   5114  C  CB  . LEU B  1 208 ? 44.162  -1.126  13.769  1.00   20.52 ? 315  LEU B CB  1 
ATOM   5115  C  CG  . LEU B  1 208 ? 43.477  -0.330  14.881  1.00   21.40 ? 315  LEU B CG  1 
ATOM   5116  C  CD1 . LEU B  1 208 ? 41.996  -0.670  14.861  1.00   21.16 ? 315  LEU B CD1 1 
ATOM   5117  C  CD2 . LEU B  1 208 ? 44.092  -0.670  16.243  1.00   20.71 ? 315  LEU B CD2 1 
ATOM   5118  N  N   . SER B  1 209 ? 45.733  -0.858  10.560  1.00   19.33 ? 316  SER B N   1 
ATOM   5119  C  CA  . SER B  1 209 ? 46.390  -1.663  9.545   1.00   17.79 ? 316  SER B CA  1 
ATOM   5120  C  C   . SER B  1 209 ? 47.553  -2.423  10.187  1.00   17.81 ? 316  SER B C   1 
ATOM   5121  O  O   . SER B  1 209 ? 48.432  -1.830  10.827  1.00   17.42 ? 316  SER B O   1 
ATOM   5122  C  CB  . SER B  1 209 ? 46.874  -0.768  8.407   1.00   16.34 ? 316  SER B CB  1 
ATOM   5123  O  OG  . SER B  1 209 ? 47.270  -1.560  7.305   1.00   23.38 ? 316  SER B OG  1 
ATOM   5124  N  N   . ILE B  1 210 ? 47.555  -3.738  10.003  1.00   15.91 ? 317  ILE B N   1 
ATOM   5125  C  CA  . ILE B  1 210 ? 48.559  -4.606  10.611  1.00   16.11 ? 317  ILE B CA  1 
ATOM   5126  C  C   . ILE B  1 210 ? 49.469  -5.328  9.614   1.00   16.66 ? 317  ILE B C   1 
ATOM   5127  O  O   . ILE B  1 210 ? 48.981  -6.000  8.706   1.00   14.34 ? 317  ILE B O   1 
ATOM   5128  C  CB  . ILE B  1 210 ? 47.851  -5.678  11.467  1.00   16.37 ? 317  ILE B CB  1 
ATOM   5129  C  CG1 . ILE B  1 210 ? 46.885  -5.005  12.451  1.00   13.85 ? 317  ILE B CG1 1 
ATOM   5130  C  CG2 . ILE B  1 210 ? 48.861  -6.502  12.194  1.00   15.36 ? 317  ILE B CG2 1 
ATOM   5131  C  CD1 . ILE B  1 210 ? 47.567  -4.199  13.519  1.00   17.30 ? 317  ILE B CD1 1 
ATOM   5132  N  N   . SER B  1 211 ? 50.784  -5.198  9.797   1.00   17.40 ? 318  SER B N   1 
ATOM   5133  C  CA  . SER B  1 211 ? 51.757  -5.869  8.933   1.00   18.30 ? 318  SER B CA  1 
ATOM   5134  C  C   . SER B  1 211 ? 52.280  -7.169  9.559   1.00   17.25 ? 318  SER B C   1 
ATOM   5135  O  O   . SER B  1 211 ? 51.870  -7.548  10.651  1.00   18.68 ? 318  SER B O   1 
ATOM   5136  C  CB  . SER B  1 211 ? 52.928  -4.940  8.613   1.00   17.35 ? 318  SER B CB  1 
ATOM   5137  O  OG  . SER B  1 211 ? 52.540  -3.993  7.639   1.00   22.23 ? 318  SER B OG  1 
ATOM   5138  N  N   . SER B  1 212 ? 53.196  -7.835  8.866   1.00   18.14 ? 319  SER B N   1 
ATOM   5139  C  CA  . SER B  1 212 ? 53.732  -9.120  9.323   1.00   19.43 ? 319  SER B CA  1 
ATOM   5140  C  C   . SER B  1 212 ? 55.248  -9.174  9.567   1.00   18.77 ? 319  SER B C   1 
ATOM   5141  O  O   . SER B  1 212 ? 56.016  -8.392  9.008   1.00   19.82 ? 319  SER B O   1 
ATOM   5142  C  CB  . SER B  1 212 ? 53.380  -10.210 8.294   1.00   19.27 ? 319  SER B CB  1 
ATOM   5143  O  OG  . SER B  1 212 ? 51.996  -10.248 7.977   1.00   16.32 ? 319  SER B OG  1 
ATOM   5144  N  N   . ALA B  1 213 ? 55.657  -10.123 10.404  1.00   16.36 ? 320  ALA B N   1 
ATOM   5145  C  CA  . ALA B  1 213 ? 57.066  -10.354 10.699  1.00   19.95 ? 320  ALA B CA  1 
ATOM   5146  C  C   . ALA B  1 213 ? 57.278  -11.874 10.657  1.00   20.21 ? 320  ALA B C   1 
ATOM   5147  O  O   . ALA B  1 213 ? 56.392  -12.625 11.057  1.00   20.66 ? 320  ALA B O   1 
ATOM   5148  C  CB  . ALA B  1 213 ? 57.417  -9.819  12.078  1.00   13.35 ? 320  ALA B CB  1 
ATOM   5149  N  N   . THR B  1 214 ? 58.425  -12.333 10.160  1.00   18.42 ? 321  THR B N   1 
ATOM   5150  C  CA  . THR B  1 214 ? 58.677  -13.773 10.126  1.00   18.67 ? 321  THR B CA  1 
ATOM   5151  C  C   . THR B  1 214 ? 59.169  -14.220 11.502  1.00   22.73 ? 321  THR B C   1 
ATOM   5152  O  O   . THR B  1 214 ? 59.518  -13.388 12.355  1.00   23.06 ? 321  THR B O   1 
ATOM   5153  C  CB  . THR B  1 214 ? 59.752  -14.169 9.093   1.00   16.03 ? 321  THR B CB  1 
ATOM   5154  O  OG1 . THR B  1 214 ? 61.032  -13.712 9.550   1.00   12.37 ? 321  THR B OG1 1 
ATOM   5155  C  CG2 . THR B  1 214 ? 59.424  -13.574 7.713   1.00   12.32 ? 321  THR B CG2 1 
ATOM   5156  N  N   . GLN B  1 215 ? 59.217  -15.531 11.716  1.00   20.90 ? 322  GLN B N   1 
ATOM   5157  C  CA  . GLN B  1 215 ? 59.644  -16.049 13.000  1.00   21.07 ? 322  GLN B CA  1 
ATOM   5158  C  C   . GLN B  1 215 ? 61.007  -15.522 13.430  1.00   21.22 ? 322  GLN B C   1 
ATOM   5159  O  O   . GLN B  1 215 ? 61.189  -15.190 14.596  1.00   23.77 ? 322  GLN B O   1 
ATOM   5160  C  CB  . GLN B  1 215 ? 59.653  -17.581 12.980  1.00   22.59 ? 322  GLN B CB  1 
ATOM   5161  C  CG  . GLN B  1 215 ? 60.211  -18.223 14.249  1.00   22.36 ? 322  GLN B CG  1 
ATOM   5162  C  CD  . GLN B  1 215 ? 60.054  -19.739 14.276  1.00   25.41 ? 322  GLN B CD  1 
ATOM   5163  O  OE1 . GLN B  1 215 ? 60.260  -20.418 13.269  1.00   27.18 ? 322  GLN B OE1 1 
ATOM   5164  N  NE2 . GLN B  1 215 ? 59.699  -20.273 15.435  1.00   24.32 ? 322  GLN B NE2 1 
ATOM   5165  N  N   . PHE B  1 216 ? 61.958  -15.437 12.504  1.00   19.64 ? 323  PHE B N   1 
ATOM   5166  C  CA  . PHE B  1 216 ? 63.290  -14.947 12.849  1.00   21.48 ? 323  PHE B CA  1 
ATOM   5167  C  C   . PHE B  1 216 ? 63.360  -13.413 12.933  1.00   22.02 ? 323  PHE B C   1 
ATOM   5168  O  O   . PHE B  1 216 ? 64.447  -12.848 13.063  1.00   22.08 ? 323  PHE B O   1 
ATOM   5169  C  CB  . PHE B  1 216 ? 64.340  -15.463 11.848  1.00   22.80 ? 323  PHE B CB  1 
ATOM   5170  C  CG  . PHE B  1 216 ? 64.409  -16.974 11.746  1.00   23.96 ? 323  PHE B CG  1 
ATOM   5171  C  CD1 . PHE B  1 216 ? 63.951  -17.787 12.784  1.00   19.69 ? 323  PHE B CD1 1 
ATOM   5172  C  CD2 . PHE B  1 216 ? 64.965  -17.582 10.617  1.00   23.38 ? 323  PHE B CD2 1 
ATOM   5173  C  CE1 . PHE B  1 216 ? 64.047  -19.181 12.698  1.00   20.23 ? 323  PHE B CE1 1 
ATOM   5174  C  CE2 . PHE B  1 216 ? 65.064  -18.974 10.523  1.00   22.95 ? 323  PHE B CE2 1 
ATOM   5175  C  CZ  . PHE B  1 216 ? 64.605  -19.773 11.565  1.00   24.21 ? 323  PHE B CZ  1 
ATOM   5176  N  N   . GLY B  1 217 ? 62.200  -12.756 12.854  1.00   19.13 ? 324  GLY B N   1 
ATOM   5177  C  CA  . GLY B  1 217 ? 62.144  -11.310 12.965  1.00   18.34 ? 324  GLY B CA  1 
ATOM   5178  C  C   . GLY B  1 217 ? 62.446  -10.505 11.717  1.00   18.32 ? 324  GLY B C   1 
ATOM   5179  O  O   . GLY B  1 217 ? 62.936  -9.384  11.817  1.00   20.59 ? 324  GLY B O   1 
ATOM   5180  N  N   . ASN B  1 218 ? 62.140  -11.047 10.546  1.00   18.91 ? 325  ASN B N   1 
ATOM   5181  C  CA  . ASN B  1 218 ? 62.419  -10.327 9.314   1.00   22.25 ? 325  ASN B CA  1 
ATOM   5182  C  C   . ASN B  1 218 ? 61.168  -9.886  8.563   1.00   21.32 ? 325  ASN B C   1 
ATOM   5183  O  O   . ASN B  1 218 ? 60.063  -10.334 8.865   1.00   22.24 ? 325  ASN B O   1 
ATOM   5184  C  CB  . ASN B  1 218 ? 63.302  -11.186 8.409   1.00   22.22 ? 325  ASN B CB  1 
ATOM   5185  C  CG  . ASN B  1 218 ? 64.684  -11.364 8.980   1.00   25.40 ? 325  ASN B CG  1 
ATOM   5186  O  OD1 . ASN B  1 218 ? 65.375  -10.386 9.264   1.00   25.60 ? 325  ASN B OD1 1 
ATOM   5187  N  ND2 . ASN B  1 218 ? 65.093  -12.615 9.171   1.00   24.62 ? 325  ASN B ND2 1 
ATOM   5188  N  N   . VAL B  1 219 ? 61.356  -9.001  7.590   1.00   18.30 ? 326  VAL B N   1 
ATOM   5189  C  CA  . VAL B  1 219 ? 60.269  -8.510  6.765   1.00   18.70 ? 326  VAL B CA  1 
ATOM   5190  C  C   . VAL B  1 219 ? 59.979  -9.591  5.726   1.00   18.61 ? 326  VAL B C   1 
ATOM   5191  O  O   . VAL B  1 219 ? 60.804  -9.862  4.856   1.00   19.91 ? 326  VAL B O   1 
ATOM   5192  C  CB  . VAL B  1 219 ? 60.679  -7.208  6.047   1.00   20.50 ? 326  VAL B CB  1 
ATOM   5193  C  CG1 . VAL B  1 219 ? 59.536  -6.703  5.156   1.00   12.49 ? 326  VAL B CG1 1 
ATOM   5194  C  CG2 . VAL B  1 219 ? 61.090  -6.165  7.090   1.00   15.08 ? 326  VAL B CG2 1 
ATOM   5195  N  N   . PRO B  1 220 ? 58.793  -10.209 5.800   1.00   18.18 ? 327  PRO B N   1 
ATOM   5196  C  CA  . PRO B  1 220 ? 58.396  -11.275 4.865   1.00   18.26 ? 327  PRO B CA  1 
ATOM   5197  C  C   . PRO B  1 220 ? 58.405  -10.831 3.403   1.00   19.41 ? 327  PRO B C   1 
ATOM   5198  O  O   . PRO B  1 220 ? 58.210  -9.648  3.096   1.00   17.67 ? 327  PRO B O   1 
ATOM   5199  C  CB  . PRO B  1 220 ? 56.983  -11.643 5.323   1.00   14.93 ? 327  PRO B CB  1 
ATOM   5200  C  CG  . PRO B  1 220 ? 56.881  -11.103 6.728   1.00   15.98 ? 327  PRO B CG  1 
ATOM   5201  C  CD  . PRO B  1 220 ? 57.661  -9.818  6.657   1.00   16.64 ? 327  PRO B CD  1 
ATOM   5202  N  N   . TRP B  1 221 ? 58.597  -11.788 2.500   1.00   19.38 ? 328  TRP B N   1 
ATOM   5203  C  CA  . TRP B  1 221 ? 58.620  -11.472 1.075   1.00   19.23 ? 328  TRP B CA  1 
ATOM   5204  C  C   . TRP B  1 221 ? 57.338  -10.791 0.585   1.00   19.07 ? 328  TRP B C   1 
ATOM   5205  O  O   . TRP B  1 221 ? 57.380  -9.952  -0.308  1.00   20.44 ? 328  TRP B O   1 
ATOM   5206  C  CB  . TRP B  1 221 ? 58.866  -12.741 0.246   1.00   18.30 ? 328  TRP B CB  1 
ATOM   5207  C  CG  . TRP B  1 221 ? 57.772  -13.757 0.318   1.00   17.36 ? 328  TRP B CG  1 
ATOM   5208  C  CD1 . TRP B  1 221 ? 57.633  -14.764 1.246   1.00   17.50 ? 328  TRP B CD1 1 
ATOM   5209  C  CD2 . TRP B  1 221 ? 56.638  -13.850 -0.544  1.00   16.99 ? 328  TRP B CD2 1 
ATOM   5210  N  NE1 . TRP B  1 221 ? 56.484  -15.471 1.007   1.00   19.41 ? 328  TRP B NE1 1 
ATOM   5211  C  CE2 . TRP B  1 221 ? 55.852  -14.933 -0.084  1.00   19.47 ? 328  TRP B CE2 1 
ATOM   5212  C  CE3 . TRP B  1 221 ? 56.203  -13.120 -1.659  1.00   20.89 ? 328  TRP B CE3 1 
ATOM   5213  C  CZ2 . TRP B  1 221 ? 54.649  -15.306 -0.706  1.00   23.37 ? 328  TRP B CZ2 1 
ATOM   5214  C  CZ3 . TRP B  1 221 ? 55.005  -13.489 -2.277  1.00   22.73 ? 328  TRP B CZ3 1 
ATOM   5215  C  CH2 . TRP B  1 221 ? 54.242  -14.576 -1.794  1.00   21.21 ? 328  TRP B CH2 1 
ATOM   5216  N  N   . TYR B  1 222 ? 56.203  -11.150 1.172   1.00   17.18 ? 329  TYR B N   1 
ATOM   5217  C  CA  . TYR B  1 222 ? 54.908  -10.600 0.760   1.00   19.27 ? 329  TYR B CA  1 
ATOM   5218  C  C   . TYR B  1 222 ? 54.546  -9.242  1.367   1.00   20.63 ? 329  TYR B C   1 
ATOM   5219  O  O   . TYR B  1 222 ? 53.575  -8.619  0.968   1.00   20.56 ? 329  TYR B O   1 
ATOM   5220  C  CB  . TYR B  1 222 ? 53.788  -11.616 1.078   1.00   15.88 ? 329  TYR B CB  1 
ATOM   5221  C  CG  . TYR B  1 222 ? 53.762  -12.070 2.530   1.00   16.71 ? 329  TYR B CG  1 
ATOM   5222  C  CD1 . TYR B  1 222 ? 53.152  -11.291 3.514   1.00   13.52 ? 329  TYR B CD1 1 
ATOM   5223  C  CD2 . TYR B  1 222 ? 54.421  -13.246 2.929   1.00   16.37 ? 329  TYR B CD2 1 
ATOM   5224  C  CE1 . TYR B  1 222 ? 53.197  -11.661 4.859   1.00   14.72 ? 329  TYR B CE1 1 
ATOM   5225  C  CE2 . TYR B  1 222 ? 54.477  -13.627 4.276   1.00   14.44 ? 329  TYR B CE2 1 
ATOM   5226  C  CZ  . TYR B  1 222 ? 53.862  -12.825 5.235   1.00   17.85 ? 329  TYR B CZ  1 
ATOM   5227  O  OH  . TYR B  1 222 ? 53.915  -13.175 6.566   1.00   17.06 ? 329  TYR B OH  1 
ATOM   5228  N  N   . SER B  1 223 ? 55.354  -8.779  2.307   1.00   21.86 ? 330  SER B N   1 
ATOM   5229  C  CA  . SER B  1 223 ? 55.098  -7.533  3.007   1.00   22.31 ? 330  SER B CA  1 
ATOM   5230  C  C   . SER B  1 223 ? 55.103  -6.251  2.176   1.00   20.85 ? 330  SER B C   1 
ATOM   5231  O  O   . SER B  1 223 ? 55.975  -6.046  1.337   1.00   20.20 ? 330  SER B O   1 
ATOM   5232  C  CB  . SER B  1 223 ? 56.110  -7.393  4.155   1.00   23.28 ? 330  SER B CB  1 
ATOM   5233  O  OG  . SER B  1 223 ? 55.988  -6.141  4.818   1.00   28.34 ? 330  SER B OG  1 
ATOM   5234  N  N   . GLU B  1 224 ? 54.132  -5.379  2.432   1.00   18.98 ? 331  GLU B N   1 
ATOM   5235  C  CA  . GLU B  1 224 ? 54.080  -4.092  1.742   1.00   18.70 ? 331  GLU B CA  1 
ATOM   5236  C  C   . GLU B  1 224 ? 54.441  -3.020  2.759   1.00   19.28 ? 331  GLU B C   1 
ATOM   5237  O  O   . GLU B  1 224 ? 53.935  -3.026  3.885   1.00   18.44 ? 331  GLU B O   1 
ATOM   5238  C  CB  . GLU B  1 224 ? 52.680  -3.788  1.193   1.00   17.25 ? 331  GLU B CB  1 
ATOM   5239  C  CG  . GLU B  1 224 ? 52.102  -4.840  0.264   1.00   18.66 ? 331  GLU B CG  1 
ATOM   5240  C  CD  . GLU B  1 224 ? 50.765  -4.420  -0.348  1.00   18.26 ? 331  GLU B CD  1 
ATOM   5241  O  OE1 . GLU B  1 224 ? 49.988  -5.315  -0.742  1.00   16.91 ? 331  GLU B OE1 1 
ATOM   5242  O  OE2 . GLU B  1 224 ? 50.495  -3.197  -0.440  1.00   20.92 ? 331  GLU B OE2 1 
ATOM   5243  N  N   . ALA B  1 225 ? 55.317  -2.101  2.364   1.00   18.30 ? 332  ALA B N   1 
ATOM   5244  C  CA  . ALA B  1 225 ? 55.717  -1.010  3.238   1.00   20.04 ? 332  ALA B CA  1 
ATOM   5245  C  C   . ALA B  1 225 ? 54.897  0.252   2.940   1.00   20.23 ? 332  ALA B C   1 
ATOM   5246  O  O   . ALA B  1 225 ? 54.544  0.517   1.786   1.00   20.50 ? 332  ALA B O   1 
ATOM   5247  C  CB  . ALA B  1 225 ? 57.197  -0.710  3.043   1.00   17.80 ? 332  ALA B CB  1 
ATOM   5248  N  N   . CYS B  1 226 ? 54.599  1.021   3.984   1.00   17.79 ? 333  CYS B N   1 
ATOM   5249  C  CA  . CYS B  1 226 ? 53.853  2.270   3.843   1.00   20.79 ? 333  CYS B CA  1 
ATOM   5250  C  C   . CYS B  1 226 ? 53.762  2.923   5.215   1.00   18.48 ? 333  CYS B C   1 
ATOM   5251  O  O   . CYS B  1 226 ? 53.952  2.269   6.245   1.00   17.97 ? 333  CYS B O   1 
ATOM   5252  C  CB  . CYS B  1 226 ? 52.441  2.036   3.248   1.00   20.54 ? 333  CYS B CB  1 
ATOM   5253  S  SG  . CYS B  1 226 ? 51.305  1.105   4.329   1.00   26.27 ? 333  CYS B SG  1 
ATOM   5254  N  N   . SER B  1 227 ? 53.479  4.214   5.231   1.00   19.04 ? 334  SER B N   1 
ATOM   5255  C  CA  . SER B  1 227 ? 53.392  4.960   6.479   1.00   18.25 ? 334  SER B CA  1 
ATOM   5256  C  C   . SER B  1 227 ? 52.067  4.825   7.215   1.00   17.89 ? 334  SER B C   1 
ATOM   5257  O  O   . SER B  1 227 ? 51.961  5.260   8.357   1.00   19.71 ? 334  SER B O   1 
ATOM   5258  C  CB  . SER B  1 227 ? 53.669  6.444   6.218   1.00   17.60 ? 334  SER B CB  1 
ATOM   5259  O  OG  . SER B  1 227 ? 52.742  6.963   5.284   1.00   17.82 ? 334  SER B OG  1 
ATOM   5260  N  N   . SER B  1 228 ? 51.059  4.234   6.580   1.00   18.07 ? 335  SER B N   1 
ATOM   5261  C  CA  . SER B  1 228 ? 49.754  4.099   7.233   1.00   20.23 ? 335  SER B CA  1 
ATOM   5262  C  C   . SER B  1 228 ? 49.646  2.904   8.192   1.00   20.14 ? 335  SER B C   1 
ATOM   5263  O  O   . SER B  1 228 ? 48.732  2.854   9.029   1.00   18.92 ? 335  SER B O   1 
ATOM   5264  C  CB  . SER B  1 228 ? 48.629  4.031   6.185   1.00   19.93 ? 335  SER B CB  1 
ATOM   5265  O  OG  . SER B  1 228 ? 48.761  2.901   5.341   1.00   21.72 ? 335  SER B OG  1 
ATOM   5266  N  N   . THR B  1 229 ? 50.574  1.952   8.071   1.00   19.56 ? 336  THR B N   1 
ATOM   5267  C  CA  . THR B  1 229 ? 50.586  0.767   8.928   1.00   17.57 ? 336  THR B CA  1 
ATOM   5268  C  C   . THR B  1 229 ? 50.791  1.201   10.381  1.00   17.86 ? 336  THR B C   1 
ATOM   5269  O  O   . THR B  1 229 ? 51.585  2.101   10.669  1.00   18.78 ? 336  THR B O   1 
ATOM   5270  C  CB  . THR B  1 229 ? 51.719  -0.215  8.499   1.00   16.82 ? 336  THR B CB  1 
ATOM   5271  O  OG1 . THR B  1 229 ? 51.382  -0.810  7.244   1.00   19.02 ? 336  THR B OG1 1 
ATOM   5272  C  CG2 . THR B  1 229 ? 51.914  -1.311  9.522   1.00   19.29 ? 336  THR B CG2 1 
ATOM   5273  N  N   . LEU B  1 230 ? 50.078  0.561   11.296  1.00   16.59 ? 337  LEU B N   1 
ATOM   5274  C  CA  . LEU B  1 230 ? 50.176  0.925   12.707  1.00   19.44 ? 337  LEU B CA  1 
ATOM   5275  C  C   . LEU B  1 230 ? 51.072  0.001   13.541  1.00   20.19 ? 337  LEU B C   1 
ATOM   5276  O  O   . LEU B  1 230 ? 51.891  0.471   14.334  1.00   19.86 ? 337  LEU B O   1 
ATOM   5277  C  CB  . LEU B  1 230 ? 48.769  0.980   13.321  1.00   18.01 ? 337  LEU B CB  1 
ATOM   5278  C  CG  . LEU B  1 230 ? 48.600  1.774   14.621  1.00   18.19 ? 337  LEU B CG  1 
ATOM   5279  C  CD1 . LEU B  1 230 ? 49.008  3.217   14.389  1.00   20.57 ? 337  LEU B CD1 1 
ATOM   5280  C  CD2 . LEU B  1 230 ? 47.151  1.710   15.091  1.00   18.05 ? 337  LEU B CD2 1 
ATOM   5281  N  N   . ALA B  1 231 ? 50.917  -1.307  13.366  1.00   19.11 ? 338  ALA B N   1 
ATOM   5282  C  CA  . ALA B  1 231 ? 51.715  -2.274  14.111  1.00   18.91 ? 338  ALA B CA  1 
ATOM   5283  C  C   . ALA B  1 231 ? 51.876  -3.592  13.361  1.00   19.17 ? 338  ALA B C   1 
ATOM   5284  O  O   . ALA B  1 231 ? 51.404  -3.746  12.226  1.00   17.76 ? 338  ALA B O   1 
ATOM   5285  C  CB  . ALA B  1 231 ? 51.094  -2.523  15.486  1.00   19.71 ? 338  ALA B CB  1 
ATOM   5286  N  N   . THR B  1 232 ? 52.506  -4.555  14.029  1.00   18.11 ? 339  THR B N   1 
ATOM   5287  C  CA  . THR B  1 232 ? 52.814  -5.843  13.426  1.00   18.19 ? 339  THR B CA  1 
ATOM   5288  C  C   . THR B  1 232 ? 52.520  -7.055  14.314  1.00   20.38 ? 339  THR B C   1 
ATOM   5289  O  O   . THR B  1 232 ? 52.533  -6.958  15.541  1.00   22.22 ? 339  THR B O   1 
ATOM   5290  C  CB  . THR B  1 232 ? 54.321  -5.880  13.094  1.00   18.58 ? 339  THR B CB  1 
ATOM   5291  O  OG1 . THR B  1 232 ? 54.649  -4.800  12.207  1.00   17.81 ? 339  THR B OG1 1 
ATOM   5292  C  CG2 . THR B  1 232 ? 54.718  -7.222  12.486  1.00   16.96 ? 339  THR B CG2 1 
ATOM   5293  N  N   . THR B  1 233 ? 52.237  -8.191  13.680  1.00   19.32 ? 340  THR B N   1 
ATOM   5294  C  CA  . THR B  1 233 ? 52.061  -9.452  14.394  1.00   20.33 ? 340  THR B CA  1 
ATOM   5295  C  C   . THR B  1 233 ? 52.796  -10.476 13.535  1.00   22.51 ? 340  THR B C   1 
ATOM   5296  O  O   . THR B  1 233 ? 53.025  -10.256 12.345  1.00   23.41 ? 340  THR B O   1 
ATOM   5297  C  CB  . THR B  1 233 ? 50.593  -9.923  14.532  1.00   21.52 ? 340  THR B CB  1 
ATOM   5298  O  OG1 . THR B  1 233 ? 50.044  -10.147 13.235  1.00   24.04 ? 340  THR B OG1 1 
ATOM   5299  C  CG2 . THR B  1 233 ? 49.750  -8.910  15.314  1.00   20.93 ? 340  THR B CG2 1 
ATOM   5300  N  N   . TYR B  1 234 ? 53.182  -11.588 14.141  1.00   22.40 ? 341  TYR B N   1 
ATOM   5301  C  CA  . TYR B  1 234 ? 53.890  -12.630 13.424  1.00   21.86 ? 341  TYR B CA  1 
ATOM   5302  C  C   . TYR B  1 234 ? 53.056  -13.340 12.377  1.00   22.89 ? 341  TYR B C   1 
ATOM   5303  O  O   . TYR B  1 234 ? 51.832  -13.446 12.497  1.00   22.61 ? 341  TYR B O   1 
ATOM   5304  C  CB  . TYR B  1 234 ? 54.390  -13.682 14.406  1.00   21.19 ? 341  TYR B CB  1 
ATOM   5305  C  CG  . TYR B  1 234 ? 55.567  -13.239 15.218  1.00   19.48 ? 341  TYR B CG  1 
ATOM   5306  C  CD1 . TYR B  1 234 ? 56.791  -13.023 14.612  1.00   18.98 ? 341  TYR B CD1 1 
ATOM   5307  C  CD2 . TYR B  1 234 ? 55.464  -13.055 16.591  1.00   19.40 ? 341  TYR B CD2 1 
ATOM   5308  C  CE1 . TYR B  1 234 ? 57.890  -12.637 15.341  1.00   19.81 ? 341  TYR B CE1 1 
ATOM   5309  C  CE2 . TYR B  1 234 ? 56.560  -12.669 17.339  1.00   16.98 ? 341  TYR B CE2 1 
ATOM   5310  C  CZ  . TYR B  1 234 ? 57.774  -12.460 16.705  1.00   19.68 ? 341  TYR B CZ  1 
ATOM   5311  O  OH  . TYR B  1 234 ? 58.884  -12.054 17.414  1.00   21.61 ? 341  TYR B OH  1 
ATOM   5312  N  N   . SER B  1 235 ? 53.741  -13.825 11.348  1.00   23.86 ? 342  SER B N   1 
ATOM   5313  C  CA  . SER B  1 235 ? 53.114  -14.616 10.304  1.00   22.57 ? 342  SER B CA  1 
ATOM   5314  C  C   . SER B  1 235 ? 54.188  -15.531 9.708   1.00   21.48 ? 342  SER B C   1 
ATOM   5315  O  O   . SER B  1 235 ? 55.176  -15.824 10.374  1.00   22.19 ? 342  SER B O   1 
ATOM   5316  C  CB  . SER B  1 235 ? 52.484  -13.739 9.230   1.00   23.50 ? 342  SER B CB  1 
ATOM   5317  O  OG  . SER B  1 235 ? 51.591  -14.522 8.444   1.00   23.78 ? 342  SER B OG  1 
ATOM   5318  N  N   . SER B  1 236 ? 54.003  -15.973 8.463   1.00   21.83 ? 343  SER B N   1 
ATOM   5319  C  CA  . SER B  1 236 ? 54.950  -16.877 7.814   1.00   19.50 ? 343  SER B CA  1 
ATOM   5320  C  C   . SER B  1 236 ? 56.152  -16.193 7.163   1.00   18.77 ? 343  SER B C   1 
ATOM   5321  O  O   . SER B  1 236 ? 56.152  -14.985 6.929   1.00   17.03 ? 343  SER B O   1 
ATOM   5322  C  CB  . SER B  1 236 ? 54.221  -17.726 6.762   1.00   21.30 ? 343  SER B CB  1 
ATOM   5323  O  OG  . SER B  1 236 ? 53.675  -16.922 5.729   1.00   21.50 ? 343  SER B OG  1 
ATOM   5324  N  N   . GLY B  1 237 ? 57.172  -16.994 6.874   1.00   18.68 ? 344  GLY B N   1 
ATOM   5325  C  CA  . GLY B  1 237 ? 58.385  -16.498 6.240   1.00   19.25 ? 344  GLY B CA  1 
ATOM   5326  C  C   . GLY B  1 237 ? 58.921  -17.559 5.290   1.00   21.07 ? 344  GLY B C   1 
ATOM   5327  O  O   . GLY B  1 237 ? 58.184  -18.041 4.426   1.00   20.18 ? 344  GLY B O   1 
ATOM   5328  N  N   . ASN B  1 238 ? 60.190  -17.939 5.439   1.00   22.46 ? 345  ASN B N   1 
ATOM   5329  C  CA  . ASN B  1 238 ? 60.771  -18.962 4.571   1.00   21.12 ? 345  ASN B CA  1 
ATOM   5330  C  C   . ASN B  1 238 ? 60.424  -20.362 5.088   1.00   23.92 ? 345  ASN B C   1 
ATOM   5331  O  O   . ASN B  1 238 ? 59.720  -20.510 6.089   1.00   22.78 ? 345  ASN B O   1 
ATOM   5332  C  CB  . ASN B  1 238 ? 62.301  -18.786 4.435   1.00   21.70 ? 345  ASN B CB  1 
ATOM   5333  C  CG  . ASN B  1 238 ? 63.040  -18.845 5.776   1.00   23.13 ? 345  ASN B CG  1 
ATOM   5334  O  OD1 . ASN B  1 238 ? 62.784  -19.719 6.611   1.00   20.58 ? 345  ASN B OD1 1 
ATOM   5335  N  ND2 . ASN B  1 238 ? 63.983  -17.924 5.971   1.00   21.11 ? 345  ASN B ND2 1 
ATOM   5336  N  N   . GLN B  1 239 ? 60.922  -21.399 4.424   1.00   23.48 ? 346  GLN B N   1 
ATOM   5337  C  CA  . GLN B  1 239 ? 60.556  -22.743 4.843   1.00   24.42 ? 346  GLN B CA  1 
ATOM   5338  C  C   . GLN B  1 239 ? 61.257  -23.276 6.088   1.00   25.94 ? 346  GLN B C   1 
ATOM   5339  O  O   . GLN B  1 239 ? 60.958  -24.374 6.542   1.00   25.62 ? 346  GLN B O   1 
ATOM   5340  C  CB  . GLN B  1 239 ? 60.683  -23.714 3.661   1.00   22.97 ? 346  GLN B CB  1 
ATOM   5341  C  CG  . GLN B  1 239 ? 59.834  -23.278 2.462   1.00   22.38 ? 346  GLN B CG  1 
ATOM   5342  C  CD  . GLN B  1 239 ? 59.777  -24.308 1.338   1.00   21.25 ? 346  GLN B CD  1 
ATOM   5343  O  OE1 . GLN B  1 239 ? 59.706  -23.955 0.160   1.00   22.04 ? 346  GLN B OE1 1 
ATOM   5344  N  NE2 . GLN B  1 239 ? 59.790  -25.579 1.698   1.00   17.95 ? 346  GLN B NE2 1 
ATOM   5345  N  N   . ASN B  1 240 ? 62.180  -22.501 6.648   1.00   26.82 ? 347  ASN B N   1 
ATOM   5346  C  CA  . ASN B  1 240 ? 62.851  -22.911 7.880   1.00   26.28 ? 347  ASN B CA  1 
ATOM   5347  C  C   . ASN B  1 240 ? 62.135  -22.252 9.066   1.00   26.55 ? 347  ASN B C   1 
ATOM   5348  O  O   . ASN B  1 240 ? 62.418  -22.556 10.221  1.00   26.85 ? 347  ASN B O   1 
ATOM   5349  C  CB  . ASN B  1 240 ? 64.314  -22.480 7.886   1.00   26.34 ? 347  ASN B CB  1 
ATOM   5350  C  CG  . ASN B  1 240 ? 65.116  -23.127 6.786   1.00   29.52 ? 347  ASN B CG  1 
ATOM   5351  O  OD1 . ASN B  1 240 ? 65.320  -22.543 5.725   1.00   36.48 ? 347  ASN B OD1 1 
ATOM   5352  N  ND2 . ASN B  1 240 ? 65.569  -24.346 7.027   1.00   29.99 ? 347  ASN B ND2 1 
ATOM   5353  N  N   . GLU B  1 241 ? 61.211  -21.344 8.766   1.00   23.13 ? 348  GLU B N   1 
ATOM   5354  C  CA  . GLU B  1 241 ? 60.467  -20.632 9.790   1.00   22.40 ? 348  GLU B CA  1 
ATOM   5355  C  C   . GLU B  1 241 ? 59.081  -21.226 9.938   1.00   22.43 ? 348  GLU B C   1 
ATOM   5356  O  O   . GLU B  1 241 ? 58.469  -21.632 8.958   1.00   22.11 ? 348  GLU B O   1 
ATOM   5357  C  CB  . GLU B  1 241 ? 60.378  -19.142 9.428   1.00   18.62 ? 348  GLU B CB  1 
ATOM   5358  C  CG  . GLU B  1 241 ? 61.727  -18.443 9.518   1.00   19.91 ? 348  GLU B CG  1 
ATOM   5359  C  CD  . GLU B  1 241 ? 61.727  -17.039 8.930   1.00   21.06 ? 348  GLU B CD  1 
ATOM   5360  O  OE1 . GLU B  1 241 ? 62.154  -16.101 9.643   1.00   22.98 ? 348  GLU B OE1 1 
ATOM   5361  O  OE2 . GLU B  1 241 ? 61.317  -16.875 7.756   1.00   21.84 ? 348  GLU B OE2 1 
ATOM   5362  N  N   . LYS B  1 242 ? 58.589  -21.285 11.169  1.00   22.95 ? 349  LYS B N   1 
ATOM   5363  C  CA  . LYS B  1 242 ? 57.261  -21.838 11.413  1.00   24.34 ? 349  LYS B CA  1 
ATOM   5364  C  C   . LYS B  1 242 ? 56.165  -20.901 10.905  1.00   23.44 ? 349  LYS B C   1 
ATOM   5365  O  O   . LYS B  1 242 ? 56.415  -19.727 10.614  1.00   21.47 ? 349  LYS B O   1 
ATOM   5366  C  CB  . LYS B  1 242 ? 57.040  -22.107 12.907  1.00   29.29 ? 349  LYS B CB  1 
ATOM   5367  C  CG  . LYS B  1 242 ? 58.149  -22.877 13.642  1.00   33.73 ? 349  LYS B CG  1 
ATOM   5368  C  CD  . LYS B  1 242 ? 58.872  -23.922 12.785  1.00   41.88 ? 349  LYS B CD  1 
ATOM   5369  C  CE  . LYS B  1 242 ? 58.002  -25.116 12.416  1.00   45.25 ? 349  LYS B CE  1 
ATOM   5370  N  NZ  . LYS B  1 242 ? 58.826  -26.210 11.829  0.0000 43.93 ? 349  LYS B NZ  1 
ATOM   5371  N  N   . GLN B  1 243 ? 54.948  -21.427 10.806  1.00   21.63 ? 350  GLN B N   1 
ATOM   5372  C  CA  . GLN B  1 243 ? 53.818  -20.646 10.318  1.00   22.84 ? 350  GLN B CA  1 
ATOM   5373  C  C   . GLN B  1 243 ? 52.677  -20.610 11.334  1.00   21.92 ? 350  GLN B C   1 
ATOM   5374  O  O   . GLN B  1 243 ? 52.873  -20.949 12.497  1.00   21.01 ? 350  GLN B O   1 
ATOM   5375  C  CB  . GLN B  1 243 ? 53.358  -21.210 8.965   1.00   21.19 ? 350  GLN B CB  1 
ATOM   5376  C  CG  . GLN B  1 243 ? 54.515  -21.293 7.975   1.00   20.57 ? 350  GLN B CG  1 
ATOM   5377  C  CD  . GLN B  1 243 ? 54.109  -21.764 6.594   1.00   24.08 ? 350  GLN B CD  1 
ATOM   5378  O  OE1 . GLN B  1 243 ? 53.174  -22.545 6.445   1.00   28.46 ? 350  GLN B OE1 1 
ATOM   5379  N  NE2 . GLN B  1 243 ? 54.830  -21.300 5.570   1.00   23.47 ? 350  GLN B NE2 1 
ATOM   5380  N  N   . ILE B  1 244 ? 51.490  -20.197 10.906  1.00   22.28 ? 351  ILE B N   1 
ATOM   5381  C  CA  . ILE B  1 244 ? 50.367  -20.100 11.831  1.00   22.29 ? 351  ILE B CA  1 
ATOM   5382  C  C   . ILE B  1 244 ? 49.511  -21.365 11.910  1.00   23.43 ? 351  ILE B C   1 
ATOM   5383  O  O   . ILE B  1 244 ? 49.104  -21.923 10.895  1.00   24.98 ? 351  ILE B O   1 
ATOM   5384  C  CB  . ILE B  1 244 ? 49.471  -18.889 11.486  1.00   21.39 ? 351  ILE B CB  1 
ATOM   5385  C  CG1 . ILE B  1 244 ? 50.286  -17.594 11.557  1.00   22.21 ? 351  ILE B CG1 1 
ATOM   5386  C  CG2 . ILE B  1 244 ? 48.315  -18.802 12.451  1.00   23.99 ? 351  ILE B CG2 1 
ATOM   5387  C  CD1 . ILE B  1 244 ? 51.276  -17.520 12.701  1.00   22.70 ? 351  ILE B CD1 1 
ATOM   5388  N  N   . VAL B  1 245 ? 49.242  -21.796 13.140  1.00   21.79 ? 352  VAL B N   1 
ATOM   5389  C  CA  . VAL B  1 245 ? 48.456  -22.993 13.423  1.00   21.85 ? 352  VAL B CA  1 
ATOM   5390  C  C   . VAL B  1 245 ? 47.035  -22.586 13.767  1.00   24.06 ? 352  VAL B C   1 
ATOM   5391  O  O   . VAL B  1 245 ? 46.806  -21.843 14.726  1.00   23.58 ? 352  VAL B O   1 
ATOM   5392  C  CB  . VAL B  1 245 ? 49.045  -23.759 14.627  1.00   25.32 ? 352  VAL B CB  1 
ATOM   5393  C  CG1 . VAL B  1 245 ? 48.161  -24.948 14.979  1.00   24.31 ? 352  VAL B CG1 1 
ATOM   5394  C  CG2 . VAL B  1 245 ? 50.468  -24.210 14.309  1.00   25.19 ? 352  VAL B CG2 1 
ATOM   5395  N  N   . THR B  1 246 ? 46.072  -23.091 13.004  1.00   22.98 ? 353  THR B N   1 
ATOM   5396  C  CA  . THR B  1 246 ? 44.691  -22.719 13.241  1.00   23.29 ? 353  THR B CA  1 
ATOM   5397  C  C   . THR B  1 246 ? 43.699  -23.755 12.698  1.00   25.60 ? 353  THR B C   1 
ATOM   5398  O  O   . THR B  1 246 ? 44.087  -24.796 12.171  1.00   26.72 ? 353  THR B O   1 
ATOM   5399  C  CB  . THR B  1 246 ? 44.426  -21.309 12.609  1.00   23.85 ? 353  THR B CB  1 
ATOM   5400  O  OG1 . THR B  1 246 ? 43.104  -20.866 12.925  1.00   21.71 ? 353  THR B OG1 1 
ATOM   5401  C  CG2 . THR B  1 246 ? 44.604  -21.350 11.086  1.00   18.25 ? 353  THR B CG2 1 
ATOM   5402  N  N   . THR B  1 247 ? 42.415  -23.456 12.845  1.00   27.67 ? 354  THR B N   1 
ATOM   5403  C  CA  . THR B  1 247 ? 41.339  -24.319 12.373  1.00   28.01 ? 354  THR B CA  1 
ATOM   5404  C  C   . THR B  1 247 ? 41.252  -24.258 10.851  1.00   29.97 ? 354  THR B C   1 
ATOM   5405  O  O   . THR B  1 247 ? 41.365  -23.181 10.260  1.00   29.09 ? 354  THR B O   1 
ATOM   5406  C  CB  . THR B  1 247 ? 39.994  -23.855 12.944  1.00   29.85 ? 354  THR B CB  1 
ATOM   5407  O  OG1 . THR B  1 247 ? 39.875  -22.431 12.777  1.00   27.40 ? 354  THR B OG1 1 
ATOM   5408  C  CG2 . THR B  1 247 ? 39.887  -24.211 14.422  1.00   26.32 ? 354  THR B CG2 1 
ATOM   5409  N  N   . ASP B  1 248 ? 41.047  -25.408 10.220  1.00   26.83 ? 355  ASP B N   1 
ATOM   5410  C  CA  . ASP B  1 248 ? 40.942  -25.461 8.768   1.00   25.72 ? 355  ASP B CA  1 
ATOM   5411  C  C   . ASP B  1 248 ? 39.601  -26.057 8.342   1.00   27.34 ? 355  ASP B C   1 
ATOM   5412  O  O   . ASP B  1 248 ? 38.934  -26.750 9.117   1.00   28.57 ? 355  ASP B O   1 
ATOM   5413  C  CB  . ASP B  1 248 ? 42.081  -26.295 8.193   1.00   25.62 ? 355  ASP B CB  1 
ATOM   5414  C  CG  . ASP B  1 248 ? 42.412  -25.926 6.768   1.00   27.59 ? 355  ASP B CG  1 
ATOM   5415  O  OD1 . ASP B  1 248 ? 41.765  -25.007 6.211   1.00   28.15 ? 355  ASP B OD1 1 
ATOM   5416  O  OD2 . ASP B  1 248 ? 43.330  -26.557 6.206   1.00   26.42 ? 355  ASP B OD2 1 
ATOM   5417  N  N   . LEU B  1 249 ? 39.217  -25.778 7.104   1.00   26.33 ? 356  LEU B N   1 
ATOM   5418  C  CA  . LEU B  1 249 ? 37.971  -26.271 6.539   1.00   25.06 ? 356  LEU B CA  1 
ATOM   5419  C  C   . LEU B  1 249 ? 37.861  -27.794 6.687   1.00   26.64 ? 356  LEU B C   1 
ATOM   5420  O  O   . LEU B  1 249 ? 38.870  -28.503 6.769   1.00   26.29 ? 356  LEU B O   1 
ATOM   5421  C  CB  . LEU B  1 249 ? 37.916  -25.884 5.065   1.00   23.21 ? 356  LEU B CB  1 
ATOM   5422  C  CG  . LEU B  1 249 ? 36.604  -26.014 4.296   1.00   25.82 ? 356  LEU B CG  1 
ATOM   5423  C  CD1 . LEU B  1 249 ? 35.488  -25.206 4.970   1.00   23.19 ? 356  LEU B CD1 1 
ATOM   5424  C  CD2 . LEU B  1 249 ? 36.852  -25.529 2.874   1.00   23.15 ? 356  LEU B CD2 1 
ATOM   5425  N  N   . ARG B  1 250 ? 36.627  -28.284 6.721   1.00   25.28 ? 357  ARG B N   1 
ATOM   5426  C  CA  . ARG B  1 250 ? 36.358  -29.708 6.853   1.00   27.58 ? 357  ARG B CA  1 
ATOM   5427  C  C   . ARG B  1 250 ? 36.807  -30.234 8.205   1.00   27.53 ? 357  ARG B C   1 
ATOM   5428  O  O   . ARG B  1 250 ? 37.298  -31.352 8.320   1.00   29.93 ? 357  ARG B O   1 
ATOM   5429  C  CB  . ARG B  1 250 ? 37.029  -30.482 5.709   1.00   26.61 ? 357  ARG B CB  1 
ATOM   5430  C  CG  . ARG B  1 250 ? 36.530  -30.067 4.325   1.00   27.18 ? 357  ARG B CG  1 
ATOM   5431  C  CD  . ARG B  1 250 ? 37.189  -30.865 3.216   1.00   30.95 ? 357  ARG B CD  1 
ATOM   5432  N  NE  . ARG B  1 250 ? 36.929  -30.323 1.875   1.00   33.32 ? 357  ARG B NE  1 
ATOM   5433  C  CZ  . ARG B  1 250 ? 35.752  -30.331 1.246   1.00   35.73 ? 357  ARG B CZ  1 
ATOM   5434  N  NH1 . ARG B  1 250 ? 35.655  -29.805 0.034   1.00   35.86 ? 357  ARG B NH1 1 
ATOM   5435  N  NH2 . ARG B  1 250 ? 34.674  -30.861 1.812   1.00   36.53 ? 357  ARG B NH2 1 
ATOM   5436  N  N   . GLN B  1 251 ? 36.639  -29.397 9.223   1.00   29.00 ? 358  GLN B N   1 
ATOM   5437  C  CA  . GLN B  1 251 ? 36.971  -29.732 10.605  1.00   31.29 ? 358  GLN B CA  1 
ATOM   5438  C  C   . GLN B  1 251 ? 38.404  -30.208 10.828  1.00   31.68 ? 358  GLN B C   1 
ATOM   5439  O  O   . GLN B  1 251 ? 38.669  -31.042 11.686  1.00   34.30 ? 358  GLN B O   1 
ATOM   5440  C  CB  . GLN B  1 251 ? 35.973  -30.771 11.110  1.00   31.78 ? 358  GLN B CB  1 
ATOM   5441  C  CG  . GLN B  1 251 ? 34.560  -30.399 10.728  1.00   36.14 ? 358  GLN B CG  1 
ATOM   5442  C  CD  . GLN B  1 251 ? 33.527  -31.366 11.236  1.00   39.18 ? 358  GLN B CD  1 
ATOM   5443  O  OE1 . GLN B  1 251 ? 33.330  -31.511 12.442  1.00   42.93 ? 358  GLN B OE1 1 
ATOM   5444  N  NE2 . GLN B  1 251 ? 32.851  -32.038 10.315  1.00   44.48 ? 358  GLN B NE2 1 
ATOM   5445  N  N   . LYS B  1 252 ? 39.335  -29.650 10.069  1.00   33.27 ? 359  LYS B N   1 
ATOM   5446  C  CA  . LYS B  1 252 ? 40.735  -30.023 10.194  1.00   34.39 ? 359  LYS B CA  1 
ATOM   5447  C  C   . LYS B  1 252 ? 41.533  -28.967 10.966  1.00   35.23 ? 359  LYS B C   1 
ATOM   5448  O  O   . LYS B  1 252 ? 40.993  -27.941 11.395  1.00   30.35 ? 359  LYS B O   1 
ATOM   5449  C  CB  . LYS B  1 252 ? 41.356  -30.187 8.810   1.00   36.51 ? 359  LYS B CB  1 
ATOM   5450  C  CG  . LYS B  1 252 ? 40.552  -31.009 7.846   1.00   42.19 ? 359  LYS B CG  1 
ATOM   5451  C  CD  . LYS B  1 252 ? 40.710  -32.481 8.121   1.00   48.02 ? 359  LYS B CD  1 
ATOM   5452  C  CE  . LYS B  1 252 ? 40.078  -33.280 6.996   1.00   53.52 ? 359  LYS B CE  1 
ATOM   5453  N  NZ  . LYS B  1 252 ? 40.567  -32.779 5.670   1.00   55.83 ? 359  LYS B NZ  1 
ATOM   5454  N  N   . CYS B  1 253 ? 42.825  -29.235 11.124  1.00   34.14 ? 360  CYS B N   1 
ATOM   5455  C  CA  . CYS B  1 253 ? 43.740  -28.343 11.828  1.00   37.40 ? 360  CYS B CA  1 
ATOM   5456  C  C   . CYS B  1 253 ? 44.871  -28.115 10.836  1.00   36.51 ? 360  CYS B C   1 
ATOM   5457  O  O   . CYS B  1 253 ? 45.300  -29.050 10.159  1.00   38.88 ? 360  CYS B O   1 
ATOM   5458  C  CB  . CYS B  1 253 ? 44.241  -29.046 13.106  1.00   39.46 ? 360  CYS B CB  1 
ATOM   5459  S  SG  . CYS B  1 253 ? 45.314  -28.157 14.297  1.00   48.70 ? 360  CYS B SG  1 
ATOM   5460  N  N   . THR B  1 254 ? 45.327  -26.877 10.703  1.00   32.26 ? 361  THR B N   1 
ATOM   5461  C  CA  . THR B  1 254 ? 46.419  -26.602 9.787   1.00   30.30 ? 361  THR B CA  1 
ATOM   5462  C  C   . THR B  1 254 ? 47.556  -25.896 10.509  1.00   32.35 ? 361  THR B C   1 
ATOM   5463  O  O   . THR B  1 254 ? 47.339  -25.137 11.456  1.00   32.86 ? 361  THR B O   1 
ATOM   5464  C  CB  . THR B  1 254 ? 45.996  -25.709 8.601   1.00   31.22 ? 361  THR B CB  1 
ATOM   5465  O  OG1 . THR B  1 254 ? 47.113  -25.543 7.713   1.00   30.62 ? 361  THR B OG1 1 
ATOM   5466  C  CG2 . THR B  1 254 ? 45.578  -24.318 9.092   1.00   26.74 ? 361  THR B CG2 1 
ATOM   5467  N  N   . GLU B  1 255 ? 48.773  -26.153 10.054  1.00   31.97 ? 362  GLU B N   1 
ATOM   5468  C  CA  . GLU B  1 255 ? 49.941  -25.524 10.636  1.00   33.82 ? 362  GLU B CA  1 
ATOM   5469  C  C   . GLU B  1 255 ? 50.566  -24.663 9.557   1.00   31.19 ? 362  GLU B C   1 
ATOM   5470  O  O   . GLU B  1 255 ? 51.703  -24.198 9.694   1.00   30.11 ? 362  GLU B O   1 
ATOM   5471  C  CB  . GLU B  1 255 ? 50.933  -26.590 11.118  1.00   35.58 ? 362  GLU B CB  1 
ATOM   5472  C  CG  . GLU B  1 255 ? 50.351  -27.479 12.207  1.00   42.95 ? 362  GLU B CG  1 
ATOM   5473  C  CD  . GLU B  1 255 ? 51.309  -28.561 12.686  1.00   47.45 ? 362  GLU B CD  1 
ATOM   5474  O  OE1 . GLU B  1 255 ? 52.452  -28.220 13.065  1.00   48.66 ? 362  GLU B OE1 1 
ATOM   5475  O  OE2 . GLU B  1 255 ? 50.911  -29.749 12.692  1.00   47.78 ? 362  GLU B OE2 1 
ATOM   5476  N  N   . SER B  1 256 ? 49.810  -24.443 8.484   1.00   28.49 ? 363  SER B N   1 
ATOM   5477  C  CA  . SER B  1 256 ? 50.314  -23.649 7.380   1.00   30.19 ? 363  SER B CA  1 
ATOM   5478  C  C   . SER B  1 256 ? 49.435  -22.497 6.909   1.00   29.67 ? 363  SER B C   1 
ATOM   5479  O  O   . SER B  1 256 ? 49.217  -22.337 5.705   1.00   29.62 ? 363  SER B O   1 
ATOM   5480  C  CB  . SER B  1 256 ? 50.643  -24.557 6.197   1.00   32.21 ? 363  SER B CB  1 
ATOM   5481  O  OG  . SER B  1 256 ? 49.513  -25.321 5.830   1.00   36.70 ? 363  SER B OG  1 
ATOM   5482  N  N   . HIS B  1 257 ? 48.911  -21.714 7.853   1.00   27.01 ? 364  HIS B N   1 
ATOM   5483  C  CA  . HIS B  1 257 ? 48.138  -20.526 7.499   1.00   26.20 ? 364  HIS B CA  1 
ATOM   5484  C  C   . HIS B  1 257 ? 49.252  -19.486 7.309   1.00   26.10 ? 364  HIS B C   1 
ATOM   5485  O  O   . HIS B  1 257 ? 50.150  -19.379 8.152   1.00   24.84 ? 364  HIS B O   1 
ATOM   5486  C  CB  . HIS B  1 257 ? 47.201  -20.125 8.629   1.00   24.56 ? 364  HIS B CB  1 
ATOM   5487  C  CG  . HIS B  1 257 ? 46.302  -18.976 8.284   1.00   25.66 ? 364  HIS B CG  1 
ATOM   5488  N  ND1 . HIS B  1 257 ? 45.849  -18.743 7.002   1.00   24.33 ? 364  HIS B ND1 1 
ATOM   5489  C  CD2 . HIS B  1 257 ? 45.744  -18.015 9.057   1.00   23.75 ? 364  HIS B CD2 1 
ATOM   5490  C  CE1 . HIS B  1 257 ? 45.052  -17.691 7.001   1.00   24.41 ? 364  HIS B CE1 1 
ATOM   5491  N  NE2 . HIS B  1 257 ? 44.970  -17.231 8.236   1.00   26.54 ? 364  HIS B NE2 1 
ATOM   5492  N  N   . THR B  1 258 ? 49.200  -18.728 6.215   1.00   22.95 ? 365  THR B N   1 
ATOM   5493  C  CA  . THR B  1 258 ? 50.287  -17.803 5.894   1.00   21.08 ? 365  THR B CA  1 
ATOM   5494  C  C   . THR B  1 258 ? 49.922  -16.399 5.404   1.00   21.54 ? 365  THR B C   1 
ATOM   5495  O  O   . THR B  1 258 ? 48.751  -16.052 5.228   1.00   22.44 ? 365  THR B O   1 
ATOM   5496  C  CB  . THR B  1 258 ? 51.147  -18.420 4.775   1.00   23.33 ? 365  THR B CB  1 
ATOM   5497  O  OG1 . THR B  1 258 ? 50.367  -18.456 3.569   1.00   24.31 ? 365  THR B OG1 1 
ATOM   5498  C  CG2 . THR B  1 258 ? 51.546  -19.861 5.125   1.00   17.88 ? 365  THR B CG2 1 
ATOM   5499  N  N   . GLY B  1 259 ? 50.966  -15.608 5.163   1.00   18.10 ? 366  GLY B N   1 
ATOM   5500  C  CA  . GLY B  1 259 ? 50.805  -14.270 4.625   1.00   17.12 ? 366  GLY B CA  1 
ATOM   5501  C  C   . GLY B  1 259 ? 50.156  -13.227 5.505   1.00   19.21 ? 366  GLY B C   1 
ATOM   5502  O  O   . GLY B  1 259 ? 49.916  -13.443 6.698   1.00   18.63 ? 366  GLY B O   1 
ATOM   5503  N  N   . THR B  1 260 ? 49.876  -12.076 4.899   1.00   21.40 ? 367  THR B N   1 
ATOM   5504  C  CA  . THR B  1 260 ? 49.252  -10.967 5.609   1.00   19.84 ? 367  THR B CA  1 
ATOM   5505  C  C   . THR B  1 260 ? 47.922  -11.398 6.242   1.00   19.50 ? 367  THR B C   1 
ATOM   5506  O  O   . THR B  1 260 ? 47.523  -10.849 7.261   1.00   20.35 ? 367  THR B O   1 
ATOM   5507  C  CB  . THR B  1 260 ? 49.038  -9.744  4.658   1.00   21.32 ? 367  THR B CB  1 
ATOM   5508  O  OG1 . THR B  1 260 ? 48.545  -8.630  5.412   1.00   21.19 ? 367  THR B OG1 1 
ATOM   5509  C  CG2 . THR B  1 260 ? 48.060  -10.069 3.547   1.00   16.89 ? 367  THR B CG2 1 
ATOM   5510  N  N   . SER B  1 261 ? 47.255  -12.395 5.657   1.00   20.24 ? 368  SER B N   1 
ATOM   5511  C  CA  . SER B  1 261 ? 45.965  -12.865 6.185   1.00   21.07 ? 368  SER B CA  1 
ATOM   5512  C  C   . SER B  1 261 ? 46.023  -13.321 7.635   1.00   21.58 ? 368  SER B C   1 
ATOM   5513  O  O   . SER B  1 261 ? 45.053  -13.175 8.379   1.00   23.13 ? 368  SER B O   1 
ATOM   5514  C  CB  . SER B  1 261 ? 45.425  -14.042 5.381   1.00   20.36 ? 368  SER B CB  1 
ATOM   5515  O  OG  . SER B  1 261 ? 45.169  -13.695 4.046   1.00   25.75 ? 368  SER B OG  1 
ATOM   5516  N  N   . ALA B  1 262 ? 47.149  -13.896 8.031   1.00   18.70 ? 369  ALA B N   1 
ATOM   5517  C  CA  . ALA B  1 262 ? 47.277  -14.409 9.386   1.00   19.89 ? 369  ALA B CA  1 
ATOM   5518  C  C   . ALA B  1 262 ? 47.585  -13.356 10.436  1.00   21.31 ? 369  ALA B C   1 
ATOM   5519  O  O   . ALA B  1 262 ? 47.375  -13.599 11.617  1.00   20.19 ? 369  ALA B O   1 
ATOM   5520  C  CB  . ALA B  1 262 ? 48.346  -15.507 9.426   1.00   15.75 ? 369  ALA B CB  1 
ATOM   5521  N  N   . SER B  1 263 ? 48.072  -12.187 10.017  1.00   19.63 ? 370  SER B N   1 
ATOM   5522  C  CA  . SER B  1 263 ? 48.420  -11.162 10.981  1.00   20.33 ? 370  SER B CA  1 
ATOM   5523  C  C   . SER B  1 263 ? 47.256  -10.374 11.567  1.00   21.11 ? 370  SER B C   1 
ATOM   5524  O  O   . SER B  1 263 ? 47.177  -10.191 12.784  1.00   24.43 ? 370  SER B O   1 
ATOM   5525  C  CB  . SER B  1 263 ? 49.458  -10.210 10.380  1.00   22.71 ? 370  SER B CB  1 
ATOM   5526  O  OG  . SER B  1 263 ? 50.741  -10.838 10.293  1.00   21.00 ? 370  SER B OG  1 
ATOM   5527  N  N   . ALA B  1 264 ? 46.348  -9.905  10.725  1.00   19.17 ? 371  ALA B N   1 
ATOM   5528  C  CA  . ALA B  1 264 ? 45.218  -9.134  11.231  1.00   21.46 ? 371  ALA B CA  1 
ATOM   5529  C  C   . ALA B  1 264 ? 44.426  -9.864  12.332  1.00   20.62 ? 371  ALA B C   1 
ATOM   5530  O  O   . ALA B  1 264 ? 44.118  -9.277  13.373  1.00   21.16 ? 371  ALA B O   1 
ATOM   5531  C  CB  . ALA B  1 264 ? 44.284  -8.737  10.073  1.00   20.64 ? 371  ALA B CB  1 
ATOM   5532  N  N   . PRO B  1 265 ? 44.091  -11.150 12.117  1.00   20.30 ? 372  PRO B N   1 
ATOM   5533  C  CA  . PRO B  1 265 ? 43.330  -11.905 13.121  1.00   19.57 ? 372  PRO B CA  1 
ATOM   5534  C  C   . PRO B  1 265 ? 43.997  -11.970 14.488  1.00   20.49 ? 372  PRO B C   1 
ATOM   5535  O  O   . PRO B  1 265 ? 43.314  -11.914 15.519  1.00   22.08 ? 372  PRO B O   1 
ATOM   5536  C  CB  . PRO B  1 265 ? 43.178  -13.281 12.485  1.00   16.59 ? 372  PRO B CB  1 
ATOM   5537  C  CG  . PRO B  1 265 ? 43.194  -12.973 11.010  1.00   20.42 ? 372  PRO B CG  1 
ATOM   5538  C  CD  . PRO B  1 265 ? 44.305  -11.960 10.905  1.00   18.27 ? 372  PRO B CD  1 
ATOM   5539  N  N   . LEU B  1 266 ? 45.321  -12.101 14.505  1.00   18.19 ? 373  LEU B N   1 
ATOM   5540  C  CA  . LEU B  1 266 ? 46.052  -12.157 15.770  1.00   18.48 ? 373  LEU B CA  1 
ATOM   5541  C  C   . LEU B  1 266 ? 45.907  -10.797 16.460  1.00   19.64 ? 373  LEU B C   1 
ATOM   5542  O  O   . LEU B  1 266 ? 45.745  -10.710 17.678  1.00   19.73 ? 373  LEU B O   1 
ATOM   5543  C  CB  . LEU B  1 266 ? 47.536  -12.494 15.529  1.00   17.43 ? 373  LEU B CB  1 
ATOM   5544  C  CG  . LEU B  1 266 ? 47.813  -13.905 14.983  1.00   19.46 ? 373  LEU B CG  1 
ATOM   5545  C  CD1 . LEU B  1 266 ? 49.271  -14.021 14.568  1.00   18.49 ? 373  LEU B CD1 1 
ATOM   5546  C  CD2 . LEU B  1 266 ? 47.478  -14.965 16.048  1.00   17.27 ? 373  LEU B CD2 1 
ATOM   5547  N  N   . ALA B  1 267 ? 45.947  -9.734  15.668  1.00   17.33 ? 374  ALA B N   1 
ATOM   5548  C  CA  . ALA B  1 267 ? 45.794  -8.402  16.211  1.00   19.32 ? 374  ALA B CA  1 
ATOM   5549  C  C   . ALA B  1 267 ? 44.367  -8.254  16.740  1.00   18.98 ? 374  ALA B C   1 
ATOM   5550  O  O   . ALA B  1 267 ? 44.141  -7.702  17.820  1.00   17.34 ? 374  ALA B O   1 
ATOM   5551  C  CB  . ALA B  1 267 ? 46.083  -7.351  15.127  1.00   19.12 ? 374  ALA B CB  1 
ATOM   5552  N  N   . ALA B  1 268 ? 43.392  -8.743  15.982  1.00   18.33 ? 375  ALA B N   1 
ATOM   5553  C  CA  . ALA B  1 268 ? 42.003  -8.651  16.438  1.00   18.75 ? 375  ALA B CA  1 
ATOM   5554  C  C   . ALA B  1 268 ? 41.846  -9.367  17.781  1.00   18.16 ? 375  ALA B C   1 
ATOM   5555  O  O   . ALA B  1 268 ? 41.129  -8.895  18.667  1.00   20.32 ? 375  ALA B O   1 
ATOM   5556  C  CB  . ALA B  1 268 ? 41.056  -9.261  15.406  1.00   14.11 ? 375  ALA B CB  1 
ATOM   5557  N  N   . GLY B  1 269 ? 42.516  -10.506 17.932  1.00   18.97 ? 376  GLY B N   1 
ATOM   5558  C  CA  . GLY B  1 269 ? 42.428  -11.245 19.183  1.00   19.56 ? 376  GLY B CA  1 
ATOM   5559  C  C   . GLY B  1 269 ? 43.025  -10.468 20.350  1.00   20.85 ? 376  GLY B C   1 
ATOM   5560  O  O   . GLY B  1 269 ? 42.434  -10.382 21.432  1.00   19.36 ? 376  GLY B O   1 
ATOM   5561  N  N   . ILE B  1 270 ? 44.196  -9.878  20.134  1.00   18.45 ? 377  ILE B N   1 
ATOM   5562  C  CA  . ILE B  1 270 ? 44.849  -9.123  21.189  1.00   19.16 ? 377  ILE B CA  1 
ATOM   5563  C  C   . ILE B  1 270 ? 43.987  -7.930  21.584  1.00   20.68 ? 377  ILE B C   1 
ATOM   5564  O  O   . ILE B  1 270 ? 43.869  -7.591  22.761  1.00   23.44 ? 377  ILE B O   1 
ATOM   5565  C  CB  . ILE B  1 270 ? 46.249  -8.679  20.738  1.00   19.30 ? 377  ILE B CB  1 
ATOM   5566  C  CG1 . ILE B  1 270 ? 47.131  -9.919  20.611  1.00   20.95 ? 377  ILE B CG1 1 
ATOM   5567  C  CG2 . ILE B  1 270 ? 46.839  -7.679  21.721  1.00   20.51 ? 377  ILE B CG2 1 
ATOM   5568  C  CD1 . ILE B  1 270 ? 48.527  -9.629  20.143  1.00   26.24 ? 377  ILE B CD1 1 
ATOM   5569  N  N   . ILE B  1 271 ? 43.367  -7.302  20.597  1.00   19.73 ? 378  ILE B N   1 
ATOM   5570  C  CA  . ILE B  1 271 ? 42.495  -6.173  20.860  1.00   17.90 ? 378  ILE B CA  1 
ATOM   5571  C  C   . ILE B  1 271 ? 41.276  -6.631  21.674  1.00   21.14 ? 378  ILE B C   1 
ATOM   5572  O  O   . ILE B  1 271 ? 40.761  -5.888  22.509  1.00   21.63 ? 378  ILE B O   1 
ATOM   5573  C  CB  . ILE B  1 271 ? 42.065  -5.514  19.528  1.00   18.12 ? 378  ILE B CB  1 
ATOM   5574  C  CG1 . ILE B  1 271 ? 43.267  -4.775  18.935  1.00   16.33 ? 378  ILE B CG1 1 
ATOM   5575  C  CG2 . ILE B  1 271 ? 40.905  -4.550  19.749  1.00   16.92 ? 378  ILE B CG2 1 
ATOM   5576  C  CD1 . ILE B  1 271 ? 43.045  -4.259  17.533  1.00   20.52 ? 378  ILE B CD1 1 
ATOM   5577  N  N   . ALA B  1 272 ? 40.817  -7.857  21.438  1.00   21.11 ? 379  ALA B N   1 
ATOM   5578  C  CA  . ALA B  1 272 ? 39.684  -8.384  22.179  1.00   20.71 ? 379  ALA B CA  1 
ATOM   5579  C  C   . ALA B  1 272 ? 40.070  -8.516  23.662  1.00   23.15 ? 379  ALA B C   1 
ATOM   5580  O  O   . ALA B  1 272 ? 39.277  -8.202  24.555  1.00   23.87 ? 379  ALA B O   1 
ATOM   5581  C  CB  . ALA B  1 272 ? 39.274  -9.736  21.616  1.00   22.71 ? 379  ALA B CB  1 
ATOM   5582  N  N   . LEU B  1 273 ? 41.293  -8.968  23.921  1.00   20.44 ? 380  LEU B N   1 
ATOM   5583  C  CA  . LEU B  1 273 ? 41.749  -9.116  25.293  1.00   21.47 ? 380  LEU B CA  1 
ATOM   5584  C  C   . LEU B  1 273 ? 41.784  -7.740  25.929  1.00   23.04 ? 380  LEU B C   1 
ATOM   5585  O  O   . LEU B  1 273 ? 41.421  -7.565  27.087  1.00   25.11 ? 380  LEU B O   1 
ATOM   5586  C  CB  . LEU B  1 273 ? 43.149  -9.736  25.338  1.00   16.32 ? 380  LEU B CB  1 
ATOM   5587  C  CG  . LEU B  1 273 ? 43.290  -11.126 24.711  1.00   21.21 ? 380  LEU B CG  1 
ATOM   5588  C  CD1 . LEU B  1 273 ? 44.706  -11.644 24.919  1.00   20.35 ? 380  LEU B CD1 1 
ATOM   5589  C  CD2 . LEU B  1 273 ? 42.283  -12.081 25.338  1.00   19.15 ? 380  LEU B CD2 1 
ATOM   5590  N  N   . THR B  1 274 ? 42.217  -6.760  25.152  1.00   23.26 ? 381  THR B N   1 
ATOM   5591  C  CA  . THR B  1 274 ? 42.316  -5.399  25.631  1.00   21.54 ? 381  THR B CA  1 
ATOM   5592  C  C   . THR B  1 274 ? 40.950  -4.800  25.984  1.00   25.32 ? 381  THR B C   1 
ATOM   5593  O  O   . THR B  1 274 ? 40.807  -4.106  27.005  1.00   23.13 ? 381  THR B O   1 
ATOM   5594  C  CB  . THR B  1 274 ? 43.008  -4.556  24.587  1.00   21.58 ? 381  THR B CB  1 
ATOM   5595  O  OG1 . THR B  1 274 ? 44.234  -5.204  24.247  1.00   20.78 ? 381  THR B OG1 1 
ATOM   5596  C  CG2 . THR B  1 274 ? 43.299  -3.145  25.128  1.00   20.88 ? 381  THR B CG2 1 
ATOM   5597  N  N   . LEU B  1 275 ? 39.946  -5.053  25.145  1.00   23.98 ? 382  LEU B N   1 
ATOM   5598  C  CA  . LEU B  1 275 ? 38.610  -4.543  25.421  1.00   23.59 ? 382  LEU B CA  1 
ATOM   5599  C  C   . LEU B  1 275 ? 38.050  -5.176  26.681  1.00   25.20 ? 382  LEU B C   1 
ATOM   5600  O  O   . LEU B  1 275 ? 37.297  -4.542  27.411  1.00   22.95 ? 382  LEU B O   1 
ATOM   5601  C  CB  . LEU B  1 275 ? 37.654  -4.825  24.270  1.00   22.35 ? 382  LEU B CB  1 
ATOM   5602  C  CG  . LEU B  1 275 ? 37.653  -3.833  23.112  1.00   27.72 ? 382  LEU B CG  1 
ATOM   5603  C  CD1 . LEU B  1 275 ? 36.515  -4.168  22.164  1.00   27.03 ? 382  LEU B CD1 1 
ATOM   5604  C  CD2 . LEU B  1 275 ? 37.478  -2.415  23.654  1.00   28.98 ? 382  LEU B CD2 1 
ATOM   5605  N  N   . GLU B  1 276 ? 38.409  -6.430  26.937  1.00   25.99 ? 383  GLU B N   1 
ATOM   5606  C  CA  . GLU B  1 276 ? 37.921  -7.079  28.139  1.00   26.42 ? 383  GLU B CA  1 
ATOM   5607  C  C   . GLU B  1 276 ? 38.539  -6.350  29.324  1.00   27.81 ? 383  GLU B C   1 
ATOM   5608  O  O   . GLU B  1 276 ? 37.865  -6.089  30.317  1.00   31.39 ? 383  GLU B O   1 
ATOM   5609  C  CB  . GLU B  1 276 ? 38.319  -8.549  28.180  1.00   25.96 ? 383  GLU B CB  1 
ATOM   5610  C  CG  . GLU B  1 276 ? 37.582  -9.316  29.259  1.00   29.54 ? 383  GLU B CG  1 
ATOM   5611  C  CD  . GLU B  1 276 ? 38.115  -10.721 29.447  1.00   31.27 ? 383  GLU B CD  1 
ATOM   5612  O  OE1 . GLU B  1 276 ? 38.797  -11.237 28.541  1.00   30.66 ? 383  GLU B OE1 1 
ATOM   5613  O  OE2 . GLU B  1 276 ? 37.838  -11.314 30.502  1.00   31.81 ? 383  GLU B OE2 1 
ATOM   5614  N  N   . ALA B  1 277 ? 39.822  -6.012  29.212  1.00   25.62 ? 384  ALA B N   1 
ATOM   5615  C  CA  . ALA B  1 277 ? 40.519  -5.298  30.276  1.00   24.79 ? 384  ALA B CA  1 
ATOM   5616  C  C   . ALA B  1 277 ? 39.902  -3.918  30.521  1.00   27.10 ? 384  ALA B C   1 
ATOM   5617  O  O   . ALA B  1 277 ? 39.966  -3.389  31.630  1.00   29.93 ? 384  ALA B O   1 
ATOM   5618  C  CB  . ALA B  1 277 ? 41.989  -5.151  29.928  1.00   22.51 ? 384  ALA B CB  1 
ATOM   5619  N  N   . ASN B  1 278 ? 39.326  -3.322  29.483  1.00   24.39 ? 385  ASN B N   1 
ATOM   5620  C  CA  . ASN B  1 278 ? 38.690  -2.012  29.618  1.00   23.26 ? 385  ASN B CA  1 
ATOM   5621  C  C   . ASN B  1 278 ? 37.671  -1.841  28.508  1.00   24.98 ? 385  ASN B C   1 
ATOM   5622  O  O   . ASN B  1 278 ? 38.012  -1.425  27.403  1.00   26.45 ? 385  ASN B O   1 
ATOM   5623  C  CB  . ASN B  1 278 ? 39.713  -0.875  29.540  1.00   21.56 ? 385  ASN B CB  1 
ATOM   5624  C  CG  . ASN B  1 278 ? 39.082  0.503   29.804  1.00   24.20 ? 385  ASN B CG  1 
ATOM   5625  O  OD1 . ASN B  1 278 ? 37.853  0.674   29.745  1.00   21.89 ? 385  ASN B OD1 1 
ATOM   5626  N  ND2 . ASN B  1 278 ? 39.923  1.491   30.078  1.00   21.04 ? 385  ASN B ND2 1 
ATOM   5627  N  N   . LYS B  1 279 ? 36.417  -2.162  28.811  1.00   24.76 ? 386  LYS B N   1 
ATOM   5628  C  CA  . LYS B  1 279 ? 35.345  -2.074  27.832  1.00   25.80 ? 386  LYS B CA  1 
ATOM   5629  C  C   . LYS B  1 279 ? 34.960  -0.660  27.423  1.00   27.32 ? 386  LYS B C   1 
ATOM   5630  O  O   . LYS B  1 279 ? 34.167  -0.481  26.502  1.00   26.84 ? 386  LYS B O   1 
ATOM   5631  C  CB  . LYS B  1 279 ? 34.100  -2.791  28.354  1.00   27.55 ? 386  LYS B CB  1 
ATOM   5632  C  CG  . LYS B  1 279 ? 34.195  -4.300  28.366  1.00   32.20 ? 386  LYS B CG  1 
ATOM   5633  C  CD  . LYS B  1 279 ? 32.819  -4.897  28.627  1.00   40.90 ? 386  LYS B CD  1 
ATOM   5634  C  CE  . LYS B  1 279 ? 32.811  -6.416  28.504  1.00   44.78 ? 386  LYS B CE  1 
ATOM   5635  N  NZ  . LYS B  1 279 ? 31.462  -6.970  28.801  0.0000 43.28 ? 386  LYS B NZ  1 
ATOM   5636  N  N   . ASN B  1 280 ? 35.513  0.346   28.095  1.00   28.72 ? 387  ASN B N   1 
ATOM   5637  C  CA  . ASN B  1 280 ? 35.172  1.735   27.773  1.00   30.08 ? 387  ASN B CA  1 
ATOM   5638  C  C   . ASN B  1 280 ? 36.120  2.413   26.787  1.00   27.03 ? 387  ASN B C   1 
ATOM   5639  O  O   . ASN B  1 280 ? 35.981  3.603   26.515  1.00   24.79 ? 387  ASN B O   1 
ATOM   5640  C  CB  . ASN B  1 280 ? 35.110  2.570   29.053  1.00   35.69 ? 387  ASN B CB  1 
ATOM   5641  C  CG  . ASN B  1 280 ? 34.028  2.102   30.003  1.00   43.97 ? 387  ASN B CG  1 
ATOM   5642  O  OD1 . ASN B  1 280 ? 34.092  2.354   31.211  1.00   52.52 ? 387  ASN B OD1 1 
ATOM   5643  N  ND2 . ASN B  1 280 ? 33.016  1.429   29.463  1.00   46.21 ? 387  ASN B ND2 1 
ATOM   5644  N  N   . LEU B  1 281 ? 37.082  1.667   26.257  1.00   24.44 ? 388  LEU B N   1 
ATOM   5645  C  CA  . LEU B  1 281 ? 38.035  2.235   25.301  1.00   23.37 ? 388  LEU B CA  1 
ATOM   5646  C  C   . LEU B  1 281 ? 37.334  2.594   23.995  1.00   22.58 ? 388  LEU B C   1 
ATOM   5647  O  O   . LEU B  1 281 ? 36.537  1.814   23.483  1.00   25.18 ? 388  LEU B O   1 
ATOM   5648  C  CB  . LEU B  1 281 ? 39.142  1.224   25.006  1.00   19.99 ? 388  LEU B CB  1 
ATOM   5649  C  CG  . LEU B  1 281 ? 39.997  0.821   26.204  1.00   21.85 ? 388  LEU B CG  1 
ATOM   5650  C  CD1 . LEU B  1 281 ? 40.791  -0.421  25.854  1.00   21.96 ? 388  LEU B CD1 1 
ATOM   5651  C  CD2 . LEU B  1 281 ? 40.913  1.968   26.594  1.00   18.64 ? 388  LEU B CD2 1 
ATOM   5652  N  N   . THR B  1 282 ? 37.624  3.774   23.458  1.00   23.54 ? 389  THR B N   1 
ATOM   5653  C  CA  . THR B  1 282 ? 37.030  4.200   22.190  1.00   21.06 ? 389  THR B CA  1 
ATOM   5654  C  C   . THR B  1 282 ? 37.902  3.670   21.052  1.00   19.87 ? 389  THR B C   1 
ATOM   5655  O  O   . THR B  1 282 ? 38.982  3.123   21.298  1.00   17.27 ? 389  THR B O   1 
ATOM   5656  C  CB  . THR B  1 282 ? 36.995  5.740   22.059  1.00   20.87 ? 389  THR B CB  1 
ATOM   5657  O  OG1 . THR B  1 282 ? 38.339  6.235   21.963  1.00   20.32 ? 389  THR B OG1 1 
ATOM   5658  C  CG2 . THR B  1 282 ? 36.288  6.374   23.260  1.00   19.79 ? 389  THR B CG2 1 
ATOM   5659  N  N   . TRP B  1 283 ? 37.446  3.840   19.810  1.00   17.81 ? 390  TRP B N   1 
ATOM   5660  C  CA  . TRP B  1 283 ? 38.230  3.384   18.666  1.00   18.08 ? 390  TRP B CA  1 
ATOM   5661  C  C   . TRP B  1 283 ? 39.584  4.108   18.632  1.00   18.11 ? 390  TRP B C   1 
ATOM   5662  O  O   . TRP B  1 283 ? 40.588  3.525   18.233  1.00   19.97 ? 390  TRP B O   1 
ATOM   5663  C  CB  . TRP B  1 283 ? 37.477  3.593   17.333  1.00   14.90 ? 390  TRP B CB  1 
ATOM   5664  C  CG  . TRP B  1 283 ? 37.243  5.025   16.941  1.00   16.70 ? 390  TRP B CG  1 
ATOM   5665  C  CD1 . TRP B  1 283 ? 36.276  5.865   17.428  1.00   17.27 ? 390  TRP B CD1 1 
ATOM   5666  C  CD2 . TRP B  1 283 ? 37.996  5.791   15.987  1.00   16.90 ? 390  TRP B CD2 1 
ATOM   5667  N  NE1 . TRP B  1 283 ? 36.383  7.104   16.834  1.00   19.61 ? 390  TRP B NE1 1 
ATOM   5668  C  CE2 . TRP B  1 283 ? 37.426  7.086   15.945  1.00   17.64 ? 390  TRP B CE2 1 
ATOM   5669  C  CE3 . TRP B  1 283 ? 39.096  5.507   15.164  1.00   18.55 ? 390  TRP B CE3 1 
ATOM   5670  C  CZ2 . TRP B  1 283 ? 37.920  8.100   15.110  1.00   17.59 ? 390  TRP B CZ2 1 
ATOM   5671  C  CZ3 . TRP B  1 283 ? 39.589  6.520   14.331  1.00   19.01 ? 390  TRP B CZ3 1 
ATOM   5672  C  CH2 . TRP B  1 283 ? 38.997  7.799   14.314  1.00   18.81 ? 390  TRP B CH2 1 
ATOM   5673  N  N   . ARG B  1 284 ? 39.615  5.370   19.056  1.00   17.22 ? 391  ARG B N   1 
ATOM   5674  C  CA  . ARG B  1 284 ? 40.875  6.118   19.098  1.00   17.11 ? 391  ARG B CA  1 
ATOM   5675  C  C   . ARG B  1 284 ? 41.760  5.675   20.286  1.00   16.61 ? 391  ARG B C   1 
ATOM   5676  O  O   . ARG B  1 284 ? 42.981  5.571   20.147  1.00   18.31 ? 391  ARG B O   1 
ATOM   5677  C  CB  . ARG B  1 284 ? 40.603  7.634   19.141  1.00   17.01 ? 391  ARG B CB  1 
ATOM   5678  C  CG  . ARG B  1 284 ? 40.282  8.241   17.752  1.00   18.83 ? 391  ARG B CG  1 
ATOM   5679  C  CD  . ARG B  1 284 ? 39.703  9.662   17.848  1.00   18.10 ? 391  ARG B CD  1 
ATOM   5680  N  NE  . ARG B  1 284 ? 40.615  10.600  18.502  1.00   17.53 ? 391  ARG B NE  1 
ATOM   5681  C  CZ  . ARG B  1 284 ? 40.303  11.319  19.579  1.00   18.30 ? 391  ARG B CZ  1 
ATOM   5682  N  NH1 . ARG B  1 284 ? 39.097  11.209  20.126  1.00   12.69 ? 391  ARG B NH1 1 
ATOM   5683  N  NH2 . ARG B  1 284 ? 41.201  12.141  20.120  1.00   17.40 ? 391  ARG B NH2 1 
ATOM   5684  N  N   . ASP B  1 285 ? 41.158  5.406   21.446  1.00   18.13 ? 392  ASP B N   1 
ATOM   5685  C  CA  . ASP B  1 285 ? 41.943  4.938   22.594  1.00   16.73 ? 392  ASP B CA  1 
ATOM   5686  C  C   . ASP B  1 285 ? 42.735  3.693   22.186  1.00   18.16 ? 392  ASP B C   1 
ATOM   5687  O  O   . ASP B  1 285 ? 43.916  3.545   22.522  1.00   18.86 ? 392  ASP B O   1 
ATOM   5688  C  CB  . ASP B  1 285 ? 41.049  4.535   23.770  1.00   17.46 ? 392  ASP B CB  1 
ATOM   5689  C  CG  . ASP B  1 285 ? 40.459  5.724   24.508  1.00   21.95 ? 392  ASP B CG  1 
ATOM   5690  O  OD1 . ASP B  1 285 ? 41.135  6.773   24.592  1.00   22.43 ? 392  ASP B OD1 1 
ATOM   5691  O  OD2 . ASP B  1 285 ? 39.329  5.590   25.025  1.00   20.10 ? 392  ASP B OD2 1 
ATOM   5692  N  N   . MET B  1 286 ? 42.070  2.790   21.473  1.00   15.76 ? 393  MET B N   1 
ATOM   5693  C  CA  . MET B  1 286 ? 42.701  1.551   21.060  1.00   16.64 ? 393  MET B CA  1 
ATOM   5694  C  C   . MET B  1 286 ? 43.943  1.790   20.213  1.00   17.26 ? 393  MET B C   1 
ATOM   5695  O  O   . MET B  1 286 ? 44.949  1.101   20.382  1.00   18.48 ? 393  MET B O   1 
ATOM   5696  C  CB  . MET B  1 286 ? 41.707  0.665   20.296  1.00   15.87 ? 393  MET B CB  1 
ATOM   5697  C  CG  . MET B  1 286 ? 42.202  -0.761  20.091  1.00   16.23 ? 393  MET B CG  1 
ATOM   5698  S  SD  . MET B  1 286 ? 42.490  -1.626  21.661  1.00   21.31 ? 393  MET B SD  1 
ATOM   5699  C  CE  . MET B  1 286 ? 40.782  -1.815  22.258  1.00   16.18 ? 393  MET B CE  1 
ATOM   5700  N  N   . GLN B  1 287 ? 43.880  2.749   19.293  1.00   17.46 ? 394  GLN B N   1 
ATOM   5701  C  CA  . GLN B  1 287 ? 45.054  3.022   18.469  1.00   18.52 ? 394  GLN B CA  1 
ATOM   5702  C  C   . GLN B  1 287 ? 46.169  3.637   19.334  1.00   17.32 ? 394  GLN B C   1 
ATOM   5703  O  O   . GLN B  1 287 ? 47.350  3.355   19.132  1.00   14.22 ? 394  GLN B O   1 
ATOM   5704  C  CB  . GLN B  1 287 ? 44.673  3.911   17.274  1.00   13.56 ? 394  GLN B CB  1 
ATOM   5705  C  CG  . GLN B  1 287 ? 43.751  3.152   16.318  1.00   17.84 ? 394  GLN B CG  1 
ATOM   5706  C  CD  . GLN B  1 287 ? 43.504  3.854   14.998  1.00   15.89 ? 394  GLN B CD  1 
ATOM   5707  O  OE1 . GLN B  1 287 ? 44.399  4.492   14.442  1.00   15.80 ? 394  GLN B OE1 1 
ATOM   5708  N  NE2 . GLN B  1 287 ? 42.287  3.710   14.469  1.00   13.08 ? 394  GLN B NE2 1 
ATOM   5709  N  N   . HIS B  1 288 ? 45.797  4.464   20.311  1.00   18.77 ? 395  HIS B N   1 
ATOM   5710  C  CA  . HIS B  1 288 ? 46.803  5.037   21.206  1.00   18.10 ? 395  HIS B CA  1 
ATOM   5711  C  C   . HIS B  1 288 ? 47.537  3.913   21.939  1.00   18.84 ? 395  HIS B C   1 
ATOM   5712  O  O   . HIS B  1 288 ? 48.766  3.918   22.024  1.00   21.86 ? 395  HIS B O   1 
ATOM   5713  C  CB  . HIS B  1 288 ? 46.148  5.950   22.234  1.00   16.66 ? 395  HIS B CB  1 
ATOM   5714  C  CG  . HIS B  1 288 ? 45.932  7.344   21.747  1.00   16.34 ? 395  HIS B CG  1 
ATOM   5715  N  ND1 . HIS B  1 288 ? 46.951  8.271   21.680  1.00   20.37 ? 395  HIS B ND1 1 
ATOM   5716  C  CD2 . HIS B  1 288 ? 44.820  7.969   21.295  1.00   15.67 ? 395  HIS B CD2 1 
ATOM   5717  C  CE1 . HIS B  1 288 ? 46.473  9.409   21.210  1.00   18.77 ? 395  HIS B CE1 1 
ATOM   5718  N  NE2 . HIS B  1 288 ? 45.183  9.254   20.968  1.00   19.13 ? 395  HIS B NE2 1 
ATOM   5719  N  N   . LEU B  1 289 ? 46.777  2.953   22.460  1.00   16.35 ? 396  LEU B N   1 
ATOM   5720  C  CA  . LEU B  1 289 ? 47.365  1.833   23.194  1.00   19.43 ? 396  LEU B CA  1 
ATOM   5721  C  C   . LEU B  1 289 ? 48.374  1.064   22.336  1.00   18.59 ? 396  LEU B C   1 
ATOM   5722  O  O   . LEU B  1 289 ? 49.456  0.708   22.797  1.00   18.15 ? 396  LEU B O   1 
ATOM   5723  C  CB  . LEU B  1 289 ? 46.258  0.886   23.698  1.00   16.61 ? 396  LEU B CB  1 
ATOM   5724  C  CG  . LEU B  1 289 ? 45.292  1.460   24.747  1.00   20.46 ? 396  LEU B CG  1 
ATOM   5725  C  CD1 . LEU B  1 289 ? 44.369  0.370   25.260  1.00   17.45 ? 396  LEU B CD1 1 
ATOM   5726  C  CD2 . LEU B  1 289 ? 46.067  2.038   25.898  1.00   17.27 ? 396  LEU B CD2 1 
ATOM   5727  N  N   . VAL B  1 290 ? 48.012  0.817   21.082  1.00   20.06 ? 397  VAL B N   1 
ATOM   5728  C  CA  . VAL B  1 290 ? 48.886  0.101   20.166  1.00   17.73 ? 397  VAL B CA  1 
ATOM   5729  C  C   . VAL B  1 290 ? 50.183  0.864   19.932  1.00   18.28 ? 397  VAL B C   1 
ATOM   5730  O  O   . VAL B  1 290 ? 51.278  0.290   19.935  1.00   15.61 ? 397  VAL B O   1 
ATOM   5731  C  CB  . VAL B  1 290 ? 48.182  -0.134  18.809  1.00   15.82 ? 397  VAL B CB  1 
ATOM   5732  C  CG1 . VAL B  1 290 ? 49.208  -0.578  17.757  1.00   14.26 ? 397  VAL B CG1 1 
ATOM   5733  C  CG2 . VAL B  1 290 ? 47.098  -1.188  18.971  1.00   15.04 ? 397  VAL B CG2 1 
ATOM   5734  N  N   . VAL B  1 291 ? 50.062  2.164   19.722  1.00   17.22 ? 398  VAL B N   1 
ATOM   5735  C  CA  . VAL B  1 291 ? 51.240  2.985   19.481  1.00   18.48 ? 398  VAL B CA  1 
ATOM   5736  C  C   . VAL B  1 291 ? 52.158  2.967   20.696  1.00   20.81 ? 398  VAL B C   1 
ATOM   5737  O  O   . VAL B  1 291 ? 53.376  2.824   20.585  1.00   19.63 ? 398  VAL B O   1 
ATOM   5738  C  CB  . VAL B  1 291 ? 50.846  4.453   19.177  1.00   19.48 ? 398  VAL B CB  1 
ATOM   5739  C  CG1 . VAL B  1 291 ? 52.083  5.363   19.241  1.00   17.43 ? 398  VAL B CG1 1 
ATOM   5740  C  CG2 . VAL B  1 291 ? 50.226  4.541   17.800  1.00   14.05 ? 398  VAL B CG2 1 
ATOM   5741  N  N   . GLN B  1 292 ? 51.567  3.095   21.872  1.00   21.91 ? 399  GLN B N   1 
ATOM   5742  C  CA  . GLN B  1 292 ? 52.369  3.134   23.079  1.00   22.44 ? 399  GLN B CA  1 
ATOM   5743  C  C   . GLN B  1 292 ? 53.011  1.835   23.518  1.00   21.19 ? 399  GLN B C   1 
ATOM   5744  O  O   . GLN B  1 292 ? 54.135  1.842   24.014  1.00   24.26 ? 399  GLN B O   1 
ATOM   5745  C  CB  . GLN B  1 292 ? 51.538  3.703   24.221  1.00   21.64 ? 399  GLN B CB  1 
ATOM   5746  C  CG  . GLN B  1 292 ? 51.241  5.161   24.009  1.00   23.22 ? 399  GLN B CG  1 
ATOM   5747  C  CD  . GLN B  1 292 ? 50.900  5.869   25.290  1.00   24.88 ? 399  GLN B CD  1 
ATOM   5748  O  OE1 . GLN B  1 292 ? 51.279  5.416   26.366  1.00   28.02 ? 399  GLN B OE1 1 
ATOM   5749  N  NE2 . GLN B  1 292 ? 50.202  7.005   25.189  1.00   22.59 ? 399  GLN B NE2 1 
ATOM   5750  N  N   . THR B  1 293 ? 52.325  0.720   23.309  1.00   20.58 ? 400  THR B N   1 
ATOM   5751  C  CA  . THR B  1 293 ? 52.843  -0.557  23.757  1.00   20.85 ? 400  THR B CA  1 
ATOM   5752  C  C   . THR B  1 293 ? 53.578  -1.427  22.761  1.00   22.42 ? 400  THR B C   1 
ATOM   5753  O  O   . THR B  1 293 ? 54.227  -2.383  23.176  1.00   26.21 ? 400  THR B O   1 
ATOM   5754  C  CB  . THR B  1 293 ? 51.723  -1.416  24.366  1.00   20.72 ? 400  THR B CB  1 
ATOM   5755  O  OG1 . THR B  1 293 ? 50.747  -1.709  23.360  1.00   20.92 ? 400  THR B OG1 1 
ATOM   5756  C  CG2 . THR B  1 293 ? 51.055  -0.686  25.521  1.00   21.18 ? 400  THR B CG2 1 
ATOM   5757  N  N   . SER B  1 294 ? 53.501  -1.121  21.469  1.00   21.71 ? 401  SER B N   1 
ATOM   5758  C  CA  . SER B  1 294 ? 54.174  -1.974  20.487  1.00   22.04 ? 401  SER B CA  1 
ATOM   5759  C  C   . SER B  1 294 ? 55.696  -1.918  20.564  1.00   24.64 ? 401  SER B C   1 
ATOM   5760  O  O   . SER B  1 294 ? 56.282  -0.865  20.794  1.00   27.21 ? 401  SER B O   1 
ATOM   5761  C  CB  . SER B  1 294 ? 53.668  -1.660  19.084  1.00   21.71 ? 401  SER B CB  1 
ATOM   5762  O  OG  . SER B  1 294 ? 52.312  -2.057  19.006  1.00   15.97 ? 401  SER B OG  1 
ATOM   5763  N  N   . LYS B  1 295 ? 56.325  -3.072  20.361  1.00   24.94 ? 402  LYS B N   1 
ATOM   5764  C  CA  . LYS B  1 295 ? 57.770  -3.214  20.489  1.00   26.63 ? 402  LYS B CA  1 
ATOM   5765  C  C   . LYS B  1 295 ? 58.555  -3.427  19.208  1.00   23.54 ? 402  LYS B C   1 
ATOM   5766  O  O   . LYS B  1 295 ? 58.280  -4.354  18.454  1.00   21.87 ? 402  LYS B O   1 
ATOM   5767  C  CB  . LYS B  1 295 ? 58.079  -4.402  21.415  1.00   29.46 ? 402  LYS B CB  1 
ATOM   5768  C  CG  . LYS B  1 295 ? 57.350  -4.410  22.758  1.00   33.65 ? 402  LYS B CG  1 
ATOM   5769  C  CD  . LYS B  1 295 ? 57.925  -3.369  23.734  1.00   35.34 ? 402  LYS B CD  1 
ATOM   5770  C  CE  . LYS B  1 295 ? 57.341  -3.526  25.145  1.00   32.35 ? 402  LYS B CE  1 
ATOM   5771  N  NZ  . LYS B  1 295 ? 55.855  -3.367  25.161  1.00   28.09 ? 402  LYS B NZ  1 
ATOM   5772  N  N   . PRO B  1 296 ? 59.558  -2.583  18.959  1.00   23.90 ? 403  PRO B N   1 
ATOM   5773  C  CA  . PRO B  1 296 ? 60.382  -2.721  17.752  1.00   29.32 ? 403  PRO B CA  1 
ATOM   5774  C  C   . PRO B  1 296 ? 61.403  -3.837  17.966  1.00   32.00 ? 403  PRO B C   1 
ATOM   5775  O  O   . PRO B  1 296 ? 61.617  -4.676  17.095  1.00   34.12 ? 403  PRO B O   1 
ATOM   5776  C  CB  . PRO B  1 296 ? 61.088  -1.367  17.637  1.00   28.08 ? 403  PRO B CB  1 
ATOM   5777  C  CG  . PRO B  1 296 ? 60.233  -0.438  18.443  1.00   30.07 ? 403  PRO B CG  1 
ATOM   5778  C  CD  . PRO B  1 296 ? 59.805  -1.291  19.611  1.00   25.89 ? 403  PRO B CD  1 
ATOM   5779  N  N   . ALA B  1 297 ? 62.010  -3.839  19.150  1.00   34.24 ? 404  ALA B N   1 
ATOM   5780  C  CA  . ALA B  1 297 ? 63.052  -4.799  19.500  1.00   39.34 ? 404  ALA B CA  1 
ATOM   5781  C  C   . ALA B  1 297 ? 62.768  -6.191  18.988  1.00   38.52 ? 404  ALA B C   1 
ATOM   5782  O  O   . ALA B  1 297 ? 61.657  -6.703  19.131  1.00   43.05 ? 404  ALA B O   1 
ATOM   5783  C  CB  . ALA B  1 297 ? 63.258  -4.831  21.010  1.00   42.73 ? 404  ALA B CB  1 
ATOM   5784  N  N   . HIS B  1 298 ? 63.789  -6.783  18.382  1.00   36.50 ? 405  HIS B N   1 
ATOM   5785  C  CA  . HIS B  1 298 ? 63.725  -8.126  17.820  1.00   36.22 ? 405  HIS B CA  1 
ATOM   5786  C  C   . HIS B  1 298 ? 63.317  -8.144  16.346  1.00   35.22 ? 405  HIS B C   1 
ATOM   5787  O  O   . HIS B  1 298 ? 63.460  -9.165  15.677  1.00   39.47 ? 405  HIS B O   1 
ATOM   5788  C  CB  . HIS B  1 298 ? 62.777  -9.011  18.643  1.00   37.36 ? 405  HIS B CB  1 
ATOM   5789  C  CG  . HIS B  1 298 ? 63.259  -9.272  20.037  0.0000 37.04 ? 405  HIS B CG  1 
ATOM   5790  N  ND1 . HIS B  1 298 ? 64.454  -9.906  20.303  0.0000 37.15 ? 405  HIS B ND1 1 
ATOM   5791  C  CD2 . HIS B  1 298 ? 62.711  -8.982  21.240  0.0000 37.15 ? 405  HIS B CD2 1 
ATOM   5792  C  CE1 . HIS B  1 298 ? 64.621  -9.994  21.611  0.0000 37.13 ? 405  HIS B CE1 1 
ATOM   5793  N  NE2 . HIS B  1 298 ? 63.577  -9.441  22.202  0.0000 37.13 ? 405  HIS B NE2 1 
ATOM   5794  N  N   . LEU B  1 299 ? 62.821  -7.018  15.842  1.00   29.36 ? 406  LEU B N   1 
ATOM   5795  C  CA  . LEU B  1 299 ? 62.403  -6.915  14.445  1.00   24.24 ? 406  LEU B CA  1 
ATOM   5796  C  C   . LEU B  1 299 ? 63.473  -6.215  13.591  1.00   22.22 ? 406  LEU B C   1 
ATOM   5797  O  O   . LEU B  1 299 ? 63.931  -5.121  13.916  1.00   21.84 ? 406  LEU B O   1 
ATOM   5798  C  CB  . LEU B  1 299 ? 61.071  -6.164  14.376  1.00   21.75 ? 406  LEU B CB  1 
ATOM   5799  C  CG  . LEU B  1 299 ? 59.775  -6.965  14.162  1.00   22.56 ? 406  LEU B CG  1 
ATOM   5800  C  CD1 . LEU B  1 299 ? 59.844  -8.347  14.760  1.00   19.44 ? 406  LEU B CD1 1 
ATOM   5801  C  CD2 . LEU B  1 299 ? 58.612  -6.182  14.741  1.00   22.66 ? 406  LEU B CD2 1 
ATOM   5802  N  N   . ASN B  1 300 ? 63.877  -6.850  12.499  1.00   22.82 ? 407  ASN B N   1 
ATOM   5803  C  CA  . ASN B  1 300 ? 64.899  -6.276  11.639  1.00   22.78 ? 407  ASN B CA  1 
ATOM   5804  C  C   . ASN B  1 300 ? 64.290  -5.536  10.463  1.00   21.73 ? 407  ASN B C   1 
ATOM   5805  O  O   . ASN B  1 300 ? 63.391  -6.042  9.796   1.00   22.22 ? 407  ASN B O   1 
ATOM   5806  C  CB  . ASN B  1 300 ? 65.836  -7.385  11.152  1.00   25.83 ? 407  ASN B CB  1 
ATOM   5807  C  CG  . ASN B  1 300 ? 66.308  -8.288  12.301  1.00   30.13 ? 407  ASN B CG  1 
ATOM   5808  O  OD1 . ASN B  1 300 ? 67.036  -7.848  13.191  1.00   32.45 ? 407  ASN B OD1 1 
ATOM   5809  N  ND2 . ASN B  1 300 ? 65.875  -9.548  12.290  1.00   33.22 ? 407  ASN B ND2 1 
ATOM   5810  N  N   . ALA B  1 301 ? 64.786  -4.328  10.227  1.00   20.03 ? 408  ALA B N   1 
ATOM   5811  C  CA  . ALA B  1 301 ? 64.328  -3.494  9.122   1.00   22.12 ? 408  ALA B CA  1 
ATOM   5812  C  C   . ALA B  1 301 ? 65.441  -2.494  8.843   1.00   23.74 ? 408  ALA B C   1 
ATOM   5813  O  O   . ALA B  1 301 ? 66.213  -2.152  9.736   1.00   22.41 ? 408  ALA B O   1 
ATOM   5814  C  CB  . ALA B  1 301 ? 63.048  -2.764  9.499   1.00   16.56 ? 408  ALA B CB  1 
ATOM   5815  N  N   . ASN B  1 302 ? 65.535  -2.029  7.607   1.00   26.45 ? 409  ASN B N   1 
ATOM   5816  C  CA  . ASN B  1 302 ? 66.579  -1.078  7.280   1.00   29.31 ? 409  ASN B CA  1 
ATOM   5817  C  C   . ASN B  1 302 ? 66.111  0.357   7.430   1.00   27.33 ? 409  ASN B C   1 
ATOM   5818  O  O   . ASN B  1 302 ? 66.884  1.278   7.200   1.00   27.22 ? 409  ASN B O   1 
ATOM   5819  C  CB  . ASN B  1 302 ? 67.087  -1.315  5.854   1.00   34.43 ? 409  ASN B CB  1 
ATOM   5820  C  CG  . ASN B  1 302 ? 67.836  -2.636  5.719   1.00   42.30 ? 409  ASN B CG  1 
ATOM   5821  O  OD1 . ASN B  1 302 ? 68.788  -2.903  6.467   1.00   43.75 ? 409  ASN B OD1 1 
ATOM   5822  N  ND2 . ASN B  1 302 ? 67.414  -3.471  4.763   1.00   42.02 ? 409  ASN B ND2 1 
ATOM   5823  N  N   . ASP B  1 303 ? 64.859  0.559   7.836   1.00   25.69 ? 410  ASP B N   1 
ATOM   5824  C  CA  . ASP B  1 303 ? 64.364  1.931   7.965   1.00   22.85 ? 410  ASP B CA  1 
ATOM   5825  C  C   . ASP B  1 303 ? 63.854  2.331   9.346   1.00   20.60 ? 410  ASP B C   1 
ATOM   5826  O  O   . ASP B  1 303 ? 63.047  3.255   9.461   1.00   18.54 ? 410  ASP B O   1 
ATOM   5827  C  CB  . ASP B  1 303 ? 63.276  2.191   6.917   1.00   22.33 ? 410  ASP B CB  1 
ATOM   5828  C  CG  . ASP B  1 303 ? 61.992  1.420   7.197   1.00   21.84 ? 410  ASP B CG  1 
ATOM   5829  O  OD1 . ASP B  1 303 ? 62.061  0.299   7.748   1.00   16.95 ? 410  ASP B OD1 1 
ATOM   5830  O  OD2 . ASP B  1 303 ? 60.910  1.942   6.854   1.00   23.38 ? 410  ASP B OD2 1 
ATOM   5831  N  N   . TRP B  1 304 ? 64.293  1.640   10.395  1.00   18.32 ? 411  TRP B N   1 
ATOM   5832  C  CA  . TRP B  1 304 ? 63.862  2.041   11.737  1.00   19.00 ? 411  TRP B CA  1 
ATOM   5833  C  C   . TRP B  1 304 ? 64.330  3.483   11.943  1.00   16.44 ? 411  TRP B C   1 
ATOM   5834  O  O   . TRP B  1 304 ? 65.461  3.815   11.646  1.00   18.26 ? 411  TRP B O   1 
ATOM   5835  C  CB  . TRP B  1 304 ? 64.483  1.151   12.820  1.00   18.46 ? 411  TRP B CB  1 
ATOM   5836  C  CG  . TRP B  1 304 ? 63.756  -0.160  13.044  1.00   18.14 ? 411  TRP B CG  1 
ATOM   5837  C  CD1 . TRP B  1 304 ? 64.259  -1.420  12.869  1.00   18.08 ? 411  TRP B CD1 1 
ATOM   5838  C  CD2 . TRP B  1 304 ? 62.408  -0.328  13.504  1.00   17.30 ? 411  TRP B CD2 1 
ATOM   5839  N  NE1 . TRP B  1 304 ? 63.308  -2.362  13.198  1.00   16.89 ? 411  TRP B NE1 1 
ATOM   5840  C  CE2 . TRP B  1 304 ? 62.163  -1.717  13.592  1.00   20.07 ? 411  TRP B CE2 1 
ATOM   5841  C  CE3 . TRP B  1 304 ? 61.382  0.562   13.852  1.00   19.50 ? 411  TRP B CE3 1 
ATOM   5842  C  CZ2 . TRP B  1 304 ? 60.932  -2.237  14.016  1.00   18.88 ? 411  TRP B CZ2 1 
ATOM   5843  C  CZ3 . TRP B  1 304 ? 60.166  0.051   14.271  1.00   17.78 ? 411  TRP B CZ3 1 
ATOM   5844  C  CH2 . TRP B  1 304 ? 59.949  -1.343  14.350  1.00   18.98 ? 411  TRP B CH2 1 
ATOM   5845  N  N   . ALA B  1 305 ? 63.451  4.343   12.423  1.00   16.71 ? 412  ALA B N   1 
ATOM   5846  C  CA  . ALA B  1 305 ? 63.816  5.732   12.649  1.00   19.10 ? 412  ALA B CA  1 
ATOM   5847  C  C   . ALA B  1 305 ? 63.081  6.190   13.884  1.00   16.99 ? 412  ALA B C   1 
ATOM   5848  O  O   . ALA B  1 305 ? 61.981  5.717   14.157  1.00   22.31 ? 412  ALA B O   1 
ATOM   5849  C  CB  . ALA B  1 305 ? 63.417  6.597   11.437  1.00   16.98 ? 412  ALA B CB  1 
ATOM   5850  N  N   . THR B  1 306 ? 63.694  7.094   14.635  1.00   18.60 ? 413  THR B N   1 
ATOM   5851  C  CA  . THR B  1 306 ? 63.089  7.621   15.852  1.00   19.04 ? 413  THR B CA  1 
ATOM   5852  C  C   . THR B  1 306 ? 62.291  8.865   15.494  1.00   18.33 ? 413  THR B C   1 
ATOM   5853  O  O   . THR B  1 306 ? 62.821  9.751   14.844  1.00   17.39 ? 413  THR B O   1 
ATOM   5854  C  CB  . THR B  1 306 ? 64.172  7.993   16.866  1.00   19.37 ? 413  THR B CB  1 
ATOM   5855  O  OG1 . THR B  1 306 ? 65.005  6.850   17.103  1.00   18.57 ? 413  THR B OG1 1 
ATOM   5856  C  CG2 . THR B  1 306 ? 63.541  8.449   18.168  1.00   17.90 ? 413  THR B CG2 1 
ATOM   5857  N  N   . ASN B  1 307 ? 61.022  8.933   15.901  1.00   17.35 ? 414  ASN B N   1 
ATOM   5858  C  CA  . ASN B  1 307 ? 60.225  10.100  15.572  1.00   17.43 ? 414  ASN B CA  1 
ATOM   5859  C  C   . ASN B  1 307 ? 60.371  11.217  16.604  1.00   20.75 ? 414  ASN B C   1 
ATOM   5860  O  O   . ASN B  1 307 ? 61.163  11.114  17.548  1.00   20.43 ? 414  ASN B O   1 
ATOM   5861  C  CB  . ASN B  1 307 ? 58.750  9.725   15.384  1.00   14.87 ? 414  ASN B CB  1 
ATOM   5862  C  CG  . ASN B  1 307 ? 58.111  9.219   16.642  1.00   17.09 ? 414  ASN B CG  1 
ATOM   5863  O  OD1 . ASN B  1 307 ? 58.666  9.350   17.735  1.00   16.55 ? 414  ASN B OD1 1 
ATOM   5864  N  ND2 . ASN B  1 307 ? 56.920  8.642   16.504  1.00   16.25 ? 414  ASN B ND2 1 
ATOM   5865  N  N   . GLY B  1 308 ? 59.608  12.288  16.405  1.00   21.39 ? 415  GLY B N   1 
ATOM   5866  C  CA  . GLY B  1 308 ? 59.676  13.447  17.280  1.00   20.67 ? 415  GLY B CA  1 
ATOM   5867  C  C   . GLY B  1 308 ? 59.454  13.202  18.756  1.00   22.27 ? 415  GLY B C   1 
ATOM   5868  O  O   . GLY B  1 308 ? 59.857  14.022  19.576  1.00   23.26 ? 415  GLY B O   1 
ATOM   5869  N  N   . VAL B  1 309 ? 58.814  12.093  19.108  1.00   20.01 ? 416  VAL B N   1 
ATOM   5870  C  CA  . VAL B  1 309 ? 58.572  11.817  20.510  1.00   21.30 ? 416  VAL B CA  1 
ATOM   5871  C  C   . VAL B  1 309 ? 59.385  10.637  21.044  1.00   21.13 ? 416  VAL B C   1 
ATOM   5872  O  O   . VAL B  1 309 ? 59.053  10.057  22.075  1.00   23.13 ? 416  VAL B O   1 
ATOM   5873  C  CB  . VAL B  1 309 ? 57.072  11.601  20.782  1.00   22.20 ? 416  VAL B CB  1 
ATOM   5874  C  CG1 . VAL B  1 309 ? 56.318  12.878  20.426  1.00   19.97 ? 416  VAL B CG1 1 
ATOM   5875  C  CG2 . VAL B  1 309 ? 56.548  10.411  19.980  1.00   22.55 ? 416  VAL B CG2 1 
ATOM   5876  N  N   . GLY B  1 310 ? 60.452  10.289  20.338  1.00   18.14 ? 417  GLY B N   1 
ATOM   5877  C  CA  . GLY B  1 310 ? 61.312  9.212   20.794  1.00   19.37 ? 417  GLY B CA  1 
ATOM   5878  C  C   . GLY B  1 310 ? 60.876  7.780   20.542  1.00   20.73 ? 417  GLY B C   1 
ATOM   5879  O  O   . GLY B  1 310 ? 61.401  6.848   21.159  1.00   17.83 ? 417  GLY B O   1 
ATOM   5880  N  N   . ARG B  1 311 ? 59.915  7.572   19.655  1.00   19.51 ? 418  ARG B N   1 
ATOM   5881  C  CA  . ARG B  1 311 ? 59.506  6.206   19.375  1.00   19.15 ? 418  ARG B CA  1 
ATOM   5882  C  C   . ARG B  1 311 ? 60.085  5.755   18.039  1.00   17.46 ? 418  ARG B C   1 
ATOM   5883  O  O   . ARG B  1 311 ? 60.259  6.557   17.125  1.00   15.05 ? 418  ARG B O   1 
ATOM   5884  C  CB  . ARG B  1 311 ? 57.974  6.089   19.393  1.00   17.51 ? 418  ARG B CB  1 
ATOM   5885  C  CG  . ARG B  1 311 ? 57.412  6.142   20.802  1.00   17.69 ? 418  ARG B CG  1 
ATOM   5886  C  CD  . ARG B  1 311 ? 55.959  5.686   20.906  1.00   21.70 ? 418  ARG B CD  1 
ATOM   5887  N  NE  . ARG B  1 311 ? 55.045  6.759   20.585  1.00   26.80 ? 418  ARG B NE  1 
ATOM   5888  C  CZ  . ARG B  1 311 ? 54.255  7.359   21.464  1.00   23.91 ? 418  ARG B CZ  1 
ATOM   5889  N  NH1 . ARG B  1 311 ? 53.466  8.330   21.055  1.00   23.04 ? 418  ARG B NH1 1 
ATOM   5890  N  NH2 . ARG B  1 311 ? 54.239  6.983   22.736  1.00   24.08 ? 418  ARG B NH2 1 
ATOM   5891  N  N   . LYS B  1 312 ? 60.425  4.476   17.957  1.00   19.02 ? 419  LYS B N   1 
ATOM   5892  C  CA  . LYS B  1 312 ? 60.968  3.895   16.729  1.00   20.10 ? 419  LYS B CA  1 
ATOM   5893  C  C   . LYS B  1 312 ? 59.823  3.503   15.805  1.00   20.20 ? 419  LYS B C   1 
ATOM   5894  O  O   . LYS B  1 312 ? 58.843  2.889   16.241  1.00   19.97 ? 419  LYS B O   1 
ATOM   5895  C  CB  . LYS B  1 312 ? 61.775  2.627   17.031  1.00   19.61 ? 419  LYS B CB  1 
ATOM   5896  C  CG  . LYS B  1 312 ? 63.065  2.841   17.760  1.00   22.46 ? 419  LYS B CG  1 
ATOM   5897  C  CD  . LYS B  1 312 ? 64.073  3.559   16.905  1.00   27.55 ? 419  LYS B CD  1 
ATOM   5898  C  CE  . LYS B  1 312 ? 65.369  3.808   17.694  1.00   33.35 ? 419  LYS B CE  1 
ATOM   5899  N  NZ  . LYS B  1 312 ? 65.156  4.718   18.881  1.00   31.97 ? 419  LYS B NZ  1 
ATOM   5900  N  N   . VAL B  1 313 ? 59.941  3.857   14.531  1.00   20.28 ? 420  VAL B N   1 
ATOM   5901  C  CA  . VAL B  1 313 ? 58.920  3.492   13.554  1.00   20.59 ? 420  VAL B CA  1 
ATOM   5902  C  C   . VAL B  1 313 ? 59.579  3.015   12.264  1.00   20.71 ? 420  VAL B C   1 
ATOM   5903  O  O   . VAL B  1 313 ? 60.653  3.492   11.887  1.00   20.53 ? 420  VAL B O   1 
ATOM   5904  C  CB  . VAL B  1 313 ? 57.978  4.682   13.190  1.00   22.49 ? 420  VAL B CB  1 
ATOM   5905  C  CG1 . VAL B  1 313 ? 57.142  5.061   14.375  1.00   26.20 ? 420  VAL B CG1 1 
ATOM   5906  C  CG2 . VAL B  1 313 ? 58.794  5.877   12.704  1.00   21.40 ? 420  VAL B CG2 1 
ATOM   5907  N  N   . SER B  1 314 ? 58.923  2.069   11.602  1.00   19.91 ? 421  SER B N   1 
ATOM   5908  C  CA  . SER B  1 314 ? 59.387  1.527   10.336  1.00   17.92 ? 421  SER B CA  1 
ATOM   5909  C  C   . SER B  1 314 ? 58.182  1.423   9.393   1.00   19.28 ? 421  SER B C   1 
ATOM   5910  O  O   . SER B  1 314 ? 57.061  1.164   9.834   1.00   16.77 ? 421  SER B O   1 
ATOM   5911  C  CB  . SER B  1 314 ? 59.981  0.135   10.538  1.00   19.46 ? 421  SER B CB  1 
ATOM   5912  O  OG  . SER B  1 314 ? 60.141  -0.507  9.285   1.00   20.65 ? 421  SER B OG  1 
ATOM   5913  N  N   . HIS B  1 315 ? 58.412  1.618   8.098   1.00   17.54 ? 422  HIS B N   1 
ATOM   5914  C  CA  . HIS B  1 315 ? 57.328  1.521   7.135   1.00   16.36 ? 422  HIS B CA  1 
ATOM   5915  C  C   . HIS B  1 315 ? 56.919  0.061   6.910   1.00   17.37 ? 422  HIS B C   1 
ATOM   5916  O  O   . HIS B  1 315 ? 55.878  -0.223  6.317   1.00   16.56 ? 422  HIS B O   1 
ATOM   5917  C  CB  . HIS B  1 315 ? 57.732  2.189   5.816   1.00   15.05 ? 422  HIS B CB  1 
ATOM   5918  C  CG  . HIS B  1 315 ? 57.929  3.670   5.936   1.00   16.39 ? 422  HIS B CG  1 
ATOM   5919  N  ND1 . HIS B  1 315 ? 58.983  4.225   6.633   1.00   17.53 ? 422  HIS B ND1 1 
ATOM   5920  C  CD2 . HIS B  1 315 ? 57.182  4.708   5.496   1.00   14.11 ? 422  HIS B CD2 1 
ATOM   5921  C  CE1 . HIS B  1 315 ? 58.875  5.542   6.615   1.00   17.12 ? 422  HIS B CE1 1 
ATOM   5922  N  NE2 . HIS B  1 315 ? 57.790  5.862   5.931   1.00   16.03 ? 422  HIS B NE2 1 
ATOM   5923  N  N   . SER B  1 316 ? 57.729  -0.869  7.399   1.00   15.86 ? 423  SER B N   1 
ATOM   5924  C  CA  . SER B  1 316 ? 57.393  -2.285  7.257   1.00   19.45 ? 423  SER B CA  1 
ATOM   5925  C  C   . SER B  1 316 ? 56.640  -2.805  8.472   1.00   20.31 ? 423  SER B C   1 
ATOM   5926  O  O   . SER B  1 316 ? 55.906  -3.795  8.372   1.00   22.20 ? 423  SER B O   1 
ATOM   5927  C  CB  . SER B  1 316 ? 58.655  -3.143  7.112   1.00   16.66 ? 423  SER B CB  1 
ATOM   5928  O  OG  . SER B  1 316 ? 59.306  -2.902  5.885   1.00   17.20 ? 423  SER B OG  1 
ATOM   5929  N  N   . TYR B  1 317 ? 56.807  -2.129  9.606   1.00   17.93 ? 424  TYR B N   1 
ATOM   5930  C  CA  . TYR B  1 317 ? 56.211  -2.588  10.859  1.00   19.33 ? 424  TYR B CA  1 
ATOM   5931  C  C   . TYR B  1 317 ? 55.381  -1.603  11.670  1.00   18.88 ? 424  TYR B C   1 
ATOM   5932  O  O   . TYR B  1 317 ? 54.790  -1.986  12.677  1.00   20.65 ? 424  TYR B O   1 
ATOM   5933  C  CB  . TYR B  1 317 ? 57.320  -3.066  11.795  1.00   18.58 ? 424  TYR B CB  1 
ATOM   5934  C  CG  . TYR B  1 317 ? 58.262  -4.116  11.264  1.00   19.58 ? 424  TYR B CG  1 
ATOM   5935  C  CD1 . TYR B  1 317 ? 57.785  -5.352  10.806  1.00   19.35 ? 424  TYR B CD1 1 
ATOM   5936  C  CD2 . TYR B  1 317 ? 59.645  -3.935  11.357  1.00   16.57 ? 424  TYR B CD2 1 
ATOM   5937  C  CE1 . TYR B  1 317 ? 58.668  -6.387  10.468  1.00   19.88 ? 424  TYR B CE1 1 
ATOM   5938  C  CE2 . TYR B  1 317 ? 60.537  -4.967  11.025  1.00   19.89 ? 424  TYR B CE2 1 
ATOM   5939  C  CZ  . TYR B  1 317 ? 60.042  -6.189  10.588  1.00   19.27 ? 424  TYR B CZ  1 
ATOM   5940  O  OH  . TYR B  1 317 ? 60.918  -7.217  10.305  1.00   17.52 ? 424  TYR B OH  1 
ATOM   5941  N  N   . GLY B  1 318 ? 55.342  -0.340  11.274  1.00   18.64 ? 425  GLY B N   1 
ATOM   5942  C  CA  . GLY B  1 318 ? 54.619  0.608   12.094  1.00   17.30 ? 425  GLY B CA  1 
ATOM   5943  C  C   . GLY B  1 318 ? 55.428  0.786   13.383  1.00   19.15 ? 425  GLY B C   1 
ATOM   5944  O  O   . GLY B  1 318 ? 56.647  0.977   13.334  1.00   15.40 ? 425  GLY B O   1 
ATOM   5945  N  N   . TYR B  1 319 ? 54.775  0.697   14.538  1.00   18.44 ? 426  TYR B N   1 
ATOM   5946  C  CA  . TYR B  1 319 ? 55.480  0.854   15.807  1.00   16.75 ? 426  TYR B CA  1 
ATOM   5947  C  C   . TYR B  1 319 ? 56.072  -0.450  16.325  1.00   18.16 ? 426  TYR B C   1 
ATOM   5948  O  O   . TYR B  1 319 ? 56.645  -0.495  17.417  1.00   18.77 ? 426  TYR B O   1 
ATOM   5949  C  CB  . TYR B  1 319 ? 54.558  1.454   16.861  1.00   13.64 ? 426  TYR B CB  1 
ATOM   5950  C  CG  . TYR B  1 319 ? 54.312  2.903   16.604  1.00   13.53 ? 426  TYR B CG  1 
ATOM   5951  C  CD1 . TYR B  1 319 ? 53.300  3.316   15.737  1.00   9.63  ? 426  TYR B CD1 1 
ATOM   5952  C  CD2 . TYR B  1 319 ? 55.172  3.859   17.129  1.00   9.29  ? 426  TYR B CD2 1 
ATOM   5953  C  CE1 . TYR B  1 319 ? 53.164  4.657   15.391  1.00   12.85 ? 426  TYR B CE1 1 
ATOM   5954  C  CE2 . TYR B  1 319 ? 55.053  5.181   16.794  1.00   14.16 ? 426  TYR B CE2 1 
ATOM   5955  C  CZ  . TYR B  1 319 ? 54.056  5.581   15.920  1.00   12.91 ? 426  TYR B CZ  1 
ATOM   5956  O  OH  . TYR B  1 319 ? 54.014  6.891   15.542  1.00   13.93 ? 426  TYR B OH  1 
ATOM   5957  N  N   . GLY B  1 320 ? 55.933  -1.515  15.546  1.00   18.29 ? 427  GLY B N   1 
ATOM   5958  C  CA  . GLY B  1 320 ? 56.504  -2.777  15.968  1.00   17.95 ? 427  GLY B CA  1 
ATOM   5959  C  C   . GLY B  1 320 ? 55.509  -3.866  16.302  1.00   19.59 ? 427  GLY B C   1 
ATOM   5960  O  O   . GLY B  1 320 ? 54.319  -3.796  15.992  1.00   18.45 ? 427  GLY B O   1 
ATOM   5961  N  N   . LEU B  1 321 ? 56.017  -4.880  16.974  1.00   20.40 ? 428  LEU B N   1 
ATOM   5962  C  CA  . LEU B  1 321 ? 55.237  -6.045  17.352  1.00   20.51 ? 428  LEU B CA  1 
ATOM   5963  C  C   . LEU B  1 321 ? 54.247  -5.743  18.466  1.00   20.33 ? 428  LEU B C   1 
ATOM   5964  O  O   . LEU B  1 321 ? 54.583  -5.058  19.439  1.00   16.40 ? 428  LEU B O   1 
ATOM   5965  C  CB  . LEU B  1 321 ? 56.210  -7.129  17.800  1.00   26.85 ? 428  LEU B CB  1 
ATOM   5966  C  CG  . LEU B  1 321 ? 55.860  -8.603  17.640  1.00   35.85 ? 428  LEU B CG  1 
ATOM   5967  C  CD1 . LEU B  1 321 ? 55.634  -8.956  16.165  1.00   34.87 ? 428  LEU B CD1 1 
ATOM   5968  C  CD2 . LEU B  1 321 ? 57.024  -9.408  18.214  1.00   34.59 ? 428  LEU B CD2 1 
ATOM   5969  N  N   . LEU B  1 322 ? 53.024  -6.249  18.330  1.00   18.59 ? 429  LEU B N   1 
ATOM   5970  C  CA  . LEU B  1 322 ? 52.035  -6.041  19.372  1.00   17.82 ? 429  LEU B CA  1 
ATOM   5971  C  C   . LEU B  1 322 ? 52.509  -6.805  20.617  1.00   21.58 ? 429  LEU B C   1 
ATOM   5972  O  O   . LEU B  1 322 ? 53.163  -7.845  20.511  1.00   18.19 ? 429  LEU B O   1 
ATOM   5973  C  CB  . LEU B  1 322 ? 50.662  -6.556  18.936  1.00   17.48 ? 429  LEU B CB  1 
ATOM   5974  C  CG  . LEU B  1 322 ? 49.950  -5.831  17.790  1.00   22.28 ? 429  LEU B CG  1 
ATOM   5975  C  CD1 . LEU B  1 322 ? 48.567  -6.450  17.612  1.00   15.83 ? 429  LEU B CD1 1 
ATOM   5976  C  CD2 . LEU B  1 322 ? 49.825  -4.320  18.091  1.00   20.46 ? 429  LEU B CD2 1 
ATOM   5977  N  N   . ASP B  1 323 ? 52.187  -6.270  21.791  1.00   20.97 ? 430  ASP B N   1 
ATOM   5978  C  CA  . ASP B  1 323 ? 52.559  -6.875  23.071  1.00   21.51 ? 430  ASP B CA  1 
ATOM   5979  C  C   . ASP B  1 323 ? 51.258  -6.980  23.876  1.00   22.74 ? 430  ASP B C   1 
ATOM   5980  O  O   . ASP B  1 323 ? 50.835  -6.002  24.491  1.00   19.67 ? 430  ASP B O   1 
ATOM   5981  C  CB  . ASP B  1 323 ? 53.547  -5.951  23.783  1.00   21.43 ? 430  ASP B CB  1 
ATOM   5982  C  CG  . ASP B  1 323 ? 54.030  -6.504  25.120  1.00   26.66 ? 430  ASP B CG  1 
ATOM   5983  O  OD1 . ASP B  1 323 ? 53.308  -7.314  25.746  1.00   26.44 ? 430  ASP B OD1 1 
ATOM   5984  O  OD2 . ASP B  1 323 ? 55.137  -6.101  25.554  1.00   26.45 ? 430  ASP B OD2 1 
ATOM   5985  N  N   . ALA B  1 324 ? 50.624  -8.151  23.861  1.00   22.04 ? 431  ALA B N   1 
ATOM   5986  C  CA  . ALA B  1 324 ? 49.357  -8.343  24.563  1.00   20.70 ? 431  ALA B CA  1 
ATOM   5987  C  C   . ALA B  1 324 ? 49.420  -8.035  26.056  1.00   21.63 ? 431  ALA B C   1 
ATOM   5988  O  O   . ALA B  1 324 ? 48.536  -7.382  26.596  1.00   21.93 ? 431  ALA B O   1 
ATOM   5989  C  CB  . ALA B  1 324 ? 48.854  -9.765  24.344  1.00   21.80 ? 431  ALA B CB  1 
ATOM   5990  N  N   . GLY B  1 325 ? 50.457  -8.514  26.731  1.00   23.06 ? 432  GLY B N   1 
ATOM   5991  C  CA  . GLY B  1 325 ? 50.575  -8.249  28.153  1.00   22.65 ? 432  GLY B CA  1 
ATOM   5992  C  C   . GLY B  1 325 ? 50.580  -6.758  28.430  1.00   20.91 ? 432  GLY B C   1 
ATOM   5993  O  O   . GLY B  1 325 ? 49.883  -6.280  29.326  1.00   23.92 ? 432  GLY B O   1 
ATOM   5994  N  N   . ALA B  1 326 ? 51.362  -6.018  27.655  1.00   21.10 ? 433  ALA B N   1 
ATOM   5995  C  CA  . ALA B  1 326 ? 51.469  -4.570  27.825  1.00   20.38 ? 433  ALA B CA  1 
ATOM   5996  C  C   . ALA B  1 326 ? 50.161  -3.868  27.463  1.00   20.91 ? 433  ALA B C   1 
ATOM   5997  O  O   . ALA B  1 326 ? 49.771  -2.893  28.106  1.00   22.63 ? 433  ALA B O   1 
ATOM   5998  C  CB  . ALA B  1 326 ? 52.614  -4.031  26.970  1.00   20.60 ? 433  ALA B CB  1 
ATOM   5999  N  N   . MET B  1 327 ? 49.486  -4.368  26.435  1.00   19.09 ? 434  MET B N   1 
ATOM   6000  C  CA  . MET B  1 327 ? 48.226  -3.793  25.991  1.00   21.64 ? 434  MET B CA  1 
ATOM   6001  C  C   . MET B  1 327 ? 47.168  -3.866  27.097  1.00   23.39 ? 434  MET B C   1 
ATOM   6002  O  O   . MET B  1 327 ? 46.533  -2.864  27.436  1.00   24.09 ? 434  MET B O   1 
ATOM   6003  C  CB  . MET B  1 327 ? 47.707  -4.532  24.751  1.00   19.38 ? 434  MET B CB  1 
ATOM   6004  C  CG  . MET B  1 327 ? 48.339  -4.114  23.434  1.00   18.20 ? 434  MET B CG  1 
ATOM   6005  S  SD  . MET B  1 327 ? 47.797  -2.482  22.893  1.00   23.85 ? 434  MET B SD  1 
ATOM   6006  C  CE  . MET B  1 327 ? 46.156  -2.869  22.238  1.00   16.59 ? 434  MET B CE  1 
ATOM   6007  N  N   . VAL B  1 328 ? 46.980  -5.054  27.656  1.00   22.58 ? 435  VAL B N   1 
ATOM   6008  C  CA  . VAL B  1 328 ? 45.987  -5.236  28.703  1.00   27.06 ? 435  VAL B CA  1 
ATOM   6009  C  C   . VAL B  1 328 ? 46.372  -4.492  30.001  1.00   26.45 ? 435  VAL B C   1 
ATOM   6010  O  O   . VAL B  1 328 ? 45.508  -3.995  30.729  1.00   25.38 ? 435  VAL B O   1 
ATOM   6011  C  CB  . VAL B  1 328 ? 45.774  -6.751  28.943  1.00   28.19 ? 435  VAL B CB  1 
ATOM   6012  C  CG1 . VAL B  1 328 ? 46.356  -7.185  30.261  1.00   28.41 ? 435  VAL B CG1 1 
ATOM   6013  C  CG2 . VAL B  1 328 ? 44.319  -7.087  28.797  1.00   30.73 ? 435  VAL B CG2 1 
ATOM   6014  N  N   . ALA B  1 329 ? 47.670  -4.398  30.274  1.00   24.25 ? 436  ALA B N   1 
ATOM   6015  C  CA  . ALA B  1 329 ? 48.127  -3.696  31.464  1.00   24.60 ? 436  ALA B CA  1 
ATOM   6016  C  C   . ALA B  1 329 ? 47.809  -2.210  31.343  1.00   26.61 ? 436  ALA B C   1 
ATOM   6017  O  O   . ALA B  1 329 ? 47.190  -1.635  32.230  1.00   28.45 ? 436  ALA B O   1 
ATOM   6018  C  CB  . ALA B  1 329 ? 49.616  -3.884  31.652  1.00   23.99 ? 436  ALA B CB  1 
ATOM   6019  N  N   . LEU B  1 330 ? 48.224  -1.592  30.241  1.00   24.70 ? 437  LEU B N   1 
ATOM   6020  C  CA  . LEU B  1 330 ? 47.981  -0.170  30.038  1.00   25.72 ? 437  LEU B CA  1 
ATOM   6021  C  C   . LEU B  1 330 ? 46.486  0.161   29.924  1.00   26.52 ? 437  LEU B C   1 
ATOM   6022  O  O   . LEU B  1 330 ? 46.044  1.218   30.361  1.00   28.08 ? 437  LEU B O   1 
ATOM   6023  C  CB  . LEU B  1 330 ? 48.737  0.314   28.788  1.00   23.40 ? 437  LEU B CB  1 
ATOM   6024  C  CG  . LEU B  1 330 ? 48.745  1.805   28.435  1.00   22.98 ? 437  LEU B CG  1 
ATOM   6025  C  CD1 . LEU B  1 330 ? 49.381  2.626   29.552  1.00   21.96 ? 437  LEU B CD1 1 
ATOM   6026  C  CD2 . LEU B  1 330 ? 49.519  2.013   27.157  1.00   22.01 ? 437  LEU B CD2 1 
ATOM   6027  N  N   . ALA B  1 331 ? 45.705  -0.750  29.356  1.00   25.56 ? 438  ALA B N   1 
ATOM   6028  C  CA  . ALA B  1 331 ? 44.284  -0.511  29.187  1.00   24.54 ? 438  ALA B CA  1 
ATOM   6029  C  C   . ALA B  1 331 ? 43.543  -0.261  30.490  1.00   28.15 ? 438  ALA B C   1 
ATOM   6030  O  O   . ALA B  1 331 ? 42.674  0.611   30.565  1.00   23.89 ? 438  ALA B O   1 
ATOM   6031  C  CB  . ALA B  1 331 ? 43.651  -1.672  28.459  1.00   20.24 ? 438  ALA B CB  1 
ATOM   6032  N  N   . GLN B  1 332 ? 43.881  -1.033  31.516  1.00   31.03 ? 439  GLN B N   1 
ATOM   6033  C  CA  . GLN B  1 332 ? 43.215  -0.917  32.806  1.00   34.20 ? 439  GLN B CA  1 
ATOM   6034  C  C   . GLN B  1 332 ? 43.191  0.477   33.402  1.00   34.61 ? 439  GLN B C   1 
ATOM   6035  O  O   . GLN B  1 332 ? 42.170  0.907   33.924  1.00   35.14 ? 439  GLN B O   1 
ATOM   6036  C  CB  . GLN B  1 332 ? 43.838  -1.896  33.796  1.00   35.62 ? 439  GLN B CB  1 
ATOM   6037  C  CG  . GLN B  1 332 ? 43.490  -3.338  33.497  1.00   39.88 ? 439  GLN B CG  1 
ATOM   6038  C  CD  . GLN B  1 332 ? 44.340  -4.294  34.283  1.00   43.61 ? 439  GLN B CD  1 
ATOM   6039  O  OE1 . GLN B  1 332 ? 44.373  -4.233  35.508  1.00   48.14 ? 439  GLN B OE1 1 
ATOM   6040  N  NE2 . GLN B  1 332 ? 45.045  -5.180  33.588  1.00   44.44 ? 439  GLN B NE2 1 
ATOM   6041  N  N   . ASN B  1 333 ? 44.300  1.191   33.309  1.00   36.54 ? 440  ASN B N   1 
ATOM   6042  C  CA  . ASN B  1 333 ? 44.350  2.523   33.874  1.00   40.51 ? 440  ASN B CA  1 
ATOM   6043  C  C   . ASN B  1 333 ? 44.219  3.662   32.874  1.00   38.69 ? 440  ASN B C   1 
ATOM   6044  O  O   . ASN B  1 333 ? 44.394  4.831   33.220  1.00   40.36 ? 440  ASN B O   1 
ATOM   6045  C  CB  . ASN B  1 333 ? 45.623  2.648   34.711  1.00   46.70 ? 440  ASN B CB  1 
ATOM   6046  C  CG  . ASN B  1 333 ? 45.395  2.163   36.150  1.00   50.97 ? 440  ASN B CG  1 
ATOM   6047  O  OD1 . ASN B  1 333 ? 46.340  1.952   36.919  1.00   53.88 ? 440  ASN B OD1 1 
ATOM   6048  N  ND2 . ASN B  1 333 ? 44.116  1.994   36.516  1.00   45.83 ? 440  ASN B ND2 1 
ATOM   6049  N  N   . TRP B  1 334 ? 43.859  3.317   31.646  1.00   33.07 ? 441  TRP B N   1 
ATOM   6050  C  CA  . TRP B  1 334 ? 43.721  4.298   30.580  1.00   29.05 ? 441  TRP B CA  1 
ATOM   6051  C  C   . TRP B  1 334 ? 42.604  5.335   30.728  1.00   27.67 ? 441  TRP B C   1 
ATOM   6052  O  O   . TRP B  1 334 ? 41.444  5.006   30.970  1.00   28.88 ? 441  TRP B O   1 
ATOM   6053  C  CB  . TRP B  1 334 ? 43.555  3.574   29.243  1.00   24.41 ? 441  TRP B CB  1 
ATOM   6054  C  CG  . TRP B  1 334 ? 43.636  4.483   28.082  1.00   23.94 ? 441  TRP B CG  1 
ATOM   6055  C  CD1 . TRP B  1 334 ? 42.601  4.984   27.354  1.00   22.91 ? 441  TRP B CD1 1 
ATOM   6056  C  CD2 . TRP B  1 334 ? 44.829  5.029   27.521  1.00   24.06 ? 441  TRP B CD2 1 
ATOM   6057  N  NE1 . TRP B  1 334 ? 43.079  5.812   26.366  1.00   22.60 ? 441  TRP B NE1 1 
ATOM   6058  C  CE2 . TRP B  1 334 ? 44.446  5.856   26.447  1.00   23.41 ? 441  TRP B CE2 1 
ATOM   6059  C  CE3 . TRP B  1 334 ? 46.191  4.899   27.825  1.00   24.86 ? 441  TRP B CE3 1 
ATOM   6060  C  CZ2 . TRP B  1 334 ? 45.379  6.557   25.669  1.00   22.41 ? 441  TRP B CZ2 1 
ATOM   6061  C  CZ3 . TRP B  1 334 ? 47.119  5.595   27.056  1.00   27.52 ? 441  TRP B CZ3 1 
ATOM   6062  C  CH2 . TRP B  1 334 ? 46.705  6.416   25.988  1.00   23.54 ? 441  TRP B CH2 1 
ATOM   6063  N  N   . THR B  1 335 ? 42.970  6.598   30.564  1.00   27.00 ? 442  THR B N   1 
ATOM   6064  C  CA  . THR B  1 335 ? 42.021  7.697   30.634  1.00   27.10 ? 442  THR B CA  1 
ATOM   6065  C  C   . THR B  1 335 ? 41.619  8.022   29.203  1.00   24.21 ? 442  THR B C   1 
ATOM   6066  O  O   . THR B  1 335 ? 42.476  8.313   28.380  1.00   24.90 ? 442  THR B O   1 
ATOM   6067  C  CB  . THR B  1 335 ? 42.668  8.935   31.260  1.00   27.76 ? 442  THR B CB  1 
ATOM   6068  O  OG1 . THR B  1 335 ? 43.050  8.633   32.605  1.00   30.18 ? 442  THR B OG1 1 
ATOM   6069  C  CG2 . THR B  1 335 ? 41.695  10.096  31.262  1.00   29.58 ? 442  THR B CG2 1 
ATOM   6070  N  N   . THR B  1 336 ? 40.324  7.972   28.909  1.00   24.75 ? 443  THR B N   1 
ATOM   6071  C  CA  . THR B  1 336 ? 39.849  8.238   27.555  1.00   27.98 ? 443  THR B CA  1 
ATOM   6072  C  C   . THR B  1 336 ? 40.382  9.550   27.002  1.00   27.71 ? 443  THR B C   1 
ATOM   6073  O  O   . THR B  1 336 ? 40.328  10.581  27.675  1.00   25.96 ? 443  THR B O   1 
ATOM   6074  C  CB  . THR B  1 336 ? 38.316  8.243   27.490  1.00   29.99 ? 443  THR B CB  1 
ATOM   6075  O  OG1 . THR B  1 336 ? 37.839  6.917   27.754  1.00   39.30 ? 443  THR B OG1 1 
ATOM   6076  C  CG2 . THR B  1 336 ? 37.840  8.647   26.101  1.00   31.77 ? 443  THR B CG2 1 
ATOM   6077  N  N   . VAL B  1 337 ? 40.898  9.503   25.776  1.00   25.26 ? 444  VAL B N   1 
ATOM   6078  C  CA  . VAL B  1 337 ? 41.461  10.692  25.151  1.00   22.89 ? 444  VAL B CA  1 
ATOM   6079  C  C   . VAL B  1 337 ? 40.403  11.756  24.894  1.00   23.28 ? 444  VAL B C   1 
ATOM   6080  O  O   . VAL B  1 337 ? 39.210  11.461  24.806  1.00   24.43 ? 444  VAL B O   1 
ATOM   6081  C  CB  . VAL B  1 337 ? 42.159  10.351  23.815  1.00   22.12 ? 444  VAL B CB  1 
ATOM   6082  C  CG1 . VAL B  1 337 ? 43.378  9.459   24.075  1.00   21.75 ? 444  VAL B CG1 1 
ATOM   6083  C  CG2 . VAL B  1 337 ? 41.171  9.655   22.870  1.00   21.91 ? 444  VAL B CG2 1 
ATOM   6084  N  N   . ALA B  1 338 ? 40.858  12.999  24.778  1.00   23.46 ? 445  ALA B N   1 
ATOM   6085  C  CA  . ALA B  1 338 ? 39.978  14.127  24.515  1.00   22.64 ? 445  ALA B CA  1 
ATOM   6086  C  C   . ALA B  1 338 ? 39.321  13.964  23.151  1.00   22.89 ? 445  ALA B C   1 
ATOM   6087  O  O   . ALA B  1 338 ? 39.759  13.153  22.329  1.00   24.46 ? 445  ALA B O   1 
ATOM   6088  C  CB  . ALA B  1 338 ? 40.766  15.419  24.557  1.00   18.10 ? 445  ALA B CB  1 
ATOM   6089  N  N   . PRO B  1 339 ? 38.262  14.743  22.892  1.00   22.64 ? 446  PRO B N   1 
ATOM   6090  C  CA  . PRO B  1 339 ? 37.548  14.675  21.621  1.00   19.93 ? 446  PRO B CA  1 
ATOM   6091  C  C   . PRO B  1 339 ? 38.493  14.925  20.458  1.00   19.66 ? 446  PRO B C   1 
ATOM   6092  O  O   . PRO B  1 339 ? 39.409  15.742  20.545  1.00   18.42 ? 446  PRO B O   1 
ATOM   6093  C  CB  . PRO B  1 339 ? 36.488  15.768  21.762  1.00   20.62 ? 446  PRO B CB  1 
ATOM   6094  C  CG  . PRO B  1 339 ? 36.203  15.761  23.232  1.00   20.75 ? 446  PRO B CG  1 
ATOM   6095  C  CD  . PRO B  1 339 ? 37.602  15.686  23.815  1.00   22.02 ? 446  PRO B CD  1 
ATOM   6096  N  N   . GLN B  1 340 ? 38.255  14.219  19.365  1.00   17.20 ? 447  GLN B N   1 
ATOM   6097  C  CA  . GLN B  1 340 ? 39.077  14.339  18.175  1.00   17.24 ? 447  GLN B CA  1 
ATOM   6098  C  C   . GLN B  1 340 ? 38.881  15.673  17.455  1.00   17.81 ? 447  GLN B C   1 
ATOM   6099  O  O   . GLN B  1 340 ? 37.754  16.059  17.154  1.00   20.04 ? 447  GLN B O   1 
ATOM   6100  C  CB  . GLN B  1 340 ? 38.753  13.182  17.219  1.00   17.95 ? 447  GLN B CB  1 
ATOM   6101  C  CG  . GLN B  1 340 ? 39.567  13.181  15.938  1.00   20.58 ? 447  GLN B CG  1 
ATOM   6102  C  CD  . GLN B  1 340 ? 38.841  12.523  14.779  1.00   19.18 ? 447  GLN B CD  1 
ATOM   6103  O  OE1 . GLN B  1 340 ? 37.776  12.971  14.369  1.00   24.02 ? 447  GLN B OE1 1 
ATOM   6104  N  NE2 . GLN B  1 340 ? 39.422  11.458  14.244  1.00   21.18 ? 447  GLN B NE2 1 
ATOM   6105  N  N   . ARG B  1 341 ? 39.979  16.378  17.190  1.00   17.13 ? 448  ARG B N   1 
ATOM   6106  C  CA  . ARG B  1 341 ? 39.931  17.648  16.467  1.00   16.32 ? 448  ARG B CA  1 
ATOM   6107  C  C   . ARG B  1 341 ? 40.472  17.389  15.067  1.00   17.25 ? 448  ARG B C   1 
ATOM   6108  O  O   . ARG B  1 341 ? 41.231  16.441  14.854  1.00   16.95 ? 448  ARG B O   1 
ATOM   6109  C  CB  . ARG B  1 341 ? 40.818  18.696  17.133  1.00   18.84 ? 448  ARG B CB  1 
ATOM   6110  C  CG  . ARG B  1 341 ? 40.532  18.903  18.583  1.00   20.20 ? 448  ARG B CG  1 
ATOM   6111  C  CD  . ARG B  1 341 ? 41.294  20.068  19.139  1.00   22.75 ? 448  ARG B CD  1 
ATOM   6112  N  NE  . ARG B  1 341 ? 40.866  20.323  20.510  1.00   23.86 ? 448  ARG B NE  1 
ATOM   6113  C  CZ  . ARG B  1 341 ? 41.137  21.431  21.185  1.00   24.14 ? 448  ARG B CZ  1 
ATOM   6114  N  NH1 . ARG B  1 341 ? 40.697  21.567  22.428  1.00   26.00 ? 448  ARG B NH1 1 
ATOM   6115  N  NH2 . ARG B  1 341 ? 41.831  22.406  20.615  1.00   21.22 ? 448  ARG B NH2 1 
ATOM   6116  N  N   . LYS B  1 342 ? 40.101  18.246  14.125  1.00   16.96 ? 449  LYS B N   1 
ATOM   6117  C  CA  . LYS B  1 342 ? 40.530  18.114  12.744  1.00   16.90 ? 449  LYS B CA  1 
ATOM   6118  C  C   . LYS B  1 342 ? 40.896  19.480  12.200  1.00   17.09 ? 449  LYS B C   1 
ATOM   6119  O  O   . LYS B  1 342 ? 40.065  20.369  12.136  1.00   17.31 ? 449  LYS B O   1 
ATOM   6120  C  CB  . LYS B  1 342 ? 39.403  17.498  11.912  1.00   16.88 ? 449  LYS B CB  1 
ATOM   6121  C  CG  . LYS B  1 342 ? 39.709  17.356  10.438  1.00   18.53 ? 449  LYS B CG  1 
ATOM   6122  C  CD  . LYS B  1 342 ? 38.575  16.615  9.746   1.00   17.05 ? 449  LYS B CD  1 
ATOM   6123  C  CE  . LYS B  1 342 ? 38.871  16.343  8.269   1.00   15.86 ? 449  LYS B CE  1 
ATOM   6124  N  NZ  . LYS B  1 342 ? 37.823  15.440  7.681   1.00   12.71 ? 449  LYS B NZ  1 
ATOM   6125  N  N   . CYS B  1 343 ? 42.152  19.643  11.813  1.00   17.00 ? 450  CYS B N   1 
ATOM   6126  C  CA  . CYS B  1 343 ? 42.636  20.909  11.290  1.00   17.39 ? 450  CYS B CA  1 
ATOM   6127  C  C   . CYS B  1 343 ? 43.013  20.720  9.820   1.00   19.14 ? 450  CYS B C   1 
ATOM   6128  O  O   . CYS B  1 343 ? 43.899  19.925  9.482   1.00   19.13 ? 450  CYS B O   1 
ATOM   6129  C  CB  . CYS B  1 343 ? 43.837  21.385  12.124  1.00   19.40 ? 450  CYS B CB  1 
ATOM   6130  S  SG  . CYS B  1 343 ? 44.605  22.968  11.621  1.00   25.22 ? 450  CYS B SG  1 
ATOM   6131  N  N   . ILE B  1 344 ? 42.320  21.451  8.956   1.00   17.02 ? 451  ILE B N   1 
ATOM   6132  C  CA  . ILE B  1 344 ? 42.521  21.376  7.514   1.00   18.37 ? 451  ILE B CA  1 
ATOM   6133  C  C   . ILE B  1 344 ? 43.363  22.562  7.030   1.00   20.32 ? 451  ILE B C   1 
ATOM   6134  O  O   . ILE B  1 344 ? 43.024  23.724  7.279   1.00   19.55 ? 451  ILE B O   1 
ATOM   6135  C  CB  . ILE B  1 344 ? 41.156  21.402  6.783   1.00   17.64 ? 451  ILE B CB  1 
ATOM   6136  C  CG1 . ILE B  1 344 ? 40.285  20.220  7.248   1.00   18.60 ? 451  ILE B CG1 1 
ATOM   6137  C  CG2 . ILE B  1 344 ? 41.369  21.421  5.281   1.00   16.18 ? 451  ILE B CG2 1 
ATOM   6138  C  CD1 . ILE B  1 344 ? 38.880  20.286  6.716   1.00   14.75 ? 451  ILE B CD1 1 
ATOM   6139  N  N   . ILE B  1 345 ? 44.444  22.267  6.319   1.00   18.93 ? 452  ILE B N   1 
ATOM   6140  C  CA  . ILE B  1 345 ? 45.330  23.308  5.825   1.00   19.44 ? 452  ILE B CA  1 
ATOM   6141  C  C   . ILE B  1 345 ? 45.627  23.080  4.354   1.00   21.26 ? 452  ILE B C   1 
ATOM   6142  O  O   . ILE B  1 345 ? 46.356  22.148  4.000   1.00   21.13 ? 452  ILE B O   1 
ATOM   6143  C  CB  . ILE B  1 345 ? 46.653  23.288  6.618   1.00   22.12 ? 452  ILE B CB  1 
ATOM   6144  C  CG1 . ILE B  1 345 ? 46.338  23.446  8.111   1.00   23.56 ? 452  ILE B CG1 1 
ATOM   6145  C  CG2 . ILE B  1 345 ? 47.592  24.392  6.129   1.00   19.58 ? 452  ILE B CG2 1 
ATOM   6146  C  CD1 . ILE B  1 345 ? 47.395  22.858  9.027   1.00   24.95 ? 452  ILE B CD1 1 
ATOM   6147  N  N   . ASP B  1 346 ? 45.059  23.916  3.490   1.00   22.03 ? 453  ASP B N   1 
ATOM   6148  C  CA  . ASP B  1 346 ? 45.307  23.767  2.063   1.00   26.09 ? 453  ASP B CA  1 
ATOM   6149  C  C   . ASP B  1 346 ? 46.619  24.497  1.804   1.00   26.87 ? 453  ASP B C   1 
ATOM   6150  O  O   . ASP B  1 346 ? 46.724  25.685  2.048   1.00   30.89 ? 453  ASP B O   1 
ATOM   6151  C  CB  . ASP B  1 346 ? 44.165  24.364  1.242   1.00   25.85 ? 453  ASP B CB  1 
ATOM   6152  C  CG  . ASP B  1 346 ? 43.922  23.592  -0.057  1.00   32.73 ? 453  ASP B CG  1 
ATOM   6153  O  OD1 . ASP B  1 346 ? 44.634  22.582  -0.303  1.00   27.64 ? 453  ASP B OD1 1 
ATOM   6154  O  OD2 . ASP B  1 346 ? 43.017  23.987  -0.833  1.00   34.85 ? 453  ASP B OD2 1 
ATOM   6155  N  N   . ILE B  1 347 ? 47.614  23.776  1.303   1.00   30.14 ? 454  ILE B N   1 
ATOM   6156  C  CA  . ILE B  1 347 ? 48.949  24.330  1.089   1.00   30.27 ? 454  ILE B CA  1 
ATOM   6157  C  C   . ILE B  1 347 ? 49.253  25.155  -0.170  1.00   30.83 ? 454  ILE B C   1 
ATOM   6158  O  O   . ILE B  1 347 ? 49.826  26.234  -0.070  1.00   31.84 ? 454  ILE B O   1 
ATOM   6159  C  CB  . ILE B  1 347 ? 50.005  23.204  1.159   1.00   29.21 ? 454  ILE B CB  1 
ATOM   6160  C  CG1 . ILE B  1 347 ? 49.757  22.327  2.390   1.00   28.87 ? 454  ILE B CG1 1 
ATOM   6161  C  CG2 . ILE B  1 347 ? 51.403  23.801  1.169   1.00   27.37 ? 454  ILE B CG2 1 
ATOM   6162  C  CD1 . ILE B  1 347 ? 49.883  23.042  3.693   1.00   33.42 ? 454  ILE B CD1 1 
ATOM   6163  N  N   . LEU B  1 348 ? 48.889  24.660  -1.346  1.00   30.29 ? 455  LEU B N   1 
ATOM   6164  C  CA  . LEU B  1 348 ? 49.220  25.373  -2.571  1.00   32.45 ? 455  LEU B CA  1 
ATOM   6165  C  C   . LEU B  1 348 ? 48.434  26.629  -2.905  1.00   36.78 ? 455  LEU B C   1 
ATOM   6166  O  O   . LEU B  1 348 ? 47.222  26.698  -2.709  1.00   38.17 ? 455  LEU B O   1 
ATOM   6167  C  CB  . LEU B  1 348 ? 49.132  24.427  -3.760  1.00   31.05 ? 455  LEU B CB  1 
ATOM   6168  C  CG  . LEU B  1 348 ? 49.967  23.149  -3.725  1.00   29.58 ? 455  LEU B CG  1 
ATOM   6169  C  CD1 . LEU B  1 348 ? 49.946  22.535  -5.114  1.00   24.55 ? 455  LEU B CD1 1 
ATOM   6170  C  CD2 . LEU B  1 348 ? 51.396  23.447  -3.298  1.00   25.62 ? 455  LEU B CD2 1 
ATOM   6171  N  N   . THR B  1 349 ? 49.141  27.626  -3.429  1.00   39.62 ? 456  THR B N   1 
ATOM   6172  C  CA  . THR B  1 349 ? 48.511  28.872  -3.849  1.00   40.52 ? 456  THR B CA  1 
ATOM   6173  C  C   . THR B  1 349 ? 48.541  28.900  -5.373  1.00   39.97 ? 456  THR B C   1 
ATOM   6174  O  O   . THR B  1 349 ? 47.973  29.785  -6.004  1.00   40.09 ? 456  THR B O   1 
ATOM   6175  C  CB  . THR B  1 349 ? 49.251  30.098  -3.303  1.00   39.21 ? 456  THR B CB  1 
ATOM   6176  O  OG1 . THR B  1 349 ? 50.657  29.948  -3.533  1.00   42.44 ? 456  THR B OG1 1 
ATOM   6177  C  CG2 . THR B  1 349 ? 48.988  30.250  -1.823  1.00   39.59 ? 456  THR B CG2 1 
ATOM   6178  N  N   . GLU B  1 350 ? 49.203  27.902  -5.950  1.00   39.12 ? 457  GLU B N   1 
ATOM   6179  C  CA  . GLU B  1 350 ? 49.320  27.773  -7.398  1.00   38.45 ? 457  GLU B CA  1 
ATOM   6180  C  C   . GLU B  1 350 ? 49.841  26.377  -7.735  1.00   32.89 ? 457  GLU B C   1 
ATOM   6181  O  O   . GLU B  1 350 ? 50.511  25.750  -6.921  1.00   28.52 ? 457  GLU B O   1 
ATOM   6182  C  CB  . GLU B  1 350 ? 50.306  28.814  -7.937  1.00   41.41 ? 457  GLU B CB  1 
ATOM   6183  C  CG  . GLU B  1 350 ? 51.648  28.772  -7.202  1.00   51.87 ? 457  GLU B CG  1 
ATOM   6184  C  CD  . GLU B  1 350 ? 52.757  29.527  -7.913  1.00   59.65 ? 457  GLU B CD  1 
ATOM   6185  O  OE1 . GLU B  1 350 ? 52.562  30.727  -8.208  1.00   64.73 ? 457  GLU B OE1 1 
ATOM   6186  O  OE2 . GLU B  1 350 ? 53.828  28.924  -8.170  1.00   62.04 ? 457  GLU B OE2 1 
ATOM   6187  N  N   . PRO B  1 351 ? 49.537  25.877  -8.940  1.00   29.91 ? 458  PRO B N   1 
ATOM   6188  C  CA  . PRO B  1 351 ? 50.008  24.551  -9.347  1.00   29.55 ? 458  PRO B CA  1 
ATOM   6189  C  C   . PRO B  1 351 ? 51.527  24.535  -9.360  1.00   29.63 ? 458  PRO B C   1 
ATOM   6190  O  O   . PRO B  1 351 ? 52.164  25.576  -9.532  1.00   26.98 ? 458  PRO B O   1 
ATOM   6191  C  CB  . PRO B  1 351 ? 49.411  24.378  -10.742 1.00   29.24 ? 458  PRO B CB  1 
ATOM   6192  C  CG  . PRO B  1 351 ? 49.268  25.781  -11.235 1.00   31.09 ? 458  PRO B CG  1 
ATOM   6193  C  CD  . PRO B  1 351 ? 48.755  26.509  -10.012 1.00   31.87 ? 458  PRO B CD  1 
ATOM   6194  N  N   . LYS B  1 352 ? 52.104  23.356  -9.174  1.00   30.87 ? 459  LYS B N   1 
ATOM   6195  C  CA  . LYS B  1 352 ? 53.554  23.214  -9.145  1.00   30.98 ? 459  LYS B CA  1 
ATOM   6196  C  C   . LYS B  1 352 ? 54.008  22.149  -10.118 1.00   30.85 ? 459  LYS B C   1 
ATOM   6197  O  O   . LYS B  1 352 ? 53.474  21.034  -10.129 1.00   31.28 ? 459  LYS B O   1 
ATOM   6198  C  CB  . LYS B  1 352 ? 54.010  22.848  -7.729  1.00   33.74 ? 459  LYS B CB  1 
ATOM   6199  C  CG  . LYS B  1 352 ? 54.547  24.015  -6.925  1.00   39.24 ? 459  LYS B CG  1 
ATOM   6200  C  CD  . LYS B  1 352 ? 53.588  25.180  -6.883  1.00   43.41 ? 459  LYS B CD  1 
ATOM   6201  C  CE  . LYS B  1 352 ? 54.270  26.417  -6.309  1.00   46.23 ? 459  LYS B CE  1 
ATOM   6202  N  NZ  . LYS B  1 352 ? 54.786  26.187  -4.932  1.00   49.60 ? 459  LYS B NZ  1 
ATOM   6203  N  N   . ASP B  1 353 ? 54.983  22.500  -10.948 1.00   29.62 ? 460  ASP B N   1 
ATOM   6204  C  CA  . ASP B  1 353 ? 55.532  21.563  -11.917 1.00   30.71 ? 460  ASP B CA  1 
ATOM   6205  C  C   . ASP B  1 353 ? 56.391  20.578  -11.133 1.00   29.82 ? 460  ASP B C   1 
ATOM   6206  O  O   . ASP B  1 353 ? 57.183  20.983  -10.284 1.00   28.99 ? 460  ASP B O   1 
ATOM   6207  C  CB  . ASP B  1 353 ? 56.384  22.314  -12.938 1.00   34.68 ? 460  ASP B CB  1 
ATOM   6208  C  CG  . ASP B  1 353 ? 56.994  21.398  -13.976 1.00   37.96 ? 460  ASP B CG  1 
ATOM   6209  O  OD1 . ASP B  1 353 ? 56.228  20.757  -14.726 1.00   41.32 ? 460  ASP B OD1 1 
ATOM   6210  O  OD2 . ASP B  1 353 ? 58.243  21.321  -14.039 1.00   42.74 ? 460  ASP B OD2 1 
ATOM   6211  N  N   . ILE B  1 354 ? 56.240  19.291  -11.413 1.00   31.28 ? 461  ILE B N   1 
ATOM   6212  C  CA  . ILE B  1 354 ? 57.000  18.284  -10.689 1.00   33.86 ? 461  ILE B CA  1 
ATOM   6213  C  C   . ILE B  1 354 ? 58.409  18.103  -11.244 1.00   36.57 ? 461  ILE B C   1 
ATOM   6214  O  O   . ILE B  1 354 ? 59.395  18.231  -10.503 1.00   36.26 ? 461  ILE B O   1 
ATOM   6215  C  CB  . ILE B  1 354 ? 56.244  16.936  -10.687 1.00   32.53 ? 461  ILE B CB  1 
ATOM   6216  C  CG1 . ILE B  1 354 ? 54.914  17.109  -9.949  1.00   30.75 ? 461  ILE B CG1 1 
ATOM   6217  C  CG2 . ILE B  1 354 ? 57.089  15.856  -10.033 1.00   31.29 ? 461  ILE B CG2 1 
ATOM   6218  C  CD1 . ILE B  1 354 ? 54.004  15.907  -9.992  1.00   26.80 ? 461  ILE B CD1 1 
ATOM   6219  N  N   . GLY B  1 355 ? 58.510  17.814  -12.539 1.00   35.60 ? 462  GLY B N   1 
ATOM   6220  C  CA  . GLY B  1 355 ? 59.822  17.636  -13.132 1.00   37.16 ? 462  GLY B CA  1 
ATOM   6221  C  C   . GLY B  1 355 ? 60.576  16.468  -12.521 1.00   41.04 ? 462  GLY B C   1 
ATOM   6222  O  O   . GLY B  1 355 ? 60.007  15.377  -12.330 1.00   40.51 ? 462  GLY B O   1 
ATOM   6223  N  N   . LYS B  1 356 ? 61.852  16.686  -12.207 1.00   39.16 ? 463  LYS B N   1 
ATOM   6224  C  CA  . LYS B  1 356 ? 62.669  15.627  -11.631 1.00   40.30 ? 463  LYS B CA  1 
ATOM   6225  C  C   . LYS B  1 356 ? 62.480  15.578  -10.125 1.00   37.67 ? 463  LYS B C   1 
ATOM   6226  O  O   . LYS B  1 356 ? 62.559  14.517  -9.511  1.00   34.50 ? 463  LYS B O   1 
ATOM   6227  C  CB  . LYS B  1 356 ? 64.149  15.856  -11.952 1.00   44.35 ? 463  LYS B CB  1 
ATOM   6228  C  CG  . LYS B  1 356 ? 64.929  14.581  -12.295 1.00   49.68 ? 463  LYS B CG  1 
ATOM   6229  C  CD  . LYS B  1 356 ? 64.908  13.536  -11.173 1.00   53.54 ? 463  LYS B CD  1 
ATOM   6230  C  CE  . LYS B  1 356 ? 65.780  12.318  -11.513 1.00   55.30 ? 463  LYS B CE  1 
ATOM   6231  N  NZ  . LYS B  1 356 ? 65.410  11.640  -12.805 1.00   56.42 ? 463  LYS B NZ  1 
ATOM   6232  N  N   . ARG B  1 357 ? 62.231  16.737  -9.533  1.00   35.29 ? 464  ARG B N   1 
ATOM   6233  C  CA  . ARG B  1 357 ? 62.037  16.814  -8.097  1.00   35.43 ? 464  ARG B CA  1 
ATOM   6234  C  C   . ARG B  1 357 ? 61.296  18.082  -7.700  1.00   33.63 ? 464  ARG B C   1 
ATOM   6235  O  O   . ARG B  1 357 ? 61.540  19.157  -8.246  1.00   35.58 ? 464  ARG B O   1 
ATOM   6236  C  CB  . ARG B  1 357 ? 63.386  16.759  -7.374  1.00   36.16 ? 464  ARG B CB  1 
ATOM   6237  C  CG  . ARG B  1 357 ? 63.273  16.791  -5.854  1.00   40.91 ? 464  ARG B CG  1 
ATOM   6238  C  CD  . ARG B  1 357 ? 64.606  16.478  -5.194  1.00   47.98 ? 464  ARG B CD  1 
ATOM   6239  N  NE  . ARG B  1 357 ? 64.476  16.135  -3.776  1.00   54.53 ? 464  ARG B NE  1 
ATOM   6240  C  CZ  . ARG B  1 357 ? 64.258  17.009  -2.795  1.00   57.67 ? 464  ARG B CZ  1 
ATOM   6241  N  NH1 . ARG B  1 357 ? 64.154  16.585  -1.538  1.00   57.83 ? 464  ARG B NH1 1 
ATOM   6242  N  NH2 . ARG B  1 357 ? 64.155  18.306  -3.063  1.00   58.35 ? 464  ARG B NH2 1 
ATOM   6243  N  N   . LEU B  1 358 ? 60.379  17.945  -6.752  1.00   28.99 ? 465  LEU B N   1 
ATOM   6244  C  CA  . LEU B  1 358 ? 59.615  19.082  -6.268  1.00   27.73 ? 465  LEU B CA  1 
ATOM   6245  C  C   . LEU B  1 358 ? 59.606  19.062  -4.759  1.00   27.28 ? 465  LEU B C   1 
ATOM   6246  O  O   . LEU B  1 358 ? 59.446  18.012  -4.139  1.00   27.80 ? 465  LEU B O   1 
ATOM   6247  C  CB  . LEU B  1 358 ? 58.173  19.035  -6.772  1.00   26.88 ? 465  LEU B CB  1 
ATOM   6248  C  CG  . LEU B  1 358 ? 57.240  20.086  -6.153  1.00   25.24 ? 465  LEU B CG  1 
ATOM   6249  C  CD1 . LEU B  1 358 ? 57.693  21.487  -6.565  1.00   21.78 ? 465  LEU B CD1 1 
ATOM   6250  C  CD2 . LEU B  1 358 ? 55.800  19.832  -6.607  1.00   19.95 ? 465  LEU B CD2 1 
ATOM   6251  N  N   . GLU B  1 359 ? 59.773  20.230  -4.169  1.00   27.21 ? 466  GLU B N   1 
ATOM   6252  C  CA  . GLU B  1 359 ? 59.769  20.336  -2.728  1.00   30.46 ? 466  GLU B CA  1 
ATOM   6253  C  C   . GLU B  1 359 ? 58.828  21.472  -2.366  1.00   30.38 ? 466  GLU B C   1 
ATOM   6254  O  O   . GLU B  1 359 ? 58.917  22.560  -2.926  1.00   30.87 ? 466  GLU B O   1 
ATOM   6255  C  CB  . GLU B  1 359 ? 61.176  20.640  -2.236  1.00   34.32 ? 466  GLU B CB  1 
ATOM   6256  C  CG  . GLU B  1 359 ? 61.434  20.288  -0.805  1.00   39.98 ? 466  GLU B CG  1 
ATOM   6257  C  CD  . GLU B  1 359 ? 62.848  20.626  -0.399  1.00   43.40 ? 466  GLU B CD  1 
ATOM   6258  O  OE1 . GLU B  1 359 ? 63.087  21.802  -0.053  1.00   45.32 ? 466  GLU B OE1 1 
ATOM   6259  O  OE2 . GLU B  1 359 ? 63.718  19.724  -0.449  1.00   42.68 ? 466  GLU B OE2 1 
ATOM   6260  N  N   . VAL B  1 360 ? 57.903  21.204  -1.452  1.00   28.69 ? 467  VAL B N   1 
ATOM   6261  C  CA  . VAL B  1 360 ? 56.960  22.212  -1.016  1.00   24.31 ? 467  VAL B CA  1 
ATOM   6262  C  C   . VAL B  1 360 ? 57.081  22.360  0.494   1.00   25.19 ? 467  VAL B C   1 
ATOM   6263  O  O   . VAL B  1 360 ? 56.926  21.394  1.241   1.00   25.37 ? 467  VAL B O   1 
ATOM   6264  C  CB  . VAL B  1 360 ? 55.521  21.821  -1.373  1.00   24.98 ? 467  VAL B CB  1 
ATOM   6265  C  CG1 . VAL B  1 360 ? 54.576  22.897  -0.896  1.00   24.65 ? 467  VAL B CG1 1 
ATOM   6266  C  CG2 . VAL B  1 360 ? 55.387  21.624  -2.886  1.00   18.93 ? 467  VAL B CG2 1 
ATOM   6267  N  N   . ARG B  1 361 ? 57.376  23.575  0.933   1.00   24.02 ? 468  ARG B N   1 
ATOM   6268  C  CA  . ARG B  1 361 ? 57.535  23.868  2.352   1.00   26.54 ? 468  ARG B CA  1 
ATOM   6269  C  C   . ARG B  1 361 ? 56.421  24.787  2.794   1.00   27.21 ? 468  ARG B C   1 
ATOM   6270  O  O   . ARG B  1 361 ? 55.985  25.658  2.037   1.00   29.15 ? 468  ARG B O   1 
ATOM   6271  C  CB  . ARG B  1 361 ? 58.867  24.564  2.607   1.00   25.94 ? 468  ARG B CB  1 
ATOM   6272  C  CG  . ARG B  1 361 ? 60.046  23.754  2.172   1.00   28.25 ? 468  ARG B CG  1 
ATOM   6273  C  CD  . ARG B  1 361 ? 61.335  24.508  2.351   1.00   31.13 ? 468  ARG B CD  1 
ATOM   6274  N  NE  . ARG B  1 361 ? 62.450  23.599  2.144   1.00   37.44 ? 468  ARG B NE  1 
ATOM   6275  C  CZ  . ARG B  1 361 ? 63.009  22.874  3.106   1.00   39.67 ? 468  ARG B CZ  1 
ATOM   6276  N  NH1 . ARG B  1 361 ? 64.015  22.053  2.816   1.00   42.04 ? 468  ARG B NH1 1 
ATOM   6277  N  NH2 . ARG B  1 361 ? 62.585  22.994  4.360   1.00   40.03 ? 468  ARG B NH2 1 
ATOM   6278  N  N   . LYS B  1 362 ? 55.980  24.612  4.029   1.00   25.30 ? 469  LYS B N   1 
ATOM   6279  C  CA  . LYS B  1 362 ? 54.908  25.427  4.550   1.00   25.48 ? 469  LYS B CA  1 
ATOM   6280  C  C   . LYS B  1 362 ? 54.929  25.390  6.068   1.00   24.41 ? 469  LYS B C   1 
ATOM   6281  O  O   . LYS B  1 362 ? 54.959  24.327  6.672   1.00   23.85 ? 469  LYS B O   1 
ATOM   6282  C  CB  . LYS B  1 362 ? 53.576  24.895  4.012   1.00   26.09 ? 469  LYS B CB  1 
ATOM   6283  C  CG  . LYS B  1 362 ? 52.327  25.440  4.681   1.00   31.82 ? 469  LYS B CG  1 
ATOM   6284  C  CD  . LYS B  1 362 ? 52.094  26.882  4.309   1.00   32.31 ? 469  LYS B CD  1 
ATOM   6285  C  CE  . LYS B  1 362 ? 50.765  27.353  4.857   1.00   37.60 ? 469  LYS B CE  1 
ATOM   6286  N  NZ  . LYS B  1 362 ? 50.588  28.795  4.592   1.00   41.33 ? 469  LYS B NZ  1 
ATOM   6287  N  N   . THR B  1 363 ? 54.934  26.561  6.682   1.00   24.73 ? 470  THR B N   1 
ATOM   6288  C  CA  . THR B  1 363 ? 54.928  26.640  8.131   1.00   25.14 ? 470  THR B CA  1 
ATOM   6289  C  C   . THR B  1 363 ? 53.472  26.765  8.508   1.00   24.59 ? 470  THR B C   1 
ATOM   6290  O  O   . THR B  1 363 ? 52.770  27.613  7.961   1.00   24.95 ? 470  THR B O   1 
ATOM   6291  C  CB  . THR B  1 363 ? 55.703  27.866  8.618   1.00   27.07 ? 470  THR B CB  1 
ATOM   6292  O  OG1 . THR B  1 363 ? 57.075  27.728  8.225   1.00   29.82 ? 470  THR B OG1 1 
ATOM   6293  C  CG2 . THR B  1 363 ? 55.616  27.994  10.136  1.00   26.67 ? 470  THR B CG2 1 
ATOM   6294  N  N   . VAL B  1 364 ? 53.011  25.904  9.414   1.00   23.71 ? 471  VAL B N   1 
ATOM   6295  C  CA  . VAL B  1 364 ? 51.614  25.924  9.831   1.00   20.61 ? 471  VAL B CA  1 
ATOM   6296  C  C   . VAL B  1 364 ? 51.479  26.196  11.322  1.00   22.75 ? 471  VAL B C   1 
ATOM   6297  O  O   . VAL B  1 364 ? 52.426  25.988  12.095  1.00   26.17 ? 471  VAL B O   1 
ATOM   6298  C  CB  . VAL B  1 364 ? 50.919  24.573  9.509   1.00   20.76 ? 471  VAL B CB  1 
ATOM   6299  C  CG1 . VAL B  1 364 ? 51.161  24.197  8.067   1.00   20.20 ? 471  VAL B CG1 1 
ATOM   6300  C  CG2 . VAL B  1 364 ? 51.431  23.470  10.443  1.00   16.15 ? 471  VAL B CG2 1 
ATOM   6301  N  N   . THR B  1 365 ? 50.304  26.653  11.735  1.00   20.04 ? 472  THR B N   1 
ATOM   6302  C  CA  . THR B  1 365 ? 50.079  26.923  13.145  1.00   20.61 ? 472  THR B CA  1 
ATOM   6303  C  C   . THR B  1 365 ? 49.194  25.852  13.750  1.00   20.56 ? 472  THR B C   1 
ATOM   6304  O  O   . THR B  1 365 ? 48.933  25.863  14.954  1.00   21.09 ? 472  THR B O   1 
ATOM   6305  C  CB  . THR B  1 365 ? 49.404  28.269  13.345  1.00   23.65 ? 472  THR B CB  1 
ATOM   6306  O  OG1 . THR B  1 365 ? 48.149  28.272  12.659  1.00   26.95 ? 472  THR B OG1 1 
ATOM   6307  C  CG2 . THR B  1 365 ? 50.289  29.392  12.797  1.00   24.47 ? 472  THR B CG2 1 
ATOM   6308  N  N   . ALA B  1 366 ? 48.727  24.930  12.905  1.00   22.29 ? 473  ALA B N   1 
ATOM   6309  C  CA  . ALA B  1 366 ? 47.863  23.835  13.345  1.00   20.16 ? 473  ALA B CA  1 
ATOM   6310  C  C   . ALA B  1 366 ? 46.595  24.358  14.024  1.00   23.82 ? 473  ALA B C   1 
ATOM   6311  O  O   . ALA B  1 366 ? 46.203  23.877  15.096  1.00   22.99 ? 473  ALA B O   1 
ATOM   6312  C  CB  . ALA B  1 366 ? 48.619  22.915  14.293  1.00   21.47 ? 473  ALA B CB  1 
ATOM   6313  N  N   . CYS B  1 367 ? 45.971  25.354  13.396  1.00   23.66 ? 474  CYS B N   1 
ATOM   6314  C  CA  . CYS B  1 367 ? 44.733  25.938  13.896  1.00   24.42 ? 474  CYS B CA  1 
ATOM   6315  C  C   . CYS B  1 367 ? 44.835  26.592  15.272  1.00   23.48 ? 474  CYS B C   1 
ATOM   6316  O  O   . CYS B  1 367 ? 43.886  26.578  16.055  1.00   25.03 ? 474  CYS B O   1 
ATOM   6317  C  CB  . CYS B  1 367 ? 43.635  24.869  13.876  1.00   24.41 ? 474  CYS B CB  1 
ATOM   6318  S  SG  . CYS B  1 367 ? 43.221  24.374  12.168  1.00   26.75 ? 474  CYS B SG  1 
ATOM   6319  N  N   . LEU B  1 368 ? 45.991  27.182  15.551  1.00   24.24 ? 475  LEU B N   1 
ATOM   6320  C  CA  . LEU B  1 368 ? 46.219  27.874  16.817  1.00   25.98 ? 475  LEU B CA  1 
ATOM   6321  C  C   . LEU B  1 368 ? 45.138  28.939  17.012  1.00   26.31 ? 475  LEU B C   1 
ATOM   6322  O  O   . LEU B  1 368 ? 44.780  29.648  16.075  1.00   25.73 ? 475  LEU B O   1 
ATOM   6323  C  CB  . LEU B  1 368 ? 47.595  28.547  16.801  1.00   26.84 ? 475  LEU B CB  1 
ATOM   6324  C  CG  . LEU B  1 368 ? 47.929  29.502  17.956  1.00   26.27 ? 475  LEU B CG  1 
ATOM   6325  C  CD1 . LEU B  1 368 ? 48.125  28.736  19.257  1.00   22.93 ? 475  LEU B CD1 1 
ATOM   6326  C  CD2 . LEU B  1 368 ? 49.192  30.267  17.605  1.00   27.51 ? 475  LEU B CD2 1 
ATOM   6327  N  N   . GLY B  1 369 ? 44.624  29.047  18.229  1.00   27.37 ? 476  GLY B N   1 
ATOM   6328  C  CA  . GLY B  1 369 ? 43.593  30.031  18.504  1.00   30.18 ? 476  GLY B CA  1 
ATOM   6329  C  C   . GLY B  1 369 ? 42.193  29.621  18.081  1.00   33.21 ? 476  GLY B C   1 
ATOM   6330  O  O   . GLY B  1 369 ? 41.243  30.357  18.323  1.00   36.74 ? 476  GLY B O   1 
ATOM   6331  N  N   . GLU B  1 370 ? 42.053  28.461  17.450  1.00   32.73 ? 477  GLU B N   1 
ATOM   6332  C  CA  . GLU B  1 370 ? 40.741  28.006  17.007  1.00   32.72 ? 477  GLU B CA  1 
ATOM   6333  C  C   . GLU B  1 370 ? 40.305  26.772  17.782  1.00   33.38 ? 477  GLU B C   1 
ATOM   6334  O  O   . GLU B  1 370 ? 41.102  26.165  18.497  1.00   32.29 ? 477  GLU B O   1 
ATOM   6335  C  CB  . GLU B  1 370 ? 40.767  27.738  15.502  1.00   34.69 ? 477  GLU B CB  1 
ATOM   6336  C  CG  . GLU B  1 370 ? 41.173  28.988  14.737  1.00   38.03 ? 477  GLU B CG  1 
ATOM   6337  C  CD  . GLU B  1 370 ? 40.325  30.214  15.113  1.00   41.64 ? 477  GLU B CD  1 
ATOM   6338  O  OE1 . GLU B  1 370 ? 40.829  31.353  14.990  1.00   45.37 ? 477  GLU B OE1 1 
ATOM   6339  O  OE2 . GLU B  1 370 ? 39.152  30.047  15.519  1.00   43.65 ? 477  GLU B OE2 1 
ATOM   6340  N  N   . PRO B  1 371 ? 39.027  26.387  17.660  1.00   32.90 ? 478  PRO B N   1 
ATOM   6341  C  CA  . PRO B  1 371 ? 38.517  25.216  18.375  1.00   31.84 ? 478  PRO B CA  1 
ATOM   6342  C  C   . PRO B  1 371 ? 39.222  23.906  18.025  1.00   28.44 ? 478  PRO B C   1 
ATOM   6343  O  O   . PRO B  1 371 ? 39.292  23.002  18.855  1.00   28.56 ? 478  PRO B O   1 
ATOM   6344  C  CB  . PRO B  1 371 ? 37.034  25.199  17.988  1.00   35.95 ? 478  PRO B CB  1 
ATOM   6345  C  CG  . PRO B  1 371 ? 36.738  26.653  17.741  1.00   34.87 ? 478  PRO B CG  1 
ATOM   6346  C  CD  . PRO B  1 371 ? 37.939  27.060  16.932  1.00   32.89 ? 478  PRO B CD  1 
ATOM   6347  N  N   . ASN B  1 372 ? 39.741  23.805  16.803  1.00   25.84 ? 479  ASN B N   1 
ATOM   6348  C  CA  . ASN B  1 372 ? 40.421  22.593  16.361  1.00   25.72 ? 479  ASN B CA  1 
ATOM   6349  C  C   . ASN B  1 372 ? 41.951  22.664  16.432  1.00   24.66 ? 479  ASN B C   1 
ATOM   6350  O  O   . ASN B  1 372 ? 42.662  21.981  15.682  1.00   20.76 ? 479  ASN B O   1 
ATOM   6351  C  CB  . ASN B  1 372 ? 39.975  22.238  14.943  1.00   29.70 ? 479  ASN B CB  1 
ATOM   6352  C  CG  . ASN B  1 372 ? 39.981  23.433  14.020  1.00   35.56 ? 479  ASN B CG  1 
ATOM   6353  O  OD1 . ASN B  1 372 ? 39.728  23.302  12.823  1.00   41.35 ? 479  ASN B OD1 1 
ATOM   6354  N  ND2 . ASN B  1 372 ? 40.268  24.612  14.569  1.00   32.69 ? 479  ASN B ND2 1 
ATOM   6355  N  N   . HIS B  1 373 ? 42.452  23.495  17.338  1.00   23.47 ? 480  HIS B N   1 
ATOM   6356  C  CA  . HIS B  1 373 ? 43.889  23.647  17.543  1.00   21.40 ? 480  HIS B CA  1 
ATOM   6357  C  C   . HIS B  1 373 ? 44.440  22.300  17.994  1.00   22.13 ? 480  HIS B C   1 
ATOM   6358  O  O   . HIS B  1 373 ? 43.914  21.676  18.919  1.00   20.06 ? 480  HIS B O   1 
ATOM   6359  C  CB  . HIS B  1 373 ? 44.150  24.712  18.615  1.00   23.41 ? 480  HIS B CB  1 
ATOM   6360  C  CG  . HIS B  1 373 ? 45.580  24.808  19.053  1.00   25.56 ? 480  HIS B CG  1 
ATOM   6361  N  ND1 . HIS B  1 373 ? 46.640  24.725  18.174  1.00   27.22 ? 480  HIS B ND1 1 
ATOM   6362  C  CD2 . HIS B  1 373 ? 46.123  25.067  20.268  1.00   27.17 ? 480  HIS B CD2 1 
ATOM   6363  C  CE1 . HIS B  1 373 ? 47.770  24.934  18.825  1.00   25.47 ? 480  HIS B CE1 1 
ATOM   6364  N  NE2 . HIS B  1 373 ? 47.483  25.145  20.097  1.00   26.61 ? 480  HIS B NE2 1 
ATOM   6365  N  N   . ILE B  1 374 ? 45.501  21.848  17.337  1.00   20.83 ? 481  ILE B N   1 
ATOM   6366  C  CA  . ILE B  1 374 ? 46.098  20.563  17.672  1.00   19.67 ? 481  ILE B CA  1 
ATOM   6367  C  C   . ILE B  1 374 ? 47.548  20.679  18.120  1.00   19.91 ? 481  ILE B C   1 
ATOM   6368  O  O   . ILE B  1 374 ? 48.391  21.182  17.382  1.00   19.50 ? 481  ILE B O   1 
ATOM   6369  C  CB  . ILE B  1 374 ? 46.039  19.591  16.456  1.00   18.83 ? 481  ILE B CB  1 
ATOM   6370  C  CG1 . ILE B  1 374 ? 44.584  19.219  16.168  1.00   21.31 ? 481  ILE B CG1 1 
ATOM   6371  C  CG2 . ILE B  1 374 ? 46.890  18.356  16.714  1.00   16.68 ? 481  ILE B CG2 1 
ATOM   6372  C  CD1 . ILE B  1 374 ? 44.402  18.308  14.978  1.00   21.07 ? 481  ILE B CD1 1 
ATOM   6373  N  N   . THR B  1 375 ? 47.834  20.214  19.332  1.00   17.30 ? 482  THR B N   1 
ATOM   6374  C  CA  . THR B  1 375 ? 49.204  20.224  19.835  1.00   20.50 ? 482  THR B CA  1 
ATOM   6375  C  C   . THR B  1 375 ? 49.723  18.785  19.950  1.00   21.63 ? 482  THR B C   1 
ATOM   6376  O  O   . THR B  1 375 ? 50.934  18.562  20.069  1.00   20.74 ? 482  THR B O   1 
ATOM   6377  C  CB  . THR B  1 375 ? 49.309  20.875  21.232  1.00   19.58 ? 482  THR B CB  1 
ATOM   6378  O  OG1 . THR B  1 375 ? 48.430  20.194  22.139  1.00   21.77 ? 482  THR B OG1 1 
ATOM   6379  C  CG2 . THR B  1 375 ? 48.965  22.358  21.165  1.00   20.08 ? 482  THR B CG2 1 
ATOM   6380  N  N   . ARG B  1 376 ? 48.804  17.818  19.928  1.00   19.86 ? 483  ARG B N   1 
ATOM   6381  C  CA  . ARG B  1 376 ? 49.163  16.409  20.036  1.00   20.05 ? 483  ARG B CA  1 
ATOM   6382  C  C   . ARG B  1 376 ? 48.531  15.677  18.843  1.00   19.36 ? 483  ARG B C   1 
ATOM   6383  O  O   . ARG B  1 376 ? 47.339  15.358  18.836  1.00   16.59 ? 483  ARG B O   1 
ATOM   6384  C  CB  . ARG B  1 376 ? 48.640  15.849  21.356  1.00   24.32 ? 483  ARG B CB  1 
ATOM   6385  C  CG  . ARG B  1 376 ? 49.585  14.902  22.082  1.00   31.61 ? 483  ARG B CG  1 
ATOM   6386  C  CD  . ARG B  1 376 ? 48.854  14.187  23.215  1.00   37.28 ? 483  ARG B CD  1 
ATOM   6387  N  NE  . ARG B  1 376 ? 49.732  13.298  23.966  1.00   43.69 ? 483  ARG B NE  1 
ATOM   6388  C  CZ  . ARG B  1 376 ? 49.393  12.082  24.391  1.00   46.22 ? 483  ARG B CZ  1 
ATOM   6389  N  NH1 . ARG B  1 376 ? 50.267  11.352  25.071  1.00   47.84 ? 483  ARG B NH1 1 
ATOM   6390  N  NH2 . ARG B  1 376 ? 48.191  11.585  24.133  1.00   48.46 ? 483  ARG B NH2 1 
ATOM   6391  N  N   . LEU B  1 377 ? 49.348  15.411  17.832  1.00   18.71 ? 484  LEU B N   1 
ATOM   6392  C  CA  . LEU B  1 377 ? 48.881  14.775  16.614  1.00   17.06 ? 484  LEU B CA  1 
ATOM   6393  C  C   . LEU B  1 377 ? 48.550  13.290  16.738  1.00   17.20 ? 484  LEU B C   1 
ATOM   6394  O  O   . LEU B  1 377 ? 49.118  12.565  17.554  1.00   16.87 ? 484  LEU B O   1 
ATOM   6395  C  CB  . LEU B  1 377 ? 49.936  14.970  15.511  1.00   18.25 ? 484  LEU B CB  1 
ATOM   6396  C  CG  . LEU B  1 377 ? 49.645  14.547  14.067  1.00   17.49 ? 484  LEU B CG  1 
ATOM   6397  C  CD1 . LEU B  1 377 ? 48.609  15.476  13.464  1.00   14.86 ? 484  LEU B CD1 1 
ATOM   6398  C  CD2 . LEU B  1 377 ? 50.925  14.621  13.240  1.00   17.92 ? 484  LEU B CD2 1 
ATOM   6399  N  N   . GLU B  1 378 ? 47.590  12.856  15.936  1.00   16.33 ? 485  GLU B N   1 
ATOM   6400  C  CA  . GLU B  1 378 ? 47.235  11.448  15.870  1.00   16.66 ? 485  GLU B CA  1 
ATOM   6401  C  C   . GLU B  1 378 ? 47.568  11.108  14.411  1.00   15.53 ? 485  GLU B C   1 
ATOM   6402  O  O   . GLU B  1 378 ? 48.749  11.050  14.081  1.00   13.10 ? 485  GLU B O   1 
ATOM   6403  C  CB  . GLU B  1 378 ? 45.762  11.236  16.242  1.00   16.16 ? 485  GLU B CB  1 
ATOM   6404  C  CG  . GLU B  1 378 ? 45.587  11.279  17.764  1.00   18.85 ? 485  GLU B CG  1 
ATOM   6405  C  CD  . GLU B  1 378 ? 44.150  11.202  18.244  1.00   20.19 ? 485  GLU B CD  1 
ATOM   6406  O  OE1 . GLU B  1 378 ? 43.949  11.292  19.475  1.00   19.58 ? 485  GLU B OE1 1 
ATOM   6407  O  OE2 . GLU B  1 378 ? 43.231  11.051  17.412  1.00   16.24 ? 485  GLU B OE2 1 
ATOM   6408  N  N   . HIS B  1 379 ? 46.573  10.914  13.542  1.00   13.35 ? 486  HIS B N   1 
ATOM   6409  C  CA  . HIS B  1 379 ? 46.854  10.628  12.132  1.00   12.57 ? 486  HIS B CA  1 
ATOM   6410  C  C   . HIS B  1 379 ? 47.046  11.944  11.385  1.00   17.61 ? 486  HIS B C   1 
ATOM   6411  O  O   . HIS B  1 379 ? 46.567  12.992  11.827  1.00   18.38 ? 486  HIS B O   1 
ATOM   6412  C  CB  . HIS B  1 379 ? 45.678  9.919   11.439  1.00   12.30 ? 486  HIS B CB  1 
ATOM   6413  C  CG  . HIS B  1 379 ? 45.038  8.843   12.253  1.00   14.31 ? 486  HIS B CG  1 
ATOM   6414  N  ND1 . HIS B  1 379 ? 44.111  9.109   13.239  1.00   11.67 ? 486  HIS B ND1 1 
ATOM   6415  C  CD2 . HIS B  1 379 ? 45.158  7.494   12.200  1.00   12.43 ? 486  HIS B CD2 1 
ATOM   6416  C  CE1 . HIS B  1 379 ? 43.680  7.969   13.748  1.00   12.32 ? 486  HIS B CE1 1 
ATOM   6417  N  NE2 . HIS B  1 379 ? 44.299  6.974   13.134  1.00   13.89 ? 486  HIS B NE2 1 
ATOM   6418  N  N   . ALA B  1 380 ? 47.744  11.888  10.257  1.00   16.17 ? 487  ALA B N   1 
ATOM   6419  C  CA  . ALA B  1 380 ? 47.912  13.057  9.399   1.00   17.17 ? 487  ALA B CA  1 
ATOM   6420  C  C   . ALA B  1 380 ? 47.729  12.560  7.975   1.00   17.54 ? 487  ALA B C   1 
ATOM   6421  O  O   . ALA B  1 380 ? 48.199  11.470  7.643   1.00   19.80 ? 487  ALA B O   1 
ATOM   6422  C  CB  . ALA B  1 380 ? 49.306  13.689  9.553   1.00   14.14 ? 487  ALA B CB  1 
ATOM   6423  N  N   . GLN B  1 381 ? 47.025  13.335  7.150   1.00   15.20 ? 488  GLN B N   1 
ATOM   6424  C  CA  . GLN B  1 381 ? 46.841  12.980  5.749   1.00   16.47 ? 488  GLN B CA  1 
ATOM   6425  C  C   . GLN B  1 381 ? 47.388  14.089  4.871   1.00   17.73 ? 488  GLN B C   1 
ATOM   6426  O  O   . GLN B  1 381 ? 47.320  15.265  5.220   1.00   17.30 ? 488  GLN B O   1 
ATOM   6427  C  CB  . GLN B  1 381 ? 45.366  12.808  5.390   1.00   14.84 ? 488  GLN B CB  1 
ATOM   6428  C  CG  . GLN B  1 381 ? 44.636  11.745  6.156   1.00   16.42 ? 488  GLN B CG  1 
ATOM   6429  C  CD  . GLN B  1 381 ? 43.145  11.841  5.910   1.00   21.87 ? 488  GLN B CD  1 
ATOM   6430  O  OE1 . GLN B  1 381 ? 42.589  12.941  5.878   1.00   23.82 ? 488  GLN B OE1 1 
ATOM   6431  N  NE2 . GLN B  1 381 ? 42.487  10.699  5.742   1.00   18.26 ? 488  GLN B NE2 1 
ATOM   6432  N  N   . ALA B  1 382 ? 47.935  13.703  3.729   1.00   18.12 ? 489  ALA B N   1 
ATOM   6433  C  CA  . ALA B  1 382 ? 48.422  14.655  2.751   1.00   18.32 ? 489  ALA B CA  1 
ATOM   6434  C  C   . ALA B  1 382 ? 47.552  14.298  1.543   1.00   20.84 ? 489  ALA B C   1 
ATOM   6435  O  O   . ALA B  1 382 ? 47.799  13.292  0.862   1.00   18.41 ? 489  ALA B O   1 
ATOM   6436  C  CB  . ALA B  1 382 ? 49.880  14.404  2.445   1.00   22.61 ? 489  ALA B CB  1 
ATOM   6437  N  N   . ARG B  1 383 ? 46.508  15.092  1.316   1.00   18.69 ? 490  ARG B N   1 
ATOM   6438  C  CA  . ARG B  1 383 ? 45.588  14.853  0.212   1.00   18.15 ? 490  ARG B CA  1 
ATOM   6439  C  C   . ARG B  1 383 ? 46.174  15.476  -1.039  1.00   17.29 ? 490  ARG B C   1 
ATOM   6440  O  O   . ARG B  1 383 ? 46.224  16.700  -1.177  1.00   20.21 ? 490  ARG B O   1 
ATOM   6441  C  CB  . ARG B  1 383 ? 44.210  15.453  0.524   1.00   16.27 ? 490  ARG B CB  1 
ATOM   6442  C  CG  . ARG B  1 383 ? 43.579  14.952  1.840   1.00   23.26 ? 490  ARG B CG  1 
ATOM   6443  C  CD  . ARG B  1 383 ? 42.106  15.385  1.978   1.00   25.05 ? 490  ARG B CD  1 
ATOM   6444  N  NE  . ARG B  1 383 ? 41.233  14.668  1.049   1.00   25.96 ? 490  ARG B NE  1 
ATOM   6445  C  CZ  . ARG B  1 383 ? 40.582  13.545  1.348   1.00   28.49 ? 490  ARG B CZ  1 
ATOM   6446  N  NH1 . ARG B  1 383 ? 39.822  12.950  0.436   1.00   29.76 ? 490  ARG B NH1 1 
ATOM   6447  N  NH2 . ARG B  1 383 ? 40.657  13.034  2.570   1.00   27.21 ? 490  ARG B NH2 1 
ATOM   6448  N  N   . LEU B  1 384 ? 46.620  14.630  -1.956  1.00   17.68 ? 491  LEU B N   1 
ATOM   6449  C  CA  . LEU B  1 384 ? 47.241  15.124  -3.174  1.00   20.77 ? 491  LEU B CA  1 
ATOM   6450  C  C   . LEU B  1 384 ? 46.462  14.889  -4.450  1.00   23.19 ? 491  LEU B C   1 
ATOM   6451  O  O   . LEU B  1 384 ? 45.807  13.853  -4.626  1.00   20.17 ? 491  LEU B O   1 
ATOM   6452  C  CB  . LEU B  1 384 ? 48.625  14.493  -3.350  1.00   19.49 ? 491  LEU B CB  1 
ATOM   6453  C  CG  . LEU B  1 384 ? 49.558  14.561  -2.146  1.00   19.31 ? 491  LEU B CG  1 
ATOM   6454  C  CD1 . LEU B  1 384 ? 50.878  13.902  -2.502  1.00   18.59 ? 491  LEU B CD1 1 
ATOM   6455  C  CD2 . LEU B  1 384 ? 49.784  16.013  -1.746  1.00   17.09 ? 491  LEU B CD2 1 
ATOM   6456  N  N   . THR B  1 385 ? 46.544  15.874  -5.340  1.00   22.36 ? 492  THR B N   1 
ATOM   6457  C  CA  . THR B  1 385 ? 45.930  15.777  -6.656  1.00   22.73 ? 492  THR B CA  1 
ATOM   6458  C  C   . THR B  1 385 ? 47.057  16.178  -7.604  1.00   22.39 ? 492  THR B C   1 
ATOM   6459  O  O   . THR B  1 385 ? 47.592  17.281  -7.521  1.00   21.78 ? 492  THR B O   1 
ATOM   6460  C  CB  . THR B  1 385 ? 44.739  16.732  -6.819  1.00   21.53 ? 492  THR B CB  1 
ATOM   6461  O  OG1 . THR B  1 385 ? 43.723  16.399  -5.863  1.00   19.48 ? 492  THR B OG1 1 
ATOM   6462  C  CG2 . THR B  1 385 ? 44.152  16.596  -8.204  1.00   19.49 ? 492  THR B CG2 1 
ATOM   6463  N  N   . LEU B  1 386 ? 47.438  15.271  -8.485  1.00   21.06 ? 493  LEU B N   1 
ATOM   6464  C  CA  . LEU B  1 386 ? 48.523  15.555  -9.400  1.00   21.39 ? 493  LEU B CA  1 
ATOM   6465  C  C   . LEU B  1 386 ? 48.426  14.721  -10.662 1.00   23.40 ? 493  LEU B C   1 
ATOM   6466  O  O   . LEU B  1 386 ? 47.792  13.658  -10.684 1.00   23.88 ? 493  LEU B O   1 
ATOM   6467  C  CB  . LEU B  1 386 ? 49.866  15.277  -8.708  1.00   21.53 ? 493  LEU B CB  1 
ATOM   6468  C  CG  . LEU B  1 386 ? 50.143  13.814  -8.330  1.00   20.45 ? 493  LEU B CG  1 
ATOM   6469  C  CD1 . LEU B  1 386 ? 50.704  13.062  -9.545  1.00   21.23 ? 493  LEU B CD1 1 
ATOM   6470  C  CD2 . LEU B  1 386 ? 51.135  13.754  -7.184  1.00   16.95 ? 493  LEU B CD2 1 
ATOM   6471  N  N   . SER B  1 387 ? 49.060  15.217  -11.715 1.00   23.27 ? 494  SER B N   1 
ATOM   6472  C  CA  . SER B  1 387 ? 49.089  14.519  -12.987 1.00   25.36 ? 494  SER B CA  1 
ATOM   6473  C  C   . SER B  1 387 ? 50.547  14.113  -13.195 1.00   26.91 ? 494  SER B C   1 
ATOM   6474  O  O   . SER B  1 387 ? 51.455  14.819  -12.742 1.00   27.61 ? 494  SER B O   1 
ATOM   6475  C  CB  . SER B  1 387 ? 48.634  15.455  -14.115 1.00   25.20 ? 494  SER B CB  1 
ATOM   6476  O  OG  . SER B  1 387 ? 49.420  16.646  -14.158 1.00   26.26 ? 494  SER B OG  1 
ATOM   6477  N  N   . TYR B  1 388 ? 50.768  12.977  -13.851 1.00   24.02 ? 495  TYR B N   1 
ATOM   6478  C  CA  . TYR B  1 388 ? 52.120  12.502  -14.119 1.00   25.39 ? 495  TYR B CA  1 
ATOM   6479  C  C   . TYR B  1 388 ? 52.000  11.481  -15.242 1.00   27.61 ? 495  TYR B C   1 
ATOM   6480  O  O   . TYR B  1 388 ? 50.956  10.838  -15.388 1.00   25.17 ? 495  TYR B O   1 
ATOM   6481  C  CB  . TYR B  1 388 ? 52.729  11.860  -12.872 1.00   23.19 ? 495  TYR B CB  1 
ATOM   6482  C  CG  . TYR B  1 388 ? 54.237  11.940  -12.844 1.00   27.18 ? 495  TYR B CG  1 
ATOM   6483  C  CD1 . TYR B  1 388 ? 54.885  13.178  -12.751 1.00   29.12 ? 495  TYR B CD1 1 
ATOM   6484  C  CD2 . TYR B  1 388 ? 55.019  10.794  -12.922 1.00   25.53 ? 495  TYR B CD2 1 
ATOM   6485  C  CE1 . TYR B  1 388 ? 56.275  13.268  -12.736 1.00   30.91 ? 495  TYR B CE1 1 
ATOM   6486  C  CE2 . TYR B  1 388 ? 56.423  10.875  -12.909 1.00   29.16 ? 495  TYR B CE2 1 
ATOM   6487  C  CZ  . TYR B  1 388 ? 57.035  12.112  -12.816 1.00   30.34 ? 495  TYR B CZ  1 
ATOM   6488  O  OH  . TYR B  1 388 ? 58.404  12.204  -12.807 1.00   34.43 ? 495  TYR B OH  1 
ATOM   6489  N  N   . ASN B  1 389 ? 53.055  11.328  -16.036 1.00   28.10 ? 496  ASN B N   1 
ATOM   6490  C  CA  . ASN B  1 389 ? 52.994  10.400  -17.154 1.00   28.88 ? 496  ASN B CA  1 
ATOM   6491  C  C   . ASN B  1 389 ? 53.215  8.946   -16.769 1.00   29.42 ? 496  ASN B C   1 
ATOM   6492  O  O   . ASN B  1 389 ? 52.687  8.054   -17.427 1.00   31.22 ? 496  ASN B O   1 
ATOM   6493  C  CB  . ASN B  1 389 ? 54.000  10.809  -18.224 1.00   31.15 ? 496  ASN B CB  1 
ATOM   6494  C  CG  . ASN B  1 389 ? 55.400  10.800  -17.713 1.00   34.51 ? 496  ASN B CG  1 
ATOM   6495  O  OD1 . ASN B  1 389 ? 55.767  11.596  -16.844 1.00   38.65 ? 496  ASN B OD1 1 
ATOM   6496  N  ND2 . ASN B  1 389 ? 56.203  9.886   -18.237 1.00   35.77 ? 496  ASN B ND2 1 
ATOM   6497  N  N   . ARG B  1 390 ? 53.986  8.699   -15.711 1.00   28.76 ? 497  ARG B N   1 
ATOM   6498  C  CA  . ARG B  1 390 ? 54.257  7.327   -15.265 1.00   28.15 ? 497  ARG B CA  1 
ATOM   6499  C  C   . ARG B  1 390 ? 54.243  7.315   -13.737 1.00   26.73 ? 497  ARG B C   1 
ATOM   6500  O  O   . ARG B  1 390 ? 55.281  7.473   -13.097 1.00   25.64 ? 497  ARG B O   1 
ATOM   6501  C  CB  . ARG B  1 390 ? 55.626  6.870   -15.780 1.00   28.73 ? 497  ARG B CB  1 
ATOM   6502  C  CG  . ARG B  1 390 ? 55.651  5.456   -16.291 1.00   30.27 ? 497  ARG B CG  1 
ATOM   6503  C  CD  . ARG B  1 390 ? 56.671  4.625   -15.562 1.00   33.88 ? 497  ARG B CD  1 
ATOM   6504  N  NE  . ARG B  1 390 ? 56.551  3.226   -15.947 1.00   37.99 ? 497  ARG B NE  1 
ATOM   6505  C  CZ  . ARG B  1 390 ? 56.698  2.205   -15.112 1.00   40.51 ? 497  ARG B CZ  1 
ATOM   6506  N  NH1 . ARG B  1 390 ? 56.564  0.963   -15.563 1.00   41.93 ? 497  ARG B NH1 1 
ATOM   6507  N  NH2 . ARG B  1 390 ? 56.970  2.426   -13.829 1.00   42.20 ? 497  ARG B NH2 1 
ATOM   6508  N  N   . ARG B  1 391 ? 53.059  7.102   -13.170 1.00   25.69 ? 498  ARG B N   1 
ATOM   6509  C  CA  . ARG B  1 391 ? 52.848  7.123   -11.728 1.00   23.83 ? 498  ARG B CA  1 
ATOM   6510  C  C   . ARG B  1 391 ? 53.840  6.351   -10.857 1.00   24.51 ? 498  ARG B C   1 
ATOM   6511  O  O   . ARG B  1 391 ? 54.323  6.879   -9.851  1.00   24.26 ? 498  ARG B O   1 
ATOM   6512  C  CB  . ARG B  1 391 ? 51.424  6.666   -11.418 1.00   22.11 ? 498  ARG B CB  1 
ATOM   6513  C  CG  . ARG B  1 391 ? 50.926  7.088   -10.046 1.00   21.09 ? 498  ARG B CG  1 
ATOM   6514  C  CD  . ARG B  1 391 ? 49.415  6.921   -9.938  1.00   20.52 ? 498  ARG B CD  1 
ATOM   6515  N  NE  . ARG B  1 391 ? 49.008  5.555   -10.264 1.00   19.92 ? 498  ARG B NE  1 
ATOM   6516  C  CZ  . ARG B  1 391 ? 47.743  5.170   -10.451 1.00   20.97 ? 498  ARG B CZ  1 
ATOM   6517  N  NH1 . ARG B  1 391 ? 47.460  3.905   -10.745 1.00   18.42 ? 498  ARG B NH1 1 
ATOM   6518  N  NH2 . ARG B  1 391 ? 46.756  6.050   -10.342 1.00   16.29 ? 498  ARG B NH2 1 
ATOM   6519  N  N   . GLY B  1 392 ? 54.144  5.116   -11.239 1.00   24.57 ? 499  GLY B N   1 
ATOM   6520  C  CA  . GLY B  1 392 ? 55.068  4.307   -10.465 1.00   23.36 ? 499  GLY B CA  1 
ATOM   6521  C  C   . GLY B  1 392 ? 56.488  4.825   -10.315 1.00   23.65 ? 499  GLY B C   1 
ATOM   6522  O  O   . GLY B  1 392 ? 57.237  4.304   -9.491  1.00   21.41 ? 499  GLY B O   1 
ATOM   6523  N  N   . ASP B  1 393 ? 56.878  5.827   -11.097 1.00   20.97 ? 500  ASP B N   1 
ATOM   6524  C  CA  . ASP B  1 393 ? 58.232  6.360   -10.975 1.00   23.74 ? 500  ASP B CA  1 
ATOM   6525  C  C   . ASP B  1 393 ? 58.330  7.374   -9.847  1.00   22.07 ? 500  ASP B C   1 
ATOM   6526  O  O   . ASP B  1 393 ? 59.423  7.775   -9.453  1.00   23.57 ? 500  ASP B O   1 
ATOM   6527  C  CB  . ASP B  1 393 ? 58.693  7.002   -12.288 1.00   25.64 ? 500  ASP B CB  1 
ATOM   6528  C  CG  . ASP B  1 393 ? 58.973  5.971   -13.373 1.00   25.92 ? 500  ASP B CG  1 
ATOM   6529  O  OD1 . ASP B  1 393 ? 59.158  4.782   -13.034 1.00   28.21 ? 500  ASP B OD1 1 
ATOM   6530  O  OD2 . ASP B  1 393 ? 59.024  6.353   -14.562 1.00   30.12 ? 500  ASP B OD2 1 
ATOM   6531  N  N   . LEU B  1 394 ? 57.184  7.784   -9.320  1.00   21.78 ? 501  LEU B N   1 
ATOM   6532  C  CA  . LEU B  1 394 ? 57.167  8.756   -8.228  1.00   22.99 ? 501  LEU B CA  1 
ATOM   6533  C  C   . LEU B  1 394 ? 57.422  8.158   -6.837  1.00   21.75 ? 501  LEU B C   1 
ATOM   6534  O  O   . LEU B  1 394 ? 57.048  7.019   -6.552  1.00   19.78 ? 501  LEU B O   1 
ATOM   6535  C  CB  . LEU B  1 394 ? 55.815  9.463   -8.183  1.00   23.85 ? 501  LEU B CB  1 
ATOM   6536  C  CG  . LEU B  1 394 ? 55.375  10.283  -9.399  1.00   27.47 ? 501  LEU B CG  1 
ATOM   6537  C  CD1 . LEU B  1 394 ? 53.889  10.578  -9.290  1.00   22.20 ? 501  LEU B CD1 1 
ATOM   6538  C  CD2 . LEU B  1 394 ? 56.180  11.570  -9.473  1.00   24.76 ? 501  LEU B CD2 1 
ATOM   6539  N  N   . ALA B  1 395 ? 58.058  8.953   -5.984  1.00   21.05 ? 502  ALA B N   1 
ATOM   6540  C  CA  . ALA B  1 395 ? 58.305  8.598   -4.599  1.00   19.79 ? 502  ALA B CA  1 
ATOM   6541  C  C   . ALA B  1 395 ? 57.912  9.908   -3.921  1.00   21.91 ? 502  ALA B C   1 
ATOM   6542  O  O   . ALA B  1 395 ? 58.320  10.986  -4.367  1.00   22.57 ? 502  ALA B O   1 
ATOM   6543  C  CB  . ALA B  1 395 ? 59.768  8.280   -4.364  1.00   17.35 ? 502  ALA B CB  1 
ATOM   6544  N  N   . ILE B  1 396 ? 57.105  9.822   -2.869  1.00   19.32 ? 503  ILE B N   1 
ATOM   6545  C  CA  . ILE B  1 396 ? 56.622  11.009  -2.178  1.00   17.86 ? 503  ILE B CA  1 
ATOM   6546  C  C   . ILE B  1 396 ? 56.885  10.896  -0.680  1.00   19.94 ? 503  ILE B C   1 
ATOM   6547  O  O   . ILE B  1 396 ? 56.550  9.886   -0.048  1.00   19.64 ? 503  ILE B O   1 
ATOM   6548  C  CB  . ILE B  1 396 ? 55.099  11.187  -2.448  1.00   17.55 ? 503  ILE B CB  1 
ATOM   6549  C  CG1 . ILE B  1 396 ? 54.861  11.231  -3.960  1.00   16.81 ? 503  ILE B CG1 1 
ATOM   6550  C  CG2 . ILE B  1 396 ? 54.575  12.473  -1.824  1.00   13.65 ? 503  ILE B CG2 1 
ATOM   6551  C  CD1 . ILE B  1 396 ? 53.406  11.418  -4.347  1.00   21.08 ? 503  ILE B CD1 1 
ATOM   6552  N  N   . HIS B  1 397 ? 57.481  11.939  -0.114  1.00   17.79 ? 504  HIS B N   1 
ATOM   6553  C  CA  . HIS B  1 397 ? 57.808  11.933  1.302   1.00   19.22 ? 504  HIS B CA  1 
ATOM   6554  C  C   . HIS B  1 397 ? 57.248  13.166  1.991   1.00   18.86 ? 504  HIS B C   1 
ATOM   6555  O  O   . HIS B  1 397 ? 57.098  14.220  1.380   1.00   18.87 ? 504  HIS B O   1 
ATOM   6556  C  CB  . HIS B  1 397 ? 59.325  11.886  1.467   1.00   19.20 ? 504  HIS B CB  1 
ATOM   6557  C  CG  . HIS B  1 397 ? 59.993  10.929  0.534   1.00   19.94 ? 504  HIS B CG  1 
ATOM   6558  N  ND1 . HIS B  1 397 ? 60.027  9.571   0.755   1.00   24.39 ? 504  HIS B ND1 1 
ATOM   6559  C  CD2 . HIS B  1 397 ? 60.620  11.134  -0.651  1.00   20.39 ? 504  HIS B CD2 1 
ATOM   6560  C  CE1 . HIS B  1 397 ? 60.644  8.979   -0.253  1.00   19.81 ? 504  HIS B CE1 1 
ATOM   6561  N  NE2 . HIS B  1 397 ? 61.014  9.905   -1.118  1.00   18.98 ? 504  HIS B NE2 1 
ATOM   6562  N  N   . LEU B  1 398 ? 56.924  13.021  3.269   1.00   17.98 ? 505  LEU B N   1 
ATOM   6563  C  CA  . LEU B  1 398 ? 56.384  14.131  4.040   1.00   17.69 ? 505  LEU B CA  1 
ATOM   6564  C  C   . LEU B  1 398 ? 57.187  14.231  5.333   1.00   18.51 ? 505  LEU B C   1 
ATOM   6565  O  O   . LEU B  1 398 ? 57.286  13.249  6.083   1.00   18.54 ? 505  LEU B O   1 
ATOM   6566  C  CB  . LEU B  1 398 ? 54.900  13.890  4.350   1.00   14.55 ? 505  LEU B CB  1 
ATOM   6567  C  CG  . LEU B  1 398 ? 54.225  15.025  5.132   1.00   17.60 ? 505  LEU B CG  1 
ATOM   6568  C  CD1 . LEU B  1 398 ? 54.148  16.301  4.286   1.00   15.06 ? 505  LEU B CD1 1 
ATOM   6569  C  CD2 . LEU B  1 398 ? 52.855  14.584  5.559   1.00   13.05 ? 505  LEU B CD2 1 
ATOM   6570  N  N   . VAL B  1 399 ? 57.778  15.401  5.584   1.00   15.84 ? 506  VAL B N   1 
ATOM   6571  C  CA  . VAL B  1 399 ? 58.569  15.587  6.790   1.00   16.91 ? 506  VAL B CA  1 
ATOM   6572  C  C   . VAL B  1 399 ? 57.850  16.496  7.769   1.00   17.03 ? 506  VAL B C   1 
ATOM   6573  O  O   . VAL B  1 399 ? 57.468  17.613  7.425   1.00   18.16 ? 506  VAL B O   1 
ATOM   6574  C  CB  . VAL B  1 399 ? 59.950  16.200  6.478   1.00   18.77 ? 506  VAL B CB  1 
ATOM   6575  C  CG1 . VAL B  1 399 ? 60.810  16.190  7.742   1.00   18.50 ? 506  VAL B CG1 1 
ATOM   6576  C  CG2 . VAL B  1 399 ? 60.635  15.417  5.375   1.00   16.66 ? 506  VAL B CG2 1 
ATOM   6577  N  N   . SER B  1 400 ? 57.655  16.015  8.990   1.00   19.05 ? 507  SER B N   1 
ATOM   6578  C  CA  . SER B  1 400 ? 56.960  16.798  10.006  1.00   17.18 ? 507  SER B CA  1 
ATOM   6579  C  C   . SER B  1 400 ? 57.904  17.854  10.578  1.00   19.12 ? 507  SER B C   1 
ATOM   6580  O  O   . SER B  1 400 ? 59.118  17.763  10.411  1.00   17.29 ? 507  SER B O   1 
ATOM   6581  C  CB  . SER B  1 400 ? 56.469  15.881  11.130  1.00   19.43 ? 507  SER B CB  1 
ATOM   6582  O  OG  . SER B  1 400 ? 57.558  15.343  11.872  1.00   16.11 ? 507  SER B OG  1 
ATOM   6583  N  N   . PRO B  1 401 ? 57.352  18.881  11.244  1.00   21.10 ? 508  PRO B N   1 
ATOM   6584  C  CA  . PRO B  1 401 ? 58.171  19.939  11.838  1.00   20.81 ? 508  PRO B CA  1 
ATOM   6585  C  C   . PRO B  1 401 ? 59.228  19.345  12.785  1.00   22.37 ? 508  PRO B C   1 
ATOM   6586  O  O   . PRO B  1 401 ? 60.317  19.891  12.934  1.00   21.47 ? 508  PRO B O   1 
ATOM   6587  C  CB  . PRO B  1 401 ? 57.140  20.787  12.581  1.00   22.45 ? 508  PRO B CB  1 
ATOM   6588  C  CG  . PRO B  1 401 ? 55.942  20.687  11.677  1.00   18.30 ? 508  PRO B CG  1 
ATOM   6589  C  CD  . PRO B  1 401 ? 55.916  19.207  11.355  1.00   20.96 ? 508  PRO B CD  1 
ATOM   6590  N  N   . MET B  1 402 ? 58.909  18.224  13.424  1.00   20.33 ? 509  MET B N   1 
ATOM   6591  C  CA  . MET B  1 402 ? 59.859  17.615  14.334  1.00   20.76 ? 509  MET B CA  1 
ATOM   6592  C  C   . MET B  1 402 ? 60.839  16.660  13.647  1.00   21.52 ? 509  MET B C   1 
ATOM   6593  O  O   . MET B  1 402 ? 61.506  15.863  14.297  1.00   22.62 ? 509  MET B O   1 
ATOM   6594  C  CB  . MET B  1 402 ? 59.112  16.928  15.473  1.00   21.68 ? 509  MET B CB  1 
ATOM   6595  C  CG  . MET B  1 402 ? 58.599  17.929  16.492  1.00   18.71 ? 509  MET B CG  1 
ATOM   6596  S  SD  . MET B  1 402 ? 57.554  17.192  17.762  1.00   25.21 ? 509  MET B SD  1 
ATOM   6597  C  CE  . MET B  1 402 ? 58.723  17.127  19.181  1.00   18.86 ? 509  MET B CE  1 
ATOM   6598  N  N   . GLY B  1 403 ? 60.897  16.739  12.323  1.00   19.88 ? 510  GLY B N   1 
ATOM   6599  C  CA  . GLY B  1 403 ? 61.839  15.947  11.560  1.00   17.74 ? 510  GLY B CA  1 
ATOM   6600  C  C   . GLY B  1 403 ? 61.520  14.515  11.195  1.00   20.11 ? 510  GLY B C   1 
ATOM   6601  O  O   . GLY B  1 403 ? 62.403  13.799  10.730  1.00   19.98 ? 510  GLY B O   1 
ATOM   6602  N  N   . THR B  1 404 ? 60.283  14.083  11.391  1.00   20.56 ? 511  THR B N   1 
ATOM   6603  C  CA  . THR B  1 404 ? 59.940  12.714  11.061  1.00   17.80 ? 511  THR B CA  1 
ATOM   6604  C  C   . THR B  1 404 ? 59.587  12.612  9.580   1.00   18.90 ? 511  THR B C   1 
ATOM   6605  O  O   . THR B  1 404 ? 58.678  13.273  9.076   1.00   18.83 ? 511  THR B O   1 
ATOM   6606  C  CB  . THR B  1 404 ? 58.780  12.234  11.914  1.00   18.87 ? 511  THR B CB  1 
ATOM   6607  O  OG1 . THR B  1 404 ? 59.143  12.364  13.289  1.00   18.88 ? 511  THR B OG1 1 
ATOM   6608  C  CG2 . THR B  1 404 ? 58.460  10.763  11.603  1.00   18.95 ? 511  THR B CG2 1 
ATOM   6609  N  N   . ARG B  1 405 ? 60.323  11.771  8.879   1.00   20.21 ? 512  ARG B N   1 
ATOM   6610  C  CA  . ARG B  1 405 ? 60.108  11.604  7.454   1.00   20.90 ? 512  ARG B CA  1 
ATOM   6611  C  C   . ARG B  1 405 ? 59.220  10.411  7.132   1.00   19.19 ? 512  ARG B C   1 
ATOM   6612  O  O   . ARG B  1 405 ? 59.631  9.258   7.285   1.00   16.46 ? 512  ARG B O   1 
ATOM   6613  C  CB  . ARG B  1 405 ? 61.453  11.452  6.750   1.00   23.77 ? 512  ARG B CB  1 
ATOM   6614  C  CG  . ARG B  1 405 ? 61.330  11.090  5.284   1.00   33.47 ? 512  ARG B CG  1 
ATOM   6615  C  CD  . ARG B  1 405 ? 62.704  10.932  4.675   1.00   40.67 ? 512  ARG B CD  1 
ATOM   6616  N  NE  . ARG B  1 405 ? 63.318  12.238  4.523   1.00   43.01 ? 512  ARG B NE  1 
ATOM   6617  C  CZ  . ARG B  1 405 ? 63.142  12.995  3.453   1.00   45.12 ? 512  ARG B CZ  1 
ATOM   6618  N  NH1 . ARG B  1 405 ? 63.716  14.188  3.383   1.00   45.32 ? 512  ARG B NH1 1 
ATOM   6619  N  NH2 . ARG B  1 405 ? 62.420  12.530  2.440   1.00   45.06 ? 512  ARG B NH2 1 
ATOM   6620  N  N   . SER B  1 406 ? 57.996  10.701  6.696   1.00   15.92 ? 513  SER B N   1 
ATOM   6621  C  CA  . SER B  1 406 ? 57.056  9.650   6.335   1.00   16.98 ? 513  SER B CA  1 
ATOM   6622  C  C   . SER B  1 406 ? 57.063  9.474   4.827   1.00   16.34 ? 513  SER B C   1 
ATOM   6623  O  O   . SER B  1 406 ? 56.864  10.436  4.084   1.00   17.90 ? 513  SER B O   1 
ATOM   6624  C  CB  . SER B  1 406 ? 55.640  10.012  6.776   1.00   16.31 ? 513  SER B CB  1 
ATOM   6625  O  OG  . SER B  1 406 ? 55.533  10.049  8.185   1.00   20.25 ? 513  SER B OG  1 
ATOM   6626  N  N   . THR B  1 407 ? 57.315  8.259   4.367   1.00   17.33 ? 514  THR B N   1 
ATOM   6627  C  CA  . THR B  1 407 ? 57.292  8.022   2.933   1.00   18.51 ? 514  THR B CA  1 
ATOM   6628  C  C   . THR B  1 407 ? 55.862  7.660   2.597   1.00   18.24 ? 514  THR B C   1 
ATOM   6629  O  O   . THR B  1 407 ? 55.394  6.565   2.910   1.00   17.62 ? 514  THR B O   1 
ATOM   6630  C  CB  . THR B  1 407 ? 58.215  6.871   2.514   1.00   18.98 ? 514  THR B CB  1 
ATOM   6631  O  OG1 . THR B  1 407 ? 59.572  7.281   2.707   1.00   22.16 ? 514  THR B OG1 1 
ATOM   6632  C  CG2 . THR B  1 407 ? 57.998  6.518   1.023   1.00   17.05 ? 514  THR B CG2 1 
ATOM   6633  N  N   . LEU B  1 408 ? 55.166  8.609   1.984   1.00   17.07 ? 515  LEU B N   1 
ATOM   6634  C  CA  . LEU B  1 408 ? 53.779  8.423   1.598   1.00   17.23 ? 515  LEU B CA  1 
ATOM   6635  C  C   . LEU B  1 408 ? 53.654  7.464   0.423   1.00   18.09 ? 515  LEU B C   1 
ATOM   6636  O  O   . LEU B  1 408 ? 52.673  6.740   0.316   1.00   19.15 ? 515  LEU B O   1 
ATOM   6637  C  CB  . LEU B  1 408 ? 53.161  9.774   1.230   1.00   15.34 ? 515  LEU B CB  1 
ATOM   6638  C  CG  . LEU B  1 408 ? 53.293  10.813  2.345   1.00   15.27 ? 515  LEU B CG  1 
ATOM   6639  C  CD1 . LEU B  1 408 ? 52.729  12.133  1.872   1.00   15.48 ? 515  LEU B CD1 1 
ATOM   6640  C  CD2 . LEU B  1 408 ? 52.550  10.338  3.593   1.00   15.86 ? 515  LEU B CD2 1 
ATOM   6641  N  N   . LEU B  1 409 ? 54.647  7.465   -0.460  1.00   17.57 ? 516  LEU B N   1 
ATOM   6642  C  CA  . LEU B  1 409 ? 54.616  6.588   -1.621  1.00   20.07 ? 516  LEU B CA  1 
ATOM   6643  C  C   . LEU B  1 409 ? 56.012  6.249   -2.093  1.00   20.30 ? 516  LEU B C   1 
ATOM   6644  O  O   . LEU B  1 409 ? 56.797  7.139   -2.402  1.00   20.98 ? 516  LEU B O   1 
ATOM   6645  C  CB  . LEU B  1 409 ? 53.855  7.253   -2.779  1.00   20.36 ? 516  LEU B CB  1 
ATOM   6646  C  CG  . LEU B  1 409 ? 53.840  6.534   -4.153  1.00   19.33 ? 516  LEU B CG  1 
ATOM   6647  C  CD1 . LEU B  1 409 ? 52.852  5.376   -4.129  1.00   18.01 ? 516  LEU B CD1 1 
ATOM   6648  C  CD2 . LEU B  1 409 ? 53.454  7.513   -5.254  1.00   14.35 ? 516  LEU B CD2 1 
ATOM   6649  N  N   . ALA B  1 410 ? 56.321  4.960   -2.145  1.00   22.19 ? 517  ALA B N   1 
ATOM   6650  C  CA  . ALA B  1 410 ? 57.621  4.519   -2.637  1.00   22.85 ? 517  ALA B CA  1 
ATOM   6651  C  C   . ALA B  1 410 ? 57.390  4.152   -4.100  1.00   22.54 ? 517  ALA B C   1 
ATOM   6652  O  O   . ALA B  1 410 ? 56.250  3.926   -4.515  1.00   22.47 ? 517  ALA B O   1 
ATOM   6653  C  CB  . ALA B  1 410 ? 58.098  3.297   -1.859  1.00   24.05 ? 517  ALA B CB  1 
ATOM   6654  N  N   . ALA B  1 411 ? 58.457  4.104   -4.885  1.00   23.30 ? 518  ALA B N   1 
ATOM   6655  C  CA  . ALA B  1 411 ? 58.328  3.754   -6.297  1.00   21.65 ? 518  ALA B CA  1 
ATOM   6656  C  C   . ALA B  1 411 ? 57.630  2.407   -6.480  1.00   22.48 ? 518  ALA B C   1 
ATOM   6657  O  O   . ALA B  1 411 ? 57.833  1.477   -5.695  1.00   21.56 ? 518  ALA B O   1 
ATOM   6658  C  CB  . ALA B  1 411 ? 59.695  3.706   -6.944  1.00   20.34 ? 518  ALA B CB  1 
ATOM   6659  N  N   . ARG B  1 412 ? 56.797  2.320   -7.513  1.00   20.05 ? 519  ARG B N   1 
ATOM   6660  C  CA  . ARG B  1 412 ? 56.079  1.093   -7.846  1.00   22.47 ? 519  ARG B CA  1 
ATOM   6661  C  C   . ARG B  1 412 ? 56.394  0.816   -9.315  1.00   23.69 ? 519  ARG B C   1 
ATOM   6662  O  O   . ARG B  1 412 ? 55.714  1.287   -10.221 1.00   23.79 ? 519  ARG B O   1 
ATOM   6663  C  CB  . ARG B  1 412 ? 54.565  1.264   -7.639  1.00   18.59 ? 519  ARG B CB  1 
ATOM   6664  C  CG  . ARG B  1 412 ? 54.160  1.424   -6.170  1.00   19.74 ? 519  ARG B CG  1 
ATOM   6665  C  CD  . ARG B  1 412 ? 52.713  0.989   -5.937  1.00   13.80 ? 519  ARG B CD  1 
ATOM   6666  N  NE  . ARG B  1 412 ? 51.785  1.746   -6.761  1.00   14.58 ? 519  ARG B NE  1 
ATOM   6667  C  CZ  . ARG B  1 412 ? 50.496  1.449   -6.901  1.00   18.55 ? 519  ARG B CZ  1 
ATOM   6668  N  NH1 . ARG B  1 412 ? 49.722  2.197   -7.679  1.00   17.84 ? 519  ARG B NH1 1 
ATOM   6669  N  NH2 . ARG B  1 412 ? 49.982  0.406   -6.268  1.00   14.97 ? 519  ARG B NH2 1 
ATOM   6670  N  N   . PRO B  1 413 ? 57.451  0.046   -9.563  1.00   25.96 ? 520  PRO B N   1 
ATOM   6671  C  CA  . PRO B  1 413 ? 57.878  -0.292  -10.921 1.00   25.99 ? 520  PRO B CA  1 
ATOM   6672  C  C   . PRO B  1 413 ? 56.810  -0.784  -11.891 1.00   24.61 ? 520  PRO B C   1 
ATOM   6673  O  O   . PRO B  1 413 ? 56.902  -0.520  -13.087 1.00   24.80 ? 520  PRO B O   1 
ATOM   6674  C  CB  . PRO B  1 413 ? 59.000  -1.310  -10.687 1.00   26.33 ? 520  PRO B CB  1 
ATOM   6675  C  CG  . PRO B  1 413 ? 58.652  -1.914  -9.334  1.00   30.55 ? 520  PRO B CG  1 
ATOM   6676  C  CD  . PRO B  1 413 ? 58.227  -0.703  -8.559  1.00   27.72 ? 520  PRO B CD  1 
ATOM   6677  N  N   . HIS B  1 414 ? 55.794  -1.483  -11.399 1.00   24.30 ? 521  HIS B N   1 
ATOM   6678  C  CA  . HIS B  1 414 ? 54.747  -1.979  -12.294 1.00   25.74 ? 521  HIS B CA  1 
ATOM   6679  C  C   . HIS B  1 414 ? 53.627  -0.967  -12.573 1.00   27.46 ? 521  HIS B C   1 
ATOM   6680  O  O   . HIS B  1 414 ? 52.737  -1.233  -13.391 1.00   27.16 ? 521  HIS B O   1 
ATOM   6681  C  CB  . HIS B  1 414 ? 54.104  -3.253  -11.729 1.00   24.41 ? 521  HIS B CB  1 
ATOM   6682  C  CG  . HIS B  1 414 ? 55.068  -4.372  -11.506 1.00   27.09 ? 521  HIS B CG  1 
ATOM   6683  N  ND1 . HIS B  1 414 ? 55.832  -4.909  -12.518 1.00   28.28 ? 521  HIS B ND1 1 
ATOM   6684  C  CD2 . HIS B  1 414 ? 55.392  -5.057  -10.384 1.00   29.86 ? 521  HIS B CD2 1 
ATOM   6685  C  CE1 . HIS B  1 414 ? 56.585  -5.879  -12.030 1.00   31.53 ? 521  HIS B CE1 1 
ATOM   6686  N  NE2 . HIS B  1 414 ? 56.337  -5.990  -10.736 1.00   31.88 ? 521  HIS B NE2 1 
ATOM   6687  N  N   . ASP B  1 415 ? 53.662  0.178   -11.894 1.00   21.78 ? 522  ASP B N   1 
ATOM   6688  C  CA  . ASP B  1 415 ? 52.626  1.187   -12.062 1.00   23.16 ? 522  ASP B CA  1 
ATOM   6689  C  C   . ASP B  1 415 ? 52.937  2.152   -13.209 1.00   22.95 ? 522  ASP B C   1 
ATOM   6690  O  O   . ASP B  1 415 ? 53.615  3.174   -13.033 1.00   20.55 ? 522  ASP B O   1 
ATOM   6691  C  CB  . ASP B  1 415 ? 52.425  1.950   -10.741 1.00   22.63 ? 522  ASP B CB  1 
ATOM   6692  C  CG  . ASP B  1 415 ? 51.180  2.836   -10.754 1.00   25.21 ? 522  ASP B CG  1 
ATOM   6693  O  OD1 . ASP B  1 415 ? 50.372  2.713   -11.701 1.00   21.73 ? 522  ASP B OD1 1 
ATOM   6694  O  OD2 . ASP B  1 415 ? 51.005  3.646   -9.814  1.00   23.96 ? 522  ASP B OD2 1 
ATOM   6695  N  N   . TYR B  1 416 ? 52.423  1.820   -14.387 1.00   24.16 ? 523  TYR B N   1 
ATOM   6696  C  CA  . TYR B  1 416 ? 52.653  2.633   -15.576 1.00   27.78 ? 523  TYR B CA  1 
ATOM   6697  C  C   . TYR B  1 416 ? 51.496  3.579   -15.843 1.00   24.97 ? 523  TYR B C   1 
ATOM   6698  O  O   . TYR B  1 416 ? 51.441  4.215   -16.888 1.00   27.20 ? 523  TYR B O   1 
ATOM   6699  C  CB  . TYR B  1 416 ? 52.881  1.725   -16.792 1.00   29.48 ? 523  TYR B CB  1 
ATOM   6700  C  CG  . TYR B  1 416 ? 51.750  0.749   -17.023 1.00   37.49 ? 523  TYR B CG  1 
ATOM   6701  C  CD1 . TYR B  1 416 ? 50.577  1.140   -17.678 1.00   38.06 ? 523  TYR B CD1 1 
ATOM   6702  C  CD2 . TYR B  1 416 ? 51.819  -0.551  -16.516 1.00   41.32 ? 523  TYR B CD2 1 
ATOM   6703  C  CE1 . TYR B  1 416 ? 49.499  0.259   -17.814 1.00   41.11 ? 523  TYR B CE1 1 
ATOM   6704  C  CE2 . TYR B  1 416 ? 50.751  -1.438  -16.645 1.00   43.81 ? 523  TYR B CE2 1 
ATOM   6705  C  CZ  . TYR B  1 416 ? 49.595  -1.028  -17.290 1.00   45.60 ? 523  TYR B CZ  1 
ATOM   6706  O  OH  . TYR B  1 416 ? 48.537  -1.908  -17.385 1.00   48.63 ? 523  TYR B OH  1 
ATOM   6707  N  N   . SER B  1 417 ? 50.580  3.683   -14.889 1.00   25.10 ? 524  SER B N   1 
ATOM   6708  C  CA  . SER B  1 417 ? 49.415  4.549   -15.039 1.00   25.26 ? 524  SER B CA  1 
ATOM   6709  C  C   . SER B  1 417 ? 49.745  5.993   -15.356 1.00   25.11 ? 524  SER B C   1 
ATOM   6710  O  O   . SER B  1 417 ? 50.711  6.559   -14.843 1.00   26.94 ? 524  SER B O   1 
ATOM   6711  C  CB  . SER B  1 417 ? 48.558  4.518   -13.776 1.00   28.20 ? 524  SER B CB  1 
ATOM   6712  O  OG  . SER B  1 417 ? 47.390  5.315   -13.919 1.00   29.15 ? 524  SER B OG  1 
ATOM   6713  N  N   . ALA B  1 418 ? 48.921  6.587   -16.206 1.00   24.74 ? 525  ALA B N   1 
ATOM   6714  C  CA  . ALA B  1 418 ? 49.093  7.980   -16.583 1.00   29.79 ? 525  ALA B CA  1 
ATOM   6715  C  C   . ALA B  1 418 ? 47.965  8.798   -15.949 1.00   28.48 ? 525  ALA B C   1 
ATOM   6716  O  O   . ALA B  1 418 ? 47.786  9.974   -16.254 1.00   30.04 ? 525  ALA B O   1 
ATOM   6717  C  CB  . ALA B  1 418 ? 49.057  8.121   -18.101 1.00   28.47 ? 525  ALA B CB  1 
ATOM   6718  N  N   . ASP B  1 419 ? 47.217  8.169   -15.050 1.00   28.30 ? 526  ASP B N   1 
ATOM   6719  C  CA  . ASP B  1 419 ? 46.106  8.839   -14.393 1.00   29.94 ? 526  ASP B CA  1 
ATOM   6720  C  C   . ASP B  1 419 ? 46.434  9.672   -13.149 1.00   28.28 ? 526  ASP B C   1 
ATOM   6721  O  O   . ASP B  1 419 ? 45.565  10.358  -12.628 1.00   29.97 ? 526  ASP B O   1 
ATOM   6722  C  CB  . ASP B  1 419 ? 45.030  7.820   -14.023 1.00   35.71 ? 526  ASP B CB  1 
ATOM   6723  C  CG  . ASP B  1 419 ? 44.503  7.061   -15.225 1.00   41.08 ? 526  ASP B CG  1 
ATOM   6724  O  OD1 . ASP B  1 419 ? 44.314  7.679   -16.294 1.00   46.77 ? 526  ASP B OD1 1 
ATOM   6725  O  OD2 . ASP B  1 419 ? 44.262  5.845   -15.094 1.00   47.24 ? 526  ASP B OD2 1 
ATOM   6726  N  N   . GLY B  1 420 ? 47.665  9.617   -12.664 1.00   26.32 ? 527  GLY B N   1 
ATOM   6727  C  CA  . GLY B  1 420 ? 48.008  10.392  -11.481 1.00   26.10 ? 527  GLY B CA  1 
ATOM   6728  C  C   . GLY B  1 420 ? 47.171  10.065  -10.247 1.00   24.63 ? 527  GLY B C   1 
ATOM   6729  O  O   . GLY B  1 420 ? 46.671  8.945   -10.096 1.00   23.43 ? 527  GLY B O   1 
ATOM   6730  N  N   . PHE B  1 421 ? 47.041  11.043  -9.352  1.00   22.48 ? 528  PHE B N   1 
ATOM   6731  C  CA  . PHE B  1 421 ? 46.265  10.884  -8.125  1.00   22.91 ? 528  PHE B CA  1 
ATOM   6732  C  C   . PHE B  1 421 ? 45.212  11.976  -8.075  1.00   23.00 ? 528  PHE B C   1 
ATOM   6733  O  O   . PHE B  1 421 ? 45.496  13.144  -8.344  1.00   23.14 ? 528  PHE B O   1 
ATOM   6734  C  CB  . PHE B  1 421 ? 47.167  10.980  -6.884  1.00   18.94 ? 528  PHE B CB  1 
ATOM   6735  C  CG  . PHE B  1 421 ? 48.056  9.790   -6.696  1.00   15.82 ? 528  PHE B CG  1 
ATOM   6736  C  CD1 . PHE B  1 421 ? 47.554  8.613   -6.150  1.00   15.56 ? 528  PHE B CD1 1 
ATOM   6737  C  CD2 . PHE B  1 421 ? 49.389  9.835   -7.081  1.00   16.89 ? 528  PHE B CD2 1 
ATOM   6738  C  CE1 . PHE B  1 421 ? 48.361  7.489   -5.988  1.00   14.20 ? 528  PHE B CE1 1 
ATOM   6739  C  CE2 . PHE B  1 421 ? 50.218  8.712   -6.923  1.00   15.15 ? 528  PHE B CE2 1 
ATOM   6740  C  CZ  . PHE B  1 421 ? 49.702  7.539   -6.377  1.00   15.37 ? 528  PHE B CZ  1 
ATOM   6741  N  N   . ASN B  1 422 ? 43.994  11.584  -7.727  1.00   23.92 ? 529  ASN B N   1 
ATOM   6742  C  CA  . ASN B  1 422 ? 42.890  12.519  -7.656  1.00   25.28 ? 529  ASN B CA  1 
ATOM   6743  C  C   . ASN B  1 422 ? 42.402  12.647  -6.222  1.00   23.99 ? 529  ASN B C   1 
ATOM   6744  O  O   . ASN B  1 422 ? 41.580  11.857  -5.752  1.00   21.96 ? 529  ASN B O   1 
ATOM   6745  C  CB  . ASN B  1 422 ? 41.763  12.047  -8.567  1.00   28.59 ? 529  ASN B CB  1 
ATOM   6746  C  CG  . ASN B  1 422 ? 40.553  12.958  -8.507  1.00   41.09 ? 529  ASN B CG  1 
ATOM   6747  O  OD1 . ASN B  1 422 ? 40.685  14.182  -8.355  1.00   46.52 ? 529  ASN B OD1 1 
ATOM   6748  N  ND2 . ASN B  1 422 ? 39.361  12.374  -8.639  1.00   45.30 ? 529  ASN B ND2 1 
ATOM   6749  N  N   . ASP B  1 423 ? 42.917  13.663  -5.538  1.00   23.07 ? 530  ASP B N   1 
ATOM   6750  C  CA  . ASP B  1 423 ? 42.603  13.915  -4.142  1.00   20.91 ? 530  ASP B CA  1 
ATOM   6751  C  C   . ASP B  1 423 ? 42.757  12.638  -3.334  1.00   22.06 ? 530  ASP B C   1 
ATOM   6752  O  O   . ASP B  1 423 ? 41.862  12.254  -2.575  1.00   21.43 ? 530  ASP B O   1 
ATOM   6753  C  CB  . ASP B  1 423 ? 41.185  14.466  -3.975  1.00   21.83 ? 530  ASP B CB  1 
ATOM   6754  C  CG  . ASP B  1 423 ? 40.920  14.935  -2.555  1.00   25.88 ? 530  ASP B CG  1 
ATOM   6755  O  OD1 . ASP B  1 423 ? 41.883  15.403  -1.917  1.00   27.76 ? 530  ASP B OD1 1 
ATOM   6756  O  OD2 . ASP B  1 423 ? 39.774  14.852  -2.066  1.00   27.19 ? 530  ASP B OD2 1 
ATOM   6757  N  N   . TRP B  1 424 ? 43.894  11.972  -3.507  1.00   19.28 ? 531  TRP B N   1 
ATOM   6758  C  CA  . TRP B  1 424 ? 44.158  10.737  -2.783  1.00   18.00 ? 531  TRP B CA  1 
ATOM   6759  C  C   . TRP B  1 424 ? 44.765  11.105  -1.431  1.00   16.84 ? 531  TRP B C   1 
ATOM   6760  O  O   . TRP B  1 424 ? 45.756  11.847  -1.367  1.00   13.54 ? 531  TRP B O   1 
ATOM   6761  C  CB  . TRP B  1 424 ? 45.112  9.844   -3.583  1.00   17.06 ? 531  TRP B CB  1 
ATOM   6762  C  CG  . TRP B  1 424 ? 45.333  8.557   -2.917  1.00   18.00 ? 531  TRP B CG  1 
ATOM   6763  C  CD1 . TRP B  1 424 ? 46.408  8.201   -2.160  1.00   17.88 ? 531  TRP B CD1 1 
ATOM   6764  C  CD2 . TRP B  1 424 ? 44.410  7.467   -2.851  1.00   15.57 ? 531  TRP B CD2 1 
ATOM   6765  N  NE1 . TRP B  1 424 ? 46.209  6.953   -1.619  1.00   19.47 ? 531  TRP B NE1 1 
ATOM   6766  C  CE2 . TRP B  1 424 ? 44.992  6.478   -2.031  1.00   18.32 ? 531  TRP B CE2 1 
ATOM   6767  C  CE3 . TRP B  1 424 ? 43.144  7.232   -3.404  1.00   18.78 ? 531  TRP B CE3 1 
ATOM   6768  C  CZ2 . TRP B  1 424 ? 44.356  5.265   -1.751  1.00   17.97 ? 531  TRP B CZ2 1 
ATOM   6769  C  CZ3 . TRP B  1 424 ? 42.505  6.022   -3.123  1.00   18.77 ? 531  TRP B CZ3 1 
ATOM   6770  C  CH2 . TRP B  1 424 ? 43.115  5.057   -2.305  1.00   21.56 ? 531  TRP B CH2 1 
ATOM   6771  N  N   . ALA B  1 425 ? 44.174  10.583  -0.358  1.00   15.32 ? 532  ALA B N   1 
ATOM   6772  C  CA  . ALA B  1 425 ? 44.635  10.908  0.992   1.00   18.76 ? 532  ALA B CA  1 
ATOM   6773  C  C   . ALA B  1 425 ? 45.704  9.998   1.590   1.00   19.64 ? 532  ALA B C   1 
ATOM   6774  O  O   . ALA B  1 425 ? 45.387  9.104   2.374   1.00   25.80 ? 532  ALA B O   1 
ATOM   6775  C  CB  . ALA B  1 425 ? 43.433  10.966  1.945   1.00   20.88 ? 532  ALA B CB  1 
ATOM   6776  N  N   . PHE B  1 426 ? 46.964  10.236  1.241   1.00   16.95 ? 533  PHE B N   1 
ATOM   6777  C  CA  . PHE B  1 426 ? 48.080  9.457   1.784   1.00   15.25 ? 533  PHE B CA  1 
ATOM   6778  C  C   . PHE B  1 426 ? 48.084  9.706   3.292   1.00   18.00 ? 533  PHE B C   1 
ATOM   6779  O  O   . PHE B  1 426 ? 48.013  10.857  3.733   1.00   18.84 ? 533  PHE B O   1 
ATOM   6780  C  CB  . PHE B  1 426 ? 49.389  9.936   1.170   1.00   13.83 ? 533  PHE B CB  1 
ATOM   6781  C  CG  . PHE B  1 426 ? 49.491  9.688   -0.314  1.00   13.72 ? 533  PHE B CG  1 
ATOM   6782  C  CD1 . PHE B  1 426 ? 49.890  8.447   -0.800  1.00   14.68 ? 533  PHE B CD1 1 
ATOM   6783  C  CD2 . PHE B  1 426 ? 49.170  10.692  -1.222  1.00   15.42 ? 533  PHE B CD2 1 
ATOM   6784  C  CE1 . PHE B  1 426 ? 49.970  8.209   -2.178  1.00   18.06 ? 533  PHE B CE1 1 
ATOM   6785  C  CE2 . PHE B  1 426 ? 49.244  10.469  -2.600  1.00   15.23 ? 533  PHE B CE2 1 
ATOM   6786  C  CZ  . PHE B  1 426 ? 49.646  9.223   -3.079  1.00   15.19 ? 533  PHE B CZ  1 
ATOM   6787  N  N   . MET B  1 427 ? 48.174  8.642   4.084   1.00   16.23 ? 534  MET B N   1 
ATOM   6788  C  CA  . MET B  1 427 ? 48.130  8.787   5.541   1.00   16.34 ? 534  MET B CA  1 
ATOM   6789  C  C   . MET B  1 427 ? 49.364  8.263   6.255   1.00   17.26 ? 534  MET B C   1 
ATOM   6790  O  O   . MET B  1 427 ? 49.947  7.256   5.848   1.00   18.27 ? 534  MET B O   1 
ATOM   6791  C  CB  . MET B  1 427 ? 46.890  8.068   6.090   1.00   13.41 ? 534  MET B CB  1 
ATOM   6792  C  CG  . MET B  1 427 ? 46.589  8.310   7.580   1.00   16.23 ? 534  MET B CG  1 
ATOM   6793  S  SD  . MET B  1 427 ? 47.442  7.178   8.754   1.00   18.17 ? 534  MET B SD  1 
ATOM   6794  C  CE  . MET B  1 427 ? 46.285  5.702   8.669   1.00   14.91 ? 534  MET B CE  1 
ATOM   6795  N  N   . THR B  1 428 ? 49.777  8.960   7.313   1.00   16.60 ? 535  THR B N   1 
ATOM   6796  C  CA  . THR B  1 428 ? 50.918  8.505   8.093   1.00   15.70 ? 535  THR B CA  1 
ATOM   6797  C  C   . THR B  1 428 ? 50.605  8.469   9.583   1.00   15.65 ? 535  THR B C   1 
ATOM   6798  O  O   . THR B  1 428 ? 49.908  9.339   10.116  1.00   12.11 ? 535  THR B O   1 
ATOM   6799  C  CB  . THR B  1 428 ? 52.189  9.365   7.855   1.00   17.74 ? 535  THR B CB  1 
ATOM   6800  O  OG1 . THR B  1 428 ? 53.210  8.919   8.751   1.00   16.51 ? 535  THR B OG1 1 
ATOM   6801  C  CG2 . THR B  1 428 ? 51.929  10.868  8.092   1.00   12.46 ? 535  THR B CG2 1 
ATOM   6802  N  N   . THR B  1 429 ? 51.121  7.445   10.247  1.00   14.23 ? 536  THR B N   1 
ATOM   6803  C  CA  . THR B  1 429 ? 50.912  7.272   11.677  1.00   15.61 ? 536  THR B CA  1 
ATOM   6804  C  C   . THR B  1 429 ? 52.231  7.549   12.386  1.00   14.26 ? 536  THR B C   1 
ATOM   6805  O  O   . THR B  1 429 ? 52.309  7.467   13.603  1.00   15.74 ? 536  THR B O   1 
ATOM   6806  C  CB  . THR B  1 429 ? 50.539  5.813   12.001  1.00   17.48 ? 536  THR B CB  1 
ATOM   6807  O  OG1 . THR B  1 429 ? 51.620  4.976   11.588  1.00   17.64 ? 536  THR B OG1 1 
ATOM   6808  C  CG2 . THR B  1 429 ? 49.294  5.365   11.236  1.00   12.08 ? 536  THR B CG2 1 
ATOM   6809  N  N   . HIS B  1 430 ? 53.263  7.876   11.619  1.00   15.18 ? 537  HIS B N   1 
ATOM   6810  C  CA  . HIS B  1 430 ? 54.592  8.073   12.189  1.00   17.34 ? 537  HIS B CA  1 
ATOM   6811  C  C   . HIS B  1 430 ? 54.848  9.291   13.063  1.00   21.04 ? 537  HIS B C   1 
ATOM   6812  O  O   . HIS B  1 430 ? 55.838  9.322   13.799  1.00   18.60 ? 537  HIS B O   1 
ATOM   6813  C  CB  . HIS B  1 430 ? 55.649  8.020   11.081  1.00   17.72 ? 537  HIS B CB  1 
ATOM   6814  C  CG  . HIS B  1 430 ? 55.777  6.675   10.429  1.00   19.06 ? 537  HIS B CG  1 
ATOM   6815  N  ND1 . HIS B  1 430 ? 56.913  6.279   9.757   1.00   16.69 ? 537  HIS B ND1 1 
ATOM   6816  C  CD2 . HIS B  1 430 ? 54.915  5.630   10.357  1.00   18.41 ? 537  HIS B CD2 1 
ATOM   6817  C  CE1 . HIS B  1 430 ? 56.749  5.048   9.304   1.00   21.45 ? 537  HIS B CE1 1 
ATOM   6818  N  NE2 . HIS B  1 430 ? 55.545  4.632   9.655   1.00   18.87 ? 537  HIS B NE2 1 
ATOM   6819  N  N   . SER B  1 431 ? 53.974  10.290  12.999  1.00   20.92 ? 538  SER B N   1 
ATOM   6820  C  CA  . SER B  1 431 ? 54.170  11.483  13.805  1.00   20.39 ? 538  SER B CA  1 
ATOM   6821  C  C   . SER B  1 431 ? 53.186  11.533  14.963  1.00   21.20 ? 538  SER B C   1 
ATOM   6822  O  O   . SER B  1 431 ? 52.951  12.595  15.539  1.00   19.27 ? 538  SER B O   1 
ATOM   6823  C  CB  . SER B  1 431 ? 54.051  12.750  12.938  1.00   20.48 ? 538  SER B CB  1 
ATOM   6824  O  OG  . SER B  1 431 ? 55.192  12.900  12.099  1.00   19.45 ? 538  SER B OG  1 
ATOM   6825  N  N   . TRP B  1 432 ? 52.634  10.372  15.305  1.00   19.50 ? 539  TRP B N   1 
ATOM   6826  C  CA  . TRP B  1 432 ? 51.673  10.264  16.395  1.00   20.04 ? 539  TRP B CA  1 
ATOM   6827  C  C   . TRP B  1 432 ? 52.274  10.882  17.660  1.00   19.09 ? 539  TRP B C   1 
ATOM   6828  O  O   . TRP B  1 432 ? 53.405  10.576  18.017  1.00   16.45 ? 539  TRP B O   1 
ATOM   6829  C  CB  . TRP B  1 432 ? 51.342  8.787   16.623  1.00   17.86 ? 539  TRP B CB  1 
ATOM   6830  C  CG  . TRP B  1 432 ? 50.102  8.531   17.434  1.00   18.15 ? 539  TRP B CG  1 
ATOM   6831  C  CD1 . TRP B  1 432 ? 49.970  8.608   18.791  1.00   20.01 ? 539  TRP B CD1 1 
ATOM   6832  C  CD2 . TRP B  1 432 ? 48.830  8.103   16.932  1.00   15.83 ? 539  TRP B CD2 1 
ATOM   6833  N  NE1 . TRP B  1 432 ? 48.692  8.244   19.168  1.00   17.18 ? 539  TRP B NE1 1 
ATOM   6834  C  CE2 . TRP B  1 432 ? 47.974  7.930   18.045  1.00   17.81 ? 539  TRP B CE2 1 
ATOM   6835  C  CE3 . TRP B  1 432 ? 48.333  7.844   15.651  1.00   18.03 ? 539  TRP B CE3 1 
ATOM   6836  C  CZ2 . TRP B  1 432 ? 46.646  7.507   17.912  1.00   18.34 ? 539  TRP B CZ2 1 
ATOM   6837  C  CZ3 . TRP B  1 432 ? 47.006  7.422   15.516  1.00   16.30 ? 539  TRP B CZ3 1 
ATOM   6838  C  CH2 . TRP B  1 432 ? 46.182  7.258   16.640  1.00   17.68 ? 539  TRP B CH2 1 
ATOM   6839  N  N   . ASP B  1 433 ? 51.497  11.743  18.315  1.00   17.74 ? 540  ASP B N   1 
ATOM   6840  C  CA  . ASP B  1 433 ? 51.878  12.456  19.534  1.00   19.21 ? 540  ASP B CA  1 
ATOM   6841  C  C   . ASP B  1 433 ? 52.832  13.645  19.354  1.00   19.19 ? 540  ASP B C   1 
ATOM   6842  O  O   . ASP B  1 433 ? 53.168  14.324  20.319  1.00   20.22 ? 540  ASP B O   1 
ATOM   6843  C  CB  . ASP B  1 433 ? 52.441  11.498  20.599  1.00   16.75 ? 540  ASP B CB  1 
ATOM   6844  C  CG  . ASP B  1 433 ? 51.342  10.774  21.362  1.00   21.83 ? 540  ASP B CG  1 
ATOM   6845  O  OD1 . ASP B  1 433 ? 50.308  11.411  21.648  1.00   17.60 ? 540  ASP B OD1 1 
ATOM   6846  O  OD2 . ASP B  1 433 ? 51.505  9.576   21.682  1.00   20.14 ? 540  ASP B OD2 1 
ATOM   6847  N  N   . GLU B  1 434 ? 53.251  13.913  18.126  1.00   16.87 ? 541  GLU B N   1 
ATOM   6848  C  CA  . GLU B  1 434 ? 54.130  15.052  17.871  1.00   17.69 ? 541  GLU B CA  1 
ATOM   6849  C  C   . GLU B  1 434 ? 53.327  16.354  17.856  1.00   18.80 ? 541  GLU B C   1 
ATOM   6850  O  O   . GLU B  1 434 ? 52.095  16.347  17.700  1.00   18.16 ? 541  GLU B O   1 
ATOM   6851  C  CB  . GLU B  1 434 ? 54.833  14.909  16.511  1.00   17.55 ? 541  GLU B CB  1 
ATOM   6852  C  CG  . GLU B  1 434 ? 56.002  13.938  16.471  1.00   17.19 ? 541  GLU B CG  1 
ATOM   6853  C  CD  . GLU B  1 434 ? 56.581  13.774  15.062  1.00   20.55 ? 541  GLU B CD  1 
ATOM   6854  O  OE1 . GLU B  1 434 ? 56.395  14.673  14.223  1.00   19.10 ? 541  GLU B OE1 1 
ATOM   6855  O  OE2 . GLU B  1 434 ? 57.237  12.749  14.789  1.00   22.29 ? 541  GLU B OE2 1 
ATOM   6856  N  N   . ASP B  1 435 ? 54.024  17.473  18.039  1.00   17.22 ? 542  ASP B N   1 
ATOM   6857  C  CA  . ASP B  1 435 ? 53.374  18.779  17.971  1.00   18.37 ? 542  ASP B CA  1 
ATOM   6858  C  C   . ASP B  1 435 ? 53.441  19.045  16.478  1.00   16.84 ? 542  ASP B C   1 
ATOM   6859  O  O   . ASP B  1 435 ? 54.517  19.061  15.906  1.00   17.78 ? 542  ASP B O   1 
ATOM   6860  C  CB  . ASP B  1 435 ? 54.184  19.836  18.710  1.00   18.07 ? 542  ASP B CB  1 
ATOM   6861  C  CG  . ASP B  1 435 ? 53.561  21.217  18.623  1.00   22.83 ? 542  ASP B CG  1 
ATOM   6862  O  OD1 . ASP B  1 435 ? 53.091  21.623  17.537  1.00   27.45 ? 542  ASP B OD1 1 
ATOM   6863  O  OD2 . ASP B  1 435 ? 53.558  21.912  19.647  1.00   24.78 ? 542  ASP B OD2 1 
ATOM   6864  N  N   . PRO B  1 436 ? 52.295  19.255  15.829  1.00   19.48 ? 543  PRO B N   1 
ATOM   6865  C  CA  . PRO B  1 436 ? 52.295  19.500  14.384  1.00   18.57 ? 543  PRO B CA  1 
ATOM   6866  C  C   . PRO B  1 436 ? 52.570  20.925  13.904  1.00   19.46 ? 543  PRO B C   1 
ATOM   6867  O  O   . PRO B  1 436 ? 52.655  21.156  12.698  1.00   17.79 ? 543  PRO B O   1 
ATOM   6868  C  CB  . PRO B  1 436 ? 50.914  19.017  13.965  1.00   20.64 ? 543  PRO B CB  1 
ATOM   6869  C  CG  . PRO B  1 436 ? 50.061  19.476  15.150  1.00   23.06 ? 543  PRO B CG  1 
ATOM   6870  C  CD  . PRO B  1 436 ? 50.920  19.123  16.356  1.00   18.32 ? 543  PRO B CD  1 
ATOM   6871  N  N   . SER B  1 437 ? 52.711  21.882  14.812  1.00   17.68 ? 544  SER B N   1 
ATOM   6872  C  CA  . SER B  1 437 ? 52.964  23.244  14.352  1.00   21.13 ? 544  SER B CA  1 
ATOM   6873  C  C   . SER B  1 437 ? 54.419  23.392  13.911  1.00   20.30 ? 544  SER B C   1 
ATOM   6874  O  O   . SER B  1 437 ? 55.327  22.788  14.474  1.00   22.20 ? 544  SER B O   1 
ATOM   6875  C  CB  . SER B  1 437 ? 52.636  24.273  15.436  1.00   18.10 ? 544  SER B CB  1 
ATOM   6876  O  OG  . SER B  1 437 ? 53.586  24.222  16.465  1.00   23.32 ? 544  SER B OG  1 
ATOM   6877  N  N   . GLY B  1 438 ? 54.641  24.202  12.892  1.00   18.58 ? 545  GLY B N   1 
ATOM   6878  C  CA  . GLY B  1 438 ? 55.981  24.376  12.401  1.00   14.59 ? 545  GLY B CA  1 
ATOM   6879  C  C   . GLY B  1 438 ? 56.009  24.105  10.908  1.00   21.78 ? 545  GLY B C   1 
ATOM   6880  O  O   . GLY B  1 438 ? 54.963  24.051  10.252  1.00   24.10 ? 545  GLY B O   1 
ATOM   6881  N  N   . GLU B  1 439 ? 57.206  23.912  10.365  1.00   20.31 ? 546  GLU B N   1 
ATOM   6882  C  CA  . GLU B  1 439 ? 57.356  23.681  8.945   1.00   21.33 ? 546  GLU B CA  1 
ATOM   6883  C  C   . GLU B  1 439 ? 57.244  22.221  8.509   1.00   22.12 ? 546  GLU B C   1 
ATOM   6884  O  O   . GLU B  1 439 ? 57.942  21.351  9.025   1.00   23.59 ? 546  GLU B O   1 
ATOM   6885  C  CB  . GLU B  1 439 ? 58.693  24.256  8.479   1.00   24.71 ? 546  GLU B CB  1 
ATOM   6886  C  CG  . GLU B  1 439 ? 59.024  23.965  7.021   1.00   32.31 ? 546  GLU B CG  1 
ATOM   6887  C  CD  . GLU B  1 439 ? 60.398  24.487  6.623   1.00   36.24 ? 546  GLU B CD  1 
ATOM   6888  O  OE1 . GLU B  1 439 ? 60.483  25.549  5.971   1.00   35.03 ? 546  GLU B OE1 1 
ATOM   6889  O  OE2 . GLU B  1 439 ? 61.398  23.828  6.975   1.00   40.93 ? 546  GLU B OE2 1 
ATOM   6890  N  N   . TRP B  1 440 ? 56.344  21.969  7.565   1.00   18.80 ? 547  TRP B N   1 
ATOM   6891  C  CA  . TRP B  1 440 ? 56.152  20.644  7.005   1.00   20.12 ? 547  TRP B CA  1 
ATOM   6892  C  C   . TRP B  1 440 ? 56.762  20.729  5.617   1.00   21.75 ? 547  TRP B C   1 
ATOM   6893  O  O   . TRP B  1 440 ? 56.717  21.789  4.982   1.00   22.85 ? 547  TRP B O   1 
ATOM   6894  C  CB  . TRP B  1 440 ? 54.665  20.299  6.861   1.00   16.30 ? 547  TRP B CB  1 
ATOM   6895  C  CG  . TRP B  1 440 ? 53.994  19.914  8.128   1.00   13.98 ? 547  TRP B CG  1 
ATOM   6896  C  CD1 . TRP B  1 440 ? 53.523  20.752  9.095   1.00   14.22 ? 547  TRP B CD1 1 
ATOM   6897  C  CD2 . TRP B  1 440 ? 53.725  18.582  8.579   1.00   15.28 ? 547  TRP B CD2 1 
ATOM   6898  N  NE1 . TRP B  1 440 ? 52.979  20.023  10.124  1.00   12.78 ? 547  TRP B NE1 1 
ATOM   6899  C  CE2 . TRP B  1 440 ? 53.091  18.688  9.834   1.00   14.60 ? 547  TRP B CE2 1 
ATOM   6900  C  CE3 . TRP B  1 440 ? 53.962  17.305  8.045   1.00   15.37 ? 547  TRP B CE3 1 
ATOM   6901  C  CZ2 . TRP B  1 440 ? 52.684  17.561  10.573  1.00   16.07 ? 547  TRP B CZ2 1 
ATOM   6902  C  CZ3 . TRP B  1 440 ? 53.558  16.186  8.779   1.00   19.68 ? 547  TRP B CZ3 1 
ATOM   6903  C  CH2 . TRP B  1 440 ? 52.925  16.326  10.035  1.00   14.71 ? 547  TRP B CH2 1 
ATOM   6904  N  N   . VAL B  1 441 ? 57.329  19.625  5.142   1.00   20.48 ? 548  VAL B N   1 
ATOM   6905  C  CA  . VAL B  1 441 ? 57.924  19.600  3.813   1.00   19.48 ? 548  VAL B CA  1 
ATOM   6906  C  C   . VAL B  1 441 ? 57.435  18.393  3.019   1.00   21.47 ? 548  VAL B C   1 
ATOM   6907  O  O   . VAL B  1 441 ? 57.494  17.248  3.496   1.00   20.36 ? 548  VAL B O   1 
ATOM   6908  C  CB  . VAL B  1 441 ? 59.458  19.520  3.876   1.00   20.37 ? 548  VAL B CB  1 
ATOM   6909  C  CG1 . VAL B  1 441 ? 60.019  19.532  2.457   1.00   20.45 ? 548  VAL B CG1 1 
ATOM   6910  C  CG2 . VAL B  1 441 ? 60.029  20.681  4.699   1.00   19.07 ? 548  VAL B CG2 1 
ATOM   6911  N  N   . LEU B  1 442 ? 56.946  18.650  1.813   1.00   18.93 ? 549  LEU B N   1 
ATOM   6912  C  CA  . LEU B  1 442 ? 56.478  17.576  0.948   1.00   21.92 ? 549  LEU B CA  1 
ATOM   6913  C  C   . LEU B  1 442 ? 57.530  17.445  -0.134  1.00   22.13 ? 549  LEU B C   1 
ATOM   6914  O  O   . LEU B  1 442 ? 57.973  18.447  -0.700  1.00   21.40 ? 549  LEU B O   1 
ATOM   6915  C  CB  . LEU B  1 442 ? 55.117  17.917  0.314   1.00   20.36 ? 549  LEU B CB  1 
ATOM   6916  C  CG  . LEU B  1 442 ? 54.530  16.870  -0.656  1.00   21.84 ? 549  LEU B CG  1 
ATOM   6917  C  CD1 . LEU B  1 442 ? 54.119  15.634  0.119   1.00   18.99 ? 549  LEU B CD1 1 
ATOM   6918  C  CD2 . LEU B  1 442 ? 53.316  17.436  -1.400  1.00   19.10 ? 549  LEU B CD2 1 
ATOM   6919  N  N   . GLU B  1 443 ? 57.946  16.216  -0.408  1.00   21.34 ? 550  GLU B N   1 
ATOM   6920  C  CA  . GLU B  1 443 ? 58.941  15.977  -1.435  1.00   22.87 ? 550  GLU B CA  1 
ATOM   6921  C  C   . GLU B  1 443 ? 58.375  15.003  -2.448  1.00   21.93 ? 550  GLU B C   1 
ATOM   6922  O  O   . GLU B  1 443 ? 57.857  13.948  -2.085  1.00   23.17 ? 550  GLU B O   1 
ATOM   6923  C  CB  . GLU B  1 443 ? 60.206  15.368  -0.831  1.00   27.73 ? 550  GLU B CB  1 
ATOM   6924  C  CG  . GLU B  1 443 ? 60.846  16.160  0.288   1.00   35.04 ? 550  GLU B CG  1 
ATOM   6925  C  CD  . GLU B  1 443 ? 61.999  15.396  0.928   1.00   40.20 ? 550  GLU B CD  1 
ATOM   6926  O  OE1 . GLU B  1 443 ? 62.565  15.896  1.922   1.00   42.58 ? 550  GLU B OE1 1 
ATOM   6927  O  OE2 . GLU B  1 443 ? 62.336  14.293  0.435   1.00   40.40 ? 550  GLU B OE2 1 
ATOM   6928  N  N   . ILE B  1 444 ? 58.461  15.368  -3.717  1.00   19.67 ? 551  ILE B N   1 
ATOM   6929  C  CA  . ILE B  1 444 ? 58.002  14.505  -4.793  1.00   22.55 ? 551  ILE B CA  1 
ATOM   6930  C  C   . ILE B  1 444 ? 59.197  14.370  -5.728  1.00   25.20 ? 551  ILE B C   1 
ATOM   6931  O  O   . ILE B  1 444 ? 59.749  15.375  -6.176  1.00   23.61 ? 551  ILE B O   1 
ATOM   6932  C  CB  . ILE B  1 444 ? 56.832  15.129  -5.563  1.00   22.55 ? 551  ILE B CB  1 
ATOM   6933  C  CG1 . ILE B  1 444 ? 55.646  15.340  -4.612  1.00   22.59 ? 551  ILE B CG1 1 
ATOM   6934  C  CG2 . ILE B  1 444 ? 56.454  14.244  -6.741  1.00   22.09 ? 551  ILE B CG2 1 
ATOM   6935  C  CD1 . ILE B  1 444 ? 54.405  15.967  -5.247  1.00   19.53 ? 551  ILE B CD1 1 
ATOM   6936  N  N   . GLU B  1 445 ? 59.602  13.140  -6.024  1.00   24.78 ? 552  GLU B N   1 
ATOM   6937  C  CA  . GLU B  1 445 ? 60.757  12.953  -6.882  1.00   26.08 ? 552  GLU B CA  1 
ATOM   6938  C  C   . GLU B  1 445 ? 60.533  11.876  -7.925  1.00   27.53 ? 552  GLU B C   1 
ATOM   6939  O  O   . GLU B  1 445 ? 59.790  10.916  -7.701  1.00   28.77 ? 552  GLU B O   1 
ATOM   6940  C  CB  . GLU B  1 445 ? 61.961  12.556  -6.039  1.00   25.04 ? 552  GLU B CB  1 
ATOM   6941  C  CG  . GLU B  1 445 ? 61.800  11.162  -5.456  1.00   33.75 ? 552  GLU B CG  1 
ATOM   6942  C  CD  . GLU B  1 445 ? 62.977  10.749  -4.596  1.00   39.91 ? 552  GLU B CD  1 
ATOM   6943  O  OE1 . GLU B  1 445 ? 64.125  10.974  -5.049  1.00   42.13 ? 552  GLU B OE1 1 
ATOM   6944  O  OE2 . GLU B  1 445 ? 62.754  10.199  -3.485  1.00   37.24 ? 552  GLU B OE2 1 
ATOM   6945  N  N   . ASN B  1 446 ? 61.189  12.048  -9.067  1.00   26.80 ? 553  ASN B N   1 
ATOM   6946  C  CA  . ASN B  1 446 ? 61.140  11.084  -10.151 1.00   26.88 ? 553  ASN B CA  1 
ATOM   6947  C  C   . ASN B  1 446 ? 62.319  10.165  -9.854  1.00   27.96 ? 553  ASN B C   1 
ATOM   6948  O  O   . ASN B  1 446 ? 63.468  10.590  -9.923  1.00   28.76 ? 553  ASN B O   1 
ATOM   6949  C  CB  . ASN B  1 446 ? 61.335  11.791  -11.496 1.00   27.29 ? 553  ASN B CB  1 
ATOM   6950  C  CG  . ASN B  1 446 ? 61.478  10.816  -12.671 1.00   26.88 ? 553  ASN B CG  1 
ATOM   6951  O  OD1 . ASN B  1 446 ? 61.167  9.630   -12.566 1.00   24.90 ? 553  ASN B OD1 1 
ATOM   6952  N  ND2 . ASN B  1 446 ? 61.944  11.327  -13.799 1.00   24.64 ? 553  ASN B ND2 1 
ATOM   6953  N  N   . THR B  1 447 ? 62.026  8.918   -9.504  1.00   27.40 ? 554  THR B N   1 
ATOM   6954  C  CA  . THR B  1 447 ? 63.060  7.956   -9.167  1.00   27.48 ? 554  THR B CA  1 
ATOM   6955  C  C   . THR B  1 447 ? 63.673  7.261   -10.377 1.00   29.78 ? 554  THR B C   1 
ATOM   6956  O  O   . THR B  1 447 ? 64.602  6.469   -10.238 1.00   29.21 ? 554  THR B O   1 
ATOM   6957  C  CB  . THR B  1 447 ? 62.514  6.888   -8.197  1.00   26.14 ? 554  THR B CB  1 
ATOM   6958  O  OG1 . THR B  1 447 ? 61.479  6.134   -8.834  1.00   23.59 ? 554  THR B OG1 1 
ATOM   6959  C  CG2 . THR B  1 447 ? 61.945  7.567   -6.951  1.00   27.28 ? 554  THR B CG2 1 
ATOM   6960  N  N   . SER B  1 448 ? 63.154  7.553   -11.561 1.00   31.60 ? 555  SER B N   1 
ATOM   6961  C  CA  . SER B  1 448 ? 63.675  6.952   -12.782 1.00   35.58 ? 555  SER B CA  1 
ATOM   6962  C  C   . SER B  1 448 ? 64.565  7.940   -13.526 1.00   37.28 ? 555  SER B C   1 
ATOM   6963  O  O   . SER B  1 448 ? 64.589  9.129   -13.206 1.00   38.38 ? 555  SER B O   1 
ATOM   6964  C  CB  . SER B  1 448 ? 62.520  6.521   -13.692 1.00   35.60 ? 555  SER B CB  1 
ATOM   6965  O  OG  . SER B  1 448 ? 62.974  6.175   -14.994 1.00   41.20 ? 555  SER B OG  1 
ATOM   6966  N  N   . GLU B  1 449 ? 65.301  7.442   -14.514 1.00   37.83 ? 556  GLU B N   1 
ATOM   6967  C  CA  . GLU B  1 449 ? 66.162  8.298   -15.316 1.00   41.22 ? 556  GLU B CA  1 
ATOM   6968  C  C   . GLU B  1 449 ? 65.349  8.882   -16.463 1.00   40.83 ? 556  GLU B C   1 
ATOM   6969  O  O   . GLU B  1 449 ? 65.786  9.813   -17.132 1.00   42.56 ? 556  GLU B O   1 
ATOM   6970  C  CB  . GLU B  1 449 ? 67.336  7.504   -15.889 1.00   44.05 ? 556  GLU B CB  1 
ATOM   6971  C  CG  . GLU B  1 449 ? 68.421  7.177   -14.897 1.00   52.23 ? 556  GLU B CG  1 
ATOM   6972  C  CD  . GLU B  1 449 ? 68.975  8.421   -14.233 1.00   57.16 ? 556  GLU B CD  1 
ATOM   6973  O  OE1 . GLU B  1 449 ? 68.810  9.524   -14.807 1.00   59.42 ? 556  GLU B OE1 1 
ATOM   6974  O  OE2 . GLU B  1 449 ? 69.586  8.296   -13.145 1.00   59.46 ? 556  GLU B OE2 1 
ATOM   6975  N  N   . ALA B  1 450 ? 64.167  8.322   -16.690 1.00   40.79 ? 557  ALA B N   1 
ATOM   6976  C  CA  . ALA B  1 450 ? 63.292  8.782   -17.763 1.00   39.97 ? 557  ALA B CA  1 
ATOM   6977  C  C   . ALA B  1 450 ? 62.891  10.240  -17.571 1.00   41.55 ? 557  ALA B C   1 
ATOM   6978  O  O   . ALA B  1 450 ? 62.795  10.731  -16.443 1.00   41.93 ? 557  ALA B O   1 
ATOM   6979  C  CB  . ALA B  1 450 ? 62.053  7.909   -17.829 1.00   38.51 ? 557  ALA B CB  1 
ATOM   6980  N  N   . ASN B  1 451 ? 62.661  10.935  -18.677 1.00   40.99 ? 558  ASN B N   1 
ATOM   6981  C  CA  . ASN B  1 451 ? 62.265  12.335  -18.610 1.00   43.01 ? 558  ASN B CA  1 
ATOM   6982  C  C   . ASN B  1 451 ? 60.757  12.378  -18.402 1.00   43.43 ? 558  ASN B C   1 
ATOM   6983  O  O   . ASN B  1 451 ? 59.997  12.524  -19.357 1.00   44.65 ? 558  ASN B O   1 
ATOM   6984  C  CB  . ASN B  1 451 ? 62.639  13.064  -19.910 1.00   43.32 ? 558  ASN B CB  1 
ATOM   6985  C  CG  . ASN B  1 451 ? 64.137  13.039  -20.187 1.00   44.26 ? 558  ASN B CG  1 
ATOM   6986  O  OD1 . ASN B  1 451 ? 64.930  13.606  -19.435 0.0000 43.89 ? 558  ASN B OD1 1 
ATOM   6987  N  ND2 . ASN B  1 451 ? 64.527  12.375  -21.269 0.0000 43.89 ? 558  ASN B ND2 1 
ATOM   6988  N  N   . ASN B  1 452 ? 60.324  12.238  -17.153 1.00   40.99 ? 559  ASN B N   1 
ATOM   6989  C  CA  . ASN B  1 452 ? 58.902  12.252  -16.846 1.00   37.39 ? 559  ASN B CA  1 
ATOM   6990  C  C   . ASN B  1 452 ? 58.411  13.672  -16.598 1.00   36.41 ? 559  ASN B C   1 
ATOM   6991  O  O   . ASN B  1 452 ? 59.202  14.580  -16.358 1.00   37.62 ? 559  ASN B O   1 
ATOM   6992  C  CB  . ASN B  1 452 ? 58.617  11.385  -15.620 1.00   37.09 ? 559  ASN B CB  1 
ATOM   6993  C  CG  . ASN B  1 452 ? 58.920  9.913   -15.852 1.00   36.10 ? 559  ASN B CG  1 
ATOM   6994  O  OD1 . ASN B  1 452 ? 58.755  9.396   -16.962 1.00   34.47 ? 559  ASN B OD1 1 
ATOM   6995  N  ND2 . ASN B  1 452 ? 59.339  9.222   -14.795 1.00   32.86 ? 559  ASN B ND2 1 
ATOM   6996  N  N   . TYR B  1 453 ? 57.098  13.863  -16.646 1.00   35.49 ? 560  TYR B N   1 
ATOM   6997  C  CA  . TYR B  1 453 ? 56.529  15.190  -16.436 1.00   33.66 ? 560  TYR B CA  1 
ATOM   6998  C  C   . TYR B  1 453 ? 55.144  15.135  -15.805 1.00   31.17 ? 560  TYR B C   1 
ATOM   6999  O  O   . TYR B  1 453 ? 54.397  14.176  -15.990 1.00   30.41 ? 560  TYR B O   1 
ATOM   7000  C  CB  . TYR B  1 453 ? 56.430  15.931  -17.772 1.00   32.91 ? 560  TYR B CB  1 
ATOM   7001  C  CG  . TYR B  1 453 ? 55.652  15.161  -18.806 1.00   33.16 ? 560  TYR B CG  1 
ATOM   7002  C  CD1 . TYR B  1 453 ? 56.272  14.182  -19.582 1.00   35.46 ? 560  TYR B CD1 1 
ATOM   7003  C  CD2 . TYR B  1 453 ? 54.279  15.346  -18.952 1.00   32.58 ? 560  TYR B CD2 1 
ATOM   7004  C  CE1 . TYR B  1 453 ? 55.540  13.403  -20.474 1.00   36.06 ? 560  TYR B CE1 1 
ATOM   7005  C  CE2 . TYR B  1 453 ? 53.538  14.572  -19.838 1.00   34.48 ? 560  TYR B CE2 1 
ATOM   7006  C  CZ  . TYR B  1 453 ? 54.175  13.601  -20.596 1.00   36.22 ? 560  TYR B CZ  1 
ATOM   7007  O  OH  . TYR B  1 453 ? 53.453  12.818  -21.472 1.00   39.44 ? 560  TYR B OH  1 
ATOM   7008  N  N   . GLY B  1 454 ? 54.799  16.191  -15.083 1.00   29.30 ? 561  GLY B N   1 
ATOM   7009  C  CA  . GLY B  1 454 ? 53.508  16.248  -14.438 1.00   29.18 ? 561  GLY B CA  1 
ATOM   7010  C  C   . GLY B  1 454 ? 53.362  17.501  -13.598 1.00   29.27 ? 561  GLY B C   1 
ATOM   7011  O  O   . GLY B  1 454 ? 54.303  18.291  -13.468 1.00   25.89 ? 561  GLY B O   1 
ATOM   7012  N  N   . THR B  1 455 ? 52.182  17.672  -13.009 1.00   27.73 ? 562  THR B N   1 
ATOM   7013  C  CA  . THR B  1 455 ? 51.900  18.843  -12.192 1.00   26.80 ? 562  THR B CA  1 
ATOM   7014  C  C   . THR B  1 455 ? 51.144  18.517  -10.905 1.00   25.92 ? 562  THR B C   1 
ATOM   7015  O  O   . THR B  1 455 ? 50.185  17.740  -10.910 1.00   25.40 ? 562  THR B O   1 
ATOM   7016  C  CB  . THR B  1 455 ? 51.028  19.849  -12.965 1.00   28.57 ? 562  THR B CB  1 
ATOM   7017  O  OG1 . THR B  1 455 ? 51.686  20.256  -14.174 1.00   31.63 ? 562  THR B OG1 1 
ATOM   7018  C  CG2 . THR B  1 455 ? 50.732  21.067  -12.098 1.00   26.18 ? 562  THR B CG2 1 
ATOM   7019  N  N   . LEU B  1 456 ? 51.582  19.113  -9.804  1.00   24.13 ? 563  LEU B N   1 
ATOM   7020  C  CA  . LEU B  1 456 ? 50.913  18.934  -8.526  1.00   25.67 ? 563  LEU B CA  1 
ATOM   7021  C  C   . LEU B  1 456 ? 49.953  20.118  -8.439  1.00   27.24 ? 563  LEU B C   1 
ATOM   7022  O  O   . LEU B  1 456 ? 50.393  21.273  -8.370  1.00   29.85 ? 563  LEU B O   1 
ATOM   7023  C  CB  . LEU B  1 456 ? 51.908  19.003  -7.358  1.00   24.37 ? 563  LEU B CB  1 
ATOM   7024  C  CG  . LEU B  1 456 ? 51.219  18.943  -5.986  1.00   24.24 ? 563  LEU B CG  1 
ATOM   7025  C  CD1 . LEU B  1 456 ? 50.631  17.542  -5.782  1.00   21.55 ? 563  LEU B CD1 1 
ATOM   7026  C  CD2 . LEU B  1 456 ? 52.213  19.277  -4.881  1.00   21.92 ? 563  LEU B CD2 1 
ATOM   7027  N  N   . THR B  1 457 ? 48.653  19.841  -8.451  1.00   26.60 ? 564  THR B N   1 
ATOM   7028  C  CA  . THR B  1 457 ? 47.661  20.908  -8.401  1.00   26.29 ? 564  THR B CA  1 
ATOM   7029  C  C   . THR B  1 457 ? 47.028  21.102  -7.042  1.00   26.85 ? 564  THR B C   1 
ATOM   7030  O  O   . THR B  1 457 ? 46.427  22.139  -6.794  1.00   27.54 ? 564  THR B O   1 
ATOM   7031  C  CB  . THR B  1 457 ? 46.515  20.688  -9.415  1.00   26.68 ? 564  THR B CB  1 
ATOM   7032  O  OG1 . THR B  1 457 ? 45.842  19.454  -9.120  1.00   29.70 ? 564  THR B OG1 1 
ATOM   7033  C  CG2 . THR B  1 457 ? 47.052  20.676  -10.850 1.00   27.11 ? 564  THR B CG2 1 
ATOM   7034  N  N   . LYS B  1 458 ? 47.129  20.111  -6.164  1.00   24.20 ? 565  LYS B N   1 
ATOM   7035  C  CA  . LYS B  1 458 ? 46.546  20.275  -4.841  1.00   23.64 ? 565  LYS B CA  1 
ATOM   7036  C  C   . LYS B  1 458 ? 47.295  19.495  -3.789  1.00   19.81 ? 565  LYS B C   1 
ATOM   7037  O  O   . LYS B  1 458 ? 47.685  18.358  -4.014  1.00   19.62 ? 565  LYS B O   1 
ATOM   7038  C  CB  . LYS B  1 458 ? 45.081  19.835  -4.824  1.00   25.96 ? 565  LYS B CB  1 
ATOM   7039  C  CG  . LYS B  1 458 ? 44.344  20.258  -3.553  1.00   29.11 ? 565  LYS B CG  1 
ATOM   7040  C  CD  . LYS B  1 458 ? 42.955  19.621  -3.445  1.00   34.36 ? 565  LYS B CD  1 
ATOM   7041  C  CE  . LYS B  1 458 ? 42.996  18.276  -2.692  1.00   39.66 ? 565  LYS B CE  1 
ATOM   7042  N  NZ  . LYS B  1 458 ? 43.883  17.205  -3.298  1.00   37.29 ? 565  LYS B NZ  1 
ATOM   7043  N  N   . PHE B  1 459 ? 47.492  20.131  -2.642  1.00   19.23 ? 566  PHE B N   1 
ATOM   7044  C  CA  . PHE B  1 459 ? 48.164  19.522  -1.502  1.00   16.64 ? 566  PHE B CA  1 
ATOM   7045  C  C   . PHE B  1 459 ? 47.467  20.059  -0.261  1.00   18.66 ? 566  PHE B C   1 
ATOM   7046  O  O   . PHE B  1 459 ? 47.669  21.200  0.143   1.00   21.08 ? 566  PHE B O   1 
ATOM   7047  C  CB  . PHE B  1 459 ? 49.649  19.887  -1.498  1.00   14.78 ? 566  PHE B CB  1 
ATOM   7048  C  CG  . PHE B  1 459 ? 50.380  19.539  -0.216  1.00   18.06 ? 566  PHE B CG  1 
ATOM   7049  C  CD1 . PHE B  1 459 ? 49.870  18.594  0.685   1.00   16.80 ? 566  PHE B CD1 1 
ATOM   7050  C  CD2 . PHE B  1 459 ? 51.608  20.137  0.068   1.00   17.70 ? 566  PHE B CD2 1 
ATOM   7051  C  CE1 . PHE B  1 459 ? 50.579  18.251  1.847   1.00   18.02 ? 566  PHE B CE1 1 
ATOM   7052  C  CE2 . PHE B  1 459 ? 52.326  19.803  1.222   1.00   18.23 ? 566  PHE B CE2 1 
ATOM   7053  C  CZ  . PHE B  1 459 ? 51.814  18.859  2.113   1.00   16.57 ? 566  PHE B CZ  1 
ATOM   7054  N  N   . THR B  1 460 ? 46.610  19.236  0.321   1.00   19.14 ? 567  THR B N   1 
ATOM   7055  C  CA  . THR B  1 460 ? 45.899  19.634  1.518   1.00   19.59 ? 567  THR B CA  1 
ATOM   7056  C  C   . THR B  1 460 ? 46.404  18.777  2.663   1.00   19.71 ? 567  THR B C   1 
ATOM   7057  O  O   . THR B  1 460 ? 46.397  17.548  2.589   1.00   19.54 ? 567  THR B O   1 
ATOM   7058  C  CB  . THR B  1 460 ? 44.380  19.444  1.359   1.00   18.06 ? 567  THR B CB  1 
ATOM   7059  O  OG1 . THR B  1 460 ? 43.948  20.071  0.146   1.00   21.39 ? 567  THR B OG1 1 
ATOM   7060  C  CG2 . THR B  1 460 ? 43.646  20.092  2.508   1.00   17.53 ? 567  THR B CG2 1 
ATOM   7061  N  N   . LEU B  1 461 ? 46.870  19.434  3.711   1.00   19.22 ? 568  LEU B N   1 
ATOM   7062  C  CA  . LEU B  1 461 ? 47.375  18.738  4.877   1.00   18.67 ? 568  LEU B CA  1 
ATOM   7063  C  C   . LEU B  1 461 ? 46.239  18.650  5.898   1.00   17.31 ? 568  LEU B C   1 
ATOM   7064  O  O   . LEU B  1 461 ? 45.670  19.671  6.299   1.00   15.97 ? 568  LEU B O   1 
ATOM   7065  C  CB  . LEU B  1 461 ? 48.563  19.509  5.462   1.00   17.20 ? 568  LEU B CB  1 
ATOM   7066  C  CG  . LEU B  1 461 ? 49.323  18.843  6.620   1.00   15.22 ? 568  LEU B CG  1 
ATOM   7067  C  CD1 . LEU B  1 461 ? 49.915  17.499  6.203   1.00   17.03 ? 568  LEU B CD1 1 
ATOM   7068  C  CD2 . LEU B  1 461 ? 50.432  19.784  7.057   1.00   18.28 ? 568  LEU B CD2 1 
ATOM   7069  N  N   . VAL B  1 462 ? 45.900  17.435  6.311   1.00   15.92 ? 569  VAL B N   1 
ATOM   7070  C  CA  . VAL B  1 462 ? 44.820  17.254  7.273   1.00   16.09 ? 569  VAL B CA  1 
ATOM   7071  C  C   . VAL B  1 462 ? 45.379  16.646  8.548   1.00   16.96 ? 569  VAL B C   1 
ATOM   7072  O  O   . VAL B  1 462 ? 45.945  15.551  8.534   1.00   17.40 ? 569  VAL B O   1 
ATOM   7073  C  CB  . VAL B  1 462 ? 43.731  16.339  6.694   1.00   17.83 ? 569  VAL B CB  1 
ATOM   7074  C  CG1 . VAL B  1 462 ? 42.606  16.137  7.708   1.00   16.94 ? 569  VAL B CG1 1 
ATOM   7075  C  CG2 . VAL B  1 462 ? 43.217  16.941  5.394   1.00   17.99 ? 569  VAL B CG2 1 
ATOM   7076  N  N   . LEU B  1 463 ? 45.212  17.359  9.652   1.00   17.06 ? 570  LEU B N   1 
ATOM   7077  C  CA  . LEU B  1 463 ? 45.714  16.907  10.940  1.00   18.29 ? 570  LEU B CA  1 
ATOM   7078  C  C   . LEU B  1 463 ? 44.575  16.517  11.875  1.00   19.14 ? 570  LEU B C   1 
ATOM   7079  O  O   . LEU B  1 463 ? 43.593  17.247  12.001  1.00   21.97 ? 570  LEU B O   1 
ATOM   7080  C  CB  . LEU B  1 463 ? 46.535  18.027  11.598  1.00   16.89 ? 570  LEU B CB  1 
ATOM   7081  C  CG  . LEU B  1 463 ? 47.614  18.671  10.723  1.00   21.82 ? 570  LEU B CG  1 
ATOM   7082  C  CD1 . LEU B  1 463 ? 48.161  19.944  11.379  1.00   17.66 ? 570  LEU B CD1 1 
ATOM   7083  C  CD2 . LEU B  1 463 ? 48.726  17.658  10.477  1.00   19.48 ? 570  LEU B CD2 1 
ATOM   7084  N  N   . TYR B  1 464 ? 44.712  15.365  12.524  1.00   15.88 ? 571  TYR B N   1 
ATOM   7085  C  CA  . TYR B  1 464 ? 43.723  14.889  13.485  1.00   15.76 ? 571  TYR B CA  1 
ATOM   7086  C  C   . TYR B  1 464 ? 44.449  14.843  14.830  1.00   18.24 ? 571  TYR B C   1 
ATOM   7087  O  O   . TYR B  1 464 ? 45.650  14.563  14.885  1.00   20.95 ? 571  TYR B O   1 
ATOM   7088  C  CB  . TYR B  1 464 ? 43.238  13.491  13.119  1.00   15.95 ? 571  TYR B CB  1 
ATOM   7089  C  CG  . TYR B  1 464 ? 42.430  13.396  11.839  1.00   16.18 ? 571  TYR B CG  1 
ATOM   7090  C  CD1 . TYR B  1 464 ? 41.046  13.587  11.842  1.00   17.51 ? 571  TYR B CD1 1 
ATOM   7091  C  CD2 . TYR B  1 464 ? 43.040  13.060  10.635  1.00   19.21 ? 571  TYR B CD2 1 
ATOM   7092  C  CE1 . TYR B  1 464 ? 40.290  13.435  10.663  1.00   18.77 ? 571  TYR B CE1 1 
ATOM   7093  C  CE2 . TYR B  1 464 ? 42.300  12.905  9.457   1.00   18.74 ? 571  TYR B CE2 1 
ATOM   7094  C  CZ  . TYR B  1 464 ? 40.934  13.094  9.479   1.00   20.10 ? 571  TYR B CZ  1 
ATOM   7095  O  OH  . TYR B  1 464 ? 40.229  12.951  8.312   1.00   24.48 ? 571  TYR B OH  1 
ATOM   7096  N  N   . GLY B  1 465 ? 43.747  15.122  15.918  1.00   18.25 ? 572  GLY B N   1 
ATOM   7097  C  CA  . GLY B  1 465 ? 44.426  15.095  17.196  1.00   19.19 ? 572  GLY B CA  1 
ATOM   7098  C  C   . GLY B  1 465 ? 43.734  15.852  18.311  1.00   21.05 ? 572  GLY B C   1 
ATOM   7099  O  O   . GLY B  1 465 ? 42.550  16.157  18.226  1.00   22.03 ? 572  GLY B O   1 
ATOM   7100  N  N   . THR B  1 466 ? 44.497  16.159  19.355  1.00   20.75 ? 573  THR B N   1 
ATOM   7101  C  CA  . THR B  1 466 ? 43.981  16.839  20.536  1.00   23.17 ? 573  THR B CA  1 
ATOM   7102  C  C   . THR B  1 466 ? 44.929  17.961  20.960  1.00   25.72 ? 573  THR B C   1 
ATOM   7103  O  O   . THR B  1 466 ? 45.987  18.158  20.359  1.00   25.11 ? 573  THR B O   1 
ATOM   7104  C  CB  . THR B  1 466 ? 43.868  15.850  21.725  1.00   21.37 ? 573  THR B CB  1 
ATOM   7105  O  OG1 . THR B  1 466 ? 45.177  15.375  22.060  1.00   24.71 ? 573  THR B OG1 1 
ATOM   7106  C  CG2 . THR B  1 466 ? 43.001  14.643  21.361  1.00   17.94 ? 573  THR B CG2 1 
ATOM   7107  N  N   . ALA B  1 467 ? 44.545  18.688  22.004  1.00   26.09 ? 574  ALA B N   1 
ATOM   7108  C  CA  . ALA B  1 467 ? 45.372  19.769  22.529  1.00   31.84 ? 574  ALA B CA  1 
ATOM   7109  C  C   . ALA B  1 467 ? 45.709  19.518  24.004  1.00   33.70 ? 574  ALA B C   1 
ATOM   7110  O  O   . ALA B  1 467 ? 45.461  18.394  24.489  1.00   37.96 ? 574  ALA B O   1 
ATOM   7111  C  CB  . ALA B  1 467 ? 44.659  21.108  22.365  1.00   29.20 ? 574  ALA B CB  1 
ATOM   7112  N  N   . VAL C  1 2   ? -14.219 72.104  25.425  1.00   37.15 ? 109  VAL C N   1 
ATOM   7113  C  CA  . VAL C  1 2   ? -12.745 71.922  25.226  1.00   35.73 ? 109  VAL C CA  1 
ATOM   7114  C  C   . VAL C  1 2   ? -12.001 72.221  26.526  1.00   34.88 ? 109  VAL C C   1 
ATOM   7115  O  O   . VAL C  1 2   ? -12.216 73.259  27.158  1.00   35.47 ? 109  VAL C O   1 
ATOM   7116  C  CB  . VAL C  1 2   ? -12.212 72.843  24.093  1.00   38.17 ? 109  VAL C CB  1 
ATOM   7117  C  CG1 . VAL C  1 2   ? -10.685 72.848  24.067  1.00   36.77 ? 109  VAL C CG1 1 
ATOM   7118  C  CG2 . VAL C  1 2   ? -12.737 72.355  22.765  1.00   37.21 ? 109  VAL C CG2 1 
ATOM   7119  N  N   . TYR C  1 3   ? -11.139 71.293  26.927  1.00   30.75 ? 110  TYR C N   1 
ATOM   7120  C  CA  . TYR C  1 3   ? -10.372 71.438  28.153  1.00   28.76 ? 110  TYR C CA  1 
ATOM   7121  C  C   . TYR C  1 3   ? -9.399  72.611  28.062  1.00   27.42 ? 110  TYR C C   1 
ATOM   7122  O  O   . TYR C  1 3   ? -8.534  72.643  27.179  1.00   29.24 ? 110  TYR C O   1 
ATOM   7123  C  CB  . TYR C  1 3   ? -9.578  70.154  28.458  1.00   25.44 ? 110  TYR C CB  1 
ATOM   7124  C  CG  . TYR C  1 3   ? -8.670  70.325  29.653  1.00   24.52 ? 110  TYR C CG  1 
ATOM   7125  C  CD1 . TYR C  1 3   ? -9.198  70.376  30.950  1.00   21.43 ? 110  TYR C CD1 1 
ATOM   7126  C  CD2 . TYR C  1 3   ? -7.305  70.568  29.485  1.00   21.93 ? 110  TYR C CD2 1 
ATOM   7127  C  CE1 . TYR C  1 3   ? -8.400  70.675  32.042  1.00   22.96 ? 110  TYR C CE1 1 
ATOM   7128  C  CE2 . TYR C  1 3   ? -6.493  70.874  30.573  1.00   22.93 ? 110  TYR C CE2 1 
ATOM   7129  C  CZ  . TYR C  1 3   ? -7.051  70.930  31.847  1.00   22.99 ? 110  TYR C CZ  1 
ATOM   7130  O  OH  . TYR C  1 3   ? -6.276  71.285  32.912  1.00   19.81 ? 110  TYR C OH  1 
ATOM   7131  N  N   . GLN C  1 4   ? -9.536  73.566  28.977  1.00   24.65 ? 111  GLN C N   1 
ATOM   7132  C  CA  . GLN C  1 4   ? -8.643  74.722  28.999  1.00   24.33 ? 111  GLN C CA  1 
ATOM   7133  C  C   . GLN C  1 4   ? -7.565  74.463  30.038  1.00   22.63 ? 111  GLN C C   1 
ATOM   7134  O  O   . GLN C  1 4   ? -7.859  74.246  31.219  1.00   18.89 ? 111  GLN C O   1 
ATOM   7135  C  CB  . GLN C  1 4   ? -9.390  76.008  29.364  1.00   25.16 ? 111  GLN C CB  1 
ATOM   7136  C  CG  . GLN C  1 4   ? -8.454  77.214  29.464  1.00   27.37 ? 111  GLN C CG  1 
ATOM   7137  C  CD  . GLN C  1 4   ? -9.143  78.480  29.934  1.00   29.24 ? 111  GLN C CD  1 
ATOM   7138  O  OE1 . GLN C  1 4   ? -8.491  79.498  30.176  1.00   30.52 ? 111  GLN C OE1 1 
ATOM   7139  N  NE2 . GLN C  1 4   ? -10.460 78.428  30.062  1.00   23.16 ? 111  GLN C NE2 1 
ATOM   7140  N  N   . GLU C  1 5   ? -6.317  74.483  29.593  1.00   23.17 ? 112  GLU C N   1 
ATOM   7141  C  CA  . GLU C  1 5   ? -5.200  74.240  30.490  1.00   24.50 ? 112  GLU C CA  1 
ATOM   7142  C  C   . GLU C  1 5   ? -5.033  75.356  31.526  1.00   22.66 ? 112  GLU C C   1 
ATOM   7143  O  O   . GLU C  1 5   ? -5.513  76.471  31.344  1.00   23.31 ? 112  GLU C O   1 
ATOM   7144  C  CB  . GLU C  1 5   ? -3.911  74.058  29.681  1.00   26.27 ? 112  GLU C CB  1 
ATOM   7145  C  CG  . GLU C  1 5   ? -3.390  75.299  28.989  1.00   23.74 ? 112  GLU C CG  1 
ATOM   7146  C  CD  . GLU C  1 5   ? -2.218  74.980  28.072  1.00   26.32 ? 112  GLU C CD  1 
ATOM   7147  O  OE1 . GLU C  1 5   ? -1.364  75.856  27.861  1.00   24.16 ? 112  GLU C OE1 1 
ATOM   7148  O  OE2 . GLU C  1 5   ? -2.153  73.851  27.545  1.00   27.28 ? 112  GLU C OE2 1 
ATOM   7149  N  N   . PRO C  1 6   ? -4.361  75.054  32.638  1.00   21.02 ? 113  PRO C N   1 
ATOM   7150  C  CA  . PRO C  1 6   ? -4.128  76.022  33.709  1.00   19.44 ? 113  PRO C CA  1 
ATOM   7151  C  C   . PRO C  1 6   ? -3.687  77.407  33.224  1.00   21.72 ? 113  PRO C C   1 
ATOM   7152  O  O   . PRO C  1 6   ? -2.979  77.552  32.225  1.00   20.06 ? 113  PRO C O   1 
ATOM   7153  C  CB  . PRO C  1 6   ? -3.047  75.353  34.542  1.00   18.87 ? 113  PRO C CB  1 
ATOM   7154  C  CG  . PRO C  1 6   ? -3.347  73.890  34.379  1.00   22.78 ? 113  PRO C CG  1 
ATOM   7155  C  CD  . PRO C  1 6   ? -3.631  73.800  32.901  1.00   22.53 ? 113  PRO C CD  1 
ATOM   7156  N  N   . THR C  1 7   ? -4.099  78.431  33.955  1.00   20.67 ? 114  THR C N   1 
ATOM   7157  C  CA  . THR C  1 7   ? -3.739  79.802  33.611  1.00   22.86 ? 114  THR C CA  1 
ATOM   7158  C  C   . THR C  1 7   ? -2.604  80.316  34.505  1.00   23.14 ? 114  THR C C   1 
ATOM   7159  O  O   . THR C  1 7   ? -2.170  81.462  34.367  1.00   23.62 ? 114  THR C O   1 
ATOM   7160  C  CB  . THR C  1 7   ? -4.936  80.746  33.803  1.00   21.66 ? 114  THR C CB  1 
ATOM   7161  O  OG1 . THR C  1 7   ? -5.367  80.683  35.171  1.00   21.18 ? 114  THR C OG1 1 
ATOM   7162  C  CG2 . THR C  1 7   ? -6.095  80.353  32.904  1.00   18.54 ? 114  THR C CG2 1 
ATOM   7163  N  N   . ASP C  1 8   ? -2.131  79.471  35.420  1.00   22.77 ? 115  ASP C N   1 
ATOM   7164  C  CA  . ASP C  1 8   ? -1.067  79.849  36.344  1.00   20.83 ? 115  ASP C CA  1 
ATOM   7165  C  C   . ASP C  1 8   ? 0.128   80.442  35.618  1.00   21.09 ? 115  ASP C C   1 
ATOM   7166  O  O   . ASP C  1 8   ? 0.539   79.971  34.562  1.00   21.82 ? 115  ASP C O   1 
ATOM   7167  C  CB  . ASP C  1 8   ? -0.688  78.643  37.191  1.00   21.67 ? 115  ASP C CB  1 
ATOM   7168  C  CG  . ASP C  1 8   ? -1.898  78.042  37.860  1.00   23.66 ? 115  ASP C CG  1 
ATOM   7169  O  OD1 . ASP C  1 8   ? -2.774  77.526  37.129  1.00   21.31 ? 115  ASP C OD1 1 
ATOM   7170  O  OD2 . ASP C  1 8   ? -1.995  78.106  39.101  1.00   22.89 ? 115  ASP C OD2 1 
ATOM   7171  N  N   . PRO C  1 9   ? 0.719   81.493  36.195  1.00   21.78 ? 116  PRO C N   1 
ATOM   7172  C  CA  . PRO C  1 9   ? 1.864   82.149  35.562  1.00   20.40 ? 116  PRO C CA  1 
ATOM   7173  C  C   . PRO C  1 9   ? 3.039   81.265  35.162  1.00   23.98 ? 116  PRO C C   1 
ATOM   7174  O  O   . PRO C  1 9   ? 3.664   81.507  34.130  1.00   21.20 ? 116  PRO C O   1 
ATOM   7175  C  CB  . PRO C  1 9   ? 2.240   83.229  36.574  1.00   18.70 ? 116  PRO C CB  1 
ATOM   7176  C  CG  . PRO C  1 9   ? 1.858   82.600  37.900  1.00   19.87 ? 116  PRO C CG  1 
ATOM   7177  C  CD  . PRO C  1 9   ? 0.535   81.951  37.589  1.00   19.42 ? 116  PRO C CD  1 
ATOM   7178  N  N   . LYS C  1 10  ? 3.329   80.237  35.955  1.00   26.09 ? 117  LYS C N   1 
ATOM   7179  C  CA  . LYS C  1 10  ? 4.455   79.356  35.657  1.00   27.63 ? 117  LYS C CA  1 
ATOM   7180  C  C   . LYS C  1 10  ? 4.101   78.093  34.903  1.00   26.61 ? 117  LYS C C   1 
ATOM   7181  O  O   . LYS C  1 10  ? 4.997   77.330  34.550  1.00   27.42 ? 117  LYS C O   1 
ATOM   7182  C  CB  . LYS C  1 10  ? 5.177   78.958  36.947  1.00   31.24 ? 117  LYS C CB  1 
ATOM   7183  C  CG  . LYS C  1 10  ? 5.793   80.113  37.719  1.00   35.49 ? 117  LYS C CG  1 
ATOM   7184  C  CD  . LYS C  1 10  ? 6.810   80.833  36.872  1.00   41.16 ? 117  LYS C CD  1 
ATOM   7185  C  CE  . LYS C  1 10  ? 7.666   81.768  37.701  1.00   47.91 ? 117  LYS C CE  1 
ATOM   7186  N  NZ  . LYS C  1 10  ? 8.597   82.536  36.829  1.00   51.78 ? 117  LYS C NZ  1 
ATOM   7187  N  N   . PHE C  1 11  ? 2.815   77.862  34.645  1.00   25.03 ? 118  PHE C N   1 
ATOM   7188  C  CA  . PHE C  1 11  ? 2.446   76.651  33.930  1.00   21.73 ? 118  PHE C CA  1 
ATOM   7189  C  C   . PHE C  1 11  ? 3.197   76.475  32.609  1.00   21.98 ? 118  PHE C C   1 
ATOM   7190  O  O   . PHE C  1 11  ? 3.607   75.369  32.267  1.00   21.27 ? 118  PHE C O   1 
ATOM   7191  C  CB  . PHE C  1 11  ? 0.952   76.594  33.647  1.00   21.55 ? 118  PHE C CB  1 
ATOM   7192  C  CG  . PHE C  1 11  ? 0.563   75.388  32.840  1.00   22.32 ? 118  PHE C CG  1 
ATOM   7193  C  CD1 . PHE C  1 11  ? 0.705   74.108  33.374  1.00   19.00 ? 118  PHE C CD1 1 
ATOM   7194  C  CD2 . PHE C  1 11  ? 0.132   75.522  31.529  1.00   19.34 ? 118  PHE C CD2 1 
ATOM   7195  C  CE1 . PHE C  1 11  ? 0.425   72.978  32.609  1.00   18.89 ? 118  PHE C CE1 1 
ATOM   7196  C  CE2 . PHE C  1 11  ? -0.149  74.396  30.754  1.00   18.94 ? 118  PHE C CE2 1 
ATOM   7197  C  CZ  . PHE C  1 11  ? -0.002  73.125  31.295  1.00   16.89 ? 118  PHE C CZ  1 
ATOM   7198  N  N   . PRO C  1 12  ? 3.397   77.566  31.850  1.00   22.37 ? 119  PRO C N   1 
ATOM   7199  C  CA  . PRO C  1 12  ? 4.110   77.408  30.578  1.00   23.32 ? 119  PRO C CA  1 
ATOM   7200  C  C   . PRO C  1 12  ? 5.527   76.864  30.756  1.00   23.56 ? 119  PRO C C   1 
ATOM   7201  O  O   . PRO C  1 12  ? 6.074   76.262  29.839  1.00   25.95 ? 119  PRO C O   1 
ATOM   7202  C  CB  . PRO C  1 12  ? 4.108   78.825  29.991  1.00   20.90 ? 119  PRO C CB  1 
ATOM   7203  C  CG  . PRO C  1 12  ? 2.989   79.511  30.699  1.00   23.15 ? 119  PRO C CG  1 
ATOM   7204  C  CD  . PRO C  1 12  ? 3.101   78.988  32.096  1.00   21.48 ? 119  PRO C CD  1 
ATOM   7205  N  N   . GLN C  1 13  ? 6.123   77.084  31.928  1.00   22.51 ? 120  GLN C N   1 
ATOM   7206  C  CA  . GLN C  1 13  ? 7.467   76.580  32.191  1.00   23.60 ? 120  GLN C CA  1 
ATOM   7207  C  C   . GLN C  1 13  ? 7.463   75.124  32.673  1.00   23.87 ? 120  GLN C C   1 
ATOM   7208  O  O   . GLN C  1 13  ? 8.513   74.509  32.818  1.00   21.57 ? 120  GLN C O   1 
ATOM   7209  C  CB  . GLN C  1 13  ? 8.194   77.446  33.222  1.00   26.46 ? 120  GLN C CB  1 
ATOM   7210  C  CG  . GLN C  1 13  ? 8.639   78.786  32.672  1.00   35.07 ? 120  GLN C CG  1 
ATOM   7211  C  CD  . GLN C  1 13  ? 7.676   79.877  33.043  1.00   41.63 ? 120  GLN C CD  1 
ATOM   7212  O  OE1 . GLN C  1 13  ? 7.651   80.321  34.193  1.00   52.00 ? 120  GLN C OE1 1 
ATOM   7213  N  NE2 . GLN C  1 13  ? 6.858   80.308  32.086  1.00   40.96 ? 120  GLN C NE2 1 
ATOM   7214  N  N   . GLN C  1 14  ? 6.286   74.564  32.923  1.00   20.86 ? 121  GLN C N   1 
ATOM   7215  C  CA  . GLN C  1 14  ? 6.241   73.181  33.371  1.00   20.90 ? 121  GLN C CA  1 
ATOM   7216  C  C   . GLN C  1 14  ? 6.222   72.279  32.136  1.00   18.65 ? 121  GLN C C   1 
ATOM   7217  O  O   . GLN C  1 14  ? 5.245   71.610  31.844  1.00   19.70 ? 121  GLN C O   1 
ATOM   7218  C  CB  . GLN C  1 14  ? 5.027   72.979  34.272  1.00   17.58 ? 121  GLN C CB  1 
ATOM   7219  C  CG  . GLN C  1 14  ? 5.074   73.925  35.477  1.00   18.71 ? 121  GLN C CG  1 
ATOM   7220  C  CD  . GLN C  1 14  ? 3.965   73.692  36.491  1.00   21.99 ? 121  GLN C CD  1 
ATOM   7221  O  OE1 . GLN C  1 14  ? 2.801   74.068  36.287  1.00   23.76 ? 121  GLN C OE1 1 
ATOM   7222  N  NE2 . GLN C  1 14  ? 4.324   73.065  37.595  1.00   26.37 ? 121  GLN C NE2 1 
ATOM   7223  N  N   . TRP C  1 15  ? 7.346   72.296  31.426  1.00   19.15 ? 122  TRP C N   1 
ATOM   7224  C  CA  . TRP C  1 15  ? 7.557   71.540  30.198  1.00   19.69 ? 122  TRP C CA  1 
ATOM   7225  C  C   . TRP C  1 15  ? 7.268   70.040  30.293  1.00   19.64 ? 122  TRP C C   1 
ATOM   7226  O  O   . TRP C  1 15  ? 6.867   69.421  29.311  1.00   20.84 ? 122  TRP C O   1 
ATOM   7227  C  CB  . TRP C  1 15  ? 8.996   71.725  29.728  1.00   19.18 ? 122  TRP C CB  1 
ATOM   7228  C  CG  . TRP C  1 15  ? 10.024  71.316  30.769  1.00   20.60 ? 122  TRP C CG  1 
ATOM   7229  C  CD1 . TRP C  1 15  ? 10.489  72.073  31.814  1.00   21.86 ? 122  TRP C CD1 1 
ATOM   7230  C  CD2 . TRP C  1 15  ? 10.661  70.038  30.889  1.00   18.70 ? 122  TRP C CD2 1 
ATOM   7231  N  NE1 . TRP C  1 15  ? 11.374  71.339  32.579  1.00   20.56 ? 122  TRP C NE1 1 
ATOM   7232  C  CE2 . TRP C  1 15  ? 11.499  70.089  32.035  1.00   17.68 ? 122  TRP C CE2 1 
ATOM   7233  C  CE3 . TRP C  1 15  ? 10.607  68.850  30.143  1.00   16.87 ? 122  TRP C CE3 1 
ATOM   7234  C  CZ2 . TRP C  1 15  ? 12.276  68.997  32.452  1.00   14.43 ? 122  TRP C CZ2 1 
ATOM   7235  C  CZ3 . TRP C  1 15  ? 11.385  67.758  30.564  1.00   17.38 ? 122  TRP C CZ3 1 
ATOM   7236  C  CH2 . TRP C  1 15  ? 12.205  67.846  31.710  1.00   14.37 ? 122  TRP C CH2 1 
ATOM   7237  N  N   . TYR C  1 16  ? 7.491   69.461  31.467  1.00   18.14 ? 123  TYR C N   1 
ATOM   7238  C  CA  . TYR C  1 16  ? 7.266   68.038  31.680  1.00   16.66 ? 123  TYR C CA  1 
ATOM   7239  C  C   . TYR C  1 16  ? 5.794   67.654  31.802  1.00   17.27 ? 123  TYR C C   1 
ATOM   7240  O  O   . TYR C  1 16  ? 5.443   66.486  31.647  1.00   18.70 ? 123  TYR C O   1 
ATOM   7241  C  CB  . TYR C  1 16  ? 8.023   67.580  32.927  1.00   15.86 ? 123  TYR C CB  1 
ATOM   7242  C  CG  . TYR C  1 16  ? 7.877   68.532  34.088  1.00   15.78 ? 123  TYR C CG  1 
ATOM   7243  C  CD1 . TYR C  1 16  ? 8.631   69.715  34.143  1.00   14.39 ? 123  TYR C CD1 1 
ATOM   7244  C  CD2 . TYR C  1 16  ? 6.934   68.298  35.093  1.00   13.57 ? 123  TYR C CD2 1 
ATOM   7245  C  CE1 . TYR C  1 16  ? 8.439   70.646  35.166  1.00   13.83 ? 123  TYR C CE1 1 
ATOM   7246  C  CE2 . TYR C  1 16  ? 6.736   69.221  36.124  1.00   15.39 ? 123  TYR C CE2 1 
ATOM   7247  C  CZ  . TYR C  1 16  ? 7.486   70.395  36.152  1.00   13.51 ? 123  TYR C CZ  1 
ATOM   7248  O  OH  . TYR C  1 16  ? 7.257   71.329  37.140  1.00   15.37 ? 123  TYR C OH  1 
ATOM   7249  N  N   . LEU C  1 17  ? 4.928   68.621  32.091  1.00   19.41 ? 124  LEU C N   1 
ATOM   7250  C  CA  . LEU C  1 17  ? 3.507   68.318  32.211  1.00   20.79 ? 124  LEU C CA  1 
ATOM   7251  C  C   . LEU C  1 17  ? 2.868   68.316  30.836  1.00   24.40 ? 124  LEU C C   1 
ATOM   7252  O  O   . LEU C  1 17  ? 2.169   67.376  30.455  1.00   25.11 ? 124  LEU C O   1 
ATOM   7253  C  CB  . LEU C  1 17  ? 2.798   69.348  33.088  1.00   17.01 ? 124  LEU C CB  1 
ATOM   7254  C  CG  . LEU C  1 17  ? 3.232   69.424  34.553  1.00   17.34 ? 124  LEU C CG  1 
ATOM   7255  C  CD1 . LEU C  1 17  ? 2.369   70.458  35.266  1.00   15.82 ? 124  LEU C CD1 1 
ATOM   7256  C  CD2 . LEU C  1 17  ? 3.110   68.057  35.214  1.00   14.89 ? 124  LEU C CD2 1 
ATOM   7257  N  N   . SER C  1 18  ? 3.121   69.378  30.090  1.00   28.84 ? 125  SER C N   1 
ATOM   7258  C  CA  . SER C  1 18  ? 2.548   69.515  28.764  1.00   33.02 ? 125  SER C CA  1 
ATOM   7259  C  C   . SER C  1 18  ? 3.503   70.315  27.894  1.00   34.69 ? 125  SER C C   1 
ATOM   7260  O  O   . SER C  1 18  ? 4.088   71.304  28.336  1.00   34.45 ? 125  SER C O   1 
ATOM   7261  C  CB  . SER C  1 18  ? 1.196   70.226  28.860  1.00   32.09 ? 125  SER C CB  1 
ATOM   7262  O  OG  . SER C  1 18  ? 0.473   70.091  27.653  1.00   40.17 ? 125  SER C OG  1 
ATOM   7263  N  N   . GLY C  1 19  ? 3.666   69.874  26.656  1.00   39.38 ? 126  GLY C N   1 
ATOM   7264  C  CA  . GLY C  1 19  ? 4.556   70.559  25.741  1.00   45.14 ? 126  GLY C CA  1 
ATOM   7265  C  C   . GLY C  1 19  ? 4.244   70.204  24.303  1.00   47.76 ? 126  GLY C C   1 
ATOM   7266  O  O   . GLY C  1 19  ? 3.676   69.149  24.018  1.00   48.87 ? 126  GLY C O   1 
ATOM   7267  N  N   . VAL C  1 20  ? 4.602   71.096  23.390  1.00   50.36 ? 127  VAL C N   1 
ATOM   7268  C  CA  . VAL C  1 20  ? 4.371   70.850  21.978  1.00   53.36 ? 127  VAL C CA  1 
ATOM   7269  C  C   . VAL C  1 20  ? 5.398   69.826  21.503  1.00   55.56 ? 127  VAL C C   1 
ATOM   7270  O  O   . VAL C  1 20  ? 5.105   68.990  20.652  1.00   57.40 ? 127  VAL C O   1 
ATOM   7271  C  CB  . VAL C  1 20  ? 4.520   72.145  21.143  1.00   52.92 ? 127  VAL C CB  1 
ATOM   7272  C  CG1 . VAL C  1 20  ? 3.502   73.173  21.597  1.00   53.85 ? 127  VAL C CG1 1 
ATOM   7273  C  CG2 . VAL C  1 20  ? 5.923   72.704  21.278  1.00   53.93 ? 127  VAL C CG2 1 
ATOM   7274  N  N   . THR C  1 21  ? 6.594   69.887  22.086  1.00   57.65 ? 128  THR C N   1 
ATOM   7275  C  CA  . THR C  1 21  ? 7.696   68.989  21.740  1.00   58.54 ? 128  THR C CA  1 
ATOM   7276  C  C   . THR C  1 21  ? 7.400   67.501  21.926  1.00   59.97 ? 128  THR C C   1 
ATOM   7277  O  O   . THR C  1 21  ? 8.277   66.670  21.704  1.00   64.67 ? 128  THR C O   1 
ATOM   7278  C  CB  . THR C  1 21  ? 8.969   69.334  22.548  1.00   56.36 ? 128  THR C CB  1 
ATOM   7279  O  OG1 . THR C  1 21  ? 10.040  68.470  22.151  0.0000 57.30 ? 128  THR C OG1 1 
ATOM   7280  C  CG2 . THR C  1 21  ? 8.714   69.173  24.038  0.0000 57.30 ? 128  THR C CG2 1 
ATOM   7281  N  N   . GLN C  1 22  ? 6.177   67.165  22.334  1.00   60.10 ? 129  GLN C N   1 
ATOM   7282  C  CA  . GLN C  1 22  ? 5.776   65.766  22.531  1.00   60.62 ? 129  GLN C CA  1 
ATOM   7283  C  C   . GLN C  1 22  ? 6.707   64.986  23.483  1.00   58.86 ? 129  GLN C C   1 
ATOM   7284  O  O   . GLN C  1 22  ? 6.643   63.755  23.565  1.00   60.68 ? 129  GLN C O   1 
ATOM   7285  C  CB  . GLN C  1 22  ? 5.719   65.043  21.177  1.00   61.81 ? 129  GLN C CB  1 
ATOM   7286  C  CG  . GLN C  1 22  ? 4.962   63.727  21.190  0.0000 61.17 ? 129  GLN C CG  1 
ATOM   7287  C  CD  . GLN C  1 22  ? 3.473   63.916  21.402  0.0000 61.19 ? 129  GLN C CD  1 
ATOM   7288  O  OE1 . GLN C  1 22  ? 3.039   64.424  22.436  0.0000 61.08 ? 129  GLN C OE1 1 
ATOM   7289  N  NE2 . GLN C  1 22  ? 2.681   63.509  20.417  0.0000 61.08 ? 129  GLN C NE2 1 
ATOM   7290  N  N   . ARG C  1 23  ? 7.578   65.701  24.188  1.00   53.45 ? 130  ARG C N   1 
ATOM   7291  C  CA  . ARG C  1 23  ? 8.489   65.068  25.136  1.00   47.47 ? 130  ARG C CA  1 
ATOM   7292  C  C   . ARG C  1 23  ? 8.064   65.467  26.556  1.00   41.97 ? 130  ARG C C   1 
ATOM   7293  O  O   . ARG C  1 23  ? 8.719   66.285  27.210  1.00   38.30 ? 130  ARG C O   1 
ATOM   7294  C  CB  . ARG C  1 23  ? 9.935   65.509  24.870  1.00   50.12 ? 130  ARG C CB  1 
ATOM   7295  C  CG  . ARG C  1 23  ? 10.531  64.993  23.560  1.00   53.31 ? 130  ARG C CG  1 
ATOM   7296  C  CD  . ARG C  1 23  ? 12.054  65.036  23.587  0.0000 51.99 ? 130  ARG C CD  1 
ATOM   7297  N  NE  . ARG C  1 23  ? 12.588  66.392  23.679  0.0000 52.07 ? 130  ARG C NE  1 
ATOM   7298  C  CZ  . ARG C  1 23  ? 12.581  67.267  22.678  0.0000 51.85 ? 130  ARG C CZ  1 
ATOM   7299  N  NH1 . ARG C  1 23  ? 12.068  66.929  21.503  0.0000 51.80 ? 130  ARG C NH1 1 
ATOM   7300  N  NH2 . ARG C  1 23  ? 13.091  68.479  22.851  0.0000 51.80 ? 130  ARG C NH2 1 
ATOM   7301  N  N   . ASP C  1 24  ? 6.950   64.898  27.014  1.00   35.21 ? 131  ASP C N   1 
ATOM   7302  C  CA  . ASP C  1 24  ? 6.425   65.192  28.343  1.00   29.97 ? 131  ASP C CA  1 
ATOM   7303  C  C   . ASP C  1 24  ? 5.718   63.971  28.922  1.00   25.51 ? 131  ASP C C   1 
ATOM   7304  O  O   . ASP C  1 24  ? 5.673   62.916  28.285  1.00   23.92 ? 131  ASP C O   1 
ATOM   7305  C  CB  . ASP C  1 24  ? 5.473   66.397  28.281  1.00   29.79 ? 131  ASP C CB  1 
ATOM   7306  C  CG  . ASP C  1 24  ? 4.350   66.217  27.261  1.00   32.55 ? 131  ASP C CG  1 
ATOM   7307  O  OD1 . ASP C  1 24  ? 3.571   65.256  27.394  1.00   28.23 ? 131  ASP C OD1 1 
ATOM   7308  O  OD2 . ASP C  1 24  ? 4.239   67.044  26.326  1.00   37.13 ? 131  ASP C OD2 1 
ATOM   7309  N  N   . LEU C  1 25  ? 5.167   64.119  30.124  1.00   21.68 ? 132  LEU C N   1 
ATOM   7310  C  CA  . LEU C  1 25  ? 4.478   63.024  30.807  1.00   18.87 ? 132  LEU C CA  1 
ATOM   7311  C  C   . LEU C  1 25  ? 3.012   62.850  30.370  1.00   18.26 ? 132  LEU C C   1 
ATOM   7312  O  O   . LEU C  1 25  ? 2.270   62.060  30.950  1.00   18.45 ? 132  LEU C O   1 
ATOM   7313  C  CB  . LEU C  1 25  ? 4.584   63.226  32.327  1.00   18.93 ? 132  LEU C CB  1 
ATOM   7314  C  CG  . LEU C  1 25  ? 6.043   63.293  32.811  1.00   19.36 ? 132  LEU C CG  1 
ATOM   7315  C  CD1 . LEU C  1 25  ? 6.095   63.684  34.271  1.00   16.16 ? 132  LEU C CD1 1 
ATOM   7316  C  CD2 . LEU C  1 25  ? 6.724   61.945  32.595  1.00   15.25 ? 132  LEU C CD2 1 
ATOM   7317  N  N   . ASN C  1 26  ? 2.605   63.596  29.345  1.00   16.97 ? 133  ASN C N   1 
ATOM   7318  C  CA  . ASN C  1 26  ? 1.257   63.496  28.804  1.00   16.19 ? 133  ASN C CA  1 
ATOM   7319  C  C   . ASN C  1 26  ? 0.165   63.686  29.854  1.00   16.65 ? 133  ASN C C   1 
ATOM   7320  O  O   . ASN C  1 26  ? -0.870  63.008  29.825  1.00   18.15 ? 133  ASN C O   1 
ATOM   7321  C  CB  . ASN C  1 26  ? 1.099   62.130  28.115  1.00   16.27 ? 133  ASN C CB  1 
ATOM   7322  C  CG  . ASN C  1 26  ? -0.006  62.125  27.088  1.00   18.83 ? 133  ASN C CG  1 
ATOM   7323  O  OD1 . ASN C  1 26  ? -0.251  63.138  26.434  1.00   23.86 ? 133  ASN C OD1 1 
ATOM   7324  N  ND2 . ASN C  1 26  ? -0.669  60.984  26.924  1.00   21.19 ? 133  ASN C ND2 1 
ATOM   7325  N  N   . VAL C  1 27  ? 0.388   64.628  30.765  1.00   18.62 ? 134  VAL C N   1 
ATOM   7326  C  CA  . VAL C  1 27  ? -0.563  64.901  31.845  1.00   20.54 ? 134  VAL C CA  1 
ATOM   7327  C  C   . VAL C  1 27  ? -1.822  65.638  31.383  1.00   21.68 ? 134  VAL C C   1 
ATOM   7328  O  O   . VAL C  1 27  ? -2.919  65.376  31.875  1.00   23.10 ? 134  VAL C O   1 
ATOM   7329  C  CB  . VAL C  1 27  ? 0.119   65.731  32.963  1.00   22.50 ? 134  VAL C CB  1 
ATOM   7330  C  CG1 . VAL C  1 27  ? -0.852  65.999  34.113  1.00   19.59 ? 134  VAL C CG1 1 
ATOM   7331  C  CG2 . VAL C  1 27  ? 1.368   65.013  33.453  1.00   20.38 ? 134  VAL C CG2 1 
ATOM   7332  N  N   . LYS C  1 28  ? -1.668  66.553  30.434  1.00   21.98 ? 135  LYS C N   1 
ATOM   7333  C  CA  . LYS C  1 28  ? -2.812  67.310  29.946  1.00   24.14 ? 135  LYS C CA  1 
ATOM   7334  C  C   . LYS C  1 28  ? -3.860  66.353  29.367  1.00   23.38 ? 135  LYS C C   1 
ATOM   7335  O  O   . LYS C  1 28  ? -5.066  66.556  29.533  1.00   24.61 ? 135  LYS C O   1 
ATOM   7336  C  CB  . LYS C  1 28  ? -2.355  68.325  28.893  1.00   24.55 ? 135  LYS C CB  1 
ATOM   7337  C  CG  . LYS C  1 28  ? -3.425  69.324  28.509  1.00   24.59 ? 135  LYS C CG  1 
ATOM   7338  C  CD  . LYS C  1 28  ? -2.925  70.280  27.437  1.00   28.14 ? 135  LYS C CD  1 
ATOM   7339  C  CE  . LYS C  1 28  ? -3.996  71.296  27.060  1.00   28.88 ? 135  LYS C CE  1 
ATOM   7340  N  NZ  . LYS C  1 28  ? -3.521  72.259  26.017  1.00   25.03 ? 135  LYS C NZ  1 
ATOM   7341  N  N   . ALA C  1 29  ? -3.396  65.301  28.705  1.00   21.48 ? 136  ALA C N   1 
ATOM   7342  C  CA  . ALA C  1 29  ? -4.298  64.309  28.130  1.00   22.49 ? 136  ALA C CA  1 
ATOM   7343  C  C   . ALA C  1 29  ? -5.141  63.659  29.225  1.00   23.49 ? 136  ALA C C   1 
ATOM   7344  O  O   . ALA C  1 29  ? -6.287  63.288  28.991  1.00   26.53 ? 136  ALA C O   1 
ATOM   7345  C  CB  . ALA C  1 29  ? -3.506  63.249  27.375  1.00   17.92 ? 136  ALA C CB  1 
ATOM   7346  N  N   . ALA C  1 30  ? -4.577  63.515  30.422  1.00   22.49 ? 137  ALA C N   1 
ATOM   7347  C  CA  . ALA C  1 30  ? -5.329  62.928  31.529  1.00   20.66 ? 137  ALA C CA  1 
ATOM   7348  C  C   . ALA C  1 30  ? -6.336  63.953  32.063  1.00   17.71 ? 137  ALA C C   1 
ATOM   7349  O  O   . ALA C  1 30  ? -7.473  63.622  32.379  1.00   19.72 ? 137  ALA C O   1 
ATOM   7350  C  CB  . ALA C  1 30  ? -4.388  62.494  32.639  1.00   17.44 ? 137  ALA C CB  1 
ATOM   7351  N  N   . TRP C  1 31  ? -5.911  65.202  32.173  1.00   18.66 ? 138  TRP C N   1 
ATOM   7352  C  CA  . TRP C  1 31  ? -6.803  66.250  32.656  1.00   20.10 ? 138  TRP C CA  1 
ATOM   7353  C  C   . TRP C  1 31  ? -7.984  66.361  31.696  1.00   22.77 ? 138  TRP C C   1 
ATOM   7354  O  O   . TRP C  1 31  ? -9.139  66.472  32.118  1.00   22.41 ? 138  TRP C O   1 
ATOM   7355  C  CB  . TRP C  1 31  ? -6.094  67.612  32.700  1.00   18.69 ? 138  TRP C CB  1 
ATOM   7356  C  CG  . TRP C  1 31  ? -4.958  67.728  33.667  1.00   19.76 ? 138  TRP C CG  1 
ATOM   7357  C  CD1 . TRP C  1 31  ? -4.788  67.027  34.824  1.00   20.20 ? 138  TRP C CD1 1 
ATOM   7358  C  CD2 . TRP C  1 31  ? -3.871  68.657  33.598  1.00   23.10 ? 138  TRP C CD2 1 
ATOM   7359  N  NE1 . TRP C  1 31  ? -3.667  67.463  35.484  1.00   17.09 ? 138  TRP C NE1 1 
ATOM   7360  C  CE2 . TRP C  1 31  ? -3.083  68.462  34.756  1.00   18.47 ? 138  TRP C CE2 1 
ATOM   7361  C  CE3 . TRP C  1 31  ? -3.488  69.641  32.673  1.00   20.07 ? 138  TRP C CE3 1 
ATOM   7362  C  CZ2 . TRP C  1 31  ? -1.937  69.207  35.014  1.00   17.52 ? 138  TRP C CZ2 1 
ATOM   7363  C  CZ3 . TRP C  1 31  ? -2.350  70.384  32.929  1.00   21.71 ? 138  TRP C CZ3 1 
ATOM   7364  C  CH2 . TRP C  1 31  ? -1.584  70.165  34.093  1.00   20.34 ? 138  TRP C CH2 1 
ATOM   7365  N  N   . ALA C  1 32  ? -7.676  66.349  30.402  1.00   23.25 ? 139  ALA C N   1 
ATOM   7366  C  CA  . ALA C  1 32  ? -8.690  66.456  29.365  1.00   24.27 ? 139  ALA C CA  1 
ATOM   7367  C  C   . ALA C  1 32  ? -9.719  65.325  29.464  1.00   25.78 ? 139  ALA C C   1 
ATOM   7368  O  O   . ALA C  1 32  ? -10.891 65.529  29.148  1.00   25.80 ? 139  ALA C O   1 
ATOM   7369  C  CB  . ALA C  1 32  ? -8.032  66.454  28.002  1.00   24.66 ? 139  ALA C CB  1 
ATOM   7370  N  N   . GLN C  1 33  ? -9.287  64.139  29.892  1.00   24.22 ? 140  GLN C N   1 
ATOM   7371  C  CA  . GLN C  1 33  ? -10.211 63.013  30.053  1.00   23.71 ? 140  GLN C CA  1 
ATOM   7372  C  C   . GLN C  1 33  ? -11.052 63.212  31.318  1.00   24.05 ? 140  GLN C C   1 
ATOM   7373  O  O   . GLN C  1 33  ? -11.920 62.403  31.631  1.00   25.72 ? 140  GLN C O   1 
ATOM   7374  C  CB  . GLN C  1 33  ? -9.443  61.692  30.155  1.00   23.26 ? 140  GLN C CB  1 
ATOM   7375  C  CG  . GLN C  1 33  ? -9.004  61.133  28.822  1.00   24.95 ? 140  GLN C CG  1 
ATOM   7376  C  CD  . GLN C  1 33  ? -7.972  60.025  28.966  1.00   28.08 ? 140  GLN C CD  1 
ATOM   7377  O  OE1 . GLN C  1 33  ? -6.764  60.273  28.925  1.00   32.82 ? 140  GLN C OE1 1 
ATOM   7378  N  NE2 . GLN C  1 33  ? -8.441  58.800  29.148  1.00   29.66 ? 140  GLN C NE2 1 
ATOM   7379  N  N   . GLY C  1 34  ? -10.780 64.286  32.054  1.00   25.02 ? 141  GLY C N   1 
ATOM   7380  C  CA  . GLY C  1 34  ? -11.539 64.575  33.262  1.00   21.05 ? 141  GLY C CA  1 
ATOM   7381  C  C   . GLY C  1 34  ? -10.910 64.198  34.595  1.00   20.83 ? 141  GLY C C   1 
ATOM   7382  O  O   . GLY C  1 34  ? -11.589 64.211  35.614  1.00   21.66 ? 141  GLY C O   1 
ATOM   7383  N  N   . TYR C  1 35  ? -9.618  63.891  34.614  1.00   21.35 ? 142  TYR C N   1 
ATOM   7384  C  CA  . TYR C  1 35  ? -8.982  63.489  35.865  1.00   20.14 ? 142  TYR C CA  1 
ATOM   7385  C  C   . TYR C  1 35  ? -7.958  64.494  36.369  1.00   19.72 ? 142  TYR C C   1 
ATOM   7386  O  O   . TYR C  1 35  ? -6.981  64.820  35.679  1.00   20.24 ? 142  TYR C O   1 
ATOM   7387  C  CB  . TYR C  1 35  ? -8.362  62.096  35.686  1.00   19.81 ? 142  TYR C CB  1 
ATOM   7388  C  CG  . TYR C  1 35  ? -9.386  61.089  35.194  1.00   20.87 ? 142  TYR C CG  1 
ATOM   7389  C  CD1 . TYR C  1 35  ? -10.379 60.593  36.043  1.00   19.46 ? 142  TYR C CD1 1 
ATOM   7390  C  CD2 . TYR C  1 35  ? -9.401  60.683  33.860  1.00   22.64 ? 142  TYR C CD2 1 
ATOM   7391  C  CE1 . TYR C  1 35  ? -11.366 59.711  35.570  1.00   18.33 ? 142  TYR C CE1 1 
ATOM   7392  C  CE2 . TYR C  1 35  ? -10.375 59.812  33.382  1.00   20.89 ? 142  TYR C CE2 1 
ATOM   7393  C  CZ  . TYR C  1 35  ? -11.345 59.330  34.239  1.00   21.41 ? 142  TYR C CZ  1 
ATOM   7394  O  OH  . TYR C  1 35  ? -12.255 58.432  33.759  1.00   22.96 ? 142  TYR C OH  1 
ATOM   7395  N  N   . THR C  1 36  ? -8.194  64.981  37.584  1.00   17.44 ? 143  THR C N   1 
ATOM   7396  C  CA  . THR C  1 36  ? -7.322  65.953  38.206  1.00   20.00 ? 143  THR C CA  1 
ATOM   7397  C  C   . THR C  1 36  ? -6.937  65.581  39.637  1.00   18.05 ? 143  THR C C   1 
ATOM   7398  O  O   . THR C  1 36  ? -6.283  66.346  40.326  1.00   20.03 ? 143  THR C O   1 
ATOM   7399  C  CB  . THR C  1 36  ? -7.976  67.339  38.199  1.00   22.64 ? 143  THR C CB  1 
ATOM   7400  O  OG1 . THR C  1 36  ? -9.179  67.299  38.969  1.00   25.97 ? 143  THR C OG1 1 
ATOM   7401  C  CG2 . THR C  1 36  ? -8.308  67.741  36.773  1.00   21.88 ? 143  THR C CG2 1 
ATOM   7402  N  N   . GLY C  1 37  ? -7.348  64.401  40.081  1.00   22.05 ? 144  GLY C N   1 
ATOM   7403  C  CA  . GLY C  1 37  ? -6.996  63.950  41.415  1.00   21.73 ? 144  GLY C CA  1 
ATOM   7404  C  C   . GLY C  1 37  ? -8.057  64.195  42.470  1.00   23.34 ? 144  GLY C C   1 
ATOM   7405  O  O   . GLY C  1 37  ? -7.826  63.980  43.659  1.00   24.10 ? 144  GLY C O   1 
ATOM   7406  N  N   . HIS C  1 38  ? -9.227  64.651  42.046  1.00   23.23 ? 145  HIS C N   1 
ATOM   7407  C  CA  . HIS C  1 38  ? -10.296 64.919  42.989  1.00   23.46 ? 145  HIS C CA  1 
ATOM   7408  C  C   . HIS C  1 38  ? -10.641 63.667  43.822  1.00   21.98 ? 145  HIS C C   1 
ATOM   7409  O  O   . HIS C  1 38  ? -10.846 62.583  43.280  1.00   18.27 ? 145  HIS C O   1 
ATOM   7410  C  CB  . HIS C  1 38  ? -11.528 65.397  42.236  1.00   29.64 ? 145  HIS C CB  1 
ATOM   7411  C  CG  . HIS C  1 38  ? -12.615 65.895  43.129  1.00   42.36 ? 145  HIS C CG  1 
ATOM   7412  N  ND1 . HIS C  1 38  ? -12.543 67.109  43.782  1.00   45.39 ? 145  HIS C ND1 1 
ATOM   7413  C  CD2 . HIS C  1 38  ? -13.773 65.317  43.533  1.00   46.60 ? 145  HIS C CD2 1 
ATOM   7414  C  CE1 . HIS C  1 38  ? -13.608 67.255  44.551  1.00   48.86 ? 145  HIS C CE1 1 
ATOM   7415  N  NE2 . HIS C  1 38  ? -14.371 66.182  44.419  1.00   49.62 ? 145  HIS C NE2 1 
ATOM   7416  N  N   . GLY C  1 39  ? -10.696 63.822  45.142  1.00   20.62 ? 146  GLY C N   1 
ATOM   7417  C  CA  . GLY C  1 39  ? -11.016 62.693  46.002  1.00   21.51 ? 146  GLY C CA  1 
ATOM   7418  C  C   . GLY C  1 39  ? -9.839  61.822  46.437  1.00   22.16 ? 146  GLY C C   1 
ATOM   7419  O  O   . GLY C  1 39  ? -10.002 60.945  47.282  1.00   21.58 ? 146  GLY C O   1 
ATOM   7420  N  N   . ILE C  1 40  ? -8.652  62.065  45.887  1.00   19.13 ? 147  ILE C N   1 
ATOM   7421  C  CA  . ILE C  1 40  ? -7.476  61.264  46.233  1.00   20.65 ? 147  ILE C CA  1 
ATOM   7422  C  C   . ILE C  1 40  ? -6.611  61.988  47.263  1.00   19.30 ? 147  ILE C C   1 
ATOM   7423  O  O   . ILE C  1 40  ? -6.471  63.207  47.209  1.00   20.46 ? 147  ILE C O   1 
ATOM   7424  C  CB  . ILE C  1 40  ? -6.631  60.950  44.960  1.00   20.83 ? 147  ILE C CB  1 
ATOM   7425  C  CG1 . ILE C  1 40  ? -7.516  60.317  43.874  1.00   18.53 ? 147  ILE C CG1 1 
ATOM   7426  C  CG2 . ILE C  1 40  ? -5.492  60.027  45.304  1.00   19.49 ? 147  ILE C CG2 1 
ATOM   7427  C  CD1 . ILE C  1 40  ? -8.195  59.013  44.285  1.00   17.37 ? 147  ILE C CD1 1 
ATOM   7428  N  N   . VAL C  1 41  ? -6.041  61.238  48.203  1.00   18.76 ? 148  VAL C N   1 
ATOM   7429  C  CA  . VAL C  1 41  ? -5.210  61.815  49.256  1.00   15.88 ? 148  VAL C CA  1 
ATOM   7430  C  C   . VAL C  1 41  ? -3.767  61.339  49.132  1.00   18.66 ? 148  VAL C C   1 
ATOM   7431  O  O   . VAL C  1 41  ? -3.496  60.135  49.153  1.00   18.67 ? 148  VAL C O   1 
ATOM   7432  C  CB  . VAL C  1 41  ? -5.735  61.417  50.680  1.00   19.20 ? 148  VAL C CB  1 
ATOM   7433  C  CG1 . VAL C  1 41  ? -4.893  62.094  51.772  1.00   13.64 ? 148  VAL C CG1 1 
ATOM   7434  C  CG2 . VAL C  1 41  ? -7.203  61.809  50.831  1.00   19.60 ? 148  VAL C CG2 1 
ATOM   7435  N  N   . VAL C  1 42  ? -2.847  62.292  49.004  1.00   20.41 ? 149  VAL C N   1 
ATOM   7436  C  CA  . VAL C  1 42  ? -1.421  61.996  48.882  1.00   17.50 ? 149  VAL C CA  1 
ATOM   7437  C  C   . VAL C  1 42  ? -0.670  62.625  50.042  1.00   18.74 ? 149  VAL C C   1 
ATOM   7438  O  O   . VAL C  1 42  ? -0.956  63.757  50.428  1.00   21.61 ? 149  VAL C O   1 
ATOM   7439  C  CB  . VAL C  1 42  ? -0.837  62.573  47.579  1.00   16.12 ? 149  VAL C CB  1 
ATOM   7440  C  CG1 . VAL C  1 42  ? 0.649   62.218  47.467  1.00   13.77 ? 149  VAL C CG1 1 
ATOM   7441  C  CG2 . VAL C  1 42  ? -1.615  62.052  46.386  1.00   15.14 ? 149  VAL C CG2 1 
ATOM   7442  N  N   . SER C  1 43  ? 0.288   61.896  50.597  1.00   16.12 ? 150  SER C N   1 
ATOM   7443  C  CA  . SER C  1 43  ? 1.066   62.415  51.711  1.00   18.57 ? 150  SER C CA  1 
ATOM   7444  C  C   . SER C  1 43  ? 2.558   62.353  51.399  1.00   19.14 ? 150  SER C C   1 
ATOM   7445  O  O   . SER C  1 43  ? 3.064   61.317  50.959  1.00   19.28 ? 150  SER C O   1 
ATOM   7446  C  CB  . SER C  1 43  ? 0.774   61.616  52.985  1.00   20.80 ? 150  SER C CB  1 
ATOM   7447  O  OG  . SER C  1 43  ? 1.444   62.190  54.094  1.00   23.44 ? 150  SER C OG  1 
ATOM   7448  N  N   . ILE C  1 44  ? 3.246   63.469  51.632  1.00   18.08 ? 151  ILE C N   1 
ATOM   7449  C  CA  . ILE C  1 44  ? 4.681   63.587  51.384  1.00   20.06 ? 151  ILE C CA  1 
ATOM   7450  C  C   . ILE C  1 44  ? 5.470   63.323  52.673  1.00   21.73 ? 151  ILE C C   1 
ATOM   7451  O  O   . ILE C  1 44  ? 5.433   64.133  53.594  1.00   25.46 ? 151  ILE C O   1 
ATOM   7452  C  CB  . ILE C  1 44  ? 5.025   65.019  50.867  1.00   21.43 ? 151  ILE C CB  1 
ATOM   7453  C  CG1 . ILE C  1 44  ? 4.261   65.301  49.570  1.00   19.53 ? 151  ILE C CG1 1 
ATOM   7454  C  CG2 . ILE C  1 44  ? 6.507   65.164  50.638  1.00   17.70 ? 151  ILE C CG2 1 
ATOM   7455  C  CD1 . ILE C  1 44  ? 4.535   64.307  48.441  1.00   21.67 ? 151  ILE C CD1 1 
ATOM   7456  N  N   . LEU C  1 45  ? 6.162   62.186  52.746  1.00   20.42 ? 152  LEU C N   1 
ATOM   7457  C  CA  . LEU C  1 45  ? 6.963   61.849  53.924  1.00   17.80 ? 152  LEU C CA  1 
ATOM   7458  C  C   . LEU C  1 45  ? 8.300   62.522  53.690  1.00   17.23 ? 152  LEU C C   1 
ATOM   7459  O  O   . LEU C  1 45  ? 9.096   62.049  52.887  1.00   18.02 ? 152  LEU C O   1 
ATOM   7460  C  CB  . LEU C  1 45  ? 7.137   60.328  54.040  1.00   16.58 ? 152  LEU C CB  1 
ATOM   7461  C  CG  . LEU C  1 45  ? 5.856   59.488  53.907  1.00   17.38 ? 152  LEU C CG  1 
ATOM   7462  C  CD1 . LEU C  1 45  ? 6.060   58.082  54.456  1.00   15.65 ? 152  LEU C CD1 1 
ATOM   7463  C  CD2 . LEU C  1 45  ? 4.738   60.159  54.668  1.00   20.54 ? 152  LEU C CD2 1 
ATOM   7464  N  N   . ASP C  1 46  ? 8.552   63.627  54.389  1.00   19.40 ? 153  ASP C N   1 
ATOM   7465  C  CA  . ASP C  1 46  ? 9.779   64.379  54.160  1.00   19.39 ? 153  ASP C CA  1 
ATOM   7466  C  C   . ASP C  1 46  ? 10.168  65.254  55.355  1.00   21.97 ? 153  ASP C C   1 
ATOM   7467  O  O   . ASP C  1 46  ? 10.021  64.832  56.504  1.00   20.92 ? 153  ASP C O   1 
ATOM   7468  C  CB  . ASP C  1 46  ? 9.576   65.240  52.905  1.00   20.24 ? 153  ASP C CB  1 
ATOM   7469  C  CG  . ASP C  1 46  ? 10.863  65.483  52.129  1.00   21.20 ? 153  ASP C CG  1 
ATOM   7470  O  OD1 . ASP C  1 46  ? 11.620  66.413  52.475  1.00   20.99 ? 153  ASP C OD1 1 
ATOM   7471  O  OD2 . ASP C  1 46  ? 11.117  64.737  51.160  1.00   20.34 ? 153  ASP C OD2 1 
ATOM   7472  N  N   . ASP C  1 47  ? 10.651  66.470  55.080  1.00   19.61 ? 154  ASP C N   1 
ATOM   7473  C  CA  . ASP C  1 47  ? 11.083  67.374  56.141  1.00   21.05 ? 154  ASP C CA  1 
ATOM   7474  C  C   . ASP C  1 47  ? 10.042  68.402  56.553  1.00   21.10 ? 154  ASP C C   1 
ATOM   7475  O  O   . ASP C  1 47  ? 10.371  69.397  57.197  1.00   21.46 ? 154  ASP C O   1 
ATOM   7476  C  CB  . ASP C  1 47  ? 12.386  68.089  55.753  1.00   19.22 ? 154  ASP C CB  1 
ATOM   7477  C  CG  . ASP C  1 47  ? 12.231  68.978  54.535  1.00   19.50 ? 154  ASP C CG  1 
ATOM   7478  O  OD1 . ASP C  1 47  ? 11.079  69.204  54.096  1.00   16.44 ? 154  ASP C OD1 1 
ATOM   7479  O  OD2 . ASP C  1 47  ? 13.269  69.453  54.027  1.00   17.01 ? 154  ASP C OD2 1 
ATOM   7480  N  N   . GLY C  1 48  ? 8.791   68.142  56.188  1.00   21.04 ? 155  GLY C N   1 
ATOM   7481  C  CA  . GLY C  1 48  ? 7.708   69.037  56.530  1.00   21.58 ? 155  GLY C CA  1 
ATOM   7482  C  C   . GLY C  1 48  ? 7.024   69.603  55.300  1.00   23.13 ? 155  GLY C C   1 
ATOM   7483  O  O   . GLY C  1 48  ? 7.463   69.395  54.170  1.00   21.57 ? 155  GLY C O   1 
ATOM   7484  N  N   . ILE C  1 49  ? 5.934   70.324  55.518  1.00   21.55 ? 156  ILE C N   1 
ATOM   7485  C  CA  . ILE C  1 49  ? 5.207   70.932  54.415  1.00   21.30 ? 156  ILE C CA  1 
ATOM   7486  C  C   . ILE C  1 49  ? 4.659   72.290  54.856  1.00   22.02 ? 156  ILE C C   1 
ATOM   7487  O  O   . ILE C  1 49  ? 4.029   72.394  55.906  1.00   21.74 ? 156  ILE C O   1 
ATOM   7488  C  CB  . ILE C  1 49  ? 4.045   70.016  53.956  1.00   18.30 ? 156  ILE C CB  1 
ATOM   7489  C  CG1 . ILE C  1 49  ? 3.342   70.617  52.743  1.00   18.09 ? 156  ILE C CG1 1 
ATOM   7490  C  CG2 . ILE C  1 49  ? 3.041   69.817  55.089  1.00   18.74 ? 156  ILE C CG2 1 
ATOM   7491  C  CD1 . ILE C  1 49  ? 2.140   69.785  52.282  1.00   16.11 ? 156  ILE C CD1 1 
ATOM   7492  N  N   . GLU C  1 50  ? 4.926   73.331  54.069  1.00   20.11 ? 157  GLU C N   1 
ATOM   7493  C  CA  . GLU C  1 50  ? 4.421   74.665  54.386  1.00   20.90 ? 157  GLU C CA  1 
ATOM   7494  C  C   . GLU C  1 50  ? 2.930   74.680  54.036  1.00   19.75 ? 157  GLU C C   1 
ATOM   7495  O  O   . GLU C  1 50  ? 2.551   75.040  52.936  1.00   21.18 ? 157  GLU C O   1 
ATOM   7496  C  CB  . GLU C  1 50  ? 5.174   75.705  53.565  1.00   22.85 ? 157  GLU C CB  1 
ATOM   7497  C  CG  . GLU C  1 50  ? 5.027   77.113  54.092  1.00   24.50 ? 157  GLU C CG  1 
ATOM   7498  C  CD  . GLU C  1 50  ? 5.970   78.060  53.401  1.00   27.09 ? 157  GLU C CD  1 
ATOM   7499  O  OE1 . GLU C  1 50  ? 5.748   78.336  52.205  1.00   29.92 ? 157  GLU C OE1 1 
ATOM   7500  O  OE2 . GLU C  1 50  ? 6.944   78.513  54.044  1.00   27.76 ? 157  GLU C OE2 1 
ATOM   7501  N  N   . LYS C  1 51  ? 2.094   74.269  54.981  1.00   19.76 ? 158  LYS C N   1 
ATOM   7502  C  CA  . LYS C  1 51  ? 0.660   74.180  54.760  1.00   22.74 ? 158  LYS C CA  1 
ATOM   7503  C  C   . LYS C  1 51  ? -0.028  75.492  54.406  1.00   24.71 ? 158  LYS C C   1 
ATOM   7504  O  O   . LYS C  1 51  ? -1.114  75.493  53.818  1.00   23.32 ? 158  LYS C O   1 
ATOM   7505  C  CB  . LYS C  1 51  ? -0.032  73.566  55.980  1.00   21.96 ? 158  LYS C CB  1 
ATOM   7506  C  CG  . LYS C  1 51  ? 0.280   74.241  57.308  1.00   27.64 ? 158  LYS C CG  1 
ATOM   7507  C  CD  . LYS C  1 51  ? -0.749  73.861  58.378  1.00   27.45 ? 158  LYS C CD  1 
ATOM   7508  C  CE  . LYS C  1 51  ? -0.161  73.895  59.781  1.00   27.33 ? 158  LYS C CE  1 
ATOM   7509  N  NZ  . LYS C  1 51  ? 0.758   75.040  60.047  1.00   24.03 ? 158  LYS C NZ  1 
ATOM   7510  N  N   . ASN C  1 52  ? 0.599   76.600  54.775  1.00   21.38 ? 159  ASN C N   1 
ATOM   7511  C  CA  . ASN C  1 52  ? 0.043   77.910  54.491  1.00   26.12 ? 159  ASN C CA  1 
ATOM   7512  C  C   . ASN C  1 52  ? 0.591   78.498  53.185  1.00   25.10 ? 159  ASN C C   1 
ATOM   7513  O  O   . ASN C  1 52  ? 0.354   79.657  52.886  1.00   25.81 ? 159  ASN C O   1 
ATOM   7514  C  CB  . ASN C  1 52  ? 0.322   78.854  55.664  1.00   23.04 ? 159  ASN C CB  1 
ATOM   7515  C  CG  . ASN C  1 52  ? 1.788   78.973  55.974  1.00   31.37 ? 159  ASN C CG  1 
ATOM   7516  O  OD1 . ASN C  1 52  ? 2.530   77.993  55.913  1.00   37.51 ? 159  ASN C OD1 1 
ATOM   7517  N  ND2 . ASN C  1 52  ? 2.221   80.175  56.321  1.00   32.98 ? 159  ASN C ND2 1 
ATOM   7518  N  N   . HIS C  1 53  ? 1.328   77.705  52.412  1.00   23.84 ? 160  HIS C N   1 
ATOM   7519  C  CA  . HIS C  1 53  ? 1.855   78.203  51.141  1.00   23.71 ? 160  HIS C CA  1 
ATOM   7520  C  C   . HIS C  1 53  ? 0.658   78.577  50.264  1.00   22.36 ? 160  HIS C C   1 
ATOM   7521  O  O   . HIS C  1 53  ? -0.317  77.826  50.181  1.00   22.72 ? 160  HIS C O   1 
ATOM   7522  C  CB  . HIS C  1 53  ? 2.706   77.131  50.444  1.00   20.17 ? 160  HIS C CB  1 
ATOM   7523  C  CG  . HIS C  1 53  ? 3.540   77.663  49.316  1.00   22.71 ? 160  HIS C CG  1 
ATOM   7524  N  ND1 . HIS C  1 53  ? 2.999   78.076  48.117  1.00   21.57 ? 160  HIS C ND1 1 
ATOM   7525  C  CD2 . HIS C  1 53  ? 4.871   77.895  49.228  1.00   20.91 ? 160  HIS C CD2 1 
ATOM   7526  C  CE1 . HIS C  1 53  ? 3.961   78.542  47.340  1.00   21.51 ? 160  HIS C CE1 1 
ATOM   7527  N  NE2 . HIS C  1 53  ? 5.105   78.444  47.990  1.00   20.67 ? 160  HIS C NE2 1 
ATOM   7528  N  N   . PRO C  1 54  ? 0.712   79.747  49.603  1.00   24.13 ? 161  PRO C N   1 
ATOM   7529  C  CA  . PRO C  1 54  ? -0.412  80.153  48.754  1.00   22.47 ? 161  PRO C CA  1 
ATOM   7530  C  C   . PRO C  1 54  ? -0.789  79.157  47.663  1.00   22.45 ? 161  PRO C C   1 
ATOM   7531  O  O   . PRO C  1 54  ? -1.924  79.155  47.199  1.00   21.39 ? 161  PRO C O   1 
ATOM   7532  C  CB  . PRO C  1 54  ? 0.030   81.516  48.195  1.00   19.07 ? 161  PRO C CB  1 
ATOM   7533  C  CG  . PRO C  1 54  ? 1.520   81.447  48.242  1.00   27.18 ? 161  PRO C CG  1 
ATOM   7534  C  CD  . PRO C  1 54  ? 1.801   80.739  49.553  1.00   24.00 ? 161  PRO C CD  1 
ATOM   7535  N  N   . ASP C  1 55  ? 0.138   78.301  47.249  1.00   22.50 ? 162  ASP C N   1 
ATOM   7536  C  CA  . ASP C  1 55  ? -0.215  77.342  46.206  1.00   23.14 ? 162  ASP C CA  1 
ATOM   7537  C  C   . ASP C  1 55  ? -0.499  75.953  46.761  1.00   25.21 ? 162  ASP C C   1 
ATOM   7538  O  O   . ASP C  1 55  ? -0.708  75.003  45.997  1.00   24.54 ? 162  ASP C O   1 
ATOM   7539  C  CB  . ASP C  1 55  ? 0.878   77.277  45.139  1.00   20.53 ? 162  ASP C CB  1 
ATOM   7540  C  CG  . ASP C  1 55  ? 0.307   77.291  43.731  1.00   19.54 ? 162  ASP C CG  1 
ATOM   7541  O  OD1 . ASP C  1 55  ? -0.807  77.820  43.563  1.00   20.21 ? 162  ASP C OD1 1 
ATOM   7542  O  OD2 . ASP C  1 55  ? 0.969   76.801  42.793  1.00   19.00 ? 162  ASP C OD2 1 
ATOM   7543  N  N   . LEU C  1 56  ? -0.526  75.839  48.090  1.00   26.22 ? 163  LEU C N   1 
ATOM   7544  C  CA  . LEU C  1 56  ? -0.804  74.559  48.736  1.00   24.60 ? 163  LEU C CA  1 
ATOM   7545  C  C   . LEU C  1 56  ? -2.006  74.599  49.687  1.00   25.30 ? 163  LEU C C   1 
ATOM   7546  O  O   . LEU C  1 56  ? -2.769  73.630  49.777  1.00   21.53 ? 163  LEU C O   1 
ATOM   7547  C  CB  . LEU C  1 56  ? 0.433   74.067  49.506  1.00   27.14 ? 163  LEU C CB  1 
ATOM   7548  C  CG  . LEU C  1 56  ? 1.735   73.779  48.745  1.00   26.63 ? 163  LEU C CG  1 
ATOM   7549  C  CD1 . LEU C  1 56  ? 2.801   73.323  49.720  1.00   22.02 ? 163  LEU C CD1 1 
ATOM   7550  C  CD2 . LEU C  1 56  ? 1.504   72.703  47.699  1.00   28.70 ? 163  LEU C CD2 1 
ATOM   7551  N  N   . ALA C  1 57  ? -2.179  75.710  50.398  1.00   23.91 ? 164  ALA C N   1 
ATOM   7552  C  CA  . ALA C  1 57  ? -3.279  75.832  51.357  1.00   23.42 ? 164  ALA C CA  1 
ATOM   7553  C  C   . ALA C  1 57  ? -4.620  75.314  50.842  1.00   23.80 ? 164  ALA C C   1 
ATOM   7554  O  O   . ALA C  1 57  ? -5.343  74.612  51.553  1.00   24.30 ? 164  ALA C O   1 
ATOM   7555  C  CB  . ALA C  1 57  ? -3.426  77.282  51.797  1.00   25.13 ? 164  ALA C CB  1 
ATOM   7556  N  N   . GLY C  1 58  ? -4.956  75.660  49.605  1.00   22.07 ? 165  GLY C N   1 
ATOM   7557  C  CA  . GLY C  1 58  ? -6.215  75.215  49.042  1.00   20.11 ? 165  GLY C CA  1 
ATOM   7558  C  C   . GLY C  1 58  ? -6.418  73.704  48.974  1.00   22.92 ? 165  GLY C C   1 
ATOM   7559  O  O   . GLY C  1 58  ? -7.563  73.231  48.944  1.00   21.86 ? 165  GLY C O   1 
ATOM   7560  N  N   . ASN C  1 59  ? -5.336  72.931  48.933  1.00   20.26 ? 166  ASN C N   1 
ATOM   7561  C  CA  . ASN C  1 59  ? -5.474  71.478  48.872  1.00   20.85 ? 166  ASN C CA  1 
ATOM   7562  C  C   . ASN C  1 59  ? -4.950  70.795  50.139  1.00   23.76 ? 166  ASN C C   1 
ATOM   7563  O  O   . ASN C  1 59  ? -5.072  69.578  50.278  1.00   26.16 ? 166  ASN C O   1 
ATOM   7564  C  CB  . ASN C  1 59  ? -4.721  70.893  47.666  1.00   17.79 ? 166  ASN C CB  1 
ATOM   7565  C  CG  . ASN C  1 59  ? -5.367  71.231  46.326  1.00   19.10 ? 166  ASN C CG  1 
ATOM   7566  O  OD1 . ASN C  1 59  ? -6.580  71.394  46.226  1.00   23.04 ? 166  ASN C OD1 1 
ATOM   7567  N  ND2 . ASN C  1 59  ? -4.548  71.304  45.276  1.00   17.54 ? 166  ASN C ND2 1 
ATOM   7568  N  N   . TYR C  1 60  ? -4.370  71.565  51.056  1.00   22.20 ? 167  TYR C N   1 
ATOM   7569  C  CA  . TYR C  1 60  ? -3.808  70.982  52.270  1.00   23.62 ? 167  TYR C CA  1 
ATOM   7570  C  C   . TYR C  1 60  ? -4.801  70.134  53.053  1.00   24.41 ? 167  TYR C C   1 
ATOM   7571  O  O   . TYR C  1 60  ? -5.949  70.514  53.233  1.00   25.08 ? 167  TYR C O   1 
ATOM   7572  C  CB  . TYR C  1 60  ? -3.249  72.064  53.186  1.00   22.63 ? 167  TYR C CB  1 
ATOM   7573  C  CG  . TYR C  1 60  ? -2.656  71.493  54.454  1.00   23.60 ? 167  TYR C CG  1 
ATOM   7574  C  CD1 . TYR C  1 60  ? -1.497  70.723  54.414  1.00   24.02 ? 167  TYR C CD1 1 
ATOM   7575  C  CD2 . TYR C  1 60  ? -3.264  71.705  55.693  1.00   21.90 ? 167  TYR C CD2 1 
ATOM   7576  C  CE1 . TYR C  1 60  ? -0.951  70.173  55.572  1.00   23.52 ? 167  TYR C CE1 1 
ATOM   7577  C  CE2 . TYR C  1 60  ? -2.725  71.160  56.865  1.00   24.38 ? 167  TYR C CE2 1 
ATOM   7578  C  CZ  . TYR C  1 60  ? -1.571  70.394  56.796  1.00   23.27 ? 167  TYR C CZ  1 
ATOM   7579  O  OH  . TYR C  1 60  ? -1.042  69.835  57.939  1.00   22.15 ? 167  TYR C OH  1 
ATOM   7580  N  N   . ASP C  1 61  ? -4.345  68.981  53.526  1.00   25.52 ? 168  ASP C N   1 
ATOM   7581  C  CA  . ASP C  1 61  ? -5.201  68.076  54.287  1.00   28.30 ? 168  ASP C CA  1 
ATOM   7582  C  C   . ASP C  1 61  ? -4.520  67.651  55.586  1.00   25.51 ? 168  ASP C C   1 
ATOM   7583  O  O   . ASP C  1 61  ? -3.592  66.845  55.576  1.00   23.83 ? 168  ASP C O   1 
ATOM   7584  C  CB  . ASP C  1 61  ? -5.550  66.836  53.446  1.00   27.77 ? 168  ASP C CB  1 
ATOM   7585  C  CG  . ASP C  1 61  ? -6.422  65.852  54.201  1.00   29.81 ? 168  ASP C CG  1 
ATOM   7586  O  OD1 . ASP C  1 61  ? -6.860  66.186  55.323  1.00   30.45 ? 168  ASP C OD1 1 
ATOM   7587  O  OD2 . ASP C  1 61  ? -6.674  64.747  53.679  1.00   25.75 ? 168  ASP C OD2 1 
ATOM   7588  N  N   . PRO C  1 62  ? -4.996  68.179  56.726  1.00   27.12 ? 169  PRO C N   1 
ATOM   7589  C  CA  . PRO C  1 62  ? -4.458  67.885  58.056  1.00   22.90 ? 169  PRO C CA  1 
ATOM   7590  C  C   . PRO C  1 62  ? -4.520  66.391  58.357  1.00   23.90 ? 169  PRO C C   1 
ATOM   7591  O  O   . PRO C  1 62  ? -3.655  65.851  59.052  1.00   22.35 ? 169  PRO C O   1 
ATOM   7592  C  CB  . PRO C  1 62  ? -5.369  68.679  58.984  1.00   25.21 ? 169  PRO C CB  1 
ATOM   7593  C  CG  . PRO C  1 62  ? -5.989  69.716  58.102  1.00   28.89 ? 169  PRO C CG  1 
ATOM   7594  C  CD  . PRO C  1 62  ? -6.238  68.961  56.842  1.00   27.97 ? 169  PRO C CD  1 
ATOM   7595  N  N   . GLY C  1 63  ? -5.546  65.736  57.821  1.00   21.18 ? 170  GLY C N   1 
ATOM   7596  C  CA  . GLY C  1 63  ? -5.726  64.311  58.032  1.00   24.96 ? 170  GLY C CA  1 
ATOM   7597  C  C   . GLY C  1 63  ? -4.663  63.441  57.384  1.00   26.86 ? 170  GLY C C   1 
ATOM   7598  O  O   . GLY C  1 63  ? -4.540  62.263  57.720  1.00   23.68 ? 170  GLY C O   1 
ATOM   7599  N  N   . ALA C  1 64  ? -3.903  64.017  56.454  1.00   25.87 ? 171  ALA C N   1 
ATOM   7600  C  CA  . ALA C  1 64  ? -2.832  63.291  55.767  1.00   25.82 ? 171  ALA C CA  1 
ATOM   7601  C  C   . ALA C  1 64  ? -1.492  63.820  56.265  1.00   26.02 ? 171  ALA C C   1 
ATOM   7602  O  O   . ALA C  1 64  ? -0.458  63.602  55.637  1.00   24.52 ? 171  ALA C O   1 
ATOM   7603  C  CB  . ALA C  1 64  ? -2.941  63.505  54.260  1.00   25.03 ? 171  ALA C CB  1 
ATOM   7604  N  N   . SER C  1 65  ? -1.509  64.514  57.401  1.00   26.30 ? 172  SER C N   1 
ATOM   7605  C  CA  . SER C  1 65  ? -0.285  65.108  57.932  1.00   25.22 ? 172  SER C CA  1 
ATOM   7606  C  C   . SER C  1 65  ? -0.015  64.823  59.400  1.00   25.15 ? 172  SER C C   1 
ATOM   7607  O  O   . SER C  1 65  ? -0.914  64.462  60.160  1.00   26.24 ? 172  SER C O   1 
ATOM   7608  C  CB  . SER C  1 65  ? -0.321  66.628  57.738  1.00   24.41 ? 172  SER C CB  1 
ATOM   7609  O  OG  . SER C  1 65  ? -0.713  66.958  56.421  1.00   26.04 ? 172  SER C OG  1 
ATOM   7610  N  N   . PHE C  1 66  ? 1.238   65.010  59.789  1.00   22.77 ? 173  PHE C N   1 
ATOM   7611  C  CA  . PHE C  1 66  ? 1.650   64.805  61.163  1.00   23.26 ? 173  PHE C CA  1 
ATOM   7612  C  C   . PHE C  1 66  ? 3.115   65.186  61.295  1.00   23.39 ? 173  PHE C C   1 
ATOM   7613  O  O   . PHE C  1 66  ? 3.854   65.195  60.304  1.00   24.60 ? 173  PHE C O   1 
ATOM   7614  C  CB  . PHE C  1 66  ? 1.477   63.340  61.564  1.00   23.24 ? 173  PHE C CB  1 
ATOM   7615  C  CG  . PHE C  1 66  ? 1.308   63.145  63.038  1.00   24.18 ? 173  PHE C CG  1 
ATOM   7616  C  CD1 . PHE C  1 66  ? 0.106   63.478  63.655  1.00   22.23 ? 173  PHE C CD1 1 
ATOM   7617  C  CD2 . PHE C  1 66  ? 2.369   62.712  63.821  1.00   21.99 ? 173  PHE C CD2 1 
ATOM   7618  C  CE1 . PHE C  1 66  ? -0.032  63.390  65.042  1.00   23.93 ? 173  PHE C CE1 1 
ATOM   7619  C  CE2 . PHE C  1 66  ? 2.242   62.619  65.202  1.00   27.73 ? 173  PHE C CE2 1 
ATOM   7620  C  CZ  . PHE C  1 66  ? 1.036   62.961  65.816  1.00   24.54 ? 173  PHE C CZ  1 
ATOM   7621  N  N   . ASP C  1 67  ? 3.529   65.526  62.508  1.00   19.25 ? 174  ASP C N   1 
ATOM   7622  C  CA  . ASP C  1 67  ? 4.919   65.862  62.753  1.00   22.04 ? 174  ASP C CA  1 
ATOM   7623  C  C   . ASP C  1 67  ? 5.461   64.767  63.668  1.00   23.31 ? 174  ASP C C   1 
ATOM   7624  O  O   . ASP C  1 67  ? 5.253   64.803  64.881  1.00   24.32 ? 174  ASP C O   1 
ATOM   7625  C  CB  . ASP C  1 67  ? 5.046   67.225  63.441  1.00   22.13 ? 174  ASP C CB  1 
ATOM   7626  C  CG  . ASP C  1 67  ? 6.495   67.610  63.688  1.00   25.80 ? 174  ASP C CG  1 
ATOM   7627  O  OD1 . ASP C  1 67  ? 7.349   66.698  63.676  1.00   25.63 ? 174  ASP C OD1 1 
ATOM   7628  O  OD2 . ASP C  1 67  ? 6.786   68.812  63.902  1.00   26.10 ? 174  ASP C OD2 1 
ATOM   7629  N  N   . VAL C  1 68  ? 6.139   63.786  63.086  1.00   22.61 ? 175  VAL C N   1 
ATOM   7630  C  CA  . VAL C  1 68  ? 6.689   62.679  63.861  1.00   23.42 ? 175  VAL C CA  1 
ATOM   7631  C  C   . VAL C  1 68  ? 7.972   63.079  64.576  1.00   25.96 ? 175  VAL C C   1 
ATOM   7632  O  O   . VAL C  1 68  ? 8.304   62.510  65.615  1.00   27.32 ? 175  VAL C O   1 
ATOM   7633  C  CB  . VAL C  1 68  ? 6.969   61.436  62.950  1.00   20.65 ? 175  VAL C CB  1 
ATOM   7634  C  CG1 . VAL C  1 68  ? 7.598   60.325  63.753  1.00   22.69 ? 175  VAL C CG1 1 
ATOM   7635  C  CG2 . VAL C  1 68  ? 5.692   60.939  62.366  1.00   21.27 ? 175  VAL C CG2 1 
ATOM   7636  N  N   . ASN C  1 69  ? 8.693   64.051  64.023  1.00   24.52 ? 176  ASN C N   1 
ATOM   7637  C  CA  . ASN C  1 69  ? 9.936   64.510  64.636  1.00   27.77 ? 176  ASN C CA  1 
ATOM   7638  C  C   . ASN C  1 69  ? 9.678   65.184  65.993  1.00   31.38 ? 176  ASN C C   1 
ATOM   7639  O  O   . ASN C  1 69  ? 10.408  64.938  66.959  1.00   34.28 ? 176  ASN C O   1 
ATOM   7640  C  CB  . ASN C  1 69  ? 10.669  65.492  63.709  1.00   25.38 ? 176  ASN C CB  1 
ATOM   7641  C  CG  . ASN C  1 69  ? 11.217  64.826  62.464  1.00   27.96 ? 176  ASN C CG  1 
ATOM   7642  O  OD1 . ASN C  1 69  ? 11.145  65.388  61.369  1.00   26.49 ? 176  ASN C OD1 1 
ATOM   7643  N  ND2 . ASN C  1 69  ? 11.783  63.627  62.621  1.00   25.68 ? 176  ASN C ND2 1 
ATOM   7644  N  N   . ASP C  1 70  ? 8.656   66.033  66.068  1.00   31.14 ? 177  ASP C N   1 
ATOM   7645  C  CA  . ASP C  1 70  ? 8.335   66.722  67.322  1.00   33.40 ? 177  ASP C CA  1 
ATOM   7646  C  C   . ASP C  1 70  ? 7.074   66.182  67.990  1.00   34.07 ? 177  ASP C C   1 
ATOM   7647  O  O   . ASP C  1 70  ? 6.626   66.705  69.009  1.00   34.51 ? 177  ASP C O   1 
ATOM   7648  C  CB  . ASP C  1 70  ? 8.158   68.231  67.102  1.00   36.32 ? 177  ASP C CB  1 
ATOM   7649  C  CG  . ASP C  1 70  ? 9.443   68.922  66.700  1.00   40.18 ? 177  ASP C CG  1 
ATOM   7650  O  OD1 . ASP C  1 70  ? 10.527  68.452  67.094  1.00   41.97 ? 177  ASP C OD1 1 
ATOM   7651  O  OD2 . ASP C  1 70  ? 9.368   69.950  65.997  1.00   43.45 ? 177  ASP C OD2 1 
ATOM   7652  N  N   . GLN C  1 71  ? 6.489   65.143  67.410  1.00   33.54 ? 178  GLN C N   1 
ATOM   7653  C  CA  . GLN C  1 71  ? 5.293   64.545  67.981  1.00   34.08 ? 178  GLN C CA  1 
ATOM   7654  C  C   . GLN C  1 71  ? 4.119   65.499  68.178  1.00   34.26 ? 178  GLN C C   1 
ATOM   7655  O  O   . GLN C  1 71  ? 3.689   65.747  69.297  1.00   36.54 ? 178  GLN C O   1 
ATOM   7656  C  CB  . GLN C  1 71  ? 5.623   63.865  69.318  1.00   36.08 ? 178  GLN C CB  1 
ATOM   7657  C  CG  . GLN C  1 71  ? 6.336   62.516  69.183  1.00   37.17 ? 178  GLN C CG  1 
ATOM   7658  C  CD  . GLN C  1 71  ? 7.803   62.644  68.823  1.00   37.26 ? 178  GLN C CD  1 
ATOM   7659  O  OE1 . GLN C  1 71  ? 8.471   61.648  68.545  0.0000 37.22 ? 178  GLN C OE1 1 
ATOM   7660  N  NE2 . GLN C  1 71  ? 8.315   63.868  68.838  0.0000 37.22 ? 178  GLN C NE2 1 
ATOM   7661  N  N   . ASP C  1 72  ? 3.614   66.044  67.083  1.00   35.78 ? 179  ASP C N   1 
ATOM   7662  C  CA  . ASP C  1 72  ? 2.450   66.914  67.120  1.00   32.63 ? 179  ASP C CA  1 
ATOM   7663  C  C   . ASP C  1 72  ? 1.847   66.807  65.728  1.00   32.97 ? 179  ASP C C   1 
ATOM   7664  O  O   . ASP C  1 72  ? 2.489   66.313  64.800  1.00   32.14 ? 179  ASP C O   1 
ATOM   7665  C  CB  . ASP C  1 72  ? 2.821   68.366  67.490  1.00   31.78 ? 179  ASP C CB  1 
ATOM   7666  C  CG  . ASP C  1 72  ? 3.703   69.041  66.462  1.00   29.80 ? 179  ASP C CG  1 
ATOM   7667  O  OD1 . ASP C  1 72  ? 3.216   69.331  65.346  1.00   32.47 ? 179  ASP C OD1 1 
ATOM   7668  O  OD2 . ASP C  1 72  ? 4.883   69.291  66.777  1.00   28.70 ? 179  ASP C OD2 1 
ATOM   7669  N  N   . PRO C  1 73  ? 0.603   67.250  65.560  1.00   32.58 ? 180  PRO C N   1 
ATOM   7670  C  CA  . PRO C  1 73  ? -0.027  67.156  64.246  1.00   32.43 ? 180  PRO C CA  1 
ATOM   7671  C  C   . PRO C  1 73  ? 0.337   68.209  63.212  1.00   31.29 ? 180  PRO C C   1 
ATOM   7672  O  O   . PRO C  1 73  ? -0.101  68.116  62.069  1.00   34.00 ? 180  PRO C O   1 
ATOM   7673  C  CB  . PRO C  1 73  ? -1.510  67.186  64.589  1.00   32.57 ? 180  PRO C CB  1 
ATOM   7674  C  CG  . PRO C  1 73  ? -1.541  68.139  65.715  1.00   33.22 ? 180  PRO C CG  1 
ATOM   7675  C  CD  . PRO C  1 73  ? -0.366  67.700  66.573  1.00   33.70 ? 180  PRO C CD  1 
ATOM   7676  N  N   . ASP C  1 74  ? 1.140   69.195  63.594  1.00   31.23 ? 181  ASP C N   1 
ATOM   7677  C  CA  . ASP C  1 74  ? 1.506   70.280  62.677  1.00   30.16 ? 181  ASP C CA  1 
ATOM   7678  C  C   . ASP C  1 74  ? 2.862   70.073  61.992  1.00   26.77 ? 181  ASP C C   1 
ATOM   7679  O  O   . ASP C  1 74  ? 3.904   70.282  62.592  1.00   28.44 ? 181  ASP C O   1 
ATOM   7680  C  CB  . ASP C  1 74  ? 1.504   71.602  63.445  1.00   31.44 ? 181  ASP C CB  1 
ATOM   7681  C  CG  . ASP C  1 74  ? 1.771   72.788  62.562  1.00   31.42 ? 181  ASP C CG  1 
ATOM   7682  O  OD1 . ASP C  1 74  ? 2.132   72.595  61.383  1.00   33.13 ? 181  ASP C OD1 1 
ATOM   7683  O  OD2 . ASP C  1 74  ? 1.621   73.922  63.056  1.00   37.02 ? 181  ASP C OD2 1 
ATOM   7684  N  N   . PRO C  1 75  ? 2.851   69.703  60.701  1.00   27.89 ? 182  PRO C N   1 
ATOM   7685  C  CA  . PRO C  1 75  ? 4.050   69.450  59.888  1.00   27.15 ? 182  PRO C CA  1 
ATOM   7686  C  C   . PRO C  1 75  ? 4.776   70.670  59.341  1.00   27.69 ? 182  PRO C C   1 
ATOM   7687  O  O   . PRO C  1 75  ? 5.622   70.538  58.453  1.00   29.58 ? 182  PRO C O   1 
ATOM   7688  C  CB  . PRO C  1 75  ? 3.508   68.577  58.767  1.00   24.66 ? 182  PRO C CB  1 
ATOM   7689  C  CG  . PRO C  1 75  ? 2.195   69.233  58.498  1.00   24.26 ? 182  PRO C CG  1 
ATOM   7690  C  CD  . PRO C  1 75  ? 1.634   69.470  59.902  1.00   23.37 ? 182  PRO C CD  1 
ATOM   7691  N  N   . GLN C  1 76  ? 4.450   71.851  59.853  1.00   27.47 ? 183  GLN C N   1 
ATOM   7692  C  CA  . GLN C  1 76  ? 5.094   73.078  59.391  1.00   27.00 ? 183  GLN C CA  1 
ATOM   7693  C  C   . GLN C  1 76  ? 6.612   72.889  59.435  1.00   25.89 ? 183  GLN C C   1 
ATOM   7694  O  O   . GLN C  1 76  ? 7.149   72.368  60.412  1.00   25.82 ? 183  GLN C O   1 
ATOM   7695  C  CB  . GLN C  1 76  ? 4.684   74.244  60.295  1.00   27.72 ? 183  GLN C CB  1 
ATOM   7696  C  CG  . GLN C  1 76  ? 4.935   75.635  59.731  1.00   28.59 ? 183  GLN C CG  1 
ATOM   7697  C  CD  . GLN C  1 76  ? 4.042   75.962  58.551  1.00   27.27 ? 183  GLN C CD  1 
ATOM   7698  O  OE1 . GLN C  1 76  ? 2.946   75.414  58.409  1.00   25.76 ? 183  GLN C OE1 1 
ATOM   7699  N  NE2 . GLN C  1 76  ? 4.498   76.879  57.707  1.00   27.47 ? 183  GLN C NE2 1 
ATOM   7700  N  N   . PRO C  1 77  ? 7.324   73.298  58.371  1.00   24.69 ? 184  PRO C N   1 
ATOM   7701  C  CA  . PRO C  1 77  ? 8.787   73.152  58.341  1.00   26.15 ? 184  PRO C CA  1 
ATOM   7702  C  C   . PRO C  1 77  ? 9.453   74.044  59.384  1.00   27.55 ? 184  PRO C C   1 
ATOM   7703  O  O   . PRO C  1 77  ? 8.879   75.047  59.809  1.00   28.73 ? 184  PRO C O   1 
ATOM   7704  C  CB  . PRO C  1 77  ? 9.160   73.597  56.927  1.00   25.89 ? 184  PRO C CB  1 
ATOM   7705  C  CG  . PRO C  1 77  ? 7.898   73.397  56.143  1.00   23.87 ? 184  PRO C CG  1 
ATOM   7706  C  CD  . PRO C  1 77  ? 6.821   73.813  57.090  1.00   21.18 ? 184  PRO C CD  1 
ATOM   7707  N  N   . ARG C  1 78  ? 10.661  73.672  59.794  1.00   27.94 ? 185  ARG C N   1 
ATOM   7708  C  CA  . ARG C  1 78  ? 11.424  74.463  60.750  1.00   27.76 ? 185  ARG C CA  1 
ATOM   7709  C  C   . ARG C  1 78  ? 12.268  75.420  59.906  1.00   27.99 ? 185  ARG C C   1 
ATOM   7710  O  O   . ARG C  1 78  ? 13.109  74.992  59.107  1.00   26.69 ? 185  ARG C O   1 
ATOM   7711  C  CB  . ARG C  1 78  ? 12.327  73.554  61.592  1.00   28.28 ? 185  ARG C CB  1 
ATOM   7712  C  CG  . ARG C  1 78  ? 13.266  74.283  62.542  1.00   29.02 ? 185  ARG C CG  1 
ATOM   7713  C  CD  . ARG C  1 78  ? 14.057  73.286  63.369  1.00   27.42 ? 185  ARG C CD  1 
ATOM   7714  N  NE  . ARG C  1 78  ? 14.823  72.380  62.522  1.00   25.58 ? 185  ARG C NE  1 
ATOM   7715  C  CZ  . ARG C  1 78  ? 16.069  72.598  62.116  1.00   25.19 ? 185  ARG C CZ  1 
ATOM   7716  N  NH1 . ARG C  1 78  ? 16.677  71.712  61.337  1.00   21.25 ? 185  ARG C NH1 1 
ATOM   7717  N  NH2 . ARG C  1 78  ? 16.719  73.688  62.501  1.00   22.01 ? 185  ARG C NH2 1 
ATOM   7718  N  N   . TYR C  1 79  ? 12.045  76.716  60.074  1.00   29.44 ? 186  TYR C N   1 
ATOM   7719  C  CA  . TYR C  1 79  ? 12.776  77.703  59.289  1.00   29.53 ? 186  TYR C CA  1 
ATOM   7720  C  C   . TYR C  1 79  ? 14.178  77.991  59.780  1.00   31.17 ? 186  TYR C C   1 
ATOM   7721  O  O   . TYR C  1 79  ? 14.409  78.137  60.981  1.00   35.28 ? 186  TYR C O   1 
ATOM   7722  C  CB  . TYR C  1 79  ? 11.982  79.007  59.216  1.00   27.72 ? 186  TYR C CB  1 
ATOM   7723  C  CG  . TYR C  1 79  ? 10.642  78.827  58.551  1.00   27.70 ? 186  TYR C CG  1 
ATOM   7724  C  CD1 . TYR C  1 79  ? 9.532   78.397  59.275  1.00   25.43 ? 186  TYR C CD1 1 
ATOM   7725  C  CD2 . TYR C  1 79  ? 10.503  79.012  57.175  1.00   24.84 ? 186  TYR C CD2 1 
ATOM   7726  C  CE1 . TYR C  1 79  ? 8.317   78.150  58.642  1.00   25.34 ? 186  TYR C CE1 1 
ATOM   7727  C  CE2 . TYR C  1 79  ? 9.300   78.767  56.537  1.00   21.74 ? 186  TYR C CE2 1 
ATOM   7728  C  CZ  . TYR C  1 79  ? 8.211   78.335  57.270  1.00   23.94 ? 186  TYR C CZ  1 
ATOM   7729  O  OH  . TYR C  1 79  ? 7.022   78.075  56.624  1.00   26.53 ? 186  TYR C OH  1 
ATOM   7730  N  N   . THR C  1 80  ? 15.112  78.066  58.837  1.00   29.34 ? 187  THR C N   1 
ATOM   7731  C  CA  . THR C  1 80  ? 16.508  78.356  59.133  1.00   31.16 ? 187  THR C CA  1 
ATOM   7732  C  C   . THR C  1 80  ? 17.047  79.228  58.001  1.00   33.26 ? 187  THR C C   1 
ATOM   7733  O  O   . THR C  1 80  ? 16.484  79.250  56.910  1.00   35.35 ? 187  THR C O   1 
ATOM   7734  C  CB  . THR C  1 80  ? 17.357  77.063  59.222  1.00   32.49 ? 187  THR C CB  1 
ATOM   7735  O  OG1 . THR C  1 80  ? 17.455  76.454  57.928  1.00   30.50 ? 187  THR C OG1 1 
ATOM   7736  C  CG2 . THR C  1 80  ? 16.714  76.072  60.187  1.00   30.15 ? 187  THR C CG2 1 
ATOM   7737  N  N   . GLN C  1 81  ? 18.135  79.940  58.263  1.00   36.37 ? 188  GLN C N   1 
ATOM   7738  C  CA  . GLN C  1 81  ? 18.754  80.829  57.277  1.00   38.61 ? 188  GLN C CA  1 
ATOM   7739  C  C   . GLN C  1 81  ? 19.119  80.080  55.993  1.00   38.06 ? 188  GLN C C   1 
ATOM   7740  O  O   . GLN C  1 81  ? 19.033  80.621  54.897  1.00   39.13 ? 188  GLN C O   1 
ATOM   7741  C  CB  . GLN C  1 81  ? 20.012  81.464  57.887  1.00   39.70 ? 188  GLN C CB  1 
ATOM   7742  C  CG  . GLN C  1 81  ? 20.532  82.725  57.211  1.00   45.40 ? 188  GLN C CG  1 
ATOM   7743  C  CD  . GLN C  1 81  ? 20.386  83.973  58.071  1.00   41.55 ? 188  GLN C CD  1 
ATOM   7744  O  OE1 . GLN C  1 81  ? 19.317  84.582  58.123  0.0000 43.07 ? 188  GLN C OE1 1 
ATOM   7745  N  NE2 . GLN C  1 81  ? 21.460  84.349  58.757  0.0000 43.07 ? 188  GLN C NE2 1 
ATOM   7746  N  N   . MET C  1 82  ? 19.530  78.829  56.128  1.00   39.09 ? 189  MET C N   1 
ATOM   7747  C  CA  . MET C  1 82  ? 19.906  78.042  54.962  1.00   38.86 ? 189  MET C CA  1 
ATOM   7748  C  C   . MET C  1 82  ? 18.720  77.412  54.245  1.00   35.63 ? 189  MET C C   1 
ATOM   7749  O  O   . MET C  1 82  ? 18.885  76.830  53.183  1.00   34.51 ? 189  MET C O   1 
ATOM   7750  C  CB  . MET C  1 82  ? 20.889  76.945  55.366  1.00   42.68 ? 189  MET C CB  1 
ATOM   7751  C  CG  . MET C  1 82  ? 22.303  77.430  55.635  1.00   49.65 ? 189  MET C CG  1 
ATOM   7752  S  SD  . MET C  1 82  ? 23.323  76.083  56.288  1.00   60.90 ? 189  MET C SD  1 
ATOM   7753  C  CE  . MET C  1 82  ? 23.894  75.273  54.738  1.00   56.97 ? 189  MET C CE  1 
ATOM   7754  N  N   . ASN C  1 83  ? 17.530  77.527  54.825  1.00   35.99 ? 190  ASN C N   1 
ATOM   7755  C  CA  . ASN C  1 83  ? 16.326  76.946  54.222  1.00   34.89 ? 190  ASN C CA  1 
ATOM   7756  C  C   . ASN C  1 83  ? 16.497  75.437  53.995  1.00   33.52 ? 190  ASN C C   1 
ATOM   7757  O  O   . ASN C  1 83  ? 16.127  74.903  52.943  1.00   29.11 ? 190  ASN C O   1 
ATOM   7758  C  CB  . ASN C  1 83  ? 16.018  77.635  52.891  1.00   33.64 ? 190  ASN C CB  1 
ATOM   7759  C  CG  . ASN C  1 83  ? 15.668  79.100  53.060  1.00   37.12 ? 190  ASN C CG  1 
ATOM   7760  O  OD1 . ASN C  1 83  ? 14.725  79.448  53.772  1.00   35.97 ? 190  ASN C OD1 1 
ATOM   7761  N  ND2 . ASN C  1 83  ? 16.428  79.970  52.402  1.00   37.15 ? 190  ASN C ND2 1 
ATOM   7762  N  N   . ASP C  1 84  ? 17.055  74.762  54.995  1.00   33.09 ? 191  ASP C N   1 
ATOM   7763  C  CA  . ASP C  1 84  ? 17.301  73.323  54.936  1.00   32.71 ? 191  ASP C CA  1 
ATOM   7764  C  C   . ASP C  1 84  ? 16.033  72.498  54.743  1.00   32.24 ? 191  ASP C C   1 
ATOM   7765  O  O   . ASP C  1 84  ? 16.037  71.484  54.039  1.00   33.20 ? 191  ASP C O   1 
ATOM   7766  C  CB  . ASP C  1 84  ? 17.960  72.843  56.231  1.00   36.49 ? 191  ASP C CB  1 
ATOM   7767  C  CG  . ASP C  1 84  ? 19.122  73.698  56.646  1.00   39.43 ? 191  ASP C CG  1 
ATOM   7768  O  OD1 . ASP C  1 84  ? 18.904  74.870  57.018  1.00   41.84 ? 191  ASP C OD1 1 
ATOM   7769  O  OD2 . ASP C  1 84  ? 20.258  73.190  56.597  1.00   43.04 ? 191  ASP C OD2 1 
ATOM   7770  N  N   . ASN C  1 85  ? 14.952  72.927  55.382  1.00   28.83 ? 192  ASN C N   1 
ATOM   7771  C  CA  . ASN C  1 85  ? 13.705  72.190  55.318  1.00   26.26 ? 192  ASN C CA  1 
ATOM   7772  C  C   . ASN C  1 85  ? 12.697  72.641  54.266  1.00   27.73 ? 192  ASN C C   1 
ATOM   7773  O  O   . ASN C  1 85  ? 11.496  72.694  54.530  1.00   29.99 ? 192  ASN C O   1 
ATOM   7774  C  CB  . ASN C  1 85  ? 13.085  72.194  56.710  1.00   24.61 ? 192  ASN C CB  1 
ATOM   7775  C  CG  . ASN C  1 85  ? 14.048  71.645  57.761  1.00   26.86 ? 192  ASN C CG  1 
ATOM   7776  O  OD1 . ASN C  1 85  ? 14.512  70.509  57.651  1.00   23.48 ? 192  ASN C OD1 1 
ATOM   7777  N  ND2 . ASN C  1 85  ? 14.368  72.457  58.770  1.00   25.71 ? 192  ASN C ND2 1 
ATOM   7778  N  N   . ARG C  1 86  ? 13.185  72.926  53.063  1.00   26.05 ? 193  ARG C N   1 
ATOM   7779  C  CA  . ARG C  1 86  ? 12.326  73.364  51.963  1.00   25.82 ? 193  ARG C CA  1 
ATOM   7780  C  C   . ARG C  1 86  ? 11.996  72.198  51.035  1.00   25.38 ? 193  ARG C C   1 
ATOM   7781  O  O   . ARG C  1 86  ? 11.145  72.311  50.147  1.00   23.80 ? 193  ARG C O   1 
ATOM   7782  C  CB  . ARG C  1 86  ? 13.053  74.421  51.144  1.00   24.30 ? 193  ARG C CB  1 
ATOM   7783  C  CG  . ARG C  1 86  ? 14.264  73.851  50.467  1.00   25.22 ? 193  ARG C CG  1 
ATOM   7784  C  CD  . ARG C  1 86  ? 15.042  74.911  49.764  1.00   28.86 ? 193  ARG C CD  1 
ATOM   7785  N  NE  . ARG C  1 86  ? 16.054  74.323  48.904  1.00   33.55 ? 193  ARG C NE  1 
ATOM   7786  C  CZ  . ARG C  1 86  ? 16.940  75.035  48.221  1.00   41.57 ? 193  ARG C CZ  1 
ATOM   7787  N  NH1 . ARG C  1 86  ? 16.935  76.369  48.314  1.00   43.19 ? 193  ARG C NH1 1 
ATOM   7788  N  NH2 . ARG C  1 86  ? 17.811  74.418  47.427  1.00   39.60 ? 193  ARG C NH2 1 
ATOM   7789  N  N   . HIS C  1 87  ? 12.689  71.084  51.249  1.00   23.66 ? 194  HIS C N   1 
ATOM   7790  C  CA  . HIS C  1 87  ? 12.555  69.898  50.420  1.00   21.94 ? 194  HIS C CA  1 
ATOM   7791  C  C   . HIS C  1 87  ? 11.159  69.308  50.321  1.00   21.15 ? 194  HIS C C   1 
ATOM   7792  O  O   . HIS C  1 87  ? 10.670  69.063  49.218  1.00   23.54 ? 194  HIS C O   1 
ATOM   7793  C  CB  . HIS C  1 87  ? 13.569  68.845  50.898  1.00   21.99 ? 194  HIS C CB  1 
ATOM   7794  C  CG  . HIS C  1 87  ? 13.768  67.700  49.950  1.00   18.07 ? 194  HIS C CG  1 
ATOM   7795  N  ND1 . HIS C  1 87  ? 13.189  66.464  50.144  1.00   18.94 ? 194  HIS C ND1 1 
ATOM   7796  C  CD2 . HIS C  1 87  ? 14.546  67.580  48.846  1.00   19.01 ? 194  HIS C CD2 1 
ATOM   7797  C  CE1 . HIS C  1 87  ? 13.605  65.628  49.206  1.00   19.35 ? 194  HIS C CE1 1 
ATOM   7798  N  NE2 . HIS C  1 87  ? 14.430  66.280  48.405  1.00   18.20 ? 194  HIS C NE2 1 
ATOM   7799  N  N   . GLY C  1 88  ? 10.510  69.081  51.455  1.00   21.05 ? 195  GLY C N   1 
ATOM   7800  C  CA  . GLY C  1 88  ? 9.174   68.511  51.426  1.00   17.42 ? 195  GLY C CA  1 
ATOM   7801  C  C   . GLY C  1 88  ? 8.158   69.399  50.727  1.00   21.39 ? 195  GLY C C   1 
ATOM   7802  O  O   . GLY C  1 88  ? 7.274   68.921  50.010  1.00   21.59 ? 195  GLY C O   1 
ATOM   7803  N  N   . THR C  1 89  ? 8.278   70.701  50.939  1.00   19.97 ? 196  THR C N   1 
ATOM   7804  C  CA  . THR C  1 89  ? 7.363   71.655  50.336  1.00   19.56 ? 196  THR C CA  1 
ATOM   7805  C  C   . THR C  1 89  ? 7.514   71.638  48.816  1.00   18.74 ? 196  THR C C   1 
ATOM   7806  O  O   . THR C  1 89  ? 6.527   71.737  48.085  1.00   21.57 ? 196  THR C O   1 
ATOM   7807  C  CB  . THR C  1 89  ? 7.626   73.073  50.915  1.00   22.85 ? 196  THR C CB  1 
ATOM   7808  O  OG1 . THR C  1 89  ? 7.275   73.070  52.306  1.00   23.41 ? 196  THR C OG1 1 
ATOM   7809  C  CG2 . THR C  1 89  ? 6.805   74.138  50.187  1.00   24.14 ? 196  THR C CG2 1 
ATOM   7810  N  N   . ARG C  1 90  ? 8.743   71.491  48.338  1.00   15.55 ? 197  ARG C N   1 
ATOM   7811  C  CA  . ARG C  1 90  ? 8.966   71.447  46.903  1.00   18.80 ? 197  ARG C CA  1 
ATOM   7812  C  C   . ARG C  1 90  ? 8.315   70.204  46.304  1.00   20.96 ? 197  ARG C C   1 
ATOM   7813  O  O   . ARG C  1 90  ? 7.669   70.280  45.250  1.00   21.20 ? 197  ARG C O   1 
ATOM   7814  C  CB  . ARG C  1 90  ? 10.467  71.461  46.591  1.00   18.74 ? 197  ARG C CB  1 
ATOM   7815  C  CG  . ARG C  1 90  ? 11.153  72.773  46.959  1.00   17.97 ? 197  ARG C CG  1 
ATOM   7816  C  CD  . ARG C  1 90  ? 12.598  72.827  46.492  1.00   19.45 ? 197  ARG C CD  1 
ATOM   7817  N  NE  . ARG C  1 90  ? 13.089  74.196  46.526  1.00   21.24 ? 197  ARG C NE  1 
ATOM   7818  C  CZ  . ARG C  1 90  ? 14.218  74.610  45.957  1.00   26.45 ? 197  ARG C CZ  1 
ATOM   7819  N  NH1 . ARG C  1 90  ? 14.578  75.891  46.040  1.00   22.38 ? 197  ARG C NH1 1 
ATOM   7820  N  NH2 . ARG C  1 90  ? 14.993  73.746  45.310  1.00   26.61 ? 197  ARG C NH2 1 
ATOM   7821  N  N   . CYS C  1 91  ? 8.464   69.068  46.983  1.00   18.39 ? 198  CYS C N   1 
ATOM   7822  C  CA  . CYS C  1 91  ? 7.874   67.817  46.503  1.00   19.73 ? 198  CYS C CA  1 
ATOM   7823  C  C   . CYS C  1 91  ? 6.342   67.881  46.521  1.00   18.72 ? 198  CYS C C   1 
ATOM   7824  O  O   . CYS C  1 91  ? 5.676   67.408  45.597  1.00   19.83 ? 198  CYS C O   1 
ATOM   7825  C  CB  . CYS C  1 91  ? 8.386   66.638  47.346  1.00   17.09 ? 198  CYS C CB  1 
ATOM   7826  S  SG  . CYS C  1 91  ? 10.182  66.294  47.123  1.00   20.46 ? 198  CYS C SG  1 
ATOM   7827  N  N   . ALA C  1 92  ? 5.790   68.483  47.567  1.00   18.06 ? 199  ALA C N   1 
ATOM   7828  C  CA  . ALA C  1 92  ? 4.346   68.624  47.692  1.00   17.98 ? 199  ALA C CA  1 
ATOM   7829  C  C   . ALA C  1 92  ? 3.737   69.375  46.496  1.00   19.02 ? 199  ALA C C   1 
ATOM   7830  O  O   . ALA C  1 92  ? 2.714   68.961  45.944  1.00   19.80 ? 199  ALA C O   1 
ATOM   7831  C  CB  . ALA C  1 92  ? 4.017   69.362  48.977  1.00   15.49 ? 199  ALA C CB  1 
ATOM   7832  N  N   . GLY C  1 93  ? 4.366   70.475  46.102  1.00   15.27 ? 200  GLY C N   1 
ATOM   7833  C  CA  . GLY C  1 93  ? 3.838   71.263  45.004  1.00   16.61 ? 200  GLY C CA  1 
ATOM   7834  C  C   . GLY C  1 93  ? 3.789   70.518  43.683  1.00   18.69 ? 200  GLY C C   1 
ATOM   7835  O  O   . GLY C  1 93  ? 2.919   70.764  42.841  1.00   16.16 ? 200  GLY C O   1 
ATOM   7836  N  N   . GLU C  1 94  ? 4.728   69.604  43.491  1.00   16.84 ? 201  GLU C N   1 
ATOM   7837  C  CA  . GLU C  1 94  ? 4.766   68.839  42.254  1.00   18.59 ? 201  GLU C CA  1 
ATOM   7838  C  C   . GLU C  1 94  ? 3.521   67.995  42.130  1.00   19.29 ? 201  GLU C C   1 
ATOM   7839  O  O   . GLU C  1 94  ? 2.973   67.811  41.038  1.00   20.58 ? 201  GLU C O   1 
ATOM   7840  C  CB  . GLU C  1 94  ? 5.960   67.910  42.242  1.00   18.79 ? 201  GLU C CB  1 
ATOM   7841  C  CG  . GLU C  1 94  ? 7.310   68.578  42.295  1.00   16.63 ? 201  GLU C CG  1 
ATOM   7842  C  CD  . GLU C  1 94  ? 8.399   67.531  42.211  1.00   20.79 ? 201  GLU C CD  1 
ATOM   7843  O  OE1 . GLU C  1 94  ? 9.027   67.202  43.244  1.00   17.25 ? 201  GLU C OE1 1 
ATOM   7844  O  OE2 . GLU C  1 94  ? 8.589   67.010  41.099  1.00   17.25 ? 201  GLU C OE2 1 
ATOM   7845  N  N   . VAL C  1 95  ? 3.078   67.475  43.265  1.00   19.15 ? 202  VAL C N   1 
ATOM   7846  C  CA  . VAL C  1 95  ? 1.908   66.624  43.282  1.00   17.58 ? 202  VAL C CA  1 
ATOM   7847  C  C   . VAL C  1 95  ? 0.591   67.373  43.205  1.00   19.84 ? 202  VAL C C   1 
ATOM   7848  O  O   . VAL C  1 95  ? -0.262  67.055  42.372  1.00   18.40 ? 202  VAL C O   1 
ATOM   7849  C  CB  . VAL C  1 95  ? 1.857   65.763  44.554  1.00   16.54 ? 202  VAL C CB  1 
ATOM   7850  C  CG1 . VAL C  1 95  ? 0.615   64.887  44.518  1.00   18.24 ? 202  VAL C CG1 1 
ATOM   7851  C  CG2 . VAL C  1 95  ? 3.116   64.900  44.678  1.00   10.32 ? 202  VAL C CG2 1 
ATOM   7852  N  N   . ALA C  1 96  ? 0.426   68.377  44.060  1.00   17.80 ? 203  ALA C N   1 
ATOM   7853  C  CA  . ALA C  1 96  ? -0.849  69.063  44.105  1.00   20.29 ? 203  ALA C CA  1 
ATOM   7854  C  C   . ALA C  1 96  ? -0.889  70.571  44.280  1.00   20.08 ? 203  ALA C C   1 
ATOM   7855  O  O   . ALA C  1 96  ? -1.747  71.076  45.005  1.00   19.91 ? 203  ALA C O   1 
ATOM   7856  C  CB  . ALA C  1 96  ? -1.718  68.409  45.187  1.00   17.57 ? 203  ALA C CB  1 
ATOM   7857  N  N   . ALA C  1 97  ? 0.015   71.301  43.638  1.00   20.41 ? 204  ALA C N   1 
ATOM   7858  C  CA  . ALA C  1 97  ? -0.046  72.757  43.748  1.00   21.44 ? 204  ALA C CA  1 
ATOM   7859  C  C   . ALA C  1 97  ? -1.408  73.173  43.153  1.00   21.66 ? 204  ALA C C   1 
ATOM   7860  O  O   . ALA C  1 97  ? -1.865  72.590  42.163  1.00   19.81 ? 204  ALA C O   1 
ATOM   7861  C  CB  . ALA C  1 97  ? 1.091   73.397  42.973  1.00   18.27 ? 204  ALA C CB  1 
ATOM   7862  N  N   . VAL C  1 98  ? -2.056  74.160  43.767  1.00   20.97 ? 205  VAL C N   1 
ATOM   7863  C  CA  . VAL C  1 98  ? -3.359  74.636  43.294  1.00   19.94 ? 205  VAL C CA  1 
ATOM   7864  C  C   . VAL C  1 98  ? -3.312  75.212  41.870  1.00   19.23 ? 205  VAL C C   1 
ATOM   7865  O  O   . VAL C  1 98  ? -2.347  75.885  41.485  1.00   16.98 ? 205  VAL C O   1 
ATOM   7866  C  CB  . VAL C  1 98  ? -3.932  75.677  44.283  1.00   21.04 ? 205  VAL C CB  1 
ATOM   7867  C  CG1 . VAL C  1 98  ? -5.236  76.257  43.767  1.00   13.71 ? 205  VAL C CG1 1 
ATOM   7868  C  CG2 . VAL C  1 98  ? -4.168  75.003  45.644  1.00   17.62 ? 205  VAL C CG2 1 
ATOM   7869  N  N   . ALA C  1 99  ? -4.350  74.928  41.087  1.00   17.01 ? 206  ALA C N   1 
ATOM   7870  C  CA  . ALA C  1 99  ? -4.417  75.410  39.702  1.00   20.52 ? 206  ALA C CA  1 
ATOM   7871  C  C   . ALA C  1 99  ? -5.304  76.636  39.504  1.00   19.70 ? 206  ALA C C   1 
ATOM   7872  O  O   . ALA C  1 99  ? -6.227  76.875  40.281  1.00   21.49 ? 206  ALA C O   1 
ATOM   7873  C  CB  . ALA C  1 99  ? -4.905  74.299  38.785  1.00   17.64 ? 206  ALA C CB  1 
ATOM   7874  N  N   . ASN C  1 100 ? -5.014  77.393  38.448  1.00   18.86 ? 207  ASN C N   1 
ATOM   7875  C  CA  . ASN C  1 100 ? -5.785  78.580  38.093  1.00   20.88 ? 207  ASN C CA  1 
ATOM   7876  C  C   . ASN C  1 100 ? -5.984  79.572  39.231  1.00   21.65 ? 207  ASN C C   1 
ATOM   7877  O  O   . ASN C  1 100 ? -7.081  80.089  39.417  1.00   19.97 ? 207  ASN C O   1 
ATOM   7878  C  CB  . ASN C  1 100 ? -7.144  78.138  37.552  1.00   18.83 ? 207  ASN C CB  1 
ATOM   7879  C  CG  . ASN C  1 100 ? -7.003  77.214  36.352  1.00   21.82 ? 207  ASN C CG  1 
ATOM   7880  O  OD1 . ASN C  1 100 ? -6.348  77.564  35.365  1.00   22.21 ? 207  ASN C OD1 1 
ATOM   7881  N  ND2 . ASN C  1 100 ? -7.599  76.026  36.434  1.00   17.76 ? 207  ASN C ND2 1 
ATOM   7882  N  N   . ASN C  1 101 ? -4.927  79.846  39.986  1.00   23.47 ? 208  ASN C N   1 
ATOM   7883  C  CA  . ASN C  1 101 ? -5.040  80.770  41.104  1.00   23.42 ? 208  ASN C CA  1 
ATOM   7884  C  C   . ASN C  1 101 ? -3.995  81.875  41.021  1.00   24.60 ? 208  ASN C C   1 
ATOM   7885  O  O   . ASN C  1 101 ? -3.675  82.508  42.022  1.00   28.40 ? 208  ASN C O   1 
ATOM   7886  C  CB  . ASN C  1 101 ? -4.914  79.996  42.425  1.00   23.14 ? 208  ASN C CB  1 
ATOM   7887  C  CG  . ASN C  1 101 ? -3.508  79.475  42.666  1.00   21.64 ? 208  ASN C CG  1 
ATOM   7888  O  OD1 . ASN C  1 101 ? -2.762  79.219  41.728  1.00   19.26 ? 208  ASN C OD1 1 
ATOM   7889  N  ND2 . ASN C  1 101 ? -3.143  79.319  43.936  1.00   24.48 ? 208  ASN C ND2 1 
ATOM   7890  N  N   . GLY C  1 102 ? -3.464  82.094  39.820  1.00   23.26 ? 209  GLY C N   1 
ATOM   7891  C  CA  . GLY C  1 102 ? -2.480  83.142  39.610  1.00   19.54 ? 209  GLY C CA  1 
ATOM   7892  C  C   . GLY C  1 102 ? -1.195  83.001  40.392  1.00   21.93 ? 209  GLY C C   1 
ATOM   7893  O  O   . GLY C  1 102 ? -0.423  83.949  40.489  1.00   19.61 ? 209  GLY C O   1 
ATOM   7894  N  N   . VAL C  1 103 ? -0.947  81.812  40.933  1.00   24.18 ? 210  VAL C N   1 
ATOM   7895  C  CA  . VAL C  1 103 ? 0.266   81.580  41.712  1.00   21.97 ? 210  VAL C CA  1 
ATOM   7896  C  C   . VAL C  1 103 ? 1.117   80.434  41.177  1.00   20.32 ? 210  VAL C C   1 
ATOM   7897  O  O   . VAL C  1 103 ? 0.618   79.334  40.939  1.00   15.87 ? 210  VAL C O   1 
ATOM   7898  C  CB  . VAL C  1 103 ? -0.079  81.258  43.180  1.00   23.50 ? 210  VAL C CB  1 
ATOM   7899  C  CG1 . VAL C  1 103 ? 1.188   81.056  43.971  1.00   20.42 ? 210  VAL C CG1 1 
ATOM   7900  C  CG2 . VAL C  1 103 ? -0.949  82.371  43.783  1.00   22.74 ? 210  VAL C CG2 1 
ATOM   7901  N  N   . CYS C  1 104 ? 2.399   80.717  40.977  1.00   21.75 ? 211  CYS C N   1 
ATOM   7902  C  CA  . CYS C  1 104 ? 3.368   79.724  40.533  1.00   24.74 ? 211  CYS C CA  1 
ATOM   7903  C  C   . CYS C  1 104 ? 2.822   78.833  39.401  1.00   26.01 ? 211  CYS C C   1 
ATOM   7904  O  O   . CYS C  1 104 ? 2.327   79.339  38.385  1.00   25.12 ? 211  CYS C O   1 
ATOM   7905  C  CB  . CYS C  1 104 ? 3.760   78.900  41.766  1.00   28.56 ? 211  CYS C CB  1 
ATOM   7906  S  SG  . CYS C  1 104 ? 5.365   78.030  41.799  1.00   35.01 ? 211  CYS C SG  1 
ATOM   7907  N  N   . GLY C  1 105 ? 2.913   77.513  39.577  1.00   24.04 ? 212  GLY C N   1 
ATOM   7908  C  CA  . GLY C  1 105 ? 2.432   76.589  38.560  1.00   19.19 ? 212  GLY C CA  1 
ATOM   7909  C  C   . GLY C  1 105 ? 1.289   75.739  39.073  1.00   18.79 ? 212  GLY C C   1 
ATOM   7910  O  O   . GLY C  1 105 ? 0.451   76.229  39.829  1.00   19.84 ? 212  GLY C O   1 
ATOM   7911  N  N   . VAL C  1 106 ? 1.243   74.476  38.654  1.00   16.90 ? 213  VAL C N   1 
ATOM   7912  C  CA  . VAL C  1 106 ? 0.201   73.555  39.100  1.00   16.84 ? 213  VAL C CA  1 
ATOM   7913  C  C   . VAL C  1 106 ? 0.775   72.162  39.388  1.00   17.22 ? 213  VAL C C   1 
ATOM   7914  O  O   . VAL C  1 106 ? 1.828   71.797  38.883  1.00   18.59 ? 213  VAL C O   1 
ATOM   7915  C  CB  . VAL C  1 106 ? -0.933  73.393  38.043  1.00   15.65 ? 213  VAL C CB  1 
ATOM   7916  C  CG1 . VAL C  1 106 ? -1.420  74.759  37.579  1.00   15.68 ? 213  VAL C CG1 1 
ATOM   7917  C  CG2 . VAL C  1 106 ? -0.449  72.547  36.866  1.00   16.63 ? 213  VAL C CG2 1 
ATOM   7918  N  N   . GLY C  1 107 ? 0.082   71.392  40.216  1.00   18.37 ? 214  GLY C N   1 
ATOM   7919  C  CA  . GLY C  1 107 ? 0.540   70.046  40.504  1.00   17.65 ? 214  GLY C CA  1 
ATOM   7920  C  C   . GLY C  1 107 ? -0.045  69.111  39.460  1.00   17.32 ? 214  GLY C C   1 
ATOM   7921  O  O   . GLY C  1 107 ? -0.965  69.495  38.735  1.00   18.70 ? 214  GLY C O   1 
ATOM   7922  N  N   . VAL C  1 108 ? 0.489   67.900  39.362  1.00   15.67 ? 215  VAL C N   1 
ATOM   7923  C  CA  . VAL C  1 108 ? -0.010  66.920  38.407  1.00   16.05 ? 215  VAL C CA  1 
ATOM   7924  C  C   . VAL C  1 108 ? -1.472  66.628  38.729  1.00   17.20 ? 215  VAL C C   1 
ATOM   7925  O  O   . VAL C  1 108 ? -2.314  66.543  37.837  1.00   17.67 ? 215  VAL C O   1 
ATOM   7926  C  CB  . VAL C  1 108 ? 0.801   65.605  38.495  1.00   16.75 ? 215  VAL C CB  1 
ATOM   7927  C  CG1 . VAL C  1 108 ? 0.106   64.502  37.702  1.00   15.71 ? 215  VAL C CG1 1 
ATOM   7928  C  CG2 . VAL C  1 108 ? 2.206   65.835  37.976  1.00   18.74 ? 215  VAL C CG2 1 
ATOM   7929  N  N   . ALA C  1 109 ? -1.763  66.468  40.017  1.00   16.38 ? 216  ALA C N   1 
ATOM   7930  C  CA  . ALA C  1 109 ? -3.124  66.208  40.488  1.00   16.37 ? 216  ALA C CA  1 
ATOM   7931  C  C   . ALA C  1 109 ? -3.546  67.458  41.273  1.00   18.68 ? 216  ALA C C   1 
ATOM   7932  O  O   . ALA C  1 109 ? -3.637  67.435  42.508  1.00   18.97 ? 216  ALA C O   1 
ATOM   7933  C  CB  . ALA C  1 109 ? -3.131  64.985  41.396  1.00   15.38 ? 216  ALA C CB  1 
ATOM   7934  N  N   . TYR C  1 110 ? -3.811  68.548  40.552  1.00   16.51 ? 217  TYR C N   1 
ATOM   7935  C  CA  . TYR C  1 110 ? -4.159  69.799  41.200  1.00   20.72 ? 217  TYR C CA  1 
ATOM   7936  C  C   . TYR C  1 110 ? -5.461  69.855  41.996  1.00   20.54 ? 217  TYR C C   1 
ATOM   7937  O  O   . TYR C  1 110 ? -5.734  70.855  42.651  1.00   24.39 ? 217  TYR C O   1 
ATOM   7938  C  CB  . TYR C  1 110 ? -4.061  70.973  40.199  1.00   20.99 ? 217  TYR C CB  1 
ATOM   7939  C  CG  . TYR C  1 110 ? -4.907  70.903  38.938  1.00   22.30 ? 217  TYR C CG  1 
ATOM   7940  C  CD1 . TYR C  1 110 ? -6.277  71.139  38.982  1.00   22.40 ? 217  TYR C CD1 1 
ATOM   7941  C  CD2 . TYR C  1 110 ? -4.312  70.691  37.688  1.00   20.78 ? 217  TYR C CD2 1 
ATOM   7942  C  CE1 . TYR C  1 110 ? -7.041  71.181  37.812  1.00   25.47 ? 217  TYR C CE1 1 
ATOM   7943  C  CE2 . TYR C  1 110 ? -5.057  70.731  36.518  1.00   25.25 ? 217  TYR C CE2 1 
ATOM   7944  C  CZ  . TYR C  1 110 ? -6.425  70.982  36.584  1.00   28.15 ? 217  TYR C CZ  1 
ATOM   7945  O  OH  . TYR C  1 110 ? -7.170  71.067  35.424  1.00   30.96 ? 217  TYR C OH  1 
ATOM   7946  N  N   . ASN C  1 111 ? -6.258  68.794  41.959  1.00   19.07 ? 218  ASN C N   1 
ATOM   7947  C  CA  . ASN C  1 111 ? -7.481  68.770  42.756  1.00   20.08 ? 218  ASN C CA  1 
ATOM   7948  C  C   . ASN C  1 111 ? -7.396  67.725  43.868  1.00   19.78 ? 218  ASN C C   1 
ATOM   7949  O  O   . ASN C  1 111 ? -8.361  67.486  44.588  1.00   22.12 ? 218  ASN C O   1 
ATOM   7950  C  CB  . ASN C  1 111 ? -8.711  68.520  41.883  1.00   20.91 ? 218  ASN C CB  1 
ATOM   7951  C  CG  . ASN C  1 111 ? -9.152  69.770  41.148  1.00   25.38 ? 218  ASN C CG  1 
ATOM   7952  O  OD1 . ASN C  1 111 ? -9.102  70.863  41.704  1.00   25.23 ? 218  ASN C OD1 1 
ATOM   7953  N  ND2 . ASN C  1 111 ? -9.587  69.619  39.899  1.00   25.60 ? 218  ASN C ND2 1 
ATOM   7954  N  N   . ALA C  1 112 ? -6.232  67.104  44.009  1.00   20.88 ? 219  ALA C N   1 
ATOM   7955  C  CA  . ALA C  1 112 ? -6.044  66.103  45.044  1.00   21.02 ? 219  ALA C CA  1 
ATOM   7956  C  C   . ALA C  1 112 ? -5.805  66.796  46.385  1.00   21.78 ? 219  ALA C C   1 
ATOM   7957  O  O   . ALA C  1 112 ? -5.504  67.992  46.433  1.00   22.35 ? 219  ALA C O   1 
ATOM   7958  C  CB  . ALA C  1 112 ? -4.850  65.215  44.694  1.00   19.30 ? 219  ALA C CB  1 
ATOM   7959  N  N   . ARG C  1 113 ? -5.962  66.054  47.475  1.00   19.48 ? 220  ARG C N   1 
ATOM   7960  C  CA  . ARG C  1 113 ? -5.699  66.611  48.792  1.00   22.62 ? 220  ARG C CA  1 
ATOM   7961  C  C   . ARG C  1 113 ? -4.267  66.203  49.095  1.00   21.32 ? 220  ARG C C   1 
ATOM   7962  O  O   . ARG C  1 113 ? -3.867  65.055  48.848  1.00   22.46 ? 220  ARG C O   1 
ATOM   7963  C  CB  . ARG C  1 113 ? -6.679  66.045  49.819  1.00   26.38 ? 220  ARG C CB  1 
ATOM   7964  C  CG  . ARG C  1 113 ? -8.085  66.591  49.621  1.00   36.16 ? 220  ARG C CG  1 
ATOM   7965  C  CD  . ARG C  1 113 ? -9.133  65.610  50.117  1.00   43.94 ? 220  ARG C CD  1 
ATOM   7966  N  NE  . ARG C  1 113 ? -9.228  65.574  51.575  1.00   47.05 ? 220  ARG C NE  1 
ATOM   7967  C  CZ  . ARG C  1 113 ? -9.940  64.676  52.250  1.00   47.31 ? 220  ARG C CZ  1 
ATOM   7968  N  NH1 . ARG C  1 113 ? -9.978  64.716  53.575  1.00   48.03 ? 220  ARG C NH1 1 
ATOM   7969  N  NH2 . ARG C  1 113 ? -10.605 63.728  51.597  1.00   48.87 ? 220  ARG C NH2 1 
ATOM   7970  N  N   . ILE C  1 114 ? -3.489  67.146  49.604  1.00   16.43 ? 221  ILE C N   1 
ATOM   7971  C  CA  . ILE C  1 114 ? -2.085  66.899  49.883  1.00   17.17 ? 221  ILE C CA  1 
ATOM   7972  C  C   . ILE C  1 114 ? -1.746  67.112  51.364  1.00   18.37 ? 221  ILE C C   1 
ATOM   7973  O  O   . ILE C  1 114 ? -2.178  68.077  51.990  1.00   19.22 ? 221  ILE C O   1 
ATOM   7974  C  CB  . ILE C  1 114 ? -1.217  67.834  49.000  1.00   18.04 ? 221  ILE C CB  1 
ATOM   7975  C  CG1 . ILE C  1 114 ? 0.268   67.504  49.148  1.00   17.90 ? 221  ILE C CG1 1 
ATOM   7976  C  CG2 . ILE C  1 114 ? -1.513  69.292  49.348  1.00   16.08 ? 221  ILE C CG2 1 
ATOM   7977  C  CD1 . ILE C  1 114 ? 0.674   66.211  48.495  1.00   18.27 ? 221  ILE C CD1 1 
ATOM   7978  N  N   . GLY C  1 115 ? -0.982  66.183  51.915  1.00   17.92 ? 222  GLY C N   1 
ATOM   7979  C  CA  . GLY C  1 115 ? -0.576  66.279  53.301  1.00   20.73 ? 222  GLY C CA  1 
ATOM   7980  C  C   . GLY C  1 115 ? 0.920   66.068  53.379  1.00   21.67 ? 222  GLY C C   1 
ATOM   7981  O  O   . GLY C  1 115 ? 1.574   65.756  52.372  1.00   22.16 ? 222  GLY C O   1 
ATOM   7982  N  N   . GLY C  1 116 ? 1.474   66.248  54.567  1.00   20.46 ? 223  GLY C N   1 
ATOM   7983  C  CA  . GLY C  1 116 ? 2.898   66.056  54.737  1.00   21.54 ? 223  GLY C CA  1 
ATOM   7984  C  C   . GLY C  1 116 ? 3.234   65.516  56.116  1.00   22.95 ? 223  GLY C C   1 
ATOM   7985  O  O   . GLY C  1 116 ? 2.598   65.880  57.110  1.00   22.00 ? 223  GLY C O   1 
ATOM   7986  N  N   . VAL C  1 117 ? 4.215   64.621  56.176  1.00   20.73 ? 224  VAL C N   1 
ATOM   7987  C  CA  . VAL C  1 117 ? 4.649   64.083  57.451  1.00   20.58 ? 224  VAL C CA  1 
ATOM   7988  C  C   . VAL C  1 117 ? 6.051   64.602  57.661  1.00   19.74 ? 224  VAL C C   1 
ATOM   7989  O  O   . VAL C  1 117 ? 6.945   64.339  56.857  1.00   21.48 ? 224  VAL C O   1 
ATOM   7990  C  CB  . VAL C  1 117 ? 4.701   62.533  57.483  1.00   20.59 ? 224  VAL C CB  1 
ATOM   7991  C  CG1 . VAL C  1 117 ? 5.206   62.065  58.847  1.00   16.96 ? 224  VAL C CG1 1 
ATOM   7992  C  CG2 . VAL C  1 117 ? 3.334   61.955  57.224  1.00   23.19 ? 224  VAL C CG2 1 
ATOM   7993  N  N   . ARG C  1 118 ? 6.236   65.369  58.726  1.00   17.91 ? 225  ARG C N   1 
ATOM   7994  C  CA  . ARG C  1 118 ? 7.552   65.892  59.034  1.00   18.15 ? 225  ARG C CA  1 
ATOM   7995  C  C   . ARG C  1 118 ? 8.278   64.768  59.771  1.00   19.61 ? 225  ARG C C   1 
ATOM   7996  O  O   . ARG C  1 118 ? 7.970   64.465  60.932  1.00   18.24 ? 225  ARG C O   1 
ATOM   7997  C  CB  . ARG C  1 118 ? 7.444   67.145  59.910  1.00   15.96 ? 225  ARG C CB  1 
ATOM   7998  C  CG  . ARG C  1 118 ? 8.786   67.737  60.280  1.00   13.76 ? 225  ARG C CG  1 
ATOM   7999  C  CD  . ARG C  1 118 ? 8.612   69.119  60.887  1.00   17.73 ? 225  ARG C CD  1 
ATOM   8000  N  NE  . ARG C  1 118 ? 9.894   69.658  61.319  1.00   23.03 ? 225  ARG C NE  1 
ATOM   8001  C  CZ  . ARG C  1 118 ? 10.314  69.672  62.579  1.00   23.32 ? 225  ARG C CZ  1 
ATOM   8002  N  NH1 . ARG C  1 118 ? 11.509  70.171  62.874  1.00   24.50 ? 225  ARG C NH1 1 
ATOM   8003  N  NH2 . ARG C  1 118 ? 9.527   69.218  63.546  1.00   17.53 ? 225  ARG C NH2 1 
ATOM   8004  N  N   . MET C  1 119 ? 9.234   64.137  59.095  1.00   18.28 ? 226  MET C N   1 
ATOM   8005  C  CA  . MET C  1 119 ? 9.961   63.044  59.711  1.00   19.25 ? 226  MET C CA  1 
ATOM   8006  C  C   . MET C  1 119 ? 11.445  62.985  59.408  1.00   20.83 ? 226  MET C C   1 
ATOM   8007  O  O   . MET C  1 119 ? 12.158  62.166  59.982  1.00   23.73 ? 226  MET C O   1 
ATOM   8008  C  CB  . MET C  1 119 ? 9.285   61.710  59.364  1.00   20.44 ? 226  MET C CB  1 
ATOM   8009  C  CG  . MET C  1 119 ? 8.867   61.542  57.899  1.00   21.74 ? 226  MET C CG  1 
ATOM   8010  S  SD  . MET C  1 119 ? 10.210  61.079  56.793  1.00   25.20 ? 226  MET C SD  1 
ATOM   8011  C  CE  . MET C  1 119 ? 10.434  59.380  57.238  1.00   22.36 ? 226  MET C CE  1 
ATOM   8012  N  N   . LEU C  1 120 ? 11.929  63.854  58.532  1.00   19.78 ? 227  LEU C N   1 
ATOM   8013  C  CA  . LEU C  1 120 ? 13.348  63.855  58.209  1.00   19.14 ? 227  LEU C CA  1 
ATOM   8014  C  C   . LEU C  1 120 ? 14.144  64.867  59.041  1.00   21.31 ? 227  LEU C C   1 
ATOM   8015  O  O   . LEU C  1 120 ? 15.369  64.788  59.110  1.00   21.35 ? 227  LEU C O   1 
ATOM   8016  C  CB  . LEU C  1 120 ? 13.560  64.160  56.718  1.00   17.19 ? 227  LEU C CB  1 
ATOM   8017  C  CG  . LEU C  1 120 ? 13.063  63.151  55.684  1.00   17.56 ? 227  LEU C CG  1 
ATOM   8018  C  CD1 . LEU C  1 120 ? 13.457  63.666  54.296  1.00   17.25 ? 227  LEU C CD1 1 
ATOM   8019  C  CD2 . LEU C  1 120 ? 13.668  61.774  55.925  1.00   13.74 ? 227  LEU C CD2 1 
ATOM   8020  N  N   . ASP C  1 121 ? 13.450  65.809  59.674  1.00   22.90 ? 228  ASP C N   1 
ATOM   8021  C  CA  . ASP C  1 121 ? 14.117  66.843  60.461  1.00   23.38 ? 228  ASP C CA  1 
ATOM   8022  C  C   . ASP C  1 121 ? 14.285  66.427  61.923  1.00   23.14 ? 228  ASP C C   1 
ATOM   8023  O  O   . ASP C  1 121 ? 13.646  66.969  62.827  1.00   22.19 ? 228  ASP C O   1 
ATOM   8024  C  CB  . ASP C  1 121 ? 13.321  68.149  60.352  1.00   25.84 ? 228  ASP C CB  1 
ATOM   8025  C  CG  . ASP C  1 121 ? 14.102  69.360  60.843  1.00   26.66 ? 228  ASP C CG  1 
ATOM   8026  O  OD1 . ASP C  1 121 ? 15.343  69.261  60.939  1.00   23.65 ? 228  ASP C OD1 1 
ATOM   8027  O  OD2 . ASP C  1 121 ? 13.473  70.411  61.109  1.00   24.89 ? 228  ASP C OD2 1 
ATOM   8028  N  N   . GLY C  1 122 ? 15.162  65.455  62.129  1.00   24.64 ? 229  GLY C N   1 
ATOM   8029  C  CA  . GLY C  1 122 ? 15.449  64.921  63.449  1.00   24.18 ? 229  GLY C CA  1 
ATOM   8030  C  C   . GLY C  1 122 ? 16.103  63.560  63.284  1.00   25.26 ? 229  GLY C C   1 
ATOM   8031  O  O   . GLY C  1 122 ? 16.572  63.223  62.196  1.00   27.75 ? 229  GLY C O   1 
ATOM   8032  N  N   . GLU C  1 123 ? 16.148  62.766  64.345  1.00   26.61 ? 230  GLU C N   1 
ATOM   8033  C  CA  . GLU C  1 123 ? 16.753  61.445  64.238  1.00   27.09 ? 230  GLU C CA  1 
ATOM   8034  C  C   . GLU C  1 123 ? 15.744  60.565  63.504  1.00   26.07 ? 230  GLU C C   1 
ATOM   8035  O  O   . GLU C  1 123 ? 14.626  60.363  63.983  1.00   26.83 ? 230  GLU C O   1 
ATOM   8036  C  CB  . GLU C  1 123 ? 17.037  60.875  65.633  1.00   30.83 ? 230  GLU C CB  1 
ATOM   8037  C  CG  . GLU C  1 123 ? 17.971  59.677  65.626  1.00   33.55 ? 230  GLU C CG  1 
ATOM   8038  C  CD  . GLU C  1 123 ? 17.910  58.862  66.908  0.0000 35.52 ? 230  GLU C CD  1 
ATOM   8039  O  OE1 . GLU C  1 123 ? 18.698  57.914  67.019  1.00   38.78 ? 230  GLU C OE1 1 
ATOM   8040  O  OE2 . GLU C  1 123 ? 17.085  59.145  67.801  1.00   37.27 ? 230  GLU C OE2 1 
ATOM   8041  N  N   . VAL C  1 124 ? 16.126  60.064  62.338  1.00   21.56 ? 231  VAL C N   1 
ATOM   8042  C  CA  . VAL C  1 124 ? 15.226  59.227  61.556  1.00   21.14 ? 231  VAL C CA  1 
ATOM   8043  C  C   . VAL C  1 124 ? 15.397  57.772  61.961  1.00   22.95 ? 231  VAL C C   1 
ATOM   8044  O  O   . VAL C  1 124 ? 16.189  57.039  61.372  1.00   26.08 ? 231  VAL C O   1 
ATOM   8045  C  CB  . VAL C  1 124 ? 15.515  59.371  60.049  1.00   21.37 ? 231  VAL C CB  1 
ATOM   8046  C  CG1 . VAL C  1 124 ? 14.431  58.683  59.232  1.00   18.90 ? 231  VAL C CG1 1 
ATOM   8047  C  CG2 . VAL C  1 124 ? 15.618  60.851  59.686  1.00   20.01 ? 231  VAL C CG2 1 
ATOM   8048  N  N   . THR C  1 125 ? 14.651  57.357  62.977  1.00   22.21 ? 232  THR C N   1 
ATOM   8049  C  CA  . THR C  1 125 ? 14.728  55.991  63.474  1.00   21.07 ? 232  THR C CA  1 
ATOM   8050  C  C   . THR C  1 125 ? 13.741  55.074  62.766  1.00   22.38 ? 232  THR C C   1 
ATOM   8051  O  O   . THR C  1 125 ? 12.902  55.520  61.977  1.00   22.75 ? 232  THR C O   1 
ATOM   8052  C  CB  . THR C  1 125 ? 14.387  55.943  64.955  1.00   20.19 ? 232  THR C CB  1 
ATOM   8053  O  OG1 . THR C  1 125 ? 13.012  56.303  65.116  1.00   22.68 ? 232  THR C OG1 1 
ATOM   8054  C  CG2 . THR C  1 125 ? 15.252  56.926  65.731  1.00   17.50 ? 232  THR C CG2 1 
ATOM   8055  N  N   . ASP C  1 126 ? 13.843  53.786  63.065  1.00   21.23 ? 233  ASP C N   1 
ATOM   8056  C  CA  . ASP C  1 126 ? 12.944  52.797  62.491  1.00   19.19 ? 233  ASP C CA  1 
ATOM   8057  C  C   . ASP C  1 126 ? 11.512  53.158  62.912  1.00   19.49 ? 233  ASP C C   1 
ATOM   8058  O  O   . ASP C  1 126 ? 10.585  53.123  62.098  1.00   18.68 ? 233  ASP C O   1 
ATOM   8059  C  CB  . ASP C  1 126 ? 13.332  51.399  62.993  1.00   17.04 ? 233  ASP C CB  1 
ATOM   8060  C  CG  . ASP C  1 126 ? 12.473  50.289  62.387  1.00   23.01 ? 233  ASP C CG  1 
ATOM   8061  O  OD1 . ASP C  1 126 ? 12.148  50.359  61.186  1.00   21.72 ? 233  ASP C OD1 1 
ATOM   8062  O  OD2 . ASP C  1 126 ? 12.139  49.329  63.113  1.00   25.95 ? 233  ASP C OD2 1 
ATOM   8063  N  N   . ALA C  1 127 ? 11.339  53.537  64.174  1.00   19.44 ? 234  ALA C N   1 
ATOM   8064  C  CA  . ALA C  1 127 ? 10.015  53.900  64.683  1.00   20.21 ? 234  ALA C CA  1 
ATOM   8065  C  C   . ALA C  1 127 ? 9.469   55.125  63.956  1.00   21.09 ? 234  ALA C C   1 
ATOM   8066  O  O   . ALA C  1 127 ? 8.282   55.194  63.637  1.00   20.53 ? 234  ALA C O   1 
ATOM   8067  C  CB  . ALA C  1 127 ? 10.087  54.176  66.186  1.00   19.79 ? 234  ALA C CB  1 
ATOM   8068  N  N   . VAL C  1 128 ? 10.339  56.098  63.715  1.00   21.34 ? 235  VAL C N   1 
ATOM   8069  C  CA  . VAL C  1 128 ? 9.942   57.317  63.013  1.00   21.53 ? 235  VAL C CA  1 
ATOM   8070  C  C   . VAL C  1 128 ? 9.431   56.938  61.619  1.00   21.01 ? 235  VAL C C   1 
ATOM   8071  O  O   . VAL C  1 128 ? 8.365   57.388  61.180  1.00   22.12 ? 235  VAL C O   1 
ATOM   8072  C  CB  . VAL C  1 128 ? 11.150  58.290  62.881  1.00   23.68 ? 235  VAL C CB  1 
ATOM   8073  C  CG1 . VAL C  1 128 ? 10.844  59.397  61.866  1.00   23.72 ? 235  VAL C CG1 1 
ATOM   8074  C  CG2 . VAL C  1 128 ? 11.476  58.883  64.247  1.00   26.06 ? 235  VAL C CG2 1 
ATOM   8075  N  N   . GLU C  1 129 ? 10.191  56.097  60.931  1.00   17.10 ? 236  GLU C N   1 
ATOM   8076  C  CA  . GLU C  1 129 ? 9.801   55.667  59.598  1.00   20.21 ? 236  GLU C CA  1 
ATOM   8077  C  C   . GLU C  1 129 ? 8.488   54.899  59.621  1.00   20.06 ? 236  GLU C C   1 
ATOM   8078  O  O   . GLU C  1 129 ? 7.579   55.166  58.827  1.00   20.40 ? 236  GLU C O   1 
ATOM   8079  C  CB  . GLU C  1 129 ? 10.888  54.788  58.985  1.00   18.64 ? 236  GLU C CB  1 
ATOM   8080  C  CG  . GLU C  1 129 ? 12.089  55.540  58.437  1.00   18.82 ? 236  GLU C CG  1 
ATOM   8081  C  CD  . GLU C  1 129 ? 13.187  54.582  57.996  1.00   21.27 ? 236  GLU C CD  1 
ATOM   8082  O  OE1 . GLU C  1 129 ? 12.858  53.466  57.534  1.00   20.16 ? 236  GLU C OE1 1 
ATOM   8083  O  OE2 . GLU C  1 129 ? 14.372  54.939  58.109  1.00   21.44 ? 236  GLU C OE2 1 
ATOM   8084  N  N   . ALA C  1 130 ? 8.379   53.947  60.542  1.00   20.65 ? 237  ALA C N   1 
ATOM   8085  C  CA  . ALA C  1 130 ? 7.176   53.127  60.627  1.00   20.68 ? 237  ALA C CA  1 
ATOM   8086  C  C   . ALA C  1 130 ? 5.925   53.950  60.895  1.00   19.52 ? 237  ALA C C   1 
ATOM   8087  O  O   . ALA C  1 130 ? 4.872   53.698  60.311  1.00   20.86 ? 237  ALA C O   1 
ATOM   8088  C  CB  . ALA C  1 130 ? 7.351   52.051  61.698  1.00   21.31 ? 237  ALA C CB  1 
ATOM   8089  N  N   . ARG C  1 131 ? 6.032   54.941  61.770  1.00   19.63 ? 238  ARG C N   1 
ATOM   8090  C  CA  . ARG C  1 131 ? 4.876   55.774  62.072  1.00   22.04 ? 238  ARG C CA  1 
ATOM   8091  C  C   . ARG C  1 131 ? 4.476   56.650  60.885  1.00   20.45 ? 238  ARG C C   1 
ATOM   8092  O  O   . ARG C  1 131 ? 3.308   57.002  60.736  1.00   20.40 ? 238  ARG C O   1 
ATOM   8093  C  CB  . ARG C  1 131 ? 5.156   56.631  63.303  1.00   23.57 ? 238  ARG C CB  1 
ATOM   8094  C  CG  . ARG C  1 131 ? 5.303   55.803  64.565  1.00   29.53 ? 238  ARG C CG  1 
ATOM   8095  C  CD  . ARG C  1 131 ? 5.458   56.680  65.783  1.00   31.68 ? 238  ARG C CD  1 
ATOM   8096  N  NE  . ARG C  1 131 ? 4.244   57.445  66.024  1.00   36.61 ? 238  ARG C NE  1 
ATOM   8097  C  CZ  . ARG C  1 131 ? 4.231   58.713  66.421  1.00   41.25 ? 238  ARG C CZ  1 
ATOM   8098  N  NH1 . ARG C  1 131 ? 3.069   59.331  66.617  1.00   39.91 ? 238  ARG C NH1 1 
ATOM   8099  N  NH2 . ARG C  1 131 ? 5.380   59.365  66.611  1.00   40.45 ? 238  ARG C NH2 1 
ATOM   8100  N  N   . SER C  1 132 ? 5.442   56.986  60.035  1.00   18.85 ? 239  SER C N   1 
ATOM   8101  C  CA  . SER C  1 132 ? 5.170   57.809  58.858  1.00   18.78 ? 239  SER C CA  1 
ATOM   8102  C  C   . SER C  1 132 ? 4.536   56.959  57.752  1.00   19.14 ? 239  SER C C   1 
ATOM   8103  O  O   . SER C  1 132 ? 3.506   57.327  57.194  1.00   19.50 ? 239  SER C O   1 
ATOM   8104  C  CB  . SER C  1 132 ? 6.461   58.441  58.352  1.00   17.16 ? 239  SER C CB  1 
ATOM   8105  O  OG  . SER C  1 132 ? 7.023   59.261  59.356  1.00   18.70 ? 239  SER C OG  1 
ATOM   8106  N  N   . LEU C  1 133 ? 5.157   55.823  57.440  1.00   16.94 ? 240  LEU C N   1 
ATOM   8107  C  CA  . LEU C  1 133 ? 4.643   54.916  56.416  1.00   18.36 ? 240  LEU C CA  1 
ATOM   8108  C  C   . LEU C  1 133 ? 3.269   54.369  56.817  1.00   19.38 ? 240  LEU C C   1 
ATOM   8109  O  O   . LEU C  1 133 ? 2.449   54.030  55.963  1.00   17.53 ? 240  LEU C O   1 
ATOM   8110  C  CB  . LEU C  1 133 ? 5.616   53.747  56.231  1.00   18.15 ? 240  LEU C CB  1 
ATOM   8111  C  CG  . LEU C  1 133 ? 6.982   54.061  55.614  1.00   20.32 ? 240  LEU C CG  1 
ATOM   8112  C  CD1 . LEU C  1 133 ? 7.956   52.906  55.833  1.00   20.48 ? 240  LEU C CD1 1 
ATOM   8113  C  CD2 . LEU C  1 133 ? 6.798   54.337  54.132  1.00   16.02 ? 240  LEU C CD2 1 
ATOM   8114  N  N   . GLY C  1 134 ? 3.022   54.287  58.124  1.00   21.43 ? 241  GLY C N   1 
ATOM   8115  C  CA  . GLY C  1 134 ? 1.745   53.773  58.597  1.00   23.36 ? 241  GLY C CA  1 
ATOM   8116  C  C   . GLY C  1 134 ? 0.737   54.824  59.033  1.00   23.58 ? 241  GLY C C   1 
ATOM   8117  O  O   . GLY C  1 134 ? -0.253  54.506  59.695  1.00   26.46 ? 241  GLY C O   1 
ATOM   8118  N  N   . LEU C  1 135 ? 0.967   56.079  58.671  1.00   23.73 ? 242  LEU C N   1 
ATOM   8119  C  CA  . LEU C  1 135 ? 0.041   57.140  59.067  1.00   23.07 ? 242  LEU C CA  1 
ATOM   8120  C  C   . LEU C  1 135 ? -1.311  57.040  58.366  1.00   22.65 ? 242  LEU C C   1 
ATOM   8121  O  O   . LEU C  1 135 ? -1.363  56.995  57.141  1.00   20.68 ? 242  LEU C O   1 
ATOM   8122  C  CB  . LEU C  1 135 ? 0.639   58.522  58.756  1.00   20.38 ? 242  LEU C CB  1 
ATOM   8123  C  CG  . LEU C  1 135 ? -0.258  59.712  59.144  1.00   20.22 ? 242  LEU C CG  1 
ATOM   8124  C  CD1 . LEU C  1 135 ? -0.286  59.801  60.660  1.00   17.76 ? 242  LEU C CD1 1 
ATOM   8125  C  CD2 . LEU C  1 135 ? 0.259   61.023  58.544  1.00   15.81 ? 242  LEU C CD2 1 
ATOM   8126  N  N   . ASN C  1 136 ? -2.399  57.002  59.135  1.00   23.35 ? 243  ASN C N   1 
ATOM   8127  C  CA  . ASN C  1 136 ? -3.748  56.979  58.556  1.00   25.86 ? 243  ASN C CA  1 
ATOM   8128  C  C   . ASN C  1 136 ? -3.901  56.183  57.275  1.00   26.09 ? 243  ASN C C   1 
ATOM   8129  O  O   . ASN C  1 136 ? -4.349  56.735  56.267  1.00   25.02 ? 243  ASN C O   1 
ATOM   8130  C  CB  . ASN C  1 136 ? -4.175  58.391  58.212  1.00   30.62 ? 243  ASN C CB  1 
ATOM   8131  C  CG  . ASN C  1 136 ? -4.802  59.085  59.339  1.00   40.59 ? 243  ASN C CG  1 
ATOM   8132  O  OD1 . ASN C  1 136 ? -4.138  59.428  60.322  1.00   44.88 ? 243  ASN C OD1 1 
ATOM   8133  N  ND2 . ASN C  1 136 ? -6.109  59.310  59.227  1.00   45.27 ? 243  ASN C ND2 1 
ATOM   8134  N  N   . PRO C  1 137 ? -3.590  54.877  57.301  1.00   26.49 ? 244  PRO C N   1 
ATOM   8135  C  CA  . PRO C  1 137 ? -3.678  54.003  56.125  1.00   26.72 ? 244  PRO C CA  1 
ATOM   8136  C  C   . PRO C  1 137 ? -5.036  53.935  55.444  1.00   28.31 ? 244  PRO C C   1 
ATOM   8137  O  O   . PRO C  1 137 ? -5.132  53.541  54.276  1.00   29.49 ? 244  PRO C O   1 
ATOM   8138  C  CB  . PRO C  1 137 ? -3.243  52.641  56.667  1.00   28.81 ? 244  PRO C CB  1 
ATOM   8139  C  CG  . PRO C  1 137 ? -2.431  52.983  57.887  1.00   30.77 ? 244  PRO C CG  1 
ATOM   8140  C  CD  . PRO C  1 137 ? -3.246  54.095  58.495  1.00   23.78 ? 244  PRO C CD  1 
ATOM   8141  N  N   . ASN C  1 138 ? -6.092  54.300  56.156  1.00   26.78 ? 245  ASN C N   1 
ATOM   8142  C  CA  . ASN C  1 138 ? -7.411  54.257  55.539  1.00   28.89 ? 245  ASN C CA  1 
ATOM   8143  C  C   . ASN C  1 138 ? -7.908  55.609  55.063  1.00   27.49 ? 245  ASN C C   1 
ATOM   8144  O  O   . ASN C  1 138 ? -9.027  55.738  54.565  1.00   27.73 ? 245  ASN C O   1 
ATOM   8145  C  CB  . ASN C  1 138 ? -8.420  53.612  56.482  1.00   30.77 ? 245  ASN C CB  1 
ATOM   8146  C  CG  . ASN C  1 138 ? -8.221  52.110  56.582  1.00   38.02 ? 245  ASN C CG  1 
ATOM   8147  O  OD1 . ASN C  1 138 ? -8.220  51.394  55.562  1.00   31.55 ? 245  ASN C OD1 1 
ATOM   8148  N  ND2 . ASN C  1 138 ? -8.038  51.619  57.808  1.00   35.27 ? 245  ASN C ND2 1 
ATOM   8149  N  N   . HIS C  1 139 ? -7.066  56.620  55.212  1.00   25.37 ? 246  HIS C N   1 
ATOM   8150  C  CA  . HIS C  1 139 ? -7.412  57.950  54.749  1.00   23.49 ? 246  HIS C CA  1 
ATOM   8151  C  C   . HIS C  1 139 ? -6.487  58.325  53.595  1.00   22.07 ? 246  HIS C C   1 
ATOM   8152  O  O   . HIS C  1 139 ? -6.934  58.777  52.541  1.00   20.90 ? 246  HIS C O   1 
ATOM   8153  C  CB  . HIS C  1 139 ? -7.253  58.967  55.864  1.00   20.66 ? 246  HIS C CB  1 
ATOM   8154  C  CG  . HIS C  1 139 ? -7.502  60.363  55.411  1.00   22.74 ? 246  HIS C CG  1 
ATOM   8155  N  ND1 . HIS C  1 139 ? -8.735  60.786  54.971  1.00   21.86 ? 246  HIS C ND1 1 
ATOM   8156  C  CD2 . HIS C  1 139 ? -6.670  61.424  55.289  1.00   20.41 ? 246  HIS C CD2 1 
ATOM   8157  C  CE1 . HIS C  1 139 ? -8.653  62.051  54.599  1.00   23.32 ? 246  HIS C CE1 1 
ATOM   8158  N  NE2 . HIS C  1 139 ? -7.410  62.459  54.782  1.00   22.01 ? 246  HIS C NE2 1 
ATOM   8159  N  N   . ILE C  1 140 ? -5.189  58.133  53.811  1.00   22.20 ? 247  ILE C N   1 
ATOM   8160  C  CA  . ILE C  1 140 ? -4.182  58.428  52.802  1.00   18.75 ? 247  ILE C CA  1 
ATOM   8161  C  C   . ILE C  1 140 ? -4.140  57.293  51.783  1.00   19.78 ? 247  ILE C C   1 
ATOM   8162  O  O   . ILE C  1 140 ? -4.124  56.116  52.156  1.00   19.48 ? 247  ILE C O   1 
ATOM   8163  C  CB  . ILE C  1 140 ? -2.792  58.569  53.453  1.00   20.41 ? 247  ILE C CB  1 
ATOM   8164  C  CG1 . ILE C  1 140 ? -2.808  59.755  54.421  1.00   17.93 ? 247  ILE C CG1 1 
ATOM   8165  C  CG2 . ILE C  1 140 ? -1.699  58.718  52.369  1.00   14.94 ? 247  ILE C CG2 1 
ATOM   8166  C  CD1 . ILE C  1 140 ? -1.563  59.858  55.282  1.00   19.06 ? 247  ILE C CD1 1 
ATOM   8167  N  N   . HIS C  1 141 ? -4.125  57.642  50.498  1.00   18.53 ? 248  HIS C N   1 
ATOM   8168  C  CA  . HIS C  1 141 ? -4.071  56.634  49.445  1.00   18.12 ? 248  HIS C CA  1 
ATOM   8169  C  C   . HIS C  1 141 ? -2.659  56.376  48.946  1.00   17.15 ? 248  HIS C C   1 
ATOM   8170  O  O   . HIS C  1 141 ? -2.272  55.233  48.728  1.00   16.48 ? 248  HIS C O   1 
ATOM   8171  C  CB  . HIS C  1 141 ? -4.889  57.052  48.229  1.00   18.71 ? 248  HIS C CB  1 
ATOM   8172  C  CG  . HIS C  1 141 ? -6.318  57.356  48.523  1.00   20.96 ? 248  HIS C CG  1 
ATOM   8173  N  ND1 . HIS C  1 141 ? -6.803  58.643  48.591  1.00   24.18 ? 248  HIS C ND1 1 
ATOM   8174  C  CD2 . HIS C  1 141 ? -7.377  56.542  48.733  1.00   23.35 ? 248  HIS C CD2 1 
ATOM   8175  C  CE1 . HIS C  1 141 ? -8.101  58.610  48.826  1.00   23.07 ? 248  HIS C CE1 1 
ATOM   8176  N  NE2 . HIS C  1 141 ? -8.474  57.347  48.918  1.00   26.76 ? 248  HIS C NE2 1 
ATOM   8177  N  N   . ILE C  1 142 ? -1.905  57.454  48.760  1.00   15.67 ? 249  ILE C N   1 
ATOM   8178  C  CA  . ILE C  1 142 ? -0.555  57.392  48.218  1.00   14.47 ? 249  ILE C CA  1 
ATOM   8179  C  C   . ILE C  1 142 ? 0.492   58.076  49.087  1.00   17.29 ? 249  ILE C C   1 
ATOM   8180  O  O   . ILE C  1 142 ? 0.299   59.208  49.537  1.00   20.34 ? 249  ILE C O   1 
ATOM   8181  C  CB  . ILE C  1 142 ? -0.553  58.072  46.831  1.00   15.27 ? 249  ILE C CB  1 
ATOM   8182  C  CG1 . ILE C  1 142 ? -1.520  57.335  45.897  1.00   11.82 ? 249  ILE C CG1 1 
ATOM   8183  C  CG2 . ILE C  1 142 ? 0.848   58.153  46.271  1.00   12.00 ? 249  ILE C CG2 1 
ATOM   8184  C  CD1 . ILE C  1 142 ? -2.177  58.260  44.821  1.00   10.01 ? 249  ILE C CD1 1 
ATOM   8185  N  N   . TYR C  1 143 ? 1.601   57.384  49.319  1.00   15.68 ? 250  TYR C N   1 
ATOM   8186  C  CA  . TYR C  1 143 ? 2.699   57.938  50.098  1.00   18.70 ? 250  TYR C CA  1 
ATOM   8187  C  C   . TYR C  1 143 ? 3.860   58.174  49.131  1.00   19.97 ? 250  TYR C C   1 
ATOM   8188  O  O   . TYR C  1 143 ? 4.177   57.307  48.308  1.00   20.54 ? 250  TYR C O   1 
ATOM   8189  C  CB  . TYR C  1 143 ? 3.152   56.961  51.191  1.00   19.06 ? 250  TYR C CB  1 
ATOM   8190  C  CG  . TYR C  1 143 ? 2.073   56.569  52.164  1.00   18.17 ? 250  TYR C CG  1 
ATOM   8191  C  CD1 . TYR C  1 143 ? 1.082   55.657  51.803  1.00   19.21 ? 250  TYR C CD1 1 
ATOM   8192  C  CD2 . TYR C  1 143 ? 2.041   57.105  53.449  1.00   17.70 ? 250  TYR C CD2 1 
ATOM   8193  C  CE1 . TYR C  1 143 ? 0.085   55.284  52.699  1.00   17.67 ? 250  TYR C CE1 1 
ATOM   8194  C  CE2 . TYR C  1 143 ? 1.039   56.733  54.362  1.00   18.13 ? 250  TYR C CE2 1 
ATOM   8195  C  CZ  . TYR C  1 143 ? 0.072   55.825  53.971  1.00   18.06 ? 250  TYR C CZ  1 
ATOM   8196  O  OH  . TYR C  1 143 ? -0.919  55.468  54.840  1.00   21.23 ? 250  TYR C OH  1 
ATOM   8197  N  N   . SER C  1 144 ? 4.489   59.338  49.225  1.00   18.41 ? 251  SER C N   1 
ATOM   8198  C  CA  . SER C  1 144 ? 5.606   59.666  48.356  1.00   18.15 ? 251  SER C CA  1 
ATOM   8199  C  C   . SER C  1 144 ? 6.843   59.913  49.220  1.00   17.63 ? 251  SER C C   1 
ATOM   8200  O  O   . SER C  1 144 ? 6.804   60.712  50.161  1.00   16.63 ? 251  SER C O   1 
ATOM   8201  C  CB  . SER C  1 144 ? 5.273   60.915  47.530  1.00   19.26 ? 251  SER C CB  1 
ATOM   8202  O  OG  . SER C  1 144 ? 6.317   61.228  46.632  1.00   22.12 ? 251  SER C OG  1 
ATOM   8203  N  N   . ALA C  1 145 ? 7.936   59.225  48.905  1.00   14.13 ? 252  ALA C N   1 
ATOM   8204  C  CA  . ALA C  1 145 ? 9.158   59.375  49.681  1.00   17.16 ? 252  ALA C CA  1 
ATOM   8205  C  C   . ALA C  1 145 ? 10.365  59.681  48.799  1.00   19.38 ? 252  ALA C C   1 
ATOM   8206  O  O   . ALA C  1 145 ? 10.801  58.836  48.007  1.00   18.95 ? 252  ALA C O   1 
ATOM   8207  C  CB  . ALA C  1 145 ? 9.416   58.102  50.500  1.00   11.34 ? 252  ALA C CB  1 
ATOM   8208  N  N   . SER C  1 146 ? 10.891  60.897  48.939  1.00   18.56 ? 253  SER C N   1 
ATOM   8209  C  CA  . SER C  1 146 ? 12.059  61.323  48.187  1.00   19.81 ? 253  SER C CA  1 
ATOM   8210  C  C   . SER C  1 146 ? 13.244  61.355  49.148  1.00   18.53 ? 253  SER C C   1 
ATOM   8211  O  O   . SER C  1 146 ? 13.864  62.394  49.347  1.00   18.93 ? 253  SER C O   1 
ATOM   8212  C  CB  . SER C  1 146 ? 11.849  62.720  47.585  1.00   20.21 ? 253  SER C CB  1 
ATOM   8213  O  OG  . SER C  1 146 ? 10.869  62.725  46.559  1.00   20.40 ? 253  SER C OG  1 
ATOM   8214  N  N   . TRP C  1 147 ? 13.540  60.206  49.745  1.00   19.05 ? 254  TRP C N   1 
ATOM   8215  C  CA  . TRP C  1 147 ? 14.653  60.063  50.682  1.00   17.38 ? 254  TRP C CA  1 
ATOM   8216  C  C   . TRP C  1 147 ? 15.014  58.590  50.795  1.00   18.17 ? 254  TRP C C   1 
ATOM   8217  O  O   . TRP C  1 147 ? 14.273  57.724  50.334  1.00   17.37 ? 254  TRP C O   1 
ATOM   8218  C  CB  . TRP C  1 147 ? 14.286  60.606  52.074  1.00   17.79 ? 254  TRP C CB  1 
ATOM   8219  C  CG  . TRP C  1 147 ? 12.987  60.088  52.637  1.00   17.54 ? 254  TRP C CG  1 
ATOM   8220  C  CD1 . TRP C  1 147 ? 11.759  60.676  52.531  1.00   19.35 ? 254  TRP C CD1 1 
ATOM   8221  C  CD2 . TRP C  1 147 ? 12.787  58.878  53.390  1.00   21.54 ? 254  TRP C CD2 1 
ATOM   8222  N  NE1 . TRP C  1 147 ? 10.806  59.917  53.171  1.00   19.66 ? 254  TRP C NE1 1 
ATOM   8223  C  CE2 . TRP C  1 147 ? 11.407  58.805  53.704  1.00   20.70 ? 254  TRP C CE2 1 
ATOM   8224  C  CE3 . TRP C  1 147 ? 13.636  57.850  53.831  1.00   21.21 ? 254  TRP C CE3 1 
ATOM   8225  C  CZ2 . TRP C  1 147 ? 10.853  57.736  54.436  1.00   18.31 ? 254  TRP C CZ2 1 
ATOM   8226  C  CZ3 . TRP C  1 147 ? 13.080  56.782  54.566  1.00   20.31 ? 254  TRP C CZ3 1 
ATOM   8227  C  CH2 . TRP C  1 147 ? 11.702  56.741  54.856  1.00   19.73 ? 254  TRP C CH2 1 
ATOM   8228  N  N   . GLY C  1 148 ? 16.156  58.306  51.404  1.00   19.29 ? 255  GLY C N   1 
ATOM   8229  C  CA  . GLY C  1 148 ? 16.567  56.930  51.564  1.00   18.71 ? 255  GLY C CA  1 
ATOM   8230  C  C   . GLY C  1 148 ? 17.958  56.827  52.151  1.00   20.87 ? 255  GLY C C   1 
ATOM   8231  O  O   . GLY C  1 148 ? 18.496  57.813  52.656  1.00   22.65 ? 255  GLY C O   1 
ATOM   8232  N  N   . PRO C  1 149 ? 18.558  55.629  52.124  1.00   21.36 ? 256  PRO C N   1 
ATOM   8233  C  CA  . PRO C  1 149 ? 19.901  55.418  52.657  1.00   19.65 ? 256  PRO C CA  1 
ATOM   8234  C  C   . PRO C  1 149 ? 20.899  56.256  51.862  1.00   22.29 ? 256  PRO C C   1 
ATOM   8235  O  O   . PRO C  1 149 ? 20.654  56.615  50.713  1.00   21.06 ? 256  PRO C O   1 
ATOM   8236  C  CB  . PRO C  1 149 ? 20.120  53.921  52.453  1.00   19.87 ? 256  PRO C CB  1 
ATOM   8237  C  CG  . PRO C  1 149 ? 18.737  53.364  52.527  1.00   20.87 ? 256  PRO C CG  1 
ATOM   8238  C  CD  . PRO C  1 149 ? 17.965  54.351  51.699  1.00   20.64 ? 256  PRO C CD  1 
ATOM   8239  N  N   . GLU C  1 150 ? 22.030  56.546  52.481  1.00   23.57 ? 257  GLU C N   1 
ATOM   8240  C  CA  . GLU C  1 150 ? 23.067  57.344  51.868  1.00   23.73 ? 257  GLU C CA  1 
ATOM   8241  C  C   . GLU C  1 150 ? 23.524  56.785  50.517  1.00   23.32 ? 257  GLU C C   1 
ATOM   8242  O  O   . GLU C  1 150 ? 23.666  55.573  50.350  1.00   22.60 ? 257  GLU C O   1 
ATOM   8243  C  CB  . GLU C  1 150 ? 24.253  57.436  52.827  1.00   26.25 ? 257  GLU C CB  1 
ATOM   8244  C  CG  . GLU C  1 150 ? 25.280  58.480  52.420  1.00   38.70 ? 257  GLU C CG  1 
ATOM   8245  C  CD  . GLU C  1 150 ? 26.389  58.650  53.442  1.00   44.08 ? 257  GLU C CD  1 
ATOM   8246  O  OE1 . GLU C  1 150 ? 27.365  59.382  53.143  1.00   44.26 ? 257  GLU C OE1 1 
ATOM   8247  O  OE2 . GLU C  1 150 ? 26.279  58.054  54.542  1.00   47.29 ? 257  GLU C OE2 1 
ATOM   8248  N  N   . ASP C  1 151 ? 23.751  57.678  49.555  1.00   22.22 ? 258  ASP C N   1 
ATOM   8249  C  CA  . ASP C  1 151 ? 24.199  57.279  48.219  1.00   23.24 ? 258  ASP C CA  1 
ATOM   8250  C  C   . ASP C  1 151 ? 25.720  57.368  48.031  1.00   23.80 ? 258  ASP C C   1 
ATOM   8251  O  O   . ASP C  1 151 ? 26.193  57.897  47.028  1.00   24.63 ? 258  ASP C O   1 
ATOM   8252  C  CB  . ASP C  1 151 ? 23.537  58.152  47.147  1.00   22.33 ? 258  ASP C CB  1 
ATOM   8253  C  CG  . ASP C  1 151 ? 22.039  57.972  47.083  1.00   21.26 ? 258  ASP C CG  1 
ATOM   8254  O  OD1 . ASP C  1 151 ? 21.551  56.841  47.293  1.00   16.57 ? 258  ASP C OD1 1 
ATOM   8255  O  OD2 . ASP C  1 151 ? 21.347  58.966  46.792  1.00   23.41 ? 258  ASP C OD2 1 
ATOM   8256  N  N   . ASP C  1 152 ? 26.493  56.848  48.972  1.00   24.74 ? 259  ASP C N   1 
ATOM   8257  C  CA  . ASP C  1 152 ? 27.935  56.928  48.834  1.00   24.08 ? 259  ASP C CA  1 
ATOM   8258  C  C   . ASP C  1 152 ? 28.487  55.841  47.927  1.00   23.56 ? 259  ASP C C   1 
ATOM   8259  O  O   . ASP C  1 152 ? 29.667  55.846  47.606  1.00   23.59 ? 259  ASP C O   1 
ATOM   8260  C  CB  . ASP C  1 152 ? 28.598  56.857  50.205  1.00   24.23 ? 259  ASP C CB  1 
ATOM   8261  C  CG  . ASP C  1 152 ? 28.129  55.676  50.999  1.00   27.13 ? 259  ASP C CG  1 
ATOM   8262  O  OD1 . ASP C  1 152 ? 27.550  54.749  50.391  1.00   24.86 ? 259  ASP C OD1 1 
ATOM   8263  O  OD2 . ASP C  1 152 ? 28.351  55.669  52.222  1.00   27.92 ? 259  ASP C OD2 1 
ATOM   8264  N  N   . GLY C  1 153 ? 27.635  54.907  47.513  1.00   23.33 ? 260  GLY C N   1 
ATOM   8265  C  CA  . GLY C  1 153 ? 28.087  53.848  46.632  1.00   19.41 ? 260  GLY C CA  1 
ATOM   8266  C  C   . GLY C  1 153 ? 28.812  52.727  47.354  1.00   23.86 ? 260  GLY C C   1 
ATOM   8267  O  O   . GLY C  1 153 ? 29.537  51.940  46.736  1.00   19.24 ? 260  GLY C O   1 
ATOM   8268  N  N   . LYS C  1 154 ? 28.637  52.648  48.669  1.00   22.73 ? 261  LYS C N   1 
ATOM   8269  C  CA  . LYS C  1 154 ? 29.289  51.584  49.404  1.00   23.76 ? 261  LYS C CA  1 
ATOM   8270  C  C   . LYS C  1 154 ? 28.424  51.057  50.522  1.00   24.11 ? 261  LYS C C   1 
ATOM   8271  O  O   . LYS C  1 154 ? 28.848  50.201  51.296  1.00   28.63 ? 261  LYS C O   1 
ATOM   8272  C  CB  . LYS C  1 154 ? 30.651  52.046  49.933  1.00   24.48 ? 261  LYS C CB  1 
ATOM   8273  C  CG  . LYS C  1 154 ? 30.647  53.298  50.788  1.00   26.47 ? 261  LYS C CG  1 
ATOM   8274  C  CD  . LYS C  1 154 ? 32.078  53.799  50.983  1.00   26.49 ? 261  LYS C CD  1 
ATOM   8275  C  CE  . LYS C  1 154 ? 32.167  54.873  52.059  1.00   26.90 ? 261  LYS C CE  1 
ATOM   8276  N  NZ  . LYS C  1 154 ? 33.560  55.349  52.281  0.0000 26.72 ? 261  LYS C NZ  1 
ATOM   8277  N  N   . THR C  1 155 ? 27.194  51.543  50.615  1.00   24.99 ? 262  THR C N   1 
ATOM   8278  C  CA  . THR C  1 155 ? 26.339  51.043  51.672  1.00   23.08 ? 262  THR C CA  1 
ATOM   8279  C  C   . THR C  1 155 ? 25.244  50.131  51.136  1.00   21.27 ? 262  THR C C   1 
ATOM   8280  O  O   . THR C  1 155 ? 24.829  50.237  49.981  1.00   20.80 ? 262  THR C O   1 
ATOM   8281  C  CB  . THR C  1 155 ? 25.707  52.201  52.542  1.00   24.53 ? 262  THR C CB  1 
ATOM   8282  O  OG1 . THR C  1 155 ? 24.320  52.381  52.241  1.00   27.96 ? 262  THR C OG1 1 
ATOM   8283  C  CG2 . THR C  1 155 ? 26.423  53.477  52.321  1.00   21.80 ? 262  THR C CG2 1 
ATOM   8284  N  N   . VAL C  1 156 ? 24.840  49.191  51.977  1.00   18.26 ? 263  VAL C N   1 
ATOM   8285  C  CA  . VAL C  1 156 ? 23.766  48.266  51.672  1.00   19.59 ? 263  VAL C CA  1 
ATOM   8286  C  C   . VAL C  1 156 ? 22.879  48.498  52.886  1.00   20.54 ? 263  VAL C C   1 
ATOM   8287  O  O   . VAL C  1 156 ? 23.274  48.192  54.013  1.00   18.49 ? 263  VAL C O   1 
ATOM   8288  C  CB  . VAL C  1 156 ? 24.256  46.815  51.634  1.00   17.10 ? 263  VAL C CB  1 
ATOM   8289  C  CG1 . VAL C  1 156 ? 23.071  45.885  51.438  1.00   15.24 ? 263  VAL C CG1 1 
ATOM   8290  C  CG2 . VAL C  1 156 ? 25.250  46.636  50.498  1.00   19.11 ? 263  VAL C CG2 1 
ATOM   8291  N  N   . ASP C  1 157 ? 21.695  49.064  52.666  1.00   20.22 ? 264  ASP C N   1 
ATOM   8292  C  CA  . ASP C  1 157 ? 20.814  49.396  53.781  1.00   20.35 ? 264  ASP C CA  1 
ATOM   8293  C  C   . ASP C  1 157 ? 19.374  49.373  53.298  1.00   20.95 ? 264  ASP C C   1 
ATOM   8294  O  O   . ASP C  1 157 ? 19.111  49.503  52.105  1.00   24.34 ? 264  ASP C O   1 
ATOM   8295  C  CB  . ASP C  1 157 ? 21.212  50.791  54.295  1.00   20.47 ? 264  ASP C CB  1 
ATOM   8296  C  CG  . ASP C  1 157 ? 20.624  51.141  55.665  1.00   24.22 ? 264  ASP C CG  1 
ATOM   8297  O  OD1 . ASP C  1 157 ? 19.880  50.334  56.271  1.00   22.69 ? 264  ASP C OD1 1 
ATOM   8298  O  OD2 . ASP C  1 157 ? 20.927  52.264  56.134  1.00   24.46 ? 264  ASP C OD2 1 
ATOM   8299  N  N   . GLY C  1 158 ? 18.450  49.186  54.233  1.00   20.19 ? 265  GLY C N   1 
ATOM   8300  C  CA  . GLY C  1 158 ? 17.040  49.137  53.908  1.00   21.20 ? 265  GLY C CA  1 
ATOM   8301  C  C   . GLY C  1 158 ? 16.223  49.333  55.171  1.00   21.69 ? 265  GLY C C   1 
ATOM   8302  O  O   . GLY C  1 158 ? 16.784  49.607  56.231  1.00   19.74 ? 265  GLY C O   1 
ATOM   8303  N  N   . PRO C  1 159 ? 14.895  49.181  55.099  1.00   18.09 ? 266  PRO C N   1 
ATOM   8304  C  CA  . PRO C  1 159 ? 14.061  49.366  56.283  1.00   17.16 ? 266  PRO C CA  1 
ATOM   8305  C  C   . PRO C  1 159 ? 14.325  48.370  57.408  1.00   18.39 ? 266  PRO C C   1 
ATOM   8306  O  O   . PRO C  1 159 ? 14.608  47.200  57.155  1.00   16.38 ? 266  PRO C O   1 
ATOM   8307  C  CB  . PRO C  1 159 ? 12.647  49.236  55.722  1.00   17.96 ? 266  PRO C CB  1 
ATOM   8308  C  CG  . PRO C  1 159 ? 12.814  48.266  54.610  1.00   15.86 ? 266  PRO C CG  1 
ATOM   8309  C  CD  . PRO C  1 159 ? 14.093  48.727  53.950  1.00   17.74 ? 266  PRO C CD  1 
ATOM   8310  N  N   . ALA C  1 160 ? 14.236  48.843  58.649  1.00   19.89 ? 267  ALA C N   1 
ATOM   8311  C  CA  . ALA C  1 160 ? 14.402  47.975  59.808  1.00   18.25 ? 267  ALA C CA  1 
ATOM   8312  C  C   . ALA C  1 160 ? 13.029  47.305  60.018  1.00   20.35 ? 267  ALA C C   1 
ATOM   8313  O  O   . ALA C  1 160 ? 12.082  47.564  59.256  1.00   20.68 ? 267  ALA C O   1 
ATOM   8314  C  CB  . ALA C  1 160 ? 14.820  48.793  61.031  1.00   20.60 ? 267  ALA C CB  1 
ATOM   8315  N  N   . ARG C  1 161 ? 12.895  46.473  61.050  1.00   22.36 ? 268  ARG C N   1 
ATOM   8316  C  CA  . ARG C  1 161 ? 11.651  45.726  61.259  1.00   21.58 ? 268  ARG C CA  1 
ATOM   8317  C  C   . ARG C  1 161 ? 10.324  46.470  61.330  1.00   24.03 ? 268  ARG C C   1 
ATOM   8318  O  O   . ARG C  1 161 ? 9.356   46.056  60.677  1.00   24.46 ? 268  ARG C O   1 
ATOM   8319  C  CB  . ARG C  1 161 ? 11.803  44.793  62.465  1.00   25.80 ? 268  ARG C CB  1 
ATOM   8320  C  CG  . ARG C  1 161 ? 13.152  44.075  62.423  1.00   33.56 ? 268  ARG C CG  1 
ATOM   8321  C  CD  . ARG C  1 161 ? 13.235  42.846  63.300  0.0000 31.24 ? 268  ARG C CD  1 
ATOM   8322  N  NE  . ARG C  1 161 ? 14.600  42.582  63.765  0.0000 32.00 ? 268  ARG C NE  1 
ATOM   8323  C  CZ  . ARG C  1 161 ? 15.707  42.721  63.036  0.0000 31.83 ? 268  ARG C CZ  1 
ATOM   8324  N  NH1 . ARG C  1 161 ? 15.649  43.131  61.776  0.0000 31.92 ? 268  ARG C NH1 1 
ATOM   8325  N  NH2 . ARG C  1 161 ? 16.887  42.446  63.577  0.0000 31.92 ? 268  ARG C NH2 1 
ATOM   8326  N  N   . LEU C  1 162 ? 10.243  47.550  62.103  1.00   20.53 ? 269  LEU C N   1 
ATOM   8327  C  CA  . LEU C  1 162 ? 8.980   48.276  62.183  1.00   18.74 ? 269  LEU C CA  1 
ATOM   8328  C  C   . LEU C  1 162 ? 8.583   48.865  60.832  1.00   17.88 ? 269  LEU C C   1 
ATOM   8329  O  O   . LEU C  1 162 ? 7.417   48.804  60.441  1.00   19.23 ? 269  LEU C O   1 
ATOM   8330  C  CB  . LEU C  1 162 ? 9.063   49.375  63.240  1.00   18.39 ? 269  LEU C CB  1 
ATOM   8331  C  CG  . LEU C  1 162 ? 9.188   48.824  64.664  1.00   21.36 ? 269  LEU C CG  1 
ATOM   8332  C  CD1 . LEU C  1 162 ? 9.360   49.978  65.629  1.00   17.03 ? 269  LEU C CD1 1 
ATOM   8333  C  CD2 . LEU C  1 162 ? 7.942   47.981  65.017  1.00   20.31 ? 269  LEU C CD2 1 
ATOM   8334  N  N   . ALA C  1 163 ? 9.549   49.418  60.107  1.00   19.15 ? 270  ALA C N   1 
ATOM   8335  C  CA  . ALA C  1 163 ? 9.253   49.993  58.798  1.00   20.39 ? 270  ALA C CA  1 
ATOM   8336  C  C   . ALA C  1 163 ? 8.803   48.894  57.839  1.00   20.47 ? 270  ALA C C   1 
ATOM   8337  O  O   . ALA C  1 163 ? 7.895   49.110  57.042  1.00   22.82 ? 270  ALA C O   1 
ATOM   8338  C  CB  . ALA C  1 163 ? 10.476  50.724  58.247  1.00   18.54 ? 270  ALA C CB  1 
ATOM   8339  N  N   . GLU C  1 164 ? 9.432   47.718  57.918  1.00   21.56 ? 271  GLU C N   1 
ATOM   8340  C  CA  . GLU C  1 164 ? 9.054   46.596  57.055  1.00   22.72 ? 271  GLU C CA  1 
ATOM   8341  C  C   . GLU C  1 164 ? 7.630   46.197  57.350  1.00   21.58 ? 271  GLU C C   1 
ATOM   8342  O  O   . GLU C  1 164 ? 6.845   45.952  56.444  1.00   21.84 ? 271  GLU C O   1 
ATOM   8343  C  CB  . GLU C  1 164 ? 9.916   45.357  57.298  1.00   26.45 ? 271  GLU C CB  1 
ATOM   8344  C  CG  . GLU C  1 164 ? 11.261  45.335  56.609  1.00   34.42 ? 271  GLU C CG  1 
ATOM   8345  C  CD  . GLU C  1 164 ? 11.917  43.961  56.707  1.00   39.09 ? 271  GLU C CD  1 
ATOM   8346  O  OE1 . GLU C  1 164 ? 11.825  43.170  55.737  1.00   41.41 ? 271  GLU C OE1 1 
ATOM   8347  O  OE2 . GLU C  1 164 ? 12.507  43.672  57.769  1.00   39.81 ? 271  GLU C OE2 1 
ATOM   8348  N  N   . GLU C  1 165 ? 7.311   46.101  58.633  1.00   20.77 ? 272  GLU C N   1 
ATOM   8349  C  CA  . GLU C  1 165 ? 5.964   45.741  59.042  1.00   17.83 ? 272  GLU C CA  1 
ATOM   8350  C  C   . GLU C  1 165 ? 4.967   46.807  58.567  1.00   16.28 ? 272  GLU C C   1 
ATOM   8351  O  O   . GLU C  1 165 ? 3.839   46.482  58.202  1.00   16.75 ? 272  GLU C O   1 
ATOM   8352  C  CB  . GLU C  1 165 ? 5.913   45.571  60.579  1.00   20.62 ? 272  GLU C CB  1 
ATOM   8353  C  CG  . GLU C  1 165 ? 6.681   44.311  61.071  1.00   17.79 ? 272  GLU C CG  1 
ATOM   8354  C  CD  . GLU C  1 165 ? 6.643   44.120  62.585  1.00   25.24 ? 272  GLU C CD  1 
ATOM   8355  O  OE1 . GLU C  1 165 ? 6.922   42.988  63.053  1.00   22.10 ? 272  GLU C OE1 1 
ATOM   8356  O  OE2 . GLU C  1 165 ? 6.339   45.098  63.311  1.00   21.94 ? 272  GLU C OE2 1 
ATOM   8357  N  N   . ALA C  1 166 ? 5.385   48.069  58.556  1.00   12.76 ? 273  ALA C N   1 
ATOM   8358  C  CA  . ALA C  1 166 ? 4.496   49.143  58.118  1.00   15.64 ? 273  ALA C CA  1 
ATOM   8359  C  C   . ALA C  1 166 ? 4.200   48.955  56.623  1.00   15.49 ? 273  ALA C C   1 
ATOM   8360  O  O   . ALA C  1 166 ? 3.053   49.104  56.182  1.00   14.11 ? 273  ALA C O   1 
ATOM   8361  C  CB  . ALA C  1 166 ? 5.145   50.536  58.382  1.00   12.57 ? 273  ALA C CB  1 
ATOM   8362  N  N   . PHE C  1 167 ? 5.231   48.620  55.847  1.00   13.55 ? 274  PHE C N   1 
ATOM   8363  C  CA  . PHE C  1 167 ? 5.040   48.392  54.414  1.00   14.31 ? 274  PHE C CA  1 
ATOM   8364  C  C   . PHE C  1 167 ? 4.052   47.237  54.215  1.00   17.23 ? 274  PHE C C   1 
ATOM   8365  O  O   . PHE C  1 167 ? 3.082   47.345  53.456  1.00   15.73 ? 274  PHE C O   1 
ATOM   8366  C  CB  . PHE C  1 167 ? 6.360   48.006  53.734  1.00   15.19 ? 274  PHE C CB  1 
ATOM   8367  C  CG  . PHE C  1 167 ? 7.208   49.174  53.320  1.00   18.15 ? 274  PHE C CG  1 
ATOM   8368  C  CD1 . PHE C  1 167 ? 6.695   50.171  52.501  1.00   17.04 ? 274  PHE C CD1 1 
ATOM   8369  C  CD2 . PHE C  1 167 ? 8.538   49.259  53.722  1.00   16.71 ? 274  PHE C CD2 1 
ATOM   8370  C  CE1 . PHE C  1 167 ? 7.496   51.241  52.083  1.00   14.87 ? 274  PHE C CE1 1 
ATOM   8371  C  CE2 . PHE C  1 167 ? 9.341   50.323  53.308  1.00   16.80 ? 274  PHE C CE2 1 
ATOM   8372  C  CZ  . PHE C  1 167 ? 8.815   51.316  52.485  1.00   15.78 ? 274  PHE C CZ  1 
ATOM   8373  N  N   . PHE C  1 168 ? 4.304   46.131  54.908  1.00   15.00 ? 275  PHE C N   1 
ATOM   8374  C  CA  . PHE C  1 168 ? 3.461   44.939  54.791  1.00   17.10 ? 275  PHE C CA  1 
ATOM   8375  C  C   . PHE C  1 168 ? 2.012   45.191  55.220  1.00   16.20 ? 275  PHE C C   1 
ATOM   8376  O  O   . PHE C  1 168 ? 1.067   44.749  54.550  1.00   15.07 ? 275  PHE C O   1 
ATOM   8377  C  CB  . PHE C  1 168 ? 4.065   43.807  55.628  1.00   20.76 ? 275  PHE C CB  1 
ATOM   8378  C  CG  . PHE C  1 168 ? 3.995   42.447  54.981  1.00   30.33 ? 275  PHE C CG  1 
ATOM   8379  C  CD1 . PHE C  1 168 ? 3.049   42.156  54.008  1.00   34.74 ? 275  PHE C CD1 1 
ATOM   8380  C  CD2 . PHE C  1 168 ? 4.862   41.434  55.383  1.00   35.90 ? 275  PHE C CD2 1 
ATOM   8381  C  CE1 . PHE C  1 168 ? 2.964   40.881  53.446  1.00   34.86 ? 275  PHE C CE1 1 
ATOM   8382  C  CE2 . PHE C  1 168 ? 4.780   40.151  54.822  1.00   36.63 ? 275  PHE C CE2 1 
ATOM   8383  C  CZ  . PHE C  1 168 ? 3.826   39.883  53.853  1.00   34.15 ? 275  PHE C CZ  1 
ATOM   8384  N  N   . ARG C  1 169 ? 1.827   45.882  56.342  1.00   14.94 ? 276  ARG C N   1 
ATOM   8385  C  CA  . ARG C  1 169 ? 0.473   46.186  56.806  1.00   15.56 ? 276  ARG C CA  1 
ATOM   8386  C  C   . ARG C  1 169 ? -0.160  47.097  55.759  1.00   14.97 ? 276  ARG C C   1 
ATOM   8387  O  O   . ARG C  1 169 ? -1.332  46.957  55.435  1.00   15.67 ? 276  ARG C O   1 
ATOM   8388  C  CB  . ARG C  1 169 ? 0.510   46.896  58.168  1.00   14.95 ? 276  ARG C CB  1 
ATOM   8389  C  CG  . ARG C  1 169 ? 1.055   46.031  59.298  1.00   16.84 ? 276  ARG C CG  1 
ATOM   8390  C  CD  . ARG C  1 169 ? 1.119   46.809  60.615  1.00   17.06 ? 276  ARG C CD  1 
ATOM   8391  N  NE  . ARG C  1 169 ? -0.208  47.070  61.178  1.00   19.16 ? 276  ARG C NE  1 
ATOM   8392  C  CZ  . ARG C  1 169 ? -0.897  46.219  61.944  1.00   20.47 ? 276  ARG C CZ  1 
ATOM   8393  N  NH1 . ARG C  1 169 ? -2.093  46.564  62.390  1.00   18.77 ? 276  ARG C NH1 1 
ATOM   8394  N  NH2 . ARG C  1 169 ? -0.396  45.031  62.284  1.00   21.38 ? 276  ARG C NH2 1 
ATOM   8395  N  N   . GLY C  1 170 ? 0.631   48.032  55.234  1.00   15.65 ? 277  GLY C N   1 
ATOM   8396  C  CA  . GLY C  1 170 ? 0.125   48.953  54.229  1.00   14.80 ? 277  GLY C CA  1 
ATOM   8397  C  C   . GLY C  1 170 ? -0.433  48.302  52.972  1.00   17.03 ? 277  GLY C C   1 
ATOM   8398  O  O   . GLY C  1 170 ? -1.576  48.568  52.601  1.00   19.34 ? 277  GLY C O   1 
ATOM   8399  N  N   . VAL C  1 171 ? 0.349   47.455  52.299  1.00   16.01 ? 278  VAL C N   1 
ATOM   8400  C  CA  . VAL C  1 171 ? -0.159  46.832  51.080  1.00   17.32 ? 278  VAL C CA  1 
ATOM   8401  C  C   . VAL C  1 171 ? -1.244  45.796  51.370  1.00   19.38 ? 278  VAL C C   1 
ATOM   8402  O  O   . VAL C  1 171 ? -2.052  45.480  50.504  1.00   19.30 ? 278  VAL C O   1 
ATOM   8403  C  CB  . VAL C  1 171 ? 0.968   46.167  50.252  1.00   18.96 ? 278  VAL C CB  1 
ATOM   8404  C  CG1 . VAL C  1 171 ? 1.935   47.237  49.743  1.00   16.32 ? 278  VAL C CG1 1 
ATOM   8405  C  CG2 . VAL C  1 171 ? 1.689   45.113  51.084  1.00   16.63 ? 278  VAL C CG2 1 
ATOM   8406  N  N   . SER C  1 172 ? -1.270  45.279  52.594  1.00   19.69 ? 279  SER C N   1 
ATOM   8407  C  CA  . SER C  1 172 ? -2.270  44.284  52.980  1.00   21.31 ? 279  SER C CA  1 
ATOM   8408  C  C   . SER C  1 172 ? -3.581  44.886  53.416  1.00   21.39 ? 279  SER C C   1 
ATOM   8409  O  O   . SER C  1 172 ? -4.638  44.462  52.957  1.00   20.58 ? 279  SER C O   1 
ATOM   8410  C  CB  . SER C  1 172 ? -1.779  43.422  54.151  1.00   19.43 ? 279  SER C CB  1 
ATOM   8411  O  OG  . SER C  1 172 ? -0.559  42.799  53.839  1.00   30.79 ? 279  SER C OG  1 
ATOM   8412  N  N   . GLN C  1 173 ? -3.506  45.866  54.310  1.00   22.02 ? 280  GLN C N   1 
ATOM   8413  C  CA  . GLN C  1 173 ? -4.707  46.478  54.870  1.00   25.99 ? 280  GLN C CA  1 
ATOM   8414  C  C   . GLN C  1 173 ? -5.030  47.910  54.476  1.00   24.71 ? 280  GLN C C   1 
ATOM   8415  O  O   . GLN C  1 173 ? -6.183  48.315  54.552  1.00   28.31 ? 280  GLN C O   1 
ATOM   8416  C  CB  . GLN C  1 173 ? -4.637  46.367  56.391  1.00   26.40 ? 280  GLN C CB  1 
ATOM   8417  C  CG  . GLN C  1 173 ? -4.374  44.946  56.838  1.00   32.52 ? 280  GLN C CG  1 
ATOM   8418  C  CD  . GLN C  1 173 ? -3.739  44.865  58.207  1.00   38.04 ? 280  GLN C CD  1 
ATOM   8419  O  OE1 . GLN C  1 173 ? -3.098  43.871  58.543  1.00   43.34 ? 280  GLN C OE1 1 
ATOM   8420  N  NE2 . GLN C  1 173 ? -3.914  45.909  59.007  1.00   42.21 ? 280  GLN C NE2 1 
ATOM   8421  N  N   . GLY C  1 174 ? -4.031  48.678  54.061  1.00   25.18 ? 281  GLY C N   1 
ATOM   8422  C  CA  . GLY C  1 174 ? -4.284  50.060  53.675  1.00   22.78 ? 281  GLY C CA  1 
ATOM   8423  C  C   . GLY C  1 174 ? -5.357  50.180  52.612  1.00   22.76 ? 281  GLY C C   1 
ATOM   8424  O  O   . GLY C  1 174 ? -5.640  49.210  51.900  1.00   21.85 ? 281  GLY C O   1 
ATOM   8425  N  N   . ARG C  1 175 ? -5.942  51.372  52.497  1.00   23.13 ? 282  ARG C N   1 
ATOM   8426  C  CA  . ARG C  1 175 ? -6.997  51.638  51.520  1.00   24.55 ? 282  ARG C CA  1 
ATOM   8427  C  C   . ARG C  1 175 ? -8.073  50.553  51.530  1.00   26.34 ? 282  ARG C C   1 
ATOM   8428  O  O   . ARG C  1 175 ? -8.436  50.009  50.485  1.00   25.54 ? 282  ARG C O   1 
ATOM   8429  C  CB  . ARG C  1 175 ? -6.431  51.749  50.101  1.00   25.15 ? 282  ARG C CB  1 
ATOM   8430  C  CG  . ARG C  1 175 ? -5.659  53.013  49.795  1.00   29.31 ? 282  ARG C CG  1 
ATOM   8431  C  CD  . ARG C  1 175 ? -4.975  52.865  48.441  1.00   27.80 ? 282  ARG C CD  1 
ATOM   8432  N  NE  . ARG C  1 175 ? -5.957  52.651  47.400  1.00   26.24 ? 282  ARG C NE  1 
ATOM   8433  C  CZ  . ARG C  1 175 ? -5.823  51.787  46.401  1.00   26.61 ? 282  ARG C CZ  1 
ATOM   8434  N  NH1 . ARG C  1 175 ? -4.737  51.033  46.288  1.00   18.59 ? 282  ARG C NH1 1 
ATOM   8435  N  NH2 . ARG C  1 175 ? -6.800  51.672  45.518  1.00   26.73 ? 282  ARG C NH2 1 
ATOM   8436  N  N   . GLY C  1 176 ? -8.578  50.238  52.716  1.00   26.27 ? 283  GLY C N   1 
ATOM   8437  C  CA  . GLY C  1 176 ? -9.620  49.236  52.821  1.00   23.77 ? 283  GLY C CA  1 
ATOM   8438  C  C   . GLY C  1 176 ? -9.245  47.890  52.232  1.00   25.01 ? 283  GLY C C   1 
ATOM   8439  O  O   . GLY C  1 176 ? -10.096 47.195  51.698  1.00   25.04 ? 283  GLY C O   1 
ATOM   8440  N  N   . GLY C  1 177 ? -7.975  47.512  52.319  1.00   23.47 ? 284  GLY C N   1 
ATOM   8441  C  CA  . GLY C  1 177 ? -7.570  46.222  51.789  1.00   23.29 ? 284  GLY C CA  1 
ATOM   8442  C  C   . GLY C  1 177 ? -7.012  46.234  50.377  1.00   22.15 ? 284  GLY C C   1 
ATOM   8443  O  O   . GLY C  1 177 ? -6.461  45.230  49.923  1.00   23.29 ? 284  GLY C O   1 
ATOM   8444  N  N   . LEU C  1 178 ? -7.152  47.354  49.674  1.00   20.17 ? 285  LEU C N   1 
ATOM   8445  C  CA  . LEU C  1 178 ? -6.631  47.458  48.314  1.00   20.71 ? 285  LEU C CA  1 
ATOM   8446  C  C   . LEU C  1 178 ? -5.109  47.634  48.365  1.00   21.40 ? 285  LEU C C   1 
ATOM   8447  O  O   . LEU C  1 178 ? -4.400  47.283  47.422  1.00   20.40 ? 285  LEU C O   1 
ATOM   8448  C  CB  . LEU C  1 178 ? -7.282  48.642  47.590  1.00   20.56 ? 285  LEU C CB  1 
ATOM   8449  C  CG  . LEU C  1 178 ? -8.808  48.532  47.480  1.00   24.16 ? 285  LEU C CG  1 
ATOM   8450  C  CD1 . LEU C  1 178 ? -9.398  49.775  46.805  1.00   22.52 ? 285  LEU C CD1 1 
ATOM   8451  C  CD2 . LEU C  1 178 ? -9.150  47.280  46.701  1.00   22.84 ? 285  LEU C CD2 1 
ATOM   8452  N  N   . GLY C  1 179 ? -4.626  48.187  49.476  1.00   20.97 ? 286  GLY C N   1 
ATOM   8453  C  CA  . GLY C  1 179 ? -3.202  48.382  49.672  1.00   19.87 ? 286  GLY C CA  1 
ATOM   8454  C  C   . GLY C  1 179 ? -2.656  49.780  49.420  1.00   19.59 ? 286  GLY C C   1 
ATOM   8455  O  O   . GLY C  1 179 ? -2.879  50.357  48.364  1.00   21.58 ? 286  GLY C O   1 
ATOM   8456  N  N   . SER C  1 180 ? -1.931  50.316  50.396  1.00   20.80 ? 287  SER C N   1 
ATOM   8457  C  CA  . SER C  1 180 ? -1.310  51.638  50.281  1.00   17.95 ? 287  SER C CA  1 
ATOM   8458  C  C   . SER C  1 180 ? -0.378  51.667  49.069  1.00   18.15 ? 287  SER C C   1 
ATOM   8459  O  O   . SER C  1 180 ? 0.249   50.658  48.742  1.00   16.96 ? 287  SER C O   1 
ATOM   8460  C  CB  . SER C  1 180 ? -0.468  51.939  51.528  1.00   14.85 ? 287  SER C CB  1 
ATOM   8461  O  OG  . SER C  1 180 ? -1.249  51.946  52.708  1.00   15.88 ? 287  SER C OG  1 
ATOM   8462  N  N   . ILE C  1 181 ? -0.279  52.817  48.405  1.00   18.91 ? 288  ILE C N   1 
ATOM   8463  C  CA  . ILE C  1 181 ? 0.622   52.952  47.263  1.00   19.17 ? 288  ILE C CA  1 
ATOM   8464  C  C   . ILE C  1 181 ? 1.856   53.708  47.756  1.00   19.95 ? 288  ILE C C   1 
ATOM   8465  O  O   . ILE C  1 181 ? 1.747   54.860  48.172  1.00   19.00 ? 288  ILE C O   1 
ATOM   8466  C  CB  . ILE C  1 181 ? -0.005  53.771  46.112  1.00   21.51 ? 288  ILE C CB  1 
ATOM   8467  C  CG1 . ILE C  1 181 ? -1.291  53.103  45.611  1.00   20.46 ? 288  ILE C CG1 1 
ATOM   8468  C  CG2 . ILE C  1 181 ? 1.002   53.898  44.977  1.00   17.39 ? 288  ILE C CG2 1 
ATOM   8469  C  CD1 . ILE C  1 181 ? -1.085  51.712  45.143  1.00   24.64 ? 288  ILE C CD1 1 
ATOM   8470  N  N   . PHE C  1 182 ? 3.018   53.055  47.722  1.00   18.45 ? 289  PHE C N   1 
ATOM   8471  C  CA  . PHE C  1 182 ? 4.273   53.665  48.166  1.00   17.04 ? 289  PHE C CA  1 
ATOM   8472  C  C   . PHE C  1 182 ? 5.157   53.988  46.961  1.00   17.98 ? 289  PHE C C   1 
ATOM   8473  O  O   . PHE C  1 182 ? 5.646   53.080  46.284  1.00   19.39 ? 289  PHE C O   1 
ATOM   8474  C  CB  . PHE C  1 182 ? 5.036   52.712  49.101  1.00   17.56 ? 289  PHE C CB  1 
ATOM   8475  C  CG  . PHE C  1 182 ? 4.303   52.385  50.375  1.00   16.05 ? 289  PHE C CG  1 
ATOM   8476  C  CD1 . PHE C  1 182 ? 4.196   53.323  51.397  1.00   13.87 ? 289  PHE C CD1 1 
ATOM   8477  C  CD2 . PHE C  1 182 ? 3.703   51.140  50.547  1.00   15.44 ? 289  PHE C CD2 1 
ATOM   8478  C  CE1 . PHE C  1 182 ? 3.500   53.026  52.583  1.00   15.70 ? 289  PHE C CE1 1 
ATOM   8479  C  CE2 . PHE C  1 182 ? 3.003   50.834  51.733  1.00   15.35 ? 289  PHE C CE2 1 
ATOM   8480  C  CZ  . PHE C  1 182 ? 2.907   51.783  52.747  1.00   14.74 ? 289  PHE C CZ  1 
ATOM   8481  N  N   . VAL C  1 183 ? 5.354   55.278  46.697  1.00   15.36 ? 290  VAL C N   1 
ATOM   8482  C  CA  . VAL C  1 183 ? 6.184   55.726  45.587  1.00   16.21 ? 290  VAL C CA  1 
ATOM   8483  C  C   . VAL C  1 183 ? 7.552   56.155  46.134  1.00   18.49 ? 290  VAL C C   1 
ATOM   8484  O  O   . VAL C  1 183 ? 7.630   56.951  47.060  1.00   18.93 ? 290  VAL C O   1 
ATOM   8485  C  CB  . VAL C  1 183 ? 5.521   56.913  44.863  1.00   18.69 ? 290  VAL C CB  1 
ATOM   8486  C  CG1 . VAL C  1 183 ? 6.334   57.298  43.624  1.00   16.65 ? 290  VAL C CG1 1 
ATOM   8487  C  CG2 . VAL C  1 183 ? 4.096   56.539  44.476  1.00   17.74 ? 290  VAL C CG2 1 
ATOM   8488  N  N   . TRP C  1 184 ? 8.628   55.620  45.565  1.00   17.74 ? 291  TRP C N   1 
ATOM   8489  C  CA  . TRP C  1 184 ? 9.975   55.926  46.047  1.00   17.17 ? 291  TRP C CA  1 
ATOM   8490  C  C   . TRP C  1 184 ? 10.923  56.485  44.986  1.00   17.44 ? 291  TRP C C   1 
ATOM   8491  O  O   . TRP C  1 184 ? 10.883  56.074  43.823  1.00   19.08 ? 291  TRP C O   1 
ATOM   8492  C  CB  . TRP C  1 184 ? 10.596  54.655  46.649  1.00   14.51 ? 291  TRP C CB  1 
ATOM   8493  C  CG  . TRP C  1 184 ? 11.287  54.889  47.953  1.00   17.60 ? 291  TRP C CG  1 
ATOM   8494  C  CD1 . TRP C  1 184 ? 12.581  55.297  48.138  1.00   15.58 ? 291  TRP C CD1 1 
ATOM   8495  C  CD2 . TRP C  1 184 ? 10.695  54.821  49.267  1.00   16.48 ? 291  TRP C CD2 1 
ATOM   8496  N  NE1 . TRP C  1 184 ? 12.828  55.491  49.484  1.00   18.05 ? 291  TRP C NE1 1 
ATOM   8497  C  CE2 . TRP C  1 184 ? 11.691  55.207  50.197  1.00   14.77 ? 291  TRP C CE2 1 
ATOM   8498  C  CE3 . TRP C  1 184 ? 9.418   54.477  49.745  1.00   17.23 ? 291  TRP C CE3 1 
ATOM   8499  C  CZ2 . TRP C  1 184 ? 11.454  55.262  51.578  1.00   15.09 ? 291  TRP C CZ2 1 
ATOM   8500  C  CZ3 . TRP C  1 184 ? 9.179   54.532  51.129  1.00   11.79 ? 291  TRP C CZ3 1 
ATOM   8501  C  CH2 . TRP C  1 184 ? 10.197  54.924  52.024  1.00   16.97 ? 291  TRP C CH2 1 
ATOM   8502  N  N   . ALA C  1 185 ? 11.771  57.425  45.399  1.00   16.91 ? 292  ALA C N   1 
ATOM   8503  C  CA  . ALA C  1 185 ? 12.776  58.020  44.514  1.00   15.45 ? 292  ALA C CA  1 
ATOM   8504  C  C   . ALA C  1 185 ? 13.908  57.001  44.489  1.00   15.61 ? 292  ALA C C   1 
ATOM   8505  O  O   . ALA C  1 185 ? 14.359  56.574  45.544  1.00   18.20 ? 292  ALA C O   1 
ATOM   8506  C  CB  . ALA C  1 185 ? 13.274  59.357  45.089  1.00   12.32 ? 292  ALA C CB  1 
ATOM   8507  N  N   . SER C  1 186 ? 14.378  56.619  43.306  1.00   15.77 ? 293  SER C N   1 
ATOM   8508  C  CA  . SER C  1 186 ? 15.420  55.600  43.217  1.00   19.02 ? 293  SER C CA  1 
ATOM   8509  C  C   . SER C  1 186 ? 16.817  55.964  43.733  1.00   19.96 ? 293  SER C C   1 
ATOM   8510  O  O   . SER C  1 186 ? 17.606  55.068  44.012  1.00   19.78 ? 293  SER C O   1 
ATOM   8511  C  CB  . SER C  1 186 ? 15.513  55.039  41.779  1.00   17.90 ? 293  SER C CB  1 
ATOM   8512  O  OG  . SER C  1 186 ? 15.904  56.022  40.841  1.00   20.49 ? 293  SER C OG  1 
ATOM   8513  N  N   . GLY C  1 187 ? 17.132  57.254  43.857  1.00   20.18 ? 294  GLY C N   1 
ATOM   8514  C  CA  . GLY C  1 187 ? 18.438  57.636  44.382  1.00   19.54 ? 294  GLY C CA  1 
ATOM   8515  C  C   . GLY C  1 187 ? 19.285  58.624  43.583  1.00   21.31 ? 294  GLY C C   1 
ATOM   8516  O  O   . GLY C  1 187 ? 19.146  58.742  42.366  1.00   21.01 ? 294  GLY C O   1 
ATOM   8517  N  N   . ASN C  1 188 ? 20.172  59.330  44.281  1.00   19.36 ? 295  ASN C N   1 
ATOM   8518  C  CA  . ASN C  1 188 ? 21.063  60.307  43.650  1.00   18.93 ? 295  ASN C CA  1 
ATOM   8519  C  C   . ASN C  1 188 ? 22.530  59.853  43.630  1.00   19.69 ? 295  ASN C C   1 
ATOM   8520  O  O   . ASN C  1 188 ? 23.422  60.684  43.483  1.00   19.69 ? 295  ASN C O   1 
ATOM   8521  C  CB  . ASN C  1 188 ? 21.002  61.657  44.384  1.00   17.57 ? 295  ASN C CB  1 
ATOM   8522  C  CG  . ASN C  1 188 ? 19.814  62.522  43.959  1.00   18.90 ? 295  ASN C CG  1 
ATOM   8523  O  OD1 . ASN C  1 188 ? 19.275  62.374  42.864  1.00   22.19 ? 295  ASN C OD1 1 
ATOM   8524  N  ND2 . ASN C  1 188 ? 19.422  63.453  44.828  1.00   21.34 ? 295  ASN C ND2 1 
ATOM   8525  N  N   . GLY C  1 189 ? 22.788  58.551  43.760  1.00   18.22 ? 296  GLY C N   1 
ATOM   8526  C  CA  . GLY C  1 189 ? 24.166  58.079  43.779  1.00   15.73 ? 296  GLY C CA  1 
ATOM   8527  C  C   . GLY C  1 189 ? 24.898  57.834  42.464  1.00   14.46 ? 296  GLY C C   1 
ATOM   8528  O  O   . GLY C  1 189 ? 25.932  57.168  42.448  1.00   15.96 ? 296  GLY C O   1 
ATOM   8529  N  N   . GLY C  1 190 ? 24.386  58.372  41.364  1.00   15.68 ? 297  GLY C N   1 
ATOM   8530  C  CA  . GLY C  1 190 ? 25.014  58.171  40.065  1.00   15.77 ? 297  GLY C CA  1 
ATOM   8531  C  C   . GLY C  1 190 ? 26.499  58.471  39.981  1.00   19.64 ? 297  GLY C C   1 
ATOM   8532  O  O   . GLY C  1 190 ? 27.263  57.706  39.393  1.00   17.63 ? 297  GLY C O   1 
ATOM   8533  N  N   . ARG C  1 191 ? 26.922  59.585  40.564  1.00   22.94 ? 298  ARG C N   1 
ATOM   8534  C  CA  . ARG C  1 191 ? 28.332  59.946  40.529  1.00   25.54 ? 298  ARG C CA  1 
ATOM   8535  C  C   . ARG C  1 191 ? 29.196  58.961  41.339  1.00   25.97 ? 298  ARG C C   1 
ATOM   8536  O  O   . ARG C  1 191 ? 30.371  58.765  41.033  1.00   25.37 ? 298  ARG C O   1 
ATOM   8537  C  CB  . ARG C  1 191 ? 28.530  61.365  41.061  1.00   30.04 ? 298  ARG C CB  1 
ATOM   8538  C  CG  . ARG C  1 191 ? 29.886  61.920  40.718  1.00   39.65 ? 298  ARG C CG  1 
ATOM   8539  C  CD  . ARG C  1 191 ? 30.447  62.742  41.851  1.00   47.46 ? 298  ARG C CD  1 
ATOM   8540  N  NE  . ARG C  1 191 ? 29.613  63.891  42.165  1.00   53.43 ? 298  ARG C NE  1 
ATOM   8541  C  CZ  . ARG C  1 191 ? 29.845  64.707  43.185  1.00   57.78 ? 298  ARG C CZ  1 
ATOM   8542  N  NH1 . ARG C  1 191 ? 29.043  65.740  43.417  1.00   59.18 ? 298  ARG C NH1 1 
ATOM   8543  N  NH2 . ARG C  1 191 ? 30.883  64.479  43.979  1.00   62.44 ? 298  ARG C NH2 1 
ATOM   8544  N  N   . GLU C  1 192 ? 28.615  58.338  42.361  1.00   22.71 ? 299  GLU C N   1 
ATOM   8545  C  CA  . GLU C  1 192 ? 29.357  57.386  43.187  1.00   22.95 ? 299  GLU C CA  1 
ATOM   8546  C  C   . GLU C  1 192 ? 29.184  55.961  42.678  1.00   24.97 ? 299  GLU C C   1 
ATOM   8547  O  O   . GLU C  1 192 ? 29.560  54.997  43.356  1.00   22.13 ? 299  GLU C O   1 
ATOM   8548  C  CB  . GLU C  1 192 ? 28.889  57.443  44.647  1.00   24.77 ? 299  GLU C CB  1 
ATOM   8549  C  CG  . GLU C  1 192 ? 28.694  58.835  45.197  1.00   34.21 ? 299  GLU C CG  1 
ATOM   8550  C  CD  . GLU C  1 192 ? 29.822  59.762  44.823  1.00   39.90 ? 299  GLU C CD  1 
ATOM   8551  O  OE1 . GLU C  1 192 ? 30.984  59.381  45.066  1.00   44.05 ? 299  GLU C OE1 1 
ATOM   8552  O  OE2 . GLU C  1 192 ? 29.550  60.862  44.290  1.00   43.30 ? 299  GLU C OE2 1 
ATOM   8553  N  N   . HIS C  1 193 ? 28.604  55.826  41.488  1.00   26.86 ? 300  HIS C N   1 
ATOM   8554  C  CA  . HIS C  1 193 ? 28.374  54.514  40.899  1.00   27.13 ? 300  HIS C CA  1 
ATOM   8555  C  C   . HIS C  1 193 ? 27.505  53.635  41.785  1.00   25.02 ? 300  HIS C C   1 
ATOM   8556  O  O   . HIS C  1 193 ? 27.674  52.420  41.818  1.00   25.13 ? 300  HIS C O   1 
ATOM   8557  C  CB  . HIS C  1 193 ? 29.703  53.798  40.641  1.00   32.10 ? 300  HIS C CB  1 
ATOM   8558  C  CG  . HIS C  1 193 ? 30.521  54.421  39.559  1.00   37.07 ? 300  HIS C CG  1 
ATOM   8559  N  ND1 . HIS C  1 193 ? 31.232  55.587  39.740  1.00   42.21 ? 300  HIS C ND1 1 
ATOM   8560  C  CD2 . HIS C  1 193 ? 30.714  54.058  38.270  1.00   41.46 ? 300  HIS C CD2 1 
ATOM   8561  C  CE1 . HIS C  1 193 ? 31.829  55.915  38.608  1.00   42.18 ? 300  HIS C CE1 1 
ATOM   8562  N  NE2 . HIS C  1 193 ? 31.531  55.004  37.700  1.00   44.00 ? 300  HIS C NE2 1 
ATOM   8563  N  N   . ASP C  1 194 ? 26.565  54.247  42.492  1.00   24.01 ? 301  ASP C N   1 
ATOM   8564  C  CA  . ASP C  1 194 ? 25.689  53.502  43.379  1.00   22.51 ? 301  ASP C CA  1 
ATOM   8565  C  C   . ASP C  1 194 ? 24.682  52.657  42.596  1.00   24.03 ? 301  ASP C C   1 
ATOM   8566  O  O   . ASP C  1 194 ? 24.411  52.915  41.426  1.00   27.61 ? 301  ASP C O   1 
ATOM   8567  C  CB  . ASP C  1 194 ? 24.959  54.475  44.313  1.00   20.99 ? 301  ASP C CB  1 
ATOM   8568  C  CG  . ASP C  1 194 ? 24.474  53.803  45.590  1.00   22.42 ? 301  ASP C CG  1 
ATOM   8569  O  OD1 . ASP C  1 194 ? 24.839  52.629  45.818  1.00   18.47 ? 301  ASP C OD1 1 
ATOM   8570  O  OD2 . ASP C  1 194 ? 23.739  54.452  46.362  1.00   20.93 ? 301  ASP C OD2 1 
ATOM   8571  N  N   . SER C  1 195 ? 24.156  51.628  43.245  1.00   23.98 ? 302  SER C N   1 
ATOM   8572  C  CA  . SER C  1 195 ? 23.161  50.741  42.650  1.00   22.90 ? 302  SER C CA  1 
ATOM   8573  C  C   . SER C  1 195 ? 21.909  50.802  43.516  1.00   22.88 ? 302  SER C C   1 
ATOM   8574  O  O   . SER C  1 195 ? 21.986  50.586  44.726  1.00   22.15 ? 302  SER C O   1 
ATOM   8575  C  CB  . SER C  1 195 ? 23.670  49.304  42.625  1.00   24.48 ? 302  SER C CB  1 
ATOM   8576  O  OG  . SER C  1 195 ? 22.584  48.399  42.528  1.00   28.83 ? 302  SER C OG  1 
ATOM   8577  N  N   . CYS C  1 196 ? 20.756  51.079  42.915  1.00   20.25 ? 303  CYS C N   1 
ATOM   8578  C  CA  . CYS C  1 196 ? 19.548  51.156  43.716  1.00   20.75 ? 303  CYS C CA  1 
ATOM   8579  C  C   . CYS C  1 196 ? 19.043  49.801  44.201  1.00   21.79 ? 303  CYS C C   1 
ATOM   8580  O  O   . CYS C  1 196 ? 18.010  49.729  44.862  1.00   23.29 ? 303  CYS C O   1 
ATOM   8581  C  CB  . CYS C  1 196 ? 18.440  51.932  42.985  1.00   19.83 ? 303  CYS C CB  1 
ATOM   8582  S  SG  . CYS C  1 196 ? 18.360  51.813  41.160  1.00   24.97 ? 303  CYS C SG  1 
ATOM   8583  N  N   . ASN C  1 197 ? 19.767  48.726  43.890  1.00   19.44 ? 304  ASN C N   1 
ATOM   8584  C  CA  . ASN C  1 197 ? 19.365  47.411  44.383  1.00   20.58 ? 304  ASN C CA  1 
ATOM   8585  C  C   . ASN C  1 197 ? 19.995  47.189  45.755  1.00   20.93 ? 304  ASN C C   1 
ATOM   8586  O  O   . ASN C  1 197 ? 19.664  46.225  46.448  1.00   20.68 ? 304  ASN C O   1 
ATOM   8587  C  CB  . ASN C  1 197 ? 19.782  46.298  43.421  1.00   22.97 ? 304  ASN C CB  1 
ATOM   8588  C  CG  . ASN C  1 197 ? 18.702  45.980  42.385  1.00   28.38 ? 304  ASN C CG  1 
ATOM   8589  O  OD1 . ASN C  1 197 ? 17.872  46.829  42.021  1.00   27.22 ? 304  ASN C OD1 1 
ATOM   8590  N  ND2 . ASN C  1 197 ? 18.729  44.759  41.886  1.00   29.48 ? 304  ASN C ND2 1 
ATOM   8591  N  N   . CYS C  1 198 ? 20.891  48.101  46.144  1.00   19.97 ? 305  CYS C N   1 
ATOM   8592  C  CA  . CYS C  1 198 ? 21.545  48.043  47.449  1.00   19.15 ? 305  CYS C CA  1 
ATOM   8593  C  C   . CYS C  1 198 ? 20.792  48.939  48.426  1.00   18.55 ? 305  CYS C C   1 
ATOM   8594  O  O   . CYS C  1 198 ? 21.302  49.275  49.493  1.00   17.45 ? 305  CYS C O   1 
ATOM   8595  C  CB  . CYS C  1 198 ? 22.999  48.521  47.356  1.00   20.80 ? 305  CYS C CB  1 
ATOM   8596  S  SG  . CYS C  1 198 ? 24.090  47.404  46.441  1.00   21.44 ? 305  CYS C SG  1 
ATOM   8597  N  N   . ASP C  1 199 ? 19.583  49.323  48.031  1.00   18.91 ? 306  ASP C N   1 
ATOM   8598  C  CA  . ASP C  1 199 ? 18.692  50.184  48.809  1.00   16.91 ? 306  ASP C CA  1 
ATOM   8599  C  C   . ASP C  1 199 ? 17.426  49.345  49.010  1.00   20.10 ? 306  ASP C C   1 
ATOM   8600  O  O   . ASP C  1 199 ? 16.703  49.053  48.052  1.00   19.22 ? 306  ASP C O   1 
ATOM   8601  C  CB  . ASP C  1 199 ? 18.389  51.437  47.986  1.00   18.35 ? 306  ASP C CB  1 
ATOM   8602  C  CG  . ASP C  1 199 ? 17.355  52.348  48.625  1.00   23.38 ? 306  ASP C CG  1 
ATOM   8603  O  OD1 . ASP C  1 199 ? 16.488  51.865  49.390  1.00   25.21 ? 306  ASP C OD1 1 
ATOM   8604  O  OD2 . ASP C  1 199 ? 17.400  53.563  48.326  1.00   20.83 ? 306  ASP C OD2 1 
ATOM   8605  N  N   . GLY C  1 200 ? 17.167  48.949  50.252  1.00   19.68 ? 307  GLY C N   1 
ATOM   8606  C  CA  . GLY C  1 200 ? 16.013  48.113  50.547  1.00   16.29 ? 307  GLY C CA  1 
ATOM   8607  C  C   . GLY C  1 200 ? 14.643  48.755  50.383  1.00   19.51 ? 307  GLY C C   1 
ATOM   8608  O  O   . GLY C  1 200 ? 13.632  48.050  50.373  1.00   13.76 ? 307  GLY C O   1 
ATOM   8609  N  N   . TYR C  1 201 ? 14.594  50.083  50.280  1.00   17.29 ? 308  TYR C N   1 
ATOM   8610  C  CA  . TYR C  1 201 ? 13.319  50.773  50.097  1.00   17.66 ? 308  TYR C CA  1 
ATOM   8611  C  C   . TYR C  1 201 ? 12.922  50.711  48.627  1.00   17.99 ? 308  TYR C C   1 
ATOM   8612  O  O   . TYR C  1 201 ? 11.791  50.350  48.289  1.00   19.09 ? 308  TYR C O   1 
ATOM   8613  C  CB  . TYR C  1 201 ? 13.423  52.247  50.545  1.00   15.58 ? 308  TYR C CB  1 
ATOM   8614  C  CG  . TYR C  1 201 ? 13.778  52.388  52.007  1.00   17.61 ? 308  TYR C CG  1 
ATOM   8615  C  CD1 . TYR C  1 201 ? 15.101  52.294  52.432  1.00   16.17 ? 308  TYR C CD1 1 
ATOM   8616  C  CD2 . TYR C  1 201 ? 12.780  52.536  52.975  1.00   17.16 ? 308  TYR C CD2 1 
ATOM   8617  C  CE1 . TYR C  1 201 ? 15.423  52.340  53.788  1.00   21.52 ? 308  TYR C CE1 1 
ATOM   8618  C  CE2 . TYR C  1 201 ? 13.087  52.589  54.332  1.00   17.91 ? 308  TYR C CE2 1 
ATOM   8619  C  CZ  . TYR C  1 201 ? 14.411  52.485  54.733  1.00   18.34 ? 308  TYR C CZ  1 
ATOM   8620  O  OH  . TYR C  1 201 ? 14.723  52.502  56.068  1.00   18.86 ? 308  TYR C OH  1 
ATOM   8621  N  N   . THR C  1 202 ? 13.856  51.075  47.755  1.00   13.89 ? 309  THR C N   1 
ATOM   8622  C  CA  . THR C  1 202 ? 13.587  51.047  46.327  1.00   17.01 ? 309  THR C CA  1 
ATOM   8623  C  C   . THR C  1 202 ? 13.455  49.600  45.830  1.00   17.53 ? 309  THR C C   1 
ATOM   8624  O  O   . THR C  1 202 ? 12.606  49.298  45.005  1.00   16.27 ? 309  THR C O   1 
ATOM   8625  C  CB  . THR C  1 202 ? 14.712  51.755  45.533  1.00   15.44 ? 309  THR C CB  1 
ATOM   8626  O  OG1 . THR C  1 202 ? 15.982  51.205  45.892  1.00   14.26 ? 309  THR C OG1 1 
ATOM   8627  C  CG2 . THR C  1 202 ? 14.717  53.234  45.825  1.00   14.20 ? 309  THR C CG2 1 
ATOM   8628  N  N   . ASN C  1 203 ? 14.297  48.722  46.370  1.00   19.00 ? 310  ASN C N   1 
ATOM   8629  C  CA  . ASN C  1 203 ? 14.365  47.304  46.021  1.00   18.19 ? 310  ASN C CA  1 
ATOM   8630  C  C   . ASN C  1 203 ? 13.128  46.496  46.456  1.00   18.97 ? 310  ASN C C   1 
ATOM   8631  O  O   . ASN C  1 203 ? 12.899  45.383  45.991  1.00   18.51 ? 310  ASN C O   1 
ATOM   8632  C  CB  . ASN C  1 203 ? 15.634  46.746  46.674  1.00   24.51 ? 310  ASN C CB  1 
ATOM   8633  C  CG  . ASN C  1 203 ? 15.999  45.371  46.199  1.00   30.29 ? 310  ASN C CG  1 
ATOM   8634  O  OD1 . ASN C  1 203 ? 16.188  45.129  44.991  1.00   32.73 ? 310  ASN C OD1 1 
ATOM   8635  N  ND2 . ASN C  1 203 ? 16.133  44.450  47.149  1.00   28.91 ? 310  ASN C ND2 1 
ATOM   8636  N  N   . SER C  1 204 ? 12.333  47.054  47.355  1.00   17.84 ? 311  SER C N   1 
ATOM   8637  C  CA  . SER C  1 204 ? 11.138  46.370  47.845  1.00   17.50 ? 311  SER C CA  1 
ATOM   8638  C  C   . SER C  1 204 ? 10.053  46.223  46.784  1.00   17.58 ? 311  SER C C   1 
ATOM   8639  O  O   . SER C  1 204 ? 9.864   47.119  45.954  1.00   18.19 ? 311  SER C O   1 
ATOM   8640  C  CB  . SER C  1 204 ? 10.548  47.132  49.029  1.00   15.34 ? 311  SER C CB  1 
ATOM   8641  O  OG  . SER C  1 204 ? 9.291   46.592  49.385  1.00   17.42 ? 311  SER C OG  1 
ATOM   8642  N  N   . ILE C  1 205 ? 9.325   45.107  46.810  1.00   16.47 ? 312  ILE C N   1 
ATOM   8643  C  CA  . ILE C  1 205 ? 8.248   44.931  45.837  1.00   16.81 ? 312  ILE C CA  1 
ATOM   8644  C  C   . ILE C  1 205 ? 7.061   45.837  46.213  1.00   16.77 ? 312  ILE C C   1 
ATOM   8645  O  O   . ILE C  1 205 ? 6.228   46.154  45.369  1.00   14.45 ? 312  ILE C O   1 
ATOM   8646  C  CB  . ILE C  1 205 ? 7.755   43.447  45.747  1.00   16.74 ? 312  ILE C CB  1 
ATOM   8647  C  CG1 . ILE C  1 205 ? 7.015   43.056  47.028  1.00   16.13 ? 312  ILE C CG1 1 
ATOM   8648  C  CG2 . ILE C  1 205 ? 8.945   42.514  45.478  1.00   13.62 ? 312  ILE C CG2 1 
ATOM   8649  C  CD1 . ILE C  1 205 ? 6.406   41.650  46.982  1.00   15.61 ? 312  ILE C CD1 1 
ATOM   8650  N  N   . TYR C  1 206 ? 7.009   46.273  47.473  1.00   16.41 ? 313  TYR C N   1 
ATOM   8651  C  CA  . TYR C  1 206 ? 5.921   47.125  47.950  1.00   16.54 ? 313  TYR C CA  1 
ATOM   8652  C  C   . TYR C  1 206 ? 5.989   48.575  47.488  1.00   18.74 ? 313  TYR C C   1 
ATOM   8653  O  O   . TYR C  1 206 ? 5.017   49.320  47.627  1.00   19.26 ? 313  TYR C O   1 
ATOM   8654  C  CB  . TYR C  1 206 ? 5.862   47.121  49.474  1.00   15.78 ? 313  TYR C CB  1 
ATOM   8655  C  CG  . TYR C  1 206 ? 5.969   45.757  50.108  1.00   15.64 ? 313  TYR C CG  1 
ATOM   8656  C  CD1 . TYR C  1 206 ? 5.208   44.685  49.643  1.00   16.89 ? 313  TYR C CD1 1 
ATOM   8657  C  CD2 . TYR C  1 206 ? 6.828   45.543  51.186  1.00   13.86 ? 313  TYR C CD2 1 
ATOM   8658  C  CE1 . TYR C  1 206 ? 5.304   43.425  50.242  1.00   18.20 ? 313  TYR C CE1 1 
ATOM   8659  C  CE2 . TYR C  1 206 ? 6.929   44.301  51.790  1.00   14.57 ? 313  TYR C CE2 1 
ATOM   8660  C  CZ  . TYR C  1 206 ? 6.166   43.246  51.314  1.00   17.86 ? 313  TYR C CZ  1 
ATOM   8661  O  OH  . TYR C  1 206 ? 6.266   42.018  51.915  1.00   18.76 ? 313  TYR C OH  1 
ATOM   8662  N  N   . THR C  1 207 ? 7.129   48.986  46.948  1.00   18.47 ? 314  THR C N   1 
ATOM   8663  C  CA  . THR C  1 207 ? 7.272   50.366  46.491  1.00   17.98 ? 314  THR C CA  1 
ATOM   8664  C  C   . THR C  1 207 ? 7.450   50.448  44.976  1.00   18.34 ? 314  THR C C   1 
ATOM   8665  O  O   . THR C  1 207 ? 8.030   49.549  44.363  1.00   16.49 ? 314  THR C O   1 
ATOM   8666  C  CB  . THR C  1 207 ? 8.512   51.031  47.114  1.00   16.58 ? 314  THR C CB  1 
ATOM   8667  O  OG1 . THR C  1 207 ? 9.692   50.400  46.597  1.00   15.37 ? 314  THR C OG1 1 
ATOM   8668  C  CG2 . THR C  1 207 ? 8.486   50.899  48.646  1.00   16.09 ? 314  THR C CG2 1 
ATOM   8669  N  N   . LEU C  1 208 ? 6.932   51.515  44.368  1.00   18.38 ? 315  LEU C N   1 
ATOM   8670  C  CA  . LEU C  1 208 ? 7.140   51.723  42.936  1.00   17.79 ? 315  LEU C CA  1 
ATOM   8671  C  C   . LEU C  1 208 ? 8.362   52.629  42.900  1.00   16.05 ? 315  LEU C C   1 
ATOM   8672  O  O   . LEU C  1 208 ? 8.277   53.817  43.234  1.00   14.88 ? 315  LEU C O   1 
ATOM   8673  C  CB  . LEU C  1 208 ? 5.963   52.450  42.270  1.00   20.96 ? 315  LEU C CB  1 
ATOM   8674  C  CG  . LEU C  1 208 ? 4.601   51.753  42.203  1.00   23.74 ? 315  LEU C CG  1 
ATOM   8675  C  CD1 . LEU C  1 208 ? 3.859   51.970  43.511  1.00   22.59 ? 315  LEU C CD1 1 
ATOM   8676  C  CD2 . LEU C  1 208 ? 3.790   52.311  41.030  1.00   20.72 ? 315  LEU C CD2 1 
ATOM   8677  N  N   . SER C  1 209 ? 9.505   52.067  42.525  1.00   14.81 ? 316  SER C N   1 
ATOM   8678  C  CA  . SER C  1 209 ? 10.730  52.856  42.465  1.00   17.13 ? 316  SER C CA  1 
ATOM   8679  C  C   . SER C  1 209 ? 10.788  53.615  41.142  1.00   14.77 ? 316  SER C C   1 
ATOM   8680  O  O   . SER C  1 209 ? 10.682  53.015  40.072  1.00   19.41 ? 316  SER C O   1 
ATOM   8681  C  CB  . SER C  1 209 ? 11.951  51.960  42.625  1.00   15.00 ? 316  SER C CB  1 
ATOM   8682  O  OG  . SER C  1 209 ? 13.105  52.783  42.719  1.00   20.32 ? 316  SER C OG  1 
ATOM   8683  N  N   . ILE C  1 210 ? 10.970  54.930  41.227  1.00   15.21 ? 317  ILE C N   1 
ATOM   8684  C  CA  . ILE C  1 210 ? 10.977  55.811  40.064  1.00   14.66 ? 317  ILE C CA  1 
ATOM   8685  C  C   . ILE C  1 210 ? 12.314  56.491  39.788  1.00   16.31 ? 317  ILE C C   1 
ATOM   8686  O  O   . ILE C  1 210 ? 12.871  57.121  40.677  1.00   16.87 ? 317  ILE C O   1 
ATOM   8687  C  CB  . ILE C  1 210 ? 9.924   56.933  40.254  1.00   15.12 ? 317  ILE C CB  1 
ATOM   8688  C  CG1 . ILE C  1 210 ? 8.577   56.312  40.603  1.00   11.18 ? 317  ILE C CG1 1 
ATOM   8689  C  CG2 . ILE C  1 210 ? 9.823   57.797  38.981  1.00   14.97 ? 317  ILE C CG2 1 
ATOM   8690  C  CD1 . ILE C  1 210 ? 7.937   55.550  39.451  1.00   14.93 ? 317  ILE C CD1 1 
ATOM   8691  N  N   . SER C  1 211 ? 12.807  56.380  38.550  1.00   16.74 ? 318  SER C N   1 
ATOM   8692  C  CA  . SER C  1 211 ? 14.062  57.011  38.145  1.00   15.82 ? 318  SER C CA  1 
ATOM   8693  C  C   . SER C  1 211 ? 13.805  58.316  37.390  1.00   18.08 ? 318  SER C C   1 
ATOM   8694  O  O   . SER C  1 211 ? 12.651  58.702  37.183  1.00   17.47 ? 318  SER C O   1 
ATOM   8695  C  CB  . SER C  1 211 ? 14.887  56.075  37.258  1.00   17.76 ? 318  SER C CB  1 
ATOM   8696  O  OG  . SER C  1 211 ? 15.523  55.074  38.019  1.00   15.12 ? 318  SER C OG  1 
ATOM   8697  N  N   . SER C  1 212 ? 14.881  58.962  36.940  1.00   17.30 ? 319  SER C N   1 
ATOM   8698  C  CA  . SER C  1 212 ? 14.792  60.246  36.244  1.00   14.65 ? 319  SER C CA  1 
ATOM   8699  C  C   . SER C  1 212 ? 15.360  60.292  34.822  1.00   14.76 ? 319  SER C C   1 
ATOM   8700  O  O   . SER C  1 212 ? 16.227  59.505  34.450  1.00   15.37 ? 319  SER C O   1 
ATOM   8701  C  CB  . SER C  1 212 ? 15.519  61.304  37.073  1.00   13.67 ? 319  SER C CB  1 
ATOM   8702  O  OG  . SER C  1 212 ? 15.084  61.276  38.417  1.00   14.79 ? 319  SER C OG  1 
ATOM   8703  N  N   . ALA C  1 213 ? 14.867  61.247  34.039  1.00   15.78 ? 320  ALA C N   1 
ATOM   8704  C  CA  . ALA C  1 213 ? 15.330  61.473  32.665  1.00   17.19 ? 320  ALA C CA  1 
ATOM   8705  C  C   . ALA C  1 213 ? 15.480  62.983  32.516  1.00   14.63 ? 320  ALA C C   1 
ATOM   8706  O  O   . ALA C  1 213 ? 14.699  63.743  33.084  1.00   17.82 ? 320  ALA C O   1 
ATOM   8707  C  CB  . ALA C  1 213 ? 14.313  60.942  31.654  1.00   13.82 ? 320  ALA C CB  1 
ATOM   8708  N  N   . THR C  1 214 ? 16.493  63.423  31.789  1.00   13.26 ? 321  THR C N   1 
ATOM   8709  C  CA  . THR C  1 214 ? 16.704  64.850  31.601  1.00   15.44 ? 321  THR C CA  1 
ATOM   8710  C  C   . THR C  1 214 ? 15.769  65.331  30.495  1.00   18.33 ? 321  THR C C   1 
ATOM   8711  O  O   . THR C  1 214 ? 15.172  64.521  29.779  1.00   18.48 ? 321  THR C O   1 
ATOM   8712  C  CB  . THR C  1 214 ? 18.155  65.159  31.186  1.00   17.24 ? 321  THR C CB  1 
ATOM   8713  O  OG1 . THR C  1 214 ? 18.404  64.596  29.897  1.00   17.07 ? 321  THR C OG1 1 
ATOM   8714  C  CG2 . THR C  1 214 ? 19.141  64.572  32.185  1.00   13.91 ? 321  THR C CG2 1 
ATOM   8715  N  N   . GLN C  1 215 ? 15.643  66.644  30.348  1.00   18.43 ? 322  GLN C N   1 
ATOM   8716  C  CA  . GLN C  1 215 ? 14.763  67.184  29.329  1.00   20.16 ? 322  GLN C CA  1 
ATOM   8717  C  C   . GLN C  1 215 ? 15.063  66.645  27.938  1.00   19.65 ? 322  GLN C C   1 
ATOM   8718  O  O   . GLN C  1 215 ? 14.140  66.330  27.182  1.00   20.89 ? 322  GLN C O   1 
ATOM   8719  C  CB  . GLN C  1 215 ? 14.832  68.708  29.313  1.00   18.61 ? 322  GLN C CB  1 
ATOM   8720  C  CG  . GLN C  1 215 ? 13.872  69.335  28.311  1.00   20.56 ? 322  GLN C CG  1 
ATOM   8721  C  CD  . GLN C  1 215 ? 13.920  70.863  28.309  1.00   21.69 ? 322  GLN C CD  1 
ATOM   8722  O  OE1 . GLN C  1 215 ? 14.874  71.476  28.795  1.00   19.88 ? 322  GLN C OE1 1 
ATOM   8723  N  NE2 . GLN C  1 215 ? 12.893  71.478  27.741  1.00   19.63 ? 322  GLN C NE2 1 
ATOM   8724  N  N   . PHE C  1 216 ? 16.341  66.512  27.602  1.00   19.26 ? 323  PHE C N   1 
ATOM   8725  C  CA  . PHE C  1 216 ? 16.706  66.023  26.277  1.00   21.02 ? 323  PHE C CA  1 
ATOM   8726  C  C   . PHE C  1 216 ? 16.622  64.503  26.147  1.00   22.57 ? 323  PHE C C   1 
ATOM   8727  O  O   . PHE C  1 216 ? 17.023  63.931  25.131  1.00   24.35 ? 323  PHE C O   1 
ATOM   8728  C  CB  . PHE C  1 216 ? 18.108  66.518  25.886  1.00   22.00 ? 323  PHE C CB  1 
ATOM   8729  C  CG  . PHE C  1 216 ? 18.247  68.025  25.888  1.00   24.02 ? 323  PHE C CG  1 
ATOM   8730  C  CD1 . PHE C  1 216 ? 17.117  68.846  25.912  1.00   21.72 ? 323  PHE C CD1 1 
ATOM   8731  C  CD2 . PHE C  1 216 ? 19.506  68.621  25.863  1.00   24.52 ? 323  PHE C CD2 1 
ATOM   8732  C  CE1 . PHE C  1 216 ? 17.241  70.237  25.913  1.00   23.80 ? 323  PHE C CE1 1 
ATOM   8733  C  CE2 . PHE C  1 216 ? 19.643  70.011  25.860  1.00   27.15 ? 323  PHE C CE2 1 
ATOM   8734  C  CZ  . PHE C  1 216 ? 18.509  70.825  25.886  1.00   23.59 ? 323  PHE C CZ  1 
ATOM   8735  N  N   . GLY C  1 217 ? 16.101  63.851  27.178  1.00   22.20 ? 324  GLY C N   1 
ATOM   8736  C  CA  . GLY C  1 217 ? 15.941  62.408  27.139  1.00   20.30 ? 324  GLY C CA  1 
ATOM   8737  C  C   . GLY C  1 217 ? 17.156  61.576  27.507  1.00   21.02 ? 324  GLY C C   1 
ATOM   8738  O  O   . GLY C  1 217 ? 17.291  60.446  27.038  1.00   18.84 ? 324  GLY C O   1 
ATOM   8739  N  N   . ASN C  1 218 ? 18.028  62.104  28.358  1.00   20.23 ? 325  ASN C N   1 
ATOM   8740  C  CA  . ASN C  1 218 ? 19.219  61.360  28.744  1.00   20.09 ? 325  ASN C CA  1 
ATOM   8741  C  C   . ASN C  1 218 ? 19.222  60.917  30.197  1.00   18.99 ? 325  ASN C C   1 
ATOM   8742  O  O   . ASN C  1 218 ? 18.404  61.366  30.992  1.00   19.73 ? 325  ASN C O   1 
ATOM   8743  C  CB  . ASN C  1 218 ? 20.468  62.196  28.448  1.00   20.57 ? 325  ASN C CB  1 
ATOM   8744  C  CG  . ASN C  1 218 ? 20.722  62.336  26.950  1.00   23.55 ? 325  ASN C CG  1 
ATOM   8745  O  OD1 . ASN C  1 218 ? 20.813  61.339  26.229  1.00   26.14 ? 325  ASN C OD1 1 
ATOM   8746  N  ND2 . ASN C  1 218 ? 20.826  63.565  26.478  1.00   22.58 ? 325  ASN C ND2 1 
ATOM   8747  N  N   . VAL C  1 219 ? 20.142  60.014  30.526  1.00   18.67 ? 326  VAL C N   1 
ATOM   8748  C  CA  . VAL C  1 219 ? 20.297  59.509  31.886  1.00   18.45 ? 326  VAL C CA  1 
ATOM   8749  C  C   . VAL C  1 219 ? 21.068  60.573  32.665  1.00   17.64 ? 326  VAL C C   1 
ATOM   8750  O  O   . VAL C  1 219 ? 22.241  60.831  32.394  1.00   18.71 ? 326  VAL C O   1 
ATOM   8751  C  CB  . VAL C  1 219 ? 21.108  58.182  31.917  1.00   18.95 ? 326  VAL C CB  1 
ATOM   8752  C  CG1 . VAL C  1 219 ? 21.244  57.697  33.339  1.00   15.71 ? 326  VAL C CG1 1 
ATOM   8753  C  CG2 . VAL C  1 219 ? 20.431  57.121  31.055  1.00   14.83 ? 326  VAL C CG2 1 
ATOM   8754  N  N   . PRO C  1 220 ? 20.413  61.207  33.642  1.00   17.84 ? 327  PRO C N   1 
ATOM   8755  C  CA  . PRO C  1 220 ? 21.045  62.258  34.457  1.00   17.50 ? 327  PRO C CA  1 
ATOM   8756  C  C   . PRO C  1 220 ? 22.314  61.774  35.153  1.00   17.56 ? 327  PRO C C   1 
ATOM   8757  O  O   . PRO C  1 220 ? 22.470  60.580  35.409  1.00   15.47 ? 327  PRO C O   1 
ATOM   8758  C  CB  . PRO C  1 220 ? 19.955  62.629  35.463  1.00   16.64 ? 327  PRO C CB  1 
ATOM   8759  C  CG  . PRO C  1 220 ? 18.652  62.241  34.762  1.00   17.99 ? 327  PRO C CG  1 
ATOM   8760  C  CD  . PRO C  1 220 ? 19.017  60.959  34.050  1.00   16.07 ? 327  PRO C CD  1 
ATOM   8761  N  N   . TRP C  1 221 ? 23.209  62.706  35.471  1.00   16.33 ? 328  TRP C N   1 
ATOM   8762  C  CA  . TRP C  1 221 ? 24.451  62.356  36.153  1.00   17.43 ? 328  TRP C CA  1 
ATOM   8763  C  C   . TRP C  1 221 ? 24.211  61.681  37.510  1.00   17.84 ? 328  TRP C C   1 
ATOM   8764  O  O   . TRP C  1 221 ? 24.973  60.816  37.906  1.00   20.68 ? 328  TRP C O   1 
ATOM   8765  C  CB  . TRP C  1 221 ? 25.318  63.605  36.374  1.00   17.12 ? 328  TRP C CB  1 
ATOM   8766  C  CG  . TRP C  1 221 ? 24.721  64.604  37.309  1.00   20.18 ? 328  TRP C CG  1 
ATOM   8767  C  CD1 . TRP C  1 221 ? 23.863  65.631  36.990  1.00   18.26 ? 328  TRP C CD1 1 
ATOM   8768  C  CD2 . TRP C  1 221 ? 24.927  64.681  38.728  1.00   20.73 ? 328  TRP C CD2 1 
ATOM   8769  N  NE1 . TRP C  1 221 ? 23.533  66.335  38.120  1.00   20.47 ? 328  TRP C NE1 1 
ATOM   8770  C  CE2 . TRP C  1 221 ? 24.169  65.777  39.200  1.00   20.80 ? 328  TRP C CE2 1 
ATOM   8771  C  CE3 . TRP C  1 221 ? 25.676  63.923  39.645  1.00   21.29 ? 328  TRP C CE3 1 
ATOM   8772  C  CZ2 . TRP C  1 221 ? 24.139  66.142  40.551  1.00   22.19 ? 328  TRP C CZ2 1 
ATOM   8773  C  CZ3 . TRP C  1 221 ? 25.645  64.280  40.988  1.00   23.73 ? 328  TRP C CZ3 1 
ATOM   8774  C  CH2 . TRP C  1 221 ? 24.878  65.385  41.429  1.00   25.18 ? 328  TRP C CH2 1 
ATOM   8775  N  N   . TYR C  1 222 ? 23.145  62.065  38.208  1.00   17.53 ? 329  TYR C N   1 
ATOM   8776  C  CA  . TYR C  1 222 ? 22.842  61.520  39.532  1.00   17.67 ? 329  TYR C CA  1 
ATOM   8777  C  C   . TYR C  1 222 ? 22.101  60.178  39.536  1.00   18.57 ? 329  TYR C C   1 
ATOM   8778  O  O   . TYR C  1 222 ? 21.922  59.550  40.579  1.00   18.91 ? 329  TYR C O   1 
ATOM   8779  C  CB  . TYR C  1 222 ? 22.030  62.561  40.314  1.00   16.24 ? 329  TYR C CB  1 
ATOM   8780  C  CG  . TYR C  1 222 ? 20.801  63.039  39.566  1.00   17.89 ? 329  TYR C CG  1 
ATOM   8781  C  CD1 . TYR C  1 222 ? 19.648  62.248  39.489  1.00   17.87 ? 329  TYR C CD1 1 
ATOM   8782  C  CD2 . TYR C  1 222 ? 20.805  64.258  38.892  1.00   16.56 ? 329  TYR C CD2 1 
ATOM   8783  C  CE1 . TYR C  1 222 ? 18.526  62.664  38.752  1.00   17.69 ? 329  TYR C CE1 1 
ATOM   8784  C  CE2 . TYR C  1 222 ? 19.695  64.686  38.148  1.00   17.68 ? 329  TYR C CE2 1 
ATOM   8785  C  CZ  . TYR C  1 222 ? 18.559  63.886  38.079  1.00   19.12 ? 329  TYR C CZ  1 
ATOM   8786  O  OH  . TYR C  1 222 ? 17.479  64.299  37.319  1.00   15.24 ? 329  TYR C OH  1 
ATOM   8787  N  N   . SER C  1 223 ? 21.679  59.738  38.362  1.00   19.73 ? 330  SER C N   1 
ATOM   8788  C  CA  . SER C  1 223 ? 20.919  58.502  38.233  1.00   19.19 ? 330  SER C CA  1 
ATOM   8789  C  C   . SER C  1 223 ? 21.611  57.208  38.651  1.00   18.78 ? 330  SER C C   1 
ATOM   8790  O  O   . SER C  1 223 ? 22.789  56.990  38.348  1.00   19.75 ? 330  SER C O   1 
ATOM   8791  C  CB  . SER C  1 223 ? 20.446  58.351  36.787  1.00   17.30 ? 330  SER C CB  1 
ATOM   8792  O  OG  . SER C  1 223 ? 19.829  57.088  36.590  1.00   24.57 ? 330  SER C OG  1 
ATOM   8793  N  N   . GLU C  1 224 ? 20.869  56.347  39.342  1.00   17.40 ? 331  GLU C N   1 
ATOM   8794  C  CA  . GLU C  1 224 ? 21.396  55.039  39.745  1.00   19.63 ? 331  GLU C CA  1 
ATOM   8795  C  C   . GLU C  1 224 ? 20.675  53.979  38.929  1.00   19.34 ? 331  GLU C C   1 
ATOM   8796  O  O   . GLU C  1 224 ? 19.446  54.010  38.796  1.00   20.05 ? 331  GLU C O   1 
ATOM   8797  C  CB  . GLU C  1 224 ? 21.150  54.750  41.228  1.00   15.99 ? 331  GLU C CB  1 
ATOM   8798  C  CG  . GLU C  1 224 ? 21.822  55.713  42.165  1.00   17.71 ? 331  GLU C CG  1 
ATOM   8799  C  CD  . GLU C  1 224 ? 21.636  55.313  43.619  1.00   17.79 ? 331  GLU C CD  1 
ATOM   8800  O  OE1 . GLU C  1 224 ? 21.532  56.226  44.456  1.00   14.71 ? 331  GLU C OE1 1 
ATOM   8801  O  OE2 . GLU C  1 224 ? 21.602  54.092  43.913  1.00   15.10 ? 331  GLU C OE2 1 
ATOM   8802  N  N   . ALA C  1 225 ? 21.434  53.045  38.376  1.00   20.34 ? 332  ALA C N   1 
ATOM   8803  C  CA  . ALA C  1 225 ? 20.845  51.971  37.588  1.00   20.60 ? 332  ALA C CA  1 
ATOM   8804  C  C   . ALA C  1 225 ? 20.663  50.723  38.447  1.00   20.91 ? 332  ALA C C   1 
ATOM   8805  O  O   . ALA C  1 225 ? 21.461  50.454  39.346  1.00   20.55 ? 332  ALA C O   1 
ATOM   8806  C  CB  . ALA C  1 225 ? 21.742  51.643  36.399  1.00   19.10 ? 332  ALA C CB  1 
ATOM   8807  N  N   . CYS C  1 226 ? 19.604  49.969  38.170  1.00   20.27 ? 333  CYS C N   1 
ATOM   8808  C  CA  . CYS C  1 226 ? 19.332  48.722  38.878  1.00   18.29 ? 333  CYS C CA  1 
ATOM   8809  C  C   . CYS C  1 226 ? 18.063  48.121  38.282  1.00   18.57 ? 333  CYS C C   1 
ATOM   8810  O  O   . CYS C  1 226 ? 17.268  48.820  37.641  1.00   17.67 ? 333  CYS C O   1 
ATOM   8811  C  CB  . CYS C  1 226 ? 19.174  48.943  40.393  1.00   21.03 ? 333  CYS C CB  1 
ATOM   8812  S  SG  . CYS C  1 226 ? 17.698  49.897  40.821  1.00   24.29 ? 333  CYS C SG  1 
ATOM   8813  N  N   . SER C  1 227 ? 17.876  46.826  38.499  1.00   15.13 ? 334  SER C N   1 
ATOM   8814  C  CA  . SER C  1 227 ? 16.733  46.118  37.955  1.00   17.97 ? 334  SER C CA  1 
ATOM   8815  C  C   . SER C  1 227 ? 15.442  46.285  38.732  1.00   18.57 ? 334  SER C C   1 
ATOM   8816  O  O   . SER C  1 227 ? 14.390  45.867  38.258  1.00   19.79 ? 334  SER C O   1 
ATOM   8817  C  CB  . SER C  1 227 ? 17.051  44.624  37.842  1.00   17.95 ? 334  SER C CB  1 
ATOM   8818  O  OG  . SER C  1 227 ? 17.184  44.033  39.122  1.00   16.78 ? 334  SER C OG  1 
ATOM   8819  N  N   . SER C  1 228 ? 15.505  46.883  39.920  1.00   17.57 ? 335  SER C N   1 
ATOM   8820  C  CA  . SER C  1 228 ? 14.293  47.039  40.728  1.00   17.26 ? 335  SER C CA  1 
ATOM   8821  C  C   . SER C  1 228 ? 13.433  48.245  40.335  1.00   17.54 ? 335  SER C C   1 
ATOM   8822  O  O   . SER C  1 228 ? 12.255  48.301  40.673  1.00   19.26 ? 335  SER C O   1 
ATOM   8823  C  CB  . SER C  1 228 ? 14.648  47.116  42.217  1.00   16.50 ? 335  SER C CB  1 
ATOM   8824  O  OG  . SER C  1 228 ? 15.527  48.202  42.487  1.00   14.70 ? 335  SER C OG  1 
ATOM   8825  N  N   . THR C  1 229 ? 14.020  49.193  39.614  1.00   17.23 ? 336  THR C N   1 
ATOM   8826  C  CA  . THR C  1 229 ? 13.306  50.380  39.170  1.00   16.75 ? 336  THR C CA  1 
ATOM   8827  C  C   . THR C  1 229 ? 12.162  49.990  38.234  1.00   19.41 ? 336  THR C C   1 
ATOM   8828  O  O   . THR C  1 229 ? 12.317  49.117  37.377  1.00   19.68 ? 336  THR C O   1 
ATOM   8829  C  CB  . THR C  1 229 ? 14.254  51.349  38.449  1.00   17.03 ? 336  THR C CB  1 
ATOM   8830  O  OG1 . THR C  1 229 ? 15.254  51.800  39.375  1.00   21.23 ? 336  THR C OG1 1 
ATOM   8831  C  CG2 . THR C  1 229 ? 13.487  52.555  37.913  1.00   17.43 ? 336  THR C CG2 1 
ATOM   8832  N  N   . LEU C  1 230 ? 11.014  50.638  38.402  1.00   17.95 ? 337  LEU C N   1 
ATOM   8833  C  CA  . LEU C  1 230 ? 9.850   50.321  37.595  1.00   18.38 ? 337  LEU C CA  1 
ATOM   8834  C  C   . LEU C  1 230 ? 9.614   51.265  36.407  1.00   19.98 ? 337  LEU C C   1 
ATOM   8835  O  O   . LEU C  1 230 ? 9.359   50.809  35.289  1.00   19.12 ? 337  LEU C O   1 
ATOM   8836  C  CB  . LEU C  1 230 ? 8.615   50.287  38.489  1.00   19.00 ? 337  LEU C CB  1 
ATOM   8837  C  CG  . LEU C  1 230 ? 7.388   49.602  37.906  1.00   21.60 ? 337  LEU C CG  1 
ATOM   8838  C  CD1 . LEU C  1 230 ? 7.695   48.126  37.621  1.00   15.35 ? 337  LEU C CD1 1 
ATOM   8839  C  CD2 . LEU C  1 230 ? 6.235   49.741  38.892  1.00   18.90 ? 337  LEU C CD2 1 
ATOM   8840  N  N   . ALA C  1 231 ? 9.707   52.572  36.637  1.00   17.13 ? 338  ALA C N   1 
ATOM   8841  C  CA  . ALA C  1 231 ? 9.486   53.541  35.570  1.00   15.17 ? 338  ALA C CA  1 
ATOM   8842  C  C   . ALA C  1 231 ? 10.246  54.828  35.821  1.00   16.54 ? 338  ALA C C   1 
ATOM   8843  O  O   . ALA C  1 231 ? 10.976  54.953  36.803  1.00   18.46 ? 338  ALA C O   1 
ATOM   8844  C  CB  . ALA C  1 231 ? 7.987   53.840  35.412  1.00   13.35 ? 338  ALA C CB  1 
ATOM   8845  N  N   . THR C  1 232 ? 10.013  55.805  34.954  1.00   15.49 ? 339  THR C N   1 
ATOM   8846  C  CA  . THR C  1 232 ? 10.728  57.073  34.995  1.00   15.34 ? 339  THR C CA  1 
ATOM   8847  C  C   . THR C  1 232 ? 9.842   58.298  34.807  1.00   15.78 ? 339  THR C C   1 
ATOM   8848  O  O   . THR C  1 232 ? 8.798   58.212  34.174  1.00   16.07 ? 339  THR C O   1 
ATOM   8849  C  CB  . THR C  1 232 ? 11.757  57.078  33.830  1.00   17.32 ? 339  THR C CB  1 
ATOM   8850  O  OG1 . THR C  1 232 ? 12.561  55.903  33.913  1.00   15.57 ? 339  THR C OG1 1 
ATOM   8851  C  CG2 . THR C  1 232 ? 12.617  58.335  33.823  1.00   15.37 ? 339  THR C CG2 1 
ATOM   8852  N  N   . THR C  1 233 ? 10.273  59.433  35.355  1.00   16.96 ? 340  THR C N   1 
ATOM   8853  C  CA  . THR C  1 233 ? 9.582   60.700  35.152  1.00   18.86 ? 340  THR C CA  1 
ATOM   8854  C  C   . THR C  1 233 ? 10.705  61.708  34.964  1.00   19.94 ? 340  THR C C   1 
ATOM   8855  O  O   . THR C  1 233 ? 11.828  61.465  35.381  1.00   20.47 ? 340  THR C O   1 
ATOM   8856  C  CB  . THR C  1 233 ? 8.703   61.150  36.346  1.00   21.48 ? 340  THR C CB  1 
ATOM   8857  O  OG1 . THR C  1 233 ? 9.519   61.377  37.494  1.00   19.83 ? 340  THR C OG1 1 
ATOM   8858  C  CG2 . THR C  1 233 ? 7.648   60.114  36.652  1.00   17.99 ? 340  THR C CG2 1 
ATOM   8859  N  N   . TYR C  1 234 ? 10.413  62.827  34.317  1.00   17.91 ? 341  TYR C N   1 
ATOM   8860  C  CA  . TYR C  1 234 ? 11.424  63.849  34.086  1.00   16.32 ? 341  TYR C CA  1 
ATOM   8861  C  C   . TYR C  1 234 ? 11.925  64.540  35.340  1.00   18.34 ? 341  TYR C C   1 
ATOM   8862  O  O   . TYR C  1 234 ? 11.216  64.634  36.357  1.00   17.38 ? 341  TYR C O   1 
ATOM   8863  C  CB  . TYR C  1 234 ? 10.879  64.931  33.154  1.00   18.21 ? 341  TYR C CB  1 
ATOM   8864  C  CG  . TYR C  1 234 ? 10.808  64.522  31.706  1.00   19.69 ? 341  TYR C CG  1 
ATOM   8865  C  CD1 . TYR C  1 234 ? 11.967  64.240  30.984  1.00   20.49 ? 341  TYR C CD1 1 
ATOM   8866  C  CD2 . TYR C  1 234 ? 9.584   64.401  31.058  1.00   22.41 ? 341  TYR C CD2 1 
ATOM   8867  C  CE1 . TYR C  1 234 ? 11.912  63.847  29.650  1.00   18.23 ? 341  TYR C CE1 1 
ATOM   8868  C  CE2 . TYR C  1 234 ? 9.517   64.001  29.714  1.00   23.84 ? 341  TYR C CE2 1 
ATOM   8869  C  CZ  . TYR C  1 234 ? 10.685  63.725  29.025  1.00   20.05 ? 341  TYR C CZ  1 
ATOM   8870  O  OH  . TYR C  1 234 ? 10.622  63.295  27.718  1.00   21.69 ? 341  TYR C OH  1 
ATOM   8871  N  N   . SER C  1 235 ? 13.167  65.008  35.255  1.00   17.46 ? 342  SER C N   1 
ATOM   8872  C  CA  . SER C  1 235 ? 13.784  65.782  36.312  1.00   19.19 ? 342  SER C CA  1 
ATOM   8873  C  C   . SER C  1 235 ? 14.863  66.668  35.688  1.00   19.06 ? 342  SER C C   1 
ATOM   8874  O  O   . SER C  1 235 ? 14.817  66.958  34.498  1.00   18.86 ? 342  SER C O   1 
ATOM   8875  C  CB  . SER C  1 235 ? 14.377  64.893  37.397  1.00   19.76 ? 342  SER C CB  1 
ATOM   8876  O  OG  . SER C  1 235 ? 14.671  65.695  38.525  1.00   16.94 ? 342  SER C OG  1 
ATOM   8877  N  N   . SER C  1 236 ? 15.842  67.084  36.481  1.00   22.07 ? 343  SER C N   1 
ATOM   8878  C  CA  . SER C  1 236 ? 16.906  67.966  36.001  1.00   19.16 ? 343  SER C CA  1 
ATOM   8879  C  C   . SER C  1 236 ? 18.036  67.260  35.266  1.00   18.41 ? 343  SER C C   1 
ATOM   8880  O  O   . SER C  1 236 ? 18.190  66.040  35.357  1.00   20.13 ? 343  SER C O   1 
ATOM   8881  C  CB  . SER C  1 236 ? 17.501  68.733  37.177  1.00   17.99 ? 343  SER C CB  1 
ATOM   8882  O  OG  . SER C  1 236 ? 18.200  67.836  38.032  1.00   16.41 ? 343  SER C OG  1 
ATOM   8883  N  N   . GLY C  1 237 ? 18.837  68.050  34.553  1.00   17.55 ? 344  GLY C N   1 
ATOM   8884  C  CA  . GLY C  1 237 ? 19.964  67.519  33.798  1.00   16.85 ? 344  GLY C CA  1 
ATOM   8885  C  C   . GLY C  1 237 ? 21.095  68.528  33.821  1.00   17.76 ? 344  GLY C C   1 
ATOM   8886  O  O   . GLY C  1 237 ? 21.508  68.969  34.898  1.00   18.15 ? 344  GLY C O   1 
ATOM   8887  N  N   . ASN C  1 238 ? 21.598  68.904  32.647  1.00   18.18 ? 345  ASN C N   1 
ATOM   8888  C  CA  . ASN C  1 238 ? 22.674  69.888  32.572  1.00   17.48 ? 345  ASN C CA  1 
ATOM   8889  C  C   . ASN C  1 238 ? 22.084  71.307  32.602  1.00   20.19 ? 345  ASN C C   1 
ATOM   8890  O  O   . ASN C  1 238 ? 20.869  71.476  32.682  1.00   17.29 ? 345  ASN C O   1 
ATOM   8891  C  CB  . ASN C  1 238 ? 23.536  69.659  31.317  1.00   18.54 ? 345  ASN C CB  1 
ATOM   8892  C  CG  . ASN C  1 238 ? 22.747  69.802  30.022  1.00   20.84 ? 345  ASN C CG  1 
ATOM   8893  O  OD1 . ASN C  1 238 ? 22.025  70.781  29.836  1.00   20.95 ? 345  ASN C OD1 1 
ATOM   8894  N  ND2 . ASN C  1 238 ? 22.895  68.828  29.111  1.00   18.10 ? 345  ASN C ND2 1 
ATOM   8895  N  N   . GLN C  1 239 ? 22.930  72.329  32.536  1.00   19.78 ? 346  GLN C N   1 
ATOM   8896  C  CA  . GLN C  1 239 ? 22.421  73.685  32.627  1.00   20.82 ? 346  GLN C CA  1 
ATOM   8897  C  C   . GLN C  1 239 ? 21.729  74.233  31.383  1.00   22.75 ? 346  GLN C C   1 
ATOM   8898  O  O   . GLN C  1 239 ? 21.226  75.357  31.390  1.00   21.60 ? 346  GLN C O   1 
ATOM   8899  C  CB  . GLN C  1 239 ? 23.532  74.608  33.118  1.00   18.31 ? 346  GLN C CB  1 
ATOM   8900  C  CG  . GLN C  1 239 ? 24.163  74.058  34.381  1.00   19.45 ? 346  GLN C CG  1 
ATOM   8901  C  CD  . GLN C  1 239 ? 25.121  75.023  35.047  1.00   22.37 ? 346  GLN C CD  1 
ATOM   8902  O  OE1 . GLN C  1 239 ? 26.049  74.604  35.736  1.00   22.26 ? 346  GLN C OE1 1 
ATOM   8903  N  NE2 . GLN C  1 239 ? 24.894  76.314  34.859  1.00   19.83 ? 346  GLN C NE2 1 
ATOM   8904  N  N   . ASN C  1 240 ? 21.684  73.436  30.321  1.00   20.66 ? 347  ASN C N   1 
ATOM   8905  C  CA  . ASN C  1 240 ? 20.989  73.863  29.118  1.00   22.59 ? 347  ASN C CA  1 
ATOM   8906  C  C   . ASN C  1 240 ? 19.589  73.247  29.151  1.00   23.90 ? 347  ASN C C   1 
ATOM   8907  O  O   . ASN C  1 240 ? 18.738  73.566  28.319  1.00   23.68 ? 347  ASN C O   1 
ATOM   8908  C  CB  . ASN C  1 240 ? 21.703  73.382  27.851  1.00   24.17 ? 347  ASN C CB  1 
ATOM   8909  C  CG  . ASN C  1 240 ? 23.150  73.851  27.763  1.00   28.50 ? 347  ASN C CG  1 
ATOM   8910  O  OD1 . ASN C  1 240 ? 24.054  73.231  28.327  1.00   31.35 ? 347  ASN C OD1 1 
ATOM   8911  N  ND2 . ASN C  1 240 ? 23.372  74.949  27.054  1.00   26.81 ? 347  ASN C ND2 1 
ATOM   8912  N  N   . GLU C  1 241 ? 19.365  72.354  30.112  1.00   21.71 ? 348  GLU C N   1 
ATOM   8913  C  CA  . GLU C  1 241 ? 18.081  71.672  30.251  1.00   20.08 ? 348  GLU C CA  1 
ATOM   8914  C  C   . GLU C  1 241 ? 17.274  72.268  31.391  1.00   19.58 ? 348  GLU C C   1 
ATOM   8915  O  O   . GLU C  1 241 ? 17.829  72.620  32.427  1.00   20.19 ? 348  GLU C O   1 
ATOM   8916  C  CB  . GLU C  1 241 ? 18.316  70.171  30.486  1.00   15.62 ? 348  GLU C CB  1 
ATOM   8917  C  CG  . GLU C  1 241 ? 18.862  69.450  29.244  1.00   15.78 ? 348  GLU C CG  1 
ATOM   8918  C  CD  . GLU C  1 241 ? 19.364  68.044  29.531  1.00   15.70 ? 348  GLU C CD  1 
ATOM   8919  O  OE1 . GLU C  1 241 ? 18.979  67.104  28.803  1.00   18.48 ? 348  GLU C OE1 1 
ATOM   8920  O  OE2 . GLU C  1 241 ? 20.165  67.878  30.476  1.00   16.87 ? 348  GLU C OE2 1 
ATOM   8921  N  N   . LYS C  1 242 ? 15.963  72.381  31.195  1.00   17.97 ? 349  LYS C N   1 
ATOM   8922  C  CA  . LYS C  1 242 ? 15.095  72.958  32.210  1.00   21.72 ? 349  LYS C CA  1 
ATOM   8923  C  C   . LYS C  1 242 ? 14.937  72.038  33.414  1.00   20.15 ? 349  LYS C C   1 
ATOM   8924  O  O   . LYS C  1 242 ? 15.263  70.855  33.347  1.00   20.51 ? 349  LYS C O   1 
ATOM   8925  C  CB  . LYS C  1 242 ? 13.724  73.309  31.602  1.00   20.72 ? 349  LYS C CB  1 
ATOM   8926  C  CG  . LYS C  1 242 ? 13.829  74.398  30.541  1.00   23.14 ? 349  LYS C CG  1 
ATOM   8927  C  CD  . LYS C  1 242 ? 12.481  75.009  30.202  1.00   34.07 ? 349  LYS C CD  1 
ATOM   8928  C  CE  . LYS C  1 242 ? 12.644  76.209  29.271  1.00   40.70 ? 349  LYS C CE  1 
ATOM   8929  N  NZ  . LYS C  1 242 ? 11.382  77.016  29.148  1.00   44.12 ? 349  LYS C NZ  1 
ATOM   8930  N  N   . GLN C  1 243 ? 14.439  72.592  34.514  1.00   19.87 ? 350  GLN C N   1 
ATOM   8931  C  CA  . GLN C  1 243 ? 14.264  71.817  35.730  1.00   19.61 ? 350  GLN C CA  1 
ATOM   8932  C  C   . GLN C  1 243 ? 12.815  71.821  36.199  1.00   20.99 ? 350  GLN C C   1 
ATOM   8933  O  O   . GLN C  1 243 ? 11.914  72.178  35.442  1.00   22.13 ? 350  GLN C O   1 
ATOM   8934  C  CB  . GLN C  1 243 ? 15.217  72.339  36.811  1.00   18.86 ? 350  GLN C CB  1 
ATOM   8935  C  CG  . GLN C  1 243 ? 16.652  72.478  36.286  1.00   18.91 ? 350  GLN C CG  1 
ATOM   8936  C  CD  . GLN C  1 243 ? 17.681  72.813  37.363  1.00   22.12 ? 350  GLN C CD  1 
ATOM   8937  O  OE1 . GLN C  1 243 ? 17.382  73.496  38.340  1.00   24.76 ? 350  GLN C OE1 1 
ATOM   8938  N  NE2 . GLN C  1 243 ? 18.910  72.347  37.167  1.00   20.13 ? 350  GLN C NE2 1 
ATOM   8939  N  N   . ILE C  1 244 ? 12.582  71.414  37.437  1.00   21.01 ? 351  ILE C N   1 
ATOM   8940  C  CA  . ILE C  1 244 ? 11.224  71.327  37.940  1.00   20.94 ? 351  ILE C CA  1 
ATOM   8941  C  C   . ILE C  1 244 ? 10.748  72.591  38.635  1.00   21.99 ? 351  ILE C C   1 
ATOM   8942  O  O   . ILE C  1 244 ? 11.433  73.129  39.512  1.00   20.94 ? 351  ILE C O   1 
ATOM   8943  C  CB  . ILE C  1 244 ? 11.084  70.123  38.888  1.00   18.32 ? 351  ILE C CB  1 
ATOM   8944  C  CG1 . ILE C  1 244 ? 11.609  68.863  38.184  1.00   21.89 ? 351  ILE C CG1 1 
ATOM   8945  C  CG2 . ILE C  1 244 ? 9.637   69.941  39.311  1.00   16.96 ? 351  ILE C CG2 1 
ATOM   8946  C  CD1 . ILE C  1 244 ? 11.005  68.588  36.824  1.00   17.19 ? 351  ILE C CD1 1 
ATOM   8947  N  N   . VAL C  1 245 ? 9.556   73.039  38.239  1.00   20.63 ? 352  VAL C N   1 
ATOM   8948  C  CA  . VAL C  1 245 ? 8.919   74.241  38.776  1.00   21.20 ? 352  VAL C CA  1 
ATOM   8949  C  C   . VAL C  1 245 ? 7.913   73.857  39.848  1.00   20.29 ? 352  VAL C C   1 
ATOM   8950  O  O   . VAL C  1 245 ? 6.972   73.115  39.579  1.00   23.91 ? 352  VAL C O   1 
ATOM   8951  C  CB  . VAL C  1 245 ? 8.197   74.998  37.652  1.00   20.28 ? 352  VAL C CB  1 
ATOM   8952  C  CG1 . VAL C  1 245 ? 7.477   76.217  38.203  1.00   22.17 ? 352  VAL C CG1 1 
ATOM   8953  C  CG2 . VAL C  1 245 ? 9.208   75.370  36.569  1.00   17.78 ? 352  VAL C CG2 1 
ATOM   8954  N  N   . THR C  1 246 ? 8.093   74.374  41.061  1.00   20.35 ? 353  THR C N   1 
ATOM   8955  C  CA  . THR C  1 246 ? 7.196   74.017  42.149  1.00   16.60 ? 353  THR C CA  1 
ATOM   8956  C  C   . THR C  1 246 ? 7.185   75.049  43.278  1.00   17.60 ? 353  THR C C   1 
ATOM   8957  O  O   . THR C  1 246 ? 7.859   76.074  43.207  1.00   17.14 ? 353  THR C O   1 
ATOM   8958  C  CB  . THR C  1 246 ? 7.606   72.602  42.714  1.00   15.36 ? 353  THR C CB  1 
ATOM   8959  O  OG1 . THR C  1 246 ? 6.687   72.172  43.729  1.00   10.63 ? 353  THR C OG1 1 
ATOM   8960  C  CG2 . THR C  1 246 ? 9.013   72.653  43.300  1.00   13.41 ? 353  THR C CG2 1 
ATOM   8961  N  N   . THR C  1 247 ? 6.405   74.759  44.314  1.00   18.13 ? 354  THR C N   1 
ATOM   8962  C  CA  . THR C  1 247 ? 6.291   75.612  45.490  1.00   19.12 ? 354  THR C CA  1 
ATOM   8963  C  C   . THR C  1 247 ? 7.574   75.535  46.335  1.00   22.99 ? 354  THR C C   1 
ATOM   8964  O  O   . THR C  1 247 ? 8.130   74.450  46.540  1.00   22.29 ? 354  THR C O   1 
ATOM   8965  C  CB  . THR C  1 247 ? 5.107   75.155  46.364  1.00   19.64 ? 354  THR C CB  1 
ATOM   8966  O  OG1 . THR C  1 247 ? 5.150   73.723  46.508  1.00   15.39 ? 354  THR C OG1 1 
ATOM   8967  C  CG2 . THR C  1 247 ? 3.784   75.554  45.748  1.00   17.43 ? 354  THR C CG2 1 
ATOM   8968  N  N   . ASP C  1 248 ? 8.044   76.679  46.826  1.00   22.07 ? 355  ASP C N   1 
ATOM   8969  C  CA  . ASP C  1 248 ? 9.253   76.709  47.640  1.00   22.25 ? 355  ASP C CA  1 
ATOM   8970  C  C   . ASP C  1 248 ? 8.954   77.297  49.015  1.00   22.32 ? 355  ASP C C   1 
ATOM   8971  O  O   . ASP C  1 248 ? 7.956   77.995  49.199  1.00   23.89 ? 355  ASP C O   1 
ATOM   8972  C  CB  . ASP C  1 248 ? 10.337  77.540  46.956  1.00   22.25 ? 355  ASP C CB  1 
ATOM   8973  C  CG  . ASP C  1 248 ? 11.740  77.144  47.392  1.00   26.32 ? 355  ASP C CG  1 
ATOM   8974  O  OD1 . ASP C  1 248 ? 11.881  76.355  48.353  1.00   25.05 ? 355  ASP C OD1 1 
ATOM   8975  O  OD2 . ASP C  1 248 ? 12.710  77.618  46.762  1.00   29.08 ? 355  ASP C OD2 1 
ATOM   8976  N  N   . LEU C  1 249 ? 9.824   77.002  49.973  1.00   22.66 ? 356  LEU C N   1 
ATOM   8977  C  CA  . LEU C  1 249 ? 9.693   77.485  51.345  1.00   25.42 ? 356  LEU C CA  1 
ATOM   8978  C  C   . LEU C  1 249 ? 9.549   79.014  51.378  1.00   25.72 ? 356  LEU C C   1 
ATOM   8979  O  O   . LEU C  1 249 ? 10.000  79.715  50.471  1.00   27.32 ? 356  LEU C O   1 
ATOM   8980  C  CB  . LEU C  1 249 ? 10.929  77.057  52.139  1.00   23.25 ? 356  LEU C CB  1 
ATOM   8981  C  CG  . LEU C  1 249 ? 10.945  77.055  53.666  1.00   25.43 ? 356  LEU C CG  1 
ATOM   8982  C  CD1 . LEU C  1 249 ? 9.821   76.189  54.236  1.00   18.49 ? 356  LEU C CD1 1 
ATOM   8983  C  CD2 . LEU C  1 249 ? 12.320  76.534  54.111  1.00   23.69 ? 356  LEU C CD2 1 
ATOM   8984  N  N   . ARG C  1 250 ? 8.914   79.519  52.430  1.00   26.88 ? 357  ARG C N   1 
ATOM   8985  C  CA  . ARG C  1 250 ? 8.697   80.951  52.596  1.00   26.83 ? 357  ARG C CA  1 
ATOM   8986  C  C   . ARG C  1 250 ? 7.765   81.498  51.524  1.00   28.10 ? 357  ARG C C   1 
ATOM   8987  O  O   . ARG C  1 250 ? 7.929   82.613  51.042  1.00   28.22 ? 357  ARG C O   1 
ATOM   8988  C  CB  . ARG C  1 250 ? 10.036  81.696  52.591  1.00   25.52 ? 357  ARG C CB  1 
ATOM   8989  C  CG  . ARG C  1 250 ? 10.972  81.254  53.722  1.00   23.61 ? 357  ARG C CG  1 
ATOM   8990  C  CD  . ARG C  1 250 ? 12.294  81.987  53.683  1.00   25.84 ? 357  ARG C CD  1 
ATOM   8991  N  NE  . ARG C  1 250 ? 13.289  81.422  54.594  1.00   29.31 ? 357  ARG C NE  1 
ATOM   8992  C  CZ  . ARG C  1 250 ? 13.266  81.527  55.924  1.00   29.19 ? 357  ARG C CZ  1 
ATOM   8993  N  NH1 . ARG C  1 250 ? 14.229  80.965  56.646  1.00   30.43 ? 357  ARG C NH1 1 
ATOM   8994  N  NH2 . ARG C  1 250 ? 12.295  82.189  56.537  1.00   32.25 ? 357  ARG C NH2 1 
ATOM   8995  N  N   . GLN C  1 251 ? 6.783   80.679  51.161  1.00   29.12 ? 358  GLN C N   1 
ATOM   8996  C  CA  . GLN C  1 251 ? 5.765   81.029  50.176  1.00   28.70 ? 358  GLN C CA  1 
ATOM   8997  C  C   . GLN C  1 251 ? 6.300   81.496  48.830  1.00   26.02 ? 358  GLN C C   1 
ATOM   8998  O  O   . GLN C  1 251 ? 5.706   82.351  48.189  1.00   27.55 ? 358  GLN C O   1 
ATOM   8999  C  CB  . GLN C  1 251 ? 4.850   82.090  50.775  1.00   30.95 ? 358  GLN C CB  1 
ATOM   9000  C  CG  . GLN C  1 251 ? 4.455   81.755  52.205  1.00   37.20 ? 358  GLN C CG  1 
ATOM   9001  C  CD  . GLN C  1 251 ? 3.247   82.536  52.676  1.00   40.42 ? 358  GLN C CD  1 
ATOM   9002  O  OE1 . GLN C  1 251 ? 2.813   82.390  53.814  1.00   44.41 ? 358  GLN C OE1 1 
ATOM   9003  N  NE2 . GLN C  1 251 ? 2.689   83.363  51.796  1.00   44.52 ? 358  GLN C NE2 1 
ATOM   9004  N  N   . LYS C  1 252 ? 7.418   80.927  48.404  1.00   24.29 ? 359  LYS C N   1 
ATOM   9005  C  CA  . LYS C  1 252 ? 8.015   81.291  47.133  1.00   23.73 ? 359  LYS C CA  1 
ATOM   9006  C  C   . LYS C  1 252 ? 7.750   80.240  46.058  1.00   24.44 ? 359  LYS C C   1 
ATOM   9007  O  O   . LYS C  1 252 ? 7.134   79.209  46.309  1.00   20.73 ? 359  LYS C O   1 
ATOM   9008  C  CB  . LYS C  1 252 ? 9.517   81.474  47.307  1.00   27.49 ? 359  LYS C CB  1 
ATOM   9009  C  CG  . LYS C  1 252 ? 9.899   82.643  48.206  1.00   33.26 ? 359  LYS C CG  1 
ATOM   9010  C  CD  . LYS C  1 252 ? 11.410  82.686  48.396  1.00   38.73 ? 359  LYS C CD  1 
ATOM   9011  C  CE  . LYS C  1 252 ? 11.887  84.051  48.877  1.00   44.49 ? 359  LYS C CE  1 
ATOM   9012  N  NZ  . LYS C  1 252 ? 11.203  84.487  50.125  1.00   46.04 ? 359  LYS C NZ  1 
ATOM   9013  N  N   . CYS C  1 253 ? 8.228   80.518  44.854  1.00   26.77 ? 360  CYS C N   1 
ATOM   9014  C  CA  . CYS C  1 253 ? 8.068   79.618  43.723  1.00   28.00 ? 360  CYS C CA  1 
ATOM   9015  C  C   . CYS C  1 253 ? 9.489   79.355  43.237  1.00   27.28 ? 360  CYS C C   1 
ATOM   9016  O  O   . CYS C  1 253 ? 10.301  80.274  43.190  1.00   29.18 ? 360  CYS C O   1 
ATOM   9017  C  CB  . CYS C  1 253 ? 7.240   80.324  42.646  1.00   29.95 ? 360  CYS C CB  1 
ATOM   9018  S  SG  . CYS C  1 253 ? 6.775   79.375  41.162  1.00   42.33 ? 360  CYS C SG  1 
ATOM   9019  N  N   . THR C  1 254 ? 9.812   78.107  42.911  1.00   23.76 ? 361  THR C N   1 
ATOM   9020  C  CA  . THR C  1 254 ? 11.151  77.808  42.413  1.00   22.30 ? 361  THR C CA  1 
ATOM   9021  C  C   . THR C  1 254 ? 11.082  77.123  41.057  1.00   22.16 ? 361  THR C C   1 
ATOM   9022  O  O   . THR C  1 254 ? 10.118  76.420  40.746  1.00   23.51 ? 361  THR C O   1 
ATOM   9023  C  CB  . THR C  1 254 ? 11.942  76.880  43.364  1.00   22.12 ? 361  THR C CB  1 
ATOM   9024  O  OG1 . THR C  1 254 ? 13.292  76.763  42.895  1.00   21.30 ? 361  THR C OG1 1 
ATOM   9025  C  CG2 . THR C  1 254 ? 11.325  75.477  43.386  1.00   16.81 ? 361  THR C CG2 1 
ATOM   9026  N  N   . GLU C  1 255 ? 12.103  77.337  40.251  1.00   18.40 ? 362  GLU C N   1 
ATOM   9027  C  CA  . GLU C  1 255 ? 12.153  76.714  38.947  1.00   23.40 ? 362  GLU C CA  1 
ATOM   9028  C  C   . GLU C  1 255 ? 13.365  75.820  38.934  1.00   20.98 ? 362  GLU C C   1 
ATOM   9029  O  O   . GLU C  1 255 ? 13.777  75.335  37.884  1.00   20.17 ? 362  GLU C O   1 
ATOM   9030  C  CB  . GLU C  1 255 ? 12.254  77.776  37.848  1.00   24.72 ? 362  GLU C CB  1 
ATOM   9031  C  CG  . GLU C  1 255 ? 10.957  78.552  37.674  1.00   35.66 ? 362  GLU C CG  1 
ATOM   9032  C  CD  . GLU C  1 255 ? 11.091  79.754  36.756  1.00   42.34 ? 362  GLU C CD  1 
ATOM   9033  O  OE1 . GLU C  1 255 ? 11.558  79.588  35.607  1.00   44.91 ? 362  GLU C OE1 1 
ATOM   9034  O  OE2 . GLU C  1 255 ? 10.713  80.867  37.188  1.00   47.76 ? 362  GLU C OE2 1 
ATOM   9035  N  N   . SER C  1 256 ? 13.925  75.590  40.118  1.00   20.11 ? 363  SER C N   1 
ATOM   9036  C  CA  . SER C  1 256 ? 15.106  74.761  40.216  1.00   20.35 ? 363  SER C CA  1 
ATOM   9037  C  C   . SER C  1 256 ? 15.047  73.618  41.209  1.00   22.29 ? 363  SER C C   1 
ATOM   9038  O  O   . SER C  1 256 ? 15.987  73.429  41.992  1.00   20.75 ? 363  SER C O   1 
ATOM   9039  C  CB  . SER C  1 256 ? 16.333  75.634  40.498  1.00   24.00 ? 363  SER C CB  1 
ATOM   9040  O  OG  . SER C  1 256 ? 16.053  76.559  41.520  1.00   29.91 ? 363  SER C OG  1 
ATOM   9041  N  N   . HIS C  1 257 ? 13.948  72.858  41.189  1.00   21.13 ? 364  HIS C N   1 
ATOM   9042  C  CA  . HIS C  1 257 ? 13.840  71.674  42.043  1.00   21.57 ? 364  HIS C CA  1 
ATOM   9043  C  C   . HIS C  1 257 ? 14.548  70.621  41.169  1.00   23.72 ? 364  HIS C C   1 
ATOM   9044  O  O   . HIS C  1 257 ? 14.311  70.553  39.948  1.00   23.66 ? 364  HIS C O   1 
ATOM   9045  C  CB  . HIS C  1 257 ? 12.377  71.319  42.301  1.00   19.72 ? 364  HIS C CB  1 
ATOM   9046  C  CG  . HIS C  1 257 ? 12.189  70.165  43.237  1.00   22.00 ? 364  HIS C CG  1 
ATOM   9047  N  ND1 . HIS C  1 257 ? 13.052  69.901  44.280  1.00   19.46 ? 364  HIS C ND1 1 
ATOM   9048  C  CD2 . HIS C  1 257 ? 11.220  69.219  43.303  1.00   19.21 ? 364  HIS C CD2 1 
ATOM   9049  C  CE1 . HIS C  1 257 ? 12.625  68.842  44.947  1.00   18.65 ? 364  HIS C CE1 1 
ATOM   9050  N  NE2 . HIS C  1 257 ? 11.516  68.409  44.374  1.00   19.02 ? 364  HIS C NE2 1 
ATOM   9051  N  N   . THR C  1 258 ? 15.420  69.816  41.775  1.00   21.35 ? 365  THR C N   1 
ATOM   9052  C  CA  . THR C  1 258 ? 16.223  68.871  40.994  1.00   21.26 ? 365  THR C CA  1 
ATOM   9053  C  C   . THR C  1 258 ? 16.430  67.469  41.562  1.00   19.66 ? 365  THR C C   1 
ATOM   9054  O  O   . THR C  1 258 ? 15.953  67.128  42.638  1.00   17.69 ? 365  THR C O   1 
ATOM   9055  C  CB  . THR C  1 258 ? 17.640  69.452  40.767  1.00   22.14 ? 365  THR C CB  1 
ATOM   9056  O  OG1 . THR C  1 258 ? 18.316  69.519  42.025  1.00   25.34 ? 365  THR C OG1 1 
ATOM   9057  C  CG2 . THR C  1 258 ? 17.566  70.864  40.186  1.00   22.56 ? 365  THR C CG2 1 
ATOM   9058  N  N   . GLY C  1 259 ? 17.161  66.667  40.792  1.00   19.83 ? 366  GLY C N   1 
ATOM   9059  C  CA  . GLY C  1 259 ? 17.512  65.316  41.187  1.00   18.32 ? 366  GLY C CA  1 
ATOM   9060  C  C   . GLY C  1 259 ? 16.404  64.293  41.273  1.00   21.08 ? 366  GLY C C   1 
ATOM   9061  O  O   . GLY C  1 259 ? 15.269  64.519  40.843  1.00   19.39 ? 366  GLY C O   1 
ATOM   9062  N  N   . THR C  1 260 ? 16.755  63.154  41.856  1.00   20.15 ? 367  THR C N   1 
ATOM   9063  C  CA  . THR C  1 260 ? 15.823  62.052  42.029  1.00   20.90 ? 367  THR C CA  1 
ATOM   9064  C  C   . THR C  1 260 ? 14.611  62.503  42.847  1.00   17.59 ? 367  THR C C   1 
ATOM   9065  O  O   . THR C  1 260 ? 13.515  61.993  42.660  1.00   16.78 ? 367  THR C O   1 
ATOM   9066  C  CB  . THR C  1 260 ? 16.542  60.832  42.706  1.00   20.04 ? 367  THR C CB  1 
ATOM   9067  O  OG1 . THR C  1 260 ? 15.674  59.698  42.711  1.00   23.31 ? 367  THR C OG1 1 
ATOM   9068  C  CG2 . THR C  1 260 ? 16.945  61.152  44.146  1.00   23.19 ? 367  THR C CG2 1 
ATOM   9069  N  N   . SER C  1 261 ? 14.804  63.482  43.729  1.00   18.79 ? 368  SER C N   1 
ATOM   9070  C  CA  . SER C  1 261 ? 13.709  63.988  44.572  1.00   19.50 ? 368  SER C CA  1 
ATOM   9071  C  C   . SER C  1 261 ? 12.492  64.473  43.809  1.00   17.00 ? 368  SER C C   1 
ATOM   9072  O  O   . SER C  1 261 ? 11.366  64.333  44.279  1.00   18.19 ? 368  SER C O   1 
ATOM   9073  C  CB  . SER C  1 261 ? 14.181  65.152  45.446  1.00   20.52 ? 368  SER C CB  1 
ATOM   9074  O  OG  . SER C  1 261 ? 15.138  64.740  46.393  1.00   24.14 ? 368  SER C OG  1 
ATOM   9075  N  N   . ALA C  1 262 ? 12.720  65.054  42.639  1.00   16.39 ? 369  ALA C N   1 
ATOM   9076  C  CA  . ALA C  1 262 ? 11.632  65.604  41.842  1.00   18.55 ? 369  ALA C CA  1 
ATOM   9077  C  C   . ALA C  1 262 ? 10.843  64.567  41.041  1.00   19.69 ? 369  ALA C C   1 
ATOM   9078  O  O   . ALA C  1 262 ? 9.707   64.821  40.640  1.00   18.94 ? 369  ALA C O   1 
ATOM   9079  C  CB  . ALA C  1 262 ? 12.179  66.691  40.907  1.00   17.26 ? 369  ALA C CB  1 
ATOM   9080  N  N   . SER C  1 263 ? 11.429  63.399  40.811  1.00   19.34 ? 370  SER C N   1 
ATOM   9081  C  CA  . SER C  1 263 ? 10.743  62.381  40.031  1.00   18.41 ? 370  SER C CA  1 
ATOM   9082  C  C   . SER C  1 263 ? 9.621   61.620  40.737  1.00   18.41 ? 370  SER C C   1 
ATOM   9083  O  O   . SER C  1 263 ? 8.533   61.466  40.184  1.00   19.76 ? 370  SER C O   1 
ATOM   9084  C  CB  . SER C  1 263 ? 11.765  61.396  39.457  1.00   16.64 ? 370  SER C CB  1 
ATOM   9085  O  OG  . SER C  1 263 ? 12.505  62.020  38.419  1.00   18.09 ? 370  SER C OG  1 
ATOM   9086  N  N   . ALA C  1 264 ? 9.867   61.150  41.957  1.00   18.82 ? 371  ALA C N   1 
ATOM   9087  C  CA  . ALA C  1 264 ? 8.841   60.387  42.668  1.00   19.54 ? 371  ALA C CA  1 
ATOM   9088  C  C   . ALA C  1 264 ? 7.523   61.142  42.821  1.00   17.30 ? 371  ALA C C   1 
ATOM   9089  O  O   . ALA C  1 264 ? 6.462   60.571  42.592  1.00   17.87 ? 371  ALA C O   1 
ATOM   9090  C  CB  . ALA C  1 264 ? 9.362   59.927  44.051  1.00   17.68 ? 371  ALA C CB  1 
ATOM   9091  N  N   . PRO C  1 265 ? 7.571   62.432  43.218  1.00   17.28 ? 372  PRO C N   1 
ATOM   9092  C  CA  . PRO C  1 265 ? 6.336   63.216  43.384  1.00   16.11 ? 372  PRO C CA  1 
ATOM   9093  C  C   . PRO C  1 265 ? 5.498   63.305  42.099  1.00   17.08 ? 372  PRO C C   1 
ATOM   9094  O  O   . PRO C  1 265 ? 4.268   63.270  42.153  1.00   14.81 ? 372  PRO C O   1 
ATOM   9095  C  CB  . PRO C  1 265 ? 6.850   64.586  43.830  1.00   18.62 ? 372  PRO C CB  1 
ATOM   9096  C  CG  . PRO C  1 265 ? 8.114   64.252  44.558  1.00   16.46 ? 372  PRO C CG  1 
ATOM   9097  C  CD  . PRO C  1 265 ? 8.743   63.216  43.645  1.00   14.94 ? 372  PRO C CD  1 
ATOM   9098  N  N   . LEU C  1 266 ? 6.159   63.433  40.948  1.00   18.64 ? 373  LEU C N   1 
ATOM   9099  C  CA  . LEU C  1 266 ? 5.441   63.507  39.671  1.00   16.84 ? 373  LEU C CA  1 
ATOM   9100  C  C   . LEU C  1 266 ? 4.750   62.169  39.428  1.00   17.40 ? 373  LEU C C   1 
ATOM   9101  O  O   . LEU C  1 266 ? 3.625   62.118  38.930  1.00   19.01 ? 373  LEU C O   1 
ATOM   9102  C  CB  . LEU C  1 266 ? 6.411   63.820  38.535  1.00   15.61 ? 373  LEU C CB  1 
ATOM   9103  C  CG  . LEU C  1 266 ? 7.034   65.225  38.589  1.00   16.00 ? 373  LEU C CG  1 
ATOM   9104  C  CD1 . LEU C  1 266 ? 8.087   65.350  37.503  1.00   13.52 ? 373  LEU C CD1 1 
ATOM   9105  C  CD2 . LEU C  1 266 ? 5.957   66.289  38.413  1.00   11.22 ? 373  LEU C CD2 1 
ATOM   9106  N  N   . ALA C  1 267 ? 5.424   61.084  39.796  1.00   15.07 ? 374  ALA C N   1 
ATOM   9107  C  CA  . ALA C  1 267 ? 4.850   59.754  39.643  1.00   13.74 ? 374  ALA C CA  1 
ATOM   9108  C  C   . ALA C  1 267 ? 3.670   59.613  40.610  1.00   14.03 ? 374  ALA C C   1 
ATOM   9109  O  O   . ALA C  1 267 ? 2.624   59.067  40.251  1.00   14.81 ? 374  ALA C O   1 
ATOM   9110  C  CB  . ALA C  1 267 ? 5.912   58.678  39.927  1.00   11.46 ? 374  ALA C CB  1 
ATOM   9111  N  N   . ALA C  1 268 ? 3.833   60.111  41.835  1.00   15.11 ? 375  ALA C N   1 
ATOM   9112  C  CA  . ALA C  1 268 ? 2.761   60.032  42.824  1.00   15.82 ? 375  ALA C CA  1 
ATOM   9113  C  C   . ALA C  1 268 ? 1.531   60.803  42.308  1.00   17.40 ? 375  ALA C C   1 
ATOM   9114  O  O   . ALA C  1 268 ? 0.379   60.383  42.499  1.00   18.87 ? 375  ALA C O   1 
ATOM   9115  C  CB  . ALA C  1 268 ? 3.240   60.597  44.157  1.00   11.25 ? 375  ALA C CB  1 
ATOM   9116  N  N   . GLY C  1 269 ? 1.772   61.926  41.640  1.00   15.33 ? 376  GLY C N   1 
ATOM   9117  C  CA  . GLY C  1 269 ? 0.657   62.690  41.106  1.00   17.11 ? 376  GLY C CA  1 
ATOM   9118  C  C   . GLY C  1 269 ? -0.069  61.941  39.994  1.00   16.44 ? 376  GLY C C   1 
ATOM   9119  O  O   . GLY C  1 269 ? -1.298  61.894  39.965  1.00   18.75 ? 376  GLY C O   1 
ATOM   9120  N  N   . ILE C  1 270 ? 0.684   61.352  39.069  1.00   15.49 ? 377  ILE C N   1 
ATOM   9121  C  CA  . ILE C  1 270 ? 0.075   60.614  37.973  1.00   15.73 ? 377  ILE C CA  1 
ATOM   9122  C  C   . ILE C  1 270 ? -0.728  59.440  38.519  1.00   16.18 ? 377  ILE C C   1 
ATOM   9123  O  O   . ILE C  1 270 ? -1.810  59.124  38.026  1.00   18.34 ? 377  ILE C O   1 
ATOM   9124  C  CB  . ILE C  1 270 ? 1.151   60.134  36.979  1.00   14.42 ? 377  ILE C CB  1 
ATOM   9125  C  CG1 . ILE C  1 270 ? 1.681   61.343  36.214  1.00   13.30 ? 377  ILE C CG1 1 
ATOM   9126  C  CG2 . ILE C  1 270 ? 0.572   59.121  35.995  1.00   13.23 ? 377  ILE C CG2 1 
ATOM   9127  C  CD1 . ILE C  1 270 ? 2.934   61.077  35.422  1.00   13.78 ? 377  ILE C CD1 1 
ATOM   9128  N  N   . ILE C  1 271 ? -0.206  58.810  39.560  1.00   18.91 ? 378  ILE C N   1 
ATOM   9129  C  CA  . ILE C  1 271 ? -0.891  57.689  40.190  1.00   17.23 ? 378  ILE C CA  1 
ATOM   9130  C  C   . ILE C  1 271 ? -2.188  58.165  40.846  1.00   19.14 ? 378  ILE C C   1 
ATOM   9131  O  O   . ILE C  1 271 ? -3.179  57.432  40.885  1.00   18.61 ? 378  ILE C O   1 
ATOM   9132  C  CB  . ILE C  1 271 ? 0.045   57.005  41.215  1.00   14.78 ? 378  ILE C CB  1 
ATOM   9133  C  CG1 . ILE C  1 271 ? 1.108   56.224  40.437  1.00   14.08 ? 378  ILE C CG1 1 
ATOM   9134  C  CG2 . ILE C  1 271 ? -0.740  56.082  42.144  1.00   13.00 ? 378  ILE C CG2 1 
ATOM   9135  C  CD1 . ILE C  1 271 ? 2.330   55.849  41.233  1.00   13.84 ? 378  ILE C CD1 1 
ATOM   9136  N  N   . ALA C  1 272 ? -2.190  59.403  41.342  1.00   18.31 ? 379  ALA C N   1 
ATOM   9137  C  CA  . ALA C  1 272 ? -3.389  59.959  41.958  1.00   17.86 ? 379  ALA C CA  1 
ATOM   9138  C  C   . ALA C  1 272 ? -4.472  60.115  40.874  1.00   21.11 ? 379  ALA C C   1 
ATOM   9139  O  O   . ALA C  1 272 ? -5.658  59.827  41.104  1.00   23.67 ? 379  ALA C O   1 
ATOM   9140  C  CB  . ALA C  1 272 ? -3.072  61.309  42.596  1.00   14.35 ? 379  ALA C CB  1 
ATOM   9141  N  N   . LEU C  1 273 ? -4.063  60.566  39.693  1.00   18.45 ? 380  LEU C N   1 
ATOM   9142  C  CA  . LEU C  1 273 ? -5.011  60.738  38.603  1.00   19.35 ? 380  LEU C CA  1 
ATOM   9143  C  C   . LEU C  1 273 ? -5.572  59.372  38.229  1.00   20.77 ? 380  LEU C C   1 
ATOM   9144  O  O   . LEU C  1 273 ? -6.753  59.236  37.914  1.00   20.57 ? 380  LEU C O   1 
ATOM   9145  C  CB  . LEU C  1 273 ? -4.332  61.358  37.381  1.00   15.67 ? 380  LEU C CB  1 
ATOM   9146  C  CG  . LEU C  1 273 ? -3.711  62.761  37.481  1.00   18.21 ? 380  LEU C CG  1 
ATOM   9147  C  CD1 . LEU C  1 273 ? -3.205  63.177  36.096  1.00   18.27 ? 380  LEU C CD1 1 
ATOM   9148  C  CD2 . LEU C  1 273 ? -4.731  63.780  37.986  1.00   15.89 ? 380  LEU C CD2 1 
ATOM   9149  N  N   . THR C  1 274 ? -4.709  58.362  38.275  1.00   20.29 ? 381  THR C N   1 
ATOM   9150  C  CA  . THR C  1 274 ? -5.101  57.007  37.927  1.00   18.63 ? 381  THR C CA  1 
ATOM   9151  C  C   . THR C  1 274 ? -6.107  56.430  38.922  1.00   17.56 ? 381  THR C C   1 
ATOM   9152  O  O   . THR C  1 274 ? -7.070  55.782  38.523  1.00   17.58 ? 381  THR C O   1 
ATOM   9153  C  CB  . THR C  1 274 ? -3.849  56.105  37.815  1.00   20.65 ? 381  THR C CB  1 
ATOM   9154  O  OG1 . THR C  1 274 ? -2.922  56.719  36.908  1.00   18.12 ? 381  THR C OG1 1 
ATOM   9155  C  CG2 . THR C  1 274 ? -4.215  54.726  37.266  1.00   15.90 ? 381  THR C CG2 1 
ATOM   9156  N  N   . LEU C  1 275 ? -5.890  56.669  40.212  1.00   18.25 ? 382  LEU C N   1 
ATOM   9157  C  CA  . LEU C  1 275 ? -6.813  56.189  41.229  1.00   19.46 ? 382  LEU C CA  1 
ATOM   9158  C  C   . LEU C  1 275 ? -8.167  56.864  41.085  1.00   18.42 ? 382  LEU C C   1 
ATOM   9159  O  O   . LEU C  1 275 ? -9.194  56.251  41.350  1.00   20.27 ? 382  LEU C O   1 
ATOM   9160  C  CB  . LEU C  1 275 ? -6.269  56.439  42.636  1.00   21.67 ? 382  LEU C CB  1 
ATOM   9161  C  CG  . LEU C  1 275 ? -5.341  55.365  43.221  1.00   26.04 ? 382  LEU C CG  1 
ATOM   9162  C  CD1 . LEU C  1 275 ? -4.995  55.721  44.671  1.00   22.13 ? 382  LEU C CD1 1 
ATOM   9163  C  CD2 . LEU C  1 275 ? -6.037  53.991  43.162  1.00   21.42 ? 382  LEU C CD2 1 
ATOM   9164  N  N   . GLU C  1 276 ? -8.176  58.126  40.670  1.00   21.41 ? 383  GLU C N   1 
ATOM   9165  C  CA  . GLU C  1 276 ? -9.449  58.820  40.480  1.00   21.68 ? 383  GLU C CA  1 
ATOM   9166  C  C   . GLU C  1 276 ? -10.199 58.116  39.347  1.00   21.45 ? 383  GLU C C   1 
ATOM   9167  O  O   . GLU C  1 276 ? -11.402 57.903  39.436  1.00   20.03 ? 383  GLU C O   1 
ATOM   9168  C  CB  . GLU C  1 276 ? -9.237  60.297  40.122  1.00   23.45 ? 383  GLU C CB  1 
ATOM   9169  C  CG  . GLU C  1 276 ? -10.536 61.114  40.100  1.00   26.24 ? 383  GLU C CG  1 
ATOM   9170  C  CD  . GLU C  1 276 ? -10.359 62.518  39.526  1.00   28.77 ? 383  GLU C CD  1 
ATOM   9171  O  OE1 . GLU C  1 276 ? -9.213  62.952  39.294  1.00   28.91 ? 383  GLU C OE1 1 
ATOM   9172  O  OE2 . GLU C  1 276 ? -11.377 63.198  39.309  1.00   29.66 ? 383  GLU C OE2 1 
ATOM   9173  N  N   . ALA C  1 277 ? -9.476  57.748  38.291  1.00   17.95 ? 384  ALA C N   1 
ATOM   9174  C  CA  . ALA C  1 277 ? -10.069 57.047  37.153  1.00   18.56 ? 384  ALA C CA  1 
ATOM   9175  C  C   . ALA C  1 277 ? -10.619 55.677  37.556  1.00   20.57 ? 384  ALA C C   1 
ATOM   9176  O  O   . ALA C  1 277 ? -11.546 55.181  36.927  1.00   22.61 ? 384  ALA C O   1 
ATOM   9177  C  CB  . ALA C  1 277 ? -9.035  56.870  36.041  1.00   14.25 ? 384  ALA C CB  1 
ATOM   9178  N  N   . ASN C  1 278 ? -10.040 55.066  38.590  1.00   19.36 ? 385  ASN C N   1 
ATOM   9179  C  CA  . ASN C  1 278 ? -10.483 53.753  39.064  1.00   18.06 ? 385  ASN C CA  1 
ATOM   9180  C  C   . ASN C  1 278 ? -10.033 53.569  40.512  1.00   19.31 ? 385  ASN C C   1 
ATOM   9181  O  O   . ASN C  1 278 ? -8.920  53.099  40.781  1.00   19.75 ? 385  ASN C O   1 
ATOM   9182  C  CB  . ASN C  1 278 ? -9.881  52.647  38.188  1.00   18.22 ? 385  ASN C CB  1 
ATOM   9183  C  CG  . ASN C  1 278 ? -10.433 51.269  38.509  1.00   21.60 ? 385  ASN C CG  1 
ATOM   9184  O  OD1 . ASN C  1 278 ? -10.980 51.027  39.591  1.00   21.72 ? 385  ASN C OD1 1 
ATOM   9185  N  ND2 . ASN C  1 278 ? -10.276 50.345  37.564  1.00   21.68 ? 385  ASN C ND2 1 
ATOM   9186  N  N   . LYS C  1 279 ? -10.901 53.930  41.445  1.00   19.94 ? 386  LYS C N   1 
ATOM   9187  C  CA  . LYS C  1 279 ? -10.590 53.821  42.863  1.00   22.33 ? 386  LYS C CA  1 
ATOM   9188  C  C   . LYS C  1 279 ? -10.457 52.394  43.383  1.00   22.65 ? 386  LYS C C   1 
ATOM   9189  O  O   . LYS C  1 279 ? -10.040 52.194  44.522  1.00   23.34 ? 386  LYS C O   1 
ATOM   9190  C  CB  . LYS C  1 279 ? -11.657 54.540  43.688  1.00   27.41 ? 386  LYS C CB  1 
ATOM   9191  C  CG  . LYS C  1 279 ? -11.741 56.043  43.446  1.00   32.34 ? 386  LYS C CG  1 
ATOM   9192  C  CD  . LYS C  1 279 ? -12.871 56.674  44.266  1.00   35.40 ? 386  LYS C CD  1 
ATOM   9193  C  CE  . LYS C  1 279 ? -14.227 56.078  43.916  0.0000 34.44 ? 386  LYS C CE  1 
ATOM   9194  N  NZ  . LYS C  1 279 ? -15.322 56.668  44.736  0.0000 34.83 ? 386  LYS C NZ  1 
ATOM   9195  N  N   . ASN C  1 280 ? -10.809 51.405  42.568  1.00   21.07 ? 387  ASN C N   1 
ATOM   9196  C  CA  . ASN C  1 280 ? -10.727 50.012  43.015  1.00   25.27 ? 387  ASN C CA  1 
ATOM   9197  C  C   . ASN C  1 280 ? -9.413  49.302  42.698  1.00   22.68 ? 387  ASN C C   1 
ATOM   9198  O  O   . ASN C  1 280 ? -9.271  48.113  42.981  1.00   21.75 ? 387  ASN C O   1 
ATOM   9199  C  CB  . ASN C  1 280 ? -11.894 49.204  42.430  1.00   31.49 ? 387  ASN C CB  1 
ATOM   9200  C  CG  . ASN C  1 280 ? -13.227 49.602  43.025  1.00   37.95 ? 387  ASN C CG  1 
ATOM   9201  O  OD1 . ASN C  1 280 ? -14.289 49.358  42.436  1.00   47.70 ? 387  ASN C OD1 1 
ATOM   9202  N  ND2 . ASN C  1 280 ? -13.184 50.208  44.210  1.00   40.99 ? 387  ASN C ND2 1 
ATOM   9203  N  N   . LEU C  1 281 ? -8.458  50.020  42.116  1.00   19.18 ? 388  LEU C N   1 
ATOM   9204  C  CA  . LEU C  1 281 ? -7.171  49.425  41.778  1.00   18.49 ? 388  LEU C CA  1 
ATOM   9205  C  C   . LEU C  1 281 ? -6.407  49.038  43.040  1.00   20.30 ? 388  LEU C C   1 
ATOM   9206  O  O   . LEU C  1 281 ? -6.351  49.812  43.999  1.00   18.39 ? 388  LEU C O   1 
ATOM   9207  C  CB  . LEU C  1 281 ? -6.323  50.411  40.974  1.00   18.32 ? 388  LEU C CB  1 
ATOM   9208  C  CG  . LEU C  1 281 ? -6.876  50.861  39.622  1.00   19.75 ? 388  LEU C CG  1 
ATOM   9209  C  CD1 . LEU C  1 281 ? -6.008  51.996  39.067  1.00   15.78 ? 388  LEU C CD1 1 
ATOM   9210  C  CD2 . LEU C  1 281 ? -6.928  49.667  38.665  1.00   18.53 ? 388  LEU C CD2 1 
ATOM   9211  N  N   . THR C  1 282 ? -5.820  47.842  43.045  1.00   19.95 ? 389  THR C N   1 
ATOM   9212  C  CA  . THR C  1 282 ? -5.036  47.387  44.198  1.00   18.44 ? 389  THR C CA  1 
ATOM   9213  C  C   . THR C  1 282 ? -3.605  47.890  44.020  1.00   17.48 ? 389  THR C C   1 
ATOM   9214  O  O   . THR C  1 282 ? -3.264  48.456  42.971  1.00   17.92 ? 389  THR C O   1 
ATOM   9215  C  CB  . THR C  1 282 ? -4.994  45.853  44.272  1.00   15.57 ? 389  THR C CB  1 
ATOM   9216  O  OG1 . THR C  1 282 ? -4.272  45.351  43.145  1.00   15.96 ? 389  THR C OG1 1 
ATOM   9217  C  CG2 . THR C  1 282 ? -6.408  45.278  44.255  1.00   18.36 ? 389  THR C CG2 1 
ATOM   9218  N  N   . TRP C  1 283 ? -2.768  47.693  45.032  1.00   14.88 ? 390  TRP C N   1 
ATOM   9219  C  CA  . TRP C  1 283 ? -1.378  48.130  44.928  1.00   15.83 ? 390  TRP C CA  1 
ATOM   9220  C  C   . TRP C  1 283 ? -0.671  47.384  43.786  1.00   15.56 ? 390  TRP C C   1 
ATOM   9221  O  O   . TRP C  1 283 ? 0.240   47.922  43.160  1.00   13.99 ? 390  TRP C O   1 
ATOM   9222  C  CB  . TRP C  1 283 ? -0.629  47.911  46.255  1.00   15.67 ? 390  TRP C CB  1 
ATOM   9223  C  CG  . TRP C  1 283 ? -0.467  46.464  46.656  1.00   14.92 ? 390  TRP C CG  1 
ATOM   9224  C  CD1 . TRP C  1 283 ? -1.417  45.647  47.206  1.00   16.68 ? 390  TRP C CD1 1 
ATOM   9225  C  CD2 . TRP C  1 283 ? 0.717   45.672  46.533  1.00   15.41 ? 390  TRP C CD2 1 
ATOM   9226  N  NE1 . TRP C  1 283 ? -0.895  44.397  47.433  1.00   15.86 ? 390  TRP C NE1 1 
ATOM   9227  C  CE2 . TRP C  1 283 ? 0.416   44.387  47.032  1.00   14.28 ? 390  TRP C CE2 1 
ATOM   9228  C  CE3 . TRP C  1 283 ? 2.007   45.923  46.047  1.00   15.26 ? 390  TRP C CE3 1 
ATOM   9229  C  CZ2 . TRP C  1 283 ? 1.361   43.359  47.065  1.00   15.58 ? 390  TRP C CZ2 1 
ATOM   9230  C  CZ3 . TRP C  1 283 ? 2.946   44.895  46.079  1.00   16.42 ? 390  TRP C CZ3 1 
ATOM   9231  C  CH2 . TRP C  1 283 ? 2.618   43.635  46.585  1.00   14.79 ? 390  TRP C CH2 1 
ATOM   9232  N  N   . ARG C  1 284 ? -1.086  46.147  43.517  1.00   14.68 ? 391  ARG C N   1 
ATOM   9233  C  CA  . ARG C  1 284 ? -0.487  45.379  42.432  1.00   16.87 ? 391  ARG C CA  1 
ATOM   9234  C  C   . ARG C  1 284 ? -1.045  45.836  41.074  1.00   18.08 ? 391  ARG C C   1 
ATOM   9235  O  O   . ARG C  1 284 ? -0.304  45.930  40.095  1.00   19.93 ? 391  ARG C O   1 
ATOM   9236  C  CB  . ARG C  1 284 ? -0.708  43.870  42.643  1.00   15.77 ? 391  ARG C CB  1 
ATOM   9237  C  CG  . ARG C  1 284 ? 0.299   43.241  43.623  1.00   18.49 ? 391  ARG C CG  1 
ATOM   9238  C  CD  . ARG C  1 284 ? -0.097  41.843  44.090  1.00   16.36 ? 391  ARG C CD  1 
ATOM   9239  N  NE  . ARG C  1 284 ? -0.199  40.900  42.984  1.00   20.33 ? 391  ARG C NE  1 
ATOM   9240  C  CZ  . ARG C  1 284 ? -1.303  40.223  42.680  1.00   20.59 ? 391  ARG C CZ  1 
ATOM   9241  N  NH1 . ARG C  1 284 ? -2.397  40.384  43.408  1.00   20.10 ? 391  ARG C NH1 1 
ATOM   9242  N  NH2 . ARG C  1 284 ? -1.317  39.400  41.636  1.00   19.26 ? 391  ARG C NH2 1 
ATOM   9243  N  N   . ASP C  1 285 ? -2.343  46.125  41.010  1.00   20.03 ? 392  ASP C N   1 
ATOM   9244  C  CA  . ASP C  1 285 ? -2.938  46.614  39.762  1.00   18.30 ? 392  ASP C CA  1 
ATOM   9245  C  C   . ASP C  1 285 ? -2.158  47.835  39.284  1.00   18.26 ? 392  ASP C C   1 
ATOM   9246  O  O   . ASP C  1 285 ? -1.841  47.965  38.094  1.00   20.11 ? 392  ASP C O   1 
ATOM   9247  C  CB  . ASP C  1 285 ? -4.400  47.054  39.956  1.00   17.23 ? 392  ASP C CB  1 
ATOM   9248  C  CG  . ASP C  1 285 ? -5.366  45.890  40.071  1.00   20.15 ? 392  ASP C CG  1 
ATOM   9249  O  OD1 . ASP C  1 285 ? -5.140  44.836  39.420  1.00   17.95 ? 392  ASP C OD1 1 
ATOM   9250  O  OD2 . ASP C  1 285 ? -6.367  46.047  40.802  1.00   18.90 ? 392  ASP C OD2 1 
ATOM   9251  N  N   . MET C  1 286 ? -1.858  48.732  40.219  1.00   17.19 ? 393  MET C N   1 
ATOM   9252  C  CA  . MET C  1 286 ? -1.142  49.956  39.889  1.00   17.98 ? 393  MET C CA  1 
ATOM   9253  C  C   . MET C  1 286 ? 0.200   49.680  39.233  1.00   18.61 ? 393  MET C C   1 
ATOM   9254  O  O   . MET C  1 286 ? 0.572   50.348  38.273  1.00   18.62 ? 393  MET C O   1 
ATOM   9255  C  CB  . MET C  1 286 ? -0.942  50.817  41.135  1.00   18.61 ? 393  MET C CB  1 
ATOM   9256  C  CG  . MET C  1 286 ? -0.491  52.235  40.830  1.00   17.44 ? 393  MET C CG  1 
ATOM   9257  S  SD  . MET C  1 286 ? -1.639  53.109  39.707  1.00   19.99 ? 393  MET C SD  1 
ATOM   9258  C  CE  . MET C  1 286 ? -3.060  53.317  40.785  1.00   17.13 ? 393  MET C CE  1 
ATOM   9259  N  N   . GLN C  1 287 ? 0.937   48.703  39.741  1.00   16.32 ? 394  GLN C N   1 
ATOM   9260  C  CA  . GLN C  1 287 ? 2.221   48.400  39.138  1.00   15.72 ? 394  GLN C CA  1 
ATOM   9261  C  C   . GLN C  1 287 ? 2.043   47.808  37.731  1.00   16.94 ? 394  GLN C C   1 
ATOM   9262  O  O   . GLN C  1 287 ? 2.826   48.121  36.817  1.00   14.87 ? 394  GLN C O   1 
ATOM   9263  C  CB  . GLN C  1 287 ? 3.026   47.490  40.060  1.00   15.14 ? 394  GLN C CB  1 
ATOM   9264  C  CG  . GLN C  1 287 ? 3.473   48.236  41.318  1.00   17.87 ? 394  GLN C CG  1 
ATOM   9265  C  CD  . GLN C  1 287 ? 4.463   47.451  42.154  1.00   18.80 ? 394  GLN C CD  1 
ATOM   9266  O  OE1 . GLN C  1 287 ? 5.344   46.777  41.620  1.00   15.77 ? 394  GLN C OE1 1 
ATOM   9267  N  NE2 . GLN C  1 287 ? 4.333   47.546  43.475  1.00   16.95 ? 394  GLN C NE2 1 
ATOM   9268  N  N   . HIS C  1 288 ? 1.008   46.982  37.548  1.00   13.57 ? 395  HIS C N   1 
ATOM   9269  C  CA  . HIS C  1 288 ? 0.718   46.419  36.230  1.00   13.69 ? 395  HIS C CA  1 
ATOM   9270  C  C   . HIS C  1 288 ? 0.458   47.559  35.232  1.00   12.81 ? 395  HIS C C   1 
ATOM   9271  O  O   . HIS C  1 288 ? 0.976   47.548  34.111  1.00   13.72 ? 395  HIS C O   1 
ATOM   9272  C  CB  . HIS C  1 288 ? -0.525  45.531  36.288  1.00   12.45 ? 395  HIS C CB  1 
ATOM   9273  C  CG  . HIS C  1 288 ? -0.259  44.142  36.778  1.00   14.94 ? 395  HIS C CG  1 
ATOM   9274  N  ND1 . HIS C  1 288 ? 0.297   43.163  35.980  1.00   14.94 ? 395  HIS C ND1 1 
ATOM   9275  C  CD2 . HIS C  1 288 ? -0.506  43.556  37.976  1.00   15.55 ? 395  HIS C CD2 1 
ATOM   9276  C  CE1 . HIS C  1 288 ? 0.374   42.033  36.664  1.00   17.70 ? 395  HIS C CE1 1 
ATOM   9277  N  NE2 . HIS C  1 288 ? -0.109  42.243  37.877  1.00   13.81 ? 395  HIS C NE2 1 
ATOM   9278  N  N   . LEU C  1 289 ? -0.350  48.536  35.643  1.00   12.46 ? 396  LEU C N   1 
ATOM   9279  C  CA  . LEU C  1 289 ? -0.670  49.674  34.780  1.00   16.45 ? 396  LEU C CA  1 
ATOM   9280  C  C   . LEU C  1 289 ? 0.591   50.419  34.346  1.00   18.81 ? 396  LEU C C   1 
ATOM   9281  O  O   . LEU C  1 289 ? 0.746   50.780  33.173  1.00   19.89 ? 396  LEU C O   1 
ATOM   9282  C  CB  . LEU C  1 289 ? -1.609  50.642  35.496  1.00   16.99 ? 396  LEU C CB  1 
ATOM   9283  C  CG  . LEU C  1 289 ? -3.036  50.170  35.750  1.00   20.44 ? 396  LEU C CG  1 
ATOM   9284  C  CD1 . LEU C  1 289 ? -3.848  51.341  36.256  1.00   21.10 ? 396  LEU C CD1 1 
ATOM   9285  C  CD2 . LEU C  1 289 ? -3.643  49.634  34.468  1.00   20.14 ? 396  LEU C CD2 1 
ATOM   9286  N  N   . VAL C  1 290 ? 1.495   50.646  35.296  1.00   16.43 ? 397  VAL C N   1 
ATOM   9287  C  CA  . VAL C  1 290 ? 2.744   51.337  34.994  1.00   15.88 ? 397  VAL C CA  1 
ATOM   9288  C  C   . VAL C  1 290 ? 3.579   50.554  33.978  1.00   13.49 ? 397  VAL C C   1 
ATOM   9289  O  O   . VAL C  1 290 ? 4.105   51.124  33.020  1.00   15.67 ? 397  VAL C O   1 
ATOM   9290  C  CB  . VAL C  1 290 ? 3.545   51.572  36.292  1.00   12.85 ? 397  VAL C CB  1 
ATOM   9291  C  CG1 . VAL C  1 290 ? 4.965   52.051  35.989  1.00   9.10  ? 397  VAL C CG1 1 
ATOM   9292  C  CG2 . VAL C  1 290 ? 2.809   52.600  37.132  1.00   11.76 ? 397  VAL C CG2 1 
ATOM   9293  N  N   . VAL C  1 291 ? 3.697   49.254  34.192  1.00   14.18 ? 398  VAL C N   1 
ATOM   9294  C  CA  . VAL C  1 291 ? 4.473   48.401  33.298  1.00   14.41 ? 398  VAL C CA  1 
ATOM   9295  C  C   . VAL C  1 291 ? 3.902   48.441  31.885  1.00   14.49 ? 398  VAL C C   1 
ATOM   9296  O  O   . VAL C  1 291 ? 4.631   48.560  30.912  1.00   13.19 ? 398  VAL C O   1 
ATOM   9297  C  CB  . VAL C  1 291 ? 4.457   46.924  33.789  1.00   17.09 ? 398  VAL C CB  1 
ATOM   9298  C  CG1 . VAL C  1 291 ? 4.989   45.984  32.695  1.00   14.15 ? 398  VAL C CG1 1 
ATOM   9299  C  CG2 . VAL C  1 291 ? 5.270   46.793  35.063  1.00   13.70 ? 398  VAL C CG2 1 
ATOM   9300  N  N   . GLN C  1 292 ? 2.584   48.348  31.785  1.00   17.26 ? 399  GLN C N   1 
ATOM   9301  C  CA  . GLN C  1 292 ? 1.928   48.334  30.488  1.00   19.27 ? 399  GLN C CA  1 
ATOM   9302  C  C   . GLN C  1 292 ? 1.893   49.631  29.710  1.00   18.85 ? 399  GLN C C   1 
ATOM   9303  O  O   . GLN C  1 292 ? 2.004   49.620  28.486  1.00   18.85 ? 399  GLN C O   1 
ATOM   9304  C  CB  . GLN C  1 292 ? 0.506   47.809  30.632  1.00   18.78 ? 399  GLN C CB  1 
ATOM   9305  C  CG  . GLN C  1 292 ? 0.467   46.305  30.813  1.00   21.36 ? 399  GLN C CG  1 
ATOM   9306  C  CD  . GLN C  1 292 ? -0.908  45.734  30.540  1.00   23.44 ? 399  GLN C CD  1 
ATOM   9307  O  OE1 . GLN C  1 292 ? -1.698  46.313  29.775  1.00   23.93 ? 399  GLN C OE1 1 
ATOM   9308  N  NE2 . GLN C  1 292 ? -1.205  44.590  31.153  1.00   21.07 ? 399  GLN C NE2 1 
ATOM   9309  N  N   . THR C  1 293 ? 1.778   50.750  30.414  1.00   18.03 ? 400  THR C N   1 
ATOM   9310  C  CA  . THR C  1 293 ? 1.671   52.033  29.746  1.00   17.42 ? 400  THR C CA  1 
ATOM   9311  C  C   . THR C  1 293 ? 2.915   52.885  29.617  1.00   18.23 ? 400  THR C C   1 
ATOM   9312  O  O   . THR C  1 293 ? 2.900   53.860  28.870  1.00   18.67 ? 400  THR C O   1 
ATOM   9313  C  CB  . THR C  1 293 ? 0.605   52.891  30.422  1.00   17.45 ? 400  THR C CB  1 
ATOM   9314  O  OG1 . THR C  1 293 ? 1.011   53.168  31.773  1.00   15.43 ? 400  THR C OG1 1 
ATOM   9315  C  CG2 . THR C  1 293 ? -0.745  52.162  30.429  1.00   12.69 ? 400  THR C CG2 1 
ATOM   9316  N  N   . SER C  1 294 ? 3.986   52.549  30.328  1.00   21.68 ? 401  SER C N   1 
ATOM   9317  C  CA  . SER C  1 294 ? 5.188   53.379  30.256  1.00   20.52 ? 401  SER C CA  1 
ATOM   9318  C  C   . SER C  1 294 ? 5.877   53.306  28.902  1.00   23.38 ? 401  SER C C   1 
ATOM   9319  O  O   . SER C  1 294 ? 5.918   52.256  28.265  1.00   24.04 ? 401  SER C O   1 
ATOM   9320  C  CB  . SER C  1 294 ? 6.127   53.030  31.401  1.00   20.09 ? 401  SER C CB  1 
ATOM   9321  O  OG  . SER C  1 294 ? 5.480   53.393  32.617  1.00   17.04 ? 401  SER C OG  1 
ATOM   9322  N  N   . LYS C  1 295 ? 6.403   54.450  28.465  1.00   23.63 ? 402  LYS C N   1 
ATOM   9323  C  CA  . LYS C  1 295 ? 7.027   54.584  27.151  1.00   24.70 ? 402  LYS C CA  1 
ATOM   9324  C  C   . LYS C  1 295 ? 8.539   54.767  27.105  1.00   22.46 ? 402  LYS C C   1 
ATOM   9325  O  O   . LYS C  1 295 ? 9.075   55.703  27.689  1.00   21.44 ? 402  LYS C O   1 
ATOM   9326  C  CB  . LYS C  1 295 ? 6.393   55.773  26.416  1.00   24.91 ? 402  LYS C CB  1 
ATOM   9327  C  CG  . LYS C  1 295 ? 4.872   55.783  26.395  1.00   23.70 ? 402  LYS C CG  1 
ATOM   9328  C  CD  . LYS C  1 295 ? 4.314   54.601  25.609  1.00   26.45 ? 402  LYS C CD  1 
ATOM   9329  C  CE  . LYS C  1 295 ? 2.838   54.835  25.242  1.00   26.08 ? 402  LYS C CE  1 
ATOM   9330  N  NZ  . LYS C  1 295 ? 1.960   54.903  26.444  1.00   20.86 ? 402  LYS C NZ  1 
ATOM   9331  N  N   . PRO C  1 296 ? 9.238   53.886  26.381  1.00   22.40 ? 403  PRO C N   1 
ATOM   9332  C  CA  . PRO C  1 296 ? 10.697  53.972  26.260  1.00   25.08 ? 403  PRO C CA  1 
ATOM   9333  C  C   . PRO C  1 296 ? 11.066  55.063  25.261  1.00   30.46 ? 403  PRO C C   1 
ATOM   9334  O  O   . PRO C  1 296 ? 11.969  55.862  25.495  1.00   31.49 ? 403  PRO C O   1 
ATOM   9335  C  CB  . PRO C  1 296 ? 11.088  52.595  25.732  1.00   26.01 ? 403  PRO C CB  1 
ATOM   9336  C  CG  . PRO C  1 296 ? 9.932   51.705  26.145  1.00   25.29 ? 403  PRO C CG  1 
ATOM   9337  C  CD  . PRO C  1 296 ? 8.751   52.589  25.884  1.00   23.92 ? 403  PRO C CD  1 
ATOM   9338  N  N   . ALA C  1 297 ? 10.336  55.092  24.150  1.00   33.87 ? 404  ALA C N   1 
ATOM   9339  C  CA  . ALA C  1 297 ? 10.578  56.045  23.072  1.00   37.72 ? 404  ALA C CA  1 
ATOM   9340  C  C   . ALA C  1 297 ? 10.925  57.424  23.587  1.00   38.86 ? 404  ALA C C   1 
ATOM   9341  O  O   . ALA C  1 297 ? 10.261  57.943  24.486  1.00   41.75 ? 404  ALA C O   1 
ATOM   9342  C  CB  . ALA C  1 297 ? 9.358   56.120  22.157  1.00   40.47 ? 404  ALA C CB  1 
ATOM   9343  N  N   . HIS C  1 298 ? 11.972  58.001  23.006  1.00   37.02 ? 405  HIS C N   1 
ATOM   9344  C  CA  . HIS C  1 298 ? 12.462  59.334  23.368  1.00   41.11 ? 405  HIS C CA  1 
ATOM   9345  C  C   . HIS C  1 298 ? 13.524  59.317  24.461  1.00   39.68 ? 405  HIS C C   1 
ATOM   9346  O  O   . HIS C  1 298 ? 14.172  60.339  24.709  1.00   43.43 ? 405  HIS C O   1 
ATOM   9347  C  CB  . HIS C  1 298 ? 11.323  60.254  23.821  1.00   44.11 ? 405  HIS C CB  1 
ATOM   9348  C  CG  . HIS C  1 298 ? 10.258  60.454  22.792  1.00   52.64 ? 405  HIS C CG  1 
ATOM   9349  N  ND1 . HIS C  1 298 ? 10.534  60.845  21.500  1.00   55.44 ? 405  HIS C ND1 1 
ATOM   9350  C  CD2 . HIS C  1 298 ? 8.911   60.326  22.868  1.00   54.23 ? 405  HIS C CD2 1 
ATOM   9351  C  CE1 . HIS C  1 298 ? 9.405   60.947  20.823  1.00   57.51 ? 405  HIS C CE1 1 
ATOM   9352  N  NE2 . HIS C  1 298 ? 8.406   60.637  21.630  1.00   57.99 ? 405  HIS C NE2 1 
ATOM   9353  N  N   . LEU C  1 299 ? 13.703  58.173  25.115  1.00   31.86 ? 406  LEU C N   1 
ATOM   9354  C  CA  . LEU C  1 299 ? 14.693  58.057  26.178  1.00   26.07 ? 406  LEU C CA  1 
ATOM   9355  C  C   . LEU C  1 299 ? 15.945  57.343  25.685  1.00   24.92 ? 406  LEU C C   1 
ATOM   9356  O  O   . LEU C  1 299 ? 15.865  56.239  25.152  1.00   25.41 ? 406  LEU C O   1 
ATOM   9357  C  CB  . LEU C  1 299 ? 14.096  57.296  27.362  1.00   25.02 ? 406  LEU C CB  1 
ATOM   9358  C  CG  . LEU C  1 299 ? 13.608  58.071  28.586  1.00   27.67 ? 406  LEU C CG  1 
ATOM   9359  C  CD1 . LEU C  1 299 ? 13.033  59.405  28.194  1.00   27.71 ? 406  LEU C CD1 1 
ATOM   9360  C  CD2 . LEU C  1 299 ? 12.590  57.221  29.317  1.00   23.93 ? 406  LEU C CD2 1 
ATOM   9361  N  N   . ASN C  1 300 ? 17.104  57.965  25.871  1.00   21.62 ? 407  ASN C N   1 
ATOM   9362  C  CA  . ASN C  1 300 ? 18.359  57.357  25.439  1.00   21.64 ? 407  ASN C CA  1 
ATOM   9363  C  C   . ASN C  1 300 ? 19.054  56.572  26.555  1.00   23.15 ? 407  ASN C C   1 
ATOM   9364  O  O   . ASN C  1 300 ? 19.216  57.057  27.677  1.00   21.23 ? 407  ASN C O   1 
ATOM   9365  C  CB  . ASN C  1 300 ? 19.311  58.431  24.923  1.00   23.66 ? 407  ASN C CB  1 
ATOM   9366  C  CG  . ASN C  1 300 ? 18.643  59.358  23.922  1.00   30.88 ? 407  ASN C CG  1 
ATOM   9367  O  OD1 . ASN C  1 300 ? 18.168  58.915  22.864  1.00   30.90 ? 407  ASN C OD1 1 
ATOM   9368  N  ND2 . ASN C  1 300 ? 18.592  60.652  24.251  1.00   31.09 ? 407  ASN C ND2 1 
ATOM   9369  N  N   . ALA C  1 301 ? 19.463  55.350  26.229  1.00   23.08 ? 408  ALA C N   1 
ATOM   9370  C  CA  . ALA C  1 301 ? 20.163  54.485  27.173  1.00   26.08 ? 408  ALA C CA  1 
ATOM   9371  C  C   . ALA C  1 301 ? 20.924  53.474  26.351  1.00   23.63 ? 408  ALA C C   1 
ATOM   9372  O  O   . ALA C  1 301 ? 20.526  53.149  25.243  1.00   26.24 ? 408  ALA C O   1 
ATOM   9373  C  CB  . ALA C  1 301 ? 19.179  53.770  28.100  1.00   19.33 ? 408  ALA C CB  1 
ATOM   9374  N  N   . ASN C  1 302 ? 22.013  52.960  26.894  1.00   27.26 ? 409  ASN C N   1 
ATOM   9375  C  CA  . ASN C  1 302 ? 22.801  51.998  26.154  1.00   26.59 ? 409  ASN C CA  1 
ATOM   9376  C  C   . ASN C  1 302 ? 22.422  50.580  26.487  1.00   24.39 ? 409  ASN C C   1 
ATOM   9377  O  O   . ASN C  1 302 ? 23.003  49.652  25.944  1.00   22.18 ? 409  ASN C O   1 
ATOM   9378  C  CB  . ASN C  1 302 ? 24.287  52.224  26.427  1.00   33.24 ? 409  ASN C CB  1 
ATOM   9379  C  CG  . ASN C  1 302 ? 24.723  53.627  26.048  1.00   41.89 ? 409  ASN C CG  1 
ATOM   9380  O  OD1 . ASN C  1 302 ? 24.561  54.046  24.891  1.00   43.54 ? 409  ASN C OD1 1 
ATOM   9381  N  ND2 . ASN C  1 302 ? 25.261  54.372  27.020  1.00   43.96 ? 409  ASN C ND2 1 
ATOM   9382  N  N   . ASP C  1 303 ? 21.442  50.394  27.364  1.00   20.63 ? 410  ASP C N   1 
ATOM   9383  C  CA  . ASP C  1 303 ? 21.063  49.027  27.716  1.00   21.10 ? 410  ASP C CA  1 
ATOM   9384  C  C   . ASP C  1 303 ? 19.608  48.651  27.446  1.00   20.51 ? 410  ASP C C   1 
ATOM   9385  O  O   . ASP C  1 303 ? 19.091  47.717  28.065  1.00   21.45 ? 410  ASP C O   1 
ATOM   9386  C  CB  . ASP C  1 303 ? 21.374  48.762  29.188  1.00   20.30 ? 410  ASP C CB  1 
ATOM   9387  C  CG  . ASP C  1 303 ? 20.471  49.543  30.109  1.00   19.78 ? 410  ASP C CG  1 
ATOM   9388  O  OD1 . ASP C  1 303 ? 19.987  50.592  29.658  1.00   17.75 ? 410  ASP C OD1 1 
ATOM   9389  O  OD2 . ASP C  1 303 ? 20.255  49.126  31.270  1.00   19.79 ? 410  ASP C OD2 1 
ATOM   9390  N  N   . TRP C  1 304 ? 18.931  49.360  26.549  1.00   19.09 ? 411  TRP C N   1 
ATOM   9391  C  CA  . TRP C  1 304 ? 17.548  48.995  26.246  1.00   20.56 ? 411  TRP C CA  1 
ATOM   9392  C  C   . TRP C  1 304 ? 17.568  47.564  25.746  1.00   23.14 ? 411  TRP C C   1 
ATOM   9393  O  O   . TRP C  1 304 ? 18.379  47.206  24.896  1.00   26.26 ? 411  TRP C O   1 
ATOM   9394  C  CB  . TRP C  1 304 ? 16.944  49.881  25.155  1.00   20.40 ? 411  TRP C CB  1 
ATOM   9395  C  CG  . TRP C  1 304 ? 16.444  51.174  25.643  1.00   21.33 ? 411  TRP C CG  1 
ATOM   9396  C  CD1 . TRP C  1 304 ? 16.895  52.420  25.293  1.00   20.46 ? 411  TRP C CD1 1 
ATOM   9397  C  CD2 . TRP C  1 304 ? 15.391  51.375  26.595  1.00   20.70 ? 411  TRP C CD2 1 
ATOM   9398  N  NE1 . TRP C  1 304 ? 16.184  53.387  25.975  1.00   23.35 ? 411  TRP C NE1 1 
ATOM   9399  C  CE2 . TRP C  1 304 ? 15.256  52.770  26.779  1.00   22.42 ? 411  TRP C CE2 1 
ATOM   9400  C  CE3 . TRP C  1 304 ? 14.551  50.510  27.312  1.00   17.90 ? 411  TRP C CE3 1 
ATOM   9401  C  CZ2 . TRP C  1 304 ? 14.314  53.317  27.648  1.00   22.03 ? 411  TRP C CZ2 1 
ATOM   9402  C  CZ3 . TRP C  1 304 ? 13.624  51.047  28.170  1.00   19.84 ? 411  TRP C CZ3 1 
ATOM   9403  C  CH2 . TRP C  1 304 ? 13.509  52.442  28.336  1.00   22.18 ? 411  TRP C CH2 1 
ATOM   9404  N  N   . ALA C  1 305 ? 16.691  46.731  26.285  1.00   22.12 ? 412  ALA C N   1 
ATOM   9405  C  CA  . ALA C  1 305 ? 16.624  45.344  25.862  1.00   20.11 ? 412  ALA C CA  1 
ATOM   9406  C  C   . ALA C  1 305 ? 15.164  44.897  25.887  1.00   22.45 ? 412  ALA C C   1 
ATOM   9407  O  O   . ALA C  1 305 ? 14.376  45.348  26.725  1.00   25.44 ? 412  ALA C O   1 
ATOM   9408  C  CB  . ALA C  1 305 ? 17.463  44.477  26.780  1.00   20.94 ? 412  ALA C CB  1 
ATOM   9409  N  N   . THR C  1 306 ? 14.800  44.021  24.961  1.00   19.03 ? 413  THR C N   1 
ATOM   9410  C  CA  . THR C  1 306 ? 13.431  43.538  24.861  1.00   20.86 ? 413  THR C CA  1 
ATOM   9411  C  C   . THR C  1 306 ? 13.286  42.291  25.715  1.00   23.43 ? 413  THR C C   1 
ATOM   9412  O  O   . THR C  1 306 ? 14.059  41.349  25.556  1.00   24.95 ? 413  THR C O   1 
ATOM   9413  C  CB  . THR C  1 306 ? 13.084  43.196  23.402  1.00   18.79 ? 413  THR C CB  1 
ATOM   9414  O  OG1 . THR C  1 306 ? 13.173  44.381  22.604  1.00   17.90 ? 413  THR C OG1 1 
ATOM   9415  C  CG2 . THR C  1 306 ? 11.680  42.619  23.294  1.00   14.31 ? 413  THR C CG2 1 
ATOM   9416  N  N   . ASN C  1 307 ? 12.309  42.281  26.627  1.00   22.20 ? 414  ASN C N   1 
ATOM   9417  C  CA  . ASN C  1 307 ? 12.121  41.117  27.486  1.00   20.58 ? 414  ASN C CA  1 
ATOM   9418  C  C   . ASN C  1 307 ? 11.275  40.016  26.844  1.00   22.56 ? 414  ASN C C   1 
ATOM   9419  O  O   . ASN C  1 307 ? 10.851  40.120  25.688  1.00   22.05 ? 414  ASN C O   1 
ATOM   9420  C  CB  . ASN C  1 307 ? 11.547  41.523  28.864  1.00   16.77 ? 414  ASN C CB  1 
ATOM   9421  C  CG  . ASN C  1 307 ? 10.091  42.022  28.808  1.00   18.32 ? 414  ASN C CG  1 
ATOM   9422  O  OD1 . ASN C  1 307 ? 9.377   41.837  27.821  1.00   20.97 ? 414  ASN C OD1 1 
ATOM   9423  N  ND2 . ASN C  1 307 ? 9.645   42.641  29.896  1.00   16.31 ? 414  ASN C ND2 1 
ATOM   9424  N  N   . GLY C  1 308 ? 11.028  38.961  27.609  1.00   24.11 ? 415  GLY C N   1 
ATOM   9425  C  CA  . GLY C  1 308 ? 10.277  37.823  27.108  1.00   22.26 ? 415  GLY C CA  1 
ATOM   9426  C  C   . GLY C  1 308 ? 8.896   38.111  26.564  1.00   24.21 ? 415  GLY C C   1 
ATOM   9427  O  O   . GLY C  1 308 ? 8.333   37.297  25.823  1.00   24.92 ? 415  GLY C O   1 
ATOM   9428  N  N   . VAL C  1 309 ? 8.316   39.246  26.933  1.00   20.92 ? 416  VAL C N   1 
ATOM   9429  C  CA  . VAL C  1 309 ? 6.989   39.554  26.420  1.00   19.78 ? 416  VAL C CA  1 
ATOM   9430  C  C   . VAL C  1 309 ? 6.980   40.719  25.443  1.00   18.45 ? 416  VAL C C   1 
ATOM   9431  O  O   . VAL C  1 309 ? 5.941   41.337  25.207  1.00   16.71 ? 416  VAL C O   1 
ATOM   9432  C  CB  . VAL C  1 309 ? 5.948   39.817  27.561  1.00   21.50 ? 416  VAL C CB  1 
ATOM   9433  C  CG1 . VAL C  1 309 ? 5.865   38.607  28.466  1.00   20.28 ? 416  VAL C CG1 1 
ATOM   9434  C  CG2 . VAL C  1 309 ? 6.299   41.054  28.363  1.00   23.39 ? 416  VAL C CG2 1 
ATOM   9435  N  N   . GLY C  1 310 ? 8.141   41.017  24.869  1.00   17.04 ? 417  GLY C N   1 
ATOM   9436  C  CA  . GLY C  1 310 ? 8.217   42.087  23.896  1.00   18.83 ? 417  GLY C CA  1 
ATOM   9437  C  C   . GLY C  1 310 ? 8.286   43.518  24.391  1.00   18.87 ? 417  GLY C C   1 
ATOM   9438  O  O   . GLY C  1 310 ? 8.113   44.442  23.605  1.00   18.46 ? 417  GLY C O   1 
ATOM   9439  N  N   . ARG C  1 311 ? 8.535   43.724  25.676  1.00   18.98 ? 418  ARG C N   1 
ATOM   9440  C  CA  . ARG C  1 311 ? 8.621   45.087  26.177  1.00   18.65 ? 418  ARG C CA  1 
ATOM   9441  C  C   . ARG C  1 311 ? 10.065  45.500  26.390  1.00   16.69 ? 418  ARG C C   1 
ATOM   9442  O  O   . ARG C  1 311 ? 10.888  44.688  26.801  1.00   15.00 ? 418  ARG C O   1 
ATOM   9443  C  CB  . ARG C  1 311 ? 7.813   45.228  27.467  1.00   18.12 ? 418  ARG C CB  1 
ATOM   9444  C  CG  . ARG C  1 311 ? 6.342   45.216  27.174  1.00   21.82 ? 418  ARG C CG  1 
ATOM   9445  C  CD  . ARG C  1 311 ? 5.543   45.744  28.325  1.00   26.28 ? 418  ARG C CD  1 
ATOM   9446  N  NE  . ARG C  1 311 ? 5.186   44.671  29.226  1.00   31.21 ? 418  ARG C NE  1 
ATOM   9447  C  CZ  . ARG C  1 311 ? 3.950   44.227  29.393  1.00   27.20 ? 418  ARG C CZ  1 
ATOM   9448  N  NH1 . ARG C  1 311 ? 3.722   43.235  30.238  1.00   27.00 ? 418  ARG C NH1 1 
ATOM   9449  N  NH2 . ARG C  1 311 ? 2.952   44.783  28.726  1.00   29.46 ? 418  ARG C NH2 1 
ATOM   9450  N  N   . LYS C  1 312 ? 10.364  46.758  26.083  1.00   17.24 ? 419  LYS C N   1 
ATOM   9451  C  CA  . LYS C  1 312 ? 11.708  47.287  26.246  1.00   21.25 ? 419  LYS C CA  1 
ATOM   9452  C  C   . LYS C  1 312 ? 11.933  47.677  27.693  1.00   21.21 ? 419  LYS C C   1 
ATOM   9453  O  O   . LYS C  1 312 ? 11.059  48.281  28.315  1.00   23.15 ? 419  LYS C O   1 
ATOM   9454  C  CB  . LYS C  1 312 ? 11.914  48.507  25.346  1.00   22.40 ? 419  LYS C CB  1 
ATOM   9455  C  CG  . LYS C  1 312 ? 12.096  48.136  23.875  1.00   20.75 ? 419  LYS C CG  1 
ATOM   9456  C  CD  . LYS C  1 312 ? 12.247  49.368  23.006  1.00   24.57 ? 419  LYS C CD  1 
ATOM   9457  C  CE  . LYS C  1 312 ? 13.649  49.930  23.068  1.00   26.93 ? 419  LYS C CE  1 
ATOM   9458  N  NZ  . LYS C  1 312 ? 13.767  51.172  22.247  1.00   32.61 ? 419  LYS C NZ  1 
ATOM   9459  N  N   . VAL C  1 313 ? 13.096  47.319  28.229  1.00   19.76 ? 420  VAL C N   1 
ATOM   9460  C  CA  . VAL C  1 313 ? 13.435  47.673  29.606  1.00   20.36 ? 420  VAL C CA  1 
ATOM   9461  C  C   . VAL C  1 313 ? 14.880  48.124  29.686  1.00   18.82 ? 420  VAL C C   1 
ATOM   9462  O  O   . VAL C  1 313 ? 15.732  47.637  28.937  1.00   20.07 ? 420  VAL C O   1 
ATOM   9463  C  CB  . VAL C  1 313 ? 13.252  46.477  30.587  1.00   24.99 ? 420  VAL C CB  1 
ATOM   9464  C  CG1 . VAL C  1 313 ? 11.844  45.949  30.520  1.00   25.70 ? 420  VAL C CG1 1 
ATOM   9465  C  CG2 . VAL C  1 313 ? 14.247  45.367  30.260  1.00   22.25 ? 420  VAL C CG2 1 
ATOM   9466  N  N   . SER C  1 314 ? 15.142  49.070  30.584  1.00   18.13 ? 421  SER C N   1 
ATOM   9467  C  CA  . SER C  1 314 ? 16.490  49.584  30.827  1.00   15.56 ? 421  SER C CA  1 
ATOM   9468  C  C   . SER C  1 314 ? 16.717  49.655  32.335  1.00   16.28 ? 421  SER C C   1 
ATOM   9469  O  O   . SER C  1 314 ? 15.789  49.903  33.095  1.00   15.14 ? 421  SER C O   1 
ATOM   9470  C  CB  . SER C  1 314 ? 16.659  50.982  30.245  1.00   16.56 ? 421  SER C CB  1 
ATOM   9471  O  OG  . SER C  1 314 ? 17.819  51.595  30.781  1.00   17.96 ? 421  SER C OG  1 
ATOM   9472  N  N   . HIS C  1 315 ? 17.950  49.439  32.770  1.00   16.25 ? 422  HIS C N   1 
ATOM   9473  C  CA  . HIS C  1 315 ? 18.239  49.499  34.189  1.00   16.32 ? 422  HIS C CA  1 
ATOM   9474  C  C   . HIS C  1 315 ? 18.245  50.954  34.685  1.00   17.61 ? 422  HIS C C   1 
ATOM   9475  O  O   . HIS C  1 315 ? 18.217  51.206  35.899  1.00   17.43 ? 422  HIS C O   1 
ATOM   9476  C  CB  . HIS C  1 315 ? 19.569  48.798  34.483  1.00   12.57 ? 422  HIS C CB  1 
ATOM   9477  C  CG  . HIS C  1 315 ? 19.519  47.311  34.290  1.00   12.07 ? 422  HIS C CG  1 
ATOM   9478  N  ND1 . HIS C  1 315 ? 19.518  46.717  33.044  1.00   13.99 ? 422  HIS C ND1 1 
ATOM   9479  C  CD2 . HIS C  1 315 ? 19.402  46.300  35.188  1.00   13.98 ? 422  HIS C CD2 1 
ATOM   9480  C  CE1 . HIS C  1 315 ? 19.398  45.405  33.182  1.00   12.93 ? 422  HIS C CE1 1 
ATOM   9481  N  NE2 . HIS C  1 315 ? 19.324  45.126  34.472  1.00   15.75 ? 422  HIS C NE2 1 
ATOM   9482  N  N   . SER C  1 316 ? 18.261  51.904  33.748  1.00   15.08 ? 423  SER C N   1 
ATOM   9483  C  CA  . SER C  1 316 ? 18.236  53.323  34.107  1.00   15.84 ? 423  SER C CA  1 
ATOM   9484  C  C   . SER C  1 316 ? 16.816  53.882  34.135  1.00   17.23 ? 423  SER C C   1 
ATOM   9485  O  O   . SER C  1 316 ? 16.546  54.885  34.806  1.00   19.06 ? 423  SER C O   1 
ATOM   9486  C  CB  . SER C  1 316 ? 19.032  54.164  33.102  1.00   13.94 ? 423  SER C CB  1 
ATOM   9487  O  OG  . SER C  1 316 ? 20.417  53.957  33.237  1.00   17.02 ? 423  SER C OG  1 
ATOM   9488  N  N   . TYR C  1 317 ? 15.907  53.232  33.416  1.00   16.28 ? 424  TYR C N   1 
ATOM   9489  C  CA  . TYR C  1 317 ? 14.543  53.738  33.298  1.00   16.49 ? 424  TYR C CA  1 
ATOM   9490  C  C   . TYR C  1 317 ? 13.399  52.784  33.603  1.00   18.05 ? 424  TYR C C   1 
ATOM   9491  O  O   . TYR C  1 317 ? 12.238  53.200  33.619  1.00   16.81 ? 424  TYR C O   1 
ATOM   9492  C  CB  . TYR C  1 317 ? 14.320  54.229  31.872  1.00   19.11 ? 424  TYR C CB  1 
ATOM   9493  C  CG  . TYR C  1 317 ? 15.318  55.234  31.347  1.00   20.75 ? 424  TYR C CG  1 
ATOM   9494  C  CD1 . TYR C  1 317 ? 15.477  56.484  31.965  1.00   21.52 ? 424  TYR C CD1 1 
ATOM   9495  C  CD2 . TYR C  1 317 ? 16.016  54.992  30.156  1.00   19.19 ? 424  TYR C CD2 1 
ATOM   9496  C  CE1 . TYR C  1 317 ? 16.290  57.473  31.397  1.00   19.21 ? 424  TYR C CE1 1 
ATOM   9497  C  CE2 . TYR C  1 317 ? 16.835  55.973  29.583  1.00   16.20 ? 424  TYR C CE2 1 
ATOM   9498  C  CZ  . TYR C  1 317 ? 16.958  57.210  30.208  1.00   20.33 ? 424  TYR C CZ  1 
ATOM   9499  O  OH  . TYR C  1 317 ? 17.714  58.202  29.624  1.00   23.60 ? 424  TYR C OH  1 
ATOM   9500  N  N   . GLY C  1 318 ? 13.699  51.513  33.830  1.00   16.59 ? 425  GLY C N   1 
ATOM   9501  C  CA  . GLY C  1 318 ? 12.614  50.580  34.055  1.00   15.58 ? 425  GLY C CA  1 
ATOM   9502  C  C   . GLY C  1 318 ? 11.906  50.427  32.712  1.00   16.63 ? 425  GLY C C   1 
ATOM   9503  O  O   . GLY C  1 318 ? 12.551  50.250  31.673  1.00   13.46 ? 425  GLY C O   1 
ATOM   9504  N  N   . TYR C  1 319 ? 10.583  50.511  32.712  1.00   16.02 ? 426  TYR C N   1 
ATOM   9505  C  CA  . TYR C  1 319 ? 9.836   50.380  31.473  1.00   17.17 ? 426  TYR C CA  1 
ATOM   9506  C  C   . TYR C  1 319 ? 9.703   51.693  30.702  1.00   17.49 ? 426  TYR C C   1 
ATOM   9507  O  O   . TYR C  1 319 ? 9.015   51.756  29.678  1.00   17.89 ? 426  TYR C O   1 
ATOM   9508  C  CB  . TYR C  1 319 ? 8.454   49.797  31.753  1.00   14.19 ? 426  TYR C CB  1 
ATOM   9509  C  CG  . TYR C  1 319 ? 8.530   48.341  32.077  1.00   15.64 ? 426  TYR C CG  1 
ATOM   9510  C  CD1 . TYR C  1 319 ? 8.805   47.913  33.371  1.00   14.82 ? 426  TYR C CD1 1 
ATOM   9511  C  CD2 . TYR C  1 319 ? 8.433   47.381  31.069  1.00   15.68 ? 426  TYR C CD2 1 
ATOM   9512  C  CE1 . TYR C  1 319 ? 8.994   46.555  33.659  1.00   13.48 ? 426  TYR C CE1 1 
ATOM   9513  C  CE2 . TYR C  1 319 ? 8.621   46.026  31.345  1.00   16.84 ? 426  TYR C CE2 1 
ATOM   9514  C  CZ  . TYR C  1 319 ? 8.905   45.622  32.645  1.00   14.05 ? 426  TYR C CZ  1 
ATOM   9515  O  OH  . TYR C  1 319 ? 9.125   44.295  32.915  1.00   12.49 ? 426  TYR C OH  1 
ATOM   9516  N  N   . GLY C  1 320 ? 10.358  52.742  31.190  1.00   16.20 ? 427  GLY C N   1 
ATOM   9517  C  CA  . GLY C  1 320 ? 10.283  54.009  30.490  1.00   15.84 ? 427  GLY C CA  1 
ATOM   9518  C  C   . GLY C  1 320 ? 9.535   55.119  31.200  1.00   17.03 ? 427  GLY C C   1 
ATOM   9519  O  O   . GLY C  1 320 ? 9.236   55.064  32.400  1.00   16.33 ? 427  GLY C O   1 
ATOM   9520  N  N   . LEU C  1 321 ? 9.219   56.143  30.425  1.00   18.39 ? 428  LEU C N   1 
ATOM   9521  C  CA  . LEU C  1 321 ? 8.544   57.326  30.931  1.00   18.15 ? 428  LEU C CA  1 
ATOM   9522  C  C   . LEU C  1 321 ? 7.081   57.073  31.222  1.00   17.66 ? 428  LEU C C   1 
ATOM   9523  O  O   . LEU C  1 321 ? 6.398   56.444  30.424  1.00   16.40 ? 428  LEU C O   1 
ATOM   9524  C  CB  . LEU C  1 321 ? 8.663   58.421  29.889  1.00   18.37 ? 428  LEU C CB  1 
ATOM   9525  C  CG  . LEU C  1 321 ? 8.685   59.870  30.339  1.00   29.20 ? 428  LEU C CG  1 
ATOM   9526  C  CD1 . LEU C  1 321 ? 9.945   60.159  31.189  1.00   23.28 ? 428  LEU C CD1 1 
ATOM   9527  C  CD2 . LEU C  1 321 ? 8.669   60.729  29.076  1.00   31.70 ? 428  LEU C CD2 1 
ATOM   9528  N  N   . LEU C  1 322 ? 6.594   57.566  32.358  1.00   17.07 ? 429  LEU C N   1 
ATOM   9529  C  CA  . LEU C  1 322 ? 5.175   57.407  32.692  1.00   17.63 ? 429  LEU C CA  1 
ATOM   9530  C  C   . LEU C  1 322 ? 4.364   58.202  31.668  1.00   18.38 ? 429  LEU C C   1 
ATOM   9531  O  O   . LEU C  1 322 ? 4.829   59.231  31.164  1.00   15.34 ? 429  LEU C O   1 
ATOM   9532  C  CB  . LEU C  1 322 ? 4.871   57.933  34.096  1.00   16.43 ? 429  LEU C CB  1 
ATOM   9533  C  CG  . LEU C  1 322 ? 5.466   57.160  35.280  1.00   15.17 ? 429  LEU C CG  1 
ATOM   9534  C  CD1 . LEU C  1 322 ? 5.039   57.826  36.572  1.00   14.57 ? 429  LEU C CD1 1 
ATOM   9535  C  CD2 . LEU C  1 322 ? 5.003   55.715  35.247  1.00   15.34 ? 429  LEU C CD2 1 
ATOM   9536  N  N   . ASP C  1 323 ? 3.171   57.703  31.356  1.00   17.39 ? 430  ASP C N   1 
ATOM   9537  C  CA  . ASP C  1 323 ? 2.263   58.335  30.392  1.00   19.38 ? 430  ASP C CA  1 
ATOM   9538  C  C   . ASP C  1 323 ? 0.916   58.487  31.102  1.00   17.99 ? 430  ASP C C   1 
ATOM   9539  O  O   . ASP C  1 323 ? 0.140   57.542  31.162  1.00   15.32 ? 430  ASP C O   1 
ATOM   9540  C  CB  . ASP C  1 323 ? 2.097   57.437  29.169  1.00   17.52 ? 430  ASP C CB  1 
ATOM   9541  C  CG  . ASP C  1 323 ? 1.230   58.069  28.092  1.00   20.89 ? 430  ASP C CG  1 
ATOM   9542  O  OD1 . ASP C  1 323 ? 0.386   58.945  28.413  1.00   18.41 ? 430  ASP C OD1 1 
ATOM   9543  O  OD2 . ASP C  1 323 ? 1.392   57.668  26.920  1.00   16.74 ? 430  ASP C OD2 1 
ATOM   9544  N  N   . ALA C  1 324 ? 0.645   59.676  31.636  1.00   15.95 ? 431  ALA C N   1 
ATOM   9545  C  CA  . ALA C  1 324 ? -0.587  59.898  32.380  1.00   18.83 ? 431  ALA C CA  1 
ATOM   9546  C  C   . ALA C  1 324 ? -1.856  59.599  31.593  1.00   18.06 ? 431  ALA C C   1 
ATOM   9547  O  O   . ALA C  1 324 ? -2.762  58.931  32.097  1.00   21.46 ? 431  ALA C O   1 
ATOM   9548  C  CB  . ALA C  1 324 ? -0.617  61.318  32.910  1.00   19.40 ? 431  ALA C CB  1 
ATOM   9549  N  N   . GLY C  1 325 ? -1.931  60.102  30.365  1.00   16.17 ? 432  GLY C N   1 
ATOM   9550  C  CA  . GLY C  1 325 ? -3.104  59.841  29.547  1.00   18.16 ? 432  GLY C CA  1 
ATOM   9551  C  C   . GLY C  1 325 ? -3.364  58.344  29.374  1.00   21.08 ? 432  GLY C C   1 
ATOM   9552  O  O   . GLY C  1 325 ? -4.514  57.885  29.495  1.00   20.43 ? 432  GLY C O   1 
ATOM   9553  N  N   . ALA C  1 326 ? -2.302  57.577  29.109  1.00   16.21 ? 433  ALA C N   1 
ATOM   9554  C  CA  . ALA C  1 326 ? -2.445  56.137  28.911  1.00   18.76 ? 433  ALA C CA  1 
ATOM   9555  C  C   . ALA C  1 326 ? -2.820  55.454  30.229  1.00   18.93 ? 433  ALA C C   1 
ATOM   9556  O  O   . ALA C  1 326 ? -3.616  54.511  30.254  1.00   19.32 ? 433  ALA C O   1 
ATOM   9557  C  CB  . ALA C  1 326 ? -1.141  55.548  28.352  1.00   16.15 ? 433  ALA C CB  1 
ATOM   9558  N  N   . MET C  1 327 ? -2.242  55.936  31.325  1.00   19.12 ? 434  MET C N   1 
ATOM   9559  C  CA  . MET C  1 327 ? -2.516  55.379  32.646  1.00   17.97 ? 434  MET C CA  1 
ATOM   9560  C  C   . MET C  1 327 ? -3.994  55.491  33.001  1.00   17.80 ? 434  MET C C   1 
ATOM   9561  O  O   . MET C  1 327 ? -4.621  54.499  33.376  1.00   17.10 ? 434  MET C O   1 
ATOM   9562  C  CB  . MET C  1 327 ? -1.681  56.102  33.710  1.00   18.76 ? 434  MET C CB  1 
ATOM   9563  C  CG  . MET C  1 327 ? -0.219  55.642  33.783  1.00   17.45 ? 434  MET C CG  1 
ATOM   9564  S  SD  . MET C  1 327 ? -0.005  54.026  34.617  1.00   21.53 ? 434  MET C SD  1 
ATOM   9565  C  CE  . MET C  1 327 ? -0.231  54.519  36.332  1.00   15.41 ? 434  MET C CE  1 
ATOM   9566  N  N   . VAL C  1 328 ? -4.556  56.695  32.883  1.00   18.76 ? 435  VAL C N   1 
ATOM   9567  C  CA  . VAL C  1 328 ? -5.963  56.872  33.229  1.00   21.53 ? 435  VAL C CA  1 
ATOM   9568  C  C   . VAL C  1 328 ? -6.888  56.158  32.244  1.00   24.55 ? 435  VAL C C   1 
ATOM   9569  O  O   . VAL C  1 328 ? -7.970  55.693  32.629  1.00   26.23 ? 435  VAL C O   1 
ATOM   9570  C  CB  . VAL C  1 328 ? -6.372  58.369  33.321  1.00   24.14 ? 435  VAL C CB  1 
ATOM   9571  C  CG1 . VAL C  1 328 ? -5.595  59.056  34.434  1.00   18.92 ? 435  VAL C CG1 1 
ATOM   9572  C  CG2 . VAL C  1 328 ? -6.180  59.065  31.980  1.00   23.11 ? 435  VAL C CG2 1 
ATOM   9573  N  N   . ALA C  1 329 ? -6.459  56.051  30.985  1.00   21.25 ? 436  ALA C N   1 
ATOM   9574  C  CA  . ALA C  1 329 ? -7.265  55.373  29.977  1.00   23.90 ? 436  ALA C CA  1 
ATOM   9575  C  C   . ALA C  1 329 ? -7.364  53.883  30.292  1.00   23.30 ? 436  ALA C C   1 
ATOM   9576  O  O   . ALA C  1 329 ? -8.455  53.323  30.333  1.00   24.14 ? 436  ALA C O   1 
ATOM   9577  C  CB  . ALA C  1 329 ? -6.657  55.567  28.584  1.00   24.01 ? 436  ALA C CB  1 
ATOM   9578  N  N   . LEU C  1 330 ? -6.223  53.245  30.524  1.00   21.12 ? 437  LEU C N   1 
ATOM   9579  C  CA  . LEU C  1 330 ? -6.217  51.823  30.821  1.00   19.94 ? 437  LEU C CA  1 
ATOM   9580  C  C   . LEU C  1 330 ? -6.874  51.501  32.161  1.00   20.45 ? 437  LEU C C   1 
ATOM   9581  O  O   . LEU C  1 330 ? -7.513  50.464  32.310  1.00   20.12 ? 437  LEU C O   1 
ATOM   9582  C  CB  . LEU C  1 330 ? -4.784  51.288  30.794  1.00   19.57 ? 437  LEU C CB  1 
ATOM   9583  C  CG  . LEU C  1 330 ? -4.599  49.799  31.113  1.00   19.64 ? 437  LEU C CG  1 
ATOM   9584  C  CD1 . LEU C  1 330 ? -5.459  48.956  30.186  1.00   19.08 ? 437  LEU C CD1 1 
ATOM   9585  C  CD2 . LEU C  1 330 ? -3.141  49.426  30.952  1.00   19.78 ? 437  LEU C CD2 1 
ATOM   9586  N  N   . ALA C  1 331 ? -6.734  52.395  33.131  1.00   21.00 ? 438  ALA C N   1 
ATOM   9587  C  CA  . ALA C  1 331 ? -7.319  52.172  34.447  1.00   22.36 ? 438  ALA C CA  1 
ATOM   9588  C  C   . ALA C  1 331 ? -8.833  51.958  34.421  1.00   24.24 ? 438  ALA C C   1 
ATOM   9589  O  O   . ALA C  1 331 ? -9.363  51.092  35.119  1.00   22.56 ? 438  ALA C O   1 
ATOM   9590  C  CB  . ALA C  1 331 ? -6.987  53.351  35.374  1.00   22.22 ? 438  ALA C CB  1 
ATOM   9591  N  N   . GLN C  1 332 ? -9.526  52.753  33.619  1.00   26.87 ? 439  GLN C N   1 
ATOM   9592  C  CA  . GLN C  1 332 ? -10.980 52.683  33.545  1.00   32.81 ? 439  GLN C CA  1 
ATOM   9593  C  C   . GLN C  1 332 ? -11.556 51.303  33.259  1.00   33.34 ? 439  GLN C C   1 
ATOM   9594  O  O   . GLN C  1 332 ? -12.543 50.909  33.869  1.00   36.84 ? 439  GLN C O   1 
ATOM   9595  C  CB  . GLN C  1 332 ? -11.494 53.701  32.518  1.00   33.36 ? 439  GLN C CB  1 
ATOM   9596  C  CG  . GLN C  1 332 ? -11.118 55.143  32.858  1.00   35.83 ? 439  GLN C CG  1 
ATOM   9597  C  CD  . GLN C  1 332 ? -11.665 56.142  31.860  1.00   37.75 ? 439  GLN C CD  1 
ATOM   9598  O  OE1 . GLN C  1 332 ? -12.872 56.196  31.623  1.00   39.41 ? 439  GLN C OE1 1 
ATOM   9599  N  NE2 . GLN C  1 332 ? -10.781 56.944  31.273  1.00   39.47 ? 439  GLN C NE2 1 
ATOM   9600  N  N   . ASN C  1 333 ? -10.941 50.565  32.347  1.00   35.78 ? 440  ASN C N   1 
ATOM   9601  C  CA  . ASN C  1 333 ? -11.435 49.237  32.009  1.00   36.63 ? 440  ASN C CA  1 
ATOM   9602  C  C   . ASN C  1 333 ? -10.652 48.084  32.634  1.00   35.82 ? 440  ASN C C   1 
ATOM   9603  O  O   . ASN C  1 333 ? -10.880 46.923  32.303  1.00   35.97 ? 440  ASN C O   1 
ATOM   9604  C  CB  . ASN C  1 333 ? -11.469 49.091  30.488  1.00   40.77 ? 440  ASN C CB  1 
ATOM   9605  C  CG  . ASN C  1 333 ? -12.702 49.737  29.882  1.00   42.36 ? 440  ASN C CG  1 
ATOM   9606  O  OD1 . ASN C  1 333 ? -12.818 49.863  28.664  0.0000 41.75 ? 440  ASN C OD1 1 
ATOM   9607  N  ND2 . ASN C  1 333 ? -13.635 50.142  30.736  0.0000 41.75 ? 440  ASN C ND2 1 
ATOM   9608  N  N   . TRP C  1 334 ? -9.751  48.406  33.555  1.00   33.03 ? 441  TRP C N   1 
ATOM   9609  C  CA  . TRP C  1 334 ? -8.920  47.393  34.193  1.00   28.82 ? 441  TRP C CA  1 
ATOM   9610  C  C   . TRP C  1 334 ? -9.632  46.371  35.081  1.00   27.84 ? 441  TRP C C   1 
ATOM   9611  O  O   . TRP C  1 334 ? -10.408 46.713  35.967  1.00   28.18 ? 441  TRP C O   1 
ATOM   9612  C  CB  . TRP C  1 334 ? -7.807  48.068  35.005  1.00   27.76 ? 441  TRP C CB  1 
ATOM   9613  C  CG  . TRP C  1 334 ? -6.764  47.108  35.497  1.00   21.38 ? 441  TRP C CG  1 
ATOM   9614  C  CD1 . TRP C  1 334 ? -6.652  46.578  36.751  1.00   18.84 ? 441  TRP C CD1 1 
ATOM   9615  C  CD2 . TRP C  1 334 ? -5.697  46.547  34.726  1.00   23.47 ? 441  TRP C CD2 1 
ATOM   9616  N  NE1 . TRP C  1 334 ? -5.576  45.721  36.809  1.00   18.29 ? 441  TRP C NE1 1 
ATOM   9617  C  CE2 . TRP C  1 334 ? -4.975  45.682  35.579  1.00   17.23 ? 441  TRP C CE2 1 
ATOM   9618  C  CE3 . TRP C  1 334 ? -5.283  46.690  33.392  1.00   20.64 ? 441  TRP C CE3 1 
ATOM   9619  C  CZ2 . TRP C  1 334 ? -3.862  44.960  35.143  1.00   21.02 ? 441  TRP C CZ2 1 
ATOM   9620  C  CZ3 . TRP C  1 334 ? -4.175  45.974  32.957  1.00   23.87 ? 441  TRP C CZ3 1 
ATOM   9621  C  CH2 . TRP C  1 334 ? -3.475  45.116  33.834  1.00   23.36 ? 441  TRP C CH2 1 
ATOM   9622  N  N   . THR C  1 335 ? -9.333  45.103  34.838  1.00   26.71 ? 442  THR C N   1 
ATOM   9623  C  CA  . THR C  1 335 ? -9.893  44.003  35.613  1.00   27.08 ? 442  THR C CA  1 
ATOM   9624  C  C   . THR C  1 335 ? -8.866  43.653  36.695  1.00   26.05 ? 442  THR C C   1 
ATOM   9625  O  O   . THR C  1 335 ? -7.734  43.304  36.377  1.00   26.27 ? 442  THR C O   1 
ATOM   9626  C  CB  . THR C  1 335 ? -10.098 42.766  34.722  1.00   27.80 ? 442  THR C CB  1 
ATOM   9627  O  OG1 . THR C  1 335 ? -10.999 43.078  33.650  1.00   31.23 ? 442  THR C OG1 1 
ATOM   9628  C  CG2 . THR C  1 335 ? -10.636 41.613  35.531  1.00   25.99 ? 442  THR C CG2 1 
ATOM   9629  N  N   . THR C  1 336 ? -9.253  43.749  37.963  1.00   26.88 ? 443  THR C N   1 
ATOM   9630  C  CA  . THR C  1 336 ? -8.341  43.452  39.065  1.00   25.63 ? 443  THR C CA  1 
ATOM   9631  C  C   . THR C  1 336 ? -7.623  42.120  38.877  1.00   25.93 ? 443  THR C C   1 
ATOM   9632  O  O   . THR C  1 336 ? -8.248  41.100  38.576  1.00   25.19 ? 443  THR C O   1 
ATOM   9633  C  CB  . THR C  1 336 ? -9.095  43.456  40.412  1.00   28.01 ? 443  THR C CB  1 
ATOM   9634  O  OG1 . THR C  1 336 ? -9.622  44.773  40.630  1.00   36.75 ? 443  THR C OG1 1 
ATOM   9635  C  CG2 . THR C  1 336 ? -8.160  43.118  41.577  1.00   25.17 ? 443  THR C CG2 1 
ATOM   9636  N  N   . VAL C  1 337 ? -6.303  42.136  39.049  1.00   22.07 ? 444  VAL C N   1 
ATOM   9637  C  CA  . VAL C  1 337 ? -5.510  40.927  38.884  1.00   22.64 ? 444  VAL C CA  1 
ATOM   9638  C  C   . VAL C  1 337 ? -5.848  39.865  39.923  1.00   24.02 ? 444  VAL C C   1 
ATOM   9639  O  O   . VAL C  1 337 ? -6.359  40.168  41.006  1.00   20.99 ? 444  VAL C O   1 
ATOM   9640  C  CB  . VAL C  1 337 ? -3.990  41.236  38.961  1.00   23.11 ? 444  VAL C CB  1 
ATOM   9641  C  CG1 . VAL C  1 337 ? -3.606  42.166  37.822  1.00   23.93 ? 444  VAL C CG1 1 
ATOM   9642  C  CG2 . VAL C  1 337 ? -3.625  41.871  40.316  1.00   20.58 ? 444  VAL C CG2 1 
ATOM   9643  N  N   . ALA C  1 338 ? -5.562  38.616  39.581  1.00   23.55 ? 445  ALA C N   1 
ATOM   9644  C  CA  . ALA C  1 338 ? -5.812  37.504  40.484  1.00   23.25 ? 445  ALA C CA  1 
ATOM   9645  C  C   . ALA C  1 338 ? -4.960  37.636  41.751  1.00   23.75 ? 445  ALA C C   1 
ATOM   9646  O  O   . ALA C  1 338 ? -4.004  38.412  41.803  1.00   21.81 ? 445  ALA C O   1 
ATOM   9647  C  CB  . ALA C  1 338 ? -5.492  36.185  39.779  1.00   22.25 ? 445  ALA C CB  1 
ATOM   9648  N  N   . PRO C  1 339 ? -5.307  36.876  42.798  1.00   24.60 ? 446  PRO C N   1 
ATOM   9649  C  CA  . PRO C  1 339 ? -4.564  36.914  44.060  1.00   24.06 ? 446  PRO C CA  1 
ATOM   9650  C  C   . PRO C  1 339 ? -3.089  36.620  43.817  1.00   22.41 ? 446  PRO C C   1 
ATOM   9651  O  O   . PRO C  1 339 ? -2.730  35.787  42.983  1.00   22.34 ? 446  PRO C O   1 
ATOM   9652  C  CB  . PRO C  1 339 ? -5.226  35.810  44.881  1.00   23.87 ? 446  PRO C CB  1 
ATOM   9653  C  CG  . PRO C  1 339 ? -6.627  35.813  44.382  1.00   24.11 ? 446  PRO C CG  1 
ATOM   9654  C  CD  . PRO C  1 339 ? -6.423  35.919  42.887  1.00   26.91 ? 446  PRO C CD  1 
ATOM   9655  N  N   . GLN C  1 340 ? -2.241  37.300  44.562  1.00   18.49 ? 447  GLN C N   1 
ATOM   9656  C  CA  . GLN C  1 340 ? -0.814  37.134  44.423  1.00   18.84 ? 447  GLN C CA  1 
ATOM   9657  C  C   . GLN C  1 340 ? -0.317  35.785  44.952  1.00   20.50 ? 447  GLN C C   1 
ATOM   9658  O  O   . GLN C  1 340 ? -0.631  35.397  46.079  1.00   22.00 ? 447  GLN C O   1 
ATOM   9659  C  CB  . GLN C  1 340 ? -0.122  38.268  45.169  1.00   15.41 ? 447  GLN C CB  1 
ATOM   9660  C  CG  . GLN C  1 340 ? 1.374   38.278  45.044  1.00   16.45 ? 447  GLN C CG  1 
ATOM   9661  C  CD  . GLN C  1 340 ? 2.002   38.880  46.265  1.00   19.58 ? 447  GLN C CD  1 
ATOM   9662  O  OE1 . GLN C  1 340 ? 1.719   38.446  47.382  1.00   20.19 ? 447  GLN C OE1 1 
ATOM   9663  N  NE2 . GLN C  1 340 ? 2.854   39.887  46.072  1.00   16.34 ? 447  GLN C NE2 1 
ATOM   9664  N  N   . ARG C  1 341 ? 0.456   35.074  44.137  1.00   18.38 ? 448  ARG C N   1 
ATOM   9665  C  CA  . ARG C  1 341 ? 1.034   33.796  44.547  1.00   17.72 ? 448  ARG C CA  1 
ATOM   9666  C  C   . ARG C  1 341 ? 2.516   34.023  44.770  1.00   16.45 ? 448  ARG C C   1 
ATOM   9667  O  O   . ARG C  1 341 ? 3.098   34.957  44.211  1.00   17.63 ? 448  ARG C O   1 
ATOM   9668  C  CB  . ARG C  1 341 ? 0.848   32.750  43.460  1.00   19.92 ? 448  ARG C CB  1 
ATOM   9669  C  CG  . ARG C  1 341 ? -0.583  32.553  43.080  1.00   24.93 ? 448  ARG C CG  1 
ATOM   9670  C  CD  . ARG C  1 341 ? -0.719  31.568  41.954  1.00   27.09 ? 448  ARG C CD  1 
ATOM   9671  N  NE  . ARG C  1 341 ? -2.130  31.322  41.688  1.00   28.64 ? 448  ARG C NE  1 
ATOM   9672  C  CZ  . ARG C  1 341 ? -2.611  30.180  41.216  1.00   28.61 ? 448  ARG C CZ  1 
ATOM   9673  N  NH1 . ARG C  1 341 ? -3.914  30.054  41.017  1.00   30.39 ? 448  ARG C NH1 1 
ATOM   9674  N  NH2 . ARG C  1 341 ? -1.793  29.167  40.953  1.00   27.34 ? 448  ARG C NH2 1 
ATOM   9675  N  N   . LYS C  1 342 ? 3.125   33.166  45.578  1.00   18.41 ? 449  LYS C N   1 
ATOM   9676  C  CA  . LYS C  1 342 ? 4.540   33.275  45.893  1.00   15.65 ? 449  LYS C CA  1 
ATOM   9677  C  C   . LYS C  1 342 ? 5.156   31.886  45.834  1.00   19.80 ? 449  LYS C C   1 
ATOM   9678  O  O   . LYS C  1 342 ? 4.751   30.987  46.582  1.00   21.53 ? 449  LYS C O   1 
ATOM   9679  C  CB  . LYS C  1 342 ? 4.697   33.862  47.295  1.00   15.49 ? 449  LYS C CB  1 
ATOM   9680  C  CG  . LYS C  1 342 ? 6.119   34.153  47.717  1.00   13.87 ? 449  LYS C CG  1 
ATOM   9681  C  CD  . LYS C  1 342 ? 6.139   34.598  49.171  1.00   15.67 ? 449  LYS C CD  1 
ATOM   9682  C  CE  . LYS C  1 342 ? 7.515   35.096  49.599  1.00   17.39 ? 449  LYS C CE  1 
ATOM   9683  N  NZ  . LYS C  1 342 ? 7.476   35.540  51.036  1.00   15.20 ? 449  LYS C NZ  1 
ATOM   9684  N  N   . CYS C  1 343 ? 6.124   31.707  44.941  1.00   18.55 ? 450  CYS C N   1 
ATOM   9685  C  CA  . CYS C  1 343 ? 6.788   30.418  44.793  1.00   20.55 ? 450  CYS C CA  1 
ATOM   9686  C  C   . CYS C  1 343 ? 8.252   30.561  45.209  1.00   20.50 ? 450  CYS C C   1 
ATOM   9687  O  O   . CYS C  1 343 ? 9.006   31.335  44.610  1.00   18.51 ? 450  CYS C O   1 
ATOM   9688  C  CB  . CYS C  1 343 ? 6.653   29.942  43.337  1.00   22.69 ? 450  CYS C CB  1 
ATOM   9689  S  SG  . CYS C  1 343 ? 7.398   28.320  42.970  1.00   25.25 ? 450  CYS C SG  1 
ATOM   9690  N  N   . ILE C  1 344 ? 8.633   29.827  46.255  1.00   19.20 ? 451  ILE C N   1 
ATOM   9691  C  CA  . ILE C  1 344 ? 9.991   29.857  46.803  1.00   17.69 ? 451  ILE C CA  1 
ATOM   9692  C  C   . ILE C  1 344 ? 10.805  28.664  46.320  1.00   19.40 ? 451  ILE C C   1 
ATOM   9693  O  O   . ILE C  1 344 ? 10.394  27.517  46.475  1.00   21.04 ? 451  ILE C O   1 
ATOM   9694  C  CB  . ILE C  1 344 ? 9.948   29.831  48.351  1.00   19.69 ? 451  ILE C CB  1 
ATOM   9695  C  CG1 . ILE C  1 344 ? 9.276   31.101  48.879  1.00   18.07 ? 451  ILE C CG1 1 
ATOM   9696  C  CG2 . ILE C  1 344 ? 11.346  29.693  48.919  1.00   15.84 ? 451  ILE C CG2 1 
ATOM   9697  C  CD1 . ILE C  1 344 ? 8.957   31.051  50.384  1.00   17.50 ? 451  ILE C CD1 1 
ATOM   9698  N  N   . ILE C  1 345 ? 11.964  28.933  45.735  1.00   20.50 ? 452  ILE C N   1 
ATOM   9699  C  CA  . ILE C  1 345 ? 12.806  27.861  45.219  1.00   21.65 ? 452  ILE C CA  1 
ATOM   9700  C  C   . ILE C  1 345 ? 14.239  28.035  45.688  1.00   21.72 ? 452  ILE C C   1 
ATOM   9701  O  O   . ILE C  1 345 ? 14.937  28.937  45.227  1.00   17.47 ? 452  ILE C O   1 
ATOM   9702  C  CB  . ILE C  1 345 ? 12.803  27.852  43.681  1.00   22.83 ? 452  ILE C CB  1 
ATOM   9703  C  CG1 . ILE C  1 345 ? 11.365  27.927  43.162  1.00   24.99 ? 452  ILE C CG1 1 
ATOM   9704  C  CG2 . ILE C  1 345 ? 13.455  26.578  43.184  1.00   22.69 ? 452  ILE C CG2 1 
ATOM   9705  C  CD1 . ILE C  1 345 ? 11.256  28.374  41.721  1.00   27.05 ? 452  ILE C CD1 1 
ATOM   9706  N  N   . ASP C  1 346 ? 14.676  27.190  46.617  1.00   22.54 ? 453  ASP C N   1 
ATOM   9707  C  CA  . ASP C  1 346 ? 16.051  27.288  47.103  1.00   27.37 ? 453  ASP C CA  1 
ATOM   9708  C  C   . ASP C  1 346 ? 16.917  26.533  46.090  1.00   28.19 ? 453  ASP C C   1 
ATOM   9709  O  O   . ASP C  1 346 ? 16.731  25.339  45.866  1.00   27.08 ? 453  ASP C O   1 
ATOM   9710  C  CB  . ASP C  1 346 ? 16.177  26.689  48.503  1.00   27.24 ? 453  ASP C CB  1 
ATOM   9711  C  CG  . ASP C  1 346 ? 17.304  27.331  49.304  1.00   34.19 ? 453  ASP C CG  1 
ATOM   9712  O  OD1 . ASP C  1 346 ? 17.822  28.393  48.875  1.00   29.01 ? 453  ASP C OD1 1 
ATOM   9713  O  OD2 . ASP C  1 346 ? 17.663  26.786  50.368  1.00   35.43 ? 453  ASP C OD2 1 
ATOM   9714  N  N   . ILE C  1 347 ? 17.859  27.242  45.477  1.00   28.46 ? 454  ILE C N   1 
ATOM   9715  C  CA  . ILE C  1 347 ? 18.701  26.675  44.426  1.00   30.11 ? 454  ILE C CA  1 
ATOM   9716  C  C   . ILE C  1 347 ? 19.931  25.830  44.789  1.00   30.95 ? 454  ILE C C   1 
ATOM   9717  O  O   . ILE C  1 347 ? 20.106  24.754  44.240  1.00   32.67 ? 454  ILE C O   1 
ATOM   9718  C  CB  . ILE C  1 347 ? 19.180  27.797  43.456  1.00   29.56 ? 454  ILE C CB  1 
ATOM   9719  C  CG1 . ILE C  1 347 ? 17.985  28.633  42.968  1.00   27.69 ? 454  ILE C CG1 1 
ATOM   9720  C  CG2 . ILE C  1 347 ? 19.951  27.191  42.285  1.00   25.36 ? 454  ILE C CG2 1 
ATOM   9721  C  CD1 . ILE C  1 347 ? 17.024  27.910  42.075  1.00   26.79 ? 454  ILE C CD1 1 
ATOM   9722  N  N   . LEU C  1 348 ? 20.782  26.296  45.696  1.00   31.60 ? 455  LEU C N   1 
ATOM   9723  C  CA  . LEU C  1 348 ? 21.998  25.544  46.021  1.00   32.56 ? 455  LEU C CA  1 
ATOM   9724  C  C   . LEU C  1 348 ? 21.856  24.295  46.883  1.00   36.16 ? 455  LEU C C   1 
ATOM   9725  O  O   . LEU C  1 348 ? 21.080  24.263  47.841  1.00   35.87 ? 455  LEU C O   1 
ATOM   9726  C  CB  . LEU C  1 348 ? 23.030  26.452  46.690  1.00   29.43 ? 455  LEU C CB  1 
ATOM   9727  C  CG  . LEU C  1 348 ? 23.412  27.757  45.995  1.00   28.59 ? 455  LEU C CG  1 
ATOM   9728  C  CD1 . LEU C  1 348 ? 24.594  28.367  46.734  1.00   21.94 ? 455  LEU C CD1 1 
ATOM   9729  C  CD2 . LEU C  1 348 ? 23.753  27.505  44.533  1.00   22.21 ? 455  LEU C CD2 1 
ATOM   9730  N  N   . THR C  1 349 ? 22.629  23.268  46.533  1.00   37.02 ? 456  THR C N   1 
ATOM   9731  C  CA  . THR C  1 349 ? 22.645  22.023  47.290  1.00   38.59 ? 456  THR C CA  1 
ATOM   9732  C  C   . THR C  1 349 ? 23.977  21.971  48.034  1.00   38.04 ? 456  THR C C   1 
ATOM   9733  O  O   . THR C  1 349 ? 24.226  21.079  48.849  1.00   40.67 ? 456  THR C O   1 
ATOM   9734  C  CB  . THR C  1 349 ? 22.520  20.789  46.373  1.00   38.10 ? 456  THR C CB  1 
ATOM   9735  O  OG1 . THR C  1 349 ? 23.536  20.832  45.363  1.00   39.37 ? 456  THR C OG1 1 
ATOM   9736  C  CG2 . THR C  1 349 ? 21.161  20.762  45.706  1.00   39.57 ? 456  THR C CG2 1 
ATOM   9737  N  N   . GLU C  1 350 ? 24.830  22.946  47.745  1.00   37.37 ? 457  GLU C N   1 
ATOM   9738  C  CA  . GLU C  1 350 ? 26.140  23.052  48.379  1.00   36.93 ? 457  GLU C CA  1 
ATOM   9739  C  C   . GLU C  1 350 ? 26.740  24.417  48.082  1.00   33.10 ? 457  GLU C C   1 
ATOM   9740  O  O   . GLU C  1 350 ? 26.415  25.036  47.074  1.00   32.65 ? 457  GLU C O   1 
ATOM   9741  C  CB  . GLU C  1 350 ? 27.079  21.976  47.847  1.00   38.67 ? 457  GLU C CB  1 
ATOM   9742  C  CG  . GLU C  1 350 ? 27.157  21.945  46.341  1.00   46.03 ? 457  GLU C CG  1 
ATOM   9743  C  CD  . GLU C  1 350 ? 28.435  21.310  45.845  1.00   52.88 ? 457  GLU C CD  1 
ATOM   9744  O  OE1 . GLU C  1 350 ? 28.885  20.325  46.476  1.00   55.80 ? 457  GLU C OE1 1 
ATOM   9745  O  OE2 . GLU C  1 350 ? 28.984  21.791  44.824  1.00   52.97 ? 457  GLU C OE2 1 
ATOM   9746  N  N   . PRO C  1 351 ? 27.632  24.902  48.955  1.00   31.92 ? 458  PRO C N   1 
ATOM   9747  C  CA  . PRO C  1 351 ? 28.265  26.207  48.749  1.00   31.81 ? 458  PRO C CA  1 
ATOM   9748  C  C   . PRO C  1 351 ? 29.034  26.223  47.438  1.00   32.53 ? 458  PRO C C   1 
ATOM   9749  O  O   . PRO C  1 351 ? 29.494  25.187  46.969  1.00   33.74 ? 458  PRO C O   1 
ATOM   9750  C  CB  . PRO C  1 351 ? 29.189  26.340  49.953  1.00   31.17 ? 458  PRO C CB  1 
ATOM   9751  C  CG  . PRO C  1 351 ? 28.478  25.540  51.002  1.00   34.28 ? 458  PRO C CG  1 
ATOM   9752  C  CD  . PRO C  1 351 ? 28.049  24.318  50.238  1.00   31.54 ? 458  PRO C CD  1 
ATOM   9753  N  N   . LYS C  1 352 ? 29.167  27.399  46.845  1.00   32.18 ? 459  LYS C N   1 
ATOM   9754  C  CA  . LYS C  1 352 ? 29.879  27.541  45.586  1.00   32.76 ? 459  LYS C CA  1 
ATOM   9755  C  C   . LYS C  1 352 ? 30.986  28.584  45.690  1.00   33.20 ? 459  LYS C C   1 
ATOM   9756  O  O   . LYS C  1 352 ? 30.765  29.709  46.149  1.00   32.31 ? 459  LYS C O   1 
ATOM   9757  C  CB  . LYS C  1 352 ? 28.912  27.942  44.465  1.00   35.84 ? 459  LYS C CB  1 
ATOM   9758  C  CG  . LYS C  1 352 ? 28.338  26.770  43.678  1.00   39.41 ? 459  LYS C CG  1 
ATOM   9759  C  CD  . LYS C  1 352 ? 27.322  26.006  44.486  1.00   43.99 ? 459  LYS C CD  1 
ATOM   9760  C  CE  . LYS C  1 352 ? 27.394  24.513  44.199  1.00   47.72 ? 459  LYS C CE  1 
ATOM   9761  N  NZ  . LYS C  1 352 ? 27.281  24.180  42.754  1.00   48.65 ? 459  LYS C NZ  1 
ATOM   9762  N  N   . ASP C  1 353 ? 32.186  28.200  45.272  1.00   32.15 ? 460  ASP C N   1 
ATOM   9763  C  CA  . ASP C  1 353 ? 33.319  29.108  45.296  1.00   30.29 ? 460  ASP C CA  1 
ATOM   9764  C  C   . ASP C  1 353 ? 33.079  30.090  44.158  1.00   29.98 ? 460  ASP C C   1 
ATOM   9765  O  O   . ASP C  1 353 ? 32.689  29.691  43.062  1.00   29.23 ? 460  ASP C O   1 
ATOM   9766  C  CB  . ASP C  1 353 ? 34.621  28.345  45.066  1.00   31.89 ? 460  ASP C CB  1 
ATOM   9767  C  CG  . ASP C  1 353 ? 35.839  29.259  45.054  1.00   36.79 ? 460  ASP C CG  1 
ATOM   9768  O  OD1 . ASP C  1 353 ? 36.175  29.834  46.115  1.00   38.38 ? 460  ASP C OD1 1 
ATOM   9769  O  OD2 . ASP C  1 353 ? 36.457  29.412  43.977  1.00   37.42 ? 460  ASP C OD2 1 
ATOM   9770  N  N   . ILE C  1 354 ? 33.297  31.373  44.419  1.00   28.45 ? 461  ILE C N   1 
ATOM   9771  C  CA  . ILE C  1 354 ? 33.072  32.384  43.407  1.00   28.67 ? 461  ILE C CA  1 
ATOM   9772  C  C   . ILE C  1 354 ? 34.263  32.543  42.465  1.00   31.17 ? 461  ILE C C   1 
ATOM   9773  O  O   . ILE C  1 354 ? 34.126  32.422  41.240  1.00   29.20 ? 461  ILE C O   1 
ATOM   9774  C  CB  . ILE C  1 354 ? 32.723  33.726  44.071  1.00   27.55 ? 461  ILE C CB  1 
ATOM   9775  C  CG1 . ILE C  1 354 ? 31.425  33.569  44.868  1.00   25.85 ? 461  ILE C CG1 1 
ATOM   9776  C  CG2 . ILE C  1 354 ? 32.581  34.811  43.015  1.00   24.90 ? 461  ILE C CG2 1 
ATOM   9777  C  CD1 . ILE C  1 354 ? 31.040  34.798  45.697  1.00   21.23 ? 461  ILE C CD1 1 
ATOM   9778  N  N   . GLY C  1 355 ? 35.435  32.802  43.031  1.00   32.69 ? 462  GLY C N   1 
ATOM   9779  C  CA  . GLY C  1 355 ? 36.607  32.960  42.198  1.00   33.54 ? 462  GLY C CA  1 
ATOM   9780  C  C   . GLY C  1 355 ? 36.472  34.129  41.243  1.00   36.30 ? 462  GLY C C   1 
ATOM   9781  O  O   . GLY C  1 355 ? 36.024  35.210  41.634  1.00   36.62 ? 462  GLY C O   1 
ATOM   9782  N  N   . LYS C  1 356 ? 36.862  33.916  39.988  1.00   37.28 ? 463  LYS C N   1 
ATOM   9783  C  CA  . LYS C  1 356 ? 36.807  34.972  38.983  1.00   36.32 ? 463  LYS C CA  1 
ATOM   9784  C  C   . LYS C  1 356 ? 35.413  35.049  38.391  1.00   34.78 ? 463  LYS C C   1 
ATOM   9785  O  O   . LYS C  1 356 ? 34.957  36.126  38.009  1.00   32.04 ? 463  LYS C O   1 
ATOM   9786  C  CB  . LYS C  1 356 ? 37.823  34.700  37.866  1.00   38.52 ? 463  LYS C CB  1 
ATOM   9787  C  CG  . LYS C  1 356 ? 38.412  35.953  37.195  1.00   40.66 ? 463  LYS C CG  1 
ATOM   9788  C  CD  . LYS C  1 356 ? 37.346  36.848  36.571  1.00   44.85 ? 463  LYS C CD  1 
ATOM   9789  C  CE  . LYS C  1 356 ? 37.959  38.079  35.899  1.00   44.36 ? 463  LYS C CE  1 
ATOM   9790  N  NZ  . LYS C  1 356 ? 38.839  38.876  36.815  1.00   47.38 ? 463  LYS C NZ  1 
ATOM   9791  N  N   . ARG C  1 357 ? 34.742  33.903  38.310  1.00   33.56 ? 464  ARG C N   1 
ATOM   9792  C  CA  . ARG C  1 357 ? 33.396  33.861  37.765  1.00   33.54 ? 464  ARG C CA  1 
ATOM   9793  C  C   . ARG C  1 357 ? 32.654  32.615  38.202  1.00   33.61 ? 464  ARG C C   1 
ATOM   9794  O  O   . ARG C  1 357 ? 33.226  31.529  38.265  1.00   35.86 ? 464  ARG C O   1 
ATOM   9795  C  CB  . ARG C  1 357 ? 33.430  33.926  36.237  1.00   34.39 ? 464  ARG C CB  1 
ATOM   9796  C  CG  . ARG C  1 357 ? 32.056  33.750  35.615  1.00   41.61 ? 464  ARG C CG  1 
ATOM   9797  C  CD  . ARG C  1 357 ? 31.994  34.160  34.149  1.00   48.17 ? 464  ARG C CD  1 
ATOM   9798  N  NE  . ARG C  1 357 ? 30.638  34.024  33.602  1.00   55.26 ? 464  ARG C NE  1 
ATOM   9799  C  CZ  . ARG C  1 357 ? 30.002  32.862  33.437  1.00   59.46 ? 464  ARG C CZ  1 
ATOM   9800  N  NH1 . ARG C  1 357 ? 28.771  32.837  32.936  1.00   59.34 ? 464  ARG C NH1 1 
ATOM   9801  N  NH2 . ARG C  1 357 ? 30.596  31.718  33.765  1.00   60.93 ? 464  ARG C NH2 1 
ATOM   9802  N  N   . LEU C  1 358 ? 31.374  32.775  38.509  1.00   30.50 ? 465  LEU C N   1 
ATOM   9803  C  CA  . LEU C  1 358 ? 30.550  31.655  38.925  1.00   29.74 ? 465  LEU C CA  1 
ATOM   9804  C  C   . LEU C  1 358 ? 29.241  31.713  38.162  1.00   30.41 ? 465  LEU C C   1 
ATOM   9805  O  O   . LEU C  1 358 ? 28.676  32.785  37.959  1.00   31.19 ? 465  LEU C O   1 
ATOM   9806  C  CB  . LEU C  1 358 ? 30.275  31.725  40.428  1.00   28.23 ? 465  LEU C CB  1 
ATOM   9807  C  CG  . LEU C  1 358 ? 29.269  30.708  40.968  1.00   27.85 ? 465  LEU C CG  1 
ATOM   9808  C  CD1 . LEU C  1 358 ? 29.799  29.294  40.737  1.00   27.95 ? 465  LEU C CD1 1 
ATOM   9809  C  CD2 . LEU C  1 358 ? 29.028  30.949  42.458  1.00   23.67 ? 465  LEU C CD2 1 
ATOM   9810  N  N   . GLU C  1 359 ? 28.767  30.558  37.726  1.00   31.10 ? 466  GLU C N   1 
ATOM   9811  C  CA  . GLU C  1 359 ? 27.515  30.491  36.995  1.00   31.45 ? 466  GLU C CA  1 
ATOM   9812  C  C   . GLU C  1 359 ? 26.701  29.366  37.620  1.00   29.82 ? 466  GLU C C   1 
ATOM   9813  O  O   . GLU C  1 359 ? 27.199  28.260  37.793  1.00   30.10 ? 466  GLU C O   1 
ATOM   9814  C  CB  . GLU C  1 359 ? 27.776  30.194  35.512  1.00   34.08 ? 466  GLU C CB  1 
ATOM   9815  C  CG  . GLU C  1 359 ? 26.620  30.570  34.601  1.00   39.80 ? 466  GLU C CG  1 
ATOM   9816  C  CD  . GLU C  1 359 ? 26.670  29.880  33.246  1.00   42.77 ? 466  GLU C CD  1 
ATOM   9817  O  OE1 . GLU C  1 359 ? 26.450  28.651  33.196  1.00   44.59 ? 466  GLU C OE1 1 
ATOM   9818  O  OE2 . GLU C  1 359 ? 26.926  30.564  32.232  1.00   43.79 ? 466  GLU C OE2 1 
ATOM   9819  N  N   . VAL C  1 360 ? 25.461  29.659  37.988  1.00   27.45 ? 467  VAL C N   1 
ATOM   9820  C  CA  . VAL C  1 360 ? 24.601  28.657  38.586  1.00   24.48 ? 467  VAL C CA  1 
ATOM   9821  C  C   . VAL C  1 360 ? 23.361  28.539  37.727  1.00   29.19 ? 467  VAL C C   1 
ATOM   9822  O  O   . VAL C  1 360 ? 22.667  29.534  37.494  1.00   30.50 ? 467  VAL C O   1 
ATOM   9823  C  CB  . VAL C  1 360 ? 24.195  29.050  40.010  1.00   22.77 ? 467  VAL C CB  1 
ATOM   9824  C  CG1 . VAL C  1 360 ? 23.322  27.964  40.620  1.00   22.11 ? 467  VAL C CG1 1 
ATOM   9825  C  CG2 . VAL C  1 360 ? 25.434  29.265  40.853  1.00   22.57 ? 467  VAL C CG2 1 
ATOM   9826  N  N   . ARG C  1 361 ? 23.098  27.330  37.238  1.00   29.04 ? 468  ARG C N   1 
ATOM   9827  C  CA  . ARG C  1 361 ? 21.942  27.076  36.388  1.00   30.47 ? 468  ARG C CA  1 
ATOM   9828  C  C   . ARG C  1 361 ? 20.969  26.190  37.116  1.00   30.22 ? 468  ARG C C   1 
ATOM   9829  O  O   . ARG C  1 361 ? 21.375  25.295  37.847  1.00   34.08 ? 468  ARG C O   1 
ATOM   9830  C  CB  . ARG C  1 361 ? 22.371  26.394  35.087  1.00   30.88 ? 468  ARG C CB  1 
ATOM   9831  C  CG  . ARG C  1 361 ? 23.059  27.331  34.120  1.00   35.20 ? 468  ARG C CG  1 
ATOM   9832  C  CD  . ARG C  1 361 ? 23.405  26.655  32.803  1.00   40.41 ? 468  ARG C CD  1 
ATOM   9833  N  NE  . ARG C  1 361 ? 24.090  27.592  31.921  1.00   44.38 ? 468  ARG C NE  1 
ATOM   9834  C  CZ  . ARG C  1 361 ? 23.483  28.356  31.017  1.00   47.66 ? 468  ARG C CZ  1 
ATOM   9835  N  NH1 . ARG C  1 361 ? 24.192  29.196  30.268  1.00   47.26 ? 468  ARG C NH1 1 
ATOM   9836  N  NH2 . ARG C  1 361 ? 22.170  28.258  30.836  1.00   46.78 ? 468  ARG C NH2 1 
ATOM   9837  N  N   . LYS C  1 362 ? 19.682  26.431  36.914  1.00   29.23 ? 469  LYS C N   1 
ATOM   9838  C  CA  . LYS C  1 362 ? 18.669  25.624  37.566  1.00   29.27 ? 469  LYS C CA  1 
ATOM   9839  C  C   . LYS C  1 362 ? 17.362  25.688  36.800  1.00   28.37 ? 469  LYS C C   1 
ATOM   9840  O  O   . LYS C  1 362 ? 16.856  26.769  36.518  1.00   26.77 ? 469  LYS C O   1 
ATOM   9841  C  CB  . LYS C  1 362 ? 18.463  26.124  38.994  1.00   31.09 ? 469  LYS C CB  1 
ATOM   9842  C  CG  . LYS C  1 362 ? 17.313  25.485  39.749  1.00   30.10 ? 469  LYS C CG  1 
ATOM   9843  C  CD  . LYS C  1 362 ? 17.637  24.107  40.254  1.00   34.29 ? 469  LYS C CD  1 
ATOM   9844  C  CE  . LYS C  1 362 ? 16.474  23.587  41.082  1.00   39.22 ? 469  LYS C CE  1 
ATOM   9845  N  NZ  . LYS C  1 362 ? 16.690  22.201  41.581  1.00   42.42 ? 469  LYS C NZ  1 
ATOM   9846  N  N   . THR C  1 363 ? 16.825  24.524  36.455  1.00   28.11 ? 470  THR C N   1 
ATOM   9847  C  CA  . THR C  1 363 ? 15.555  24.458  35.747  1.00   27.86 ? 470  THR C CA  1 
ATOM   9848  C  C   . THR C  1 363 ? 14.471  24.371  36.815  1.00   26.65 ? 470  THR C C   1 
ATOM   9849  O  O   . THR C  1 363 ? 14.530  23.513  37.691  1.00   29.15 ? 470  THR C O   1 
ATOM   9850  C  CB  . THR C  1 363 ? 15.520  23.220  34.824  1.00   26.96 ? 470  THR C CB  1 
ATOM   9851  O  OG1 . THR C  1 363 ? 16.478  23.400  33.775  1.00   29.12 ? 470  THR C OG1 1 
ATOM   9852  C  CG2 . THR C  1 363 ? 14.143  23.021  34.218  1.00   25.04 ? 470  THR C CG2 1 
ATOM   9853  N  N   . VAL C  1 364 ? 13.492  25.267  36.763  1.00   24.91 ? 471  VAL C N   1 
ATOM   9854  C  CA  . VAL C  1 364 ? 12.434  25.262  37.766  1.00   22.26 ? 471  VAL C CA  1 
ATOM   9855  C  C   . VAL C  1 364 ? 11.081  25.042  37.122  1.00   24.93 ? 471  VAL C C   1 
ATOM   9856  O  O   . VAL C  1 364 ? 10.914  25.273  35.920  1.00   24.43 ? 471  VAL C O   1 
ATOM   9857  C  CB  . VAL C  1 364 ? 12.428  26.598  38.576  1.00   24.38 ? 471  VAL C CB  1 
ATOM   9858  C  CG1 . VAL C  1 364 ? 13.868  26.960  38.965  1.00   25.25 ? 471  VAL C CG1 1 
ATOM   9859  C  CG2 . VAL C  1 364 ? 11.817  27.745  37.772  1.00   17.63 ? 471  VAL C CG2 1 
ATOM   9860  N  N   . THR C  1 365 ? 10.124  24.579  37.921  1.00   24.72 ? 472  THR C N   1 
ATOM   9861  C  CA  . THR C  1 365 ? 8.772   24.332  37.440  1.00   22.43 ? 472  THR C CA  1 
ATOM   9862  C  C   . THR C  1 365 ? 7.831   25.434  37.904  1.00   21.92 ? 472  THR C C   1 
ATOM   9863  O  O   . THR C  1 365 ? 6.661   25.454  37.529  1.00   23.18 ? 472  THR C O   1 
ATOM   9864  C  CB  . THR C  1 365 ? 8.227   23.000  37.973  1.00   25.69 ? 472  THR C CB  1 
ATOM   9865  O  OG1 . THR C  1 365 ? 8.224   23.035  39.402  1.00   24.72 ? 472  THR C OG1 1 
ATOM   9866  C  CG2 . THR C  1 365 ? 9.082   21.838  37.508  1.00   23.70 ? 472  THR C CG2 1 
ATOM   9867  N  N   . ALA C  1 366 ? 8.348   26.343  38.730  1.00   24.15 ? 473  ALA C N   1 
ATOM   9868  C  CA  . ALA C  1 366 ? 7.565   27.458  39.254  1.00   22.49 ? 473  ALA C CA  1 
ATOM   9869  C  C   . ALA C  1 366 ? 6.339   26.961  40.017  1.00   23.43 ? 473  ALA C C   1 
ATOM   9870  O  O   . ALA C  1 366 ? 5.228   27.472  39.848  1.00   22.94 ? 473  ALA C O   1 
ATOM   9871  C  CB  . ALA C  1 366 ? 7.137   28.394  38.108  1.00   18.78 ? 473  ALA C CB  1 
ATOM   9872  N  N   . CYS C  1 367 ? 6.543   25.943  40.841  1.00   23.26 ? 474  CYS C N   1 
ATOM   9873  C  CA  . CYS C  1 367 ? 5.468   25.395  41.657  1.00   23.94 ? 474  CYS C CA  1 
ATOM   9874  C  C   . CYS C  1 367 ? 4.312   24.765  40.880  1.00   24.13 ? 474  CYS C C   1 
ATOM   9875  O  O   . CYS C  1 367 ? 3.155   24.805  41.309  1.00   20.60 ? 474  CYS C O   1 
ATOM   9876  C  CB  . CYS C  1 367 ? 4.946   26.481  42.602  1.00   21.49 ? 474  CYS C CB  1 
ATOM   9877  S  SG  . CYS C  1 367 ? 6.179   26.937  43.864  1.00   25.22 ? 474  CYS C SG  1 
ATOM   9878  N  N   . LEU C  1 368 ? 4.637   24.172  39.738  1.00   26.08 ? 475  LEU C N   1 
ATOM   9879  C  CA  . LEU C  1 368 ? 3.642   23.502  38.913  1.00   26.00 ? 475  LEU C CA  1 
ATOM   9880  C  C   . LEU C  1 368 ? 2.903   22.458  39.745  1.00   27.65 ? 475  LEU C C   1 
ATOM   9881  O  O   . LEU C  1 368 ? 3.512   21.732  40.519  1.00   26.71 ? 475  LEU C O   1 
ATOM   9882  C  CB  . LEU C  1 368 ? 4.321   22.809  37.733  1.00   25.96 ? 475  LEU C CB  1 
ATOM   9883  C  CG  . LEU C  1 368 ? 3.403   21.921  36.880  1.00   26.99 ? 475  LEU C CG  1 
ATOM   9884  C  CD1 . LEU C  1 368 ? 2.250   22.721  36.331  1.00   27.49 ? 475  LEU C CD1 1 
ATOM   9885  C  CD2 . LEU C  1 368 ? 4.204   21.319  35.751  1.00   30.95 ? 475  LEU C CD2 1 
ATOM   9886  N  N   . GLY C  1 369 ? 1.588   22.389  39.585  1.00   30.00 ? 476  GLY C N   1 
ATOM   9887  C  CA  . GLY C  1 369 ? 0.819   21.419  40.337  1.00   31.52 ? 476  GLY C CA  1 
ATOM   9888  C  C   . GLY C  1 369 ? 0.498   21.831  41.762  1.00   33.90 ? 476  GLY C C   1 
ATOM   9889  O  O   . GLY C  1 369 ? -0.210  21.116  42.462  1.00   35.33 ? 476  GLY C O   1 
ATOM   9890  N  N   . GLU C  1 370 ? 1.019   22.970  42.208  1.00   34.45 ? 477  GLU C N   1 
ATOM   9891  C  CA  . GLU C  1 370 ? 0.748   23.431  43.561  1.00   34.49 ? 477  GLU C CA  1 
ATOM   9892  C  C   . GLU C  1 370 ? -0.112  24.690  43.545  1.00   36.57 ? 477  GLU C C   1 
ATOM   9893  O  O   . GLU C  1 370 ? -0.299  25.316  42.498  1.00   35.05 ? 477  GLU C O   1 
ATOM   9894  C  CB  . GLU C  1 370 ? 2.059   23.675  44.311  1.00   35.59 ? 477  GLU C CB  1 
ATOM   9895  C  CG  . GLU C  1 370 ? 2.865   22.397  44.550  1.00   39.49 ? 477  GLU C CG  1 
ATOM   9896  C  CD  . GLU C  1 370 ? 1.986   21.167  44.847  1.00   46.13 ? 477  GLU C CD  1 
ATOM   9897  O  OE1 . GLU C  1 370 ? 1.175   21.203  45.802  1.00   49.58 ? 477  GLU C OE1 1 
ATOM   9898  O  OE2 . GLU C  1 370 ? 2.109   20.154  44.120  1.00   49.81 ? 477  GLU C OE2 1 
ATOM   9899  N  N   . PRO C  1 371 ? -0.657  25.076  44.709  1.00   37.21 ? 478  PRO C N   1 
ATOM   9900  C  CA  . PRO C  1 371 ? -1.506  26.269  44.806  1.00   35.83 ? 478  PRO C CA  1 
ATOM   9901  C  C   . PRO C  1 371 ? -0.808  27.563  44.377  1.00   34.95 ? 478  PRO C C   1 
ATOM   9902  O  O   . PRO C  1 371 ? -1.463  28.503  43.923  1.00   34.16 ? 478  PRO C O   1 
ATOM   9903  C  CB  . PRO C  1 371 ? -1.893  26.299  46.287  1.00   38.10 ? 478  PRO C CB  1 
ATOM   9904  C  CG  . PRO C  1 371 ? -1.793  24.852  46.713  1.00   37.42 ? 478  PRO C CG  1 
ATOM   9905  C  CD  . PRO C  1 371 ? -0.534  24.409  46.019  1.00   39.02 ? 478  PRO C CD  1 
ATOM   9906  N  N   . ASN C  1 372 ? 0.514   27.611  44.516  1.00   30.71 ? 479  ASN C N   1 
ATOM   9907  C  CA  . ASN C  1 372 ? 1.258   28.813  44.161  1.00   31.33 ? 479  ASN C CA  1 
ATOM   9908  C  C   . ASN C  1 372 ? 1.964   28.737  42.818  1.00   27.67 ? 479  ASN C C   1 
ATOM   9909  O  O   . ASN C  1 372 ? 2.966   29.421  42.589  1.00   26.81 ? 479  ASN C O   1 
ATOM   9910  C  CB  . ASN C  1 372 ? 2.257   29.142  45.266  1.00   36.10 ? 479  ASN C CB  1 
ATOM   9911  C  CG  . ASN C  1 372 ? 3.126   27.971  45.608  1.00   41.11 ? 479  ASN C CG  1 
ATOM   9912  O  OD1 . ASN C  1 372 ? 2.662   26.825  45.670  1.00   43.86 ? 479  ASN C OD1 1 
ATOM   9913  N  ND2 . ASN C  1 372 ? 4.398   28.242  45.842  1.00   46.33 ? 479  ASN C ND2 1 
ATOM   9914  N  N   . HIS C  1 373 ? 1.428   27.904  41.934  1.00   23.84 ? 480  HIS C N   1 
ATOM   9915  C  CA  . HIS C  1 373 ? 1.963   27.756  40.586  1.00   24.81 ? 480  HIS C CA  1 
ATOM   9916  C  C   . HIS C  1 373 ? 1.886   29.122  39.883  1.00   24.54 ? 480  HIS C C   1 
ATOM   9917  O  O   . HIS C  1 373 ? 0.831   29.763  39.877  1.00   27.14 ? 480  HIS C O   1 
ATOM   9918  C  CB  . HIS C  1 373 ? 1.131   26.717  39.839  1.00   26.72 ? 480  HIS C CB  1 
ATOM   9919  C  CG  . HIS C  1 373 ? 1.456   26.598  38.385  1.00   27.37 ? 480  HIS C CG  1 
ATOM   9920  N  ND1 . HIS C  1 373 ? 2.750   26.584  37.907  1.00   30.34 ? 480  HIS C ND1 1 
ATOM   9921  C  CD2 . HIS C  1 373 ? 0.656   26.428  37.308  1.00   26.99 ? 480  HIS C CD2 1 
ATOM   9922  C  CE1 . HIS C  1 373 ? 2.732   26.408  36.598  1.00   24.46 ? 480  HIS C CE1 1 
ATOM   9923  N  NE2 . HIS C  1 373 ? 1.473   26.310  36.210  1.00   28.61 ? 480  HIS C NE2 1 
ATOM   9924  N  N   . ILE C  1 374 ? 2.996   29.581  39.312  1.00   21.45 ? 481  ILE C N   1 
ATOM   9925  C  CA  . ILE C  1 374 ? 3.013   30.870  38.623  1.00   18.49 ? 481  ILE C CA  1 
ATOM   9926  C  C   . ILE C  1 374 ? 3.361   30.766  37.140  1.00   19.72 ? 481  ILE C C   1 
ATOM   9927  O  O   . ILE C  1 374 ? 4.428   30.276  36.770  1.00   18.78 ? 481  ILE C O   1 
ATOM   9928  C  CB  . ILE C  1 374 ? 4.020   31.856  39.291  1.00   21.12 ? 481  ILE C CB  1 
ATOM   9929  C  CG1 . ILE C  1 374 ? 3.522   32.243  40.686  1.00   19.54 ? 481  ILE C CG1 1 
ATOM   9930  C  CG2 . ILE C  1 374 ? 4.155   33.152  38.451  1.00   14.93 ? 481  ILE C CG2 1 
ATOM   9931  C  CD1 . ILE C  1 374 ? 4.514   33.074  41.465  1.00   21.68 ? 481  ILE C CD1 1 
ATOM   9932  N  N   . THR C  1 375 ? 2.462   31.250  36.292  1.00   19.32 ? 482  THR C N   1 
ATOM   9933  C  CA  . THR C  1 375 ? 2.690   31.230  34.849  1.00   20.72 ? 482  THR C CA  1 
ATOM   9934  C  C   . THR C  1 375 ? 2.878   32.649  34.321  1.00   21.05 ? 482  THR C C   1 
ATOM   9935  O  O   . THR C  1 375 ? 3.380   32.853  33.218  1.00   23.79 ? 482  THR C O   1 
ATOM   9936  C  CB  . THR C  1 375 ? 1.512   30.564  34.118  1.00   21.98 ? 482  THR C CB  1 
ATOM   9937  O  OG1 . THR C  1 375 ? 0.284   31.213  34.487  1.00   19.37 ? 482  THR C OG1 1 
ATOM   9938  C  CG2 . THR C  1 375 ? 1.434   29.091  34.501  1.00   17.26 ? 482  THR C CG2 1 
ATOM   9939  N  N   . ARG C  1 376 ? 2.488   33.629  35.127  1.00   19.78 ? 483  ARG C N   1 
ATOM   9940  C  CA  . ARG C  1 376 ? 2.616   35.035  34.751  1.00   21.32 ? 483  ARG C CA  1 
ATOM   9941  C  C   . ARG C  1 376 ? 3.356   35.742  35.901  1.00   20.89 ? 483  ARG C C   1 
ATOM   9942  O  O   . ARG C  1 376 ? 2.774   36.076  36.941  1.00   20.62 ? 483  ARG C O   1 
ATOM   9943  C  CB  . ARG C  1 376 ? 1.221   35.628  34.548  1.00   22.96 ? 483  ARG C CB  1 
ATOM   9944  C  CG  . ARG C  1 376 ? 1.179   36.897  33.737  1.00   35.28 ? 483  ARG C CG  1 
ATOM   9945  C  CD  . ARG C  1 376 ? -0.024  37.734  34.151  1.00   41.85 ? 483  ARG C CD  1 
ATOM   9946  N  NE  . ARG C  1 376 ? -0.609  38.473  33.038  1.00   46.91 ? 483  ARG C NE  1 
ATOM   9947  C  CZ  . ARG C  1 376 ? -1.206  37.891  32.000  1.00   53.15 ? 483  ARG C CZ  1 
ATOM   9948  N  NH1 . ARG C  1 376 ? -1.719  38.628  31.024  1.00   53.53 ? 483  ARG C NH1 1 
ATOM   9949  N  NH2 . ARG C  1 376 ? -1.283  36.565  31.934  1.00   56.13 ? 483  ARG C NH2 1 
ATOM   9950  N  N   . LEU C  1 377 ? 4.645   35.977  35.703  1.00   19.55 ? 484  LEU C N   1 
ATOM   9951  C  CA  . LEU C  1 377 ? 5.470   36.590  36.731  1.00   17.99 ? 484  LEU C CA  1 
ATOM   9952  C  C   . LEU C  1 377 ? 5.227   38.071  36.992  1.00   17.83 ? 484  LEU C C   1 
ATOM   9953  O  O   . LEU C  1 377 ? 4.823   38.820  36.118  1.00   16.96 ? 484  LEU C O   1 
ATOM   9954  C  CB  . LEU C  1 377 ? 6.955   36.400  36.386  1.00   16.21 ? 484  LEU C CB  1 
ATOM   9955  C  CG  . LEU C  1 377 ? 8.021   36.836  37.401  1.00   19.75 ? 484  LEU C CG  1 
ATOM   9956  C  CD1 . LEU C  1 377 ? 8.013   35.908  38.603  1.00   17.53 ? 484  LEU C CD1 1 
ATOM   9957  C  CD2 . LEU C  1 377 ? 9.389   36.856  36.746  1.00   13.44 ? 484  LEU C CD2 1 
ATOM   9958  N  N   . GLU C  1 378 ? 5.465   38.487  38.224  1.00   16.12 ? 485  GLU C N   1 
ATOM   9959  C  CA  . GLU C  1 378 ? 5.375   39.897  38.579  1.00   18.10 ? 485  GLU C CA  1 
ATOM   9960  C  C   . GLU C  1 378 ? 6.811   40.195  39.027  1.00   18.04 ? 485  GLU C C   1 
ATOM   9961  O  O   . GLU C  1 378 ? 7.703   40.232  38.188  1.00   20.23 ? 485  GLU C O   1 
ATOM   9962  C  CB  . GLU C  1 378 ? 4.326   40.124  39.675  1.00   20.26 ? 485  GLU C CB  1 
ATOM   9963  C  CG  . GLU C  1 378 ? 2.904   40.197  39.072  1.00   17.27 ? 485  GLU C CG  1 
ATOM   9964  C  CD  . GLU C  1 378 ? 1.789   40.258  40.115  1.00   22.23 ? 485  GLU C CD  1 
ATOM   9965  O  OE1 . GLU C  1 378 ? 0.600   40.203  39.718  1.00   23.88 ? 485  GLU C OE1 1 
ATOM   9966  O  OE2 . GLU C  1 378 ? 2.083   40.360  41.329  1.00   19.83 ? 485  GLU C OE2 1 
ATOM   9967  N  N   . HIS C  1 379 ? 7.058   40.372  40.319  1.00   16.90 ? 486  HIS C N   1 
ATOM   9968  C  CA  . HIS C  1 379 ? 8.414   40.628  40.780  1.00   15.59 ? 486  HIS C CA  1 
ATOM   9969  C  C   . HIS C  1 379 ? 9.134   39.297  40.987  1.00   16.10 ? 486  HIS C C   1 
ATOM   9970  O  O   . HIS C  1 379 ? 8.500   38.275  41.195  1.00   17.84 ? 486  HIS C O   1 
ATOM   9971  C  CB  . HIS C  1 379 ? 8.440   41.337  42.142  1.00   13.65 ? 486  HIS C CB  1 
ATOM   9972  C  CG  . HIS C  1 379 ? 7.438   42.434  42.294  1.00   14.68 ? 486  HIS C CG  1 
ATOM   9973  N  ND1 . HIS C  1 379 ? 6.105   42.193  42.554  1.00   14.08 ? 486  HIS C ND1 1 
ATOM   9974  C  CD2 . HIS C  1 379 ? 7.584   43.780  42.279  1.00   12.70 ? 486  HIS C CD2 1 
ATOM   9975  C  CE1 . HIS C  1 379 ? 5.474   43.346  42.700  1.00   14.19 ? 486  HIS C CE1 1 
ATOM   9976  N  NE2 . HIS C  1 379 ? 6.348   44.324  42.538  1.00   15.46 ? 486  HIS C NE2 1 
ATOM   9977  N  N   . ALA C  1 380 ? 10.461  39.320  40.939  1.00   16.88 ? 487  ALA C N   1 
ATOM   9978  C  CA  . ALA C  1 380 ? 11.264  38.132  41.209  1.00   16.66 ? 487  ALA C CA  1 
ATOM   9979  C  C   . ALA C  1 380 ? 12.409  38.617  42.089  1.00   17.61 ? 487  ALA C C   1 
ATOM   9980  O  O   . ALA C  1 380 ? 12.944  39.711  41.869  1.00   15.70 ? 487  ALA C O   1 
ATOM   9981  C  CB  . ALA C  1 380 ? 11.823  37.515  39.908  1.00   14.66 ? 487  ALA C CB  1 
ATOM   9982  N  N   . GLN C  1 381 ? 12.750  37.837  43.111  1.00   17.55 ? 488  GLN C N   1 
ATOM   9983  C  CA  . GLN C  1 381 ? 13.879  38.182  43.968  1.00   18.46 ? 488  GLN C CA  1 
ATOM   9984  C  C   . GLN C  1 381 ? 14.897  37.042  43.931  1.00   19.97 ? 488  GLN C C   1 
ATOM   9985  O  O   . GLN C  1 381 ? 14.534  35.874  43.801  1.00   19.66 ? 488  GLN C O   1 
ATOM   9986  C  CB  . GLN C  1 381 ? 13.456  38.348  45.426  1.00   21.27 ? 488  GLN C CB  1 
ATOM   9987  C  CG  . GLN C  1 381 ? 12.508  39.477  45.740  1.00   18.95 ? 488  GLN C CG  1 
ATOM   9988  C  CD  . GLN C  1 381 ? 11.939  39.330  47.146  1.00   22.57 ? 488  GLN C CD  1 
ATOM   9989  O  OE1 . GLN C  1 381 ? 11.548  38.236  47.539  1.00   23.23 ? 488  GLN C OE1 1 
ATOM   9990  N  NE2 . GLN C  1 381 ? 11.885  40.425  47.900  1.00   19.49 ? 488  GLN C NE2 1 
ATOM   9991  N  N   . ALA C  1 382 ? 16.170