data_4RZR
# 
_entry.id   4RZR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4RZR         
NDB   NA3335       
RCSB  RCSB087998   
WWPDB D_1000087998 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4RZR 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vyas, R.' 1 
'Suo, Z.'  2 
# 
_citation.id                        primary 
_citation.title                     
'Mechanistic Basis for the Bypass of a Bulky DNA Adduct Catalyzed by a Y-Family DNA Polymerase.' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            137 
_citation.page_first                12131 
_citation.page_last                 12142 
_citation.year                      2015 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26327169 
_citation.pdbx_database_id_DOI      10.1021/jacs.5b08027 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vyas, R.'           1 
primary 'Efthimiopoulos, G.' 2 
primary 'Tokarsky, E.J.'     3 
primary 'Malik, C.K.'        4 
primary 'Basu, A.K.'         5 
primary 'Suo, Z.'            6 
# 
_cell.entry_id           4RZR 
_cell.length_a           56.397 
_cell.length_b           56.397 
_cell.length_c           288.776 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4RZR 
_symmetry.space_group_name_H-M             'P 31' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                144 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase IV'                                                       40257.879 2   2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*TP*TP*GP*C*(2JV)P*GP*AP*CP*TP*GP*GP*TP*AP*TP*TP*GP*GP*G)-3')
;
5835.889  2   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(P*CP*CP*CP*AP*AP*TP*AP*CP*CP*AP*GP*TP*C)-3')
;
3880.552  2   ?       ? ? ? 
4 non-polymer syn 'CALCIUM ION'                                                             40.078    4   ?       ? ? ? 
5 non-polymer syn 'SODIUM ION'                                                              22.990    2   ?       ? ? ? 
6 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL                                  122.143   1   ?       ? ? ? 
7 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                                        467.157   1   ?       ? ? ? 
8 non-polymer syn GLYCEROL                                                                  92.094    2   ?       ? ? ? 
9 water       nat water                                                                     18.015    157 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol IV' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
A,D ? 
2 polydeoxyribonucleotide no yes '(DT)(DT)(DG)(DC)(2JV)(DG)(DA)(DC)(DT)(DG)(DG)(DT)(DA)(DT)(DT)(DG)(DG)(DG)' TTGCXGACTGGTATTGGG 
B,E ? 
3 polydeoxyribonucleotide no no  '(DC)(DC)(DC)(DA)(DA)(DT)(DA)(DC)(DC)(DA)(DG)(DT)(DC)' CCCAATACCAGTC C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   VAL n 
1 4   LEU n 
1 5   PHE n 
1 6   VAL n 
1 7   ASP n 
1 8   PHE n 
1 9   ASP n 
1 10  TYR n 
1 11  PHE n 
1 12  TYR n 
1 13  ALA n 
1 14  GLN n 
1 15  VAL n 
1 16  GLU n 
1 17  GLU n 
1 18  VAL n 
1 19  LEU n 
1 20  ASN n 
1 21  PRO n 
1 22  SER n 
1 23  LEU n 
1 24  LYS n 
1 25  GLY n 
1 26  LYS n 
1 27  PRO n 
1 28  VAL n 
1 29  VAL n 
1 30  VAL n 
1 31  CYS n 
1 32  VAL n 
1 33  PHE n 
1 34  SER n 
1 35  GLY n 
1 36  ARG n 
1 37  PHE n 
1 38  GLU n 
1 39  ASP n 
1 40  SER n 
1 41  GLY n 
1 42  ALA n 
1 43  VAL n 
1 44  ALA n 
1 45  THR n 
1 46  ALA n 
1 47  ASN n 
1 48  TYR n 
1 49  GLU n 
1 50  ALA n 
1 51  ARG n 
1 52  LYS n 
1 53  PHE n 
1 54  GLY n 
1 55  VAL n 
1 56  LYS n 
1 57  ALA n 
1 58  GLY n 
1 59  ILE n 
1 60  PRO n 
1 61  ILE n 
1 62  VAL n 
1 63  GLU n 
1 64  ALA n 
1 65  LYS n 
1 66  LYS n 
1 67  ILE n 
1 68  LEU n 
1 69  PRO n 
1 70  ASN n 
1 71  ALA n 
1 72  VAL n 
1 73  TYR n 
1 74  LEU n 
1 75  PRO n 
1 76  MET n 
1 77  ARG n 
1 78  LYS n 
1 79  GLU n 
1 80  VAL n 
1 81  TYR n 
1 82  GLN n 
1 83  GLN n 
1 84  VAL n 
1 85  SER n 
1 86  SER n 
1 87  ARG n 
1 88  ILE n 
1 89  MET n 
1 90  ASN n 
1 91  LEU n 
1 92  LEU n 
1 93  ARG n 
1 94  GLU n 
1 95  TYR n 
1 96  SER n 
1 97  GLU n 
1 98  LYS n 
1 99  ILE n 
1 100 GLU n 
1 101 ILE n 
1 102 ALA n 
1 103 SER n 
1 104 ILE n 
1 105 ASP n 
1 106 GLU n 
1 107 ALA n 
1 108 TYR n 
1 109 LEU n 
1 110 ASP n 
1 111 ILE n 
1 112 SER n 
1 113 ASP n 
1 114 LYS n 
1 115 VAL n 
1 116 ARG n 
1 117 ASP n 
1 118 TYR n 
1 119 ARG n 
1 120 GLU n 
1 121 ALA n 
1 122 TYR n 
1 123 ASN n 
1 124 LEU n 
1 125 GLY n 
1 126 LEU n 
1 127 GLU n 
1 128 ILE n 
1 129 LYS n 
1 130 ASN n 
1 131 LYS n 
1 132 ILE n 
1 133 LEU n 
1 134 GLU n 
1 135 LYS n 
1 136 GLU n 
1 137 LYS n 
1 138 ILE n 
1 139 THR n 
1 140 VAL n 
1 141 THR n 
1 142 VAL n 
1 143 GLY n 
1 144 ILE n 
1 145 SER n 
1 146 LYS n 
1 147 ASN n 
1 148 LYS n 
1 149 VAL n 
1 150 PHE n 
1 151 ALA n 
1 152 LYS n 
1 153 ILE n 
1 154 ALA n 
1 155 ALA n 
1 156 ASP n 
1 157 MET n 
1 158 ALA n 
1 159 LYS n 
1 160 PRO n 
1 161 ASN n 
1 162 GLY n 
1 163 ILE n 
1 164 LYS n 
1 165 VAL n 
1 166 ILE n 
1 167 ASP n 
1 168 ASP n 
1 169 GLU n 
1 170 GLU n 
1 171 VAL n 
1 172 LYS n 
1 173 ARG n 
1 174 LEU n 
1 175 ILE n 
1 176 ARG n 
1 177 GLU n 
1 178 LEU n 
1 179 ASP n 
1 180 ILE n 
1 181 ALA n 
1 182 ASP n 
1 183 VAL n 
1 184 PRO n 
1 185 GLY n 
1 186 ILE n 
1 187 GLY n 
1 188 ASN n 
1 189 ILE n 
1 190 THR n 
1 191 ALA n 
1 192 GLU n 
1 193 LYS n 
1 194 LEU n 
1 195 LYS n 
1 196 LYS n 
1 197 LEU n 
1 198 GLY n 
1 199 ILE n 
1 200 ASN n 
1 201 LYS n 
1 202 LEU n 
1 203 VAL n 
1 204 ASP n 
1 205 THR n 
1 206 LEU n 
1 207 SER n 
1 208 ILE n 
1 209 GLU n 
1 210 PHE n 
1 211 ASP n 
1 212 LYS n 
1 213 LEU n 
1 214 LYS n 
1 215 GLY n 
1 216 MET n 
1 217 ILE n 
1 218 GLY n 
1 219 GLU n 
1 220 ALA n 
1 221 LYS n 
1 222 ALA n 
1 223 LYS n 
1 224 TYR n 
1 225 LEU n 
1 226 ILE n 
1 227 SER n 
1 228 LEU n 
1 229 ALA n 
1 230 ARG n 
1 231 ASP n 
1 232 GLU n 
1 233 TYR n 
1 234 ASN n 
1 235 GLU n 
1 236 PRO n 
1 237 ILE n 
1 238 ARG n 
1 239 THR n 
1 240 ARG n 
1 241 VAL n 
1 242 ARG n 
1 243 LYS n 
1 244 SER n 
1 245 ILE n 
1 246 GLY n 
1 247 ARG n 
1 248 ILE n 
1 249 VAL n 
1 250 THR n 
1 251 MET n 
1 252 LYS n 
1 253 ARG n 
1 254 ASN n 
1 255 SER n 
1 256 ARG n 
1 257 ASN n 
1 258 LEU n 
1 259 GLU n 
1 260 GLU n 
1 261 ILE n 
1 262 LYS n 
1 263 PRO n 
1 264 TYR n 
1 265 LEU n 
1 266 PHE n 
1 267 ARG n 
1 268 ALA n 
1 269 ILE n 
1 270 GLU n 
1 271 GLU n 
1 272 SER n 
1 273 TYR n 
1 274 TYR n 
1 275 LYS n 
1 276 LEU n 
1 277 ASP n 
1 278 LYS n 
1 279 ARG n 
1 280 ILE n 
1 281 PRO n 
1 282 LYS n 
1 283 ALA n 
1 284 ILE n 
1 285 HIS n 
1 286 VAL n 
1 287 VAL n 
1 288 ALA n 
1 289 VAL n 
1 290 THR n 
1 291 GLU n 
1 292 ASP n 
1 293 LEU n 
1 294 ASP n 
1 295 ILE n 
1 296 VAL n 
1 297 SER n 
1 298 ARG n 
1 299 GLY n 
1 300 ARG n 
1 301 THR n 
1 302 PHE n 
1 303 PRO n 
1 304 HIS n 
1 305 GLY n 
1 306 ILE n 
1 307 SER n 
1 308 LYS n 
1 309 GLU n 
1 310 THR n 
1 311 ALA n 
1 312 TYR n 
1 313 SER n 
1 314 GLU n 
1 315 SER n 
1 316 VAL n 
1 317 LYS n 
1 318 LEU n 
1 319 LEU n 
1 320 GLN n 
1 321 LYS n 
1 322 ILE n 
1 323 LEU n 
1 324 GLU n 
1 325 GLU n 
1 326 ASP n 
1 327 GLU n 
1 328 ARG n 
1 329 LYS n 
1 330 ILE n 
1 331 ARG n 
1 332 ARG n 
1 333 ILE n 
1 334 GLY n 
1 335 VAL n 
1 336 ARG n 
1 337 PHE n 
1 338 SER n 
1 339 LYS n 
1 340 PHE n 
1 341 ILE n 
1 342 GLU n 
1 343 ALA n 
1 344 ILE n 
1 345 GLY n 
1 346 LEU n 
1 347 ASP n 
1 348 LYS n 
1 349 PHE n 
1 350 PHE n 
1 351 ASP n 
1 352 THR n 
2 1   DT  n 
2 2   DT  n 
2 3   DG  n 
2 4   DC  n 
2 5   2JV n 
2 6   DG  n 
2 7   DA  n 
2 8   DC  n 
2 9   DT  n 
2 10  DG  n 
2 11  DG  n 
2 12  DT  n 
2 13  DA  n 
2 14  DT  n 
2 15  DT  n 
2 16  DG  n 
2 17  DG  n 
2 18  DG  n 
3 1   DC  n 
3 2   DC  n 
3 3   DC  n 
3 4   DA  n 
3 5   DA  n 
3 6   DT  n 
3 7   DA  n 
3 8   DC  n 
3 9   DC  n 
3 10  DA  n 
3 11  DG  n 
3 12  DT  n 
3 13  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'dbh, dpo4, SSO2448' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 35092 / DSM 1617 / JCM 11322 / P2' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Sulfolobus solfataricus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     273057 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'synthetic construct' ? 32630 '18-mer DNA template' 
3 1 sample ? ? 'synthetic construct' ? 32630 '13-mer DNA template' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPO4_SULSO Q97W02 1 
;MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEARKFGVKAGIPIVEAKKILPNAVYLPMRKEV
YQQVSSRIMNLLREYSEKIEIASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVFAKIAADMAKP
NGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGINKLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTR
VRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQ
KILEEDERKIRRIGVRFSKFIEAIGLDKFFDT
;
1 ? 
2 PDB 4RZR       4RZR   2 ? ? ? 
3 PDB 4RZR       4RZR   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4RZR A 1 ? 352 ? Q97W02 1 ? 352 ? 1 352 
2 1 4RZR D 1 ? 352 ? Q97W02 1 ? 352 ? 1 352 
3 2 4RZR B 1 ? 18  ? 4RZR   1 ? 18  ? 1 18  
4 2 4RZR E 1 ? 18  ? 4RZR   1 ? 18  ? 1 18  
5 3 4RZR C 1 ? 13  ? 4RZR   1 ? 13  ? 1 13  
6 3 4RZR F 1 ? 13  ? 4RZR   1 ? 13  ? 1 13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
2JV 'DNA linking'       n "N-(8-aminopyren-1-yl)-2'-deoxy-5'-O-(trihydroxy-lambda~5~-phosphanyl)guanosine" ? 'C26 H25 N6 O7 P'  
564.486 
ALA 'L-peptide linking' y ALANINE                                                                          ? 'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking' y ARGININE                                                                         ? 'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                       ? 'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                  ? 'C4 H7 N O4'       
133.103 
CA  non-polymer         . 'CALCIUM ION'                                                                    ? 'Ca 2'             
40.078  
CYS 'L-peptide linking' y CYSTEINE                                                                         ? 'C3 H7 N O2 S'     
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                             ? 'C10 H14 N5 O6 P'  
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                              ? 'C9 H14 N3 O7 P'   
307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                                               ? 'C9 H16 N3 O13 P3' 
467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                             ? 'C10 H14 N5 O7 P'  
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                     ? 'C10 H15 N2 O8 P'  
322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                        ? 'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                  ? 'C5 H9 N O4'       
147.129 
GLY 'peptide linking'   y GLYCINE                                                                          ? 'C2 H5 N O2'       
75.067  
GOL non-polymer         . GLYCEROL                                                                         
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                        ? 'C6 H10 N3 O2 1'   
156.162 
HOH non-polymer         . WATER                                                                            ? 'H2 O'             
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                       ? 'C6 H13 N O2'      
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                          ? 'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking' y LYSINE                                                                           ? 'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking' y METHIONINE                                                                       ? 'C5 H11 N O2 S'    
149.211 
NA  non-polymer         . 'SODIUM ION'                                                                     ? 'Na 1'             
22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                                                    ? 'C9 H11 N O2'      
165.189 
PRO 'L-peptide linking' y PROLINE                                                                          ? 'C5 H9 N O2'       
115.130 
SER 'L-peptide linking' y SERINE                                                                           ? 'C3 H7 N O3'       
105.093 
THR 'L-peptide linking' y THREONINE                                                                        ? 'C4 H9 N O3'       
119.119 
TRS non-polymer         . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL                                         'TRIS BUFFER' 
'C4 H12 N O3 1'    122.143 
TYR 'L-peptide linking' y TYROSINE                                                                         ? 'C9 H11 N O3'      
181.189 
VAL 'L-peptide linking' y VALINE                                                                           ? 'C5 H11 N O2'      
117.146 
# 
_exptl.entry_id          4RZR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.65 
_exptl_crystal.density_percent_sol   53.63 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
;20 MM TRIS, 15% PEG3350, 60 MM SODIUM CHLORIDE, 5 MM CALCIUM CHLORIDE, 4% GLYCEROL, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           193 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'RAYONIX MX225HE' 
_diffrn_detector.pdbx_collection_date   2013-10-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DIAMOND(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97931 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 31-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   31-ID 
_diffrn_source.pdbx_wavelength             0.97931 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     4RZR 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            2.200 
_reflns.number_obs                   52026 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.14000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.3400 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.800 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   99.8 
_reflns_shell.Rmerge_I_obs           0.83000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.100 
_reflns_shell.pdbx_redundancy        6.80 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 4RZR 
_refine.ls_number_reflns_obs                     49297 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.23 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    99.8 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.250 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2649 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.952 
_refine.correlation_coeff_Fo_to_Fc_free          0.927 
_refine.B_iso_mean                               44.31 
_refine.aniso_B[1][1]                            0.02000 
_refine.aniso_B[2][2]                            0.02000 
_refine.aniso_B[3][3]                            -0.08000 
_refine.aniso_B[1][2]                            0.02000 
_refine.aniso_B[1][3]                            -0.00000 
_refine.aniso_B[2][3]                            0.00000 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.254 
_refine.pdbx_overall_ESU_R_Free                  0.210 
_refine.overall_SU_ML                            0.162 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             13.003 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5504 
_refine_hist.pdbx_number_atoms_nucleic_acid   1225 
_refine_hist.pdbx_number_atoms_ligand         54 
_refine_hist.number_atoms_solvent             157 
_refine_hist.number_atoms_total               6940 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        20.23 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.008  0.018  ? 7015  ? 'X-RAY DIFFRACTION' 
r_bond_other_d               0.001  0.020  ? 6420  ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.294  1.848  ? 9682  ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            0.861  3.000  ? 14840 ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.574  5.000  ? 686   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       33.113 23.740 ? 246   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       14.882 15.000 ? 1133  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       17.161 15.000 ? 48    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.073  0.200  ? 1040  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.005  0.020  ? 6862  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           0.003  0.020  ? 1498  ? 'X-RAY DIFFRACTION' 
r_nbd_refined                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  1.392  2.752  ? 2739  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               1.391  2.750  ? 2737  ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 2.254  4.119  ? 3420  ? 'X-RAY DIFFRACTION' 
r_mcangle_other              2.395  4.461  ? 3424  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.701  3.057  ? 4276  ? 'X-RAY DIFFRACTION' 
r_scbond_other               1.906  3.441  ? 4282  ? 'X-RAY DIFFRACTION' 
r_scangle_it                 ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_scangle_other              3.099  5.084  ? 6270  ? 'X-RAY DIFFRACTION' 
r_long_range_B_refined       5.088  27.164 ? 8517  ? 'X-RAY DIFFRACTION' 
r_long_range_B_other         5.081  27.131 ? 8492  ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.26 
_refine_ls_shell.number_reflns_R_work             3684 
_refine_ls_shell.R_factor_R_work                  0.2750 
_refine_ls_shell.percent_reflns_obs               99.59 
_refine_ls_shell.R_factor_R_free                  0.3350 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             232 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  4RZR 
_struct.title                     'Bypass of a bulky adduct dG1,8 by DPO4' 
_struct.pdbx_descriptor           'DNA polymerase IV (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4RZR 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'DPO4, DBH, POLYMERASE, TRANSFERASE-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 4 ? 
M N N 4 ? 
N N N 5 ? 
O N N 8 ? 
P N N 8 ? 
Q N N 9 ? 
R N N 9 ? 
S N N 9 ? 
T N N 9 ? 
U N N 9 ? 
V N N 9 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 10  ? ASN A 20  ? TYR A 10  ASN A 20  1 ? 11 
HELX_P HELX_P2  2  PRO A 21  ? LYS A 24  ? PRO A 21  LYS A 24  5 ? 4  
HELX_P HELX_P3  3  ASN A 47  ? PHE A 53  ? ASN A 47  PHE A 53  1 ? 7  
HELX_P HELX_P4  4  PRO A 60  ? LEU A 68  ? PRO A 60  LEU A 68  1 ? 9  
HELX_P HELX_P5  5  ARG A 77  ? SER A 96  ? ARG A 77  SER A 96  1 ? 20 
HELX_P HELX_P6  6  ASP A 117 ? LYS A 137 ? ASP A 117 LYS A 137 1 ? 21 
HELX_P HELX_P7  7  ASN A 147 ? LYS A 159 ? ASN A 147 LYS A 159 1 ? 13 
HELX_P HELX_P8  8  ASP A 167 ? LEU A 178 ? ASP A 167 LEU A 178 1 ? 12 
HELX_P HELX_P9  9  ASP A 179 ? VAL A 183 ? ASP A 179 VAL A 183 5 ? 5  
HELX_P HELX_P10 10 GLY A 187 ? LEU A 197 ? GLY A 187 LEU A 197 1 ? 11 
HELX_P HELX_P11 11 LYS A 201 ? SER A 207 ? LYS A 201 SER A 207 5 ? 7  
HELX_P HELX_P12 12 GLU A 209 ? GLY A 218 ? GLU A 209 GLY A 218 1 ? 10 
HELX_P HELX_P13 13 GLY A 218 ? ARG A 230 ? GLY A 218 ARG A 230 1 ? 13 
HELX_P HELX_P14 14 ASN A 257 ? ASP A 277 ? ASN A 257 ASP A 277 1 ? 21 
HELX_P HELX_P15 15 SER A 307 ? ASP A 326 ? SER A 307 ASP A 326 1 ? 20 
HELX_P HELX_P16 16 TYR D 10  ? ASN D 20  ? TYR D 10  ASN D 20  1 ? 11 
HELX_P HELX_P17 17 PRO D 21  ? LYS D 24  ? PRO D 21  LYS D 24  5 ? 4  
HELX_P HELX_P18 18 ASN D 47  ? LYS D 52  ? ASN D 47  LYS D 52  1 ? 6  
HELX_P HELX_P19 19 PRO D 60  ? LEU D 68  ? PRO D 60  LEU D 68  1 ? 9  
HELX_P HELX_P20 20 ARG D 77  ? GLU D 94  ? ARG D 77  GLU D 94  1 ? 18 
HELX_P HELX_P21 21 ASP D 117 ? LYS D 137 ? ASP D 117 LYS D 137 1 ? 21 
HELX_P HELX_P22 22 ASN D 147 ? LYS D 159 ? ASN D 147 LYS D 159 1 ? 13 
HELX_P HELX_P23 23 ASP D 167 ? LEU D 178 ? ASP D 167 LEU D 178 1 ? 12 
HELX_P HELX_P24 24 ASP D 179 ? VAL D 183 ? ASP D 179 VAL D 183 5 ? 5  
HELX_P HELX_P25 25 GLY D 187 ? GLY D 198 ? GLY D 187 GLY D 198 1 ? 12 
HELX_P HELX_P26 26 VAL D 203 ? ILE D 208 ? VAL D 203 ILE D 208 1 ? 6  
HELX_P HELX_P27 27 GLU D 209 ? GLY D 218 ? GLU D 209 GLY D 218 1 ? 10 
HELX_P HELX_P28 28 GLY D 218 ? ARG D 230 ? GLY D 218 ARG D 230 1 ? 13 
HELX_P HELX_P29 29 ASN D 257 ? ASP D 277 ? ASN D 257 ASP D 277 1 ? 21 
HELX_P HELX_P30 30 SER D 307 ? ASP D 326 ? SER D 307 ASP D 326 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B 2JV 5   OAS   ? ? ? 1_555 B DG  6  P   ? ? B 2JV 5   B DG  6   1_555 ? ? ? ? ? ? ?            1.486 ? 
covale2  covale ? ? E DC  4   "O3'" ? ? ? 1_555 E 2JV 5  PAD ? ? E DC  4   E 2JV 5   1_555 ? ? ? ? ? ? ?            1.495 ? 
covale3  covale ? ? E 2JV 5   OAS   ? ? ? 1_555 E DG  6  P   ? ? E 2JV 5   E DG  6   1_555 ? ? ? ? ? ? ?            1.492 ? 
metalc1  metalc ? ? D ALA 181 O     ? ? ? 1_555 N NA  .  NA  ? ? D ALA 181 D NA  404 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc2  metalc ? ? K DCP .   O1A   ? ? ? 1_555 L CA  .  CA  ? ? D DCP 401 D CA  402 1_555 ? ? ? ? ? ? ?            2.202 ? 
metalc3  metalc ? ? D ASP 7   OD1   ? ? ? 1_555 L CA  .  CA  ? ? D ASP 7   D CA  402 1_555 ? ? ? ? ? ? ?            2.207 ? 
metalc4  metalc ? ? D ASP 105 OD2   ? ? ? 1_555 L CA  .  CA  ? ? D ASP 105 D CA  402 1_555 ? ? ? ? ? ? ?            2.256 ? 
metalc5  metalc ? ? K DCP .   O2G   ? ? ? 1_555 L CA  .  CA  ? ? D DCP 401 D CA  402 1_555 ? ? ? ? ? ? ?            2.273 ? 
metalc6  metalc ? ? K DCP .   O1B   ? ? ? 1_555 L CA  .  CA  ? ? D DCP 401 D CA  402 1_555 ? ? ? ? ? ? ?            2.274 ? 
metalc7  metalc ? ? A ALA 181 O     ? ? ? 1_555 I NA  .  NA  ? ? A ALA 181 A NA  403 1_555 ? ? ? ? ? ? ?            2.287 ? 
metalc8  metalc ? ? A ILE 186 O     ? ? ? 1_555 I NA  .  NA  ? ? A ILE 186 A NA  403 1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc9  metalc ? ? D PHE 8   O     ? ? ? 1_555 L CA  .  CA  ? ? D PHE 8   D CA  402 1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc10 metalc ? ? A PHE 8   O     ? ? ? 1_555 H CA  .  CA  ? ? A PHE 8   A CA  402 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc11 metalc ? ? A GLU 106 OE2   ? ? ? 1_555 G CA  .  CA  ? ? A GLU 106 A CA  401 1_555 ? ? ? ? ? ? ?            2.421 ? 
metalc12 metalc ? ? D GLU 106 OE1   ? ? ? 1_555 M CA  .  CA  ? ? D GLU 106 D CA  403 1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc13 metalc ? ? K DCP .   O1A   ? ? ? 1_555 M CA  .  CA  ? ? D DCP 401 D CA  403 1_555 ? ? ? ? ? ? ?            2.517 ? 
metalc14 metalc ? ? D ASP 105 OD1   ? ? ? 1_555 M CA  .  CA  ? ? D ASP 105 D CA  403 1_555 ? ? ? ? ? ? ?            2.541 ? 
metalc15 metalc ? ? A ASP 7   OD1   ? ? ? 1_555 H CA  .  CA  ? ? A ASP 7   A CA  402 1_555 ? ? ? ? ? ? ?            2.560 ? 
metalc16 metalc ? ? D ILE 186 O     ? ? ? 1_555 N NA  .  NA  ? ? D ILE 186 D NA  404 1_555 ? ? ? ? ? ? ?            2.839 ? 
metalc17 metalc ? ? D ASP 7   OD1   ? ? ? 1_555 M CA  .  CA  ? ? D ASP 7   D CA  403 1_555 ? ? ? ? ? ? ?            2.930 ? 
metalc18 metalc ? ? A ASP 7   OD1   ? ? ? 1_555 G CA  .  CA  ? ? A ASP 7   A CA  401 1_555 ? ? ? ? ? ? ?            2.957 ? 
metalc19 metalc ? ? A ASP 105 OD2   ? ? ? 1_555 G CA  .  CA  ? ? A ASP 105 A CA  401 1_555 ? ? ? ? ? ? ?            3.009 ? 
metalc20 metalc ? ? A ASP 105 OD2   ? ? ? 1_555 H CA  .  CA  ? ? A ASP 105 A CA  402 1_555 ? ? ? ? ? ? ?            3.017 ? 
metalc21 metalc ? ? A ASP 7   OD2   ? ? ? 1_555 G CA  .  CA  ? ? A ASP 7   A CA  401 1_555 ? ? ? ? ? ? ?            3.105 ? 
metalc22 metalc ? ? D ASP 7   OD2   ? ? ? 1_555 M CA  .  CA  ? ? D ASP 7   D CA  403 1_555 ? ? ? ? ? ? ?            3.136 ? 
metalc23 metalc ? ? M CA  .   CA    ? ? ? 1_555 T HOH .  O   ? ? D CA  403 D HOH 502 1_555 ? ? ? ? ? ? ?            2.049 ? 
metalc24 metalc ? ? N NA  .   NA    ? ? ? 1_555 V HOH .  O   ? ? D NA  404 F HOH 101 1_555 ? ? ? ? ? ? ?            2.050 ? 
metalc25 metalc ? ? I NA  .   NA    ? ? ? 1_555 S HOH .  O   ? ? A NA  403 C HOH 101 1_555 ? ? ? ? ? ? ?            2.250 ? 
metalc26 metalc ? ? M CA  .   CA    ? ? ? 1_555 T HOH .  O   ? ? D CA  403 D HOH 503 1_555 ? ? ? ? ? ? ?            2.301 ? 
metalc27 metalc ? ? I NA  .   NA    ? ? ? 1_555 Q HOH .  O   ? ? A NA  403 A HOH 508 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc28 metalc ? ? G CA  .   CA    ? ? ? 1_555 Q HOH .  O   ? ? A CA  401 A HOH 502 1_555 ? ? ? ? ? ? ?            2.468 ? 
metalc29 metalc ? ? N NA  .   NA    ? ? ? 1_555 T HOH .  O   ? ? D NA  404 D HOH 506 1_555 ? ? ? ? ? ? ?            2.540 ? 
metalc30 metalc ? ? H CA  .   CA    ? ? ? 1_555 Q HOH .  O   ? ? A CA  402 A HOH 574 1_555 ? ? ? ? ? ? ?            2.555 ? 
metalc31 metalc ? ? I NA  .   NA    ? ? ? 1_555 Q HOH .  O   ? ? A NA  403 A HOH 522 1_555 ? ? ? ? ? ? ?            2.566 ? 
metalc32 metalc ? ? G CA  .   CA    ? ? ? 1_555 Q HOH .  O   ? ? A CA  401 A HOH 503 1_555 ? ? ? ? ? ? ?            2.835 ? 
metalc33 metalc ? ? H CA  .   CA    ? ? ? 1_555 Q HOH .  O   ? ? A CA  402 A HOH 501 1_555 ? ? ? ? ? ? ?            2.970 ? 
metalc34 metalc ? ? H CA  .   CA    ? ? ? 1_555 Q HOH .  O   ? ? A CA  402 A HOH 503 1_555 ? ? ? ? ? ? ?            3.111 ? 
hydrog1  hydrog ? ? B DG  6   N1    ? ? ? 1_555 C DC  13 N3  ? ? B DG  6   C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  6   N2    ? ? ? 1_555 C DC  13 O2  ? ? B DG  6   C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  6   O6    ? ? ? 1_555 C DC  13 N4  ? ? B DG  6   C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  12 N3  ? ? B DA  7   C DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA  7   N6    ? ? ? 1_555 C DT  12 O4  ? ? B DA  7   C DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC  8   N3    ? ? ? 1_555 C DG  11 N1  ? ? B DC  8   C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  8   N4    ? ? ? 1_555 C DG  11 O6  ? ? B DC  8   C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  8   O2    ? ? ? 1_555 C DG  11 N2  ? ? B DC  8   C DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DT  9   N3    ? ? ? 1_555 C DA  10 N1  ? ? B DT  9   C DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DT  9   O4    ? ? ? 1_555 C DA  10 N6  ? ? B DT  9   C DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  9  N3  ? ? B DG  10  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  9  O2  ? ? B DG  10  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  9  N4  ? ? B DG  10  C DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  11  N1    ? ? ? 1_555 C DC  8  N3  ? ? B DG  11  C DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  11  N2    ? ? ? 1_555 C DC  8  O2  ? ? B DG  11  C DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  11  O6    ? ? ? 1_555 C DC  8  N4  ? ? B DG  11  C DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  7  N1  ? ? B DT  12  C DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  7  N6  ? ? B DT  12  C DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DA  13  N1    ? ? ? 1_555 C DT  6  N3  ? ? B DA  13  C DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  13  N6    ? ? ? 1_555 C DT  6  O4  ? ? B DA  13  C DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  14  N3    ? ? ? 1_555 C DA  5  N1  ? ? B DT  14  C DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  14  O4    ? ? ? 1_555 C DA  5  N6  ? ? B DT  14  C DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  15  N3    ? ? ? 1_555 C DA  4  N1  ? ? B DT  15  C DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DT  15  O4    ? ? ? 1_555 C DA  4  N6  ? ? B DT  15  C DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  16  N1    ? ? ? 1_555 C DC  3  N3  ? ? B DG  16  C DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC  3  O2  ? ? B DG  16  C DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DG  16  O6    ? ? ? 1_555 C DC  3  N4  ? ? B DG  16  C DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DG  17  N1    ? ? ? 1_555 C DC  2  N3  ? ? B DG  17  C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  17  N2    ? ? ? 1_555 C DC  2  O2  ? ? B DG  17  C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  17  O6    ? ? ? 1_555 C DC  2  N4  ? ? B DG  17  C DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  18  N1    ? ? ? 1_555 C DC  1  N3  ? ? B DG  18  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  18  N2    ? ? ? 1_555 C DC  1  O2  ? ? B DG  18  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DG  18  O6    ? ? ? 1_555 C DC  1  N4  ? ? B DG  18  C DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? E DG  6   N1    ? ? ? 1_555 F DC  13 N3  ? ? E DG  6   F DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? E DG  6   N2    ? ? ? 1_555 F DC  13 O2  ? ? E DG  6   F DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? E DG  6   O6    ? ? ? 1_555 F DC  13 N4  ? ? E DG  6   F DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? E DA  7   N1    ? ? ? 1_555 F DT  12 N3  ? ? E DA  7   F DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? E DA  7   N6    ? ? ? 1_555 F DT  12 O4  ? ? E DA  7   F DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? E DC  8   N3    ? ? ? 1_555 F DG  11 N1  ? ? E DC  8   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? E DC  8   N4    ? ? ? 1_555 F DG  11 O6  ? ? E DC  8   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? E DC  8   O2    ? ? ? 1_555 F DG  11 N2  ? ? E DC  8   F DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? E DT  9   N3    ? ? ? 1_555 F DA  10 N1  ? ? E DT  9   F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? E DT  9   O4    ? ? ? 1_555 F DA  10 N6  ? ? E DT  9   F DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? E DG  10  N1    ? ? ? 1_555 F DC  9  N3  ? ? E DG  10  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? E DG  10  N2    ? ? ? 1_555 F DC  9  O2  ? ? E DG  10  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? E DG  10  O6    ? ? ? 1_555 F DC  9  N4  ? ? E DG  10  F DC  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? E DG  11  N1    ? ? ? 1_555 F DC  8  N3  ? ? E DG  11  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? E DG  11  N2    ? ? ? 1_555 F DC  8  O2  ? ? E DG  11  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? E DG  11  O6    ? ? ? 1_555 F DC  8  N4  ? ? E DG  11  F DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? E DT  12  N3    ? ? ? 1_555 F DA  7  N1  ? ? E DT  12  F DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? E DT  12  O4    ? ? ? 1_555 F DA  7  N6  ? ? E DT  12  F DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? E DA  13  N1    ? ? ? 1_555 F DT  6  N3  ? ? E DA  13  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53 hydrog ? ? E DA  13  N6    ? ? ? 1_555 F DT  6  O4  ? ? E DA  13  F DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54 hydrog ? ? E DT  14  N3    ? ? ? 1_555 F DA  5  N1  ? ? E DT  14  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55 hydrog ? ? E DT  14  O4    ? ? ? 1_555 F DA  5  N6  ? ? E DT  14  F DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56 hydrog ? ? E DT  15  N3    ? ? ? 1_555 F DA  4  N1  ? ? E DT  15  F DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57 hydrog ? ? E DT  15  O4    ? ? ? 1_555 F DA  4  N6  ? ? E DT  15  F DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58 hydrog ? ? E DG  16  N1    ? ? ? 1_555 F DC  3  N3  ? ? E DG  16  F DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59 hydrog ? ? E DG  16  N2    ? ? ? 1_555 F DC  3  O2  ? ? E DG  16  F DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60 hydrog ? ? E DG  16  O6    ? ? ? 1_555 F DC  3  N4  ? ? E DG  16  F DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61 hydrog ? ? E DG  17  N1    ? ? ? 1_555 F DC  2  N3  ? ? E DG  17  F DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62 hydrog ? ? E DG  17  N2    ? ? ? 1_555 F DC  2  O2  ? ? E DG  17  F DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63 hydrog ? ? E DG  17  O6    ? ? ? 1_555 F DC  2  N4  ? ? E DG  17  F DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64 hydrog ? ? E DG  18  N1    ? ? ? 1_555 F DC  1  N3  ? ? E DG  18  F DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65 hydrog ? ? E DG  18  N2    ? ? ? 1_555 F DC  1  O2  ? ? E DG  18  F DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66 hydrog ? ? E DG  18  O6    ? ? ? 1_555 F DC  1  N4  ? ? E DG  18  F DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 159 A . ? LYS 159 A PRO 160 A ? PRO 160 A 1 -7.66 
2 LYS 159 D . ? LYS 159 D PRO 160 D ? PRO 160 D 1 -7.88 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 4 ? 
D ? 5 ? 
E ? 3 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? parallel      
E 1 2 ? anti-parallel 
E 2 3 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 99  ? SER A 103 ? ILE A 99  SER A 103 
A 2 GLU A 106 ? ASP A 110 ? GLU A 106 ASP A 110 
A 3 VAL A 3   ? PHE A 8   ? VAL A 3   PHE A 8   
A 4 VAL A 140 ? SER A 145 ? VAL A 140 SER A 145 
A 5 ILE A 163 ? VAL A 165 ? ILE A 163 VAL A 165 
B 1 GLY A 41  ? ALA A 46  ? GLY A 41  ALA A 46  
B 2 VAL A 28  ? PHE A 33  ? VAL A 28  PHE A 33  
B 3 VAL A 72  ? PRO A 75  ? VAL A 72  PRO A 75  
C 1 SER A 244 ? SER A 255 ? SER A 244 SER A 255 
C 2 ILE A 330 ? PHE A 340 ? ILE A 330 PHE A 340 
C 3 PRO A 281 ? THR A 290 ? PRO A 281 THR A 290 
C 4 ILE A 295 ? THR A 301 ? ILE A 295 THR A 301 
D 1 ILE D 99  ? SER D 103 ? ILE D 99  SER D 103 
D 2 GLU D 106 ? ASP D 110 ? GLU D 106 ASP D 110 
D 3 VAL D 3   ? PHE D 8   ? VAL D 3   PHE D 8   
D 4 VAL D 140 ? SER D 145 ? VAL D 140 SER D 145 
D 5 ILE D 163 ? VAL D 165 ? ILE D 163 VAL D 165 
E 1 GLY D 41  ? ALA D 46  ? GLY D 41  ALA D 46  
E 2 VAL D 28  ? PHE D 33  ? VAL D 28  PHE D 33  
E 3 VAL D 72  ? PRO D 75  ? VAL D 72  PRO D 75  
F 1 SER D 244 ? SER D 255 ? SER D 244 SER D 255 
F 2 ILE D 330 ? PHE D 340 ? ILE D 330 PHE D 340 
F 3 PRO D 281 ? THR D 290 ? PRO D 281 THR D 290 
F 4 ILE D 295 ? THR D 301 ? ILE D 295 THR D 301 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 100 ? N GLU A 100 O TYR A 108 ? O TYR A 108 
A 2 3 O LEU A 109 ? O LEU A 109 N LEU A 4   ? N LEU A 4   
A 3 4 N PHE A 5   ? N PHE A 5   O GLY A 143 ? O GLY A 143 
A 4 5 N ILE A 144 ? N ILE A 144 O LYS A 164 ? O LYS A 164 
B 1 2 O ALA A 42  ? O ALA A 42  N VAL A 32  ? N VAL A 32  
B 2 3 N CYS A 31  ? N CYS A 31  O LEU A 74  ? O LEU A 74  
C 1 2 N VAL A 249 ? N VAL A 249 O ILE A 333 ? O ILE A 333 
C 2 3 O ARG A 331 ? O ARG A 331 N VAL A 289 ? N VAL A 289 
C 3 4 N ALA A 288 ? N ALA A 288 O VAL A 296 ? O VAL A 296 
D 1 2 N GLU D 100 ? N GLU D 100 O TYR D 108 ? O TYR D 108 
D 2 3 O LEU D 109 ? O LEU D 109 N LEU D 4   ? N LEU D 4   
D 3 4 N PHE D 5   ? N PHE D 5   O GLY D 143 ? O GLY D 143 
D 4 5 N ILE D 144 ? N ILE D 144 O LYS D 164 ? O LYS D 164 
E 1 2 O ALA D 44  ? O ALA D 44  N VAL D 30  ? N VAL D 30  
E 2 3 N CYS D 31  ? N CYS D 31  O LEU D 74  ? O LEU D 74  
F 1 2 N ILE D 245 ? N ILE D 245 O PHE D 337 ? O PHE D 337 
F 2 3 O ARG D 331 ? O ARG D 331 N VAL D 289 ? N VAL D 289 
F 3 4 N ALA D 288 ? N ALA D 288 O VAL D 296 ? O VAL D 296 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 401'  
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 402'  
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE NA A 403'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE TRS B 101' 
AC5 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE DCP D 401' 
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CA D 402'  
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE CA D 403'  
AC8 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE NA D 404'  
AC9 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE GOL D 405' 
BC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE GOL D 406' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP A 7   ? ASP A 7   . ? 1_555 ? 
2  AC1 6  ASP A 105 ? ASP A 105 . ? 1_555 ? 
3  AC1 6  GLU A 106 ? GLU A 106 . ? 1_555 ? 
4  AC1 6  CA  H .   ? CA  A 402 . ? 1_555 ? 
5  AC1 6  HOH Q .   ? HOH A 502 . ? 1_555 ? 
6  AC1 6  HOH Q .   ? HOH A 503 . ? 1_555 ? 
7  AC2 6  ASP A 7   ? ASP A 7   . ? 1_555 ? 
8  AC2 6  PHE A 8   ? PHE A 8   . ? 1_555 ? 
9  AC2 6  ASP A 105 ? ASP A 105 . ? 1_555 ? 
10 AC2 6  CA  G .   ? CA  A 401 . ? 1_555 ? 
11 AC2 6  HOH Q .   ? HOH A 501 . ? 1_555 ? 
12 AC2 6  HOH Q .   ? HOH A 574 . ? 1_555 ? 
13 AC3 5  ALA A 181 ? ALA A 181 . ? 1_555 ? 
14 AC3 5  ILE A 186 ? ILE A 186 . ? 1_555 ? 
15 AC3 5  HOH Q .   ? HOH A 508 . ? 1_555 ? 
16 AC3 5  HOH Q .   ? HOH A 522 . ? 1_555 ? 
17 AC3 5  HOH S .   ? HOH C 101 . ? 1_555 ? 
18 AC4 4  ARG A 332 ? ARG A 332 . ? 1_555 ? 
19 AC4 4  2JV B 5   ? 2JV B 5   . ? 1_555 ? 
20 AC4 4  DG  B 6   ? DG  B 6   . ? 1_555 ? 
21 AC4 4  HOH R .   ? HOH B 208 . ? 1_555 ? 
22 AC5 19 ASP D 7   ? ASP D 7   . ? 1_555 ? 
23 AC5 19 PHE D 8   ? PHE D 8   . ? 1_555 ? 
24 AC5 19 ASP D 9   ? ASP D 9   . ? 1_555 ? 
25 AC5 19 TYR D 10  ? TYR D 10  . ? 1_555 ? 
26 AC5 19 PHE D 11  ? PHE D 11  . ? 1_555 ? 
27 AC5 19 TYR D 12  ? TYR D 12  . ? 1_555 ? 
28 AC5 19 ALA D 44  ? ALA D 44  . ? 1_555 ? 
29 AC5 19 THR D 45  ? THR D 45  . ? 1_555 ? 
30 AC5 19 TYR D 48  ? TYR D 48  . ? 1_555 ? 
31 AC5 19 ARG D 51  ? ARG D 51  . ? 1_555 ? 
32 AC5 19 ASP D 105 ? ASP D 105 . ? 1_555 ? 
33 AC5 19 LYS D 159 ? LYS D 159 . ? 1_555 ? 
34 AC5 19 CA  L .   ? CA  D 402 . ? 1_555 ? 
35 AC5 19 CA  M .   ? CA  D 403 . ? 1_555 ? 
36 AC5 19 HOH T .   ? HOH D 502 . ? 1_555 ? 
37 AC5 19 HOH T .   ? HOH D 523 . ? 1_555 ? 
38 AC5 19 HOH T .   ? HOH D 561 . ? 1_555 ? 
39 AC5 19 DG  E 3   ? DG  E 3   . ? 1_555 ? 
40 AC5 19 2JV E 5   ? 2JV E 5   . ? 1_555 ? 
41 AC6 5  ASP D 7   ? ASP D 7   . ? 1_555 ? 
42 AC6 5  PHE D 8   ? PHE D 8   . ? 1_555 ? 
43 AC6 5  ASP D 105 ? ASP D 105 . ? 1_555 ? 
44 AC6 5  DCP K .   ? DCP D 401 . ? 1_555 ? 
45 AC6 5  CA  M .   ? CA  D 403 . ? 1_555 ? 
46 AC7 7  ASP D 7   ? ASP D 7   . ? 1_555 ? 
47 AC7 7  ASP D 105 ? ASP D 105 . ? 1_555 ? 
48 AC7 7  GLU D 106 ? GLU D 106 . ? 1_555 ? 
49 AC7 7  DCP K .   ? DCP D 401 . ? 1_555 ? 
50 AC7 7  CA  L .   ? CA  D 402 . ? 1_555 ? 
51 AC7 7  HOH T .   ? HOH D 502 . ? 1_555 ? 
52 AC7 7  HOH T .   ? HOH D 503 . ? 1_555 ? 
53 AC8 4  ALA D 181 ? ALA D 181 . ? 1_555 ? 
54 AC8 4  ILE D 186 ? ILE D 186 . ? 1_555 ? 
55 AC8 4  HOH T .   ? HOH D 506 . ? 1_555 ? 
56 AC8 4  HOH V .   ? HOH F 101 . ? 1_555 ? 
57 AC9 4  VAL D 80  ? VAL D 80  . ? 1_555 ? 
58 AC9 4  GLN D 83  ? GLN D 83  . ? 1_555 ? 
59 AC9 4  VAL D 84  ? VAL D 84  . ? 1_555 ? 
60 AC9 4  ARG D 87  ? ARG D 87  . ? 1_555 ? 
61 BC1 5  GLU D 100 ? GLU D 100 . ? 1_555 ? 
62 BC1 5  LYS D 148 ? LYS D 148 . ? 1_555 ? 
63 BC1 5  TYR D 233 ? TYR D 233 . ? 1_555 ? 
64 BC1 5  ARG D 240 ? ARG D 240 . ? 1_555 ? 
65 BC1 5  HOH T .   ? HOH D 543 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4RZR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4RZR 
_atom_sites.fract_transf_matrix[1][1]   0.017731 
_atom_sites.fract_transf_matrix[1][2]   0.010237 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020475 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003463 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? -7.290  91.350  25.035  1.00 43.18  ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? -5.968  90.709  24.878  1.00 42.03  ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? -6.144  89.201  24.713  1.00 38.74  ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? -7.094  88.646  25.228  1.00 35.70  ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? -5.158  91.010  26.129  1.00 43.48  ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? -3.737  90.505  26.156  1.00 46.48  ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? -2.854  91.187  27.591  1.00 50.51  ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? -3.965  90.724  28.934  1.00 45.03  ? 1   MET A CE    1 
ATOM   9    N  N     . ILE A 1 2   ? -5.225  88.541  24.013  1.00 37.34  ? 2   ILE A N     1 
ATOM   10   C  CA    . ILE A 1 2   ? -5.238  87.086  23.919  1.00 35.32  ? 2   ILE A CA    1 
ATOM   11   C  C     . ILE A 1 2   ? -3.834  86.606  24.175  1.00 34.33  ? 2   ILE A C     1 
ATOM   12   O  O     . ILE A 1 2   ? -2.915  87.005  23.477  1.00 35.08  ? 2   ILE A O     1 
ATOM   13   C  CB    . ILE A 1 2   ? -5.729  86.606  22.526  1.00 36.43  ? 2   ILE A CB    1 
ATOM   14   C  CG1   . ILE A 1 2   ? -7.228  86.865  22.392  1.00 36.50  ? 2   ILE A CG1   1 
ATOM   15   C  CG2   . ILE A 1 2   ? -5.455  85.119  22.312  1.00 35.42  ? 2   ILE A CG2   1 
ATOM   16   C  CD1   . ILE A 1 2   ? -7.785  86.579  21.014  1.00 38.97  ? 2   ILE A CD1   1 
ATOM   17   N  N     . VAL A 1 3   ? -3.668  85.733  25.165  1.00 32.76  ? 3   VAL A N     1 
ATOM   18   C  CA    . VAL A 1 3   ? -2.330  85.313  25.595  1.00 32.31  ? 3   VAL A CA    1 
ATOM   19   C  C     . VAL A 1 3   ? -2.180  83.821  25.400  1.00 31.88  ? 3   VAL A C     1 
ATOM   20   O  O     . VAL A 1 3   ? -3.097  83.074  25.715  1.00 30.70  ? 3   VAL A O     1 
ATOM   21   C  CB    . VAL A 1 3   ? -2.055  85.643  27.083  1.00 30.22  ? 3   VAL A CB    1 
ATOM   22   C  CG1   . VAL A 1 3   ? -0.661  85.188  27.485  1.00 29.51  ? 3   VAL A CG1   1 
ATOM   23   C  CG2   . VAL A 1 3   ? -2.198  87.129  27.338  1.00 30.95  ? 3   VAL A CG2   1 
ATOM   24   N  N     . LEU A 1 4   ? -1.024  83.399  24.890  1.00 32.42  ? 4   LEU A N     1 
ATOM   25   C  CA    . LEU A 1 4   ? -0.749  81.977  24.698  1.00 32.81  ? 4   LEU A CA    1 
ATOM   26   C  C     . LEU A 1 4   ? 0.502   81.592  25.458  1.00 32.75  ? 4   LEU A C     1 
ATOM   27   O  O     . LEU A 1 4   ? 1.593   82.075  25.142  1.00 34.59  ? 4   LEU A O     1 
ATOM   28   C  CB    . LEU A 1 4   ? -0.594  81.672  23.211  1.00 34.79  ? 4   LEU A CB    1 
ATOM   29   C  CG    . LEU A 1 4   ? -0.499  80.200  22.796  1.00 35.32  ? 4   LEU A CG    1 
ATOM   30   C  CD1   . LEU A 1 4   ? -0.935  80.029  21.347  1.00 36.22  ? 4   LEU A CD1   1 
ATOM   31   C  CD2   . LEU A 1 4   ? 0.908   79.636  23.012  1.00 35.86  ? 4   LEU A CD2   1 
ATOM   32   N  N     . PHE A 1 5   ? 0.346   80.709  26.446  1.00 30.68  ? 5   PHE A N     1 
ATOM   33   C  CA    . PHE A 1 5   ? 1.453   80.275  27.295  1.00 30.17  ? 5   PHE A CA    1 
ATOM   34   C  C     . PHE A 1 5   ? 1.921   78.897  26.883  1.00 30.57  ? 5   PHE A C     1 
ATOM   35   O  O     . PHE A 1 5   ? 1.114   77.998  26.653  1.00 30.47  ? 5   PHE A O     1 
ATOM   36   C  CB    . PHE A 1 5   ? 0.984   80.254  28.753  1.00 29.39  ? 5   PHE A CB    1 
ATOM   37   C  CG    . PHE A 1 5   ? 1.975   79.687  29.736  1.00 28.90  ? 5   PHE A CG    1 
ATOM   38   C  CD1   . PHE A 1 5   ? 3.067   80.438  30.164  1.00 28.52  ? 5   PHE A CD1   1 
ATOM   39   C  CD2   . PHE A 1 5   ? 1.767   78.438  30.299  1.00 28.78  ? 5   PHE A CD2   1 
ATOM   40   C  CE1   . PHE A 1 5   ? 3.948   79.946  31.110  1.00 28.20  ? 5   PHE A CE1   1 
ATOM   41   C  CE2   . PHE A 1 5   ? 2.640   77.940  31.253  1.00 29.50  ? 5   PHE A CE2   1 
ATOM   42   C  CZ    . PHE A 1 5   ? 3.738   78.697  31.669  1.00 28.40  ? 5   PHE A CZ    1 
ATOM   43   N  N     . VAL A 1 6   ? 3.232   78.740  26.802  1.00 30.96  ? 6   VAL A N     1 
ATOM   44   C  CA    . VAL A 1 6   ? 3.832   77.475  26.428  1.00 32.70  ? 6   VAL A CA    1 
ATOM   45   C  C     . VAL A 1 6   ? 4.696   76.962  27.571  1.00 32.41  ? 6   VAL A C     1 
ATOM   46   O  O     . VAL A 1 6   ? 5.533   77.684  28.060  1.00 32.09  ? 6   VAL A O     1 
ATOM   47   C  CB    . VAL A 1 6   ? 4.724   77.625  25.184  1.00 33.29  ? 6   VAL A CB    1 
ATOM   48   C  CG1   . VAL A 1 6   ? 5.238   76.268  24.746  1.00 34.78  ? 6   VAL A CG1   1 
ATOM   49   C  CG2   . VAL A 1 6   ? 3.961   78.295  24.052  1.00 34.11  ? 6   VAL A CG2   1 
ATOM   50   N  N     . ASP A 1 7   ? 4.511   75.698  27.939  1.00 33.82  ? 7   ASP A N     1 
ATOM   51   C  CA    . ASP A 1 7   ? 5.192   75.066  29.059  1.00 33.86  ? 7   ASP A CA    1 
ATOM   52   C  C     . ASP A 1 7   ? 5.710   73.720  28.604  1.00 34.49  ? 7   ASP A C     1 
ATOM   53   O  O     . ASP A 1 7   ? 4.921   72.854  28.296  1.00 35.61  ? 7   ASP A O     1 
ATOM   54   C  CB    . ASP A 1 7   ? 4.209   74.876  30.221  1.00 34.59  ? 7   ASP A CB    1 
ATOM   55   C  CG    . ASP A 1 7   ? 4.861   74.305  31.479  1.00 35.16  ? 7   ASP A CG    1 
ATOM   56   O  OD1   . ASP A 1 7   ? 5.905   73.658  31.404  1.00 38.72  ? 7   ASP A OD1   1 
ATOM   57   O  OD2   . ASP A 1 7   ? 4.307   74.479  32.570  1.00 36.78  ? 7   ASP A OD2   1 
ATOM   58   N  N     . PHE A 1 8   ? 7.031   73.529  28.584  1.00 35.64  ? 8   PHE A N     1 
ATOM   59   C  CA    . PHE A 1 8   ? 7.595   72.308  28.006  1.00 38.56  ? 8   PHE A CA    1 
ATOM   60   C  C     . PHE A 1 8   ? 7.371   71.146  28.971  1.00 38.75  ? 8   PHE A C     1 
ATOM   61   O  O     . PHE A 1 8   ? 7.576   71.292  30.147  1.00 37.14  ? 8   PHE A O     1 
ATOM   62   C  CB    . PHE A 1 8   ? 9.088   72.462  27.650  1.00 40.23  ? 8   PHE A CB    1 
ATOM   63   C  CG    . PHE A 1 8   ? 9.431   73.762  26.972  1.00 40.22  ? 8   PHE A CG    1 
ATOM   64   C  CD1   . PHE A 1 8   ? 8.476   74.487  26.274  1.00 41.24  ? 8   PHE A CD1   1 
ATOM   65   C  CD2   . PHE A 1 8   ? 10.725  74.251  27.025  1.00 41.59  ? 8   PHE A CD2   1 
ATOM   66   C  CE1   . PHE A 1 8   ? 8.809   75.689  25.667  1.00 42.91  ? 8   PHE A CE1   1 
ATOM   67   C  CE2   . PHE A 1 8   ? 11.067  75.446  26.415  1.00 42.19  ? 8   PHE A CE2   1 
ATOM   68   C  CZ    . PHE A 1 8   ? 10.106  76.170  25.739  1.00 42.59  ? 8   PHE A CZ    1 
ATOM   69   N  N     . ASP A 1 9   ? 6.927   70.002  28.459  1.00 41.65  ? 9   ASP A N     1 
ATOM   70   C  CA    . ASP A 1 9   ? 6.569   68.861  29.310  1.00 42.42  ? 9   ASP A CA    1 
ATOM   71   C  C     . ASP A 1 9   ? 7.789   68.201  29.962  1.00 44.05  ? 9   ASP A C     1 
ATOM   72   O  O     . ASP A 1 9   ? 8.766   67.875  29.281  1.00 44.05  ? 9   ASP A O     1 
ATOM   73   C  CB    . ASP A 1 9   ? 5.804   67.810  28.500  1.00 43.67  ? 9   ASP A CB    1 
ATOM   74   C  CG    . ASP A 1 9   ? 4.462   68.316  27.989  1.00 42.83  ? 9   ASP A CG    1 
ATOM   75   O  OD1   . ASP A 1 9   ? 3.745   69.057  28.708  1.00 42.00  ? 9   ASP A OD1   1 
ATOM   76   O  OD2   . ASP A 1 9   ? 4.111   67.954  26.859  1.00 43.56  ? 9   ASP A OD2   1 
ATOM   77   N  N     . TYR A 1 10  ? 7.705   68.014  31.282  1.00 44.10  ? 10  TYR A N     1 
ATOM   78   C  CA    . TYR A 1 10  ? 8.742   67.384  32.094  1.00 44.62  ? 10  TYR A CA    1 
ATOM   79   C  C     . TYR A 1 10  ? 10.140  67.582  31.484  1.00 43.85  ? 10  TYR A C     1 
ATOM   80   O  O     . TYR A 1 10  ? 10.846  66.635  31.167  1.00 46.93  ? 10  TYR A O     1 
ATOM   81   C  CB    . TYR A 1 10  ? 8.375   65.910  32.373  1.00 48.23  ? 10  TYR A CB    1 
ATOM   82   C  CG    . TYR A 1 10  ? 8.235   64.965  31.162  1.00 53.16  ? 10  TYR A CG    1 
ATOM   83   C  CD1   . TYR A 1 10  ? 7.012   64.811  30.485  1.00 53.76  ? 10  TYR A CD1   1 
ATOM   84   C  CD2   . TYR A 1 10  ? 9.318   64.172  30.735  1.00 56.49  ? 10  TYR A CD2   1 
ATOM   85   C  CE1   . TYR A 1 10  ? 6.891   63.940  29.406  1.00 55.24  ? 10  TYR A CE1   1 
ATOM   86   C  CE2   . TYR A 1 10  ? 9.199   63.293  29.659  1.00 58.03  ? 10  TYR A CE2   1 
ATOM   87   C  CZ    . TYR A 1 10  ? 7.989   63.182  29.002  1.00 58.54  ? 10  TYR A CZ    1 
ATOM   88   O  OH    . TYR A 1 10  ? 7.895   62.310  27.942  1.00 62.45  ? 10  TYR A OH    1 
ATOM   89   N  N     . PHE A 1 11  ? 10.523  68.848  31.350  1.00 41.09  ? 11  PHE A N     1 
ATOM   90   C  CA    . PHE A 1 11  ? 11.517  69.267  30.356  1.00 41.87  ? 11  PHE A CA    1 
ATOM   91   C  C     . PHE A 1 11  ? 12.847  68.520  30.413  1.00 43.79  ? 11  PHE A C     1 
ATOM   92   O  O     . PHE A 1 11  ? 13.253  67.921  29.423  1.00 46.28  ? 11  PHE A O     1 
ATOM   93   C  CB    . PHE A 1 11  ? 11.748  70.787  30.431  1.00 40.35  ? 11  PHE A CB    1 
ATOM   94   C  CG    . PHE A 1 11  ? 12.623  71.337  29.324  1.00 40.62  ? 11  PHE A CG    1 
ATOM   95   C  CD1   . PHE A 1 11  ? 12.314  71.108  27.987  1.00 41.77  ? 11  PHE A CD1   1 
ATOM   96   C  CD2   . PHE A 1 11  ? 13.750  72.100  29.622  1.00 40.80  ? 11  PHE A CD2   1 
ATOM   97   C  CE1   . PHE A 1 11  ? 13.125  71.601  26.966  1.00 43.29  ? 11  PHE A CE1   1 
ATOM   98   C  CE2   . PHE A 1 11  ? 14.568  72.595  28.606  1.00 41.57  ? 11  PHE A CE2   1 
ATOM   99   C  CZ    . PHE A 1 11  ? 14.255  72.352  27.276  1.00 42.92  ? 11  PHE A CZ    1 
ATOM   100  N  N     . TYR A 1 12  ? 13.514  68.554  31.562  1.00 43.02  ? 12  TYR A N     1 
ATOM   101  C  CA    . TYR A 1 12  ? 14.878  68.041  31.657  1.00 44.31  ? 12  TYR A CA    1 
ATOM   102  C  C     . TYR A 1 12  ? 14.922  66.551  31.322  1.00 46.41  ? 12  TYR A C     1 
ATOM   103  O  O     . TYR A 1 12  ? 15.719  66.129  30.495  1.00 47.19  ? 12  TYR A O     1 
ATOM   104  C  CB    . TYR A 1 12  ? 15.479  68.291  33.051  1.00 42.68  ? 12  TYR A CB    1 
ATOM   105  C  CG    . TYR A 1 12  ? 15.690  69.750  33.471  1.00 40.67  ? 12  TYR A CG    1 
ATOM   106  C  CD1   . TYR A 1 12  ? 15.585  70.812  32.569  1.00 40.44  ? 12  TYR A CD1   1 
ATOM   107  C  CD2   . TYR A 1 12  ? 16.024  70.053  34.787  1.00 39.16  ? 12  TYR A CD2   1 
ATOM   108  C  CE1   . TYR A 1 12  ? 15.787  72.125  32.983  1.00 38.56  ? 12  TYR A CE1   1 
ATOM   109  C  CE2   . TYR A 1 12  ? 16.231  71.352  35.204  1.00 37.23  ? 12  TYR A CE2   1 
ATOM   110  C  CZ    . TYR A 1 12  ? 16.116  72.384  34.305  1.00 37.45  ? 12  TYR A CZ    1 
ATOM   111  O  OH    . TYR A 1 12  ? 16.340  73.673  34.750  1.00 37.34  ? 12  TYR A OH    1 
ATOM   112  N  N     . ALA A 1 13  ? 14.049  65.767  31.950  1.00 47.50  ? 13  ALA A N     1 
ATOM   113  C  CA    . ALA A 1 13  ? 13.936  64.336  31.645  1.00 48.97  ? 13  ALA A CA    1 
ATOM   114  C  C     . ALA A 1 13  ? 13.612  64.084  30.171  1.00 52.26  ? 13  ALA A C     1 
ATOM   115  O  O     . ALA A 1 13  ? 14.179  63.175  29.552  1.00 56.47  ? 13  ALA A O     1 
ATOM   116  C  CB    . ALA A 1 13  ? 12.892  63.677  32.536  1.00 47.47  ? 13  ALA A CB    1 
ATOM   117  N  N     . GLN A 1 14  ? 12.725  64.886  29.594  1.00 51.72  ? 14  GLN A N     1 
ATOM   118  C  CA    . GLN A 1 14  ? 12.349  64.690  28.187  1.00 54.39  ? 14  GLN A CA    1 
ATOM   119  C  C     . GLN A 1 14  ? 13.533  64.929  27.256  1.00 56.66  ? 14  GLN A C     1 
ATOM   120  O  O     . GLN A 1 14  ? 13.697  64.225  26.260  1.00 57.74  ? 14  GLN A O     1 
ATOM   121  C  CB    . GLN A 1 14  ? 11.187  65.596  27.776  1.00 52.58  ? 14  GLN A CB    1 
ATOM   122  C  CG    . GLN A 1 14  ? 10.328  64.983  26.676  1.00 55.20  ? 14  GLN A CG    1 
ATOM   123  C  CD    . GLN A 1 14  ? 9.312   65.938  26.067  1.00 53.35  ? 14  GLN A CD    1 
ATOM   124  O  OE1   . GLN A 1 14  ? 8.894   65.749  24.931  1.00 54.52  ? 14  GLN A OE1   1 
ATOM   125  N  NE2   . GLN A 1 14  ? 8.913   66.963  26.812  1.00 51.04  ? 14  GLN A NE2   1 
ATOM   126  N  N     . VAL A 1 15  ? 14.344  65.934  27.578  1.00 56.69  ? 15  VAL A N     1 
ATOM   127  C  CA    . VAL A 1 15  ? 15.498  66.269  26.754  1.00 60.27  ? 15  VAL A CA    1 
ATOM   128  C  C     . VAL A 1 15  ? 16.531  65.139  26.780  1.00 64.18  ? 15  VAL A C     1 
ATOM   129  O  O     . VAL A 1 15  ? 17.180  64.861  25.761  1.00 66.33  ? 15  VAL A O     1 
ATOM   130  C  CB    . VAL A 1 15  ? 16.140  67.605  27.178  1.00 58.45  ? 15  VAL A CB    1 
ATOM   131  C  CG1   . VAL A 1 15  ? 17.476  67.816  26.471  1.00 60.84  ? 15  VAL A CG1   1 
ATOM   132  C  CG2   . VAL A 1 15  ? 15.195  68.754  26.866  1.00 55.65  ? 15  VAL A CG2   1 
ATOM   133  N  N     . GLU A 1 16  ? 16.661  64.473  27.926  1.00 64.94  ? 16  GLU A N     1 
ATOM   134  C  CA    . GLU A 1 16  ? 17.545  63.306  28.026  1.00 68.61  ? 16  GLU A CA    1 
ATOM   135  C  C     . GLU A 1 16  ? 17.067  62.152  27.126  1.00 71.58  ? 16  GLU A C     1 
ATOM   136  O  O     . GLU A 1 16  ? 17.888  61.426  26.553  1.00 73.71  ? 16  GLU A O     1 
ATOM   137  C  CB    . GLU A 1 16  ? 17.668  62.833  29.478  1.00 67.25  ? 16  GLU A CB    1 
ATOM   138  C  CG    . GLU A 1 16  ? 18.338  63.832  30.402  1.00 65.90  ? 16  GLU A CG    1 
ATOM   139  C  CD    . GLU A 1 16  ? 19.793  64.088  30.050  1.00 67.95  ? 16  GLU A CD    1 
ATOM   140  O  OE1   . GLU A 1 16  ? 20.472  63.145  29.594  1.00 69.27  ? 16  GLU A OE1   1 
ATOM   141  O  OE2   . GLU A 1 16  ? 20.258  65.235  30.243  1.00 66.51  ? 16  GLU A OE2   1 
ATOM   142  N  N     . GLU A 1 17  ? 15.748  61.988  27.012  1.00 71.20  ? 17  GLU A N     1 
ATOM   143  C  CA    . GLU A 1 17  ? 15.162  60.976  26.125  1.00 74.67  ? 17  GLU A CA    1 
ATOM   144  C  C     . GLU A 1 17  ? 15.435  61.279  24.662  1.00 75.37  ? 17  GLU A C     1 
ATOM   145  O  O     . GLU A 1 17  ? 15.623  60.363  23.871  1.00 78.55  ? 17  GLU A O     1 
ATOM   146  C  CB    . GLU A 1 17  ? 13.654  60.878  26.307  1.00 74.77  ? 17  GLU A CB    1 
ATOM   147  C  CG    . GLU A 1 17  ? 13.183  60.325  27.641  1.00 75.32  ? 17  GLU A CG    1 
ATOM   148  C  CD    . GLU A 1 17  ? 11.784  59.738  27.529  1.00 77.23  ? 17  GLU A CD    1 
ATOM   149  O  OE1   . GLU A 1 17  ? 11.650  58.672  26.882  1.00 78.98  ? 17  GLU A OE1   1 
ATOM   150  O  OE2   . GLU A 1 17  ? 10.823  60.349  28.060  1.00 74.24  ? 17  GLU A OE2   1 
ATOM   151  N  N     . VAL A 1 18  ? 15.423  62.559  24.301  1.00 73.45  ? 18  VAL A N     1 
ATOM   152  C  CA    . VAL A 1 18  ? 15.836  62.972  22.964  1.00 75.71  ? 18  VAL A CA    1 
ATOM   153  C  C     . VAL A 1 18  ? 17.290  62.559  22.741  1.00 77.85  ? 18  VAL A C     1 
ATOM   154  O  O     . VAL A 1 18  ? 17.583  61.783  21.837  1.00 80.63  ? 18  VAL A O     1 
ATOM   155  C  CB    . VAL A 1 18  ? 15.678  64.496  22.746  1.00 73.80  ? 18  VAL A CB    1 
ATOM   156  C  CG1   . VAL A 1 18  ? 16.479  64.967  21.530  1.00 75.16  ? 18  VAL A CG1   1 
ATOM   157  C  CG2   . VAL A 1 18  ? 14.202  64.867  22.614  1.00 71.77  ? 18  VAL A CG2   1 
ATOM   158  N  N     . LEU A 1 19  ? 18.184  63.057  23.591  1.00 77.99  ? 19  LEU A N     1 
ATOM   159  C  CA    . LEU A 1 19  ? 19.617  62.787  23.458  1.00 80.30  ? 19  LEU A CA    1 
ATOM   160  C  C     . LEU A 1 19  ? 19.982  61.312  23.645  1.00 84.13  ? 19  LEU A C     1 
ATOM   161  O  O     . LEU A 1 19  ? 21.080  60.905  23.289  1.00 86.61  ? 19  LEU A O     1 
ATOM   162  C  CB    . LEU A 1 19  ? 20.422  63.657  24.427  1.00 77.69  ? 19  LEU A CB    1 
ATOM   163  C  CG    . LEU A 1 19  ? 20.356  65.156  24.128  1.00 76.49  ? 19  LEU A CG    1 
ATOM   164  C  CD1   . LEU A 1 19  ? 21.077  65.949  25.205  1.00 75.42  ? 19  LEU A CD1   1 
ATOM   165  C  CD2   . LEU A 1 19  ? 20.920  65.486  22.754  1.00 78.87  ? 19  LEU A CD2   1 
ATOM   166  N  N     . ASN A 1 20  ? 19.069  60.521  24.201  1.00 85.34  ? 20  ASN A N     1 
ATOM   167  C  CA    . ASN A 1 20  ? 19.241  59.076  24.264  1.00 89.21  ? 20  ASN A CA    1 
ATOM   168  C  C     . ASN A 1 20  ? 17.926  58.317  24.040  1.00 90.13  ? 20  ASN A C     1 
ATOM   169  O  O     . ASN A 1 20  ? 17.211  58.013  24.999  1.00 88.30  ? 20  ASN A O     1 
ATOM   170  C  CB    . ASN A 1 20  ? 19.842  58.673  25.609  1.00 89.47  ? 20  ASN A CB    1 
ATOM   171  C  CG    . ASN A 1 20  ? 19.976  57.166  25.750  1.00 93.08  ? 20  ASN A CG    1 
ATOM   172  O  OD1   . ASN A 1 20  ? 19.967  56.433  24.757  1.00 92.21  ? 20  ASN A OD1   1 
ATOM   173  N  ND2   . ASN A 1 20  ? 20.092  56.697  26.986  1.00 93.68  ? 20  ASN A ND2   1 
ATOM   174  N  N     . PRO A 1 21  ? 17.615  57.981  22.774  1.00 92.47  ? 21  PRO A N     1 
ATOM   175  C  CA    . PRO A 1 21  ? 16.364  57.281  22.457  1.00 93.34  ? 21  PRO A CA    1 
ATOM   176  C  C     . PRO A 1 21  ? 16.079  56.050  23.333  1.00 94.64  ? 21  PRO A C     1 
ATOM   177  O  O     . PRO A 1 21  ? 14.915  55.716  23.547  1.00 93.76  ? 21  PRO A O     1 
ATOM   178  C  CB    . PRO A 1 21  ? 16.553  56.879  20.994  1.00 96.52  ? 21  PRO A CB    1 
ATOM   179  C  CG    . PRO A 1 21  ? 17.465  57.920  20.440  1.00 96.36  ? 21  PRO A CG    1 
ATOM   180  C  CD    . PRO A 1 21  ? 18.395  58.292  21.560  1.00 94.66  ? 21  PRO A CD    1 
ATOM   181  N  N     . SER A 1 22  ? 17.133  55.408  23.839  1.00 97.20  ? 22  SER A N     1 
ATOM   182  C  CA    . SER A 1 22  ? 17.022  54.226  24.702  1.00 99.17  ? 22  SER A CA    1 
ATOM   183  C  C     . SER A 1 22  ? 16.084  54.391  25.891  1.00 97.18  ? 22  SER A C     1 
ATOM   184  O  O     . SER A 1 22  ? 15.407  53.442  26.283  1.00 98.23  ? 22  SER A O     1 
ATOM   185  C  CB    . SER A 1 22  ? 18.404  53.837  25.235  1.00 101.35 ? 22  SER A CB    1 
ATOM   186  O  OG    . SER A 1 22  ? 18.304  52.840  26.232  1.00 102.36 ? 22  SER A OG    1 
ATOM   187  N  N     . LEU A 1 23  ? 16.050  55.591  26.464  1.00 95.47  ? 23  LEU A N     1 
ATOM   188  C  CA    . LEU A 1 23  ? 15.277  55.842  27.680  1.00 93.07  ? 23  LEU A CA    1 
ATOM   189  C  C     . LEU A 1 23  ? 13.767  55.764  27.435  1.00 91.93  ? 23  LEU A C     1 
ATOM   190  O  O     . LEU A 1 23  ? 12.982  55.715  28.383  1.00 88.13  ? 23  LEU A O     1 
ATOM   191  C  CB    . LEU A 1 23  ? 15.664  57.195  28.281  1.00 91.95  ? 23  LEU A CB    1 
ATOM   192  C  CG    . LEU A 1 23  ? 17.146  57.316  28.677  1.00 92.69  ? 23  LEU A CG    1 
ATOM   193  C  CD1   . LEU A 1 23  ? 17.507  58.760  29.005  1.00 89.56  ? 23  LEU A CD1   1 
ATOM   194  C  CD2   . LEU A 1 23  ? 17.479  56.389  29.840  1.00 92.47  ? 23  LEU A CD2   1 
ATOM   195  N  N     . LYS A 1 24  ? 13.379  55.779  26.160  1.00 92.93  ? 24  LYS A N     1 
ATOM   196  C  CA    . LYS A 1 24  ? 12.066  55.327  25.716  1.00 92.82  ? 24  LYS A CA    1 
ATOM   197  C  C     . LYS A 1 24  ? 11.487  54.313  26.702  1.00 92.33  ? 24  LYS A C     1 
ATOM   198  O  O     . LYS A 1 24  ? 12.079  53.258  26.926  1.00 95.32  ? 24  LYS A O     1 
ATOM   199  C  CB    . LYS A 1 24  ? 12.223  54.694  24.322  1.00 97.69  ? 24  LYS A CB    1 
ATOM   200  C  CG    . LYS A 1 24  ? 11.132  53.734  23.849  1.00 100.47 ? 24  LYS A CG    1 
ATOM   201  C  CD    . LYS A 1 24  ? 9.821   54.441  23.552  1.00 98.43  ? 24  LYS A CD    1 
ATOM   202  C  CE    . LYS A 1 24  ? 8.864   53.520  22.810  1.00 100.52 ? 24  LYS A CE    1 
ATOM   203  N  NZ    . LYS A 1 24  ? 7.608   54.228  22.444  1.00 98.70  ? 24  LYS A NZ    1 
ATOM   204  N  N     . GLY A 1 25  ? 10.357  54.647  27.317  1.00 89.15  ? 25  GLY A N     1 
ATOM   205  C  CA    . GLY A 1 25  ? 9.640   53.702  28.174  1.00 89.90  ? 25  GLY A CA    1 
ATOM   206  C  C     . GLY A 1 25  ? 10.102  53.639  29.620  1.00 89.52  ? 25  GLY A C     1 
ATOM   207  O  O     . GLY A 1 25  ? 9.286   53.410  30.516  1.00 91.04  ? 25  GLY A O     1 
ATOM   208  N  N     . LYS A 1 26  ? 11.403  53.828  29.851  1.00 88.08  ? 26  LYS A N     1 
ATOM   209  C  CA    . LYS A 1 26  ? 11.976  53.795  31.201  1.00 86.56  ? 26  LYS A CA    1 
ATOM   210  C  C     . LYS A 1 26  ? 11.565  55.006  32.048  1.00 83.31  ? 26  LYS A C     1 
ATOM   211  O  O     . LYS A 1 26  ? 11.570  56.137  31.556  1.00 77.97  ? 26  LYS A O     1 
ATOM   212  C  CB    . LYS A 1 26  ? 13.512  53.762  31.141  1.00 87.45  ? 26  LYS A CB    1 
ATOM   213  C  CG    . LYS A 1 26  ? 14.126  52.378  30.981  1.00 91.29  ? 26  LYS A CG    1 
ATOM   214  C  CD    . LYS A 1 26  ? 15.643  52.460  30.876  1.00 91.98  ? 26  LYS A CD    1 
ATOM   215  C  CE    . LYS A 1 26  ? 16.321  51.141  31.226  1.00 94.99  ? 26  LYS A CE    1 
ATOM   216  N  NZ    . LYS A 1 26  ? 15.788  49.992  30.439  1.00 98.25  ? 26  LYS A NZ    1 
ATOM   217  N  N     . PRO A 1 27  ? 11.234  54.778  33.336  1.00 82.46  ? 27  PRO A N     1 
ATOM   218  C  CA    . PRO A 1 27  ? 11.125  55.925  34.236  1.00 76.75  ? 27  PRO A CA    1 
ATOM   219  C  C     . PRO A 1 27  ? 12.468  56.640  34.337  1.00 73.51  ? 27  PRO A C     1 
ATOM   220  O  O     . PRO A 1 27  ? 13.500  55.995  34.536  1.00 74.32  ? 27  PRO A O     1 
ATOM   221  C  CB    . PRO A 1 27  ? 10.752  55.294  35.582  1.00 78.47  ? 27  PRO A CB    1 
ATOM   222  C  CG    . PRO A 1 27  ? 11.230  53.883  35.494  1.00 82.91  ? 27  PRO A CG    1 
ATOM   223  C  CD    . PRO A 1 27  ? 11.054  53.498  34.052  1.00 84.69  ? 27  PRO A CD    1 
ATOM   224  N  N     . VAL A 1 28  ? 12.436  57.960  34.201  1.00 67.09  ? 28  VAL A N     1 
ATOM   225  C  CA    . VAL A 1 28  ? 13.636  58.769  34.105  1.00 63.64  ? 28  VAL A CA    1 
ATOM   226  C  C     . VAL A 1 28  ? 13.512  59.900  35.118  1.00 59.53  ? 28  VAL A C     1 
ATOM   227  O  O     . VAL A 1 28  ? 12.454  60.540  35.224  1.00 56.88  ? 28  VAL A O     1 
ATOM   228  C  CB    . VAL A 1 28  ? 13.822  59.335  32.685  1.00 63.10  ? 28  VAL A CB    1 
ATOM   229  C  CG1   . VAL A 1 28  ? 14.995  60.300  32.630  1.00 62.69  ? 28  VAL A CG1   1 
ATOM   230  C  CG2   . VAL A 1 28  ? 14.011  58.212  31.689  1.00 66.02  ? 28  VAL A CG2   1 
ATOM   231  N  N     . VAL A 1 29  ? 14.596  60.119  35.863  1.00 57.10  ? 29  VAL A N     1 
ATOM   232  C  CA    . VAL A 1 29  ? 14.631  61.061  36.960  1.00 53.83  ? 29  VAL A CA    1 
ATOM   233  C  C     . VAL A 1 29  ? 15.907  61.883  36.891  1.00 53.48  ? 29  VAL A C     1 
ATOM   234  O  O     . VAL A 1 29  ? 17.016  61.348  37.047  1.00 55.60  ? 29  VAL A O     1 
ATOM   235  C  CB    . VAL A 1 29  ? 14.574  60.343  38.320  1.00 53.68  ? 29  VAL A CB    1 
ATOM   236  C  CG1   . VAL A 1 29  ? 14.665  61.352  39.463  1.00 50.64  ? 29  VAL A CG1   1 
ATOM   237  C  CG2   . VAL A 1 29  ? 13.311  59.505  38.428  1.00 53.28  ? 29  VAL A CG2   1 
ATOM   238  N  N     . VAL A 1 30  ? 15.745  63.180  36.649  1.00 50.96  ? 30  VAL A N     1 
ATOM   239  C  CA    . VAL A 1 30  ? 16.865  64.101  36.639  1.00 50.88  ? 30  VAL A CA    1 
ATOM   240  C  C     . VAL A 1 30  ? 16.986  64.724  38.025  1.00 50.50  ? 30  VAL A C     1 
ATOM   241  O  O     . VAL A 1 30  ? 15.978  65.136  38.620  1.00 50.13  ? 30  VAL A O     1 
ATOM   242  C  CB    . VAL A 1 30  ? 16.719  65.171  35.543  1.00 49.99  ? 30  VAL A CB    1 
ATOM   243  C  CG1   . VAL A 1 30  ? 17.825  66.218  35.643  1.00 49.89  ? 30  VAL A CG1   1 
ATOM   244  C  CG2   . VAL A 1 30  ? 16.750  64.506  34.178  1.00 52.40  ? 30  VAL A CG2   1 
ATOM   245  N  N     . CYS A 1 31  ? 18.222  64.771  38.529  1.00 51.52  ? 31  CYS A N     1 
ATOM   246  C  CA    . CYS A 1 31  ? 18.502  65.207  39.896  1.00 51.30  ? 31  CYS A CA    1 
ATOM   247  C  C     . CYS A 1 31  ? 19.579  66.283  39.963  1.00 48.88  ? 31  CYS A C     1 
ATOM   248  O  O     . CYS A 1 31  ? 20.434  66.388  39.069  1.00 48.72  ? 31  CYS A O     1 
ATOM   249  C  CB    . CYS A 1 31  ? 18.978  64.029  40.739  1.00 54.45  ? 31  CYS A CB    1 
ATOM   250  S  SG    . CYS A 1 31  ? 17.927  62.570  40.684  1.00 58.03  ? 31  CYS A SG    1 
ATOM   251  N  N     . VAL A 1 32  ? 19.529  67.059  41.041  1.00 45.61  ? 32  VAL A N     1 
ATOM   252  C  CA    . VAL A 1 32  ? 20.612  67.977  41.399  1.00 45.64  ? 32  VAL A CA    1 
ATOM   253  C  C     . VAL A 1 32  ? 21.454  67.257  42.437  1.00 46.05  ? 32  VAL A C     1 
ATOM   254  O  O     . VAL A 1 32  ? 21.073  67.196  43.604  1.00 44.11  ? 32  VAL A O     1 
ATOM   255  C  CB    . VAL A 1 32  ? 20.070  69.321  41.954  1.00 42.93  ? 32  VAL A CB    1 
ATOM   256  C  CG1   . VAL A 1 32  ? 21.208  70.278  42.324  1.00 43.65  ? 32  VAL A CG1   1 
ATOM   257  C  CG2   . VAL A 1 32  ? 19.149  69.965  40.935  1.00 42.20  ? 32  VAL A CG2   1 
ATOM   258  N  N     . PHE A 1 33  ? 22.568  66.677  41.993  1.00 48.73  ? 33  PHE A N     1 
ATOM   259  C  CA    . PHE A 1 33  ? 23.500  65.981  42.894  1.00 51.19  ? 33  PHE A CA    1 
ATOM   260  C  C     . PHE A 1 33  ? 24.364  67.025  43.579  1.00 49.77  ? 33  PHE A C     1 
ATOM   261  O  O     . PHE A 1 33  ? 25.219  67.631  42.943  1.00 49.71  ? 33  PHE A O     1 
ATOM   262  C  CB    . PHE A 1 33  ? 24.382  64.981  42.138  1.00 53.30  ? 33  PHE A CB    1 
ATOM   263  C  CG    . PHE A 1 33  ? 23.658  63.734  41.722  1.00 56.47  ? 33  PHE A CG    1 
ATOM   264  C  CD1   . PHE A 1 33  ? 23.517  62.668  42.602  1.00 58.31  ? 33  PHE A CD1   1 
ATOM   265  C  CD2   . PHE A 1 33  ? 23.100  63.627  40.447  1.00 58.07  ? 33  PHE A CD2   1 
ATOM   266  C  CE1   . PHE A 1 33  ? 22.837  61.519  42.218  1.00 61.32  ? 33  PHE A CE1   1 
ATOM   267  C  CE2   . PHE A 1 33  ? 22.418  62.481  40.059  1.00 59.76  ? 33  PHE A CE2   1 
ATOM   268  C  CZ    . PHE A 1 33  ? 22.290  61.423  40.946  1.00 61.62  ? 33  PHE A CZ    1 
ATOM   269  N  N     . SER A 1 34  ? 24.125  67.232  44.870  1.00 48.03  ? 34  SER A N     1 
ATOM   270  C  CA    . SER A 1 34  ? 24.772  68.313  45.614  1.00 46.24  ? 34  SER A CA    1 
ATOM   271  C  C     . SER A 1 34  ? 26.229  68.010  45.999  1.00 48.41  ? 34  SER A C     1 
ATOM   272  O  O     . SER A 1 34  ? 26.988  68.923  46.321  1.00 46.86  ? 34  SER A O     1 
ATOM   273  C  CB    . SER A 1 34  ? 23.936  68.674  46.854  1.00 44.34  ? 34  SER A CB    1 
ATOM   274  O  OG    . SER A 1 34  ? 23.614  67.522  47.611  1.00 44.75  ? 34  SER A OG    1 
ATOM   275  N  N     . GLY A 1 35  ? 26.608  66.733  45.981  1.00 51.38  ? 35  GLY A N     1 
ATOM   276  C  CA    . GLY A 1 35  ? 28.001  66.332  46.157  1.00 53.84  ? 35  GLY A CA    1 
ATOM   277  C  C     . GLY A 1 35  ? 28.526  66.310  47.590  1.00 55.41  ? 35  GLY A C     1 
ATOM   278  O  O     . GLY A 1 35  ? 29.744  66.323  47.796  1.00 57.16  ? 35  GLY A O     1 
ATOM   279  N  N     . ARG A 1 36  ? 27.619  66.266  48.567  1.00 55.01  ? 36  ARG A N     1 
ATOM   280  C  CA    . ARG A 1 36  ? 27.977  66.276  49.992  1.00 55.69  ? 36  ARG A CA    1 
ATOM   281  C  C     . ARG A 1 36  ? 28.217  64.861  50.518  1.00 58.97  ? 36  ARG A C     1 
ATOM   282  O  O     . ARG A 1 36  ? 29.000  64.655  51.448  1.00 58.66  ? 36  ARG A O     1 
ATOM   283  C  CB    . ARG A 1 36  ? 26.883  66.966  50.814  1.00 54.38  ? 36  ARG A CB    1 
ATOM   284  C  CG    . ARG A 1 36  ? 26.831  68.467  50.580  1.00 53.30  ? 36  ARG A CG    1 
ATOM   285  C  CD    . ARG A 1 36  ? 25.549  69.099  51.089  1.00 52.12  ? 36  ARG A CD    1 
ATOM   286  N  NE    . ARG A 1 36  ? 25.363  68.907  52.521  1.00 53.22  ? 36  ARG A NE    1 
ATOM   287  C  CZ    . ARG A 1 36  ? 25.971  69.610  53.474  1.00 54.74  ? 36  ARG A CZ    1 
ATOM   288  N  NH1   . ARG A 1 36  ? 26.865  70.572  53.187  1.00 54.17  ? 36  ARG A NH1   1 
ATOM   289  N  NH2   . ARG A 1 36  ? 25.692  69.333  54.739  1.00 56.82  ? 36  ARG A NH2   1 
ATOM   290  N  N     . PHE A 1 37  ? 27.515  63.904  49.928  1.00 60.11  ? 37  PHE A N     1 
ATOM   291  C  CA    . PHE A 1 37  ? 27.760  62.483  50.149  1.00 63.36  ? 37  PHE A CA    1 
ATOM   292  C  C     . PHE A 1 37  ? 27.055  61.741  49.025  1.00 64.66  ? 37  PHE A C     1 
ATOM   293  O  O     . PHE A 1 37  ? 26.312  62.353  48.257  1.00 61.71  ? 37  PHE A O     1 
ATOM   294  C  CB    . PHE A 1 37  ? 27.234  62.035  51.519  1.00 64.50  ? 37  PHE A CB    1 
ATOM   295  C  CG    . PHE A 1 37  ? 25.768  62.318  51.743  1.00 64.56  ? 37  PHE A CG    1 
ATOM   296  C  CD1   . PHE A 1 37  ? 25.352  63.523  52.300  1.00 62.36  ? 37  PHE A CD1   1 
ATOM   297  C  CD2   . PHE A 1 37  ? 24.800  61.361  51.420  1.00 66.20  ? 37  PHE A CD2   1 
ATOM   298  C  CE1   . PHE A 1 37  ? 24.002  63.777  52.514  1.00 62.74  ? 37  PHE A CE1   1 
ATOM   299  C  CE2   . PHE A 1 37  ? 23.450  61.609  51.635  1.00 65.07  ? 37  PHE A CE2   1 
ATOM   300  C  CZ    . PHE A 1 37  ? 23.049  62.821  52.181  1.00 63.17  ? 37  PHE A CZ    1 
ATOM   301  N  N     . GLU A 1 38  ? 27.263  60.434  48.927  1.00 67.57  ? 38  GLU A N     1 
ATOM   302  C  CA    . GLU A 1 38  ? 26.612  59.651  47.878  1.00 68.49  ? 38  GLU A CA    1 
ATOM   303  C  C     . GLU A 1 38  ? 25.083  59.889  47.856  1.00 66.67  ? 38  GLU A C     1 
ATOM   304  O  O     . GLU A 1 38  ? 24.406  59.764  48.879  1.00 65.55  ? 38  GLU A O     1 
ATOM   305  C  CB    . GLU A 1 38  ? 26.926  58.160  48.033  1.00 71.39  ? 38  GLU A CB    1 
ATOM   306  C  CG    . GLU A 1 38  ? 26.475  57.326  46.844  1.00 73.10  ? 38  GLU A CG    1 
ATOM   307  C  CD    . GLU A 1 38  ? 26.582  55.841  47.094  1.00 76.65  ? 38  GLU A CD    1 
ATOM   308  O  OE1   . GLU A 1 38  ? 27.647  55.396  47.567  1.00 79.48  ? 38  GLU A OE1   1 
ATOM   309  O  OE2   . GLU A 1 38  ? 25.601  55.117  46.811  1.00 78.10  ? 38  GLU A OE2   1 
ATOM   310  N  N     . ASP A 1 39  ? 24.569  60.239  46.676  1.00 65.75  ? 39  ASP A N     1 
ATOM   311  C  CA    . ASP A 1 39  ? 23.142  60.568  46.442  1.00 63.48  ? 39  ASP A CA    1 
ATOM   312  C  C     . ASP A 1 39  ? 22.590  61.748  47.258  1.00 59.44  ? 39  ASP A C     1 
ATOM   313  O  O     . ASP A 1 39  ? 21.375  61.853  47.441  1.00 58.13  ? 39  ASP A O     1 
ATOM   314  C  CB    . ASP A 1 39  ? 22.238  59.336  46.637  1.00 65.32  ? 39  ASP A CB    1 
ATOM   315  C  CG    . ASP A 1 39  ? 22.562  58.212  45.676  1.00 68.25  ? 39  ASP A CG    1 
ATOM   316  O  OD1   . ASP A 1 39  ? 23.173  58.464  44.611  1.00 68.84  ? 39  ASP A OD1   1 
ATOM   317  O  OD2   . ASP A 1 39  ? 22.204  57.062  45.996  1.00 70.66  ? 39  ASP A OD2   1 
ATOM   318  N  N     . SER A 1 40  ? 23.461  62.640  47.729  1.00 55.34  ? 40  SER A N     1 
ATOM   319  C  CA    . SER A 1 40  ? 22.983  63.850  48.384  1.00 52.02  ? 40  SER A CA    1 
ATOM   320  C  C     . SER A 1 40  ? 22.344  64.702  47.310  1.00 49.88  ? 40  SER A C     1 
ATOM   321  O  O     . SER A 1 40  ? 22.878  64.818  46.205  1.00 51.09  ? 40  SER A O     1 
ATOM   322  C  CB    . SER A 1 40  ? 24.118  64.625  49.092  1.00 50.32  ? 40  SER A CB    1 
ATOM   323  O  OG    . SER A 1 40  ? 24.990  65.275  48.183  1.00 48.23  ? 40  SER A OG    1 
ATOM   324  N  N     . GLY A 1 41  ? 21.196  65.288  47.616  1.00 48.47  ? 41  GLY A N     1 
ATOM   325  C  CA    . GLY A 1 41  ? 20.534  66.171  46.667  1.00 46.62  ? 41  GLY A CA    1 
ATOM   326  C  C     . GLY A 1 41  ? 19.067  65.842  46.505  1.00 46.93  ? 41  GLY A C     1 
ATOM   327  O  O     . GLY A 1 41  ? 18.499  65.093  47.309  1.00 47.55  ? 41  GLY A O     1 
ATOM   328  N  N     . ALA A 1 42  ? 18.457  66.405  45.458  1.00 44.50  ? 42  ALA A N     1 
ATOM   329  C  CA    . ALA A 1 42  ? 17.020  66.284  45.237  1.00 43.25  ? 42  ALA A CA    1 
ATOM   330  C  C     . ALA A 1 42  ? 16.680  66.062  43.753  1.00 42.38  ? 42  ALA A C     1 
ATOM   331  O  O     . ALA A 1 42  ? 17.490  66.343  42.866  1.00 41.31  ? 42  ALA A O     1 
ATOM   332  C  CB    . ALA A 1 42  ? 16.314  67.524  45.770  1.00 41.23  ? 42  ALA A CB    1 
ATOM   333  N  N     . VAL A 1 43  ? 15.475  65.553  43.510  1.00 41.81  ? 43  VAL A N     1 
ATOM   334  C  CA    . VAL A 1 43  ? 14.974  65.313  42.157  1.00 42.17  ? 43  VAL A CA    1 
ATOM   335  C  C     . VAL A 1 43  ? 14.539  66.647  41.555  1.00 39.97  ? 43  VAL A C     1 
ATOM   336  O  O     . VAL A 1 43  ? 13.743  67.354  42.174  1.00 37.83  ? 43  VAL A O     1 
ATOM   337  C  CB    . VAL A 1 43  ? 13.756  64.353  42.188  1.00 43.46  ? 43  VAL A CB    1 
ATOM   338  C  CG1   . VAL A 1 43  ? 13.063  64.268  40.829  1.00 43.41  ? 43  VAL A CG1   1 
ATOM   339  C  CG2   . VAL A 1 43  ? 14.191  62.969  42.655  1.00 46.93  ? 43  VAL A CG2   1 
ATOM   340  N  N     . ALA A 1 44  ? 15.049  66.976  40.364  1.00 39.95  ? 44  ALA A N     1 
ATOM   341  C  CA    . ALA A 1 44  ? 14.588  68.161  39.616  1.00 39.49  ? 44  ALA A CA    1 
ATOM   342  C  C     . ALA A 1 44  ? 13.315  67.893  38.788  1.00 40.91  ? 44  ALA A C     1 
ATOM   343  O  O     . ALA A 1 44  ? 12.336  68.646  38.880  1.00 39.04  ? 44  ALA A O     1 
ATOM   344  C  CB    . ALA A 1 44  ? 15.688  68.698  38.724  1.00 38.26  ? 44  ALA A CB    1 
ATOM   345  N  N     . THR A 1 45  ? 13.356  66.834  37.973  1.00 45.25  ? 45  THR A N     1 
ATOM   346  C  CA    . THR A 1 45  ? 12.238  66.443  37.109  1.00 45.77  ? 45  THR A CA    1 
ATOM   347  C  C     . THR A 1 45  ? 12.112  64.930  37.017  1.00 49.46  ? 45  THR A C     1 
ATOM   348  O  O     . THR A 1 45  ? 13.105  64.223  36.824  1.00 50.88  ? 45  THR A O     1 
ATOM   349  C  CB    . THR A 1 45  ? 12.415  66.882  35.649  1.00 45.49  ? 45  THR A CB    1 
ATOM   350  O  OG1   . THR A 1 45  ? 13.051  68.149  35.580  1.00 44.14  ? 45  THR A OG1   1 
ATOM   351  C  CG2   . THR A 1 45  ? 11.071  66.946  34.960  1.00 45.74  ? 45  THR A CG2   1 
ATOM   352  N  N     . ALA A 1 46  ? 10.874  64.457  37.110  1.00 50.06  ? 46  ALA A N     1 
ATOM   353  C  CA    . ALA A 1 46  ? 10.546  63.053  36.935  1.00 52.85  ? 46  ALA A CA    1 
ATOM   354  C  C     . ALA A 1 46  ? 9.579   62.917  35.760  1.00 52.71  ? 46  ALA A C     1 
ATOM   355  O  O     . ALA A 1 46  ? 8.556   63.616  35.716  1.00 47.94  ? 46  ALA A O     1 
ATOM   356  C  CB    . ALA A 1 46  ? 9.916   62.507  38.210  1.00 53.46  ? 46  ALA A CB    1 
ATOM   357  N  N     . ASN A 1 47  ? 9.890   62.018  34.821  1.00 55.44  ? 47  ASN A N     1 
ATOM   358  C  CA    . ASN A 1 47  ? 8.985   61.767  33.696  1.00 57.00  ? 47  ASN A CA    1 
ATOM   359  C  C     . ASN A 1 47  ? 7.713   61.057  34.147  1.00 59.17  ? 47  ASN A C     1 
ATOM   360  O  O     . ASN A 1 47  ? 7.589   60.675  35.315  1.00 57.93  ? 47  ASN A O     1 
ATOM   361  C  CB    . ASN A 1 47  ? 9.678   61.025  32.558  1.00 59.18  ? 47  ASN A CB    1 
ATOM   362  C  CG    . ASN A 1 47  ? 9.933   59.553  32.861  1.00 62.66  ? 47  ASN A CG    1 
ATOM   363  O  OD1   . ASN A 1 47  ? 9.517   59.009  33.892  1.00 62.26  ? 47  ASN A OD1   1 
ATOM   364  N  ND2   . ASN A 1 47  ? 10.623  58.898  31.944  1.00 64.47  ? 47  ASN A ND2   1 
ATOM   365  N  N     . TYR A 1 48  ? 6.770   60.896  33.222  1.00 62.09  ? 48  TYR A N     1 
ATOM   366  C  CA    . TYR A 1 48  ? 5.437   60.391  33.559  1.00 65.03  ? 48  TYR A CA    1 
ATOM   367  C  C     . TYR A 1 48  ? 5.465   59.003  34.227  1.00 63.53  ? 48  TYR A C     1 
ATOM   368  O  O     . TYR A 1 48  ? 4.726   58.750  35.183  1.00 60.62  ? 48  TYR A O     1 
ATOM   369  C  CB    . TYR A 1 48  ? 4.541   60.366  32.311  1.00 70.36  ? 48  TYR A CB    1 
ATOM   370  C  CG    . TYR A 1 48  ? 3.397   59.396  32.424  1.00 74.94  ? 48  TYR A CG    1 
ATOM   371  C  CD1   . TYR A 1 48  ? 2.231   59.738  33.114  1.00 76.00  ? 48  TYR A CD1   1 
ATOM   372  C  CD2   . TYR A 1 48  ? 3.492   58.121  31.866  1.00 78.92  ? 48  TYR A CD2   1 
ATOM   373  C  CE1   . TYR A 1 48  ? 1.182   58.836  33.228  1.00 79.62  ? 48  TYR A CE1   1 
ATOM   374  C  CE2   . TYR A 1 48  ? 2.455   57.215  31.975  1.00 83.32  ? 48  TYR A CE2   1 
ATOM   375  C  CZ    . TYR A 1 48  ? 1.306   57.570  32.654  1.00 82.80  ? 48  TYR A CZ    1 
ATOM   376  O  OH    . TYR A 1 48  ? 0.290   56.647  32.747  1.00 88.70  ? 48  TYR A OH    1 
ATOM   377  N  N     . GLU A 1 49  ? 6.307   58.115  33.719  1.00 63.60  ? 49  GLU A N     1 
ATOM   378  C  CA    . GLU A 1 49  ? 6.470   56.796  34.325  1.00 67.24  ? 49  GLU A CA    1 
ATOM   379  C  C     . GLU A 1 49  ? 6.847   56.916  35.803  1.00 65.69  ? 49  GLU A C     1 
ATOM   380  O  O     . GLU A 1 49  ? 6.147   56.391  36.674  1.00 64.21  ? 49  GLU A O     1 
ATOM   381  C  CB    . GLU A 1 49  ? 7.524   55.970  33.576  1.00 70.14  ? 49  GLU A CB    1 
ATOM   382  C  CG    . GLU A 1 49  ? 7.068   55.397  32.242  1.00 72.96  ? 49  GLU A CG    1 
ATOM   383  C  CD    . GLU A 1 49  ? 5.795   54.562  32.340  1.00 74.39  ? 49  GLU A CD    1 
ATOM   384  O  OE1   . GLU A 1 49  ? 4.689   55.143  32.259  1.00 73.58  ? 49  GLU A OE1   1 
ATOM   385  O  OE2   . GLU A 1 49  ? 5.899   53.323  32.475  1.00 77.33  ? 49  GLU A OE2   1 
ATOM   386  N  N     . ALA A 1 50  ? 7.935   57.633  36.084  1.00 64.92  ? 50  ALA A N     1 
ATOM   387  C  CA    . ALA A 1 50  ? 8.418   57.771  37.458  1.00 62.49  ? 50  ALA A CA    1 
ATOM   388  C  C     . ALA A 1 50  ? 7.317   58.320  38.353  1.00 60.93  ? 50  ALA A C     1 
ATOM   389  O  O     . ALA A 1 50  ? 7.209   57.925  39.518  1.00 61.43  ? 50  ALA A O     1 
ATOM   390  C  CB    . ALA A 1 50  ? 9.660   58.649  37.517  1.00 61.22  ? 50  ALA A CB    1 
ATOM   391  N  N     . ARG A 1 51  ? 6.487   59.204  37.799  1.00 58.21  ? 51  ARG A N     1 
ATOM   392  C  CA    . ARG A 1 51  ? 5.442   59.866  38.570  1.00 57.77  ? 51  ARG A CA    1 
ATOM   393  C  C     . ARG A 1 51  ? 4.348   58.913  39.012  1.00 58.45  ? 51  ARG A C     1 
ATOM   394  O  O     . ARG A 1 51  ? 3.950   58.940  40.171  1.00 58.00  ? 51  ARG A O     1 
ATOM   395  C  CB    . ARG A 1 51  ? 4.823   61.041  37.791  1.00 57.62  ? 51  ARG A CB    1 
ATOM   396  C  CG    . ARG A 1 51  ? 5.737   62.251  37.637  1.00 56.91  ? 51  ARG A CG    1 
ATOM   397  C  CD    . ARG A 1 51  ? 5.091   63.353  36.793  1.00 57.22  ? 51  ARG A CD    1 
ATOM   398  N  NE    . ARG A 1 51  ? 6.074   64.361  36.379  1.00 57.89  ? 51  ARG A NE    1 
ATOM   399  C  CZ    . ARG A 1 51  ? 5.792   65.580  35.913  1.00 58.58  ? 51  ARG A CZ    1 
ATOM   400  N  NH1   . ARG A 1 51  ? 4.532   65.996  35.796  1.00 57.39  ? 51  ARG A NH1   1 
ATOM   401  N  NH2   . ARG A 1 51  ? 6.785   66.402  35.565  1.00 57.59  ? 51  ARG A NH2   1 
ATOM   402  N  N     . LYS A 1 52  ? 3.857   58.065  38.112  1.00 59.83  ? 52  LYS A N     1 
ATOM   403  C  CA    . LYS A 1 52  ? 2.778   57.156  38.491  1.00 62.24  ? 52  LYS A CA    1 
ATOM   404  C  C     . LYS A 1 52  ? 3.249   56.128  39.542  1.00 62.96  ? 52  LYS A C     1 
ATOM   405  O  O     . LYS A 1 52  ? 2.434   55.575  40.284  1.00 62.12  ? 52  LYS A O     1 
ATOM   406  C  CB    . LYS A 1 52  ? 2.116   56.494  37.267  1.00 66.70  ? 52  LYS A CB    1 
ATOM   407  C  CG    . LYS A 1 52  ? 3.007   55.589  36.419  1.00 71.77  ? 52  LYS A CG    1 
ATOM   408  C  CD    . LYS A 1 52  ? 2.181   54.709  35.474  1.00 73.66  ? 52  LYS A CD    1 
ATOM   409  C  CE    . LYS A 1 52  ? 3.008   53.535  34.959  1.00 78.34  ? 52  LYS A CE    1 
ATOM   410  N  NZ    . LYS A 1 52  ? 2.238   52.585  34.102  1.00 81.62  ? 52  LYS A NZ    1 
ATOM   411  N  N     . PHE A 1 53  ? 4.561   55.907  39.625  1.00 63.55  ? 53  PHE A N     1 
ATOM   412  C  CA    . PHE A 1 53  ? 5.152   55.139  40.727  1.00 65.56  ? 53  PHE A CA    1 
ATOM   413  C  C     . PHE A 1 53  ? 5.657   56.020  41.881  1.00 63.84  ? 53  PHE A C     1 
ATOM   414  O  O     . PHE A 1 53  ? 6.576   55.643  42.597  1.00 65.51  ? 53  PHE A O     1 
ATOM   415  C  CB    . PHE A 1 53  ? 6.262   54.230  40.194  1.00 68.47  ? 53  PHE A CB    1 
ATOM   416  C  CG    . PHE A 1 53  ? 5.750   53.089  39.368  1.00 71.20  ? 53  PHE A CG    1 
ATOM   417  C  CD1   . PHE A 1 53  ? 5.054   52.043  39.966  1.00 74.41  ? 53  PHE A CD1   1 
ATOM   418  C  CD2   . PHE A 1 53  ? 5.945   53.061  37.995  1.00 72.34  ? 53  PHE A CD2   1 
ATOM   419  C  CE1   . PHE A 1 53  ? 4.562   50.988  39.210  1.00 76.66  ? 53  PHE A CE1   1 
ATOM   420  C  CE2   . PHE A 1 53  ? 5.460   52.005  37.233  1.00 76.19  ? 53  PHE A CE2   1 
ATOM   421  C  CZ    . PHE A 1 53  ? 4.764   50.968  37.841  1.00 77.61  ? 53  PHE A CZ    1 
ATOM   422  N  N     . GLY A 1 54  ? 5.051   57.192  42.056  1.00 61.27  ? 54  GLY A N     1 
ATOM   423  C  CA    . GLY A 1 54  ? 5.212   57.986  43.274  1.00 60.02  ? 54  GLY A CA    1 
ATOM   424  C  C     . GLY A 1 54  ? 6.505   58.765  43.430  1.00 58.97  ? 54  GLY A C     1 
ATOM   425  O  O     . GLY A 1 54  ? 6.888   59.103  44.551  1.00 59.02  ? 54  GLY A O     1 
ATOM   426  N  N     . VAL A 1 55  ? 7.183   59.034  42.318  1.00 58.34  ? 55  VAL A N     1 
ATOM   427  C  CA    . VAL A 1 55  ? 8.365   59.899  42.297  1.00 56.97  ? 55  VAL A CA    1 
ATOM   428  C  C     . VAL A 1 55  ? 7.950   61.254  41.709  1.00 55.09  ? 55  VAL A C     1 
ATOM   429  O  O     . VAL A 1 55  ? 7.204   61.295  40.733  1.00 53.54  ? 55  VAL A O     1 
ATOM   430  C  CB    . VAL A 1 55  ? 9.503   59.264  41.465  1.00 58.23  ? 55  VAL A CB    1 
ATOM   431  C  CG1   . VAL A 1 55  ? 10.525  60.300  41.031  1.00 58.01  ? 55  VAL A CG1   1 
ATOM   432  C  CG2   . VAL A 1 55  ? 10.187  58.159  42.255  1.00 60.35  ? 55  VAL A CG2   1 
ATOM   433  N  N     . LYS A 1 56  ? 8.438   62.345  42.304  1.00 53.64  ? 56  LYS A N     1 
ATOM   434  C  CA    . LYS A 1 56  ? 8.108   63.715  41.869  1.00 52.26  ? 56  LYS A CA    1 
ATOM   435  C  C     . LYS A 1 56  ? 9.194   64.747  42.238  1.00 49.76  ? 56  LYS A C     1 
ATOM   436  O  O     . LYS A 1 56  ? 10.082  64.473  43.039  1.00 47.89  ? 56  LYS A O     1 
ATOM   437  C  CB    . LYS A 1 56  ? 6.756   64.138  42.459  1.00 53.96  ? 56  LYS A CB    1 
ATOM   438  C  CG    . LYS A 1 56  ? 6.644   63.895  43.955  1.00 58.10  ? 56  LYS A CG    1 
ATOM   439  C  CD    . LYS A 1 56  ? 5.398   64.532  44.554  1.00 59.75  ? 56  LYS A CD    1 
ATOM   440  C  CE    . LYS A 1 56  ? 5.279   64.194  46.036  1.00 63.58  ? 56  LYS A CE    1 
ATOM   441  N  NZ    . LYS A 1 56  ? 4.659   65.300  46.817  1.00 64.08  ? 56  LYS A NZ    1 
ATOM   442  N  N     . ALA A 1 57  ? 9.120   65.945  41.659  1.00 48.65  ? 57  ALA A N     1 
ATOM   443  C  CA    . ALA A 1 57  ? 10.138  66.976  41.916  1.00 45.85  ? 57  ALA A CA    1 
ATOM   444  C  C     . ALA A 1 57  ? 10.224  67.387  43.388  1.00 45.31  ? 57  ALA A C     1 
ATOM   445  O  O     . ALA A 1 57  ? 9.218   67.481  44.095  1.00 43.64  ? 57  ALA A O     1 
ATOM   446  C  CB    . ALA A 1 57  ? 9.894   68.204  41.053  1.00 44.70  ? 57  ALA A CB    1 
ATOM   447  N  N     . GLY A 1 58  ? 11.447  67.626  43.842  1.00 46.24  ? 58  GLY A N     1 
ATOM   448  C  CA    . GLY A 1 58  ? 11.671  68.224  45.139  1.00 46.33  ? 58  GLY A CA    1 
ATOM   449  C  C     . GLY A 1 58  ? 11.733  67.250  46.295  1.00 50.03  ? 58  GLY A C     1 
ATOM   450  O  O     . GLY A 1 58  ? 11.763  67.674  47.459  1.00 51.41  ? 58  GLY A O     1 
ATOM   451  N  N     . ILE A 1 59  ? 11.759  65.951  46.009  1.00 51.40  ? 59  ILE A N     1 
ATOM   452  C  CA    . ILE A 1 59  ? 12.013  65.000  47.079  1.00 54.30  ? 59  ILE A CA    1 
ATOM   453  C  C     . ILE A 1 59  ? 13.451  64.487  46.990  1.00 55.48  ? 59  ILE A C     1 
ATOM   454  O  O     . ILE A 1 59  ? 14.053  64.463  45.907  1.00 52.75  ? 59  ILE A O     1 
ATOM   455  C  CB    . ILE A 1 59  ? 10.981  63.848  47.145  1.00 56.37  ? 59  ILE A CB    1 
ATOM   456  C  CG1   . ILE A 1 59  ? 11.116  62.897  45.958  1.00 58.02  ? 59  ILE A CG1   1 
ATOM   457  C  CG2   . ILE A 1 59  ? 9.558   64.404  47.250  1.00 54.54  ? 59  ILE A CG2   1 
ATOM   458  C  CD1   . ILE A 1 59  ? 10.164  61.719  46.041  1.00 60.20  ? 59  ILE A CD1   1 
ATOM   459  N  N     . PRO A 1 60  ? 14.014  64.086  48.140  1.00 57.21  ? 60  PRO A N     1 
ATOM   460  C  CA    . PRO A 1 60  ? 15.413  63.660  48.135  1.00 58.36  ? 60  PRO A CA    1 
ATOM   461  C  C     . PRO A 1 60  ? 15.658  62.524  47.163  1.00 59.07  ? 60  PRO A C     1 
ATOM   462  O  O     . PRO A 1 60  ? 14.751  61.721  46.900  1.00 58.63  ? 60  PRO A O     1 
ATOM   463  C  CB    . PRO A 1 60  ? 15.662  63.220  49.581  1.00 59.78  ? 60  PRO A CB    1 
ATOM   464  C  CG    . PRO A 1 60  ? 14.654  63.972  50.380  1.00 59.81  ? 60  PRO A CG    1 
ATOM   465  C  CD    . PRO A 1 60  ? 13.437  64.071  49.496  1.00 58.97  ? 60  PRO A CD    1 
ATOM   466  N  N     . ILE A 1 61  ? 16.866  62.490  46.616  1.00 57.58  ? 61  ILE A N     1 
ATOM   467  C  CA    . ILE A 1 61  ? 17.258  61.438  45.694  1.00 62.20  ? 61  ILE A CA    1 
ATOM   468  C  C     . ILE A 1 61  ? 17.180  60.067  46.382  1.00 68.02  ? 61  ILE A C     1 
ATOM   469  O  O     . ILE A 1 61  ? 16.772  59.086  45.763  1.00 70.26  ? 61  ILE A O     1 
ATOM   470  C  CB    . ILE A 1 61  ? 18.684  61.673  45.153  1.00 61.11  ? 61  ILE A CB    1 
ATOM   471  C  CG1   . ILE A 1 61  ? 18.738  62.971  44.348  1.00 58.17  ? 61  ILE A CG1   1 
ATOM   472  C  CG2   . ILE A 1 61  ? 19.136  60.502  44.289  1.00 63.89  ? 61  ILE A CG2   1 
ATOM   473  C  CD1   . ILE A 1 61  ? 20.135  63.487  44.099  1.00 58.27  ? 61  ILE A CD1   1 
ATOM   474  N  N     . VAL A 1 62  ? 17.569  60.011  47.658  1.00 71.73  ? 62  VAL A N     1 
ATOM   475  C  CA    . VAL A 1 62  ? 17.584  58.743  48.427  1.00 76.29  ? 62  VAL A CA    1 
ATOM   476  C  C     . VAL A 1 62  ? 16.169  58.284  48.817  1.00 77.84  ? 62  VAL A C     1 
ATOM   477  O  O     . VAL A 1 62  ? 15.854  57.096  48.759  1.00 80.94  ? 62  VAL A O     1 
ATOM   478  C  CB    . VAL A 1 62  ? 18.485  58.820  49.702  1.00 75.48  ? 62  VAL A CB    1 
ATOM   479  C  CG1   . VAL A 1 62  ? 19.905  59.250  49.340  1.00 73.91  ? 62  VAL A CG1   1 
ATOM   480  C  CG2   . VAL A 1 62  ? 17.901  59.754  50.762  1.00 73.58  ? 62  VAL A CG2   1 
ATOM   481  N  N     . GLU A 1 63  ? 15.330  59.236  49.211  1.00 76.34  ? 63  GLU A N     1 
ATOM   482  C  CA    . GLU A 1 63  ? 13.941  58.963  49.561  1.00 78.83  ? 63  GLU A CA    1 
ATOM   483  C  C     . GLU A 1 63  ? 13.193  58.503  48.316  1.00 78.16  ? 63  GLU A C     1 
ATOM   484  O  O     . GLU A 1 63  ? 12.255  57.711  48.400  1.00 77.40  ? 63  GLU A O     1 
ATOM   485  C  CB    . GLU A 1 63  ? 13.284  60.220  50.146  1.00 78.51  ? 63  GLU A CB    1 
ATOM   486  C  CG    . GLU A 1 63  ? 12.198  59.946  51.175  1.00 81.31  ? 63  GLU A CG    1 
ATOM   487  C  CD    . GLU A 1 63  ? 10.837  59.698  50.561  1.00 83.31  ? 63  GLU A CD    1 
ATOM   488  O  OE1   . GLU A 1 63  ? 10.391  60.526  49.735  1.00 82.68  ? 63  GLU A OE1   1 
ATOM   489  O  OE2   . GLU A 1 63  ? 10.205  58.682  50.925  1.00 86.02  ? 63  GLU A OE2   1 
ATOM   490  N  N     . ALA A 1 64  ? 13.628  59.011  47.164  1.00 77.07  ? 64  ALA A N     1 
ATOM   491  C  CA    . ALA A 1 64  ? 13.104  58.594  45.868  1.00 77.67  ? 64  ALA A CA    1 
ATOM   492  C  C     . ALA A 1 64  ? 13.614  57.215  45.458  1.00 79.84  ? 64  ALA A C     1 
ATOM   493  O  O     . ALA A 1 64  ? 12.846  56.402  44.942  1.00 81.46  ? 64  ALA A O     1 
ATOM   494  C  CB    . ALA A 1 64  ? 13.467  59.614  44.801  1.00 75.62  ? 64  ALA A CB    1 
ATOM   495  N  N     . LYS A 1 65  ? 14.904  56.959  45.666  1.00 78.22  ? 65  LYS A N     1 
ATOM   496  C  CA    . LYS A 1 65  ? 15.477  55.643  45.347  1.00 81.87  ? 65  LYS A CA    1 
ATOM   497  C  C     . LYS A 1 65  ? 14.975  54.535  46.275  1.00 82.34  ? 65  LYS A C     1 
ATOM   498  O  O     . LYS A 1 65  ? 15.175  53.371  45.978  1.00 83.72  ? 65  LYS A O     1 
ATOM   499  C  CB    . LYS A 1 65  ? 17.010  55.684  45.335  1.00 82.90  ? 65  LYS A CB    1 
ATOM   500  C  CG    . LYS A 1 65  ? 17.597  56.124  43.999  1.00 82.15  ? 65  LYS A CG    1 
ATOM   501  C  CD    . LYS A 1 65  ? 19.122  56.191  44.038  1.00 81.76  ? 65  LYS A CD    1 
ATOM   502  C  CE    . LYS A 1 65  ? 19.697  56.569  42.679  1.00 80.00  ? 65  LYS A CE    1 
ATOM   503  N  NZ    . LYS A 1 65  ? 21.176  56.739  42.690  1.00 78.17  ? 65  LYS A NZ    1 
ATOM   504  N  N     . LYS A 1 66  ? 14.336  54.898  47.390  1.00 82.59  ? 66  LYS A N     1 
ATOM   505  C  CA    . LYS A 1 66  ? 13.550  53.941  48.183  1.00 85.63  ? 66  LYS A CA    1 
ATOM   506  C  C     . LYS A 1 66  ? 12.245  53.630  47.477  1.00 84.61  ? 66  LYS A C     1 
ATOM   507  O  O     . LYS A 1 66  ? 11.990  52.480  47.131  1.00 86.52  ? 66  LYS A O     1 
ATOM   508  C  CB    . LYS A 1 66  ? 13.197  54.484  49.572  1.00 86.77  ? 66  LYS A CB    1 
ATOM   509  C  CG    . LYS A 1 66  ? 14.343  54.525  50.561  1.00 90.19  ? 66  LYS A CG    1 
ATOM   510  C  CD    . LYS A 1 66  ? 13.876  55.041  51.918  1.00 91.04  ? 66  LYS A CD    1 
ATOM   511  C  CE    . LYS A 1 66  ? 14.966  55.839  52.616  1.00 90.72  ? 66  LYS A CE    1 
ATOM   512  N  NZ    . LYS A 1 66  ? 16.274  55.129  52.632  1.00 93.34  ? 66  LYS A NZ    1 
ATOM   513  N  N     . ILE A 1 67  ? 11.430  54.669  47.272  1.00 81.84  ? 67  ILE A N     1 
ATOM   514  C  CA    . ILE A 1 67  ? 10.061  54.520  46.764  1.00 80.18  ? 67  ILE A CA    1 
ATOM   515  C  C     . ILE A 1 67  ? 10.049  53.743  45.442  1.00 82.04  ? 67  ILE A C     1 
ATOM   516  O  O     . ILE A 1 67  ? 9.184   52.886  45.244  1.00 83.25  ? 67  ILE A O     1 
ATOM   517  C  CB    . ILE A 1 67  ? 9.332   55.885  46.629  1.00 77.65  ? 67  ILE A CB    1 
ATOM   518  C  CG1   . ILE A 1 67  ? 9.121   56.518  48.012  1.00 76.50  ? 67  ILE A CG1   1 
ATOM   519  C  CG2   . ILE A 1 67  ? 7.972   55.719  45.946  1.00 76.78  ? 67  ILE A CG2   1 
ATOM   520  C  CD1   . ILE A 1 67  ? 8.652   57.961  47.974  1.00 74.13  ? 67  ILE A CD1   1 
ATOM   521  N  N     . LEU A 1 68  ? 11.001  54.029  44.551  1.00 82.01  ? 68  LEU A N     1 
ATOM   522  C  CA    . LEU A 1 68  ? 11.256  53.154  43.397  1.00 84.73  ? 68  LEU A CA    1 
ATOM   523  C  C     . LEU A 1 68  ? 12.745  53.151  43.011  1.00 85.62  ? 68  LEU A C     1 
ATOM   524  O  O     . LEU A 1 68  ? 13.222  54.039  42.313  1.00 83.27  ? 68  LEU A O     1 
ATOM   525  C  CB    . LEU A 1 68  ? 10.331  53.497  42.220  1.00 85.37  ? 68  LEU A CB    1 
ATOM   526  C  CG    . LEU A 1 68  ? 10.671  54.557  41.164  1.00 84.21  ? 68  LEU A CG    1 
ATOM   527  C  CD1   . LEU A 1 68  ? 11.313  53.924  39.941  1.00 86.54  ? 68  LEU A CD1   1 
ATOM   528  C  CD2   . LEU A 1 68  ? 9.420   55.291  40.720  1.00 83.19  ? 68  LEU A CD2   1 
ATOM   529  N  N     . PRO A 1 69  ? 13.495  52.143  43.488  1.00 89.82  ? 69  PRO A N     1 
ATOM   530  C  CA    . PRO A 1 69  ? 14.930  52.087  43.185  1.00 91.48  ? 69  PRO A CA    1 
ATOM   531  C  C     . PRO A 1 69  ? 15.263  51.711  41.731  1.00 92.39  ? 69  PRO A C     1 
ATOM   532  O  O     . PRO A 1 69  ? 16.409  51.851  41.302  1.00 91.78  ? 69  PRO A O     1 
ATOM   533  C  CB    . PRO A 1 69  ? 15.455  51.002  44.140  1.00 94.97  ? 69  PRO A CB    1 
ATOM   534  C  CG    . PRO A 1 69  ? 14.295  50.567  44.984  1.00 95.42  ? 69  PRO A CG    1 
ATOM   535  C  CD    . PRO A 1 69  ? 13.054  50.981  44.273  1.00 92.24  ? 69  PRO A CD    1 
ATOM   536  N  N     . ASN A 1 70  ? 14.268  51.254  40.982  1.00 93.58  ? 70  ASN A N     1 
ATOM   537  C  CA    . ASN A 1 70  ? 14.486  50.742  39.632  1.00 95.43  ? 70  ASN A CA    1 
ATOM   538  C  C     . ASN A 1 70  ? 14.818  51.785  38.557  1.00 92.13  ? 70  ASN A C     1 
ATOM   539  O  O     . ASN A 1 70  ? 15.424  51.438  37.535  1.00 95.61  ? 70  ASN A O     1 
ATOM   540  C  CB    . ASN A 1 70  ? 13.258  49.946  39.199  1.00 97.16  ? 70  ASN A CB    1 
ATOM   541  C  CG    . ASN A 1 70  ? 13.010  48.749  40.090  1.00 99.72  ? 70  ASN A CG    1 
ATOM   542  O  OD1   . ASN A 1 70  ? 13.775  47.786  40.068  1.00 99.66  ? 70  ASN A OD1   1 
ATOM   543  N  ND2   . ASN A 1 70  ? 11.941  48.805  40.885  1.00 100.26 ? 70  ASN A ND2   1 
ATOM   544  N  N     . ALA A 1 71  ? 14.448  53.048  38.784  1.00 84.36  ? 71  ALA A N     1 
ATOM   545  C  CA    . ALA A 1 71  ? 14.510  54.059  37.724  1.00 79.32  ? 71  ALA A CA    1 
ATOM   546  C  C     . ALA A 1 71  ? 15.933  54.474  37.389  1.00 77.42  ? 71  ALA A C     1 
ATOM   547  O  O     . ALA A 1 71  ? 16.867  54.236  38.162  1.00 76.66  ? 71  ALA A O     1 
ATOM   548  C  CB    . ALA A 1 71  ? 13.687  55.284  38.093  1.00 77.27  ? 71  ALA A CB    1 
ATOM   549  N  N     . VAL A 1 72  ? 16.080  55.102  36.224  1.00 74.08  ? 72  VAL A N     1 
ATOM   550  C  CA    . VAL A 1 72  ? 17.365  55.666  35.805  1.00 72.77  ? 72  VAL A CA    1 
ATOM   551  C  C     . VAL A 1 72  ? 17.467  57.106  36.334  1.00 69.95  ? 72  VAL A C     1 
ATOM   552  O  O     . VAL A 1 72  ? 16.567  57.940  36.110  1.00 66.64  ? 72  VAL A O     1 
ATOM   553  C  CB    . VAL A 1 72  ? 17.592  55.570  34.269  1.00 73.15  ? 72  VAL A CB    1 
ATOM   554  C  CG1   . VAL A 1 72  ? 16.324  55.857  33.492  1.00 73.33  ? 72  VAL A CG1   1 
ATOM   555  C  CG2   . VAL A 1 72  ? 18.708  56.494  33.807  1.00 72.24  ? 72  VAL A CG2   1 
ATOM   556  N  N     . TYR A 1 73  ? 18.546  57.378  37.065  1.00 68.22  ? 73  TYR A N     1 
ATOM   557  C  CA    . TYR A 1 73  ? 18.761  58.680  37.683  1.00 66.15  ? 73  TYR A CA    1 
ATOM   558  C  C     . TYR A 1 73  ? 19.924  59.385  36.997  1.00 66.37  ? 73  TYR A C     1 
ATOM   559  O  O     . TYR A 1 73  ? 21.010  58.828  36.907  1.00 70.12  ? 73  TYR A O     1 
ATOM   560  C  CB    . TYR A 1 73  ? 19.030  58.504  39.175  1.00 65.59  ? 73  TYR A CB    1 
ATOM   561  C  CG    . TYR A 1 73  ? 17.837  57.949  39.934  1.00 66.02  ? 73  TYR A CG    1 
ATOM   562  C  CD1   . TYR A 1 73  ? 17.590  56.578  39.984  1.00 67.96  ? 73  TYR A CD1   1 
ATOM   563  C  CD2   . TYR A 1 73  ? 16.950  58.798  40.601  1.00 63.71  ? 73  TYR A CD2   1 
ATOM   564  C  CE1   . TYR A 1 73  ? 16.501  56.068  40.681  1.00 68.20  ? 73  TYR A CE1   1 
ATOM   565  C  CE2   . TYR A 1 73  ? 15.857  58.298  41.301  1.00 63.47  ? 73  TYR A CE2   1 
ATOM   566  C  CZ    . TYR A 1 73  ? 15.631  56.932  41.338  1.00 66.60  ? 73  TYR A CZ    1 
ATOM   567  O  OH    . TYR A 1 73  ? 14.539  56.439  42.035  1.00 65.90  ? 73  TYR A OH    1 
ATOM   568  N  N     . LEU A 1 74  ? 19.687  60.594  36.485  1.00 65.93  ? 74  LEU A N     1 
ATOM   569  C  CA    . LEU A 1 74  ? 20.722  61.372  35.783  1.00 65.97  ? 74  LEU A CA    1 
ATOM   570  C  C     . LEU A 1 74  ? 20.984  62.735  36.441  1.00 62.70  ? 74  LEU A C     1 
ATOM   571  O  O     . LEU A 1 74  ? 20.190  63.189  37.260  1.00 58.19  ? 74  LEU A O     1 
ATOM   572  C  CB    . LEU A 1 74  ? 20.338  61.609  34.315  1.00 66.82  ? 74  LEU A CB    1 
ATOM   573  C  CG    . LEU A 1 74  ? 20.064  60.420  33.380  1.00 70.22  ? 74  LEU A CG    1 
ATOM   574  C  CD1   . LEU A 1 74  ? 20.987  59.229  33.654  1.00 71.83  ? 74  LEU A CD1   1 
ATOM   575  C  CD2   . LEU A 1 74  ? 18.602  60.010  33.442  1.00 69.62  ? 74  LEU A CD2   1 
ATOM   576  N  N     . PRO A 1 75  ? 22.109  63.381  36.073  1.00 63.53  ? 75  PRO A N     1 
ATOM   577  C  CA    . PRO A 1 75  ? 22.478  64.675  36.615  1.00 61.72  ? 75  PRO A CA    1 
ATOM   578  C  C     . PRO A 1 75  ? 22.141  65.831  35.686  1.00 61.50  ? 75  PRO A C     1 
ATOM   579  O  O     . PRO A 1 75  ? 21.934  65.639  34.495  1.00 61.44  ? 75  PRO A O     1 
ATOM   580  C  CB    . PRO A 1 75  ? 24.012  64.563  36.783  1.00 62.27  ? 75  PRO A CB    1 
ATOM   581  C  CG    . PRO A 1 75  ? 24.444  63.399  35.928  1.00 65.14  ? 75  PRO A CG    1 
ATOM   582  C  CD    . PRO A 1 75  ? 23.219  62.819  35.271  1.00 66.05  ? 75  PRO A CD    1 
ATOM   583  N  N     . MET A 1 76  ? 22.116  67.031  36.251  1.00 62.70  ? 76  MET A N     1 
ATOM   584  C  CA    . MET A 1 76  ? 21.835  68.251  35.498  1.00 63.94  ? 76  MET A CA    1 
ATOM   585  C  C     . MET A 1 76  ? 22.839  68.532  34.396  1.00 66.38  ? 76  MET A C     1 
ATOM   586  O  O     . MET A 1 76  ? 24.043  68.431  34.607  1.00 71.18  ? 76  MET A O     1 
ATOM   587  C  CB    . MET A 1 76  ? 21.831  69.448  36.445  1.00 62.61  ? 76  MET A CB    1 
ATOM   588  C  CG    . MET A 1 76  ? 20.635  69.458  37.367  1.00 62.12  ? 76  MET A CG    1 
ATOM   589  S  SD    . MET A 1 76  ? 19.185  70.133  36.550  1.00 60.19  ? 76  MET A SD    1 
ATOM   590  C  CE    . MET A 1 76  ? 19.539  71.887  36.700  1.00 57.23  ? 76  MET A CE    1 
ATOM   591  N  N     . ARG A 1 77  ? 22.331  68.880  33.222  1.00 67.06  ? 77  ARG A N     1 
ATOM   592  C  CA    . ARG A 1 77  ? 23.131  69.499  32.178  1.00 70.24  ? 77  ARG A CA    1 
ATOM   593  C  C     . ARG A 1 77  ? 22.487  70.833  31.830  1.00 67.76  ? 77  ARG A C     1 
ATOM   594  O  O     . ARG A 1 77  ? 22.132  71.082  30.679  1.00 69.13  ? 77  ARG A O     1 
ATOM   595  C  CB    . ARG A 1 77  ? 23.199  68.616  30.934  1.00 75.15  ? 77  ARG A CB    1 
ATOM   596  C  CG    . ARG A 1 77  ? 23.870  67.266  31.123  1.00 78.49  ? 77  ARG A CG    1 
ATOM   597  C  CD    . ARG A 1 77  ? 23.426  66.315  30.017  1.00 82.27  ? 77  ARG A CD    1 
ATOM   598  N  NE    . ARG A 1 77  ? 23.757  64.918  30.285  1.00 86.25  ? 77  ARG A NE    1 
ATOM   599  C  CZ    . ARG A 1 77  ? 23.174  64.147  31.207  1.00 85.90  ? 77  ARG A CZ    1 
ATOM   600  N  NH1   . ARG A 1 77  ? 22.218  64.620  32.004  1.00 82.13  ? 77  ARG A NH1   1 
ATOM   601  N  NH2   . ARG A 1 77  ? 23.566  62.884  31.344  1.00 89.46  ? 77  ARG A NH2   1 
ATOM   602  N  N     . LYS A 1 78  ? 22.339  71.689  32.836  1.00 66.25  ? 78  LYS A N     1 
ATOM   603  C  CA    . LYS A 1 78  ? 21.719  73.010  32.664  1.00 65.56  ? 78  LYS A CA    1 
ATOM   604  C  C     . LYS A 1 78  ? 22.069  73.658  31.318  1.00 63.85  ? 78  LYS A C     1 
ATOM   605  O  O     . LYS A 1 78  ? 21.196  74.203  30.633  1.00 60.85  ? 78  LYS A O     1 
ATOM   606  C  CB    . LYS A 1 78  ? 22.127  73.945  33.810  1.00 65.83  ? 78  LYS A CB    1 
ATOM   607  C  CG    . LYS A 1 78  ? 21.217  75.159  34.011  1.00 66.81  ? 78  LYS A CG    1 
ATOM   608  C  CD    . LYS A 1 78  ? 19.823  74.770  34.501  1.00 66.33  ? 78  LYS A CD    1 
ATOM   609  C  CE    . LYS A 1 78  ? 19.335  75.642  35.649  1.00 65.69  ? 78  LYS A CE    1 
ATOM   610  N  NZ    . LYS A 1 78  ? 19.089  77.048  35.228  1.00 66.06  ? 78  LYS A NZ    1 
ATOM   611  N  N     . GLU A 1 79  ? 23.338  73.572  30.934  1.00 62.02  ? 79  GLU A N     1 
ATOM   612  C  CA    . GLU A 1 79  ? 23.795  74.177  29.688  1.00 62.81  ? 79  GLU A CA    1 
ATOM   613  C  C     . GLU A 1 79  ? 23.174  73.537  28.451  1.00 60.95  ? 79  GLU A C     1 
ATOM   614  O  O     . GLU A 1 79  ? 22.784  74.250  27.528  1.00 60.70  ? 79  GLU A O     1 
ATOM   615  C  CB    . GLU A 1 79  ? 25.325  74.162  29.597  1.00 65.67  ? 79  GLU A CB    1 
ATOM   616  C  CG    . GLU A 1 79  ? 25.980  75.224  30.474  1.00 66.50  ? 79  GLU A CG    1 
ATOM   617  C  CD    . GLU A 1 79  ? 27.471  75.389  30.202  1.00 70.27  ? 79  GLU A CD    1 
ATOM   618  O  OE1   . GLU A 1 79  ? 27.889  75.402  29.018  1.00 73.54  ? 79  GLU A OE1   1 
ATOM   619  O  OE2   . GLU A 1 79  ? 28.233  75.514  31.180  1.00 69.97  ? 79  GLU A OE2   1 
ATOM   620  N  N     . VAL A 1 80  ? 23.084  72.208  28.433  1.00 60.33  ? 80  VAL A N     1 
ATOM   621  C  CA    . VAL A 1 80  ? 22.428  71.489  27.334  1.00 62.03  ? 80  VAL A CA    1 
ATOM   622  C  C     . VAL A 1 80  ? 20.921  71.814  27.308  1.00 60.74  ? 80  VAL A C     1 
ATOM   623  O  O     . VAL A 1 80  ? 20.351  72.116  26.255  1.00 59.66  ? 80  VAL A O     1 
ATOM   624  C  CB    . VAL A 1 80  ? 22.638  69.957  27.441  1.00 64.12  ? 80  VAL A CB    1 
ATOM   625  C  CG1   . VAL A 1 80  ? 21.694  69.206  26.514  1.00 66.12  ? 80  VAL A CG1   1 
ATOM   626  C  CG2   . VAL A 1 80  ? 24.079  69.579  27.117  1.00 66.48  ? 80  VAL A CG2   1 
ATOM   627  N  N     . TYR A 1 81  ? 20.284  71.766  28.474  1.00 59.47  ? 81  TYR A N     1 
ATOM   628  C  CA    . TYR A 1 81  ? 18.883  72.154  28.582  1.00 56.82  ? 81  TYR A CA    1 
ATOM   629  C  C     . TYR A 1 81  ? 18.683  73.586  28.080  1.00 55.51  ? 81  TYR A C     1 
ATOM   630  O  O     . TYR A 1 81  ? 17.684  73.870  27.424  1.00 52.37  ? 81  TYR A O     1 
ATOM   631  C  CB    . TYR A 1 81  ? 18.378  72.004  30.021  1.00 55.61  ? 81  TYR A CB    1 
ATOM   632  C  CG    . TYR A 1 81  ? 18.646  70.645  30.644  1.00 57.25  ? 81  TYR A CG    1 
ATOM   633  C  CD1   . TYR A 1 81  ? 18.696  69.481  29.865  1.00 60.97  ? 81  TYR A CD1   1 
ATOM   634  C  CD2   . TYR A 1 81  ? 18.836  70.519  32.018  1.00 57.27  ? 81  TYR A CD2   1 
ATOM   635  C  CE1   . TYR A 1 81  ? 18.935  68.239  30.436  1.00 61.86  ? 81  TYR A CE1   1 
ATOM   636  C  CE2   . TYR A 1 81  ? 19.076  69.281  32.602  1.00 59.08  ? 81  TYR A CE2   1 
ATOM   637  C  CZ    . TYR A 1 81  ? 19.131  68.142  31.807  1.00 61.43  ? 81  TYR A CZ    1 
ATOM   638  O  OH    . TYR A 1 81  ? 19.385  66.913  32.389  1.00 63.47  ? 81  TYR A OH    1 
ATOM   639  N  N     . GLN A 1 82  ? 19.657  74.464  28.347  1.00 55.91  ? 82  GLN A N     1 
ATOM   640  C  CA    . GLN A 1 82  ? 19.560  75.888  27.984  1.00 55.36  ? 82  GLN A CA    1 
ATOM   641  C  C     . GLN A 1 82  ? 19.682  76.088  26.490  1.00 57.65  ? 82  GLN A C     1 
ATOM   642  O  O     . GLN A 1 82  ? 19.025  76.963  25.928  1.00 60.96  ? 82  GLN A O     1 
ATOM   643  C  CB    . GLN A 1 82  ? 20.632  76.733  28.707  1.00 54.67  ? 82  GLN A CB    1 
ATOM   644  C  CG    . GLN A 1 82  ? 20.512  78.245  28.497  1.00 54.29  ? 82  GLN A CG    1 
ATOM   645  C  CD    . GLN A 1 82  ? 19.156  78.813  28.918  1.00 54.40  ? 82  GLN A CD    1 
ATOM   646  O  OE1   . GLN A 1 82  ? 18.487  79.500  28.144  1.00 53.10  ? 82  GLN A OE1   1 
ATOM   647  N  NE2   . GLN A 1 82  ? 18.745  78.525  30.153  1.00 53.61  ? 82  GLN A NE2   1 
ATOM   648  N  N     . GLN A 1 83  ? 20.523  75.291  25.838  1.00 58.68  ? 83  GLN A N     1 
ATOM   649  C  CA    . GLN A 1 83  ? 20.612  75.356  24.382  1.00 58.87  ? 83  GLN A CA    1 
ATOM   650  C  C     . GLN A 1 83  ? 19.276  74.976  23.729  1.00 56.47  ? 83  GLN A C     1 
ATOM   651  O  O     . GLN A 1 83  ? 18.777  75.702  22.873  1.00 55.53  ? 83  GLN A O     1 
ATOM   652  C  CB    . GLN A 1 83  ? 21.758  74.488  23.866  1.00 62.48  ? 83  GLN A CB    1 
ATOM   653  C  CG    . GLN A 1 83  ? 23.125  75.118  24.104  1.00 63.76  ? 83  GLN A CG    1 
ATOM   654  C  CD    . GLN A 1 83  ? 24.273  74.199  23.754  1.00 67.16  ? 83  GLN A CD    1 
ATOM   655  O  OE1   . GLN A 1 83  ? 24.085  72.999  23.548  1.00 70.70  ? 83  GLN A OE1   1 
ATOM   656  N  NE2   . GLN A 1 83  ? 25.478  74.759  23.683  1.00 68.05  ? 83  GLN A NE2   1 
ATOM   657  N  N     . VAL A 1 84  ? 18.692  73.858  24.151  1.00 53.87  ? 84  VAL A N     1 
ATOM   658  C  CA    . VAL A 1 84  ? 17.365  73.463  23.660  1.00 54.07  ? 84  VAL A CA    1 
ATOM   659  C  C     . VAL A 1 84  ? 16.323  74.537  23.948  1.00 50.81  ? 84  VAL A C     1 
ATOM   660  O  O     . VAL A 1 84  ? 15.535  74.920  23.083  1.00 50.72  ? 84  VAL A O     1 
ATOM   661  C  CB    . VAL A 1 84  ? 16.877  72.144  24.291  1.00 53.68  ? 84  VAL A CB    1 
ATOM   662  C  CG1   . VAL A 1 84  ? 15.469  71.832  23.804  1.00 53.84  ? 84  VAL A CG1   1 
ATOM   663  C  CG2   . VAL A 1 84  ? 17.837  70.996  23.954  1.00 56.56  ? 84  VAL A CG2   1 
ATOM   664  N  N     . SER A 1 85  ? 16.325  75.003  25.185  1.00 48.85  ? 85  SER A N     1 
ATOM   665  C  CA    . SER A 1 85  ? 15.404  76.029  25.626  1.00 47.51  ? 85  SER A CA    1 
ATOM   666  C  C     . SER A 1 85  ? 15.492  77.266  24.738  1.00 48.55  ? 85  SER A C     1 
ATOM   667  O  O     . SER A 1 85  ? 14.476  77.742  24.195  1.00 48.87  ? 85  SER A O     1 
ATOM   668  C  CB    . SER A 1 85  ? 15.713  76.406  27.073  1.00 44.56  ? 85  SER A CB    1 
ATOM   669  O  OG    . SER A 1 85  ? 14.875  77.455  27.481  1.00 43.69  ? 85  SER A OG    1 
ATOM   670  N  N     . SER A 1 86  ? 16.714  77.772  24.598  1.00 48.09  ? 86  SER A N     1 
ATOM   671  C  CA    . SER A 1 86  ? 16.988  78.975  23.815  1.00 49.97  ? 86  SER A CA    1 
ATOM   672  C  C     . SER A 1 86  ? 16.524  78.854  22.374  1.00 51.56  ? 86  SER A C     1 
ATOM   673  O  O     . SER A 1 86  ? 15.981  79.805  21.806  1.00 52.52  ? 86  SER A O     1 
ATOM   674  C  CB    . SER A 1 86  ? 18.493  79.282  23.844  1.00 51.07  ? 86  SER A CB    1 
ATOM   675  O  OG    . SER A 1 86  ? 18.960  79.262  25.189  1.00 50.86  ? 86  SER A OG    1 
ATOM   676  N  N     . ARG A 1 87  ? 16.736  77.687  21.780  1.00 52.78  ? 87  ARG A N     1 
ATOM   677  C  CA    . ARG A 1 87  ? 16.289  77.464  20.406  1.00 55.14  ? 87  ARG A CA    1 
ATOM   678  C  C     . ARG A 1 87  ? 14.761  77.486  20.328  1.00 53.12  ? 87  ARG A C     1 
ATOM   679  O  O     . ARG A 1 87  ? 14.185  78.142  19.463  1.00 53.19  ? 87  ARG A O     1 
ATOM   680  C  CB    . ARG A 1 87  ? 16.844  76.148  19.844  1.00 58.23  ? 87  ARG A CB    1 
ATOM   681  C  CG    . ARG A 1 87  ? 18.327  76.199  19.491  1.00 60.22  ? 87  ARG A CG    1 
ATOM   682  C  CD    . ARG A 1 87  ? 18.699  75.129  18.479  1.00 63.87  ? 87  ARG A CD    1 
ATOM   683  N  NE    . ARG A 1 87  ? 18.419  73.785  18.979  1.00 64.53  ? 87  ARG A NE    1 
ATOM   684  C  CZ    . ARG A 1 87  ? 19.228  73.071  19.763  1.00 64.12  ? 87  ARG A CZ    1 
ATOM   685  N  NH1   . ARG A 1 87  ? 20.404  73.551  20.159  1.00 64.50  ? 87  ARG A NH1   1 
ATOM   686  N  NH2   . ARG A 1 87  ? 18.856  71.855  20.156  1.00 63.93  ? 87  ARG A NH2   1 
ATOM   687  N  N     . ILE A 1 88  ? 14.110  76.789  21.254  1.00 51.05  ? 88  ILE A N     1 
ATOM   688  C  CA    . ILE A 1 88  ? 12.649  76.780  21.307  1.00 49.55  ? 88  ILE A CA    1 
ATOM   689  C  C     . ILE A 1 88  ? 12.093  78.197  21.479  1.00 48.90  ? 88  ILE A C     1 
ATOM   690  O  O     . ILE A 1 88  ? 11.121  78.545  20.825  1.00 51.09  ? 88  ILE A O     1 
ATOM   691  C  CB    . ILE A 1 88  ? 12.120  75.845  22.407  1.00 47.78  ? 88  ILE A CB    1 
ATOM   692  C  CG1   . ILE A 1 88  ? 12.446  74.397  22.044  1.00 48.85  ? 88  ILE A CG1   1 
ATOM   693  C  CG2   . ILE A 1 88  ? 10.609  75.999  22.564  1.00 46.57  ? 88  ILE A CG2   1 
ATOM   694  C  CD1   . ILE A 1 88  ? 12.213  73.421  23.172  1.00 48.04  ? 88  ILE A CD1   1 
ATOM   695  N  N     . MET A 1 89  ? 12.721  79.023  22.317  1.00 49.00  ? 89  MET A N     1 
ATOM   696  C  CA    . MET A 1 89  ? 12.297  80.425  22.450  1.00 48.37  ? 89  MET A CA    1 
ATOM   697  C  C     . MET A 1 89  ? 12.364  81.162  21.125  1.00 50.70  ? 89  MET A C     1 
ATOM   698  O  O     . MET A 1 89  ? 11.433  81.885  20.771  1.00 51.84  ? 89  MET A O     1 
ATOM   699  C  CB    . MET A 1 89  ? 13.130  81.185  23.490  1.00 46.62  ? 89  MET A CB    1 
ATOM   700  C  CG    . MET A 1 89  ? 12.934  80.744  24.932  1.00 43.73  ? 89  MET A CG    1 
ATOM   701  S  SD    . MET A 1 89  ? 11.224  80.360  25.407  1.00 42.00  ? 89  MET A SD    1 
ATOM   702  C  CE    . MET A 1 89  ? 11.578  79.429  26.895  1.00 40.55  ? 89  MET A CE    1 
ATOM   703  N  N     . ASN A 1 90  ? 13.458  80.973  20.393  1.00 53.94  ? 90  ASN A N     1 
ATOM   704  C  CA    . ASN A 1 90  ? 13.588  81.556  19.058  1.00 55.96  ? 90  ASN A CA    1 
ATOM   705  C  C     . ASN A 1 90  ? 12.495  81.102  18.084  1.00 54.77  ? 90  ASN A C     1 
ATOM   706  O  O     . ASN A 1 90  ? 11.989  81.907  17.311  1.00 53.98  ? 90  ASN A O     1 
ATOM   707  C  CB    . ASN A 1 90  ? 14.984  81.290  18.474  1.00 60.37  ? 90  ASN A CB    1 
ATOM   708  C  CG    . ASN A 1 90  ? 16.046  82.208  19.063  1.00 63.09  ? 90  ASN A CG    1 
ATOM   709  O  OD1   . ASN A 1 90  ? 15.765  83.356  19.407  1.00 65.27  ? 90  ASN A OD1   1 
ATOM   710  N  ND2   . ASN A 1 90  ? 17.274  81.708  19.173  1.00 64.78  ? 90  ASN A ND2   1 
ATOM   711  N  N     . LEU A 1 91  ? 12.118  79.828  18.123  1.00 53.94  ? 91  LEU A N     1 
ATOM   712  C  CA    . LEU A 1 91  ? 10.958  79.376  17.336  1.00 54.36  ? 91  LEU A CA    1 
ATOM   713  C  C     . LEU A 1 91  ? 9.676   80.114  17.727  1.00 53.26  ? 91  LEU A C     1 
ATOM   714  O  O     . LEU A 1 91  ? 8.866   80.436  16.853  1.00 53.83  ? 91  LEU A O     1 
ATOM   715  C  CB    . LEU A 1 91  ? 10.735  77.872  17.469  1.00 54.16  ? 91  LEU A CB    1 
ATOM   716  C  CG    . LEU A 1 91  ? 11.845  76.972  16.922  1.00 56.97  ? 91  LEU A CG    1 
ATOM   717  C  CD1   . LEU A 1 91  ? 11.528  75.525  17.254  1.00 57.10  ? 91  LEU A CD1   1 
ATOM   718  C  CD2   . LEU A 1 91  ? 12.056  77.140  15.417  1.00 59.27  ? 91  LEU A CD2   1 
ATOM   719  N  N     . LEU A 1 92  ? 9.493   80.382  19.028  1.00 51.38  ? 92  LEU A N     1 
ATOM   720  C  CA    . LEU A 1 92  ? 8.284   81.062  19.511  1.00 50.12  ? 92  LEU A CA    1 
ATOM   721  C  C     . LEU A 1 92  ? 8.243   82.509  19.051  1.00 51.78  ? 92  LEU A C     1 
ATOM   722  O  O     . LEU A 1 92  ? 7.180   83.035  18.738  1.00 50.91  ? 92  LEU A O     1 
ATOM   723  C  CB    . LEU A 1 92  ? 8.183   81.001  21.036  1.00 47.89  ? 92  LEU A CB    1 
ATOM   724  C  CG    . LEU A 1 92  ? 7.957   79.609  21.642  1.00 48.15  ? 92  LEU A CG    1 
ATOM   725  C  CD1   . LEU A 1 92  ? 7.938   79.692  23.169  1.00 46.38  ? 92  LEU A CD1   1 
ATOM   726  C  CD2   . LEU A 1 92  ? 6.678   78.961  21.114  1.00 47.46  ? 92  LEU A CD2   1 
ATOM   727  N  N     . ARG A 1 93  ? 9.409   83.147  19.018  1.00 55.45  ? 93  ARG A N     1 
ATOM   728  C  CA    . ARG A 1 93  ? 9.551   84.487  18.438  1.00 58.45  ? 93  ARG A CA    1 
ATOM   729  C  C     . ARG A 1 93  ? 8.950   84.586  17.031  1.00 59.40  ? 93  ARG A C     1 
ATOM   730  O  O     . ARG A 1 93  ? 8.387   85.615  16.673  1.00 60.74  ? 93  ARG A O     1 
ATOM   731  C  CB    . ARG A 1 93  ? 11.025  84.910  18.418  1.00 61.71  ? 93  ARG A CB    1 
ATOM   732  C  CG    . ARG A 1 93  ? 11.470  85.678  19.650  1.00 61.49  ? 93  ARG A CG    1 
ATOM   733  C  CD    . ARG A 1 93  ? 12.973  85.956  19.630  1.00 64.64  ? 93  ARG A CD    1 
ATOM   734  N  NE    . ARG A 1 93  ? 13.726  85.085  20.543  1.00 63.87  ? 93  ARG A NE    1 
ATOM   735  C  CZ    . ARG A 1 93  ? 13.793  85.247  21.863  1.00 63.09  ? 93  ARG A CZ    1 
ATOM   736  N  NH1   . ARG A 1 93  ? 13.162  86.258  22.456  1.00 63.72  ? 93  ARG A NH1   1 
ATOM   737  N  NH2   . ARG A 1 93  ? 14.496  84.389  22.600  1.00 63.40  ? 93  ARG A NH2   1 
ATOM   738  N  N     . GLU A 1 94  ? 9.031   83.508  16.254  1.00 60.09  ? 94  GLU A N     1 
ATOM   739  C  CA    . GLU A 1 94  ? 8.454   83.490  14.899  1.00 62.95  ? 94  GLU A CA    1 
ATOM   740  C  C     . GLU A 1 94  ? 6.963   83.810  14.915  1.00 60.52  ? 94  GLU A C     1 
ATOM   741  O  O     . GLU A 1 94  ? 6.452   84.481  14.020  1.00 61.81  ? 94  GLU A O     1 
ATOM   742  C  CB    . GLU A 1 94  ? 8.662   82.125  14.219  1.00 65.95  ? 94  GLU A CB    1 
ATOM   743  C  CG    . GLU A 1 94  ? 10.115  81.673  14.088  1.00 68.67  ? 94  GLU A CG    1 
ATOM   744  C  CD    . GLU A 1 94  ? 10.885  82.487  13.077  1.00 73.24  ? 94  GLU A CD    1 
ATOM   745  O  OE1   . GLU A 1 94  ? 10.586  82.367  11.870  1.00 79.42  ? 94  GLU A OE1   1 
ATOM   746  O  OE2   . GLU A 1 94  ? 11.789  83.243  13.482  1.00 74.75  ? 94  GLU A OE2   1 
ATOM   747  N  N     . TYR A 1 95  ? 6.272   83.331  15.940  1.00 56.75  ? 95  TYR A N     1 
ATOM   748  C  CA    . TYR A 1 95  ? 4.829   83.512  16.042  1.00 55.43  ? 95  TYR A CA    1 
ATOM   749  C  C     . TYR A 1 95  ? 4.435   84.839  16.681  1.00 52.77  ? 95  TYR A C     1 
ATOM   750  O  O     . TYR A 1 95  ? 3.343   85.336  16.436  1.00 51.80  ? 95  TYR A O     1 
ATOM   751  C  CB    . TYR A 1 95  ? 4.203   82.336  16.797  1.00 54.15  ? 95  TYR A CB    1 
ATOM   752  C  CG    . TYR A 1 95  ? 4.419   81.016  16.081  1.00 55.93  ? 95  TYR A CG    1 
ATOM   753  C  CD1   . TYR A 1 95  ? 3.582   80.617  15.053  1.00 57.07  ? 95  TYR A CD1   1 
ATOM   754  C  CD2   . TYR A 1 95  ? 5.487   80.183  16.422  1.00 56.50  ? 95  TYR A CD2   1 
ATOM   755  C  CE1   . TYR A 1 95  ? 3.782   79.416  14.395  1.00 59.10  ? 95  TYR A CE1   1 
ATOM   756  C  CE2   . TYR A 1 95  ? 5.695   78.984  15.768  1.00 57.01  ? 95  TYR A CE2   1 
ATOM   757  C  CZ    . TYR A 1 95  ? 4.843   78.606  14.762  1.00 59.09  ? 95  TYR A CZ    1 
ATOM   758  O  OH    . TYR A 1 95  ? 5.060   77.413  14.114  1.00 62.17  ? 95  TYR A OH    1 
ATOM   759  N  N     . SER A 1 96  ? 5.317   85.430  17.478  1.00 51.46  ? 96  SER A N     1 
ATOM   760  C  CA    . SER A 1 96  ? 5.027   86.738  18.052  1.00 50.66  ? 96  SER A CA    1 
ATOM   761  C  C     . SER A 1 96  ? 6.280   87.389  18.595  1.00 51.83  ? 96  SER A C     1 
ATOM   762  O  O     . SER A 1 96  ? 7.089   86.746  19.274  1.00 50.45  ? 96  SER A O     1 
ATOM   763  C  CB    . SER A 1 96  ? 3.996   86.628  19.173  1.00 47.51  ? 96  SER A CB    1 
ATOM   764  O  OG    . SER A 1 96  ? 3.638   87.912  19.651  1.00 46.56  ? 96  SER A OG    1 
ATOM   765  N  N     . GLU A 1 97  ? 6.432   88.673  18.284  1.00 54.44  ? 97  GLU A N     1 
ATOM   766  C  CA    . GLU A 1 97  ? 7.544   89.469  18.790  1.00 55.01  ? 97  GLU A CA    1 
ATOM   767  C  C     . GLU A 1 97  ? 7.319   89.824  20.263  1.00 51.18  ? 97  GLU A C     1 
ATOM   768  O  O     . GLU A 1 97  ? 8.273   90.083  20.976  1.00 51.28  ? 97  GLU A O     1 
ATOM   769  C  CB    . GLU A 1 97  ? 7.755   90.728  17.917  1.00 59.61  ? 97  GLU A CB    1 
ATOM   770  C  CG    . GLU A 1 97  ? 6.772   91.889  18.124  1.00 61.50  ? 97  GLU A CG    1 
ATOM   771  C  CD    . GLU A 1 97  ? 5.419   91.736  17.432  1.00 64.19  ? 97  GLU A CD    1 
ATOM   772  O  OE1   . GLU A 1 97  ? 5.036   90.618  17.011  1.00 65.62  ? 97  GLU A OE1   1 
ATOM   773  O  OE2   . GLU A 1 97  ? 4.712   92.763  17.323  1.00 66.98  ? 97  GLU A OE2   1 
ATOM   774  N  N     . LYS A 1 98  ? 6.061   89.822  20.710  1.00 48.32  ? 98  LYS A N     1 
ATOM   775  C  CA    . LYS A 1 98  ? 5.735   90.101  22.105  1.00 45.48  ? 98  LYS A CA    1 
ATOM   776  C  C     . LYS A 1 98  ? 5.776   88.803  22.903  1.00 42.96  ? 98  LYS A C     1 
ATOM   777  O  O     . LYS A 1 98  ? 4.774   88.084  23.018  1.00 41.79  ? 98  LYS A O     1 
ATOM   778  C  CB    . LYS A 1 98  ? 4.377   90.782  22.234  1.00 44.96  ? 98  LYS A CB    1 
ATOM   779  C  CG    . LYS A 1 98  ? 4.333   92.162  21.596  1.00 47.16  ? 98  LYS A CG    1 
ATOM   780  C  CD    . LYS A 1 98  ? 2.925   92.734  21.530  1.00 47.13  ? 98  LYS A CD    1 
ATOM   781  C  CE    . LYS A 1 98  ? 2.923   94.065  20.790  1.00 49.77  ? 98  LYS A CE    1 
ATOM   782  N  NZ    . LYS A 1 98  ? 1.614   94.747  20.932  1.00 49.84  ? 98  LYS A NZ    1 
ATOM   783  N  N     . ILE A 1 99  ? 6.966   88.527  23.425  1.00 42.01  ? 99  ILE A N     1 
ATOM   784  C  CA    . ILE A 1 99  ? 7.281   87.307  24.159  1.00 41.34  ? 99  ILE A CA    1 
ATOM   785  C  C     . ILE A 1 99  ? 7.810   87.656  25.565  1.00 40.12  ? 99  ILE A C     1 
ATOM   786  O  O     . ILE A 1 99  ? 8.534   88.626  25.740  1.00 41.94  ? 99  ILE A O     1 
ATOM   787  C  CB    . ILE A 1 99  ? 8.320   86.432  23.404  1.00 42.20  ? 99  ILE A CB    1 
ATOM   788  C  CG1   . ILE A 1 99  ? 8.611   85.146  24.183  1.00 41.20  ? 99  ILE A CG1   1 
ATOM   789  C  CG2   . ILE A 1 99  ? 9.628   87.185  23.167  1.00 43.44  ? 99  ILE A CG2   1 
ATOM   790  C  CD1   . ILE A 1 99  ? 9.452   84.147  23.420  1.00 42.86  ? 99  ILE A CD1   1 
ATOM   791  N  N     . GLU A 1 100 ? 7.429   86.861  26.554  1.00 37.83  ? 100 GLU A N     1 
ATOM   792  C  CA    . GLU A 1 100 ? 7.960   86.983  27.904  1.00 35.90  ? 100 GLU A CA    1 
ATOM   793  C  C     . GLU A 1 100 ? 8.424   85.616  28.323  1.00 34.16  ? 100 GLU A C     1 
ATOM   794  O  O     . GLU A 1 100 ? 7.622   84.716  28.444  1.00 34.42  ? 100 GLU A O     1 
ATOM   795  C  CB    . GLU A 1 100 ? 6.901   87.486  28.883  1.00 35.50  ? 100 GLU A CB    1 
ATOM   796  C  CG    . GLU A 1 100 ? 7.392   87.505  30.333  1.00 36.32  ? 100 GLU A CG    1 
ATOM   797  C  CD    . GLU A 1 100 ? 6.439   88.185  31.287  1.00 36.41  ? 100 GLU A CD    1 
ATOM   798  O  OE1   . GLU A 1 100 ? 5.571   88.982  30.852  1.00 38.22  ? 100 GLU A OE1   1 
ATOM   799  O  OE2   . GLU A 1 100 ? 6.565   87.911  32.491  1.00 37.28  ? 100 GLU A OE2   1 
ATOM   800  N  N     . ILE A 1 101 ? 9.723   85.458  28.513  1.00 35.29  ? 101 ILE A N     1 
ATOM   801  C  CA    . ILE A 1 101 ? 10.303  84.189  28.940  1.00 36.02  ? 101 ILE A CA    1 
ATOM   802  C  C     . ILE A 1 101 ? 10.239  84.187  30.447  1.00 34.01  ? 101 ILE A C     1 
ATOM   803  O  O     . ILE A 1 101 ? 10.816  85.067  31.057  1.00 36.72  ? 101 ILE A O     1 
ATOM   804  C  CB    . ILE A 1 101 ? 11.768  84.071  28.495  1.00 37.70  ? 101 ILE A CB    1 
ATOM   805  C  CG1   . ILE A 1 101 ? 11.838  84.093  26.960  1.00 39.66  ? 101 ILE A CG1   1 
ATOM   806  C  CG2   . ILE A 1 101 ? 12.395  82.806  29.082  1.00 37.54  ? 101 ILE A CG2   1 
ATOM   807  C  CD1   . ILE A 1 101 ? 13.231  84.233  26.401  1.00 41.21  ? 101 ILE A CD1   1 
ATOM   808  N  N     . ALA A 1 102 ? 9.515   83.237  31.035  1.00 32.92  ? 102 ALA A N     1 
ATOM   809  C  CA    . ALA A 1 102 ? 9.304   83.199  32.490  1.00 32.36  ? 102 ALA A CA    1 
ATOM   810  C  C     . ALA A 1 102 ? 10.285  82.273  33.199  1.00 33.26  ? 102 ALA A C     1 
ATOM   811  O  O     . ALA A 1 102 ? 10.570  82.477  34.368  1.00 33.42  ? 102 ALA A O     1 
ATOM   812  C  CB    . ALA A 1 102 ? 7.890   82.777  32.813  1.00 31.24  ? 102 ALA A CB    1 
ATOM   813  N  N     . SER A 1 103 ? 10.763  81.241  32.500  1.00 33.74  ? 103 SER A N     1 
ATOM   814  C  CA    . SER A 1 103 ? 11.796  80.331  33.021  1.00 33.26  ? 103 SER A CA    1 
ATOM   815  C  C     . SER A 1 103 ? 12.321  79.502  31.862  1.00 35.15  ? 103 SER A C     1 
ATOM   816  O  O     . SER A 1 103 ? 11.783  79.564  30.761  1.00 34.39  ? 103 SER A O     1 
ATOM   817  C  CB    . SER A 1 103 ? 11.236  79.374  34.070  1.00 32.19  ? 103 SER A CB    1 
ATOM   818  O  OG    . SER A 1 103 ? 10.363  78.423  33.473  1.00 32.63  ? 103 SER A OG    1 
ATOM   819  N  N     . ILE A 1 104 ? 13.325  78.678  32.141  1.00 36.10  ? 104 ILE A N     1 
ATOM   820  C  CA    . ILE A 1 104 ? 13.951  77.822  31.133  1.00 38.18  ? 104 ILE A CA    1 
ATOM   821  C  C     . ILE A 1 104 ? 12.980  76.966  30.313  1.00 38.74  ? 104 ILE A C     1 
ATOM   822  O  O     . ILE A 1 104 ? 13.329  76.550  29.200  1.00 39.50  ? 104 ILE A O     1 
ATOM   823  C  CB    . ILE A 1 104 ? 15.008  76.896  31.772  1.00 39.36  ? 104 ILE A CB    1 
ATOM   824  C  CG1   . ILE A 1 104 ? 15.931  76.300  30.684  1.00 42.29  ? 104 ILE A CG1   1 
ATOM   825  C  CG2   . ILE A 1 104 ? 14.332  75.821  32.611  1.00 38.77  ? 104 ILE A CG2   1 
ATOM   826  C  CD1   . ILE A 1 104 ? 17.226  75.717  31.223  1.00 43.43  ? 104 ILE A CD1   1 
ATOM   827  N  N     . ASP A 1 105 ? 11.778  76.709  30.843  1.00 37.98  ? 105 ASP A N     1 
ATOM   828  C  CA    . ASP A 1 105 ? 10.783  75.868  30.146  1.00 40.36  ? 105 ASP A CA    1 
ATOM   829  C  C     . ASP A 1 105 ? 9.390   76.493  29.981  1.00 38.24  ? 105 ASP A C     1 
ATOM   830  O  O     . ASP A 1 105 ? 8.389   75.766  29.811  1.00 39.16  ? 105 ASP A O     1 
ATOM   831  C  CB    . ASP A 1 105 ? 10.660  74.517  30.869  1.00 43.76  ? 105 ASP A CB    1 
ATOM   832  C  CG    . ASP A 1 105 ? 10.262  74.659  32.343  1.00 45.99  ? 105 ASP A CG    1 
ATOM   833  O  OD1   . ASP A 1 105 ? 10.480  75.738  32.948  1.00 44.16  ? 105 ASP A OD1   1 
ATOM   834  O  OD2   . ASP A 1 105 ? 9.736   73.668  32.894  1.00 50.81  ? 105 ASP A OD2   1 
ATOM   835  N  N     . GLU A 1 106 ? 9.317   77.824  30.035  1.00 35.75  ? 106 GLU A N     1 
ATOM   836  C  CA    . GLU A 1 106 ? 8.040   78.535  30.007  1.00 34.32  ? 106 GLU A CA    1 
ATOM   837  C  C     . GLU A 1 106 ? 8.142   79.900  29.365  1.00 32.88  ? 106 GLU A C     1 
ATOM   838  O  O     . GLU A 1 106 ? 9.087   80.656  29.639  1.00 31.33  ? 106 GLU A O     1 
ATOM   839  C  CB    . GLU A 1 106 ? 7.516   78.773  31.422  1.00 34.66  ? 106 GLU A CB    1 
ATOM   840  C  CG    . GLU A 1 106 ? 7.142   77.522  32.164  1.00 36.05  ? 106 GLU A CG    1 
ATOM   841  C  CD    . GLU A 1 106 ? 6.813   77.774  33.618  1.00 36.80  ? 106 GLU A CD    1 
ATOM   842  O  OE1   . GLU A 1 106 ? 6.485   78.924  33.987  1.00 36.78  ? 106 GLU A OE1   1 
ATOM   843  O  OE2   . GLU A 1 106 ? 6.885   76.790  34.389  1.00 39.73  ? 106 GLU A OE2   1 
ATOM   844  N  N     . ALA A 1 107 ? 7.130   80.239  28.566  1.00 30.79  ? 107 ALA A N     1 
ATOM   845  C  CA    . ALA A 1 107 ? 7.048   81.562  27.960  1.00 30.35  ? 107 ALA A CA    1 
ATOM   846  C  C     . ALA A 1 107 ? 5.623   81.942  27.603  1.00 29.77  ? 107 ALA A C     1 
ATOM   847  O  O     . ALA A 1 107 ? 4.811   81.086  27.254  1.00 29.66  ? 107 ALA A O     1 
ATOM   848  C  CB    . ALA A 1 107 ? 7.917   81.618  26.720  1.00 31.75  ? 107 ALA A CB    1 
ATOM   849  N  N     . TYR A 1 108 ? 5.342   83.238  27.674  1.00 30.23  ? 108 TYR A N     1 
ATOM   850  C  CA    . TYR A 1 108 ? 4.074   83.799  27.224  1.00 31.42  ? 108 TYR A CA    1 
ATOM   851  C  C     . TYR A 1 108 ? 4.253   84.456  25.859  1.00 33.17  ? 108 TYR A C     1 
ATOM   852  O  O     . TYR A 1 108 ? 5.314   85.034  25.559  1.00 34.48  ? 108 TYR A O     1 
ATOM   853  C  CB    . TYR A 1 108 ? 3.582   84.867  28.204  1.00 31.12  ? 108 TYR A CB    1 
ATOM   854  C  CG    . TYR A 1 108 ? 3.383   84.388  29.619  1.00 28.96  ? 108 TYR A CG    1 
ATOM   855  C  CD1   . TYR A 1 108 ? 4.450   84.282  30.501  1.00 29.53  ? 108 TYR A CD1   1 
ATOM   856  C  CD2   . TYR A 1 108 ? 2.119   84.058  30.079  1.00 28.68  ? 108 TYR A CD2   1 
ATOM   857  C  CE1   . TYR A 1 108 ? 4.270   83.849  31.819  1.00 27.31  ? 108 TYR A CE1   1 
ATOM   858  C  CE2   . TYR A 1 108 ? 1.926   83.613  31.372  1.00 27.78  ? 108 TYR A CE2   1 
ATOM   859  C  CZ    . TYR A 1 108 ? 3.006   83.510  32.240  1.00 27.77  ? 108 TYR A CZ    1 
ATOM   860  O  OH    . TYR A 1 108 ? 2.765   83.089  33.527  1.00 26.83  ? 108 TYR A OH    1 
ATOM   861  N  N     . LEU A 1 109 ? 3.225   84.345  25.033  1.00 33.17  ? 109 LEU A N     1 
ATOM   862  C  CA    . LEU A 1 109 ? 3.148   85.099  23.795  1.00 34.87  ? 109 LEU A CA    1 
ATOM   863  C  C     . LEU A 1 109 ? 1.858   85.905  23.832  1.00 35.02  ? 109 LEU A C     1 
ATOM   864  O  O     . LEU A 1 109 ? 0.781   85.380  24.158  1.00 34.96  ? 109 LEU A O     1 
ATOM   865  C  CB    . LEU A 1 109 ? 3.188   84.180  22.568  1.00 35.63  ? 109 LEU A CB    1 
ATOM   866  C  CG    . LEU A 1 109 ? 4.428   83.291  22.419  1.00 36.43  ? 109 LEU A CG    1 
ATOM   867  C  CD1   . LEU A 1 109 ? 4.308   82.431  21.172  1.00 38.27  ? 109 LEU A CD1   1 
ATOM   868  C  CD2   . LEU A 1 109 ? 5.714   84.107  22.357  1.00 37.38  ? 109 LEU A CD2   1 
ATOM   869  N  N     . ASP A 1 110 ? 1.975   87.191  23.545  1.00 35.74  ? 110 ASP A N     1 
ATOM   870  C  CA    . ASP A 1 110 ? 0.810   88.025  23.373  1.00 36.63  ? 110 ASP A CA    1 
ATOM   871  C  C     . ASP A 1 110 ? 0.468   87.924  21.913  1.00 38.43  ? 110 ASP A C     1 
ATOM   872  O  O     . ASP A 1 110 ? 1.215   88.405  21.080  1.00 38.95  ? 110 ASP A O     1 
ATOM   873  C  CB    . ASP A 1 110 ? 1.108   89.475  23.761  1.00 37.00  ? 110 ASP A CB    1 
ATOM   874  C  CG    . ASP A 1 110 ? -0.075  90.392  23.570  1.00 38.07  ? 110 ASP A CG    1 
ATOM   875  O  OD1   . ASP A 1 110 ? -1.065  90.019  22.885  1.00 38.83  ? 110 ASP A OD1   1 
ATOM   876  O  OD2   . ASP A 1 110 ? -0.013  91.508  24.111  1.00 38.26  ? 110 ASP A OD2   1 
ATOM   877  N  N     . ILE A 1 111 ? -0.650  87.274  21.608  1.00 39.13  ? 111 ILE A N     1 
ATOM   878  C  CA    . ILE A 1 111 ? -1.078  87.105  20.216  1.00 41.02  ? 111 ILE A CA    1 
ATOM   879  C  C     . ILE A 1 111 ? -2.378  87.867  19.944  1.00 42.22  ? 111 ILE A C     1 
ATOM   880  O  O     . ILE A 1 111 ? -3.135  87.503  19.041  1.00 43.63  ? 111 ILE A O     1 
ATOM   881  C  CB    . ILE A 1 111 ? -1.260  85.612  19.846  1.00 40.22  ? 111 ILE A CB    1 
ATOM   882  C  CG1   . ILE A 1 111 ? -2.220  84.929  20.813  1.00 38.05  ? 111 ILE A CG1   1 
ATOM   883  C  CG2   . ILE A 1 111 ? 0.072   84.879  19.824  1.00 40.24  ? 111 ILE A CG2   1 
ATOM   884  C  CD1   . ILE A 1 111 ? -2.700  83.573  20.336  1.00 38.33  ? 111 ILE A CD1   1 
ATOM   885  N  N     . SER A 1 112 ? -2.623  88.933  20.703  1.00 41.87  ? 112 SER A N     1 
ATOM   886  C  CA    . SER A 1 112 ? -3.821  89.752  20.511  1.00 43.47  ? 112 SER A CA    1 
ATOM   887  C  C     . SER A 1 112 ? -3.914  90.314  19.087  1.00 46.02  ? 112 SER A C     1 
ATOM   888  O  O     . SER A 1 112 ? -5.003  90.495  18.559  1.00 47.39  ? 112 SER A O     1 
ATOM   889  C  CB    . SER A 1 112 ? -3.869  90.882  21.536  1.00 43.29  ? 112 SER A CB    1 
ATOM   890  O  OG    . SER A 1 112 ? -3.716  90.360  22.844  1.00 40.66  ? 112 SER A OG    1 
ATOM   891  N  N     . ASP A 1 113 ? -2.768  90.540  18.468  1.00 46.57  ? 113 ASP A N     1 
ATOM   892  C  CA    . ASP A 1 113 ? -2.707  91.097  17.136  1.00 49.76  ? 113 ASP A CA    1 
ATOM   893  C  C     . ASP A 1 113 ? -2.431  90.054  16.050  1.00 52.40  ? 113 ASP A C     1 
ATOM   894  O  O     . ASP A 1 113 ? -2.570  90.365  14.866  1.00 55.68  ? 113 ASP A O     1 
ATOM   895  C  CB    . ASP A 1 113 ? -1.650  92.211  17.097  1.00 49.85  ? 113 ASP A CB    1 
ATOM   896  C  CG    . ASP A 1 113 ? -2.040  93.396  17.950  1.00 48.87  ? 113 ASP A CG    1 
ATOM   897  O  OD1   . ASP A 1 113 ? -3.179  93.443  18.444  1.00 49.37  ? 113 ASP A OD1   1 
ATOM   898  O  OD2   . ASP A 1 113 ? -1.225  94.291  18.143  1.00 49.60  ? 113 ASP A OD2   1 
ATOM   899  N  N     . LYS A 1 114 ? -2.073  88.831  16.442  1.00 51.14  ? 114 LYS A N     1 
ATOM   900  C  CA    . LYS A 1 114 ? -1.735  87.782  15.484  1.00 53.67  ? 114 LYS A CA    1 
ATOM   901  C  C     . LYS A 1 114 ? -2.913  86.850  15.151  1.00 53.12  ? 114 LYS A C     1 
ATOM   902  O  O     . LYS A 1 114 ? -2.831  86.089  14.179  1.00 54.18  ? 114 LYS A O     1 
ATOM   903  C  CB    . LYS A 1 114 ? -0.526  86.977  15.963  1.00 54.49  ? 114 LYS A CB    1 
ATOM   904  C  CG    . LYS A 1 114 ? 0.669   87.821  16.415  1.00 57.55  ? 114 LYS A CG    1 
ATOM   905  C  CD    . LYS A 1 114 ? 1.719   88.101  15.326  1.00 61.54  ? 114 LYS A CD    1 
ATOM   906  C  CE    . LYS A 1 114 ? 1.122   88.634  14.031  1.00 66.06  ? 114 LYS A CE    1 
ATOM   907  N  NZ    . LYS A 1 114 ? 2.164   89.057  13.035  1.00 69.77  ? 114 LYS A NZ    1 
ATOM   908  N  N     . VAL A 1 115 ? -3.995  86.927  15.937  1.00 50.48  ? 115 VAL A N     1 
ATOM   909  C  CA    . VAL A 1 115 ? -5.236  86.162  15.714  1.00 49.47  ? 115 VAL A CA    1 
ATOM   910  C  C     . VAL A 1 115 ? -6.448  86.947  16.206  1.00 48.75  ? 115 VAL A C     1 
ATOM   911  O  O     . VAL A 1 115 ? -6.305  87.909  16.946  1.00 47.49  ? 115 VAL A O     1 
ATOM   912  C  CB    . VAL A 1 115 ? -5.225  84.787  16.434  1.00 48.29  ? 115 VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 115 ? -4.067  83.925  15.939  1.00 49.24  ? 115 VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 115 ? -5.164  84.939  17.956  1.00 46.18  ? 115 VAL A CG2   1 
ATOM   915  N  N     . ARG A 1 116 ? -7.639  86.507  15.816  1.00 49.62  ? 116 ARG A N     1 
ATOM   916  C  CA    . ARG A 1 116 ? -8.878  87.252  16.072  1.00 50.79  ? 116 ARG A CA    1 
ATOM   917  C  C     . ARG A 1 116 ? -9.661  86.768  17.258  1.00 47.77  ? 116 ARG A C     1 
ATOM   918  O  O     . ARG A 1 116 ? -10.388 87.552  17.880  1.00 47.88  ? 116 ARG A O     1 
ATOM   919  C  CB    . ARG A 1 116 ? -9.821  87.156  14.866  1.00 54.27  ? 116 ARG A CB    1 
ATOM   920  C  CG    . ARG A 1 116 ? -9.236  87.776  13.623  1.00 59.82  ? 116 ARG A CG    1 
ATOM   921  C  CD    . ARG A 1 116 ? -10.280 88.208  12.603  1.00 65.24  ? 116 ARG A CD    1 
ATOM   922  N  NE    . ARG A 1 116 ? -9.829  89.448  11.969  1.00 71.38  ? 116 ARG A NE    1 
ATOM   923  C  CZ    . ARG A 1 116 ? -8.786  89.546  11.143  1.00 75.84  ? 116 ARG A CZ    1 
ATOM   924  N  NH1   . ARG A 1 116 ? -8.089  88.468  10.792  1.00 75.89  ? 116 ARG A NH1   1 
ATOM   925  N  NH2   . ARG A 1 116 ? -8.448  90.733  10.646  1.00 80.62  ? 116 ARG A NH2   1 
ATOM   926  N  N     . ASP A 1 117 ? -9.575  85.468  17.525  1.00 44.93  ? 117 ASP A N     1 
ATOM   927  C  CA    . ASP A 1 117 ? -10.368 84.852  18.563  1.00 42.16  ? 117 ASP A CA    1 
ATOM   928  C  C     . ASP A 1 117 ? -9.694  83.569  19.040  1.00 40.98  ? 117 ASP A C     1 
ATOM   929  O  O     . ASP A 1 117 ? -8.577  83.253  18.621  1.00 41.59  ? 117 ASP A O     1 
ATOM   930  C  CB    . ASP A 1 117 ? -11.773 84.573  18.031  1.00 43.28  ? 117 ASP A CB    1 
ATOM   931  C  CG    . ASP A 1 117 ? -11.753 83.805  16.742  1.00 44.21  ? 117 ASP A CG    1 
ATOM   932  O  OD1   . ASP A 1 117 ? -11.087 82.752  16.660  1.00 43.68  ? 117 ASP A OD1   1 
ATOM   933  O  OD2   . ASP A 1 117 ? -12.387 84.280  15.796  1.00 47.27  ? 117 ASP A OD2   1 
ATOM   934  N  N     . TYR A 1 118 ? -10.366 82.841  19.923  1.00 39.21  ? 118 TYR A N     1 
ATOM   935  C  CA    . TYR A 1 118 ? -9.781  81.646  20.525  1.00 38.93  ? 118 TYR A CA    1 
ATOM   936  C  C     . TYR A 1 118 ? -9.770  80.423  19.604  1.00 41.46  ? 118 TYR A C     1 
ATOM   937  O  O     . TYR A 1 118 ? -8.933  79.533  19.777  1.00 41.51  ? 118 TYR A O     1 
ATOM   938  C  CB    . TYR A 1 118 ? -10.503 81.304  21.820  1.00 36.63  ? 118 TYR A CB    1 
ATOM   939  C  CG    . TYR A 1 118 ? -10.244 82.271  22.952  1.00 36.37  ? 118 TYR A CG    1 
ATOM   940  C  CD1   . TYR A 1 118 ? -8.944  82.676  23.276  1.00 35.45  ? 118 TYR A CD1   1 
ATOM   941  C  CD2   . TYR A 1 118 ? -11.296 82.752  23.731  1.00 35.97  ? 118 TYR A CD2   1 
ATOM   942  C  CE1   . TYR A 1 118 ? -8.704  83.534  24.335  1.00 35.76  ? 118 TYR A CE1   1 
ATOM   943  C  CE2   . TYR A 1 118 ? -11.062 83.619  24.786  1.00 35.62  ? 118 TYR A CE2   1 
ATOM   944  C  CZ    . TYR A 1 118 ? -9.767  83.998  25.086  1.00 35.52  ? 118 TYR A CZ    1 
ATOM   945  O  OH    . TYR A 1 118 ? -9.548  84.852  26.131  1.00 34.46  ? 118 TYR A OH    1 
ATOM   946  N  N     . ARG A 1 119 ? -10.708 80.376  18.653  1.00 43.57  ? 119 ARG A N     1 
ATOM   947  C  CA    . ARG A 1 119 ? -10.710 79.354  17.609  1.00 46.00  ? 119 ARG A CA    1 
ATOM   948  C  C     . ARG A 1 119 ? -9.383  79.373  16.875  1.00 44.59  ? 119 ARG A C     1 
ATOM   949  O  O     . ARG A 1 119 ? -8.735  78.345  16.733  1.00 44.87  ? 119 ARG A O     1 
ATOM   950  C  CB    . ARG A 1 119 ? -11.857 79.582  16.603  1.00 49.82  ? 119 ARG A CB    1 
ATOM   951  C  CG    . ARG A 1 119 ? -12.026 78.459  15.576  1.00 53.82  ? 119 ARG A CG    1 
ATOM   952  C  CD    . ARG A 1 119 ? -12.930 78.861  14.415  1.00 57.70  ? 119 ARG A CD    1 
ATOM   953  N  NE    . ARG A 1 119 ? -12.905 77.881  13.322  1.00 61.43  ? 119 ARG A NE    1 
ATOM   954  C  CZ    . ARG A 1 119 ? -13.662 76.783  13.245  1.00 63.79  ? 119 ARG A CZ    1 
ATOM   955  N  NH1   . ARG A 1 119 ? -14.530 76.477  14.201  1.00 63.18  ? 119 ARG A NH1   1 
ATOM   956  N  NH2   . ARG A 1 119 ? -13.545 75.975  12.197  1.00 67.19  ? 119 ARG A NH2   1 
ATOM   957  N  N     . GLU A 1 120 ? -8.995  80.561  16.424  1.00 44.56  ? 120 GLU A N     1 
ATOM   958  C  CA    . GLU A 1 120 ? -7.720  80.782  15.754  1.00 44.88  ? 120 GLU A CA    1 
ATOM   959  C  C     . GLU A 1 120 ? -6.537  80.709  16.722  1.00 42.64  ? 120 GLU A C     1 
ATOM   960  O  O     . GLU A 1 120 ? -5.427  80.341  16.335  1.00 43.41  ? 120 GLU A O     1 
ATOM   961  C  CB    . GLU A 1 120 ? -7.737  82.145  15.057  1.00 46.99  ? 120 GLU A CB    1 
ATOM   962  C  CG    . GLU A 1 120 ? -8.817  82.278  13.986  1.00 49.31  ? 120 GLU A CG    1 
ATOM   963  C  CD    . GLU A 1 120 ? -8.634  83.492  13.088  1.00 51.81  ? 120 GLU A CD    1 
ATOM   964  O  OE1   . GLU A 1 120 ? -7.873  84.419  13.443  1.00 51.85  ? 120 GLU A OE1   1 
ATOM   965  O  OE2   . GLU A 1 120 ? -9.255  83.511  12.003  1.00 55.89  ? 120 GLU A OE2   1 
ATOM   966  N  N     . ALA A 1 121 ? -6.758  81.066  17.982  1.00 39.57  ? 121 ALA A N     1 
ATOM   967  C  CA    . ALA A 1 121 ? -5.697  80.922  18.978  1.00 37.94  ? 121 ALA A CA    1 
ATOM   968  C  C     . ALA A 1 121 ? -5.361  79.445  19.125  1.00 37.77  ? 121 ALA A C     1 
ATOM   969  O  O     . ALA A 1 121 ? -4.184  79.062  19.065  1.00 37.42  ? 121 ALA A O     1 
ATOM   970  C  CB    . ALA A 1 121 ? -6.095  81.541  20.314  1.00 35.70  ? 121 ALA A CB    1 
ATOM   971  N  N     . TYR A 1 122 ? -6.399  78.620  19.260  1.00 38.68  ? 122 TYR A N     1 
ATOM   972  C  CA    . TYR A 1 122 ? -6.230  77.167  19.395  1.00 40.37  ? 122 TYR A CA    1 
ATOM   973  C  C     . TYR A 1 122 ? -5.456  76.621  18.194  1.00 42.90  ? 122 TYR A C     1 
ATOM   974  O  O     . TYR A 1 122 ? -4.469  75.894  18.339  1.00 43.02  ? 122 TYR A O     1 
ATOM   975  C  CB    . TYR A 1 122 ? -7.593  76.464  19.486  1.00 41.83  ? 122 TYR A CB    1 
ATOM   976  C  CG    . TYR A 1 122 ? -7.524  75.003  19.916  1.00 42.73  ? 122 TYR A CG    1 
ATOM   977  C  CD1   . TYR A 1 122 ? -7.141  74.000  19.027  1.00 44.11  ? 122 TYR A CD1   1 
ATOM   978  C  CD2   . TYR A 1 122 ? -7.855  74.631  21.220  1.00 42.35  ? 122 TYR A CD2   1 
ATOM   979  C  CE1   . TYR A 1 122 ? -7.073  72.677  19.426  1.00 44.55  ? 122 TYR A CE1   1 
ATOM   980  C  CE2   . TYR A 1 122 ? -7.794  73.310  21.623  1.00 42.59  ? 122 TYR A CE2   1 
ATOM   981  C  CZ    . TYR A 1 122 ? -7.403  72.343  20.724  1.00 43.85  ? 122 TYR A CZ    1 
ATOM   982  O  OH    . TYR A 1 122 ? -7.342  71.046  21.142  1.00 44.75  ? 122 TYR A OH    1 
ATOM   983  N  N     . ASN A 1 123 ? -5.906  76.965  16.999  1.00 43.98  ? 123 ASN A N     1 
ATOM   984  C  CA    . ASN A 1 123 ? -5.206  76.486  15.825  1.00 47.84  ? 123 ASN A CA    1 
ATOM   985  C  C     . ASN A 1 123 ? -3.718  76.865  15.797  1.00 47.15  ? 123 ASN A C     1 
ATOM   986  O  O     . ASN A 1 123 ? -2.874  76.032  15.479  1.00 48.22  ? 123 ASN A O     1 
ATOM   987  C  CB    . ASN A 1 123 ? -5.891  76.927  14.541  1.00 51.22  ? 123 ASN A CB    1 
ATOM   988  C  CG    . ASN A 1 123 ? -5.428  76.111  13.370  1.00 56.16  ? 123 ASN A CG    1 
ATOM   989  O  OD1   . ASN A 1 123 ? -5.834  74.964  13.205  1.00 58.02  ? 123 ASN A OD1   1 
ATOM   990  N  ND2   . ASN A 1 123 ? -4.521  76.672  12.583  1.00 60.17  ? 123 ASN A ND2   1 
ATOM   991  N  N     . LEU A 1 124 ? -3.385  78.098  16.160  1.00 45.17  ? 124 LEU A N     1 
ATOM   992  C  CA    . LEU A 1 124 ? -1.974  78.493  16.223  1.00 45.65  ? 124 LEU A CA    1 
ATOM   993  C  C     . LEU A 1 124 ? -1.212  77.695  17.298  1.00 44.00  ? 124 LEU A C     1 
ATOM   994  O  O     . LEU A 1 124 ? -0.014  77.404  17.151  1.00 43.60  ? 124 LEU A O     1 
ATOM   995  C  CB    . LEU A 1 124 ? -1.868  79.978  16.533  1.00 45.73  ? 124 LEU A CB    1 
ATOM   996  C  CG    . LEU A 1 124 ? -0.496  80.614  16.350  1.00 46.83  ? 124 LEU A CG    1 
ATOM   997  C  CD1   . LEU A 1 124 ? -0.204  80.798  14.870  1.00 49.76  ? 124 LEU A CD1   1 
ATOM   998  C  CD2   . LEU A 1 124 ? -0.454  81.948  17.078  1.00 45.69  ? 124 LEU A CD2   1 
ATOM   999  N  N     . GLY A 1 125 ? -1.920  77.348  18.375  1.00 40.82  ? 125 GLY A N     1 
ATOM   1000 C  CA    . GLY A 1 125 ? -1.356  76.525  19.438  1.00 38.83  ? 125 GLY A CA    1 
ATOM   1001 C  C     . GLY A 1 125 ? -0.884  75.195  18.900  1.00 39.90  ? 125 GLY A C     1 
ATOM   1002 O  O     . GLY A 1 125 ? 0.233   74.752  19.206  1.00 38.09  ? 125 GLY A O     1 
ATOM   1003 N  N     . LEU A 1 126 ? -1.730  74.572  18.074  1.00 40.90  ? 126 LEU A N     1 
ATOM   1004 C  CA    . LEU A 1 126 ? -1.371  73.317  17.410  1.00 43.23  ? 126 LEU A CA    1 
ATOM   1005 C  C     . LEU A 1 126 ? -0.165  73.478  16.495  1.00 45.34  ? 126 LEU A C     1 
ATOM   1006 O  O     . LEU A 1 126 ? 0.721   72.625  16.507  1.00 46.44  ? 126 LEU A O     1 
ATOM   1007 C  CB    . LEU A 1 126 ? -2.542  72.749  16.597  1.00 44.26  ? 126 LEU A CB    1 
ATOM   1008 C  CG    . LEU A 1 126 ? -3.799  72.360  17.379  1.00 42.41  ? 126 LEU A CG    1 
ATOM   1009 C  CD1   . LEU A 1 126 ? -4.857  71.894  16.388  1.00 43.80  ? 126 LEU A CD1   1 
ATOM   1010 C  CD2   . LEU A 1 126 ? -3.515  71.285  18.417  1.00 41.26  ? 126 LEU A CD2   1 
ATOM   1011 N  N     . GLU A 1 127 ? -0.136  74.554  15.702  1.00 46.99  ? 127 GLU A N     1 
ATOM   1012 C  CA    . GLU A 1 127 ? 1.023   74.845  14.841  1.00 49.48  ? 127 GLU A CA    1 
ATOM   1013 C  C     . GLU A 1 127 ? 2.273   74.858  15.691  1.00 48.32  ? 127 GLU A C     1 
ATOM   1014 O  O     . GLU A 1 127 ? 3.299   74.312  15.315  1.00 48.96  ? 127 GLU A O     1 
ATOM   1015 C  CB    . GLU A 1 127 ? 0.939   76.230  14.190  1.00 51.19  ? 127 GLU A CB    1 
ATOM   1016 C  CG    . GLU A 1 127 ? -0.108  76.434  13.128  1.00 54.13  ? 127 GLU A CG    1 
ATOM   1017 C  CD    . GLU A 1 127 ? 0.188   77.640  12.238  1.00 57.28  ? 127 GLU A CD    1 
ATOM   1018 O  OE1   . GLU A 1 127 ? 1.375   77.969  12.007  1.00 56.99  ? 127 GLU A OE1   1 
ATOM   1019 O  OE2   . GLU A 1 127 ? -0.783  78.250  11.740  1.00 60.40  ? 127 GLU A OE2   1 
ATOM   1020 N  N     . ILE A 1 128 ? 2.184   75.498  16.857  1.00 46.49  ? 128 ILE A N     1 
ATOM   1021 C  CA    . ILE A 1 128 ? 3.364   75.636  17.729  1.00 45.31  ? 128 ILE A CA    1 
ATOM   1022 C  C     . ILE A 1 128 ? 3.800   74.267  18.251  1.00 44.62  ? 128 ILE A C     1 
ATOM   1023 O  O     . ILE A 1 128 ? 4.977   73.902  18.175  1.00 44.37  ? 128 ILE A O     1 
ATOM   1024 C  CB    . ILE A 1 128 ? 3.095   76.669  18.844  1.00 43.76  ? 128 ILE A CB    1 
ATOM   1025 C  CG1   . ILE A 1 128 ? 3.101   78.067  18.218  1.00 44.38  ? 128 ILE A CG1   1 
ATOM   1026 C  CG2   . ILE A 1 128 ? 4.147   76.595  19.949  1.00 43.94  ? 128 ILE A CG2   1 
ATOM   1027 C  CD1   . ILE A 1 128 ? 2.509   79.149  19.086  1.00 42.88  ? 128 ILE A CD1   1 
ATOM   1028 N  N     . LYS A 1 129 ? 2.837   73.492  18.733  1.00 44.28  ? 129 LYS A N     1 
ATOM   1029 C  CA    . LYS A 1 129 ? 3.110   72.120  19.148  1.00 45.06  ? 129 LYS A CA    1 
ATOM   1030 C  C     . LYS A 1 129 ? 3.770   71.325  18.007  1.00 48.09  ? 129 LYS A C     1 
ATOM   1031 O  O     . LYS A 1 129 ? 4.839   70.753  18.198  1.00 48.64  ? 129 LYS A O     1 
ATOM   1032 C  CB    . LYS A 1 129 ? 1.840   71.449  19.694  1.00 43.74  ? 129 LYS A CB    1 
ATOM   1033 C  CG    . LYS A 1 129 ? 1.461   72.000  21.077  1.00 42.13  ? 129 LYS A CG    1 
ATOM   1034 C  CD    . LYS A 1 129 ? 0.042   71.659  21.539  1.00 40.83  ? 129 LYS A CD    1 
ATOM   1035 C  CE    . LYS A 1 129 ? -0.165  70.172  21.800  1.00 41.60  ? 129 LYS A CE    1 
ATOM   1036 N  NZ    . LYS A 1 129 ? 0.745   69.594  22.827  1.00 41.08  ? 129 LYS A NZ    1 
ATOM   1037 N  N     . ASN A 1 130 ? 3.158   71.324  16.824  1.00 50.60  ? 130 ASN A N     1 
ATOM   1038 C  CA    . ASN A 1 130 ? 3.757   70.679  15.646  1.00 53.87  ? 130 ASN A CA    1 
ATOM   1039 C  C     . ASN A 1 130 ? 5.190   71.173  15.407  1.00 53.31  ? 130 ASN A C     1 
ATOM   1040 O  O     . ASN A 1 130 ? 6.125   70.376  15.359  1.00 53.43  ? 130 ASN A O     1 
ATOM   1041 C  CB    . ASN A 1 130 ? 2.895   70.906  14.385  1.00 57.14  ? 130 ASN A CB    1 
ATOM   1042 C  CG    . ASN A 1 130 ? 1.510   70.252  14.479  1.00 59.02  ? 130 ASN A CG    1 
ATOM   1043 O  OD1   . ASN A 1 130 ? 0.585   70.577  13.709  1.00 60.88  ? 130 ASN A OD1   1 
ATOM   1044 N  ND2   . ASN A 1 130 ? 1.360   69.324  15.420  1.00 59.43  ? 130 ASN A ND2   1 
ATOM   1045 N  N     . LYS A 1 131 ? 5.357   72.486  15.291  1.00 51.99  ? 131 LYS A N     1 
ATOM   1046 C  CA    . LYS A 1 131 ? 6.660   73.069  14.980  1.00 53.86  ? 131 LYS A CA    1 
ATOM   1047 C  C     . LYS A 1 131 ? 7.762   72.692  15.991  1.00 52.99  ? 131 LYS A C     1 
ATOM   1048 O  O     . LYS A 1 131 ? 8.897   72.418  15.591  1.00 53.42  ? 131 LYS A O     1 
ATOM   1049 C  CB    . LYS A 1 131 ? 6.551   74.596  14.868  1.00 53.89  ? 131 LYS A CB    1 
ATOM   1050 C  CG    . LYS A 1 131 ? 7.841   75.305  14.439  1.00 56.17  ? 131 LYS A CG    1 
ATOM   1051 C  CD    . LYS A 1 131 ? 8.100   75.207  12.924  1.00 59.92  ? 131 LYS A CD    1 
ATOM   1052 C  CE    . LYS A 1 131 ? 7.176   76.134  12.133  1.00 60.94  ? 131 LYS A CE    1 
ATOM   1053 N  NZ    . LYS A 1 131 ? 7.623   76.379  10.731  1.00 65.66  ? 131 LYS A NZ    1 
ATOM   1054 N  N     . ILE A 1 132 ? 7.438   72.685  17.288  1.00 50.74  ? 132 ILE A N     1 
ATOM   1055 C  CA    . ILE A 1 132 ? 8.446   72.377  18.318  1.00 50.13  ? 132 ILE A CA    1 
ATOM   1056 C  C     . ILE A 1 132 ? 8.767   70.892  18.343  1.00 52.25  ? 132 ILE A C     1 
ATOM   1057 O  O     . ILE A 1 132 ? 9.930   70.512  18.488  1.00 53.69  ? 132 ILE A O     1 
ATOM   1058 C  CB    . ILE A 1 132 ? 8.017   72.872  19.714  1.00 47.78  ? 132 ILE A CB    1 
ATOM   1059 C  CG1   . ILE A 1 132 ? 7.974   74.402  19.703  1.00 46.64  ? 132 ILE A CG1   1 
ATOM   1060 C  CG2   . ILE A 1 132 ? 8.966   72.368  20.804  1.00 46.73  ? 132 ILE A CG2   1 
ATOM   1061 C  CD1   . ILE A 1 132 ? 7.415   75.006  20.955  1.00 43.74  ? 132 ILE A CD1   1 
ATOM   1062 N  N     . LEU A 1 133 ? 7.743   70.061  18.178  1.00 52.91  ? 133 LEU A N     1 
ATOM   1063 C  CA    . LEU A 1 133 ? 7.922   68.620  18.120  1.00 56.16  ? 133 LEU A CA    1 
ATOM   1064 C  C     . LEU A 1 133 ? 8.784   68.251  16.907  1.00 61.32  ? 133 LEU A C     1 
ATOM   1065 O  O     . LEU A 1 133 ? 9.614   67.352  16.977  1.00 62.55  ? 133 LEU A O     1 
ATOM   1066 C  CB    . LEU A 1 133 ? 6.557   67.928  18.011  1.00 56.05  ? 133 LEU A CB    1 
ATOM   1067 C  CG    . LEU A 1 133 ? 6.564   66.394  18.022  1.00 58.24  ? 133 LEU A CG    1 
ATOM   1068 C  CD1   . LEU A 1 133 ? 6.962   65.874  19.396  1.00 57.10  ? 133 LEU A CD1   1 
ATOM   1069 C  CD2   . LEU A 1 133 ? 5.202   65.832  17.622  1.00 59.30  ? 133 LEU A CD2   1 
ATOM   1070 N  N     . GLU A 1 134 ? 8.560   68.963  15.807  1.00 63.71  ? 134 GLU A N     1 
ATOM   1071 C  CA    . GLU A 1 134 ? 9.245   68.742  14.548  1.00 68.73  ? 134 GLU A CA    1 
ATOM   1072 C  C     . GLU A 1 134 ? 10.713  69.132  14.614  1.00 70.31  ? 134 GLU A C     1 
ATOM   1073 O  O     . GLU A 1 134 ? 11.574  68.426  14.085  1.00 70.97  ? 134 GLU A O     1 
ATOM   1074 C  CB    . GLU A 1 134 ? 8.562   69.580  13.473  1.00 71.55  ? 134 GLU A CB    1 
ATOM   1075 C  CG    . GLU A 1 134 ? 9.026   69.340  12.049  1.00 77.25  ? 134 GLU A CG    1 
ATOM   1076 C  CD    . GLU A 1 134 ? 8.231   70.165  11.061  1.00 79.81  ? 134 GLU A CD    1 
ATOM   1077 O  OE1   . GLU A 1 134 ? 7.612   71.166  11.490  1.00 77.71  ? 134 GLU A OE1   1 
ATOM   1078 O  OE2   . GLU A 1 134 ? 8.218   69.812  9.857   1.00 86.42  ? 134 GLU A OE2   1 
ATOM   1079 N  N     . LYS A 1 135 ? 10.990  70.269  15.246  1.00 68.05  ? 135 LYS A N     1 
ATOM   1080 C  CA    . LYS A 1 135 ? 12.342  70.795  15.295  1.00 68.46  ? 135 LYS A CA    1 
ATOM   1081 C  C     . LYS A 1 135 ? 13.124  70.194  16.453  1.00 67.49  ? 135 LYS A C     1 
ATOM   1082 O  O     . LYS A 1 135 ? 14.333  70.048  16.349  1.00 68.13  ? 135 LYS A O     1 
ATOM   1083 C  CB    . LYS A 1 135 ? 12.335  72.323  15.414  1.00 67.81  ? 135 LYS A CB    1 
ATOM   1084 C  CG    . LYS A 1 135 ? 11.722  73.066  14.229  1.00 69.63  ? 135 LYS A CG    1 
ATOM   1085 C  CD    . LYS A 1 135 ? 12.658  73.125  13.023  1.00 74.07  ? 135 LYS A CD    1 
ATOM   1086 C  CE    . LYS A 1 135 ? 12.312  74.285  12.095  1.00 75.54  ? 135 LYS A CE    1 
ATOM   1087 N  NZ    . LYS A 1 135 ? 12.985  74.184  10.766  1.00 80.09  ? 135 LYS A NZ    1 
ATOM   1088 N  N     . GLU A 1 136 ? 12.452  69.855  17.560  1.00 66.14  ? 136 GLU A N     1 
ATOM   1089 C  CA    . GLU A 1 136 ? 13.172  69.439  18.783  1.00 63.66  ? 136 GLU A CA    1 
ATOM   1090 C  C     . GLU A 1 136 ? 12.714  68.136  19.459  1.00 63.34  ? 136 GLU A C     1 
ATOM   1091 O  O     . GLU A 1 136 ? 13.272  67.761  20.489  1.00 62.25  ? 136 GLU A O     1 
ATOM   1092 C  CB    . GLU A 1 136 ? 13.150  70.577  19.799  1.00 60.15  ? 136 GLU A CB    1 
ATOM   1093 C  CG    . GLU A 1 136 ? 13.865  71.846  19.346  1.00 60.26  ? 136 GLU A CG    1 
ATOM   1094 C  CD    . GLU A 1 136 ? 15.377  71.700  19.283  1.00 60.98  ? 136 GLU A CD    1 
ATOM   1095 O  OE1   . GLU A 1 136 ? 15.926  70.761  19.911  1.00 59.43  ? 136 GLU A OE1   1 
ATOM   1096 O  OE2   . GLU A 1 136 ? 16.018  72.540  18.613  1.00 62.09  ? 136 GLU A OE2   1 
ATOM   1097 N  N     . LYS A 1 137 ? 11.731  67.439  18.893  1.00 64.05  ? 137 LYS A N     1 
ATOM   1098 C  CA    . LYS A 1 137 ? 11.257  66.170  19.468  1.00 65.12  ? 137 LYS A CA    1 
ATOM   1099 C  C     . LYS A 1 137 ? 10.862  66.319  20.942  1.00 62.69  ? 137 LYS A C     1 
ATOM   1100 O  O     . LYS A 1 137 ? 11.047  65.398  21.741  1.00 64.11  ? 137 LYS A O     1 
ATOM   1101 C  CB    . LYS A 1 137 ? 12.323  65.073  19.317  1.00 69.12  ? 137 LYS A CB    1 
ATOM   1102 C  CG    . LYS A 1 137 ? 12.979  65.020  17.943  1.00 72.87  ? 137 LYS A CG    1 
ATOM   1103 C  CD    . LYS A 1 137 ? 13.796  63.750  17.729  1.00 76.85  ? 137 LYS A CD    1 
ATOM   1104 C  CE    . LYS A 1 137 ? 12.903  62.542  17.472  1.00 79.39  ? 137 LYS A CE    1 
ATOM   1105 N  NZ    . LYS A 1 137 ? 13.606  61.481  16.698  1.00 83.70  ? 137 LYS A NZ    1 
ATOM   1106 N  N     . ILE A 1 138 ? 10.329  67.493  21.283  1.00 59.25  ? 138 ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 138 ? 9.871   67.821  22.627  1.00 56.00  ? 138 ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 138 ? 8.384   68.176  22.512  1.00 53.09  ? 138 ILE A C     1 
ATOM   1109 O  O     . ILE A 1 138 ? 8.013   69.012  21.679  1.00 52.04  ? 138 ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 138 ? 10.688  69.013  23.202  1.00 54.92  ? 138 ILE A CB    1 
ATOM   1111 C  CG1   . ILE A 1 138 ? 12.121  68.573  23.550  1.00 56.72  ? 138 ILE A CG1   1 
ATOM   1112 C  CG2   . ILE A 1 138 ? 10.018  69.649  24.418  1.00 51.61  ? 138 ILE A CG2   1 
ATOM   1113 C  CD1   . ILE A 1 138 ? 12.254  67.727  24.802  1.00 56.37  ? 138 ILE A CD1   1 
ATOM   1114 N  N     . THR A 1 139 ? 7.535   67.509  23.299  1.00 50.97  ? 139 THR A N     1 
ATOM   1115 C  CA    . THR A 1 139 ? 6.125   67.914  23.430  1.00 48.04  ? 139 THR A CA    1 
ATOM   1116 C  C     . THR A 1 139 ? 6.007   69.064  24.431  1.00 44.77  ? 139 THR A C     1 
ATOM   1117 O  O     . THR A 1 139 ? 6.771   69.150  25.397  1.00 43.43  ? 139 THR A O     1 
ATOM   1118 C  CB    . THR A 1 139 ? 5.197   66.796  23.946  1.00 47.30  ? 139 THR A CB    1 
ATOM   1119 O  OG1   . THR A 1 139 ? 5.544   66.474  25.295  1.00 45.63  ? 139 THR A OG1   1 
ATOM   1120 C  CG2   . THR A 1 139 ? 5.260   65.556  23.082  1.00 49.46  ? 139 THR A CG2   1 
ATOM   1121 N  N     . VAL A 1 140 ? 5.025   69.928  24.199  1.00 42.24  ? 140 VAL A N     1 
ATOM   1122 C  CA    . VAL A 1 140 ? 4.736   71.016  25.097  1.00 39.74  ? 140 VAL A CA    1 
ATOM   1123 C  C     . VAL A 1 140 ? 3.252   71.019  25.426  1.00 37.63  ? 140 VAL A C     1 
ATOM   1124 O  O     . VAL A 1 140 ? 2.452   70.358  24.763  1.00 36.64  ? 140 VAL A O     1 
ATOM   1125 C  CB    . VAL A 1 140 ? 5.185   72.381  24.509  1.00 40.31  ? 140 VAL A CB    1 
ATOM   1126 C  CG1   . VAL A 1 140 ? 6.673   72.355  24.167  1.00 41.74  ? 140 VAL A CG1   1 
ATOM   1127 C  CG2   . VAL A 1 140 ? 4.373   72.746  23.282  1.00 41.22  ? 140 VAL A CG2   1 
ATOM   1128 N  N     . THR A 1 141 ? 2.905   71.758  26.478  1.00 34.90  ? 141 THR A N     1 
ATOM   1129 C  CA    . THR A 1 141 ? 1.523   72.033  26.808  1.00 32.48  ? 141 THR A CA    1 
ATOM   1130 C  C     . THR A 1 141 ? 1.275   73.522  26.607  1.00 31.29  ? 141 THR A C     1 
ATOM   1131 O  O     . THR A 1 141 ? 2.091   74.373  27.039  1.00 31.27  ? 141 THR A O     1 
ATOM   1132 C  CB    . THR A 1 141 ? 1.175   71.585  28.239  1.00 31.62  ? 141 THR A CB    1 
ATOM   1133 O  OG1   . THR A 1 141 ? 1.248   70.157  28.308  1.00 32.49  ? 141 THR A OG1   1 
ATOM   1134 C  CG2   . THR A 1 141 ? -0.275  72.008  28.620  1.00 30.93  ? 141 THR A CG2   1 
ATOM   1135 N  N     . VAL A 1 142 ? 0.166   73.831  25.934  1.00 30.29  ? 142 VAL A N     1 
ATOM   1136 C  CA    . VAL A 1 142 ? -0.213  75.214  25.599  1.00 29.06  ? 142 VAL A CA    1 
ATOM   1137 C  C     . VAL A 1 142 ? -1.502  75.593  26.321  1.00 27.27  ? 142 VAL A C     1 
ATOM   1138 O  O     . VAL A 1 142 ? -2.497  74.867  26.242  1.00 27.61  ? 142 VAL A O     1 
ATOM   1139 C  CB    . VAL A 1 142 ? -0.469  75.366  24.090  1.00 30.44  ? 142 VAL A CB    1 
ATOM   1140 C  CG1   . VAL A 1 142 ? -1.097  76.715  23.733  1.00 30.05  ? 142 VAL A CG1   1 
ATOM   1141 C  CG2   . VAL A 1 142 ? 0.801   75.125  23.304  1.00 32.03  ? 142 VAL A CG2   1 
ATOM   1142 N  N     . GLY A 1 143 ? -1.472  76.734  26.997  1.00 25.47  ? 143 GLY A N     1 
ATOM   1143 C  CA    . GLY A 1 143 ? -2.628  77.325  27.639  1.00 24.97  ? 143 GLY A CA    1 
ATOM   1144 C  C     . GLY A 1 143 ? -2.945  78.668  26.989  1.00 25.55  ? 143 GLY A C     1 
ATOM   1145 O  O     . GLY A 1 143 ? -2.038  79.415  26.641  1.00 26.05  ? 143 GLY A O     1 
ATOM   1146 N  N     . ILE A 1 144 ? -4.237  78.953  26.827  1.00 25.36  ? 144 ILE A N     1 
ATOM   1147 C  CA    . ILE A 1 144 ? -4.728  80.113  26.081  1.00 25.98  ? 144 ILE A CA    1 
ATOM   1148 C  C     . ILE A 1 144 ? -5.848  80.794  26.858  1.00 25.32  ? 144 ILE A C     1 
ATOM   1149 O  O     . ILE A 1 144 ? -6.815  80.150  27.211  1.00 24.79  ? 144 ILE A O     1 
ATOM   1150 C  CB    . ILE A 1 144 ? -5.252  79.679  24.686  1.00 26.65  ? 144 ILE A CB    1 
ATOM   1151 C  CG1   . ILE A 1 144 ? -4.073  79.210  23.815  1.00 27.92  ? 144 ILE A CG1   1 
ATOM   1152 C  CG2   . ILE A 1 144 ? -5.956  80.835  23.984  1.00 27.57  ? 144 ILE A CG2   1 
ATOM   1153 C  CD1   . ILE A 1 144 ? -4.447  78.413  22.579  1.00 29.10  ? 144 ILE A CD1   1 
ATOM   1154 N  N     . SER A 1 145 ? -5.701  82.082  27.157  1.00 25.84  ? 145 SER A N     1 
ATOM   1155 C  CA    . SER A 1 145 ? -6.761  82.831  27.810  1.00 25.52  ? 145 SER A CA    1 
ATOM   1156 C  C     . SER A 1 145 ? -6.639  84.324  27.511  1.00 27.58  ? 145 SER A C     1 
ATOM   1157 O  O     . SER A 1 145 ? -5.926  84.726  26.595  1.00 27.87  ? 145 SER A O     1 
ATOM   1158 C  CB    . SER A 1 145 ? -6.800  82.554  29.322  1.00 24.56  ? 145 SER A CB    1 
ATOM   1159 O  OG    . SER A 1 145 ? -8.068  82.921  29.875  1.00 23.50  ? 145 SER A OG    1 
ATOM   1160 N  N     . LYS A 1 146 ? -7.382  85.139  28.260  1.00 28.68  ? 146 LYS A N     1 
ATOM   1161 C  CA    . LYS A 1 146 ? -7.429  86.590  28.037  1.00 29.51  ? 146 LYS A CA    1 
ATOM   1162 C  C     . LYS A 1 146 ? -6.313  87.307  28.818  1.00 29.46  ? 146 LYS A C     1 
ATOM   1163 O  O     . LYS A 1 146 ? -6.131  88.522  28.698  1.00 30.44  ? 146 LYS A O     1 
ATOM   1164 C  CB    . LYS A 1 146 ? -8.805  87.131  28.452  1.00 29.34  ? 146 LYS A CB    1 
ATOM   1165 C  CG    . LYS A 1 146 ? -8.952  87.225  29.961  1.00 28.29  ? 146 LYS A CG    1 
ATOM   1166 C  CD    . LYS A 1 146 ? -10.396 87.307  30.397  1.00 28.63  ? 146 LYS A CD    1 
ATOM   1167 C  CE    . LYS A 1 146 ? -10.958 88.701  30.233  1.00 29.82  ? 146 LYS A CE    1 
ATOM   1168 N  NZ    . LYS A 1 146 ? -12.419 88.653  30.476  1.00 31.17  ? 146 LYS A NZ    1 
ATOM   1169 N  N     . ASN A 1 147 ? -5.577  86.558  29.625  1.00 28.77  ? 147 ASN A N     1 
ATOM   1170 C  CA    . ASN A 1 147 ? -4.438  87.121  30.352  1.00 28.28  ? 147 ASN A CA    1 
ATOM   1171 C  C     . ASN A 1 147 ? -3.414  86.060  30.725  1.00 27.80  ? 147 ASN A C     1 
ATOM   1172 O  O     . ASN A 1 147 ? -3.653  84.874  30.527  1.00 27.12  ? 147 ASN A O     1 
ATOM   1173 C  CB    . ASN A 1 147 ? -4.895  87.980  31.575  1.00 27.59  ? 147 ASN A CB    1 
ATOM   1174 C  CG    . ASN A 1 147 ? -5.468  87.169  32.737  1.00 26.24  ? 147 ASN A CG    1 
ATOM   1175 O  OD1   . ASN A 1 147 ? -4.957  86.112  33.109  1.00 25.94  ? 147 ASN A OD1   1 
ATOM   1176 N  ND2   . ASN A 1 147 ? -6.497  87.716  33.373  1.00 26.72  ? 147 ASN A ND2   1 
ATOM   1177 N  N     . LYS A 1 148 ? -2.278  86.515  31.268  1.00 29.14  ? 148 LYS A N     1 
ATOM   1178 C  CA    . LYS A 1 148 ? -1.137  85.651  31.577  1.00 28.13  ? 148 LYS A CA    1 
ATOM   1179 C  C     . LYS A 1 148 ? -1.470  84.591  32.611  1.00 26.14  ? 148 LYS A C     1 
ATOM   1180 O  O     . LYS A 1 148 ? -1.052  83.420  32.496  1.00 23.56  ? 148 LYS A O     1 
ATOM   1181 C  CB    . LYS A 1 148 ? 0.042   86.466  32.097  1.00 29.56  ? 148 LYS A CB    1 
ATOM   1182 C  CG    . LYS A 1 148 ? 0.833   87.161  30.998  1.00 32.60  ? 148 LYS A CG    1 
ATOM   1183 C  CD    . LYS A 1 148 ? 2.179   87.646  31.500  1.00 31.95  ? 148 LYS A CD    1 
ATOM   1184 C  CE    . LYS A 1 148 ? 2.027   88.916  32.305  1.00 33.02  ? 148 LYS A CE    1 
ATOM   1185 N  NZ    . LYS A 1 148 ? 3.348   89.284  32.888  1.00 33.96  ? 148 LYS A NZ    1 
ATOM   1186 N  N     . VAL A 1 149 ? -2.202  85.018  33.631  1.00 24.43  ? 149 VAL A N     1 
ATOM   1187 C  CA    . VAL A 1 149 ? -2.517  84.141  34.747  1.00 23.06  ? 149 VAL A CA    1 
ATOM   1188 C  C     . VAL A 1 149 ? -3.423  82.979  34.315  1.00 22.35  ? 149 VAL A C     1 
ATOM   1189 O  O     . VAL A 1 149 ? -3.146  81.803  34.622  1.00 22.04  ? 149 VAL A O     1 
ATOM   1190 C  CB    . VAL A 1 149 ? -3.130  84.941  35.916  1.00 22.64  ? 149 VAL A CB    1 
ATOM   1191 C  CG1   . VAL A 1 149 ? -3.555  84.010  37.031  1.00 22.50  ? 149 VAL A CG1   1 
ATOM   1192 C  CG2   . VAL A 1 149 ? -2.108  85.953  36.430  1.00 22.72  ? 149 VAL A CG2   1 
ATOM   1193 N  N     . PHE A 1 150 ? -4.502  83.290  33.626  1.00 22.67  ? 150 PHE A N     1 
ATOM   1194 C  CA    . PHE A 1 150 ? -5.400  82.236  33.159  1.00 23.99  ? 150 PHE A CA    1 
ATOM   1195 C  C     . PHE A 1 150 ? -4.809  81.402  32.020  1.00 23.94  ? 150 PHE A C     1 
ATOM   1196 O  O     . PHE A 1 150 ? -5.127  80.235  31.890  1.00 22.98  ? 150 PHE A O     1 
ATOM   1197 C  CB    . PHE A 1 150 ? -6.791  82.796  32.850  1.00 24.88  ? 150 PHE A CB    1 
ATOM   1198 C  CG    . PHE A 1 150 ? -7.538  83.136  34.094  1.00 25.40  ? 150 PHE A CG    1 
ATOM   1199 C  CD1   . PHE A 1 150 ? -8.036  82.114  34.900  1.00 25.34  ? 150 PHE A CD1   1 
ATOM   1200 C  CD2   . PHE A 1 150 ? -7.640  84.438  34.517  1.00 26.18  ? 150 PHE A CD2   1 
ATOM   1201 C  CE1   . PHE A 1 150 ? -8.689  82.397  36.067  1.00 27.23  ? 150 PHE A CE1   1 
ATOM   1202 C  CE2   . PHE A 1 150 ? -8.295  84.735  35.695  1.00 27.97  ? 150 PHE A CE2   1 
ATOM   1203 C  CZ    . PHE A 1 150 ? -8.815  83.711  36.481  1.00 27.52  ? 150 PHE A CZ    1 
ATOM   1204 N  N     . ALA A 1 151 ? -3.892  81.982  31.252  1.00 25.10  ? 151 ALA A N     1 
ATOM   1205 C  CA    . ALA A 1 151 ? -3.150  81.202  30.255  1.00 24.97  ? 151 ALA A CA    1 
ATOM   1206 C  C     . ALA A 1 151 ? -2.251  80.133  30.928  1.00 24.46  ? 151 ALA A C     1 
ATOM   1207 O  O     . ALA A 1 151 ? -2.178  78.970  30.462  1.00 23.11  ? 151 ALA A O     1 
ATOM   1208 C  CB    . ALA A 1 151 ? -2.335  82.129  29.393  1.00 25.91  ? 151 ALA A CB    1 
ATOM   1209 N  N     . LYS A 1 152 ? -1.611  80.514  32.038  1.00 22.95  ? 152 LYS A N     1 
ATOM   1210 C  CA    . LYS A 1 152 ? -0.793  79.593  32.829  1.00 23.68  ? 152 LYS A CA    1 
ATOM   1211 C  C     . LYS A 1 152 ? -1.607  78.482  33.502  1.00 23.90  ? 152 LYS A C     1 
ATOM   1212 O  O     . LYS A 1 152 ? -1.210  77.320  33.509  1.00 24.75  ? 152 LYS A O     1 
ATOM   1213 C  CB    . LYS A 1 152 ? -0.036  80.340  33.917  1.00 24.17  ? 152 LYS A CB    1 
ATOM   1214 C  CG    . LYS A 1 152 ? 1.003   79.482  34.642  1.00 23.91  ? 152 LYS A CG    1 
ATOM   1215 C  CD    . LYS A 1 152 ? 1.982   80.363  35.383  1.00 24.56  ? 152 LYS A CD    1 
ATOM   1216 C  CE    . LYS A 1 152 ? 3.333   79.712  35.557  1.00 25.73  ? 152 LYS A CE    1 
ATOM   1217 N  NZ    . LYS A 1 152 ? 3.210   78.409  36.232  1.00 26.44  ? 152 LYS A NZ    1 
ATOM   1218 N  N     . ILE A 1 153 ? -2.734  78.849  34.094  1.00 23.60  ? 153 ILE A N     1 
ATOM   1219 C  CA    . ILE A 1 153 ? -3.639  77.876  34.691  1.00 22.88  ? 153 ILE A CA    1 
ATOM   1220 C  C     . ILE A 1 153 ? -4.191  76.896  33.654  1.00 24.12  ? 153 ILE A C     1 
ATOM   1221 O  O     . ILE A 1 153 ? -4.305  75.699  33.929  1.00 23.94  ? 153 ILE A O     1 
ATOM   1222 C  CB    . ILE A 1 153 ? -4.802  78.596  35.388  1.00 23.13  ? 153 ILE A CB    1 
ATOM   1223 C  CG1   . ILE A 1 153 ? -4.288  79.355  36.624  1.00 22.87  ? 153 ILE A CG1   1 
ATOM   1224 C  CG2   . ILE A 1 153 ? -5.887  77.610  35.774  1.00 23.03  ? 153 ILE A CG2   1 
ATOM   1225 C  CD1   . ILE A 1 153 ? -5.177  80.507  37.043  1.00 22.64  ? 153 ILE A CD1   1 
ATOM   1226 N  N     . ALA A 1 154 ? -4.516  77.393  32.459  1.00 24.81  ? 154 ALA A N     1 
ATOM   1227 C  CA    . ALA A 1 154 ? -4.965  76.523  31.370  1.00 26.07  ? 154 ALA A CA    1 
ATOM   1228 C  C     . ALA A 1 154 ? -3.967  75.424  31.128  1.00 26.60  ? 154 ALA A C     1 
ATOM   1229 O  O     . ALA A 1 154 ? -4.328  74.259  31.024  1.00 26.86  ? 154 ALA A O     1 
ATOM   1230 C  CB    . ALA A 1 154 ? -5.161  77.329  30.088  1.00 27.07  ? 154 ALA A CB    1 
ATOM   1231 N  N     . ALA A 1 155 ? -2.695  75.792  31.040  1.00 27.44  ? 155 ALA A N     1 
ATOM   1232 C  CA    . ALA A 1 155 ? -1.672  74.802  30.764  1.00 29.61  ? 155 ALA A CA    1 
ATOM   1233 C  C     . ALA A 1 155 ? -1.557  73.816  31.933  1.00 30.57  ? 155 ALA A C     1 
ATOM   1234 O  O     . ALA A 1 155 ? -1.402  72.623  31.689  1.00 30.57  ? 155 ALA A O     1 
ATOM   1235 C  CB    . ALA A 1 155 ? -0.332  75.459  30.479  1.00 29.46  ? 155 ALA A CB    1 
ATOM   1236 N  N     . ASP A 1 156 ? -1.664  74.309  33.178  1.00 30.22  ? 156 ASP A N     1 
ATOM   1237 C  CA    . ASP A 1 156 ? -1.590  73.448  34.358  1.00 31.73  ? 156 ASP A CA    1 
ATOM   1238 C  C     . ASP A 1 156 ? -2.676  72.398  34.315  1.00 32.08  ? 156 ASP A C     1 
ATOM   1239 O  O     . ASP A 1 156 ? -2.465  71.267  34.723  1.00 34.32  ? 156 ASP A O     1 
ATOM   1240 C  CB    . ASP A 1 156 ? -1.760  74.241  35.663  1.00 32.41  ? 156 ASP A CB    1 
ATOM   1241 C  CG    . ASP A 1 156 ? -0.587  75.150  35.968  1.00 33.42  ? 156 ASP A CG    1 
ATOM   1242 O  OD1   . ASP A 1 156 ? 0.545   74.824  35.581  1.00 35.16  ? 156 ASP A OD1   1 
ATOM   1243 O  OD2   . ASP A 1 156 ? -0.810  76.192  36.622  1.00 35.15  ? 156 ASP A OD2   1 
ATOM   1244 N  N     . MET A 1 157 ? -3.845  72.787  33.838  1.00 32.74  ? 157 MET A N     1 
ATOM   1245 C  CA    . MET A 1 157 ? -4.967  71.865  33.681  1.00 34.22  ? 157 MET A CA    1 
ATOM   1246 C  C     . MET A 1 157 ? -4.781  70.857  32.559  1.00 35.37  ? 157 MET A C     1 
ATOM   1247 O  O     . MET A 1 157 ? -5.369  69.788  32.593  1.00 37.47  ? 157 MET A O     1 
ATOM   1248 C  CB    . MET A 1 157 ? -6.234  72.650  33.393  1.00 34.25  ? 157 MET A CB    1 
ATOM   1249 C  CG    . MET A 1 157 ? -6.743  73.443  34.575  1.00 35.42  ? 157 MET A CG    1 
ATOM   1250 S  SD    . MET A 1 157 ? -8.129  74.486  34.083  1.00 38.71  ? 157 MET A SD    1 
ATOM   1251 C  CE    . MET A 1 157 ? -8.531  75.120  35.705  1.00 39.61  ? 157 MET A CE    1 
ATOM   1252 N  N     . ALA A 1 158 ? -3.995  71.196  31.546  1.00 35.94  ? 158 ALA A N     1 
ATOM   1253 C  CA    . ALA A 1 158 ? -3.933  70.369  30.335  1.00 36.29  ? 158 ALA A CA    1 
ATOM   1254 C  C     . ALA A 1 158 ? -2.669  69.504  30.273  1.00 36.93  ? 158 ALA A C     1 
ATOM   1255 O  O     . ALA A 1 158 ? -2.551  68.671  29.383  1.00 37.36  ? 158 ALA A O     1 
ATOM   1256 C  CB    . ALA A 1 158 ? -4.044  71.253  29.097  1.00 35.31  ? 158 ALA A CB    1 
ATOM   1257 N  N     . LYS A 1 159 ? -1.738  69.700  31.211  1.00 37.31  ? 159 LYS A N     1 
ATOM   1258 C  CA    . LYS A 1 159 ? -0.471  68.930  31.250  1.00 38.67  ? 159 LYS A CA    1 
ATOM   1259 C  C     . LYS A 1 159 ? -0.719  67.443  31.331  1.00 39.97  ? 159 LYS A C     1 
ATOM   1260 O  O     . LYS A 1 159 ? -1.668  67.033  31.982  1.00 42.36  ? 159 LYS A O     1 
ATOM   1261 C  CB    . LYS A 1 159 ? 0.352   69.290  32.483  1.00 39.43  ? 159 LYS A CB    1 
ATOM   1262 C  CG    . LYS A 1 159 ? 1.235   70.484  32.293  1.00 40.76  ? 159 LYS A CG    1 
ATOM   1263 C  CD    . LYS A 1 159 ? 1.931   70.873  33.594  1.00 41.08  ? 159 LYS A CD    1 
ATOM   1264 C  CE    . LYS A 1 159 ? 2.354   72.328  33.492  1.00 41.37  ? 159 LYS A CE    1 
ATOM   1265 N  NZ    . LYS A 1 159 ? 3.507   72.694  34.356  1.00 41.72  ? 159 LYS A NZ    1 
ATOM   1266 N  N     . PRO A 1 160 ? 0.123   66.620  30.680  1.00 40.85  ? 160 PRO A N     1 
ATOM   1267 C  CA    . PRO A 1 160 ? 1.199   66.952  29.751  1.00 40.97  ? 160 PRO A CA    1 
ATOM   1268 C  C     . PRO A 1 160 ? 0.702   66.839  28.303  1.00 41.28  ? 160 PRO A C     1 
ATOM   1269 O  O     . PRO A 1 160 ? -0.434  66.437  28.075  1.00 41.58  ? 160 PRO A O     1 
ATOM   1270 C  CB    . PRO A 1 160 ? 2.257   65.882  30.060  1.00 42.16  ? 160 PRO A CB    1 
ATOM   1271 C  CG    . PRO A 1 160 ? 1.481   64.705  30.588  1.00 44.01  ? 160 PRO A CG    1 
ATOM   1272 C  CD    . PRO A 1 160 ? 0.064   65.161  30.896  1.00 42.66  ? 160 PRO A CD    1 
ATOM   1273 N  N     . ASN A 1 161 ? 1.542   67.209  27.342  1.00 41.11  ? 161 ASN A N     1 
ATOM   1274 C  CA    . ASN A 1 161 ? 1.180   67.187  25.921  1.00 41.24  ? 161 ASN A CA    1 
ATOM   1275 C  C     . ASN A 1 161 ? -0.259  67.642  25.642  1.00 39.22  ? 161 ASN A C     1 
ATOM   1276 O  O     . ASN A 1 161 ? -1.028  66.929  25.016  1.00 39.02  ? 161 ASN A O     1 
ATOM   1277 C  CB    . ASN A 1 161 ? 1.396   65.785  25.363  1.00 43.76  ? 161 ASN A CB    1 
ATOM   1278 C  CG    . ASN A 1 161 ? 1.309   65.739  23.857  1.00 45.44  ? 161 ASN A CG    1 
ATOM   1279 O  OD1   . ASN A 1 161 ? 1.416   66.759  23.173  1.00 45.57  ? 161 ASN A OD1   1 
ATOM   1280 N  ND2   . ASN A 1 161 ? 1.107   64.553  23.332  1.00 48.15  ? 161 ASN A ND2   1 
ATOM   1281 N  N     . GLY A 1 162 ? -0.626  68.821  26.131  1.00 36.70  ? 162 GLY A N     1 
ATOM   1282 C  CA    . GLY A 1 162 ? -1.989  69.296  25.961  1.00 35.30  ? 162 GLY A CA    1 
ATOM   1283 C  C     . GLY A 1 162 ? -2.089  70.673  25.356  1.00 33.75  ? 162 GLY A C     1 
ATOM   1284 O  O     . GLY A 1 162 ? -1.085  71.319  25.070  1.00 33.03  ? 162 GLY A O     1 
ATOM   1285 N  N     . ILE A 1 163 ? -3.333  71.102  25.175  1.00 32.95  ? 163 ILE A N     1 
ATOM   1286 C  CA    . ILE A 1 163 ? -3.654  72.430  24.741  1.00 32.84  ? 163 ILE A CA    1 
ATOM   1287 C  C     . ILE A 1 163 ? -5.044  72.779  25.264  1.00 33.11  ? 163 ILE A C     1 
ATOM   1288 O  O     . ILE A 1 163 ? -5.967  71.986  25.148  1.00 34.72  ? 163 ILE A O     1 
ATOM   1289 C  CB    . ILE A 1 163 ? -3.560  72.533  23.206  1.00 34.58  ? 163 ILE A CB    1 
ATOM   1290 C  CG1   . ILE A 1 163 ? -4.053  73.897  22.707  1.00 34.14  ? 163 ILE A CG1   1 
ATOM   1291 C  CG2   . ILE A 1 163 ? -4.297  71.386  22.518  1.00 35.60  ? 163 ILE A CG2   1 
ATOM   1292 C  CD1   . ILE A 1 163 ? -3.615  74.182  21.275  1.00 36.08  ? 163 ILE A CD1   1 
ATOM   1293 N  N     . LYS A 1 164 ? -5.196  73.949  25.872  1.00 32.19  ? 164 LYS A N     1 
ATOM   1294 C  CA    . LYS A 1 164 ? -6.472  74.315  26.462  1.00 30.84  ? 164 LYS A CA    1 
ATOM   1295 C  C     . LYS A 1 164 ? -6.720  75.806  26.381  1.00 29.34  ? 164 LYS A C     1 
ATOM   1296 O  O     . LYS A 1 164 ? -5.808  76.636  26.597  1.00 28.46  ? 164 LYS A O     1 
ATOM   1297 C  CB    . LYS A 1 164 ? -6.550  73.871  27.925  1.00 31.37  ? 164 LYS A CB    1 
ATOM   1298 C  CG    . LYS A 1 164 ? -7.907  74.149  28.573  1.00 33.05  ? 164 LYS A CG    1 
ATOM   1299 C  CD    . LYS A 1 164 ? -8.096  73.341  29.857  1.00 35.21  ? 164 LYS A CD    1 
ATOM   1300 C  CE    . LYS A 1 164 ? -9.376  73.683  30.624  1.00 35.11  ? 164 LYS A CE    1 
ATOM   1301 N  NZ    . LYS A 1 164 ? -10.518 74.158  29.788  1.00 36.13  ? 164 LYS A NZ    1 
ATOM   1302 N  N     . VAL A 1 165 ? -7.974  76.124  26.088  1.00 27.88  ? 165 VAL A N     1 
ATOM   1303 C  CA    . VAL A 1 165 ? -8.483  77.475  26.112  1.00 27.27  ? 165 VAL A CA    1 
ATOM   1304 C  C     . VAL A 1 165 ? -9.344  77.628  27.336  1.00 25.97  ? 165 VAL A C     1 
ATOM   1305 O  O     . VAL A 1 165 ? -10.205 76.805  27.574  1.00 23.73  ? 165 VAL A O     1 
ATOM   1306 C  CB    . VAL A 1 165 ? -9.394  77.748  24.903  1.00 28.52  ? 165 VAL A CB    1 
ATOM   1307 C  CG1   . VAL A 1 165 ? -10.044 79.122  25.026  1.00 28.16  ? 165 VAL A CG1   1 
ATOM   1308 C  CG2   . VAL A 1 165 ? -8.605  77.612  23.601  1.00 29.65  ? 165 VAL A CG2   1 
ATOM   1309 N  N     . ILE A 1 166 ? -9.102  78.674  28.115  1.00 25.51  ? 166 ILE A N     1 
ATOM   1310 C  CA    . ILE A 1 166 ? -10.055 79.087  29.136  1.00 25.95  ? 166 ILE A CA    1 
ATOM   1311 C  C     . ILE A 1 166 ? -10.697 80.345  28.587  1.00 27.05  ? 166 ILE A C     1 
ATOM   1312 O  O     . ILE A 1 166 ? -10.049 81.414  28.547  1.00 25.98  ? 166 ILE A O     1 
ATOM   1313 C  CB    . ILE A 1 166 ? -9.372  79.377  30.480  1.00 25.93  ? 166 ILE A CB    1 
ATOM   1314 C  CG1   . ILE A 1 166 ? -8.858  78.084  31.108  1.00 26.82  ? 166 ILE A CG1   1 
ATOM   1315 C  CG2   . ILE A 1 166 ? -10.336 80.058  31.444  1.00 25.75  ? 166 ILE A CG2   1 
ATOM   1316 C  CD1   . ILE A 1 166 ? -7.971  78.321  32.313  1.00 26.69  ? 166 ILE A CD1   1 
ATOM   1317 N  N     . ASP A 1 167 ? -11.950 80.214  28.140  1.00 28.47  ? 167 ASP A N     1 
ATOM   1318 C  CA    . ASP A 1 167 ? -12.662 81.337  27.531  1.00 29.96  ? 167 ASP A CA    1 
ATOM   1319 C  C     . ASP A 1 167 ? -13.201 82.304  28.586  1.00 30.84  ? 167 ASP A C     1 
ATOM   1320 O  O     . ASP A 1 167 ? -13.036 82.079  29.791  1.00 29.24  ? 167 ASP A O     1 
ATOM   1321 C  CB    . ASP A 1 167 ? -13.723 80.857  26.505  1.00 31.41  ? 167 ASP A CB    1 
ATOM   1322 C  CG    . ASP A 1 167 ? -14.895 80.084  27.122  1.00 31.44  ? 167 ASP A CG    1 
ATOM   1323 O  OD1   . ASP A 1 167 ? -15.284 80.293  28.302  1.00 31.51  ? 167 ASP A OD1   1 
ATOM   1324 O  OD2   . ASP A 1 167 ? -15.470 79.267  26.379  1.00 30.66  ? 167 ASP A OD2   1 
ATOM   1325 N  N     . ASP A 1 168 ? -13.778 83.414  28.127  1.00 33.39  ? 168 ASP A N     1 
ATOM   1326 C  CA    . ASP A 1 168 ? -14.295 84.443  29.020  1.00 34.84  ? 168 ASP A CA    1 
ATOM   1327 C  C     . ASP A 1 168 ? -15.294 83.899  30.038  1.00 34.62  ? 168 ASP A C     1 
ATOM   1328 O  O     . ASP A 1 168 ? -15.314 84.327  31.193  1.00 33.01  ? 168 ASP A O     1 
ATOM   1329 C  CB    . ASP A 1 168 ? -14.918 85.594  28.206  1.00 37.07  ? 168 ASP A CB    1 
ATOM   1330 C  CG    . ASP A 1 168 ? -13.867 86.462  27.554  1.00 40.12  ? 168 ASP A CG    1 
ATOM   1331 O  OD1   . ASP A 1 168 ? -12.702 86.023  27.440  1.00 41.47  ? 168 ASP A OD1   1 
ATOM   1332 O  OD2   . ASP A 1 168 ? -14.178 87.595  27.157  1.00 45.89  ? 168 ASP A OD2   1 
ATOM   1333 N  N     . GLU A 1 169 ? -16.106 82.936  29.626  1.00 36.01  ? 169 GLU A N     1 
ATOM   1334 C  CA    . GLU A 1 169 ? -17.078 82.347  30.544  1.00 36.74  ? 169 GLU A CA    1 
ATOM   1335 C  C     . GLU A 1 169 ? -16.420 81.438  31.556  1.00 33.78  ? 169 GLU A C     1 
ATOM   1336 O  O     . GLU A 1 169 ? -16.818 81.431  32.706  1.00 30.82  ? 169 GLU A O     1 
ATOM   1337 C  CB    . GLU A 1 169 ? -18.175 81.600  29.788  1.00 40.12  ? 169 GLU A CB    1 
ATOM   1338 C  CG    . GLU A 1 169 ? -19.197 82.559  29.197  1.00 45.14  ? 169 GLU A CG    1 
ATOM   1339 C  CD    . GLU A 1 169 ? -20.146 83.095  30.258  1.00 49.59  ? 169 GLU A CD    1 
ATOM   1340 O  OE1   . GLU A 1 169 ? -20.848 82.261  30.892  1.00 53.55  ? 169 GLU A OE1   1 
ATOM   1341 O  OE2   . GLU A 1 169 ? -20.191 84.331  30.460  1.00 50.84  ? 169 GLU A OE2   1 
ATOM   1342 N  N     . GLU A 1 170 ? -15.424 80.663  31.132  1.00 32.52  ? 170 GLU A N     1 
ATOM   1343 C  CA    . GLU A 1 170 ? -14.704 79.828  32.078  1.00 32.07  ? 170 GLU A CA    1 
ATOM   1344 C  C     . GLU A 1 170 ? -13.861 80.686  33.040  1.00 29.50  ? 170 GLU A C     1 
ATOM   1345 O  O     . GLU A 1 170 ? -13.720 80.328  34.180  1.00 27.46  ? 170 GLU A O     1 
ATOM   1346 C  CB    . GLU A 1 170 ? -13.856 78.740  31.397  1.00 33.90  ? 170 GLU A CB    1 
ATOM   1347 C  CG    . GLU A 1 170 ? -13.234 77.803  32.432  1.00 35.72  ? 170 GLU A CG    1 
ATOM   1348 C  CD    . GLU A 1 170 ? -12.734 76.469  31.907  1.00 39.06  ? 170 GLU A CD    1 
ATOM   1349 O  OE1   . GLU A 1 170 ? -12.420 76.339  30.691  1.00 40.93  ? 170 GLU A OE1   1 
ATOM   1350 O  OE2   . GLU A 1 170 ? -12.634 75.539  32.749  1.00 40.28  ? 170 GLU A OE2   1 
ATOM   1351 N  N     . VAL A 1 171 ? -13.349 81.829  32.595  1.00 28.57  ? 171 VAL A N     1 
ATOM   1352 C  CA    . VAL A 1 171 ? -12.691 82.754  33.516  1.00 29.02  ? 171 VAL A CA    1 
ATOM   1353 C  C     . VAL A 1 171 ? -13.635 83.138  34.652  1.00 30.04  ? 171 VAL A C     1 
ATOM   1354 O  O     . VAL A 1 171 ? -13.272 83.047  35.841  1.00 27.93  ? 171 VAL A O     1 
ATOM   1355 C  CB    . VAL A 1 171 ? -12.173 84.025  32.821  1.00 29.59  ? 171 VAL A CB    1 
ATOM   1356 C  CG1   . VAL A 1 171 ? -11.737 85.074  33.841  1.00 30.11  ? 171 VAL A CG1   1 
ATOM   1357 C  CG2   . VAL A 1 171 ? -10.987 83.686  31.929  1.00 30.38  ? 171 VAL A CG2   1 
ATOM   1358 N  N     . LYS A 1 172 ? -14.848 83.554  34.296  1.00 31.49  ? 172 LYS A N     1 
ATOM   1359 C  CA    . LYS A 1 172 ? -15.825 83.971  35.314  1.00 33.36  ? 172 LYS A CA    1 
ATOM   1360 C  C     . LYS A 1 172 ? -16.100 82.840  36.276  1.00 32.09  ? 172 LYS A C     1 
ATOM   1361 O  O     . LYS A 1 172 ? -16.010 83.038  37.485  1.00 32.72  ? 172 LYS A O     1 
ATOM   1362 C  CB    . LYS A 1 172 ? -17.129 84.456  34.690  1.00 34.96  ? 172 LYS A CB    1 
ATOM   1363 C  CG    . LYS A 1 172 ? -17.002 85.823  34.069  1.00 37.54  ? 172 LYS A CG    1 
ATOM   1364 C  CD    . LYS A 1 172 ? -18.358 86.294  33.568  1.00 42.63  ? 172 LYS A CD    1 
ATOM   1365 C  CE    . LYS A 1 172 ? -18.256 87.032  32.248  1.00 46.02  ? 172 LYS A CE    1 
ATOM   1366 N  NZ    . LYS A 1 172 ? -19.544 86.903  31.497  1.00 49.94  ? 172 LYS A NZ    1 
ATOM   1367 N  N     . ARG A 1 173 ? -16.386 81.654  35.752  1.00 30.19  ? 173 ARG A N     1 
ATOM   1368 C  CA    . ARG A 1 173 ? -16.522 80.489  36.624  1.00 32.25  ? 173 ARG A CA    1 
ATOM   1369 C  C     . ARG A 1 173 ? -15.311 80.254  37.548  1.00 29.46  ? 173 ARG A C     1 
ATOM   1370 O  O     . ARG A 1 173 ? -15.479 80.060  38.758  1.00 28.00  ? 173 ARG A O     1 
ATOM   1371 C  CB    . ARG A 1 173 ? -16.803 79.215  35.826  1.00 35.10  ? 173 ARG A CB    1 
ATOM   1372 C  CG    . ARG A 1 173 ? -17.475 78.138  36.652  1.00 39.52  ? 173 ARG A CG    1 
ATOM   1373 C  CD    . ARG A 1 173 ? -17.532 76.800  35.920  1.00 44.60  ? 173 ARG A CD    1 
ATOM   1374 N  NE    . ARG A 1 173 ? -16.212 76.170  35.911  1.00 48.00  ? 173 ARG A NE    1 
ATOM   1375 C  CZ    . ARG A 1 173 ? -15.474 75.900  34.834  1.00 53.19  ? 173 ARG A CZ    1 
ATOM   1376 N  NH1   . ARG A 1 173 ? -15.912 76.178  33.598  1.00 58.83  ? 173 ARG A NH1   1 
ATOM   1377 N  NH2   . ARG A 1 173 ? -14.271 75.334  35.000  1.00 52.13  ? 173 ARG A NH2   1 
ATOM   1378 N  N     . LEU A 1 174 ? -14.102 80.254  36.983  1.00 26.80  ? 174 LEU A N     1 
ATOM   1379 C  CA    . LEU A 1 174 ? -12.918 79.930  37.779  1.00 26.56  ? 174 LEU A CA    1 
ATOM   1380 C  C     . LEU A 1 174 ? -12.676 80.937  38.891  1.00 25.65  ? 174 LEU A C     1 
ATOM   1381 O  O     . LEU A 1 174 ? -12.269 80.561  39.986  1.00 25.37  ? 174 LEU A O     1 
ATOM   1382 C  CB    . LEU A 1 174 ? -11.657 79.794  36.910  1.00 26.45  ? 174 LEU A CB    1 
ATOM   1383 C  CG    . LEU A 1 174 ? -11.660 78.571  35.990  1.00 27.51  ? 174 LEU A CG    1 
ATOM   1384 C  CD1   . LEU A 1 174 ? -10.483 78.648  35.019  1.00 27.81  ? 174 LEU A CD1   1 
ATOM   1385 C  CD2   . LEU A 1 174 ? -11.631 77.272  36.794  1.00 27.81  ? 174 LEU A CD2   1 
ATOM   1386 N  N     . ILE A 1 175 ? -12.944 82.208  38.604  1.00 25.34  ? 175 ILE A N     1 
ATOM   1387 C  CA    . ILE A 1 175 ? -12.903 83.253  39.609  1.00 26.09  ? 175 ILE A CA    1 
ATOM   1388 C  C     . ILE A 1 175 ? -13.698 82.898  40.864  1.00 25.96  ? 175 ILE A C     1 
ATOM   1389 O  O     . ILE A 1 175 ? -13.255 83.181  41.992  1.00 24.24  ? 175 ILE A O     1 
ATOM   1390 C  CB    . ILE A 1 175 ? -13.427 84.596  39.043  1.00 26.64  ? 175 ILE A CB    1 
ATOM   1391 C  CG1   . ILE A 1 175 ? -12.387 85.192  38.083  1.00 26.01  ? 175 ILE A CG1   1 
ATOM   1392 C  CG2   . ILE A 1 175 ? -13.732 85.567  40.187  1.00 27.18  ? 175 ILE A CG2   1 
ATOM   1393 C  CD1   . ILE A 1 175 ? -12.913 86.321  37.229  1.00 27.43  ? 175 ILE A CD1   1 
ATOM   1394 N  N     . ARG A 1 176 ? -14.872 82.294  40.664  1.00 25.85  ? 176 ARG A N     1 
ATOM   1395 C  CA    . ARG A 1 176 ? -15.677 81.802  41.784  1.00 27.26  ? 176 ARG A CA    1 
ATOM   1396 C  C     . ARG A 1 176 ? -15.241 80.418  42.285  1.00 27.35  ? 176 ARG A C     1 
ATOM   1397 O  O     . ARG A 1 176 ? -15.320 80.145  43.483  1.00 26.34  ? 176 ARG A O     1 
ATOM   1398 C  CB    . ARG A 1 176 ? -17.172 81.744  41.415  1.00 27.96  ? 176 ARG A CB    1 
ATOM   1399 C  CG    . ARG A 1 176 ? -17.858 83.098  41.431  1.00 29.46  ? 176 ARG A CG    1 
ATOM   1400 C  CD    . ARG A 1 176 ? -19.365 82.968  41.186  1.00 30.73  ? 176 ARG A CD    1 
ATOM   1401 N  NE    . ARG A 1 176 ? -19.656 82.236  39.957  1.00 30.43  ? 176 ARG A NE    1 
ATOM   1402 C  CZ    . ARG A 1 176 ? -19.941 80.939  39.863  1.00 30.49  ? 176 ARG A CZ    1 
ATOM   1403 N  NH1   . ARG A 1 176 ? -20.008 80.152  40.926  1.00 30.86  ? 176 ARG A NH1   1 
ATOM   1404 N  NH2   . ARG A 1 176 ? -20.178 80.419  38.665  1.00 31.22  ? 176 ARG A NH2   1 
ATOM   1405 N  N     . GLU A 1 177 ? -14.809 79.548  41.376  1.00 27.52  ? 177 GLU A N     1 
ATOM   1406 C  CA    . GLU A 1 177 ? -14.673 78.126  41.700  1.00 29.90  ? 177 GLU A CA    1 
ATOM   1407 C  C     . GLU A 1 177 ? -13.257 77.596  41.865  1.00 29.15  ? 177 GLU A C     1 
ATOM   1408 O  O     . GLU A 1 177 ? -13.054 76.573  42.510  1.00 29.22  ? 177 GLU A O     1 
ATOM   1409 C  CB    . GLU A 1 177 ? -15.445 77.290  40.682  1.00 32.18  ? 177 GLU A CB    1 
ATOM   1410 C  CG    . GLU A 1 177 ? -16.924 77.625  40.738  1.00 34.97  ? 177 GLU A CG    1 
ATOM   1411 C  CD    . GLU A 1 177 ? -17.820 76.679  39.952  1.00 38.79  ? 177 GLU A CD    1 
ATOM   1412 O  OE1   . GLU A 1 177 ? -17.292 75.801  39.231  1.00 39.27  ? 177 GLU A OE1   1 
ATOM   1413 O  OE2   . GLU A 1 177 ? -19.073 76.837  40.076  1.00 42.52  ? 177 GLU A OE2   1 
ATOM   1414 N  N     . LEU A 1 178 ? -12.269 78.293  41.344  1.00 29.43  ? 178 LEU A N     1 
ATOM   1415 C  CA    . LEU A 1 178 ? -10.893 77.793  41.461  1.00 29.79  ? 178 LEU A CA    1 
ATOM   1416 C  C     . LEU A 1 178 ? -10.306 77.983  42.845  1.00 29.89  ? 178 LEU A C     1 
ATOM   1417 O  O     . LEU A 1 178 ? -10.247 79.112  43.344  1.00 28.02  ? 178 LEU A O     1 
ATOM   1418 C  CB    . LEU A 1 178 ? -9.972  78.486  40.455  1.00 29.30  ? 178 LEU A CB    1 
ATOM   1419 C  CG    . LEU A 1 178 ? -8.561  77.889  40.451  1.00 29.94  ? 178 LEU A CG    1 
ATOM   1420 C  CD1   . LEU A 1 178 ? -8.571  76.441  39.966  1.00 30.69  ? 178 LEU A CD1   1 
ATOM   1421 C  CD2   . LEU A 1 178 ? -7.627  78.733  39.610  1.00 30.09  ? 178 LEU A CD2   1 
ATOM   1422 N  N     . ASP A 1 179 ? -9.848  76.891  43.455  1.00 30.53  ? 179 ASP A N     1 
ATOM   1423 C  CA    A ASP A 1 179 ? -9.129  76.972  44.729  0.60 31.03  ? 179 ASP A CA    1 
ATOM   1424 C  CA    B ASP A 1 179 ? -9.141  76.986  44.730  0.40 31.13  ? 179 ASP A CA    1 
ATOM   1425 C  C     . ASP A 1 179 ? -8.034  78.016  44.569  1.00 30.31  ? 179 ASP A C     1 
ATOM   1426 O  O     . ASP A 1 179 ? -7.235  77.933  43.647  1.00 30.36  ? 179 ASP A O     1 
ATOM   1427 C  CB    A ASP A 1 179 ? -8.521  75.616  45.089  0.60 31.74  ? 179 ASP A CB    1 
ATOM   1428 C  CB    B ASP A 1 179 ? -8.568  75.633  45.155  0.40 31.90  ? 179 ASP A CB    1 
ATOM   1429 C  CG    A ASP A 1 179 ? -7.850  75.604  46.455  0.60 32.64  ? 179 ASP A CG    1 
ATOM   1430 C  CG    B ASP A 1 179 ? -9.636  74.690  45.666  0.40 33.33  ? 179 ASP A CG    1 
ATOM   1431 O  OD1   A ASP A 1 179 ? -7.642  76.674  47.074  0.60 32.79  ? 179 ASP A OD1   1 
ATOM   1432 O  OD1   B ASP A 1 179 ? -10.681 75.189  46.135  0.40 33.99  ? 179 ASP A OD1   1 
ATOM   1433 O  OD2   A ASP A 1 179 ? -7.519  74.494  46.907  0.60 33.71  ? 179 ASP A OD2   1 
ATOM   1434 O  OD2   B ASP A 1 179 ? -9.433  73.457  45.597  0.40 33.95  ? 179 ASP A OD2   1 
ATOM   1435 N  N     . ILE A 1 180 ? -8.000  78.996  45.458  1.00 30.81  ? 180 ILE A N     1 
ATOM   1436 C  CA    . ILE A 1 180 ? -7.104  80.133  45.283  1.00 30.35  ? 180 ILE A CA    1 
ATOM   1437 C  C     . ILE A 1 180 ? -5.633  79.730  45.420  1.00 30.31  ? 180 ILE A C     1 
ATOM   1438 O  O     . ILE A 1 180 ? -4.754  80.390  44.882  1.00 32.16  ? 180 ILE A O     1 
ATOM   1439 C  CB    . ILE A 1 180 ? -7.495  81.286  46.228  1.00 31.39  ? 180 ILE A CB    1 
ATOM   1440 C  CG1   . ILE A 1 180 ? -6.939  82.607  45.706  1.00 31.22  ? 180 ILE A CG1   1 
ATOM   1441 C  CG2   . ILE A 1 180 ? -7.064  81.005  47.661  1.00 31.76  ? 180 ILE A CG2   1 
ATOM   1442 C  CD1   . ILE A 1 180 ? -7.526  83.792  46.417  1.00 32.95  ? 180 ILE A CD1   1 
ATOM   1443 N  N     . ALA A 1 181 ? -5.389  78.631  46.118  1.00 29.68  ? 181 ALA A N     1 
ATOM   1444 C  CA    . ALA A 1 181 ? -4.078  77.980  46.163  1.00 30.37  ? 181 ALA A CA    1 
ATOM   1445 C  C     . ALA A 1 181 ? -3.493  77.645  44.780  1.00 29.90  ? 181 ALA A C     1 
ATOM   1446 O  O     . ALA A 1 181 ? -2.278  77.627  44.614  1.00 29.46  ? 181 ALA A O     1 
ATOM   1447 C  CB    . ALA A 1 181 ? -4.171  76.702  47.011  1.00 30.98  ? 181 ALA A CB    1 
ATOM   1448 N  N     . ASP A 1 182 ? -4.356  77.385  43.795  1.00 30.42  ? 182 ASP A N     1 
ATOM   1449 C  CA    . ASP A 1 182 ? -3.907  77.098  42.434  1.00 30.28  ? 182 ASP A CA    1 
ATOM   1450 C  C     . ASP A 1 182 ? -3.620  78.336  41.581  1.00 27.65  ? 182 ASP A C     1 
ATOM   1451 O  O     . ASP A 1 182 ? -3.233  78.216  40.417  1.00 27.41  ? 182 ASP A O     1 
ATOM   1452 C  CB    . ASP A 1 182 ? -4.927  76.178  41.728  1.00 31.69  ? 182 ASP A CB    1 
ATOM   1453 C  CG    . ASP A 1 182 ? -5.003  74.793  42.364  1.00 34.32  ? 182 ASP A CG    1 
ATOM   1454 O  OD1   . ASP A 1 182 ? -4.080  74.452  43.101  1.00 37.13  ? 182 ASP A OD1   1 
ATOM   1455 O  OD2   . ASP A 1 182 ? -5.979  74.034  42.133  1.00 39.53  ? 182 ASP A OD2   1 
ATOM   1456 N  N     . VAL A 1 183 ? -3.782  79.523  42.140  1.00 26.69  ? 183 VAL A N     1 
ATOM   1457 C  CA    . VAL A 1 183 ? -3.419  80.750  41.421  1.00 25.68  ? 183 VAL A CA    1 
ATOM   1458 C  C     . VAL A 1 183 ? -1.909  80.999  41.492  1.00 25.76  ? 183 VAL A C     1 
ATOM   1459 O  O     . VAL A 1 183 ? -1.369  81.043  42.595  1.00 26.16  ? 183 VAL A O     1 
ATOM   1460 C  CB    . VAL A 1 183 ? -4.141  81.972  42.037  1.00 25.53  ? 183 VAL A CB    1 
ATOM   1461 C  CG1   . VAL A 1 183 ? -3.707  83.265  41.361  1.00 24.88  ? 183 VAL A CG1   1 
ATOM   1462 C  CG2   . VAL A 1 183 ? -5.649  81.785  41.920  1.00 25.87  ? 183 VAL A CG2   1 
ATOM   1463 N  N     . PRO A 1 184 ? -1.228  81.182  40.334  1.00 25.27  ? 184 PRO A N     1 
ATOM   1464 C  CA    . PRO A 1 184 ? 0.224   81.483  40.348  1.00 24.81  ? 184 PRO A CA    1 
ATOM   1465 C  C     . PRO A 1 184 ? 0.566   82.612  41.328  1.00 25.95  ? 184 PRO A C     1 
ATOM   1466 O  O     . PRO A 1 184 ? -0.136  83.631  41.382  1.00 28.00  ? 184 PRO A O     1 
ATOM   1467 C  CB    . PRO A 1 184 ? 0.510   81.923  38.896  1.00 24.84  ? 184 PRO A CB    1 
ATOM   1468 C  CG    . PRO A 1 184 ? -0.545  81.207  38.072  1.00 25.78  ? 184 PRO A CG    1 
ATOM   1469 C  CD    . PRO A 1 184 ? -1.764  81.074  38.954  1.00 25.27  ? 184 PRO A CD    1 
ATOM   1470 N  N     . GLY A 1 185 ? 1.610   82.423  42.116  1.00 25.91  ? 185 GLY A N     1 
ATOM   1471 C  CA    . GLY A 1 185 ? 2.055   83.446  43.081  1.00 24.81  ? 185 GLY A CA    1 
ATOM   1472 C  C     . GLY A 1 185 ? 1.571   83.144  44.478  1.00 25.90  ? 185 GLY A C     1 
ATOM   1473 O  O     . GLY A 1 185 ? 2.071   83.740  45.442  1.00 27.86  ? 185 GLY A O     1 
ATOM   1474 N  N     . ILE A 1 186 ? 0.632   82.204  44.603  1.00 24.43  ? 186 ILE A N     1 
ATOM   1475 C  CA    . ILE A 1 186 ? 0.090   81.817  45.887  1.00 25.80  ? 186 ILE A CA    1 
ATOM   1476 C  C     . ILE A 1 186 ? 0.614   80.448  46.323  1.00 26.90  ? 186 ILE A C     1 
ATOM   1477 O  O     . ILE A 1 186 ? 0.203   79.428  45.775  1.00 28.02  ? 186 ILE A O     1 
ATOM   1478 C  CB    . ILE A 1 186 ? -1.460  81.738  45.845  1.00 25.58  ? 186 ILE A CB    1 
ATOM   1479 C  CG1   . ILE A 1 186 ? -2.060  83.061  45.395  1.00 25.74  ? 186 ILE A CG1   1 
ATOM   1480 C  CG2   . ILE A 1 186 ? -2.022  81.298  47.200  1.00 26.09  ? 186 ILE A CG2   1 
ATOM   1481 C  CD1   . ILE A 1 186 ? -1.573  84.269  46.153  1.00 26.46  ? 186 ILE A CD1   1 
ATOM   1482 N  N     . GLY A 1 187 ? 1.478   80.424  47.335  1.00 28.02  ? 187 GLY A N     1 
ATOM   1483 C  CA    . GLY A 1 187 ? 2.032   79.172  47.861  1.00 28.89  ? 187 GLY A CA    1 
ATOM   1484 C  C     . GLY A 1 187 ? 1.290   78.687  49.100  1.00 31.07  ? 187 GLY A C     1 
ATOM   1485 O  O     . GLY A 1 187 ? 0.282   79.292  49.534  1.00 30.16  ? 187 GLY A O     1 
ATOM   1486 N  N     . ASN A 1 188 ? 1.773   77.585  49.665  1.00 32.78  ? 188 ASN A N     1 
ATOM   1487 C  CA    . ASN A 1 188 ? 1.146   77.007  50.862  1.00 36.77  ? 188 ASN A CA    1 
ATOM   1488 C  C     . ASN A 1 188 ? 0.985   78.043  51.982  1.00 35.80  ? 188 ASN A C     1 
ATOM   1489 O  O     . ASN A 1 188 ? -0.070  78.149  52.586  1.00 34.67  ? 188 ASN A O     1 
ATOM   1490 C  CB    . ASN A 1 188 ? 1.956   75.816  51.387  1.00 41.92  ? 188 ASN A CB    1 
ATOM   1491 C  CG    . ASN A 1 188 ? 1.915   74.610  50.454  1.00 46.00  ? 188 ASN A CG    1 
ATOM   1492 O  OD1   . ASN A 1 188 ? 0.851   74.201  49.968  1.00 48.26  ? 188 ASN A OD1   1 
ATOM   1493 N  ND2   . ASN A 1 188 ? 3.085   74.009  50.224  1.00 50.01  ? 188 ASN A ND2   1 
ATOM   1494 N  N     . ILE A 1 189 ? 2.031   78.826  52.236  1.00 34.40  ? 189 ILE A N     1 
ATOM   1495 C  CA    . ILE A 1 189 ? 1.982   79.807  53.334  1.00 34.98  ? 189 ILE A CA    1 
ATOM   1496 C  C     . ILE A 1 189 ? 0.918   80.880  53.104  1.00 33.15  ? 189 ILE A C     1 
ATOM   1497 O  O     . ILE A 1 189 ? 0.158   81.169  54.006  1.00 32.57  ? 189 ILE A O     1 
ATOM   1498 C  CB    . ILE A 1 189 ? 3.358   80.447  53.597  1.00 35.84  ? 189 ILE A CB    1 
ATOM   1499 C  CG1   . ILE A 1 189 ? 4.344   79.381  54.107  1.00 36.43  ? 189 ILE A CG1   1 
ATOM   1500 C  CG2   . ILE A 1 189 ? 3.252   81.569  54.624  1.00 38.34  ? 189 ILE A CG2   1 
ATOM   1501 C  CD1   . ILE A 1 189 ? 5.791   79.763  53.887  1.00 35.71  ? 189 ILE A CD1   1 
ATOM   1502 N  N     . THR A 1 190 ? 0.852   81.456  51.903  1.00 29.97  ? 190 THR A N     1 
ATOM   1503 C  CA    . THR A 1 190 ? -0.177  82.440  51.623  1.00 30.39  ? 190 THR A CA    1 
ATOM   1504 C  C     . THR A 1 190 ? -1.567  81.800  51.645  1.00 30.67  ? 190 THR A C     1 
ATOM   1505 O  O     . THR A 1 190 ? -2.487  82.363  52.227  1.00 30.82  ? 190 THR A O     1 
ATOM   1506 C  CB    . THR A 1 190 ? 0.030   83.142  50.283  1.00 28.98  ? 190 THR A CB    1 
ATOM   1507 O  OG1   . THR A 1 190 ? 1.358   83.628  50.239  1.00 29.79  ? 190 THR A OG1   1 
ATOM   1508 C  CG2   . THR A 1 190 ? -0.924  84.302  50.124  1.00 30.66  ? 190 THR A CG2   1 
ATOM   1509 N  N     . ALA A 1 191 ? -1.707  80.622  51.043  1.00 30.74  ? 191 ALA A N     1 
ATOM   1510 C  CA    . ALA A 1 191 ? -2.998  79.911  51.065  1.00 32.26  ? 191 ALA A CA    1 
ATOM   1511 C  C     . ALA A 1 191 ? -3.543  79.748  52.498  1.00 34.47  ? 191 ALA A C     1 
ATOM   1512 O  O     . ALA A 1 191 ? -4.744  79.920  52.754  1.00 34.77  ? 191 ALA A O     1 
ATOM   1513 C  CB    . ALA A 1 191 ? -2.863  78.551  50.405  1.00 31.36  ? 191 ALA A CB    1 
ATOM   1514 N  N     . GLU A 1 192 ? -2.663  79.377  53.414  1.00 35.58  ? 192 GLU A N     1 
ATOM   1515 C  CA    . GLU A 1 192 ? -3.046  79.193  54.799  1.00 39.41  ? 192 GLU A CA    1 
ATOM   1516 C  C     . GLU A 1 192 ? -3.447  80.520  55.463  1.00 39.08  ? 192 GLU A C     1 
ATOM   1517 O  O     . GLU A 1 192 ? -4.405  80.556  56.238  1.00 41.19  ? 192 GLU A O     1 
ATOM   1518 C  CB    . GLU A 1 192 ? -1.923  78.506  55.596  1.00 42.92  ? 192 GLU A CB    1 
ATOM   1519 C  CG    . GLU A 1 192 ? -2.099  77.005  55.736  1.00 46.96  ? 192 GLU A CG    1 
ATOM   1520 C  CD    . GLU A 1 192 ? -3.309  76.660  56.579  1.00 53.47  ? 192 GLU A CD    1 
ATOM   1521 O  OE1   . GLU A 1 192 ? -3.311  77.046  57.771  1.00 64.24  ? 192 GLU A OE1   1 
ATOM   1522 O  OE2   . GLU A 1 192 ? -4.264  76.027  56.063  1.00 54.26  ? 192 GLU A OE2   1 
ATOM   1523 N  N     . LYS A 1 193 ? -2.726  81.602  55.181  1.00 35.63  ? 193 LYS A N     1 
ATOM   1524 C  CA    . LYS A 1 193 ? -3.146  82.904  55.702  1.00 35.98  ? 193 LYS A CA    1 
ATOM   1525 C  C     . LYS A 1 193 ? -4.505  83.246  55.116  1.00 35.10  ? 193 LYS A C     1 
ATOM   1526 O  O     . LYS A 1 193 ? -5.416  83.612  55.830  1.00 35.20  ? 193 LYS A O     1 
ATOM   1527 C  CB    . LYS A 1 193 ? -2.157  84.006  55.344  1.00 35.71  ? 193 LYS A CB    1 
ATOM   1528 C  CG    . LYS A 1 193 ? -0.833  83.940  56.102  1.00 36.18  ? 193 LYS A CG    1 
ATOM   1529 C  CD    . LYS A 1 193 ? 0.207   84.767  55.382  1.00 35.58  ? 193 LYS A CD    1 
ATOM   1530 C  CE    . LYS A 1 193 ? 1.562   84.657  56.061  1.00 36.53  ? 193 LYS A CE    1 
ATOM   1531 N  NZ    . LYS A 1 193 ? 2.504   85.633  55.463  1.00 35.98  ? 193 LYS A NZ    1 
ATOM   1532 N  N     . LEU A 1 194 ? -4.624  83.122  53.796  1.00 33.60  ? 194 LEU A N     1 
ATOM   1533 C  CA    . LEU A 1 194 ? -5.868  83.455  53.118  1.00 33.83  ? 194 LEU A CA    1 
ATOM   1534 C  C     . LEU A 1 194 ? -7.029  82.670  53.699  1.00 35.63  ? 194 LEU A C     1 
ATOM   1535 O  O     . LEU A 1 194 ? -8.064  83.249  54.059  1.00 37.07  ? 194 LEU A O     1 
ATOM   1536 C  CB    . LEU A 1 194 ? -5.741  83.218  51.625  1.00 31.91  ? 194 LEU A CB    1 
ATOM   1537 C  CG    . LEU A 1 194 ? -4.872  84.248  50.910  1.00 30.74  ? 194 LEU A CG    1 
ATOM   1538 C  CD1   . LEU A 1 194 ? -4.664  83.863  49.458  1.00 28.73  ? 194 LEU A CD1   1 
ATOM   1539 C  CD2   . LEU A 1 194 ? -5.457  85.650  51.036  1.00 32.39  ? 194 LEU A CD2   1 
ATOM   1540 N  N     . LYS A 1 195 ? -6.832  81.367  53.862  1.00 36.17  ? 195 LYS A N     1 
ATOM   1541 C  CA    . LYS A 1 195 ? -7.896  80.508  54.380  1.00 39.27  ? 195 LYS A CA    1 
ATOM   1542 C  C     . LYS A 1 195 ? -8.401  80.958  55.760  1.00 40.47  ? 195 LYS A C     1 
ATOM   1543 O  O     . LYS A 1 195 ? -9.592  80.896  56.028  1.00 40.13  ? 195 LYS A O     1 
ATOM   1544 C  CB    . LYS A 1 195 ? -7.435  79.051  54.433  1.00 41.90  ? 195 LYS A CB    1 
ATOM   1545 C  CG    . LYS A 1 195 ? -8.418  78.114  55.127  1.00 46.91  ? 195 LYS A CG    1 
ATOM   1546 C  CD    . LYS A 1 195 ? -7.930  76.676  55.075  1.00 49.52  ? 195 LYS A CD    1 
ATOM   1547 C  CE    . LYS A 1 195 ? -8.910  75.738  55.752  1.00 53.18  ? 195 LYS A CE    1 
ATOM   1548 N  NZ    . LYS A 1 195 ? -8.706  74.343  55.275  1.00 54.61  ? 195 LYS A NZ    1 
ATOM   1549 N  N     . LYS A 1 196 ? -7.512  81.418  56.630  1.00 39.99  ? 196 LYS A N     1 
ATOM   1550 C  CA    . LYS A 1 196 ? -7.926  81.821  57.975  1.00 43.24  ? 196 LYS A CA    1 
ATOM   1551 C  C     . LYS A 1 196 ? -8.714  83.125  57.969  1.00 43.46  ? 196 LYS A C     1 
ATOM   1552 O  O     . LYS A 1 196 ? -9.423  83.414  58.918  1.00 44.92  ? 196 LYS A O     1 
ATOM   1553 C  CB    . LYS A 1 196 ? -6.707  81.991  58.882  1.00 45.16  ? 196 LYS A CB    1 
ATOM   1554 C  CG    . LYS A 1 196 ? -5.980  80.697  59.210  1.00 46.54  ? 196 LYS A CG    1 
ATOM   1555 C  CD    . LYS A 1 196 ? -4.537  80.973  59.639  1.00 47.51  ? 196 LYS A CD    1 
ATOM   1556 C  CE    . LYS A 1 196 ? -4.105  80.081  60.783  1.00 49.80  ? 196 LYS A CE    1 
ATOM   1557 N  NZ    . LYS A 1 196 ? -2.895  80.622  61.468  1.00 51.40  ? 196 LYS A NZ    1 
ATOM   1558 N  N     . LEU A 1 197 ? -8.542  83.927  56.920  1.00 42.04  ? 197 LEU A N     1 
ATOM   1559 C  CA    . LEU A 1 197 ? -9.357  85.119  56.698  1.00 42.13  ? 197 LEU A CA    1 
ATOM   1560 C  C     . LEU A 1 197 ? -10.655 84.841  55.927  1.00 41.31  ? 197 LEU A C     1 
ATOM   1561 O  O     . LEU A 1 197 ? -11.401 85.764  55.636  1.00 42.15  ? 197 LEU A O     1 
ATOM   1562 C  CB    . LEU A 1 197 ? -8.559  86.159  55.919  1.00 41.03  ? 197 LEU A CB    1 
ATOM   1563 C  CG    . LEU A 1 197 ? -7.247  86.649  56.491  1.00 42.16  ? 197 LEU A CG    1 
ATOM   1564 C  CD1   . LEU A 1 197 ? -6.705  87.691  55.529  1.00 41.71  ? 197 LEU A CD1   1 
ATOM   1565 C  CD2   . LEU A 1 197 ? -7.417  87.221  57.896  1.00 44.93  ? 197 LEU A CD2   1 
ATOM   1566 N  N     . GLY A 1 198 ? -10.915 83.584  55.583  1.00 40.38  ? 198 GLY A N     1 
ATOM   1567 C  CA    . GLY A 1 198 ? -12.146 83.195  54.891  1.00 39.24  ? 198 GLY A CA    1 
ATOM   1568 C  C     . GLY A 1 198 ? -12.047 83.357  53.380  1.00 36.95  ? 198 GLY A C     1 
ATOM   1569 O  O     . GLY A 1 198 ? -13.034 83.651  52.706  1.00 36.66  ? 198 GLY A O     1 
ATOM   1570 N  N     . ILE A 1 199 ? -10.853 83.179  52.844  1.00 35.15  ? 199 ILE A N     1 
ATOM   1571 C  CA    . ILE A 1 199 ? -10.596 83.441  51.439  1.00 33.76  ? 199 ILE A CA    1 
ATOM   1572 C  C     . ILE A 1 199 ? -10.074 82.171  50.817  1.00 32.54  ? 199 ILE A C     1 
ATOM   1573 O  O     . ILE A 1 199 ? -8.915  81.818  50.982  1.00 32.42  ? 199 ILE A O     1 
ATOM   1574 C  CB    . ILE A 1 199 ? -9.604  84.593  51.256  1.00 33.41  ? 199 ILE A CB    1 
ATOM   1575 C  CG1   . ILE A 1 199 ? -10.270 85.900  51.686  1.00 35.99  ? 199 ILE A CG1   1 
ATOM   1576 C  CG2   . ILE A 1 199 ? -9.159  84.694  49.808  1.00 31.68  ? 199 ILE A CG2   1 
ATOM   1577 C  CD1   . ILE A 1 199 ? -9.297  87.052  51.724  1.00 37.23  ? 199 ILE A CD1   1 
ATOM   1578 N  N     . ASN A 1 200 ? -10.966 81.456  50.151  1.00 32.06  ? 200 ASN A N     1 
ATOM   1579 C  CA    . ASN A 1 200 ? -10.613 80.186  49.534  1.00 31.32  ? 200 ASN A CA    1 
ATOM   1580 C  C     . ASN A 1 200 ? -10.688 80.228  48.028  1.00 29.50  ? 200 ASN A C     1 
ATOM   1581 O  O     . ASN A 1 200 ? -10.236 79.305  47.361  1.00 30.37  ? 200 ASN A O     1 
ATOM   1582 C  CB    . ASN A 1 200 ? -11.519 79.113  50.092  1.00 32.43  ? 200 ASN A CB    1 
ATOM   1583 C  CG    . ASN A 1 200 ? -11.314 78.939  51.573  1.00 34.75  ? 200 ASN A CG    1 
ATOM   1584 O  OD1   . ASN A 1 200 ? -10.294 78.425  51.989  1.00 36.04  ? 200 ASN A OD1   1 
ATOM   1585 N  ND2   . ASN A 1 200 ? -12.257 79.415  52.377  1.00 36.82  ? 200 ASN A ND2   1 
ATOM   1586 N  N     . LYS A 1 201 ? -11.238 81.306  47.496  1.00 28.91  ? 201 LYS A N     1 
ATOM   1587 C  CA    . LYS A 1 201 ? -11.461 81.444  46.067  1.00 28.97  ? 201 LYS A CA    1 
ATOM   1588 C  C     . LYS A 1 201 ? -11.172 82.880  45.730  1.00 27.43  ? 201 LYS A C     1 
ATOM   1589 O  O     . LYS A 1 201 ? -11.341 83.752  46.582  1.00 28.29  ? 201 LYS A O     1 
ATOM   1590 C  CB    . LYS A 1 201 ? -12.924 81.169  45.702  1.00 29.97  ? 201 LYS A CB    1 
ATOM   1591 C  CG    . LYS A 1 201 ? -13.523 79.899  46.264  1.00 31.93  ? 201 LYS A CG    1 
ATOM   1592 C  CD    . LYS A 1 201 ? -13.042 78.678  45.503  1.00 32.24  ? 201 LYS A CD    1 
ATOM   1593 C  CE    . LYS A 1 201 ? -13.745 77.431  46.010  1.00 33.25  ? 201 LYS A CE    1 
ATOM   1594 N  NZ    . LYS A 1 201 ? -13.166 76.242  45.335  1.00 34.18  ? 201 LYS A NZ    1 
ATOM   1595 N  N     . LEU A 1 202 ? -10.776 83.123  44.490  1.00 25.15  ? 202 LEU A N     1 
ATOM   1596 C  CA    . LEU A 1 202 ? -10.494 84.476  44.043  1.00 24.72  ? 202 LEU A CA    1 
ATOM   1597 C  C     . LEU A 1 202 ? -11.594 85.456  44.427  1.00 26.04  ? 202 LEU A C     1 
ATOM   1598 O  O     . LEU A 1 202 ? -11.329 86.528  44.993  1.00 26.80  ? 202 LEU A O     1 
ATOM   1599 C  CB    . LEU A 1 202 ? -10.288 84.496  42.529  1.00 23.58  ? 202 LEU A CB    1 
ATOM   1600 C  CG    . LEU A 1 202 ? -8.852  84.258  42.080  1.00 22.83  ? 202 LEU A CG    1 
ATOM   1601 C  CD1   . LEU A 1 202 ? -8.832  84.219  40.562  1.00 22.07  ? 202 LEU A CD1   1 
ATOM   1602 C  CD2   . LEU A 1 202 ? -7.942  85.342  42.639  1.00 22.82  ? 202 LEU A CD2   1 
ATOM   1603 N  N     . VAL A 1 203 ? -12.833 85.071  44.138  1.00 26.13  ? 203 VAL A N     1 
ATOM   1604 C  CA    . VAL A 1 203 ? -13.975 85.957  44.352  1.00 27.50  ? 203 VAL A CA    1 
ATOM   1605 C  C     . VAL A 1 203 ? -14.057 86.480  45.789  1.00 28.55  ? 203 VAL A C     1 
ATOM   1606 O  O     . VAL A 1 203 ? -14.548 87.594  46.007  1.00 29.33  ? 203 VAL A O     1 
ATOM   1607 C  CB    . VAL A 1 203 ? -15.319 85.295  43.944  1.00 27.52  ? 203 VAL A CB    1 
ATOM   1608 C  CG1   . VAL A 1 203 ? -15.658 84.111  44.862  1.00 27.88  ? 203 VAL A CG1   1 
ATOM   1609 C  CG2   . VAL A 1 203 ? -16.436 86.339  43.964  1.00 29.01  ? 203 VAL A CG2   1 
ATOM   1610 N  N     . ASP A 1 204 ? -13.558 85.692  46.749  1.00 28.58  ? 204 ASP A N     1 
ATOM   1611 C  CA    . ASP A 1 204 ? -13.652 86.017  48.178  1.00 30.00  ? 204 ASP A CA    1 
ATOM   1612 C  C     . ASP A 1 204 ? -12.895 87.306  48.531  1.00 30.18  ? 204 ASP A C     1 
ATOM   1613 O  O     . ASP A 1 204 ? -13.259 88.018  49.469  1.00 30.97  ? 204 ASP A O     1 
ATOM   1614 C  CB    . ASP A 1 204 ? -13.121 84.851  49.043  1.00 30.55  ? 204 ASP A CB    1 
ATOM   1615 C  CG    . ASP A 1 204 ? -13.978 83.562  48.934  1.00 31.56  ? 204 ASP A CG    1 
ATOM   1616 O  OD1   . ASP A 1 204 ? -15.219 83.646  48.705  1.00 31.56  ? 204 ASP A OD1   1 
ATOM   1617 O  OD2   . ASP A 1 204 ? -13.400 82.451  49.122  1.00 31.14  ? 204 ASP A OD2   1 
ATOM   1618 N  N     . THR A 1 205 ? -11.839 87.598  47.781  1.00 29.24  ? 205 THR A N     1 
ATOM   1619 C  CA    . THR A 1 205 ? -11.068 88.834  47.991  1.00 29.79  ? 205 THR A CA    1 
ATOM   1620 C  C     . THR A 1 205 ? -11.904 90.103  47.790  1.00 31.60  ? 205 THR A C     1 
ATOM   1621 O  O     . THR A 1 205 ? -11.487 91.186  48.225  1.00 32.85  ? 205 THR A O     1 
ATOM   1622 C  CB    . THR A 1 205 ? -9.816  88.922  47.079  1.00 27.85  ? 205 THR A CB    1 
ATOM   1623 O  OG1   . THR A 1 205 ? -10.207 88.970  45.712  1.00 26.70  ? 205 THR A OG1   1 
ATOM   1624 C  CG2   . THR A 1 205 ? -8.900  87.741  47.286  1.00 26.54  ? 205 THR A CG2   1 
ATOM   1625 N  N     . LEU A 1 206 ? -13.057 89.970  47.133  1.00 31.68  ? 206 LEU A N     1 
ATOM   1626 C  CA    . LEU A 1 206 ? -13.998 91.085  46.933  1.00 34.10  ? 206 LEU A CA    1 
ATOM   1627 C  C     . LEU A 1 206 ? -14.970 91.317  48.099  1.00 35.87  ? 206 LEU A C     1 
ATOM   1628 O  O     . LEU A 1 206 ? -15.683 92.315  48.095  1.00 37.46  ? 206 LEU A O     1 
ATOM   1629 C  CB    . LEU A 1 206 ? -14.805 90.891  45.624  1.00 33.75  ? 206 LEU A CB    1 
ATOM   1630 C  CG    . LEU A 1 206 ? -13.929 90.762  44.365  1.00 32.55  ? 206 LEU A CG    1 
ATOM   1631 C  CD1   . LEU A 1 206 ? -14.728 90.434  43.115  1.00 32.29  ? 206 LEU A CD1   1 
ATOM   1632 C  CD2   . LEU A 1 206 ? -13.114 92.024  44.147  1.00 33.32  ? 206 LEU A CD2   1 
ATOM   1633 N  N     . SER A 1 207 ? -14.981 90.424  49.091  1.00 36.14  ? 207 SER A N     1 
ATOM   1634 C  CA    . SER A 1 207 ? -15.863 90.556  50.248  1.00 38.83  ? 207 SER A CA    1 
ATOM   1635 C  C     . SER A 1 207 ? -15.109 90.660  51.567  1.00 40.22  ? 207 SER A C     1 
ATOM   1636 O  O     . SER A 1 207 ? -15.681 90.437  52.633  1.00 41.42  ? 207 SER A O     1 
ATOM   1637 C  CB    . SER A 1 207 ? -16.892 89.402  50.282  1.00 39.48  ? 207 SER A CB    1 
ATOM   1638 O  OG    . SER A 1 207 ? -16.260 88.135  50.175  1.00 38.16  ? 207 SER A OG    1 
ATOM   1639 N  N     . ILE A 1 208 ? -13.827 91.020  51.494  1.00 39.82  ? 208 ILE A N     1 
ATOM   1640 C  CA    . ILE A 1 208 ? -13.044 91.357  52.681  1.00 41.43  ? 208 ILE A CA    1 
ATOM   1641 C  C     . ILE A 1 208 ? -12.571 92.815  52.576  1.00 42.64  ? 208 ILE A C     1 
ATOM   1642 O  O     . ILE A 1 208 ? -12.370 93.319  51.476  1.00 40.97  ? 208 ILE A O     1 
ATOM   1643 C  CB    . ILE A 1 208 ? -11.816 90.420  52.832  1.00 39.67  ? 208 ILE A CB    1 
ATOM   1644 C  CG1   . ILE A 1 208 ? -11.186 90.580  54.217  1.00 41.44  ? 208 ILE A CG1   1 
ATOM   1645 C  CG2   . ILE A 1 208 ? -10.803 90.673  51.738  1.00 37.47  ? 208 ILE A CG2   1 
ATOM   1646 C  CD1   . ILE A 1 208 ? -10.035 89.632  54.488  1.00 40.74  ? 208 ILE A CD1   1 
ATOM   1647 N  N     . GLU A 1 209 ? -12.384 93.475  53.715  1.00 44.70  ? 209 GLU A N     1 
ATOM   1648 C  CA    . GLU A 1 209 ? -11.743 94.795  53.737  1.00 46.95  ? 209 GLU A CA    1 
ATOM   1649 C  C     . GLU A 1 209 ? -10.332 94.725  53.166  1.00 45.02  ? 209 GLU A C     1 
ATOM   1650 O  O     . GLU A 1 209 ? -9.531  93.886  53.580  1.00 42.83  ? 209 GLU A O     1 
ATOM   1651 C  CB    . GLU A 1 209 ? -11.688 95.368  55.163  1.00 50.59  ? 209 GLU A CB    1 
ATOM   1652 C  CG    . GLU A 1 209 ? -13.046 95.772  55.706  1.00 55.03  ? 209 GLU A CG    1 
ATOM   1653 C  CD    . GLU A 1 209 ? -13.647 96.956  54.964  1.00 57.75  ? 209 GLU A CD    1 
ATOM   1654 O  OE1   . GLU A 1 209 ? -12.932 97.969  54.807  1.00 60.76  ? 209 GLU A OE1   1 
ATOM   1655 O  OE2   . GLU A 1 209 ? -14.822 96.878  54.544  1.00 59.87  ? 209 GLU A OE2   1 
ATOM   1656 N  N     . PHE A 1 210 ? -10.045 95.609  52.210  1.00 45.31  ? 210 PHE A N     1 
ATOM   1657 C  CA    . PHE A 1 210 ? -8.731  95.667  51.563  1.00 45.01  ? 210 PHE A CA    1 
ATOM   1658 C  C     . PHE A 1 210 ? -7.580  95.688  52.578  1.00 44.59  ? 210 PHE A C     1 
ATOM   1659 O  O     . PHE A 1 210 ? -6.636  94.900  52.457  1.00 41.75  ? 210 PHE A O     1 
ATOM   1660 C  CB    . PHE A 1 210 ? -8.644  96.883  50.634  1.00 45.16  ? 210 PHE A CB    1 
ATOM   1661 C  CG    . PHE A 1 210 ? -7.321  97.019  49.942  1.00 43.56  ? 210 PHE A CG    1 
ATOM   1662 C  CD1   . PHE A 1 210 ? -6.957  96.142  48.951  1.00 41.60  ? 210 PHE A CD1   1 
ATOM   1663 C  CD2   . PHE A 1 210 ? -6.440  98.027  50.293  1.00 45.35  ? 210 PHE A CD2   1 
ATOM   1664 C  CE1   . PHE A 1 210 ? -5.749  96.259  48.299  1.00 40.49  ? 210 PHE A CE1   1 
ATOM   1665 C  CE2   . PHE A 1 210 ? -5.227  98.157  49.648  1.00 44.48  ? 210 PHE A CE2   1 
ATOM   1666 C  CZ    . PHE A 1 210 ? -4.882  97.268  48.645  1.00 42.39  ? 210 PHE A CZ    1 
ATOM   1667 N  N     . ASP A 1 211 ? -7.685  96.569  53.575  1.00 47.29  ? 211 ASP A N     1 
ATOM   1668 C  CA    . ASP A 1 211 ? -6.622  96.762  54.581  1.00 49.32  ? 211 ASP A CA    1 
ATOM   1669 C  C     . ASP A 1 211 ? -6.276  95.488  55.326  1.00 48.05  ? 211 ASP A C     1 
ATOM   1670 O  O     . ASP A 1 211 ? -5.104  95.208  55.593  1.00 46.56  ? 211 ASP A O     1 
ATOM   1671 C  CB    . ASP A 1 211 ? -7.010  97.836  55.606  1.00 54.18  ? 211 ASP A CB    1 
ATOM   1672 C  CG    . ASP A 1 211 ? -6.842  99.252  55.075  1.00 56.92  ? 211 ASP A CG    1 
ATOM   1673 O  OD1   . ASP A 1 211 ? -6.069  99.459  54.123  1.00 58.65  ? 211 ASP A OD1   1 
ATOM   1674 O  OD2   . ASP A 1 211 ? -7.479  100.170 55.616  1.00 61.21  ? 211 ASP A OD2   1 
ATOM   1675 N  N     . LYS A 1 212 ? -7.298  94.716  55.661  1.00 49.12  ? 212 LYS A N     1 
ATOM   1676 C  CA    . LYS A 1 212 ? -7.094  93.429  56.300  1.00 49.02  ? 212 LYS A CA    1 
ATOM   1677 C  C     . LYS A 1 212 ? -6.365  92.467  55.370  1.00 45.83  ? 212 LYS A C     1 
ATOM   1678 O  O     . LYS A 1 212 ? -5.461  91.757  55.804  1.00 44.69  ? 212 LYS A O     1 
ATOM   1679 C  CB    . LYS A 1 212 ? -8.419  92.817  56.763  1.00 51.74  ? 212 LYS A CB    1 
ATOM   1680 C  CG    . LYS A 1 212 ? -8.198  91.636  57.694  1.00 53.29  ? 212 LYS A CG    1 
ATOM   1681 C  CD    . LYS A 1 212 ? -9.015  91.748  58.966  1.00 57.86  ? 212 LYS A CD    1 
ATOM   1682 C  CE    . LYS A 1 212 ? -10.397 91.149  58.781  1.00 59.01  ? 212 LYS A CE    1 
ATOM   1683 N  NZ    . LYS A 1 212 ? -10.367 89.685  59.039  1.00 59.07  ? 212 LYS A NZ    1 
ATOM   1684 N  N     . LEU A 1 213 ? -6.753  92.451  54.096  1.00 42.84  ? 213 LEU A N     1 
ATOM   1685 C  CA    . LEU A 1 213 ? -6.097  91.596  53.122  1.00 40.07  ? 213 LEU A CA    1 
ATOM   1686 C  C     . LEU A 1 213 ? -4.636  92.031  52.967  1.00 39.07  ? 213 LEU A C     1 
ATOM   1687 O  O     . LEU A 1 213 ? -3.742  91.240  53.176  1.00 36.68  ? 213 LEU A O     1 
ATOM   1688 C  CB    . LEU A 1 213 ? -6.816  91.662  51.777  1.00 38.89  ? 213 LEU A CB    1 
ATOM   1689 C  CG    . LEU A 1 213 ? -6.319  90.733  50.682  1.00 37.67  ? 213 LEU A CG    1 
ATOM   1690 C  CD1   . LEU A 1 213 ? -6.412  89.279  51.132  1.00 37.28  ? 213 LEU A CD1   1 
ATOM   1691 C  CD2   . LEU A 1 213 ? -7.116  90.975  49.406  1.00 37.42  ? 213 LEU A CD2   1 
ATOM   1692 N  N     . LYS A 1 214 ? -4.432  93.294  52.607  1.00 40.25  ? 214 LYS A N     1 
ATOM   1693 C  CA    . LYS A 1 214 ? -3.102  93.924  52.491  1.00 40.74  ? 214 LYS A CA    1 
ATOM   1694 C  C     . LYS A 1 214 ? -2.231  93.726  53.745  1.00 41.06  ? 214 LYS A C     1 
ATOM   1695 O  O     . LYS A 1 214 ? -1.066  93.325  53.653  1.00 39.85  ? 214 LYS A O     1 
ATOM   1696 C  CB    . LYS A 1 214 ? -3.304  95.412  52.183  1.00 42.81  ? 214 LYS A CB    1 
ATOM   1697 C  CG    . LYS A 1 214 ? -2.143  96.353  52.438  1.00 44.73  ? 214 LYS A CG    1 
ATOM   1698 C  CD    . LYS A 1 214 ? -2.620  97.800  52.293  1.00 47.70  ? 214 LYS A CD    1 
ATOM   1699 C  CE    . LYS A 1 214 ? -1.541  98.716  51.718  1.00 48.87  ? 214 LYS A CE    1 
ATOM   1700 N  NZ    . LYS A 1 214 ? -0.399  98.917  52.646  1.00 48.58  ? 214 LYS A NZ    1 
ATOM   1701 N  N     . GLY A 1 215 ? -2.816  93.971  54.907  1.00 42.62  ? 215 GLY A N     1 
ATOM   1702 C  CA    . GLY A 1 215 ? -2.127  93.782  56.185  1.00 44.12  ? 215 GLY A CA    1 
ATOM   1703 C  C     . GLY A 1 215 ? -1.662  92.356  56.388  1.00 43.96  ? 215 GLY A C     1 
ATOM   1704 O  O     . GLY A 1 215 ? -0.639  92.115  57.034  1.00 43.25  ? 215 GLY A O     1 
ATOM   1705 N  N     . MET A 1 216 ? -2.389  91.398  55.813  1.00 42.93  ? 216 MET A N     1 
ATOM   1706 C  CA    . MET A 1 216 ? -2.029  90.001  55.970  1.00 42.31  ? 216 MET A CA    1 
ATOM   1707 C  C     . MET A 1 216 ? -1.085  89.470  54.876  1.00 38.61  ? 216 MET A C     1 
ATOM   1708 O  O     . MET A 1 216 ? -0.224  88.642  55.158  1.00 38.59  ? 216 MET A O     1 
ATOM   1709 C  CB    . MET A 1 216 ? -3.292  89.152  56.055  1.00 44.53  ? 216 MET A CB    1 
ATOM   1710 C  CG    . MET A 1 216 ? -3.019  87.658  56.169  1.00 45.59  ? 216 MET A CG    1 
ATOM   1711 S  SD    . MET A 1 216 ? -2.064  87.238  57.634  1.00 51.45  ? 216 MET A SD    1 
ATOM   1712 C  CE    . MET A 1 216 ? -2.997  88.084  58.920  1.00 51.94  ? 216 MET A CE    1 
ATOM   1713 N  N     . ILE A 1 217 ? -1.237  89.915  53.633  1.00 36.08  ? 217 ILE A N     1 
ATOM   1714 C  CA    . ILE A 1 217 ? -0.433  89.342  52.533  1.00 34.25  ? 217 ILE A CA    1 
ATOM   1715 C  C     . ILE A 1 217 ? 0.414   90.358  51.775  1.00 32.12  ? 217 ILE A C     1 
ATOM   1716 O  O     . ILE A 1 217 ? 1.084   90.007  50.817  1.00 31.33  ? 217 ILE A O     1 
ATOM   1717 C  CB    . ILE A 1 217 ? -1.312  88.514  51.530  1.00 33.22  ? 217 ILE A CB    1 
ATOM   1718 C  CG1   . ILE A 1 217 ? -2.324  89.397  50.794  1.00 33.06  ? 217 ILE A CG1   1 
ATOM   1719 C  CG2   . ILE A 1 217 ? -2.036  87.389  52.260  1.00 33.83  ? 217 ILE A CG2   1 
ATOM   1720 C  CD1   . ILE A 1 217 ? -2.946  88.735  49.578  1.00 31.90  ? 217 ILE A CD1   1 
ATOM   1721 N  N     . GLY A 1 218 ? 0.395   91.607  52.216  1.00 33.75  ? 218 GLY A N     1 
ATOM   1722 C  CA    . GLY A 1 218 ? 1.101   92.678  51.525  1.00 33.70  ? 218 GLY A CA    1 
ATOM   1723 C  C     . GLY A 1 218 ? 0.298   93.219  50.355  1.00 33.73  ? 218 GLY A C     1 
ATOM   1724 O  O     . GLY A 1 218 ? -0.575  92.536  49.798  1.00 31.91  ? 218 GLY A O     1 
ATOM   1725 N  N     . GLU A 1 219 ? 0.624   94.448  49.979  1.00 35.53  ? 219 GLU A N     1 
ATOM   1726 C  CA    . GLU A 1 219 ? -0.129  95.208  48.992  1.00 36.67  ? 219 GLU A CA    1 
ATOM   1727 C  C     . GLU A 1 219 ? -0.110  94.600  47.589  1.00 35.02  ? 219 GLU A C     1 
ATOM   1728 O  O     . GLU A 1 219 ? -1.132  94.635  46.881  1.00 34.50  ? 219 GLU A O     1 
ATOM   1729 C  CB    . GLU A 1 219 ? 0.424   96.626  48.934  1.00 39.50  ? 219 GLU A CB    1 
ATOM   1730 C  CG    . GLU A 1 219 ? -0.275  97.541  47.945  1.00 41.84  ? 219 GLU A CG    1 
ATOM   1731 C  CD    . GLU A 1 219 ? 0.161   98.970  48.112  1.00 45.65  ? 219 GLU A CD    1 
ATOM   1732 O  OE1   . GLU A 1 219 ? 1.324   99.287  47.780  1.00 48.12  ? 219 GLU A OE1   1 
ATOM   1733 O  OE2   . GLU A 1 219 ? -0.652  99.774  48.604  1.00 51.14  ? 219 GLU A OE2   1 
ATOM   1734 N  N     . ALA A 1 220 ? 1.040   94.063  47.179  1.00 33.09  ? 220 ALA A N     1 
ATOM   1735 C  CA    . ALA A 1 220 ? 1.213   93.593  45.800  1.00 32.08  ? 220 ALA A CA    1 
ATOM   1736 C  C     . ALA A 1 220 ? 0.347   92.372  45.540  1.00 31.94  ? 220 ALA A C     1 
ATOM   1737 O  O     . ALA A 1 220 ? -0.290  92.253  44.492  1.00 31.97  ? 220 ALA A O     1 
ATOM   1738 C  CB    . ALA A 1 220 ? 2.684   93.262  45.518  1.00 30.58  ? 220 ALA A CB    1 
ATOM   1739 N  N     . LYS A 1 221 ? 0.344   91.447  46.494  1.00 33.09  ? 221 LYS A N     1 
ATOM   1740 C  CA    . LYS A 1 221 ? -0.495  90.264  46.369  1.00 32.34  ? 221 LYS A CA    1 
ATOM   1741 C  C     . LYS A 1 221 ? -1.968  90.568  46.461  1.00 31.34  ? 221 LYS A C     1 
ATOM   1742 O  O     . LYS A 1 221 ? -2.766  89.939  45.738  1.00 29.72  ? 221 LYS A O     1 
ATOM   1743 C  CB    . LYS A 1 221 ? -0.166  89.239  47.433  1.00 34.77  ? 221 LYS A CB    1 
ATOM   1744 C  CG    . LYS A 1 221 ? 1.009   88.386  47.057  1.00 36.50  ? 221 LYS A CG    1 
ATOM   1745 C  CD    . LYS A 1 221 ? 0.720   86.931  47.385  1.00 38.81  ? 221 LYS A CD    1 
ATOM   1746 C  CE    . LYS A 1 221 ? 1.982   86.099  47.238  1.00 37.63  ? 221 LYS A CE    1 
ATOM   1747 N  NZ    . LYS A 1 221 ? 3.074   86.690  48.026  1.00 37.18  ? 221 LYS A NZ    1 
ATOM   1748 N  N     . ALA A 1 222 ? -2.340  91.474  47.365  1.00 30.24  ? 222 ALA A N     1 
ATOM   1749 C  CA    . ALA A 1 222 ? -3.749  91.804  47.549  1.00 31.95  ? 222 ALA A CA    1 
ATOM   1750 C  C     . ALA A 1 222 ? -4.310  92.405  46.268  1.00 32.15  ? 222 ALA A C     1 
ATOM   1751 O  O     . ALA A 1 222 ? -5.364  91.977  45.784  1.00 31.63  ? 222 ALA A O     1 
ATOM   1752 C  CB    . ALA A 1 222 ? -3.956  92.761  48.716  1.00 33.62  ? 222 ALA A CB    1 
ATOM   1753 N  N     . LYS A 1 223 ? -3.601  93.392  45.727  1.00 32.17  ? 223 LYS A N     1 
ATOM   1754 C  CA    . LYS A 1 223 ? -3.991  94.026  44.464  1.00 32.20  ? 223 LYS A CA    1 
ATOM   1755 C  C     . LYS A 1 223 ? -4.015  93.034  43.324  1.00 29.33  ? 223 LYS A C     1 
ATOM   1756 O  O     . LYS A 1 223 ? -4.886  93.066  42.492  1.00 29.62  ? 223 LYS A O     1 
ATOM   1757 C  CB    . LYS A 1 223 ? -3.017  95.148  44.102  1.00 33.96  ? 223 LYS A CB    1 
ATOM   1758 C  CG    . LYS A 1 223 ? -3.181  96.374  44.970  1.00 36.96  ? 223 LYS A CG    1 
ATOM   1759 C  CD    . LYS A 1 223 ? -2.201  97.467  44.591  1.00 38.92  ? 223 LYS A CD    1 
ATOM   1760 C  CE    . LYS A 1 223 ? -2.770  98.819  44.960  1.00 42.33  ? 223 LYS A CE    1 
ATOM   1761 N  NZ    . LYS A 1 223 ? -1.865  99.897  44.481  1.00 45.25  ? 223 LYS A NZ    1 
ATOM   1762 N  N     . TYR A 1 224 ? -3.011  92.184  43.265  1.00 27.46  ? 224 TYR A N     1 
ATOM   1763 C  CA    . TYR A 1 224 ? -2.913  91.152  42.224  1.00 26.05  ? 224 TYR A CA    1 
ATOM   1764 C  C     . TYR A 1 224 ? -4.159  90.271  42.221  1.00 25.66  ? 224 TYR A C     1 
ATOM   1765 O  O     . TYR A 1 224 ? -4.807  90.080  41.188  1.00 25.32  ? 224 TYR A O     1 
ATOM   1766 C  CB    . TYR A 1 224 ? -1.641  90.330  42.487  1.00 25.14  ? 224 TYR A CB    1 
ATOM   1767 C  CG    . TYR A 1 224 ? -1.507  89.048  41.731  1.00 24.78  ? 224 TYR A CG    1 
ATOM   1768 C  CD1   . TYR A 1 224 ? -1.316  89.041  40.354  1.00 24.76  ? 224 TYR A CD1   1 
ATOM   1769 C  CD2   . TYR A 1 224 ? -1.516  87.836  42.400  1.00 24.69  ? 224 TYR A CD2   1 
ATOM   1770 C  CE1   . TYR A 1 224 ? -1.167  87.852  39.664  1.00 24.17  ? 224 TYR A CE1   1 
ATOM   1771 C  CE2   . TYR A 1 224 ? -1.369  86.639  41.721  1.00 24.06  ? 224 TYR A CE2   1 
ATOM   1772 C  CZ    . TYR A 1 224 ? -1.188  86.650  40.358  1.00 23.51  ? 224 TYR A CZ    1 
ATOM   1773 O  OH    . TYR A 1 224 ? -1.031  85.453  39.702  1.00 21.44  ? 224 TYR A OH    1 
ATOM   1774 N  N     . LEU A 1 225 ? -4.512  89.780  43.403  1.00 25.95  ? 225 LEU A N     1 
ATOM   1775 C  CA    . LEU A 1 225 ? -5.636  88.862  43.566  1.00 26.72  ? 225 LEU A CA    1 
ATOM   1776 C  C     . LEU A 1 225 ? -6.976  89.540  43.301  1.00 27.92  ? 225 LEU A C     1 
ATOM   1777 O  O     . LEU A 1 225 ? -7.866  88.945  42.699  1.00 28.43  ? 225 LEU A O     1 
ATOM   1778 C  CB    . LEU A 1 225 ? -5.632  88.231  44.976  1.00 26.57  ? 225 LEU A CB    1 
ATOM   1779 C  CG    . LEU A 1 225 ? -4.569  87.158  45.238  1.00 24.78  ? 225 LEU A CG    1 
ATOM   1780 C  CD1   . LEU A 1 225 ? -4.642  86.715  46.686  1.00 25.59  ? 225 LEU A CD1   1 
ATOM   1781 C  CD2   . LEU A 1 225 ? -4.748  85.958  44.331  1.00 23.65  ? 225 LEU A CD2   1 
ATOM   1782 N  N     . ILE A 1 226 ? -7.109  90.777  43.742  1.00 29.19  ? 226 ILE A N     1 
ATOM   1783 C  CA    . ILE A 1 226 ? -8.317  91.560  43.489  1.00 31.27  ? 226 ILE A CA    1 
ATOM   1784 C  C     . ILE A 1 226 ? -8.491  91.895  42.010  1.00 30.48  ? 226 ILE A C     1 
ATOM   1785 O  O     . ILE A 1 226 ? -9.626  91.836  41.515  1.00 29.03  ? 226 ILE A O     1 
ATOM   1786 C  CB    . ILE A 1 226 ? -8.352  92.835  44.361  1.00 33.29  ? 226 ILE A CB    1 
ATOM   1787 C  CG1   . ILE A 1 226 ? -8.718  92.435  45.789  1.00 34.19  ? 226 ILE A CG1   1 
ATOM   1788 C  CG2   . ILE A 1 226 ? -9.353  93.864  43.829  1.00 35.27  ? 226 ILE A CG2   1 
ATOM   1789 C  CD1   . ILE A 1 226 ? -8.482  93.517  46.819  1.00 36.20  ? 226 ILE A CD1   1 
ATOM   1790 N  N     . SER A 1 227 ? -7.390  92.230  41.308  1.00 29.50  ? 227 SER A N     1 
ATOM   1791 C  CA    . SER A 1 227 ? -7.512  92.582  39.884  1.00 29.86  ? 227 SER A CA    1 
ATOM   1792 C  C     . SER A 1 227 ? -7.922  91.350  39.065  1.00 28.90  ? 227 SER A C     1 
ATOM   1793 O  O     . SER A 1 227 ? -8.668  91.450  38.103  1.00 29.41  ? 227 SER A O     1 
ATOM   1794 C  CB    . SER A 1 227 ? -6.257  93.228  39.322  1.00 30.48  ? 227 SER A CB    1 
ATOM   1795 O  OG    . SER A 1 227 ? -5.221  92.295  39.101  1.00 30.63  ? 227 SER A OG    1 
ATOM   1796 N  N     . LEU A 1 228 ? -7.447  90.181  39.479  1.00 26.90  ? 228 LEU A N     1 
ATOM   1797 C  CA    . LEU A 1 228 ? -7.885  88.944  38.891  1.00 25.50  ? 228 LEU A CA    1 
ATOM   1798 C  C     . LEU A 1 228 ? -9.368  88.708  39.139  1.00 25.97  ? 228 LEU A C     1 
ATOM   1799 O  O     . LEU A 1 228 ? -10.107 88.392  38.208  1.00 25.58  ? 228 LEU A O     1 
ATOM   1800 C  CB    . LEU A 1 228 ? -7.087  87.785  39.460  1.00 24.22  ? 228 LEU A CB    1 
ATOM   1801 C  CG    . LEU A 1 228 ? -5.679  87.700  38.898  1.00 23.66  ? 228 LEU A CG    1 
ATOM   1802 C  CD1   . LEU A 1 228 ? -4.853  86.789  39.786  1.00 22.67  ? 228 LEU A CD1   1 
ATOM   1803 C  CD2   . LEU A 1 228 ? -5.728  87.234  37.453  1.00 23.49  ? 228 LEU A CD2   1 
ATOM   1804 N  N     . ALA A 1 229 ? -9.780  88.872  40.395  1.00 26.28  ? 229 ALA A N     1 
ATOM   1805 C  CA    . ALA A 1 229 ? -11.138 88.628  40.806  1.00 27.28  ? 229 ALA A CA    1 
ATOM   1806 C  C     . ALA A 1 229 ? -12.127 89.564  40.101  1.00 28.97  ? 229 ALA A C     1 
ATOM   1807 O  O     . ALA A 1 229 ? -13.191 89.122  39.711  1.00 27.92  ? 229 ALA A O     1 
ATOM   1808 C  CB    . ALA A 1 229 ? -11.256 88.746  42.320  1.00 28.63  ? 229 ALA A CB    1 
ATOM   1809 N  N     . ARG A 1 230 ? -11.759 90.830  39.918  1.00 30.69  ? 230 ARG A N     1 
ATOM   1810 C  CA    . ARG A 1 230 ? -12.564 91.775  39.120  1.00 32.69  ? 230 ARG A CA    1 
ATOM   1811 C  C     . ARG A 1 230 ? -12.441 91.549  37.609  1.00 33.46  ? 230 ARG A C     1 
ATOM   1812 O  O     . ARG A 1 230 ? -12.966 92.343  36.840  1.00 34.16  ? 230 ARG A O     1 
ATOM   1813 C  CB    . ARG A 1 230 ? -12.143 93.220  39.382  1.00 33.93  ? 230 ARG A CB    1 
ATOM   1814 C  CG    . ARG A 1 230 ? -12.391 93.746  40.791  1.00 35.41  ? 230 ARG A CG    1 
ATOM   1815 C  CD    . ARG A 1 230 ? -11.775 95.125  41.044  1.00 36.51  ? 230 ARG A CD    1 
ATOM   1816 N  NE    . ARG A 1 230 ? -12.189 95.605  42.363  1.00 38.96  ? 230 ARG A NE    1 
ATOM   1817 C  CZ    . ARG A 1 230 ? -11.525 96.440  43.169  1.00 40.38  ? 230 ARG A CZ    1 
ATOM   1818 N  NH1   . ARG A 1 230 ? -10.321 96.932  42.866  1.00 41.78  ? 230 ARG A NH1   1 
ATOM   1819 N  NH2   . ARG A 1 230 ? -12.065 96.754  44.338  1.00 41.19  ? 230 ARG A NH2   1 
ATOM   1820 N  N     . ASP A 1 231 ? -11.702 90.525  37.182  1.00 34.01  ? 231 ASP A N     1 
ATOM   1821 C  CA    . ASP A 1 231 ? -11.542 90.222  35.757  1.00 35.52  ? 231 ASP A CA    1 
ATOM   1822 C  C     . ASP A 1 231 ? -10.876 91.397  35.043  1.00 37.76  ? 231 ASP A C     1 
ATOM   1823 O  O     . ASP A 1 231 ? -11.165 91.662  33.878  1.00 38.97  ? 231 ASP A O     1 
ATOM   1824 C  CB    . ASP A 1 231 ? -12.914 89.912  35.121  1.00 35.80  ? 231 ASP A CB    1 
ATOM   1825 C  CG    . ASP A 1 231 ? -12.818 89.036  33.852  1.00 36.33  ? 231 ASP A CG    1 
ATOM   1826 O  OD1   . ASP A 1 231 ? -11.692 88.721  33.395  1.00 35.91  ? 231 ASP A OD1   1 
ATOM   1827 O  OD2   . ASP A 1 231 ? -13.897 88.656  33.319  1.00 35.82  ? 231 ASP A OD2   1 
ATOM   1828 N  N     . GLU A 1 232 ? -10.011 92.114  35.753  1.00 38.90  ? 232 GLU A N     1 
ATOM   1829 C  CA    . GLU A 1 232 ? -9.340  93.302  35.202  1.00 41.73  ? 232 GLU A CA    1 
ATOM   1830 C  C     . GLU A 1 232 ? -7.819  93.155  35.111  1.00 38.94  ? 232 GLU A C     1 
ATOM   1831 O  O     . GLU A 1 232 ? -7.119  94.093  34.749  1.00 39.86  ? 232 GLU A O     1 
ATOM   1832 C  CB    . GLU A 1 232 ? -9.691  94.517  36.046  1.00 45.42  ? 232 GLU A CB    1 
ATOM   1833 C  CG    . GLU A 1 232 ? -11.103 95.026  35.790  1.00 51.70  ? 232 GLU A CG    1 
ATOM   1834 C  CD    . GLU A 1 232 ? -11.611 95.951  36.881  1.00 57.49  ? 232 GLU A CD    1 
ATOM   1835 O  OE1   . GLU A 1 232 ? -10.801 96.368  37.741  1.00 60.05  ? 232 GLU A OE1   1 
ATOM   1836 O  OE2   . GLU A 1 232 ? -12.829 96.271  36.873  1.00 65.97  ? 232 GLU A OE2   1 
ATOM   1837 N  N     . TYR A 1 233 ? -7.289  91.990  35.454  1.00 36.15  ? 233 TYR A N     1 
ATOM   1838 C  CA    . TYR A 1 233 ? -5.843  91.815  35.383  1.00 34.91  ? 233 TYR A CA    1 
ATOM   1839 C  C     . TYR A 1 233 ? -5.435  91.873  33.919  1.00 36.18  ? 233 TYR A C     1 
ATOM   1840 O  O     . TYR A 1 233 ? -6.010  91.190  33.094  1.00 37.27  ? 233 TYR A O     1 
ATOM   1841 C  CB    . TYR A 1 233 ? -5.430  90.482  36.014  1.00 32.50  ? 233 TYR A CB    1 
ATOM   1842 C  CG    . TYR A 1 233 ? -3.963  90.162  35.883  1.00 31.25  ? 233 TYR A CG    1 
ATOM   1843 C  CD1   . TYR A 1 233 ? -3.470  89.594  34.719  1.00 30.81  ? 233 TYR A CD1   1 
ATOM   1844 C  CD2   . TYR A 1 233 ? -3.060  90.414  36.929  1.00 32.12  ? 233 TYR A CD2   1 
ATOM   1845 C  CE1   . TYR A 1 233 ? -2.120  89.280  34.576  1.00 30.94  ? 233 TYR A CE1   1 
ATOM   1846 C  CE2   . TYR A 1 233 ? -1.698  90.098  36.797  1.00 31.00  ? 233 TYR A CE2   1 
ATOM   1847 C  CZ    . TYR A 1 233 ? -1.247  89.538  35.611  1.00 30.44  ? 233 TYR A CZ    1 
ATOM   1848 O  OH    . TYR A 1 233 ? 0.064   89.223  35.422  1.00 32.53  ? 233 TYR A OH    1 
ATOM   1849 N  N     . ASN A 1 234 ? -4.432  92.663  33.579  1.00 39.66  ? 234 ASN A N     1 
ATOM   1850 C  CA    . ASN A 1 234 ? -3.973  92.665  32.195  1.00 42.65  ? 234 ASN A CA    1 
ATOM   1851 C  C     . ASN A 1 234 ? -2.520  93.079  32.000  1.00 42.98  ? 234 ASN A C     1 
ATOM   1852 O  O     . ASN A 1 234 ? -2.221  93.841  31.085  1.00 47.04  ? 234 ASN A O     1 
ATOM   1853 C  CB    . ASN A 1 234 ? -4.894  93.539  31.342  1.00 45.06  ? 234 ASN A CB    1 
ATOM   1854 C  CG    . ASN A 1 234 ? -4.704  95.003  31.610  1.00 47.25  ? 234 ASN A CG    1 
ATOM   1855 O  OD1   . ASN A 1 234 ? -4.131  95.390  32.619  1.00 47.86  ? 234 ASN A OD1   1 
ATOM   1856 N  ND2   . ASN A 1 234 ? -5.159  95.833  30.685  1.00 52.00  ? 234 ASN A ND2   1 
ATOM   1857 N  N     . GLU A 1 235 ? -1.619  92.560  32.825  1.00 39.53  ? 235 GLU A N     1 
ATOM   1858 C  CA    . GLU A 1 235 ? -0.220  92.919  32.709  1.00 40.48  ? 235 GLU A CA    1 
ATOM   1859 C  C     . GLU A 1 235 ? 0.363   92.562  31.334  1.00 38.81  ? 235 GLU A C     1 
ATOM   1860 O  O     . GLU A 1 235 ? 0.195   91.447  30.858  1.00 35.73  ? 235 GLU A O     1 
ATOM   1861 C  CB    . GLU A 1 235 ? 0.608   92.257  33.810  1.00 41.37  ? 235 GLU A CB    1 
ATOM   1862 C  CG    . GLU A 1 235 ? 0.321   92.787  35.212  1.00 44.47  ? 235 GLU A CG    1 
ATOM   1863 C  CD    . GLU A 1 235 ? 0.354   94.301  35.294  1.00 46.40  ? 235 GLU A CD    1 
ATOM   1864 O  OE1   . GLU A 1 235 ? 1.467   94.866  35.249  1.00 51.99  ? 235 GLU A OE1   1 
ATOM   1865 O  OE2   . GLU A 1 235 ? -0.725  94.917  35.394  1.00 44.37  ? 235 GLU A OE2   1 
ATOM   1866 N  N     . PRO A 1 236 ? 1.063   93.511  30.699  1.00 39.77  ? 236 PRO A N     1 
ATOM   1867 C  CA    . PRO A 1 236 ? 1.638   93.216  29.388  1.00 40.08  ? 236 PRO A CA    1 
ATOM   1868 C  C     . PRO A 1 236 ? 2.618   92.055  29.400  1.00 37.84  ? 236 PRO A C     1 
ATOM   1869 O  O     . PRO A 1 236 ? 3.224   91.758  30.419  1.00 36.46  ? 236 PRO A O     1 
ATOM   1870 C  CB    . PRO A 1 236 ? 2.376   94.510  29.030  1.00 42.15  ? 236 PRO A CB    1 
ATOM   1871 C  CG    . PRO A 1 236 ? 1.668   95.562  29.813  1.00 43.16  ? 236 PRO A CG    1 
ATOM   1872 C  CD    . PRO A 1 236 ? 1.375   94.889  31.120  1.00 41.04  ? 236 PRO A CD    1 
ATOM   1873 N  N     . ILE A 1 237 ? 2.748   91.413  28.246  1.00 37.86  ? 237 ILE A N     1 
ATOM   1874 C  CA    . ILE A 1 237 ? 3.685   90.336  28.039  1.00 37.37  ? 237 ILE A CA    1 
ATOM   1875 C  C     . ILE A 1 237 ? 4.983   91.063  27.734  1.00 40.59  ? 237 ILE A C     1 
ATOM   1876 O  O     . ILE A 1 237 ? 5.102   91.715  26.700  1.00 41.99  ? 237 ILE A O     1 
ATOM   1877 C  CB    . ILE A 1 237 ? 3.260   89.415  26.871  1.00 37.14  ? 237 ILE A CB    1 
ATOM   1878 C  CG1   . ILE A 1 237 ? 2.072   88.518  27.274  1.00 35.45  ? 237 ILE A CG1   1 
ATOM   1879 C  CG2   . ILE A 1 237 ? 4.408   88.506  26.424  1.00 37.62  ? 237 ILE A CG2   1 
ATOM   1880 C  CD1   . ILE A 1 237 ? 0.828   89.236  27.778  1.00 34.53  ? 237 ILE A CD1   1 
ATOM   1881 N  N     . ARG A 1 238 ? 5.920   90.995  28.671  1.00 41.36  ? 238 ARG A N     1 
ATOM   1882 C  CA    . ARG A 1 238 ? 7.200   91.664  28.533  1.00 46.48  ? 238 ARG A CA    1 
ATOM   1883 C  C     . ARG A 1 238 ? 8.221   91.021  29.475  1.00 45.47  ? 238 ARG A C     1 
ATOM   1884 O  O     . ARG A 1 238 ? 7.969   90.825  30.681  1.00 39.07  ? 238 ARG A O     1 
ATOM   1885 C  CB    . ARG A 1 238 ? 7.056   93.160  28.825  1.00 50.68  ? 238 ARG A CB    1 
ATOM   1886 C  CG    . ARG A 1 238 ? 8.357   93.934  28.735  1.00 57.00  ? 238 ARG A CG    1 
ATOM   1887 C  CD    . ARG A 1 238 ? 8.157   95.441  28.861  1.00 62.76  ? 238 ARG A CD    1 
ATOM   1888 N  NE    . ARG A 1 238 ? 7.147   95.797  29.867  1.00 64.99  ? 238 ARG A NE    1 
ATOM   1889 C  CZ    . ARG A 1 238 ? 5.959   96.353  29.612  1.00 68.17  ? 238 ARG A CZ    1 
ATOM   1890 N  NH1   . ARG A 1 238 ? 5.581   96.646  28.368  1.00 71.70  ? 238 ARG A NH1   1 
ATOM   1891 N  NH2   . ARG A 1 238 ? 5.133   96.627  30.619  1.00 67.50  ? 238 ARG A NH2   1 
ATOM   1892 N  N     . THR A 1 239 ? 9.367   90.670  28.906  1.00 48.31  ? 239 THR A N     1 
ATOM   1893 C  CA    . THR A 1 239 ? 10.472  90.135  29.686  1.00 49.19  ? 239 THR A CA    1 
ATOM   1894 C  C     . THR A 1 239 ? 10.834  91.153  30.794  1.00 48.57  ? 239 THR A C     1 
ATOM   1895 O  O     . THR A 1 239 ? 10.985  92.354  30.555  1.00 47.00  ? 239 THR A O     1 
ATOM   1896 C  CB    . THR A 1 239 ? 11.640  89.729  28.748  1.00 52.65  ? 239 THR A CB    1 
ATOM   1897 O  OG1   . THR A 1 239 ? 11.394  88.394  28.255  1.00 52.43  ? 239 THR A OG1   1 
ATOM   1898 C  CG2   . THR A 1 239 ? 12.998  89.777  29.450  1.00 53.21  ? 239 THR A CG2   1 
ATOM   1899 N  N     . ARG A 1 240 ? 10.897  90.661  32.020  1.00 50.23  ? 240 ARG A N     1 
ATOM   1900 C  CA    . ARG A 1 240 ? 10.982  91.522  33.200  1.00 53.27  ? 240 ARG A CA    1 
ATOM   1901 C  C     . ARG A 1 240 ? 12.429  92.023  33.399  1.00 49.69  ? 240 ARG A C     1 
ATOM   1902 O  O     . ARG A 1 240 ? 13.379  91.314  33.074  1.00 46.73  ? 240 ARG A O     1 
ATOM   1903 C  CB    . ARG A 1 240 ? 10.492  90.733  34.415  1.00 58.50  ? 240 ARG A CB    1 
ATOM   1904 C  CG    . ARG A 1 240 ? 10.055  91.580  35.597  1.00 65.22  ? 240 ARG A CG    1 
ATOM   1905 C  CD    . ARG A 1 240 ? 9.945   90.740  36.862  1.00 68.08  ? 240 ARG A CD    1 
ATOM   1906 N  NE    . ARG A 1 240 ? 9.627   91.567  38.029  1.00 72.99  ? 240 ARG A NE    1 
ATOM   1907 C  CZ    . ARG A 1 240 ? 8.398   91.831  38.477  1.00 76.79  ? 240 ARG A CZ    1 
ATOM   1908 N  NH1   . ARG A 1 240 ? 7.314   91.336  37.876  1.00 77.12  ? 240 ARG A NH1   1 
ATOM   1909 N  NH2   . ARG A 1 240 ? 8.252   92.602  39.548  1.00 79.78  ? 240 ARG A NH2   1 
ATOM   1910 N  N     . VAL A 1 241 ? 12.596  93.253  33.879  1.00 47.72  ? 241 VAL A N     1 
ATOM   1911 C  CA    . VAL A 1 241 ? 13.949  93.779  34.154  1.00 46.96  ? 241 VAL A CA    1 
ATOM   1912 C  C     . VAL A 1 241 ? 14.337  93.373  35.573  1.00 43.71  ? 241 VAL A C     1 
ATOM   1913 O  O     . VAL A 1 241 ? 13.621  93.698  36.515  1.00 40.78  ? 241 VAL A O     1 
ATOM   1914 C  CB    . VAL A 1 241 ? 14.063  95.313  33.987  1.00 49.22  ? 241 VAL A CB    1 
ATOM   1915 C  CG1   . VAL A 1 241 ? 13.887  95.701  32.523  1.00 50.20  ? 241 VAL A CG1   1 
ATOM   1916 C  CG2   . VAL A 1 241 ? 13.071  96.065  34.882  1.00 50.58  ? 241 VAL A CG2   1 
ATOM   1917 N  N     . ARG A 1 242 ? 15.443  92.636  35.705  1.00 43.07  ? 242 ARG A N     1 
ATOM   1918 C  CA    . ARG A 1 242 ? 15.905  92.152  37.012  1.00 43.83  ? 242 ARG A CA    1 
ATOM   1919 C  C     . ARG A 1 242 ? 16.288  93.315  37.928  1.00 40.41  ? 242 ARG A C     1 
ATOM   1920 O  O     . ARG A 1 242 ? 16.991  94.228  37.520  1.00 38.88  ? 242 ARG A O     1 
ATOM   1921 C  CB    . ARG A 1 242 ? 17.095  91.161  36.884  1.00 45.19  ? 242 ARG A CB    1 
ATOM   1922 C  CG    . ARG A 1 242 ? 16.760  89.746  36.390  1.00 49.65  ? 242 ARG A CG    1 
ATOM   1923 C  CD    . ARG A 1 242 ? 15.357  89.316  36.811  1.00 54.88  ? 242 ARG A CD    1 
ATOM   1924 N  NE    . ARG A 1 242 ? 15.038  87.895  36.620  1.00 60.86  ? 242 ARG A NE    1 
ATOM   1925 C  CZ    . ARG A 1 242 ? 13.831  87.359  36.838  1.00 62.07  ? 242 ARG A CZ    1 
ATOM   1926 N  NH1   . ARG A 1 242 ? 12.809  88.115  37.245  1.00 61.78  ? 242 ARG A NH1   1 
ATOM   1927 N  NH2   . ARG A 1 242 ? 13.639  86.057  36.648  1.00 64.11  ? 242 ARG A NH2   1 
ATOM   1928 N  N     . LYS A 1 243 ? 15.799  93.250  39.160  1.00 38.72  ? 243 LYS A N     1 
ATOM   1929 C  CA    . LYS A 1 243 ? 16.215  94.158  40.236  1.00 39.12  ? 243 LYS A CA    1 
ATOM   1930 C  C     . LYS A 1 243 ? 17.362  93.591  41.088  1.00 36.78  ? 243 LYS A C     1 
ATOM   1931 O  O     . LYS A 1 243 ? 18.065  94.341  41.752  1.00 35.82  ? 243 LYS A O     1 
ATOM   1932 C  CB    . LYS A 1 243 ? 15.007  94.482  41.126  1.00 40.97  ? 243 LYS A CB    1 
ATOM   1933 C  CG    . LYS A 1 243 ? 14.013  95.386  40.417  1.00 42.56  ? 243 LYS A CG    1 
ATOM   1934 C  CD    . LYS A 1 243 ? 12.572  95.003  40.662  1.00 44.12  ? 243 LYS A CD    1 
ATOM   1935 C  CE    . LYS A 1 243 ? 11.964  95.744  41.830  1.00 45.15  ? 243 LYS A CE    1 
ATOM   1936 N  NZ    . LYS A 1 243 ? 10.513  95.933  41.566  1.00 46.11  ? 243 LYS A NZ    1 
ATOM   1937 N  N     . SER A 1 244 ? 17.551  92.277  41.089  1.00 34.97  ? 244 SER A N     1 
ATOM   1938 C  CA    . SER A 1 244 ? 18.785  91.725  41.663  1.00 34.26  ? 244 SER A CA    1 
ATOM   1939 C  C     . SER A 1 244 ? 19.317  90.570  40.841  1.00 34.71  ? 244 SER A C     1 
ATOM   1940 O  O     . SER A 1 244 ? 18.557  89.914  40.088  1.00 36.33  ? 244 SER A O     1 
ATOM   1941 C  CB    . SER A 1 244 ? 18.581  91.307  43.118  1.00 32.12  ? 244 SER A CB    1 
ATOM   1942 O  OG    . SER A 1 244 ? 17.725  90.195  43.222  1.00 31.79  ? 244 SER A OG    1 
ATOM   1943 N  N     . ILE A 1 245 ? 20.625  90.340  40.975  1.00 32.53  ? 245 ILE A N     1 
ATOM   1944 C  CA    . ILE A 1 245 ? 21.326  89.263  40.276  1.00 31.83  ? 245 ILE A CA    1 
ATOM   1945 C  C     . ILE A 1 245 ? 22.359  88.621  41.202  1.00 30.92  ? 245 ILE A C     1 
ATOM   1946 O  O     . ILE A 1 245 ? 23.140  89.303  41.864  1.00 29.29  ? 245 ILE A O     1 
ATOM   1947 C  CB    . ILE A 1 245 ? 22.013  89.785  39.003  1.00 34.40  ? 245 ILE A CB    1 
ATOM   1948 C  CG1   . ILE A 1 245 ? 20.943  90.140  37.970  1.00 35.78  ? 245 ILE A CG1   1 
ATOM   1949 C  CG2   . ILE A 1 245 ? 22.993  88.746  38.428  1.00 35.58  ? 245 ILE A CG2   1 
ATOM   1950 C  CD1   . ILE A 1 245 ? 21.490  90.676  36.679  1.00 38.62  ? 245 ILE A CD1   1 
ATOM   1951 N  N     . GLY A 1 246 ? 22.360  87.302  41.259  1.00 30.08  ? 246 GLY A N     1 
ATOM   1952 C  CA    . GLY A 1 246 ? 23.247  86.635  42.175  1.00 30.18  ? 246 GLY A CA    1 
ATOM   1953 C  C     . GLY A 1 246 ? 23.397  85.162  41.942  1.00 30.55  ? 246 GLY A C     1 
ATOM   1954 O  O     . GLY A 1 246 ? 22.918  84.590  40.948  1.00 31.03  ? 246 GLY A O     1 
ATOM   1955 N  N     . ARG A 1 247 ? 24.070  84.550  42.899  1.00 30.22  ? 247 ARG A N     1 
ATOM   1956 C  CA    . ARG A 1 247 ? 24.439  83.173  42.805  1.00 31.60  ? 247 ARG A CA    1 
ATOM   1957 C  C     . ARG A 1 247 ? 24.629  82.683  44.217  1.00 30.46  ? 247 ARG A C     1 
ATOM   1958 O  O     . ARG A 1 247 ? 25.182  83.397  45.074  1.00 29.79  ? 247 ARG A O     1 
ATOM   1959 C  CB    . ARG A 1 247 ? 25.737  83.069  41.995  1.00 34.18  ? 247 ARG A CB    1 
ATOM   1960 C  CG    . ARG A 1 247 ? 26.148  81.662  41.681  1.00 39.47  ? 247 ARG A CG    1 
ATOM   1961 C  CD    . ARG A 1 247 ? 25.492  81.132  40.413  1.00 42.26  ? 247 ARG A CD    1 
ATOM   1962 N  NE    . ARG A 1 247 ? 26.122  79.870  40.038  1.00 48.47  ? 247 ARG A NE    1 
ATOM   1963 C  CZ    . ARG A 1 247 ? 25.965  78.702  40.675  1.00 51.51  ? 247 ARG A CZ    1 
ATOM   1964 N  NH1   . ARG A 1 247 ? 25.164  78.584  41.736  1.00 49.02  ? 247 ARG A NH1   1 
ATOM   1965 N  NH2   . ARG A 1 247 ? 26.623  77.630  40.236  1.00 54.27  ? 247 ARG A NH2   1 
ATOM   1966 N  N     . ILE A 1 248 ? 24.163  81.470  44.463  1.00 31.46  ? 248 ILE A N     1 
ATOM   1967 C  CA    . ILE A 1 248 ? 24.347  80.829  45.738  1.00 33.27  ? 248 ILE A CA    1 
ATOM   1968 C  C     . ILE A 1 248 ? 24.600  79.341  45.529  1.00 35.85  ? 248 ILE A C     1 
ATOM   1969 O  O     . ILE A 1 248 ? 23.909  78.679  44.727  1.00 34.22  ? 248 ILE A O     1 
ATOM   1970 C  CB    . ILE A 1 248 ? 23.179  81.111  46.715  1.00 32.83  ? 248 ILE A CB    1 
ATOM   1971 C  CG1   . ILE A 1 248 ? 23.323  80.257  47.974  1.00 33.20  ? 248 ILE A CG1   1 
ATOM   1972 C  CG2   . ILE A 1 248 ? 21.848  80.807  46.078  1.00 34.84  ? 248 ILE A CG2   1 
ATOM   1973 C  CD1   . ILE A 1 248 ? 22.431  80.677  49.107  1.00 33.72  ? 248 ILE A CD1   1 
ATOM   1974 N  N     . VAL A 1 249 ? 25.607  78.827  46.247  1.00 35.28  ? 249 VAL A N     1 
ATOM   1975 C  CA    . VAL A 1 249 ? 26.076  77.461  46.050  1.00 37.04  ? 249 VAL A CA    1 
ATOM   1976 C  C     . VAL A 1 249 ? 26.170  76.675  47.343  1.00 37.05  ? 249 VAL A C     1 
ATOM   1977 O  O     . VAL A 1 249 ? 26.456  77.225  48.399  1.00 37.62  ? 249 VAL A O     1 
ATOM   1978 C  CB    . VAL A 1 249 ? 27.460  77.407  45.371  1.00 38.96  ? 249 VAL A CB    1 
ATOM   1979 C  CG1   . VAL A 1 249 ? 27.365  77.896  43.940  1.00 41.56  ? 249 VAL A CG1   1 
ATOM   1980 C  CG2   . VAL A 1 249 ? 28.502  78.207  46.139  1.00 39.03  ? 249 VAL A CG2   1 
ATOM   1981 N  N     . THR A 1 250 ? 25.954  75.372  47.229  1.00 36.67  ? 250 THR A N     1 
ATOM   1982 C  CA    . THR A 1 250 ? 26.060  74.472  48.360  1.00 37.32  ? 250 THR A CA    1 
ATOM   1983 C  C     . THR A 1 250 ? 27.491  74.041  48.485  1.00 37.81  ? 250 THR A C     1 
ATOM   1984 O  O     . THR A 1 250 ? 28.145  73.711  47.494  1.00 38.23  ? 250 THR A O     1 
ATOM   1985 C  CB    . THR A 1 250 ? 25.137  73.245  48.183  1.00 38.23  ? 250 THR A CB    1 
ATOM   1986 O  OG1   . THR A 1 250 ? 23.818  73.617  48.567  1.00 37.51  ? 250 THR A OG1   1 
ATOM   1987 C  CG2   . THR A 1 250 ? 25.578  72.049  49.034  1.00 39.33  ? 250 THR A CG2   1 
ATOM   1988 N  N     . MET A 1 251 ? 27.984  74.050  49.712  1.00 37.64  ? 251 MET A N     1 
ATOM   1989 C  CA    . MET A 1 251 ? 29.333  73.616  49.958  1.00 39.70  ? 251 MET A CA    1 
ATOM   1990 C  C     . MET A 1 251 ? 29.331  72.112  50.201  1.00 41.40  ? 251 MET A C     1 
ATOM   1991 O  O     . MET A 1 251 ? 28.363  71.558  50.716  1.00 39.72  ? 251 MET A O     1 
ATOM   1992 C  CB    . MET A 1 251 ? 29.935  74.390  51.136  1.00 40.17  ? 251 MET A CB    1 
ATOM   1993 C  CG    . MET A 1 251 ? 29.894  75.905  50.921  1.00 39.52  ? 251 MET A CG    1 
ATOM   1994 S  SD    . MET A 1 251 ? 30.830  76.814  52.166  1.00 39.58  ? 251 MET A SD    1 
ATOM   1995 C  CE    . MET A 1 251 ? 29.733  76.590  53.559  1.00 40.65  ? 251 MET A CE    1 
ATOM   1996 N  N     . LYS A 1 252 ? 30.428  71.464  49.831  1.00 43.42  ? 252 LYS A N     1 
ATOM   1997 C  CA    . LYS A 1 252 ? 30.527  70.028  49.948  1.00 47.22  ? 252 LYS A CA    1 
ATOM   1998 C  C     . LYS A 1 252 ? 30.525  69.594  51.405  1.00 47.86  ? 252 LYS A C     1 
ATOM   1999 O  O     . LYS A 1 252 ? 30.153  68.469  51.710  1.00 49.50  ? 252 LYS A O     1 
ATOM   2000 C  CB    . LYS A 1 252 ? 31.759  69.516  49.203  1.00 51.22  ? 252 LYS A CB    1 
ATOM   2001 C  CG    . LYS A 1 252 ? 31.773  69.948  47.733  1.00 53.35  ? 252 LYS A CG    1 
ATOM   2002 C  CD    . LYS A 1 252 ? 32.067  68.810  46.757  1.00 57.44  ? 252 LYS A CD    1 
ATOM   2003 C  CE    . LYS A 1 252 ? 33.555  68.629  46.535  1.00 59.49  ? 252 LYS A CE    1 
ATOM   2004 N  NZ    . LYS A 1 252 ? 34.279  68.379  47.811  1.00 61.76  ? 252 LYS A NZ    1 
ATOM   2005 N  N     . ARG A 1 253 ? 30.878  70.513  52.300  1.00 46.75  ? 253 ARG A N     1 
ATOM   2006 C  CA    . ARG A 1 253 ? 30.963  70.230  53.728  1.00 48.47  ? 253 ARG A CA    1 
ATOM   2007 C  C     . ARG A 1 253 ? 30.549  71.482  54.507  1.00 44.92  ? 253 ARG A C     1 
ATOM   2008 O  O     . ARG A 1 253 ? 30.938  72.580  54.135  1.00 44.58  ? 253 ARG A O     1 
ATOM   2009 C  CB    . ARG A 1 253 ? 32.412  69.881  54.046  1.00 52.27  ? 253 ARG A CB    1 
ATOM   2010 C  CG    . ARG A 1 253 ? 32.595  68.909  55.191  1.00 58.17  ? 253 ARG A CG    1 
ATOM   2011 C  CD    . ARG A 1 253 ? 34.030  68.951  55.670  1.00 60.72  ? 253 ARG A CD    1 
ATOM   2012 N  NE    . ARG A 1 253 ? 34.353  70.274  56.222  1.00 62.53  ? 253 ARG A NE    1 
ATOM   2013 C  CZ    . ARG A 1 253 ? 34.151  70.661  57.482  1.00 61.78  ? 253 ARG A CZ    1 
ATOM   2014 N  NH1   . ARG A 1 253 ? 33.618  69.834  58.381  1.00 64.50  ? 253 ARG A NH1   1 
ATOM   2015 N  NH2   . ARG A 1 253 ? 34.487  71.892  57.850  1.00 59.61  ? 253 ARG A NH2   1 
ATOM   2016 N  N     . ASN A 1 254 ? 29.787  71.337  55.588  1.00 43.28  ? 254 ASN A N     1 
ATOM   2017 C  CA    . ASN A 1 254 ? 29.394  72.511  56.387  1.00 41.36  ? 254 ASN A CA    1 
ATOM   2018 C  C     . ASN A 1 254 ? 30.612  73.134  57.068  1.00 40.66  ? 254 ASN A C     1 
ATOM   2019 O  O     . ASN A 1 254 ? 31.535  72.424  57.414  1.00 41.06  ? 254 ASN A O     1 
ATOM   2020 C  CB    . ASN A 1 254 ? 28.346  72.136  57.424  1.00 42.08  ? 254 ASN A CB    1 
ATOM   2021 C  CG    . ASN A 1 254 ? 27.024  71.724  56.790  1.00 42.26  ? 254 ASN A CG    1 
ATOM   2022 O  OD1   . ASN A 1 254 ? 26.801  71.934  55.597  1.00 40.09  ? 254 ASN A OD1   1 
ATOM   2023 N  ND2   . ASN A 1 254 ? 26.152  71.117  57.584  1.00 43.23  ? 254 ASN A ND2   1 
ATOM   2024 N  N     . SER A 1 255 ? 30.637  74.453  57.247  1.00 39.60  ? 255 SER A N     1 
ATOM   2025 C  CA    . SER A 1 255 ? 31.855  75.091  57.752  1.00 39.47  ? 255 SER A CA    1 
ATOM   2026 C  C     . SER A 1 255 ? 31.677  76.491  58.320  1.00 39.05  ? 255 SER A C     1 
ATOM   2027 O  O     . SER A 1 255 ? 30.709  77.185  57.981  1.00 37.98  ? 255 SER A O     1 
ATOM   2028 C  CB    . SER A 1 255 ? 32.906  75.127  56.635  1.00 38.19  ? 255 SER A CB    1 
ATOM   2029 O  OG    . SER A 1 255 ? 34.124  75.669  57.095  1.00 37.54  ? 255 SER A OG    1 
ATOM   2030 N  N     . ARG A 1 256 ? 32.626  76.873  59.191  1.00 40.43  ? 256 ARG A N     1 
ATOM   2031 C  CA    . ARG A 1 256 ? 32.828  78.257  59.660  1.00 40.88  ? 256 ARG A CA    1 
ATOM   2032 C  C     . ARG A 1 256 ? 34.237  78.784  59.342  1.00 40.50  ? 256 ARG A C     1 
ATOM   2033 O  O     . ARG A 1 256 ? 34.629  79.847  59.826  1.00 41.49  ? 256 ARG A O     1 
ATOM   2034 C  CB    . ARG A 1 256 ? 32.680  78.373  61.179  1.00 43.73  ? 256 ARG A CB    1 
ATOM   2035 C  CG    . ARG A 1 256 ? 31.521  77.656  61.840  1.00 46.46  ? 256 ARG A CG    1 
ATOM   2036 C  CD    . ARG A 1 256 ? 31.333  78.184  63.271  1.00 49.61  ? 256 ARG A CD    1 
ATOM   2037 N  NE    . ARG A 1 256 ? 30.444  79.349  63.245  1.00 52.96  ? 256 ARG A NE    1 
ATOM   2038 C  CZ    . ARG A 1 256 ? 30.743  80.593  63.630  1.00 53.36  ? 256 ARG A CZ    1 
ATOM   2039 N  NH1   . ARG A 1 256 ? 31.922  80.912  64.141  1.00 52.27  ? 256 ARG A NH1   1 
ATOM   2040 N  NH2   . ARG A 1 256 ? 29.820  81.542  63.502  1.00 54.76  ? 256 ARG A NH2   1 
ATOM   2041 N  N     . ASN A 1 257 ? 35.006  78.035  58.560  1.00 38.85  ? 257 ASN A N     1 
ATOM   2042 C  CA    . ASN A 1 257 ? 36.378  78.393  58.230  1.00 37.34  ? 257 ASN A CA    1 
ATOM   2043 C  C     . ASN A 1 257 ? 36.392  79.234  56.958  1.00 37.89  ? 257 ASN A C     1 
ATOM   2044 O  O     . ASN A 1 257 ? 36.088  78.734  55.875  1.00 37.28  ? 257 ASN A O     1 
ATOM   2045 C  CB    . ASN A 1 257 ? 37.171  77.107  58.046  1.00 37.18  ? 257 ASN A CB    1 
ATOM   2046 C  CG    . ASN A 1 257 ? 38.658  77.331  57.772  1.00 36.57  ? 257 ASN A CG    1 
ATOM   2047 O  OD1   . ASN A 1 257 ? 39.088  78.387  57.328  1.00 34.94  ? 257 ASN A OD1   1 
ATOM   2048 N  ND2   . ASN A 1 257 ? 39.433  76.290  57.981  1.00 36.69  ? 257 ASN A ND2   1 
ATOM   2049 N  N     . LEU A 1 258 ? 36.760  80.507  57.085  1.00 39.85  ? 258 LEU A N     1 
ATOM   2050 C  CA    . LEU A 1 258 ? 36.818  81.428  55.936  1.00 41.11  ? 258 LEU A CA    1 
ATOM   2051 C  C     . LEU A 1 258 ? 37.478  80.863  54.719  1.00 42.21  ? 258 LEU A C     1 
ATOM   2052 O  O     . LEU A 1 258 ? 37.034  81.101  53.609  1.00 42.73  ? 258 LEU A O     1 
ATOM   2053 C  CB    . LEU A 1 258 ? 37.601  82.680  56.273  1.00 42.52  ? 258 LEU A CB    1 
ATOM   2054 C  CG    . LEU A 1 258 ? 36.865  83.702  57.111  1.00 43.60  ? 258 LEU A CG    1 
ATOM   2055 C  CD1   . LEU A 1 258 ? 37.766  84.924  57.257  1.00 43.81  ? 258 LEU A CD1   1 
ATOM   2056 C  CD2   . LEU A 1 258 ? 35.537  84.061  56.475  1.00 42.45  ? 258 LEU A CD2   1 
ATOM   2057 N  N     . GLU A 1 259 ? 38.560  80.132  54.935  1.00 45.24  ? 259 GLU A N     1 
ATOM   2058 C  CA    . GLU A 1 259 ? 39.366  79.632  53.839  1.00 45.92  ? 259 GLU A CA    1 
ATOM   2059 C  C     . GLU A 1 259 ? 38.699  78.437  53.174  1.00 43.62  ? 259 GLU A C     1 
ATOM   2060 O  O     . GLU A 1 259 ? 39.025  78.106  52.036  1.00 44.19  ? 259 GLU A O     1 
ATOM   2061 C  CB    . GLU A 1 259 ? 40.780  79.290  54.324  1.00 49.65  ? 259 GLU A CB    1 
ATOM   2062 C  CG    . GLU A 1 259 ? 41.365  80.214  55.405  1.00 52.34  ? 259 GLU A CG    1 
ATOM   2063 C  CD    . GLU A 1 259 ? 41.080  81.709  55.241  1.00 54.88  ? 259 GLU A CD    1 
ATOM   2064 O  OE1   . GLU A 1 259 ? 40.834  82.186  54.110  1.00 56.86  ? 259 GLU A OE1   1 
ATOM   2065 O  OE2   . GLU A 1 259 ? 41.112  82.432  56.270  1.00 58.51  ? 259 GLU A OE2   1 
ATOM   2066 N  N     . GLU A 1 260 ? 37.771  77.786  53.876  1.00 40.72  ? 260 GLU A N     1 
ATOM   2067 C  CA    . GLU A 1 260 ? 36.909  76.787  53.232  1.00 39.51  ? 260 GLU A CA    1 
ATOM   2068 C  C     . GLU A 1 260 ? 35.772  77.453  52.462  1.00 35.53  ? 260 GLU A C     1 
ATOM   2069 O  O     . GLU A 1 260 ? 35.354  76.963  51.418  1.00 36.12  ? 260 GLU A O     1 
ATOM   2070 C  CB    . GLU A 1 260 ? 36.295  75.815  54.249  1.00 40.62  ? 260 GLU A CB    1 
ATOM   2071 C  CG    . GLU A 1 260 ? 36.939  74.448  54.321  1.00 43.15  ? 260 GLU A CG    1 
ATOM   2072 C  CD    . GLU A 1 260 ? 36.101  73.481  55.146  1.00 44.10  ? 260 GLU A CD    1 
ATOM   2073 O  OE1   . GLU A 1 260 ? 35.847  73.780  56.330  1.00 43.57  ? 260 GLU A OE1   1 
ATOM   2074 O  OE2   . GLU A 1 260 ? 35.660  72.444  54.602  1.00 44.59  ? 260 GLU A OE2   1 
ATOM   2075 N  N     . ILE A 1 261 ? 35.263  78.562  52.975  1.00 32.46  ? 261 ILE A N     1 
ATOM   2076 C  CA    . ILE A 1 261 ? 34.053  79.157  52.411  1.00 30.90  ? 261 ILE A CA    1 
ATOM   2077 C  C     . ILE A 1 261 ? 34.373  80.068  51.220  1.00 30.33  ? 261 ILE A C     1 
ATOM   2078 O  O     . ILE A 1 261 ? 33.695  80.012  50.202  1.00 28.21  ? 261 ILE A O     1 
ATOM   2079 C  CB    . ILE A 1 261 ? 33.263  79.917  53.484  1.00 29.86  ? 261 ILE A CB    1 
ATOM   2080 C  CG1   . ILE A 1 261 ? 32.877  78.982  54.631  1.00 30.16  ? 261 ILE A CG1   1 
ATOM   2081 C  CG2   . ILE A 1 261 ? 31.994  80.526  52.886  1.00 29.02  ? 261 ILE A CG2   1 
ATOM   2082 C  CD1   . ILE A 1 261 ? 32.448  79.707  55.896  1.00 30.08  ? 261 ILE A CD1   1 
ATOM   2083 N  N     . LYS A 1 262 ? 35.448  80.855  51.340  1.00 30.95  ? 262 LYS A N     1 
ATOM   2084 C  CA    . LYS A 1 262 ? 35.858  81.814  50.315  1.00 31.35  ? 262 LYS A CA    1 
ATOM   2085 C  C     . LYS A 1 262 ? 35.795  81.302  48.876  1.00 32.41  ? 262 LYS A C     1 
ATOM   2086 O  O     . LYS A 1 262 ? 35.246  81.987  48.016  1.00 33.76  ? 262 LYS A O     1 
ATOM   2087 C  CB    . LYS A 1 262 ? 37.277  82.348  50.607  1.00 32.86  ? 262 LYS A CB    1 
ATOM   2088 C  CG    . LYS A 1 262 ? 37.304  83.648  51.381  1.00 32.32  ? 262 LYS A CG    1 
ATOM   2089 C  CD    . LYS A 1 262 ? 38.494  83.783  52.319  1.00 32.85  ? 262 LYS A CD    1 
ATOM   2090 C  CE    . LYS A 1 262 ? 39.829  83.896  51.623  1.00 34.01  ? 262 LYS A CE    1 
ATOM   2091 N  NZ    . LYS A 1 262 ? 40.893  84.254  52.604  1.00 34.63  ? 262 LYS A NZ    1 
ATOM   2092 N  N     . PRO A 1 263 ? 36.373  80.113  48.600  1.00 33.09  ? 263 PRO A N     1 
ATOM   2093 C  CA    . PRO A 1 263 ? 36.372  79.637  47.226  1.00 33.32  ? 263 PRO A CA    1 
ATOM   2094 C  C     . PRO A 1 263 ? 34.975  79.650  46.634  1.00 31.85  ? 263 PRO A C     1 
ATOM   2095 O  O     . PRO A 1 263 ? 34.797  80.044  45.476  1.00 30.71  ? 263 PRO A O     1 
ATOM   2096 C  CB    . PRO A 1 263 ? 36.898  78.196  47.331  1.00 34.64  ? 263 PRO A CB    1 
ATOM   2097 C  CG    . PRO A 1 263 ? 37.636  78.135  48.620  1.00 34.94  ? 263 PRO A CG    1 
ATOM   2098 C  CD    . PRO A 1 263 ? 37.136  79.227  49.504  1.00 34.14  ? 263 PRO A CD    1 
ATOM   2099 N  N     . TYR A 1 264 ? 33.997  79.224  47.431  1.00 30.25  ? 264 TYR A N     1 
ATOM   2100 C  CA    . TYR A 1 264 ? 32.614  79.192  46.967  1.00 29.36  ? 264 TYR A CA    1 
ATOM   2101 C  C     . TYR A 1 264 ? 32.091  80.599  46.800  1.00 27.68  ? 264 TYR A C     1 
ATOM   2102 O  O     . TYR A 1 264 ? 31.460  80.903  45.776  1.00 27.51  ? 264 TYR A O     1 
ATOM   2103 C  CB    . TYR A 1 264 ? 31.721  78.441  47.935  1.00 29.80  ? 264 TYR A CB    1 
ATOM   2104 C  CG    . TYR A 1 264 ? 32.074  76.993  48.124  1.00 31.32  ? 264 TYR A CG    1 
ATOM   2105 C  CD1   . TYR A 1 264 ? 31.599  76.022  47.237  1.00 32.03  ? 264 TYR A CD1   1 
ATOM   2106 C  CD2   . TYR A 1 264 ? 32.825  76.583  49.214  1.00 31.77  ? 264 TYR A CD2   1 
ATOM   2107 C  CE1   . TYR A 1 264 ? 31.888  74.689  47.412  1.00 33.39  ? 264 TYR A CE1   1 
ATOM   2108 C  CE2   . TYR A 1 264 ? 33.125  75.238  49.407  1.00 33.57  ? 264 TYR A CE2   1 
ATOM   2109 C  CZ    . TYR A 1 264 ? 32.651  74.306  48.501  1.00 34.31  ? 264 TYR A CZ    1 
ATOM   2110 O  OH    . TYR A 1 264 ? 32.937  72.993  48.667  1.00 36.53  ? 264 TYR A OH    1 
ATOM   2111 N  N     . LEU A 1 265 ? 32.355  81.458  47.785  1.00 26.17  ? 265 LEU A N     1 
ATOM   2112 C  CA    . LEU A 1 265 ? 31.872  82.826  47.720  1.00 25.98  ? 265 LEU A CA    1 
ATOM   2113 C  C     . LEU A 1 265 ? 32.435  83.528  46.488  1.00 25.75  ? 265 LEU A C     1 
ATOM   2114 O  O     . LEU A 1 265 ? 31.707  84.163  45.740  1.00 26.34  ? 265 LEU A O     1 
ATOM   2115 C  CB    . LEU A 1 265 ? 32.226  83.586  48.987  1.00 27.04  ? 265 LEU A CB    1 
ATOM   2116 C  CG    . LEU A 1 265 ? 31.840  85.068  49.110  1.00 27.61  ? 265 LEU A CG    1 
ATOM   2117 C  CD1   . LEU A 1 265 ? 30.362  85.297  48.934  1.00 27.64  ? 265 LEU A CD1   1 
ATOM   2118 C  CD2   . LEU A 1 265 ? 32.250  85.612  50.464  1.00 29.14  ? 265 LEU A CD2   1 
ATOM   2119 N  N     . PHE A 1 266 ? 33.725  83.378  46.258  1.00 25.79  ? 266 PHE A N     1 
ATOM   2120 C  CA    . PHE A 1 266 ? 34.390  84.058  45.156  1.00 25.79  ? 266 PHE A CA    1 
ATOM   2121 C  C     . PHE A 1 266 ? 33.959  83.538  43.780  1.00 26.24  ? 266 PHE A C     1 
ATOM   2122 O  O     . PHE A 1 266 ? 33.883  84.302  42.831  1.00 25.80  ? 266 PHE A O     1 
ATOM   2123 C  CB    . PHE A 1 266 ? 35.914  83.937  45.305  1.00 25.95  ? 266 PHE A CB    1 
ATOM   2124 C  CG    . PHE A 1 266 ? 36.505  84.742  46.441  1.00 25.38  ? 266 PHE A CG    1 
ATOM   2125 C  CD1   . PHE A 1 266 ? 35.813  85.777  47.050  1.00 24.86  ? 266 PHE A CD1   1 
ATOM   2126 C  CD2   . PHE A 1 266 ? 37.799  84.492  46.858  1.00 26.00  ? 266 PHE A CD2   1 
ATOM   2127 C  CE1   . PHE A 1 266 ? 36.386  86.524  48.065  1.00 24.86  ? 266 PHE A CE1   1 
ATOM   2128 C  CE2   . PHE A 1 266 ? 38.386  85.234  47.876  1.00 25.77  ? 266 PHE A CE2   1 
ATOM   2129 C  CZ    . PHE A 1 266 ? 37.678  86.260  48.473  1.00 25.58  ? 266 PHE A CZ    1 
ATOM   2130 N  N     . ARG A 1 267 ? 33.725  82.240  43.658  1.00 27.74  ? 267 ARG A N     1 
ATOM   2131 C  CA    . ARG A 1 267 ? 33.161  81.699  42.423  1.00 30.06  ? 267 ARG A CA    1 
ATOM   2132 C  C     . ARG A 1 267 ? 31.779  82.303  42.185  1.00 28.29  ? 267 ARG A C     1 
ATOM   2133 O  O     . ARG A 1 267 ? 31.471  82.722  41.075  1.00 27.33  ? 267 ARG A O     1 
ATOM   2134 C  CB    . ARG A 1 267 ? 33.063  80.169  42.451  1.00 33.54  ? 267 ARG A CB    1 
ATOM   2135 C  CG    . ARG A 1 267 ? 32.472  79.595  41.162  1.00 37.90  ? 267 ARG A CG    1 
ATOM   2136 C  CD    . ARG A 1 267 ? 32.934  78.177  40.850  1.00 42.44  ? 267 ARG A CD    1 
ATOM   2137 N  NE    . ARG A 1 267 ? 32.556  77.243  41.906  1.00 46.20  ? 267 ARG A NE    1 
ATOM   2138 C  CZ    . ARG A 1 267 ? 31.325  76.754  42.093  1.00 50.15  ? 267 ARG A CZ    1 
ATOM   2139 N  NH1   . ARG A 1 267 ? 30.316  77.096  41.287  1.00 49.88  ? 267 ARG A NH1   1 
ATOM   2140 N  NH2   . ARG A 1 267 ? 31.096  75.916  43.105  1.00 51.33  ? 267 ARG A NH2   1 
ATOM   2141 N  N     . ALA A 1 268 ? 30.967  82.355  43.244  1.00 27.03  ? 268 ALA A N     1 
ATOM   2142 C  CA    . ALA A 1 268 ? 29.609  82.883  43.157  1.00 26.63  ? 268 ALA A CA    1 
ATOM   2143 C  C     . ALA A 1 268 ? 29.640  84.333  42.695  1.00 26.55  ? 268 ALA A C     1 
ATOM   2144 O  O     . ALA A 1 268 ? 28.823  84.740  41.878  1.00 25.19  ? 268 ALA A O     1 
ATOM   2145 C  CB    . ALA A 1 268 ? 28.901  82.775  44.502  1.00 25.85  ? 268 ALA A CB    1 
ATOM   2146 N  N     . ILE A 1 269 ? 30.604  85.092  43.212  1.00 26.60  ? 269 ILE A N     1 
ATOM   2147 C  CA    . ILE A 1 269 ? 30.782  86.483  42.800  1.00 28.05  ? 269 ILE A CA    1 
ATOM   2148 C  C     . ILE A 1 269 ? 31.216  86.599  41.338  1.00 29.42  ? 269 ILE A C     1 
ATOM   2149 O  O     . ILE A 1 269 ? 30.657  87.401  40.582  1.00 29.07  ? 269 ILE A O     1 
ATOM   2150 C  CB    . ILE A 1 269 ? 31.799  87.219  43.706  1.00 27.70  ? 269 ILE A CB    1 
ATOM   2151 C  CG1   . ILE A 1 269 ? 31.204  87.427  45.107  1.00 27.28  ? 269 ILE A CG1   1 
ATOM   2152 C  CG2   . ILE A 1 269 ? 32.190  88.562  43.114  1.00 28.19  ? 269 ILE A CG2   1 
ATOM   2153 C  CD1   . ILE A 1 269 ? 32.221  87.849  46.154  1.00 27.23  ? 269 ILE A CD1   1 
ATOM   2154 N  N     . GLU A 1 270 ? 32.207  85.809  40.937  1.00 30.85  ? 270 GLU A N     1 
ATOM   2155 C  CA    . GLU A 1 270 ? 32.671  85.860  39.553  1.00 32.74  ? 270 GLU A CA    1 
ATOM   2156 C  C     . GLU A 1 270 ? 31.539  85.518  38.551  1.00 32.00  ? 270 GLU A C     1 
ATOM   2157 O  O     . GLU A 1 270 ? 31.353  86.196  37.541  1.00 30.84  ? 270 GLU A O     1 
ATOM   2158 C  CB    . GLU A 1 270 ? 33.871  84.944  39.326  1.00 35.17  ? 270 GLU A CB    1 
ATOM   2159 C  CG    . GLU A 1 270 ? 34.364  84.975  37.875  1.00 38.65  ? 270 GLU A CG    1 
ATOM   2160 C  CD    . GLU A 1 270 ? 35.869  85.023  37.770  1.00 42.21  ? 270 GLU A CD    1 
ATOM   2161 O  OE1   . GLU A 1 270 ? 36.533  83.974  37.948  1.00 45.04  ? 270 GLU A OE1   1 
ATOM   2162 O  OE2   . GLU A 1 270 ? 36.391  86.122  37.516  1.00 44.62  ? 270 GLU A OE2   1 
ATOM   2163 N  N     . GLU A 1 271 ? 30.791  84.467  38.839  1.00 31.74  ? 271 GLU A N     1 
ATOM   2164 C  CA    . GLU A 1 271 ? 29.677  84.094  37.977  1.00 32.90  ? 271 GLU A CA    1 
ATOM   2165 C  C     . GLU A 1 271 ? 28.600  85.181  38.031  1.00 32.17  ? 271 GLU A C     1 
ATOM   2166 O  O     . GLU A 1 271 ? 27.960  85.479  37.032  1.00 32.23  ? 271 GLU A O     1 
ATOM   2167 C  CB    . GLU A 1 271 ? 29.147  82.713  38.362  1.00 33.89  ? 271 GLU A CB    1 
ATOM   2168 C  CG    . GLU A 1 271 ? 30.154  81.606  38.004  1.00 36.94  ? 271 GLU A CG    1 
ATOM   2169 C  CD    . GLU A 1 271 ? 29.806  80.233  38.570  1.00 38.54  ? 271 GLU A CD    1 
ATOM   2170 O  OE1   . GLU A 1 271 ? 28.670  80.044  39.043  1.00 40.73  ? 271 GLU A OE1   1 
ATOM   2171 O  OE2   . GLU A 1 271 ? 30.674  79.331  38.544  1.00 42.18  ? 271 GLU A OE2   1 
ATOM   2172 N  N     . SER A 1 272 ? 28.433  85.811  39.186  1.00 31.13  ? 272 SER A N     1 
ATOM   2173 C  CA    . SER A 1 272 ? 27.491  86.920  39.276  1.00 30.96  ? 272 SER A CA    1 
ATOM   2174 C  C     . SER A 1 272 ? 27.880  88.087  38.380  1.00 31.72  ? 272 SER A C     1 
ATOM   2175 O  O     . SER A 1 272 ? 26.999  88.653  37.738  1.00 31.03  ? 272 SER A O     1 
ATOM   2176 C  CB    . SER A 1 272 ? 27.309  87.394  40.707  1.00 29.38  ? 272 SER A CB    1 
ATOM   2177 O  OG    . SER A 1 272 ? 26.668  86.397  41.453  1.00 28.76  ? 272 SER A OG    1 
ATOM   2178 N  N     . TYR A 1 273 ? 29.181  88.409  38.308  1.00 33.63  ? 273 TYR A N     1 
ATOM   2179 C  CA    . TYR A 1 273 ? 29.665  89.479  37.420  1.00 35.52  ? 273 TYR A CA    1 
ATOM   2180 C  C     . TYR A 1 273 ? 29.593  89.109  35.941  1.00 39.11  ? 273 TYR A C     1 
ATOM   2181 O  O     . TYR A 1 273 ? 29.428  89.986  35.090  1.00 41.00  ? 273 TYR A O     1 
ATOM   2182 C  CB    . TYR A 1 273 ? 31.070  90.007  37.814  1.00 35.52  ? 273 TYR A CB    1 
ATOM   2183 C  CG    . TYR A 1 273 ? 30.987  91.118  38.847  1.00 33.50  ? 273 TYR A CG    1 
ATOM   2184 C  CD1   . TYR A 1 273 ? 30.720  90.824  40.169  1.00 32.11  ? 273 TYR A CD1   1 
ATOM   2185 C  CD2   . TYR A 1 273 ? 31.131  92.458  38.488  1.00 33.90  ? 273 TYR A CD2   1 
ATOM   2186 C  CE1   . TYR A 1 273 ? 30.594  91.826  41.119  1.00 31.59  ? 273 TYR A CE1   1 
ATOM   2187 C  CE2   . TYR A 1 273 ? 31.014  93.470  39.430  1.00 33.43  ? 273 TYR A CE2   1 
ATOM   2188 C  CZ    . TYR A 1 273 ? 30.728  93.142  40.750  1.00 32.04  ? 273 TYR A CZ    1 
ATOM   2189 O  OH    . TYR A 1 273 ? 30.607  94.117  41.723  1.00 31.72  ? 273 TYR A OH    1 
ATOM   2190 N  N     . TYR A 1 274 ? 29.682  87.826  35.620  1.00 41.53  ? 274 TYR A N     1 
ATOM   2191 C  CA    . TYR A 1 274 ? 29.424  87.407  34.247  1.00 44.88  ? 274 TYR A CA    1 
ATOM   2192 C  C     . TYR A 1 274 ? 27.930  87.633  33.895  1.00 44.68  ? 274 TYR A C     1 
ATOM   2193 O  O     . TYR A 1 274 ? 27.614  88.140  32.829  1.00 44.09  ? 274 TYR A O     1 
ATOM   2194 C  CB    . TYR A 1 274 ? 29.812  85.948  34.048  1.00 47.23  ? 274 TYR A CB    1 
ATOM   2195 C  CG    . TYR A 1 274 ? 29.465  85.433  32.688  1.00 51.19  ? 274 TYR A CG    1 
ATOM   2196 C  CD1   . TYR A 1 274 ? 28.201  84.903  32.425  1.00 52.59  ? 274 TYR A CD1   1 
ATOM   2197 C  CD2   . TYR A 1 274 ? 30.386  85.489  31.648  1.00 55.64  ? 274 TYR A CD2   1 
ATOM   2198 C  CE1   . TYR A 1 274 ? 27.873  84.436  31.161  1.00 56.33  ? 274 TYR A CE1   1 
ATOM   2199 C  CE2   . TYR A 1 274 ? 30.067  85.019  30.377  1.00 58.00  ? 274 TYR A CE2   1 
ATOM   2200 C  CZ    . TYR A 1 274 ? 28.810  84.494  30.143  1.00 58.62  ? 274 TYR A CZ    1 
ATOM   2201 O  OH    . TYR A 1 274 ? 28.476  84.029  28.887  1.00 66.32  ? 274 TYR A OH    1 
ATOM   2202 N  N     . LYS A 1 275 ? 27.019  87.262  34.791  1.00 43.27  ? 275 LYS A N     1 
ATOM   2203 C  CA    . LYS A 1 275 ? 25.585  87.540  34.576  1.00 43.97  ? 275 LYS A CA    1 
ATOM   2204 C  C     . LYS A 1 275 ? 25.275  89.033  34.520  1.00 44.32  ? 275 LYS A C     1 
ATOM   2205 O  O     . LYS A 1 275 ? 24.415  89.448  33.765  1.00 45.02  ? 275 LYS A O     1 
ATOM   2206 C  CB    . LYS A 1 275 ? 24.726  86.967  35.692  1.00 42.22  ? 275 LYS A CB    1 
ATOM   2207 C  CG    . LYS A 1 275 ? 24.639  85.461  35.755  1.00 44.60  ? 275 LYS A CG    1 
ATOM   2208 C  CD    . LYS A 1 275 ? 23.379  85.064  36.505  1.00 44.39  ? 275 LYS A CD    1 
ATOM   2209 C  CE    . LYS A 1 275 ? 23.582  83.922  37.476  1.00 44.53  ? 275 LYS A CE    1 
ATOM   2210 N  NZ    . LYS A 1 275 ? 22.333  83.750  38.279  1.00 45.88  ? 275 LYS A NZ    1 
ATOM   2211 N  N     . LEU A 1 276 ? 25.939  89.823  35.363  1.00 44.72  ? 276 LEU A N     1 
ATOM   2212 C  CA    . LEU A 1 276 ? 25.730  91.273  35.396  1.00 46.49  ? 276 LEU A CA    1 
ATOM   2213 C  C     . LEU A 1 276 ? 26.011  91.868  34.037  1.00 49.21  ? 276 LEU A C     1 
ATOM   2214 O  O     . LEU A 1 276 ? 25.297  92.763  33.582  1.00 48.04  ? 276 LEU A O     1 
ATOM   2215 C  CB    . LEU A 1 276 ? 26.626  91.944  36.447  1.00 45.76  ? 276 LEU A CB    1 
ATOM   2216 C  CG    . LEU A 1 276 ? 26.124  91.841  37.885  1.00 45.17  ? 276 LEU A CG    1 
ATOM   2217 C  CD1   . LEU A 1 276 ? 27.201  92.270  38.875  1.00 46.69  ? 276 LEU A CD1   1 
ATOM   2218 C  CD2   . LEU A 1 276 ? 24.859  92.660  38.082  1.00 45.24  ? 276 LEU A CD2   1 
ATOM   2219 N  N     . ASP A 1 277 ? 27.060  91.350  33.403  1.00 53.74  ? 277 ASP A N     1 
ATOM   2220 C  CA    . ASP A 1 277 ? 27.413  91.683  32.026  1.00 57.15  ? 277 ASP A CA    1 
ATOM   2221 C  C     . ASP A 1 277 ? 27.901  93.128  31.984  1.00 59.73  ? 277 ASP A C     1 
ATOM   2222 O  O     . ASP A 1 277 ? 29.080  93.369  32.222  1.00 64.04  ? 277 ASP A O     1 
ATOM   2223 C  CB    . ASP A 1 277 ? 26.242  91.397  31.070  1.00 56.54  ? 277 ASP A CB    1 
ATOM   2224 C  CG    . ASP A 1 277 ? 26.655  91.416  29.601  1.00 60.99  ? 277 ASP A CG    1 
ATOM   2225 O  OD1   . ASP A 1 277 ? 27.846  91.629  29.294  1.00 62.98  ? 277 ASP A OD1   1 
ATOM   2226 O  OD2   . ASP A 1 277 ? 25.770  91.216  28.743  1.00 61.98  ? 277 ASP A OD2   1 
ATOM   2227 N  N     . LYS A 1 278 ? 27.015  94.088  31.738  1.00 60.19  ? 278 LYS A N     1 
ATOM   2228 C  CA    . LYS A 1 278 ? 27.415  95.494  31.736  1.00 62.29  ? 278 LYS A CA    1 
ATOM   2229 C  C     . LYS A 1 278 ? 26.770  96.333  32.846  1.00 59.03  ? 278 LYS A C     1 
ATOM   2230 O  O     . LYS A 1 278 ? 27.123  97.496  33.022  1.00 62.14  ? 278 LYS A O     1 
ATOM   2231 C  CB    . LYS A 1 278 ? 27.171  96.107  30.346  1.00 66.90  ? 278 LYS A CB    1 
ATOM   2232 C  CG    . LYS A 1 278 ? 28.278  95.749  29.365  1.00 70.59  ? 278 LYS A CG    1 
ATOM   2233 C  CD    . LYS A 1 278 ? 27.997  96.259  27.965  1.00 74.94  ? 278 LYS A CD    1 
ATOM   2234 C  CE    . LYS A 1 278 ? 29.175  96.003  27.033  1.00 78.32  ? 278 LYS A CE    1 
ATOM   2235 N  NZ    . LYS A 1 278 ? 28.853  96.390  25.625  1.00 81.69  ? 278 LYS A NZ    1 
ATOM   2236 N  N     . ARG A 1 279 ? 25.844  95.751  33.601  1.00 56.67  ? 279 ARG A N     1 
ATOM   2237 C  CA    . ARG A 1 279 ? 25.257  96.443  34.744  1.00 55.63  ? 279 ARG A CA    1 
ATOM   2238 C  C     . ARG A 1 279 ? 26.248  96.471  35.899  1.00 52.71  ? 279 ARG A C     1 
ATOM   2239 O  O     . ARG A 1 279 ? 26.809  95.439  36.248  1.00 53.26  ? 279 ARG A O     1 
ATOM   2240 C  CB    . ARG A 1 279 ? 23.980  95.751  35.191  1.00 56.12  ? 279 ARG A CB    1 
ATOM   2241 C  CG    . ARG A 1 279 ? 22.845  95.860  34.192  1.00 59.60  ? 279 ARG A CG    1 
ATOM   2242 C  CD    . ARG A 1 279 ? 21.774  94.809  34.453  1.00 59.40  ? 279 ARG A CD    1 
ATOM   2243 N  NE    . ARG A 1 279 ? 22.232  93.484  34.040  1.00 60.37  ? 279 ARG A NE    1 
ATOM   2244 C  CZ    . ARG A 1 279 ? 21.449  92.428  33.841  1.00 61.66  ? 279 ARG A CZ    1 
ATOM   2245 N  NH1   . ARG A 1 279 ? 20.127  92.491  34.030  1.00 60.02  ? 279 ARG A NH1   1 
ATOM   2246 N  NH2   . ARG A 1 279 ? 22.004  91.286  33.453  1.00 63.77  ? 279 ARG A NH2   1 
ATOM   2247 N  N     . ILE A 1 280 ? 26.470  97.650  36.471  1.00 50.37  ? 280 ILE A N     1 
ATOM   2248 C  CA    . ILE A 1 280 ? 27.363  97.810  37.620  1.00 48.94  ? 280 ILE A CA    1 
ATOM   2249 C  C     . ILE A 1 280 ? 26.488  98.005  38.861  1.00 45.70  ? 280 ILE A C     1 
ATOM   2250 O  O     . ILE A 1 280 ? 25.685  98.926  38.902  1.00 47.14  ? 280 ILE A O     1 
ATOM   2251 C  CB    . ILE A 1 280 ? 28.322  98.998  37.419  1.00 52.02  ? 280 ILE A CB    1 
ATOM   2252 C  CG1   . ILE A 1 280 ? 29.540  98.564  36.600  1.00 54.23  ? 280 ILE A CG1   1 
ATOM   2253 C  CG2   . ILE A 1 280 ? 28.832  99.542  38.748  1.00 52.42  ? 280 ILE A CG2   1 
ATOM   2254 C  CD1   . ILE A 1 280 ? 29.206  98.040  35.222  1.00 55.83  ? 280 ILE A CD1   1 
ATOM   2255 N  N     . PRO A 1 281 ? 26.610  97.121  39.864  1.00 40.47  ? 281 PRO A N     1 
ATOM   2256 C  CA    . PRO A 1 281 ? 25.764  97.209  41.059  1.00 39.17  ? 281 PRO A CA    1 
ATOM   2257 C  C     . PRO A 1 281 ? 26.306  98.197  42.107  1.00 39.70  ? 281 PRO A C     1 
ATOM   2258 O  O     . PRO A 1 281 ? 27.510  98.427  42.166  1.00 39.44  ? 281 PRO A O     1 
ATOM   2259 C  CB    . PRO A 1 281 ? 25.807  95.775  41.599  1.00 36.83  ? 281 PRO A CB    1 
ATOM   2260 C  CG    . PRO A 1 281 ? 27.182  95.298  41.227  1.00 36.93  ? 281 PRO A CG    1 
ATOM   2261 C  CD    . PRO A 1 281 ? 27.519  95.963  39.922  1.00 39.30  ? 281 PRO A CD    1 
ATOM   2262 N  N     . LYS A 1 282 ? 25.429  98.777  42.922  1.00 40.18  ? 282 LYS A N     1 
ATOM   2263 C  CA    . LYS A 1 282 ? 25.890  99.581  44.068  1.00 40.81  ? 282 LYS A CA    1 
ATOM   2264 C  C     . LYS A 1 282 ? 25.658  98.892  45.416  1.00 38.39  ? 282 LYS A C     1 
ATOM   2265 O  O     . LYS A 1 282 ? 26.121  99.381  46.452  1.00 39.38  ? 282 LYS A O     1 
ATOM   2266 C  CB    . LYS A 1 282 ? 25.206  100.937 44.083  1.00 43.59  ? 282 LYS A CB    1 
ATOM   2267 C  CG    . LYS A 1 282 ? 25.503  101.794 42.868  1.00 46.88  ? 282 LYS A CG    1 
ATOM   2268 C  CD    . LYS A 1 282 ? 25.087  103.251 43.068  1.00 51.06  ? 282 LYS A CD    1 
ATOM   2269 C  CE    . LYS A 1 282 ? 23.607  103.402 43.415  1.00 52.32  ? 282 LYS A CE    1 
ATOM   2270 N  NZ    . LYS A 1 282 ? 22.700  102.595 42.550  1.00 52.82  ? 282 LYS A NZ    1 
ATOM   2271 N  N     . ALA A 1 283 ? 24.954  97.762  45.418  1.00 35.32  ? 283 ALA A N     1 
ATOM   2272 C  CA    . ALA A 1 283 ? 24.717  97.027  46.663  1.00 34.69  ? 283 ALA A CA    1 
ATOM   2273 C  C     . ALA A 1 283 ? 25.147  95.584  46.502  1.00 33.22  ? 283 ALA A C     1 
ATOM   2274 O  O     . ALA A 1 283 ? 25.053  95.016  45.404  1.00 32.85  ? 283 ALA A O     1 
ATOM   2275 C  CB    . ALA A 1 283 ? 23.253  97.090  47.072  1.00 34.71  ? 283 ALA A CB    1 
ATOM   2276 N  N     . ILE A 1 284 ? 25.613  95.017  47.615  1.00 30.92  ? 284 ILE A N     1 
ATOM   2277 C  CA    . ILE A 1 284 ? 26.009  93.636  47.697  1.00 28.83  ? 284 ILE A CA    1 
ATOM   2278 C  C     . ILE A 1 284 ? 25.491  93.048  48.987  1.00 28.64  ? 284 ILE A C     1 
ATOM   2279 O  O     . ILE A 1 284 ? 25.612  93.644  50.049  1.00 29.72  ? 284 ILE A O     1 
ATOM   2280 C  CB    . ILE A 1 284 ? 27.558  93.459  47.627  1.00 28.80  ? 284 ILE A CB    1 
ATOM   2281 C  CG1   . ILE A 1 284 ? 27.943  91.973  47.750  1.00 27.44  ? 284 ILE A CG1   1 
ATOM   2282 C  CG2   . ILE A 1 284 ? 28.278  94.296  48.690  1.00 28.91  ? 284 ILE A CG2   1 
ATOM   2283 C  CD1   . ILE A 1 284 ? 29.427  91.690  47.532  1.00 27.28  ? 284 ILE A CD1   1 
ATOM   2284 N  N     . HIS A 1 285 ? 24.913  91.864  48.897  1.00 28.02  ? 285 HIS A N     1 
ATOM   2285 C  CA    . HIS A 1 285 ? 24.591  91.114  50.079  1.00 28.75  ? 285 HIS A CA    1 
ATOM   2286 C  C     . HIS A 1 285 ? 25.166  89.740  49.943  1.00 27.69  ? 285 HIS A C     1 
ATOM   2287 O  O     . HIS A 1 285 ? 25.057  89.102  48.875  1.00 26.36  ? 285 HIS A O     1 
ATOM   2288 C  CB    . HIS A 1 285 ? 23.077  91.010  50.269  1.00 30.35  ? 285 HIS A CB    1 
ATOM   2289 C  CG    . HIS A 1 285 ? 22.410  92.335  50.444  1.00 33.33  ? 285 HIS A CG    1 
ATOM   2290 N  ND1   . HIS A 1 285 ? 21.729  92.680  51.593  1.00 35.69  ? 285 HIS A ND1   1 
ATOM   2291 C  CD2   . HIS A 1 285 ? 22.364  93.419  49.637  1.00 34.15  ? 285 HIS A CD2   1 
ATOM   2292 C  CE1   . HIS A 1 285 ? 21.267  93.908  51.473  1.00 36.34  ? 285 HIS A CE1   1 
ATOM   2293 N  NE2   . HIS A 1 285 ? 21.637  94.378  50.294  1.00 36.60  ? 285 HIS A NE2   1 
ATOM   2294 N  N     . VAL A 1 286 ? 25.772  89.301  51.039  1.00 27.68  ? 286 VAL A N     1 
ATOM   2295 C  CA    . VAL A 1 286 ? 26.242  87.956  51.210  1.00 27.28  ? 286 VAL A CA    1 
ATOM   2296 C  C     . VAL A 1 286 ? 25.196  87.172  51.982  1.00 27.70  ? 286 VAL A C     1 
ATOM   2297 O  O     . VAL A 1 286 ? 24.762  87.572  53.080  1.00 27.22  ? 286 VAL A O     1 
ATOM   2298 C  CB    . VAL A 1 286 ? 27.558  87.937  51.995  1.00 27.55  ? 286 VAL A CB    1 
ATOM   2299 C  CG1   . VAL A 1 286 ? 27.994  86.508  52.256  1.00 27.62  ? 286 VAL A CG1   1 
ATOM   2300 C  CG2   . VAL A 1 286 ? 28.624  88.694  51.219  1.00 28.31  ? 286 VAL A CG2   1 
ATOM   2301 N  N     . VAL A 1 287 ? 24.829  86.029  51.422  1.00 27.84  ? 287 VAL A N     1 
ATOM   2302 C  CA    . VAL A 1 287 ? 23.760  85.213  51.947  1.00 27.98  ? 287 VAL A CA    1 
ATOM   2303 C  C     . VAL A 1 287 ? 24.322  83.877  52.395  1.00 28.06  ? 287 VAL A C     1 
ATOM   2304 O  O     . VAL A 1 287 ? 24.969  83.199  51.629  1.00 28.94  ? 287 VAL A O     1 
ATOM   2305 C  CB    . VAL A 1 287 ? 22.701  84.960  50.863  1.00 27.90  ? 287 VAL A CB    1 
ATOM   2306 C  CG1   . VAL A 1 287 ? 21.543  84.140  51.429  1.00 28.35  ? 287 VAL A CG1   1 
ATOM   2307 C  CG2   . VAL A 1 287 ? 22.199  86.276  50.283  1.00 28.08  ? 287 VAL A CG2   1 
ATOM   2308 N  N     . ALA A 1 288 ? 24.079  83.511  53.642  1.00 29.64  ? 288 ALA A N     1 
ATOM   2309 C  CA    . ALA A 1 288 ? 24.496  82.222  54.169  1.00 30.88  ? 288 ALA A CA    1 
ATOM   2310 C  C     . ALA A 1 288 ? 23.257  81.425  54.499  1.00 31.47  ? 288 ALA A C     1 
ATOM   2311 O  O     . ALA A 1 288 ? 22.336  81.954  55.124  1.00 32.81  ? 288 ALA A O     1 
ATOM   2312 C  CB    . ALA A 1 288 ? 25.357  82.402  55.423  1.00 30.69  ? 288 ALA A CB    1 
ATOM   2313 N  N     . VAL A 1 289 ? 23.229  80.170  54.053  1.00 32.63  ? 289 VAL A N     1 
ATOM   2314 C  CA    . VAL A 1 289 ? 22.232  79.213  54.483  1.00 33.97  ? 289 VAL A CA    1 
ATOM   2315 C  C     . VAL A 1 289 ? 22.945  78.369  55.514  1.00 35.68  ? 289 VAL A C     1 
ATOM   2316 O  O     . VAL A 1 289 ? 23.951  77.748  55.189  1.00 35.13  ? 289 VAL A O     1 
ATOM   2317 C  CB    . VAL A 1 289 ? 21.731  78.312  53.331  1.00 35.48  ? 289 VAL A CB    1 
ATOM   2318 C  CG1   . VAL A 1 289 ? 20.631  77.373  53.809  1.00 37.10  ? 289 VAL A CG1   1 
ATOM   2319 C  CG2   . VAL A 1 289 ? 21.205  79.137  52.165  1.00 34.97  ? 289 VAL A CG2   1 
ATOM   2320 N  N     . THR A 1 290 ? 22.433  78.357  56.750  1.00 37.44  ? 290 THR A N     1 
ATOM   2321 C  CA    . THR A 1 290 ? 23.036  77.590  57.854  1.00 40.51  ? 290 THR A CA    1 
ATOM   2322 C  C     . THR A 1 290 ? 22.756  76.086  57.773  1.00 42.79  ? 290 THR A C     1 
ATOM   2323 O  O     . THR A 1 290 ? 22.009  75.633  56.923  1.00 41.11  ? 290 THR A O     1 
ATOM   2324 C  CB    . THR A 1 290 ? 22.578  78.117  59.231  1.00 40.84  ? 290 THR A CB    1 
ATOM   2325 O  OG1   . THR A 1 290 ? 21.140  78.077  59.319  1.00 42.69  ? 290 THR A OG1   1 
ATOM   2326 C  CG2   . THR A 1 290 ? 23.072  79.537  59.431  1.00 39.83  ? 290 THR A CG2   1 
ATOM   2327 N  N     . GLU A 1 291 ? 23.380  75.321  58.666  1.00 47.28  ? 291 GLU A N     1 
ATOM   2328 C  CA    . GLU A 1 291 ? 23.323  73.856  58.628  1.00 51.15  ? 291 GLU A CA    1 
ATOM   2329 C  C     . GLU A 1 291 ? 21.931  73.311  58.899  1.00 52.62  ? 291 GLU A C     1 
ATOM   2330 O  O     . GLU A 1 291 ? 21.633  72.185  58.522  1.00 52.68  ? 291 GLU A O     1 
ATOM   2331 C  CB    . GLU A 1 291 ? 24.312  73.245  59.628  1.00 54.16  ? 291 GLU A CB    1 
ATOM   2332 C  CG    . GLU A 1 291 ? 23.980  73.536  61.086  1.00 56.55  ? 291 GLU A CG    1 
ATOM   2333 C  CD    . GLU A 1 291 ? 25.169  73.343  61.997  1.00 57.82  ? 291 GLU A CD    1 
ATOM   2334 O  OE1   . GLU A 1 291 ? 25.778  72.250  61.942  1.00 59.31  ? 291 GLU A OE1   1 
ATOM   2335 O  OE2   . GLU A 1 291 ? 25.495  74.289  62.750  1.00 58.10  ? 291 GLU A OE2   1 
ATOM   2336 N  N     . ASP A 1 292 ? 21.093  74.106  59.554  1.00 54.65  ? 292 ASP A N     1 
ATOM   2337 C  CA    . ASP A 1 292 ? 19.677  73.760  59.728  1.00 57.17  ? 292 ASP A CA    1 
ATOM   2338 C  C     . ASP A 1 292 ? 18.771  74.420  58.665  1.00 56.06  ? 292 ASP A C     1 
ATOM   2339 O  O     . ASP A 1 292 ? 17.553  74.393  58.775  1.00 58.76  ? 292 ASP A O     1 
ATOM   2340 C  CB    . ASP A 1 292 ? 19.205  74.094  61.149  1.00 58.79  ? 292 ASP A CB    1 
ATOM   2341 C  CG    . ASP A 1 292 ? 19.564  75.506  61.579  1.00 59.88  ? 292 ASP A CG    1 
ATOM   2342 O  OD1   . ASP A 1 292 ? 19.540  76.424  60.730  1.00 61.31  ? 292 ASP A OD1   1 
ATOM   2343 O  OD2   . ASP A 1 292 ? 19.878  75.694  62.772  1.00 60.69  ? 292 ASP A OD2   1 
ATOM   2344 N  N     . LEU A 1 293 ? 19.377  74.989  57.631  1.00 54.92  ? 293 LEU A N     1 
ATOM   2345 C  CA    . LEU A 1 293 ? 18.657  75.599  56.495  1.00 53.45  ? 293 LEU A CA    1 
ATOM   2346 C  C     . LEU A 1 293 ? 17.957  76.926  56.808  1.00 51.89  ? 293 LEU A C     1 
ATOM   2347 O  O     . LEU A 1 293 ? 17.134  77.402  56.007  1.00 48.54  ? 293 LEU A O     1 
ATOM   2348 C  CB    . LEU A 1 293 ? 17.670  74.613  55.836  1.00 55.59  ? 293 LEU A CB    1 
ATOM   2349 C  CG    . LEU A 1 293 ? 18.167  73.190  55.524  1.00 56.75  ? 293 LEU A CG    1 
ATOM   2350 C  CD1   . LEU A 1 293 ? 17.053  72.370  54.881  1.00 56.68  ? 293 LEU A CD1   1 
ATOM   2351 C  CD2   . LEU A 1 293 ? 19.395  73.204  54.627  1.00 54.94  ? 293 LEU A CD2   1 
ATOM   2352 N  N     . ASP A 1 294 ? 18.310  77.550  57.930  1.00 50.63  ? 294 ASP A N     1 
ATOM   2353 C  CA    . ASP A 1 294 ? 17.931  78.941  58.163  1.00 52.53  ? 294 ASP A CA    1 
ATOM   2354 C  C     . ASP A 1 294 ? 18.737  79.814  57.175  1.00 51.21  ? 294 ASP A C     1 
ATOM   2355 O  O     . ASP A 1 294 ? 19.811  79.415  56.723  1.00 50.14  ? 294 ASP A O     1 
ATOM   2356 C  CB    . ASP A 1 294 ? 18.213  79.337  59.619  1.00 57.21  ? 294 ASP A CB    1 
ATOM   2357 C  CG    . ASP A 1 294 ? 17.296  80.464  60.138  1.00 62.02  ? 294 ASP A CG    1 
ATOM   2358 O  OD1   . ASP A 1 294 ? 16.609  81.143  59.343  1.00 63.54  ? 294 ASP A OD1   1 
ATOM   2359 O  OD2   . ASP A 1 294 ? 17.273  80.676  61.373  1.00 64.61  ? 294 ASP A OD2   1 
ATOM   2360 N  N     . ILE A 1 295 ? 18.200  80.976  56.816  1.00 49.93  ? 295 ILE A N     1 
ATOM   2361 C  CA    . ILE A 1 295 ? 18.865  81.903  55.898  1.00 47.58  ? 295 ILE A CA    1 
ATOM   2362 C  C     . ILE A 1 295 ? 19.279  83.178  56.650  1.00 48.19  ? 295 ILE A C     1 
ATOM   2363 O  O     . ILE A 1 295 ? 18.416  83.876  57.185  1.00 49.71  ? 295 ILE A O     1 
ATOM   2364 C  CB    . ILE A 1 295 ? 17.966  82.285  54.684  1.00 46.39  ? 295 ILE A CB    1 
ATOM   2365 C  CG1   . ILE A 1 295 ? 17.529  81.043  53.868  1.00 46.01  ? 295 ILE A CG1   1 
ATOM   2366 C  CG2   . ILE A 1 295 ? 18.702  83.254  53.764  1.00 46.27  ? 295 ILE A CG2   1 
ATOM   2367 C  CD1   . ILE A 1 295 ? 16.217  80.401  54.307  1.00 46.49  ? 295 ILE A CD1   1 
ATOM   2368 N  N     . VAL A 1 296 ? 20.592  83.457  56.691  1.00 45.53  ? 296 VAL A N     1 
ATOM   2369 C  CA    . VAL A 1 296 ? 21.164  84.704  57.242  1.00 43.66  ? 296 VAL A CA    1 
ATOM   2370 C  C     . VAL A 1 296 ? 21.812  85.526  56.123  1.00 41.38  ? 296 VAL A C     1 
ATOM   2371 O  O     . VAL A 1 296 ? 22.436  84.960  55.220  1.00 39.96  ? 296 VAL A O     1 
ATOM   2372 C  CB    . VAL A 1 296 ? 22.297  84.417  58.248  1.00 47.57  ? 296 VAL A CB    1 
ATOM   2373 C  CG1   . VAL A 1 296 ? 22.783  85.712  58.897  1.00 49.84  ? 296 VAL A CG1   1 
ATOM   2374 C  CG2   . VAL A 1 296 ? 21.848  83.437  59.317  1.00 50.28  ? 296 VAL A CG2   1 
ATOM   2375 N  N     . SER A 1 297 ? 21.696  86.851  56.175  1.00 38.41  ? 297 SER A N     1 
ATOM   2376 C  CA    . SER A 1 297 ? 22.403  87.692  55.200  1.00 36.69  ? 297 SER A CA    1 
ATOM   2377 C  C     . SER A 1 297 ? 22.890  89.022  55.794  1.00 34.85  ? 297 SER A C     1 
ATOM   2378 O  O     . SER A 1 297 ? 22.300  89.550  56.740  1.00 34.14  ? 297 SER A O     1 
ATOM   2379 C  CB    . SER A 1 297 ? 21.546  87.932  53.940  1.00 36.86  ? 297 SER A CB    1 
ATOM   2380 O  OG    . SER A 1 297 ? 20.768  89.118  54.040  1.00 40.68  ? 297 SER A OG    1 
ATOM   2381 N  N     . ARG A 1 298 ? 23.994  89.528  55.248  1.00 32.06  ? 298 ARG A N     1 
ATOM   2382 C  CA    . ARG A 1 298 ? 24.520  90.844  55.616  1.00 32.91  ? 298 ARG A CA    1 
ATOM   2383 C  C     . ARG A 1 298 ? 24.892  91.596  54.348  1.00 31.36  ? 298 ARG A C     1 
ATOM   2384 O  O     . ARG A 1 298 ? 25.408  90.999  53.391  1.00 31.48  ? 298 ARG A O     1 
ATOM   2385 C  CB    . ARG A 1 298 ? 25.755  90.719  56.510  1.00 34.08  ? 298 ARG A CB    1 
ATOM   2386 C  CG    . ARG A 1 298 ? 25.492  90.079  57.864  1.00 36.03  ? 298 ARG A CG    1 
ATOM   2387 C  CD    . ARG A 1 298 ? 24.708  91.002  58.778  1.00 37.86  ? 298 ARG A CD    1 
ATOM   2388 N  NE    . ARG A 1 298 ? 24.413  90.385  60.073  1.00 39.34  ? 298 ARG A NE    1 
ATOM   2389 C  CZ    . ARG A 1 298 ? 23.379  89.576  60.317  1.00 39.61  ? 298 ARG A CZ    1 
ATOM   2390 N  NH1   . ARG A 1 298 ? 22.506  89.243  59.363  1.00 38.82  ? 298 ARG A NH1   1 
ATOM   2391 N  NH2   . ARG A 1 298 ? 23.217  89.085  61.538  1.00 41.36  ? 298 ARG A NH2   1 
ATOM   2392 N  N     . GLY A 1 299 ? 24.676  92.903  54.336  1.00 30.47  ? 299 GLY A N     1 
ATOM   2393 C  CA    . GLY A 1 299 ? 24.911  93.649  53.115  1.00 30.99  ? 299 GLY A CA    1 
ATOM   2394 C  C     . GLY A 1 299 ? 25.328  95.069  53.299  1.00 32.07  ? 299 GLY A C     1 
ATOM   2395 O  O     . GLY A 1 299 ? 25.393  95.580  54.411  1.00 33.69  ? 299 GLY A O     1 
ATOM   2396 N  N     . ARG A 1 300 ? 25.606  95.716  52.184  1.00 33.05  ? 300 ARG A N     1 
ATOM   2397 C  CA    . ARG A 1 300 ? 26.044  97.089  52.222  1.00 36.83  ? 300 ARG A CA    1 
ATOM   2398 C  C     . ARG A 1 300 ? 25.756  97.702  50.895  1.00 37.41  ? 300 ARG A C     1 
ATOM   2399 O  O     . ARG A 1 300 ? 25.893  97.040  49.865  1.00 38.22  ? 300 ARG A O     1 
ATOM   2400 C  CB    . ARG A 1 300 ? 27.551  97.149  52.477  1.00 38.84  ? 300 ARG A CB    1 
ATOM   2401 C  CG    . ARG A 1 300 ? 28.161  98.529  52.348  1.00 42.01  ? 300 ARG A CG    1 
ATOM   2402 C  CD    . ARG A 1 300 ? 29.612  98.509  52.771  1.00 44.95  ? 300 ARG A CD    1 
ATOM   2403 N  NE    . ARG A 1 300 ? 30.181  99.854  52.817  1.00 50.20  ? 300 ARG A NE    1 
ATOM   2404 C  CZ    . ARG A 1 300 ? 31.440  100.125 53.154  1.00 53.67  ? 300 ARG A CZ    1 
ATOM   2405 N  NH1   . ARG A 1 300 ? 32.296  99.152  53.481  1.00 54.12  ? 300 ARG A NH1   1 
ATOM   2406 N  NH2   . ARG A 1 300 ? 31.854  101.383 53.160  1.00 59.15  ? 300 ARG A NH2   1 
ATOM   2407 N  N     . THR A 1 301 ? 25.378  98.970  50.927  1.00 39.75  ? 301 THR A N     1 
ATOM   2408 C  CA    . THR A 1 301 ? 25.176  99.751  49.730  1.00 41.12  ? 301 THR A CA    1 
ATOM   2409 C  C     . THR A 1 301 ? 26.248  100.819 49.704  1.00 43.44  ? 301 THR A C     1 
ATOM   2410 O  O     . THR A 1 301 ? 26.533  101.432 50.719  1.00 44.01  ? 301 THR A O     1 
ATOM   2411 C  CB    . THR A 1 301 ? 23.780  100.382 49.739  1.00 42.47  ? 301 THR A CB    1 
ATOM   2412 O  OG1   . THR A 1 301 ? 22.814  99.352  49.967  1.00 41.24  ? 301 THR A OG1   1 
ATOM   2413 C  CG2   . THR A 1 301 ? 23.469  101.076 48.409  1.00 42.95  ? 301 THR A CG2   1 
ATOM   2414 N  N     . PHE A 1 302 ? 26.859  101.010 48.543  1.00 44.75  ? 302 PHE A N     1 
ATOM   2415 C  CA    . PHE A 1 302 ? 27.846  102.049 48.348  1.00 46.17  ? 302 PHE A CA    1 
ATOM   2416 C  C     . PHE A 1 302 ? 27.205  103.201 47.601  1.00 50.51  ? 302 PHE A C     1 
ATOM   2417 O  O     . PHE A 1 302 ? 26.195  103.009 46.910  1.00 51.21  ? 302 PHE A O     1 
ATOM   2418 C  CB    . PHE A 1 302 ? 29.017  101.524 47.525  1.00 45.55  ? 302 PHE A CB    1 
ATOM   2419 C  CG    . PHE A 1 302 ? 29.843  100.505 48.240  1.00 45.21  ? 302 PHE A CG    1 
ATOM   2420 C  CD1   . PHE A 1 302 ? 29.451  99.167  48.260  1.00 43.56  ? 302 PHE A CD1   1 
ATOM   2421 C  CD2   . PHE A 1 302 ? 31.009  100.877 48.903  1.00 46.00  ? 302 PHE A CD2   1 
ATOM   2422 C  CE1   . PHE A 1 302 ? 30.209  98.206  48.922  1.00 43.97  ? 302 PHE A CE1   1 
ATOM   2423 C  CE2   . PHE A 1 302 ? 31.775  99.920  49.571  1.00 47.11  ? 302 PHE A CE2   1 
ATOM   2424 C  CZ    . PHE A 1 302 ? 31.375  98.582  49.577  1.00 44.85  ? 302 PHE A CZ    1 
ATOM   2425 N  N     . PRO A 1 303 ? 27.806  104.395 47.715  1.00 53.79  ? 303 PRO A N     1 
ATOM   2426 C  CA    . PRO A 1 303 ? 27.433  105.563 46.926  1.00 57.44  ? 303 PRO A CA    1 
ATOM   2427 C  C     . PRO A 1 303 ? 28.093  105.598 45.540  1.00 58.09  ? 303 PRO A C     1 
ATOM   2428 O  O     . PRO A 1 303 ? 28.238  106.669 44.956  1.00 62.76  ? 303 PRO A O     1 
ATOM   2429 C  CB    . PRO A 1 303 ? 27.946  106.732 47.787  1.00 58.33  ? 303 PRO A CB    1 
ATOM   2430 C  CG    . PRO A 1 303 ? 29.108  106.178 48.518  1.00 56.98  ? 303 PRO A CG    1 
ATOM   2431 C  CD    . PRO A 1 303 ? 28.853  104.712 48.709  1.00 54.49  ? 303 PRO A CD    1 
ATOM   2432 N  N     . HIS A 1 304 ? 28.505  104.446 45.029  1.00 54.99  ? 304 HIS A N     1 
ATOM   2433 C  CA    . HIS A 1 304 ? 29.118  104.364 43.715  1.00 54.00  ? 304 HIS A CA    1 
ATOM   2434 C  C     . HIS A 1 304 ? 29.093  102.907 43.266  1.00 50.21  ? 304 HIS A C     1 
ATOM   2435 O  O     . HIS A 1 304 ? 28.623  102.021 43.999  1.00 45.91  ? 304 HIS A O     1 
ATOM   2436 C  CB    . HIS A 1 304 ? 30.554  104.879 43.769  1.00 57.06  ? 304 HIS A CB    1 
ATOM   2437 C  CG    . HIS A 1 304 ? 31.420  104.131 44.736  1.00 60.21  ? 304 HIS A CG    1 
ATOM   2438 N  ND1   . HIS A 1 304 ? 31.289  104.255 46.104  1.00 61.26  ? 304 HIS A ND1   1 
ATOM   2439 C  CD2   . HIS A 1 304 ? 32.421  103.240 44.535  1.00 60.69  ? 304 HIS A CD2   1 
ATOM   2440 C  CE1   . HIS A 1 304 ? 32.176  103.480 46.703  1.00 60.75  ? 304 HIS A CE1   1 
ATOM   2441 N  NE2   . HIS A 1 304 ? 32.877  102.855 45.772  1.00 60.75  ? 304 HIS A NE2   1 
ATOM   2442 N  N     . GLY A 1 305 ? 29.599  102.660 42.064  1.00 48.50  ? 305 GLY A N     1 
ATOM   2443 C  CA    . GLY A 1 305 ? 29.600  101.318 41.514  1.00 46.25  ? 305 GLY A CA    1 
ATOM   2444 C  C     . GLY A 1 305 ? 30.561  100.419 42.271  1.00 44.03  ? 305 GLY A C     1 
ATOM   2445 O  O     . GLY A 1 305 ? 31.542  100.892 42.842  1.00 41.81  ? 305 GLY A O     1 
ATOM   2446 N  N     . ILE A 1 306 ? 30.259  99.126  42.281  1.00 41.80  ? 306 ILE A N     1 
ATOM   2447 C  CA    . ILE A 1 306 ? 31.133  98.121  42.897  1.00 41.05  ? 306 ILE A CA    1 
ATOM   2448 C  C     . ILE A 1 306 ? 31.827  97.320  41.795  1.00 39.08  ? 306 ILE A C     1 
ATOM   2449 O  O     . ILE A 1 306 ? 31.169  96.602  41.045  1.00 39.26  ? 306 ILE A O     1 
ATOM   2450 C  CB    . ILE A 1 306 ? 30.326  97.172  43.810  1.00 39.57  ? 306 ILE A CB    1 
ATOM   2451 C  CG1   . ILE A 1 306 ? 29.547  97.963  44.869  1.00 41.05  ? 306 ILE A CG1   1 
ATOM   2452 C  CG2   . ILE A 1 306 ? 31.234  96.190  44.511  1.00 39.29  ? 306 ILE A CG2   1 
ATOM   2453 C  CD1   . ILE A 1 306 ? 28.516  97.131  45.615  1.00 39.27  ? 306 ILE A CD1   1 
ATOM   2454 N  N     . SER A 1 307 ? 33.145  97.448  41.677  1.00 38.22  ? 307 SER A N     1 
ATOM   2455 C  CA    . SER A 1 307 ? 33.903  96.548  40.807  1.00 37.71  ? 307 SER A CA    1 
ATOM   2456 C  C     . SER A 1 307 ? 33.951  95.139  41.442  1.00 36.56  ? 307 SER A C     1 
ATOM   2457 O  O     . SER A 1 307 ? 33.672  94.970  42.646  1.00 33.05  ? 307 SER A O     1 
ATOM   2458 C  CB    . SER A 1 307 ? 35.314  97.082  40.572  1.00 39.57  ? 307 SER A CB    1 
ATOM   2459 O  OG    . SER A 1 307 ? 36.023  97.231  41.800  1.00 39.97  ? 307 SER A OG    1 
ATOM   2460 N  N     . LYS A 1 308 ? 34.296  94.142  40.634  1.00 36.15  ? 308 LYS A N     1 
ATOM   2461 C  CA    . LYS A 1 308 ? 34.431  92.779  41.124  1.00 35.89  ? 308 LYS A CA    1 
ATOM   2462 C  C     . LYS A 1 308 ? 35.453  92.672  42.268  1.00 36.11  ? 308 LYS A C     1 
ATOM   2463 O  O     . LYS A 1 308 ? 35.238  91.916  43.212  1.00 35.47  ? 308 LYS A O     1 
ATOM   2464 C  CB    . LYS A 1 308 ? 34.808  91.828  39.985  1.00 36.14  ? 308 LYS A CB    1 
ATOM   2465 C  CG    . LYS A 1 308 ? 34.731  90.350  40.369  1.00 35.30  ? 308 LYS A CG    1 
ATOM   2466 C  CD    . LYS A 1 308 ? 35.131  89.433  39.225  1.00 36.15  ? 308 LYS A CD    1 
ATOM   2467 C  CE    . LYS A 1 308 ? 36.620  89.512  38.924  1.00 38.24  ? 308 LYS A CE    1 
ATOM   2468 N  NZ    . LYS A 1 308 ? 36.945  88.731  37.704  1.00 39.04  ? 308 LYS A NZ    1 
ATOM   2469 N  N     . GLU A 1 309 ? 36.559  93.412  42.179  1.00 37.17  ? 309 GLU A N     1 
ATOM   2470 C  CA    . GLU A 1 309 ? 37.583  93.421  43.243  1.00 37.72  ? 309 GLU A CA    1 
ATOM   2471 C  C     . GLU A 1 309 ? 36.974  93.881  44.556  1.00 36.92  ? 309 GLU A C     1 
ATOM   2472 O  O     . GLU A 1 309 ? 37.144  93.226  45.601  1.00 36.38  ? 309 GLU A O     1 
ATOM   2473 C  CB    . GLU A 1 309 ? 38.777  94.332  42.883  1.00 39.05  ? 309 GLU A CB    1 
ATOM   2474 C  CG    . GLU A 1 309 ? 39.723  94.603  44.057  1.00 40.19  ? 309 GLU A CG    1 
ATOM   2475 C  CD    . GLU A 1 309 ? 41.102  95.142  43.655  1.00 41.55  ? 309 GLU A CD    1 
ATOM   2476 O  OE1   . GLU A 1 309 ? 41.369  95.348  42.451  1.00 43.17  ? 309 GLU A OE1   1 
ATOM   2477 O  OE2   . GLU A 1 309 ? 41.938  95.366  44.558  1.00 41.48  ? 309 GLU A OE2   1 
ATOM   2478 N  N     . THR A 1 310 ? 36.279  95.019  44.502  1.00 35.89  ? 310 THR A N     1 
ATOM   2479 C  CA    . THR A 1 310 ? 35.600  95.547  45.673  1.00 34.77  ? 310 THR A CA    1 
ATOM   2480 C  C     . THR A 1 310 ? 34.620  94.498  46.202  1.00 32.72  ? 310 THR A C     1 
ATOM   2481 O  O     . THR A 1 310 ? 34.519  94.304  47.417  1.00 32.92  ? 310 THR A O     1 
ATOM   2482 C  CB    . THR A 1 310 ? 34.868  96.886  45.368  1.00 35.74  ? 310 THR A CB    1 
ATOM   2483 O  OG1   . THR A 1 310 ? 35.824  97.875  44.985  1.00 37.10  ? 310 THR A OG1   1 
ATOM   2484 C  CG2   . THR A 1 310 ? 34.114  97.396  46.580  1.00 35.59  ? 310 THR A CG2   1 
ATOM   2485 N  N     . ALA A 1 311 ? 33.920  93.805  45.304  1.00 30.58  ? 311 ALA A N     1 
ATOM   2486 C  CA    . ALA A 1 311 ? 32.974  92.768  45.727  1.00 29.22  ? 311 ALA A CA    1 
ATOM   2487 C  C     . ALA A 1 311 ? 33.648  91.643  46.520  1.00 28.39  ? 311 ALA A C     1 
ATOM   2488 O  O     . ALA A 1 311 ? 33.098  91.176  47.518  1.00 28.30  ? 311 ALA A O     1 
ATOM   2489 C  CB    . ALA A 1 311 ? 32.221  92.195  44.535  1.00 28.89  ? 311 ALA A CB    1 
ATOM   2490 N  N     . TYR A 1 312 ? 34.809  91.190  46.043  1.00 28.17  ? 312 TYR A N     1 
ATOM   2491 C  CA    . TYR A 1 312 ? 35.591  90.185  46.730  1.00 28.15  ? 312 TYR A CA    1 
ATOM   2492 C  C     . TYR A 1 312 ? 35.914  90.706  48.142  1.00 28.51  ? 312 TYR A C     1 
ATOM   2493 O  O     . TYR A 1 312 ? 35.581  90.076  49.148  1.00 28.13  ? 312 TYR A O     1 
ATOM   2494 C  CB    . TYR A 1 312 ? 36.893  89.870  45.967  1.00 28.83  ? 312 TYR A CB    1 
ATOM   2495 C  CG    . TYR A 1 312 ? 36.779  89.060  44.664  1.00 28.97  ? 312 TYR A CG    1 
ATOM   2496 C  CD1   . TYR A 1 312 ? 35.819  88.061  44.502  1.00 28.75  ? 312 TYR A CD1   1 
ATOM   2497 C  CD2   . TYR A 1 312 ? 37.686  89.260  43.623  1.00 30.19  ? 312 TYR A CD2   1 
ATOM   2498 C  CE1   . TYR A 1 312 ? 35.743  87.325  43.330  1.00 29.40  ? 312 TYR A CE1   1 
ATOM   2499 C  CE2   . TYR A 1 312 ? 37.630  88.521  42.452  1.00 30.70  ? 312 TYR A CE2   1 
ATOM   2500 C  CZ    . TYR A 1 312 ? 36.664  87.547  42.314  1.00 30.52  ? 312 TYR A CZ    1 
ATOM   2501 O  OH    . TYR A 1 312 ? 36.590  86.807  41.160  1.00 31.54  ? 312 TYR A OH    1 
ATOM   2502 N  N     . SER A 1 313 ? 36.503  91.891  48.199  1.00 29.11  ? 313 SER A N     1 
ATOM   2503 C  CA    . SER A 1 313 ? 36.961  92.457  49.457  1.00 29.65  ? 313 SER A CA    1 
ATOM   2504 C  C     . SER A 1 313 ? 35.789  92.643  50.407  1.00 29.14  ? 313 SER A C     1 
ATOM   2505 O  O     . SER A 1 313 ? 35.829  92.213  51.553  1.00 27.03  ? 313 SER A O     1 
ATOM   2506 C  CB    . SER A 1 313 ? 37.650  93.788  49.205  1.00 30.83  ? 313 SER A CB    1 
ATOM   2507 O  OG    . SER A 1 313 ? 38.045  94.365  50.420  1.00 33.46  ? 313 SER A OG    1 
ATOM   2508 N  N     . GLU A 1 314 ? 34.713  93.234  49.903  1.00 29.69  ? 314 GLU A N     1 
ATOM   2509 C  CA    . GLU A 1 314 ? 33.585  93.540  50.752  1.00 30.04  ? 314 GLU A CA    1 
ATOM   2510 C  C     . GLU A 1 314 ? 32.849  92.278  51.152  1.00 28.82  ? 314 GLU A C     1 
ATOM   2511 O  O     . GLU A 1 314 ? 32.361  92.168  52.290  1.00 29.43  ? 314 GLU A O     1 
ATOM   2512 C  CB    . GLU A 1 314 ? 32.658  94.522  50.063  1.00 32.59  ? 314 GLU A CB    1 
ATOM   2513 C  CG    . GLU A 1 314 ? 31.591  95.112  50.971  1.00 35.34  ? 314 GLU A CG    1 
ATOM   2514 C  CD    . GLU A 1 314 ? 32.171  95.850  52.179  1.00 38.88  ? 314 GLU A CD    1 
ATOM   2515 O  OE1   . GLU A 1 314 ? 33.280  96.463  52.075  1.00 39.87  ? 314 GLU A OE1   1 
ATOM   2516 O  OE2   . GLU A 1 314 ? 31.509  95.791  53.238  1.00 40.91  ? 314 GLU A OE2   1 
ATOM   2517 N  N     . SER A 1 315 ? 32.769  91.310  50.240  1.00 27.23  ? 315 SER A N     1 
ATOM   2518 C  CA    . SER A 1 315 ? 32.079  90.058  50.547  1.00 26.11  ? 315 SER A CA    1 
ATOM   2519 C  C     . SER A 1 315 ? 32.705  89.393  51.775  1.00 26.05  ? 315 SER A C     1 
ATOM   2520 O  O     . SER A 1 315 ? 31.998  88.881  52.657  1.00 24.46  ? 315 SER A O     1 
ATOM   2521 C  CB    . SER A 1 315 ? 32.071  89.099  49.354  1.00 25.53  ? 315 SER A CB    1 
ATOM   2522 O  OG    . SER A 1 315 ? 33.361  88.557  49.053  1.00 26.01  ? 315 SER A OG    1 
ATOM   2523 N  N     . VAL A 1 316 ? 34.032  89.440  51.855  1.00 27.12  ? 316 VAL A N     1 
ATOM   2524 C  CA    . VAL A 1 316 ? 34.726  88.796  52.982  1.00 28.12  ? 316 VAL A CA    1 
ATOM   2525 C  C     . VAL A 1 316 ? 34.389  89.438  54.310  1.00 28.28  ? 316 VAL A C     1 
ATOM   2526 O  O     . VAL A 1 316 ? 34.194  88.732  55.298  1.00 26.75  ? 316 VAL A O     1 
ATOM   2527 C  CB    . VAL A 1 316 ? 36.245  88.728  52.780  1.00 28.90  ? 316 VAL A CB    1 
ATOM   2528 C  CG1   . VAL A 1 316 ? 36.946  88.284  54.054  1.00 29.80  ? 316 VAL A CG1   1 
ATOM   2529 C  CG2   . VAL A 1 316 ? 36.554  87.749  51.657  1.00 29.13  ? 316 VAL A CG2   1 
ATOM   2530 N  N     . LYS A 1 317 ? 34.286  90.764  54.321  1.00 29.75  ? 317 LYS A N     1 
ATOM   2531 C  CA    . LYS A 1 317 ? 33.944  91.484  55.552  1.00 32.46  ? 317 LYS A CA    1 
ATOM   2532 C  C     . LYS A 1 317 ? 32.520  91.168  55.976  1.00 32.16  ? 317 LYS A C     1 
ATOM   2533 O  O     . LYS A 1 317 ? 32.251  90.999  57.155  1.00 33.04  ? 317 LYS A O     1 
ATOM   2534 C  CB    . LYS A 1 317 ? 34.132  92.988  55.368  1.00 35.20  ? 317 LYS A CB    1 
ATOM   2535 C  CG    . LYS A 1 317 ? 35.460  93.295  54.692  1.00 37.61  ? 317 LYS A CG    1 
ATOM   2536 C  CD    . LYS A 1 317 ? 36.108  94.563  55.187  1.00 40.40  ? 317 LYS A CD    1 
ATOM   2537 C  CE    . LYS A 1 317 ? 35.524  95.788  54.531  1.00 41.95  ? 317 LYS A CE    1 
ATOM   2538 N  NZ    . LYS A 1 317 ? 36.628  96.694  54.086  1.00 43.75  ? 317 LYS A NZ    1 
ATOM   2539 N  N     . LEU A 1 318 ? 31.624  91.047  54.999  1.00 30.36  ? 318 LEU A N     1 
ATOM   2540 C  CA    . LEU A 1 318 ? 30.243  90.678  55.271  1.00 30.17  ? 318 LEU A CA    1 
ATOM   2541 C  C     . LEU A 1 318 ? 30.127  89.230  55.760  1.00 30.06  ? 318 LEU A C     1 
ATOM   2542 O  O     . LEU A 1 318 ? 29.348  88.937  56.666  1.00 30.76  ? 318 LEU A O     1 
ATOM   2543 C  CB    . LEU A 1 318 ? 29.381  90.912  54.024  1.00 29.32  ? 318 LEU A CB    1 
ATOM   2544 C  CG    . LEU A 1 318 ? 29.379  92.359  53.513  1.00 29.52  ? 318 LEU A CG    1 
ATOM   2545 C  CD1   . LEU A 1 318 ? 28.725  92.437  52.142  1.00 29.59  ? 318 LEU A CD1   1 
ATOM   2546 C  CD2   . LEU A 1 318 ? 28.669  93.280  54.483  1.00 30.71  ? 318 LEU A CD2   1 
ATOM   2547 N  N     . LEU A 1 319 ? 30.916  88.329  55.187  1.00 29.66  ? 319 LEU A N     1 
ATOM   2548 C  CA    . LEU A 1 319 ? 30.957  86.948  55.668  1.00 30.01  ? 319 LEU A CA    1 
ATOM   2549 C  C     . LEU A 1 319 ? 31.556  86.877  57.087  1.00 30.89  ? 319 LEU A C     1 
ATOM   2550 O  O     . LEU A 1 319 ? 31.079  86.115  57.939  1.00 29.57  ? 319 LEU A O     1 
ATOM   2551 C  CB    . LEU A 1 319 ? 31.760  86.072  54.713  1.00 30.09  ? 319 LEU A CB    1 
ATOM   2552 C  CG    . LEU A 1 319 ? 32.048  84.639  55.146  1.00 30.90  ? 319 LEU A CG    1 
ATOM   2553 C  CD1   . LEU A 1 319 ? 30.757  83.861  55.287  1.00 30.67  ? 319 LEU A CD1   1 
ATOM   2554 C  CD2   . LEU A 1 319 ? 32.957  83.961  54.137  1.00 31.24  ? 319 LEU A CD2   1 
ATOM   2555 N  N     . GLN A 1 320 ? 32.582  87.675  57.353  1.00 31.46  ? 320 GLN A N     1 
ATOM   2556 C  CA    . GLN A 1 320 ? 33.132  87.722  58.715  1.00 34.18  ? 320 GLN A CA    1 
ATOM   2557 C  C     . GLN A 1 320 ? 32.049  88.198  59.692  1.00 35.61  ? 320 GLN A C     1 
ATOM   2558 O  O     . GLN A 1 320 ? 31.868  87.626  60.758  1.00 35.47  ? 320 GLN A O     1 
ATOM   2559 C  CB    . GLN A 1 320 ? 34.359  88.624  58.792  1.00 35.16  ? 320 GLN A CB    1 
ATOM   2560 C  CG    . GLN A 1 320 ? 35.570  87.987  58.142  1.00 36.57  ? 320 GLN A CG    1 
ATOM   2561 C  CD    . GLN A 1 320 ? 36.753  88.932  57.994  1.00 37.96  ? 320 GLN A CD    1 
ATOM   2562 O  OE1   . GLN A 1 320 ? 36.618  90.083  57.544  1.00 38.95  ? 320 GLN A OE1   1 
ATOM   2563 N  NE2   . GLN A 1 320 ? 37.928  88.440  58.352  1.00 38.69  ? 320 GLN A NE2   1 
ATOM   2564 N  N     . LYS A 1 321 ? 31.312  89.221  59.296  1.00 35.62  ? 321 LYS A N     1 
ATOM   2565 C  CA    . LYS A 1 321 ? 30.246  89.753  60.134  1.00 38.58  ? 321 LYS A CA    1 
ATOM   2566 C  C     . LYS A 1 321 ? 29.199  88.682  60.472  1.00 37.75  ? 321 LYS A C     1 
ATOM   2567 O  O     . LYS A 1 321 ? 28.837  88.531  61.631  1.00 37.13  ? 321 LYS A O     1 
ATOM   2568 C  CB    . LYS A 1 321 ? 29.611  90.968  59.449  1.00 39.67  ? 321 LYS A CB    1 
ATOM   2569 C  CG    . LYS A 1 321 ? 28.802  91.852  60.368  1.00 43.41  ? 321 LYS A CG    1 
ATOM   2570 C  CD    . LYS A 1 321 ? 28.240  93.052  59.612  1.00 44.70  ? 321 LYS A CD    1 
ATOM   2571 C  CE    . LYS A 1 321 ? 26.943  93.527  60.238  1.00 46.91  ? 321 LYS A CE    1 
ATOM   2572 N  NZ    . LYS A 1 321 ? 27.144  93.990  61.640  1.00 49.85  ? 321 LYS A NZ    1 
ATOM   2573 N  N     . ILE A 1 322 ? 28.743  87.937  59.457  1.00 36.46  ? 322 ILE A N     1 
ATOM   2574 C  CA    . ILE A 1 322 ? 27.878  86.772  59.638  1.00 36.71  ? 322 ILE A CA    1 
ATOM   2575 C  C     . ILE A 1 322 ? 28.460  85.741  60.605  1.00 38.99  ? 322 ILE A C     1 
ATOM   2576 O  O     . ILE A 1 322 ? 27.753  85.204  61.464  1.00 38.38  ? 322 ILE A O     1 
ATOM   2577 C  CB    . ILE A 1 322 ? 27.588  86.069  58.288  1.00 36.98  ? 322 ILE A CB    1 
ATOM   2578 C  CG1   . ILE A 1 322 ? 26.699  86.945  57.401  1.00 36.24  ? 322 ILE A CG1   1 
ATOM   2579 C  CG2   . ILE A 1 322 ? 26.906  84.716  58.486  1.00 37.54  ? 322 ILE A CG2   1 
ATOM   2580 C  CD1   . ILE A 1 322 ? 26.628  86.499  55.959  1.00 35.30  ? 322 ILE A CD1   1 
ATOM   2581 N  N     . LEU A 1 323 ? 29.748  85.455  60.449  1.00 40.64  ? 323 LEU A N     1 
ATOM   2582 C  CA    . LEU A 1 323 ? 30.432  84.468  61.289  1.00 41.31  ? 323 LEU A CA    1 
ATOM   2583 C  C     . LEU A 1 323 ? 30.559  84.963  62.723  1.00 43.63  ? 323 LEU A C     1 
ATOM   2584 O  O     . LEU A 1 323 ? 30.505  84.172  63.660  1.00 43.50  ? 323 LEU A O     1 
ATOM   2585 C  CB    . LEU A 1 323 ? 31.809  84.111  60.707  1.00 40.03  ? 323 LEU A CB    1 
ATOM   2586 C  CG    . LEU A 1 323 ? 31.731  83.139  59.512  1.00 38.75  ? 323 LEU A CG    1 
ATOM   2587 C  CD1   . LEU A 1 323 ? 33.083  82.937  58.851  1.00 37.43  ? 323 LEU A CD1   1 
ATOM   2588 C  CD2   . LEU A 1 323 ? 31.144  81.797  59.932  1.00 39.13  ? 323 LEU A CD2   1 
ATOM   2589 N  N     . GLU A 1 324 ? 30.714  86.270  62.886  1.00 44.92  ? 324 GLU A N     1 
ATOM   2590 C  CA    . GLU A 1 324 ? 30.769  86.870  64.209  1.00 48.12  ? 324 GLU A CA    1 
ATOM   2591 C  C     . GLU A 1 324 ? 29.425  86.742  64.911  1.00 48.63  ? 324 GLU A C     1 
ATOM   2592 O  O     . GLU A 1 324 ? 29.387  86.452  66.090  1.00 51.56  ? 324 GLU A O     1 
ATOM   2593 C  CB    . GLU A 1 324 ? 31.154  88.346  64.121  1.00 49.46  ? 324 GLU A CB    1 
ATOM   2594 C  CG    . GLU A 1 324 ? 32.647  88.590  64.106  1.00 51.20  ? 324 GLU A CG    1 
ATOM   2595 C  CD    . GLU A 1 324 ? 33.031  89.966  63.569  1.00 52.99  ? 324 GLU A CD    1 
ATOM   2596 O  OE1   . GLU A 1 324 ? 32.140  90.797  63.277  1.00 52.44  ? 324 GLU A OE1   1 
ATOM   2597 O  OE2   . GLU A 1 324 ? 34.245  90.213  63.422  1.00 53.39  ? 324 GLU A OE2   1 
ATOM   2598 N  N     . GLU A 1 325 ? 28.334  86.919  64.173  1.00 47.09  ? 325 GLU A N     1 
ATOM   2599 C  CA    . GLU A 1 325 ? 27.009  87.112  64.764  1.00 48.53  ? 325 GLU A CA    1 
ATOM   2600 C  C     . GLU A 1 325 ? 26.085  85.894  64.757  1.00 51.34  ? 325 GLU A C     1 
ATOM   2601 O  O     . GLU A 1 325 ? 25.010  85.956  65.334  1.00 57.41  ? 325 GLU A O     1 
ATOM   2602 C  CB    . GLU A 1 325 ? 26.301  88.267  64.052  1.00 45.46  ? 325 GLU A CB    1 
ATOM   2603 C  CG    . GLU A 1 325 ? 27.032  89.594  64.192  1.00 44.46  ? 325 GLU A CG    1 
ATOM   2604 C  CD    . GLU A 1 325 ? 26.432  90.701  63.352  1.00 43.20  ? 325 GLU A CD    1 
ATOM   2605 O  OE1   . GLU A 1 325 ? 25.365  90.501  62.707  1.00 43.69  ? 325 GLU A OE1   1 
ATOM   2606 O  OE2   . GLU A 1 325 ? 27.040  91.789  63.331  1.00 41.89  ? 325 GLU A OE2   1 
ATOM   2607 N  N     . ASP A 1 326 ? 26.473  84.810  64.094  1.00 51.60  ? 326 ASP A N     1 
ATOM   2608 C  CA    . ASP A 1 326 ? 25.695  83.567  64.101  1.00 50.79  ? 326 ASP A CA    1 
ATOM   2609 C  C     . ASP A 1 326 ? 26.695  82.435  64.218  1.00 52.63  ? 326 ASP A C     1 
ATOM   2610 O  O     . ASP A 1 326 ? 27.654  82.381  63.443  1.00 50.61  ? 326 ASP A O     1 
ATOM   2611 C  CB    . ASP A 1 326 ? 24.866  83.429  62.825  1.00 50.55  ? 326 ASP A CB    1 
ATOM   2612 C  CG    . ASP A 1 326 ? 23.847  82.283  62.893  1.00 51.61  ? 326 ASP A CG    1 
ATOM   2613 O  OD1   . ASP A 1 326 ? 24.231  81.101  63.057  1.00 52.26  ? 326 ASP A OD1   1 
ATOM   2614 O  OD2   . ASP A 1 326 ? 22.639  82.564  62.764  1.00 53.15  ? 326 ASP A OD2   1 
ATOM   2615 N  N     . GLU A 1 327 ? 26.466  81.540  65.180  1.00 55.24  ? 327 GLU A N     1 
ATOM   2616 C  CA    . GLU A 1 327 ? 27.455  80.542  65.592  1.00 58.59  ? 327 GLU A CA    1 
ATOM   2617 C  C     . GLU A 1 327 ? 27.332  79.239  64.815  1.00 56.70  ? 327 GLU A C     1 
ATOM   2618 O  O     . GLU A 1 327 ? 28.196  78.370  64.925  1.00 58.08  ? 327 GLU A O     1 
ATOM   2619 C  CB    . GLU A 1 327 ? 27.323  80.223  67.092  1.00 64.85  ? 327 GLU A CB    1 
ATOM   2620 C  CG    . GLU A 1 327 ? 27.455  81.427  68.019  1.00 69.44  ? 327 GLU A CG    1 
ATOM   2621 C  CD    . GLU A 1 327 ? 26.243  82.361  67.992  1.00 73.39  ? 327 GLU A CD    1 
ATOM   2622 O  OE1   . GLU A 1 327 ? 25.164  81.961  67.490  1.00 74.94  ? 327 GLU A OE1   1 
ATOM   2623 O  OE2   . GLU A 1 327 ? 26.370  83.509  68.473  1.00 78.01  ? 327 GLU A OE2   1 
ATOM   2624 N  N     . ARG A 1 328 ? 26.257  79.087  64.041  1.00 55.96  ? 328 ARG A N     1 
ATOM   2625 C  CA    . ARG A 1 328 ? 26.033  77.843  63.308  1.00 53.14  ? 328 ARG A CA    1 
ATOM   2626 C  C     . ARG A 1 328 ? 27.045  77.665  62.188  1.00 50.58  ? 328 ARG A C     1 
ATOM   2627 O  O     . ARG A 1 328 ? 27.670  78.626  61.742  1.00 46.61  ? 328 ARG A O     1 
ATOM   2628 C  CB    . ARG A 1 328 ? 24.618  77.787  62.756  1.00 52.57  ? 328 ARG A CB    1 
ATOM   2629 C  CG    . ARG A 1 328 ? 23.583  77.575  63.854  1.00 55.23  ? 328 ARG A CG    1 
ATOM   2630 C  CD    . ARG A 1 328 ? 22.168  77.837  63.370  1.00 53.89  ? 328 ARG A CD    1 
ATOM   2631 N  NE    . ARG A 1 328 ? 21.954  79.240  63.025  1.00 52.08  ? 328 ARG A NE    1 
ATOM   2632 C  CZ    . ARG A 1 328 ? 20.804  79.723  62.572  1.00 51.96  ? 328 ARG A CZ    1 
ATOM   2633 N  NH1   . ARG A 1 328 ? 19.763  78.917  62.417  1.00 54.74  ? 328 ARG A NH1   1 
ATOM   2634 N  NH2   . ARG A 1 328 ? 20.682  81.011  62.272  1.00 50.47  ? 328 ARG A NH2   1 
ATOM   2635 N  N     . LYS A 1 329 ? 27.231  76.413  61.787  1.00 49.80  ? 329 LYS A N     1 
ATOM   2636 C  CA    . LYS A 1 329 ? 27.972  76.084  60.583  1.00 47.91  ? 329 LYS A CA    1 
ATOM   2637 C  C     . LYS A 1 329 ? 27.193  76.594  59.369  1.00 44.76  ? 329 LYS A C     1 
ATOM   2638 O  O     . LYS A 1 329 ? 25.961  76.597  59.378  1.00 44.44  ? 329 LYS A O     1 
ATOM   2639 C  CB    . LYS A 1 329 ? 28.113  74.563  60.460  1.00 51.77  ? 329 LYS A CB    1 
ATOM   2640 C  CG    . LYS A 1 329 ? 28.884  73.863  61.579  1.00 53.84  ? 329 LYS A CG    1 
ATOM   2641 C  CD    . LYS A 1 329 ? 30.363  73.805  61.252  1.00 54.69  ? 329 LYS A CD    1 
ATOM   2642 C  CE    . LYS A 1 329 ? 31.156  73.047  62.301  1.00 57.85  ? 329 LYS A CE    1 
ATOM   2643 N  NZ    . LYS A 1 329 ? 30.824  71.598  62.267  1.00 60.07  ? 329 LYS A NZ    1 
ATOM   2644 N  N     . ILE A 1 330 ? 27.907  77.021  58.330  1.00 41.00  ? 330 ILE A N     1 
ATOM   2645 C  CA    . ILE A 1 330 ? 27.284  77.474  57.097  1.00 37.92  ? 330 ILE A CA    1 
ATOM   2646 C  C     . ILE A 1 330 ? 27.280  76.319  56.102  1.00 38.82  ? 330 ILE A C     1 
ATOM   2647 O  O     . ILE A 1 330 ? 28.250  75.557  56.001  1.00 38.68  ? 330 ILE A O     1 
ATOM   2648 C  CB    . ILE A 1 330 ? 28.011  78.700  56.516  1.00 36.16  ? 330 ILE A CB    1 
ATOM   2649 C  CG1   . ILE A 1 330 ? 27.950  79.857  57.521  1.00 35.27  ? 330 ILE A CG1   1 
ATOM   2650 C  CG2   . ILE A 1 330 ? 27.418  79.110  55.175  1.00 34.44  ? 330 ILE A CG2   1 
ATOM   2651 C  CD1   . ILE A 1 330 ? 28.578  81.148  57.045  1.00 33.57  ? 330 ILE A CD1   1 
ATOM   2652 N  N     . ARG A 1 331 ? 26.167  76.185  55.386  1.00 37.82  ? 331 ARG A N     1 
ATOM   2653 C  CA    . ARG A 1 331 ? 25.982  75.083  54.445  1.00 37.69  ? 331 ARG A CA    1 
ATOM   2654 C  C     . ARG A 1 331 ? 25.977  75.571  53.001  1.00 34.80  ? 331 ARG A C     1 
ATOM   2655 O  O     . ARG A 1 331 ? 26.560  74.929  52.132  1.00 34.57  ? 331 ARG A O     1 
ATOM   2656 C  CB    . ARG A 1 331 ? 24.689  74.339  54.771  1.00 38.88  ? 331 ARG A CB    1 
ATOM   2657 C  CG    . ARG A 1 331 ? 24.316  73.271  53.763  1.00 41.19  ? 331 ARG A CG    1 
ATOM   2658 C  CD    . ARG A 1 331 ? 23.386  72.245  54.382  1.00 44.44  ? 331 ARG A CD    1 
ATOM   2659 N  NE    . ARG A 1 331 ? 22.539  71.610  53.375  1.00 45.03  ? 331 ARG A NE    1 
ATOM   2660 C  CZ    . ARG A 1 331 ? 21.971  70.412  53.486  1.00 47.20  ? 331 ARG A CZ    1 
ATOM   2661 N  NH1   . ARG A 1 331 ? 22.149  69.659  54.564  1.00 49.35  ? 331 ARG A NH1   1 
ATOM   2662 N  NH2   . ARG A 1 331 ? 21.213  69.956  52.494  1.00 48.25  ? 331 ARG A NH2   1 
ATOM   2663 N  N     . ARG A 1 332 ? 25.307  76.688  52.751  1.00 33.29  ? 332 ARG A N     1 
ATOM   2664 C  CA    . ARG A 1 332 ? 25.376  77.343  51.441  1.00 32.94  ? 332 ARG A CA    1 
ATOM   2665 C  C     . ARG A 1 332 ? 25.830  78.767  51.602  1.00 30.13  ? 332 ARG A C     1 
ATOM   2666 O  O     . ARG A 1 332 ? 25.502  79.441  52.563  1.00 27.47  ? 332 ARG A O     1 
ATOM   2667 C  CB    . ARG A 1 332 ? 24.037  77.357  50.723  1.00 34.01  ? 332 ARG A CB    1 
ATOM   2668 C  CG    . ARG A 1 332 ? 23.334  76.018  50.675  1.00 36.50  ? 332 ARG A CG    1 
ATOM   2669 C  CD    . ARG A 1 332 ? 22.003  76.098  49.959  1.00 36.55  ? 332 ARG A CD    1 
ATOM   2670 N  NE    . ARG A 1 332 ? 21.261  74.844  50.108  1.00 40.30  ? 332 ARG A NE    1 
ATOM   2671 C  CZ    . ARG A 1 332 ? 19.930  74.721  50.061  1.00 41.92  ? 332 ARG A CZ    1 
ATOM   2672 N  NH1   . ARG A 1 332 ? 19.154  75.783  49.864  1.00 39.08  ? 332 ARG A NH1   1 
ATOM   2673 N  NH2   . ARG A 1 332 ? 19.365  73.516  50.222  1.00 43.02  ? 332 ARG A NH2   1 
ATOM   2674 N  N     . ILE A 1 333 ? 26.585  79.225  50.625  1.00 29.27  ? 333 ILE A N     1 
ATOM   2675 C  CA    . ILE A 1 333 ? 27.033  80.590  50.632  1.00 28.64  ? 333 ILE A CA    1 
ATOM   2676 C  C     . ILE A 1 333 ? 26.836  81.180  49.234  1.00 28.02  ? 333 ILE A C     1 
ATOM   2677 O  O     . ILE A 1 333 ? 26.896  80.473  48.230  1.00 28.16  ? 333 ILE A O     1 
ATOM   2678 C  CB    . ILE A 1 333 ? 28.494  80.658  51.110  1.00 28.32  ? 333 ILE A CB    1 
ATOM   2679 C  CG1   . ILE A 1 333 ? 28.901  82.115  51.359  1.00 28.54  ? 333 ILE A CG1   1 
ATOM   2680 C  CG2   . ILE A 1 333 ? 29.416  79.952  50.128  1.00 28.63  ? 333 ILE A CG2   1 
ATOM   2681 C  CD1   . ILE A 1 333 ? 28.154  82.753  52.514  1.00 29.23  ? 333 ILE A CD1   1 
ATOM   2682 N  N     . GLY A 1 334 ? 26.605  82.478  49.187  1.00 27.87  ? 334 GLY A N     1 
ATOM   2683 C  CA    . GLY A 1 334 ? 26.407  83.160  47.941  1.00 27.87  ? 334 GLY A CA    1 
ATOM   2684 C  C     . GLY A 1 334 ? 26.272  84.658  48.102  1.00 27.95  ? 334 GLY A C     1 
ATOM   2685 O  O     . GLY A 1 334 ? 26.557  85.212  49.166  1.00 28.76  ? 334 GLY A O     1 
ATOM   2686 N  N     . VAL A 1 335 ? 25.848  85.300  47.024  1.00 27.72  ? 335 VAL A N     1 
ATOM   2687 C  CA    . VAL A 1 335 ? 25.703  86.748  46.975  1.00 28.30  ? 335 VAL A CA    1 
ATOM   2688 C  C     . VAL A 1 335 ? 24.541  87.187  46.119  1.00 27.26  ? 335 VAL A C     1 
ATOM   2689 O  O     . VAL A 1 335 ? 24.103  86.463  45.220  1.00 26.11  ? 335 VAL A O     1 
ATOM   2690 C  CB    . VAL A 1 335 ? 26.923  87.458  46.386  1.00 29.39  ? 335 VAL A CB    1 
ATOM   2691 C  CG1   . VAL A 1 335 ? 27.982  87.616  47.442  1.00 31.52  ? 335 VAL A CG1   1 
ATOM   2692 C  CG2   . VAL A 1 335 ? 27.453  86.721  45.176  1.00 29.29  ? 335 VAL A CG2   1 
ATOM   2693 N  N     . ARG A 1 336 ? 24.077  88.394  46.412  1.00 28.16  ? 336 ARG A N     1 
ATOM   2694 C  CA    . ARG A 1 336 ? 23.018  89.058  45.650  1.00 28.51  ? 336 ARG A CA    1 
ATOM   2695 C  C     . ARG A 1 336 ? 23.429  90.505  45.425  1.00 29.06  ? 336 ARG A C     1 
ATOM   2696 O  O     . ARG A 1 336 ? 23.752  91.209  46.379  1.00 30.49  ? 336 ARG A O     1 
ATOM   2697 C  CB    . ARG A 1 336 ? 21.712  89.017  46.431  1.00 28.41  ? 336 ARG A CB    1 
ATOM   2698 C  CG    . ARG A 1 336 ? 21.149  87.626  46.662  1.00 28.07  ? 336 ARG A CG    1 
ATOM   2699 C  CD    . ARG A 1 336 ? 19.732  87.685  47.255  1.00 27.92  ? 336 ARG A CD    1 
ATOM   2700 N  NE    . ARG A 1 336 ? 18.765  88.198  46.283  1.00 28.67  ? 336 ARG A NE    1 
ATOM   2701 C  CZ    . ARG A 1 336 ? 17.447  88.301  46.474  1.00 27.97  ? 336 ARG A CZ    1 
ATOM   2702 N  NH1   . ARG A 1 336 ? 16.876  87.936  47.620  1.00 27.51  ? 336 ARG A NH1   1 
ATOM   2703 N  NH2   . ARG A 1 336 ? 16.699  88.769  45.494  1.00 28.04  ? 336 ARG A NH2   1 
ATOM   2704 N  N     . PHE A 1 337 ? 23.451  90.930  44.169  1.00 29.70  ? 337 PHE A N     1 
ATOM   2705 C  CA    . PHE A 1 337 ? 23.770  92.301  43.812  1.00 31.22  ? 337 PHE A CA    1 
ATOM   2706 C  C     . PHE A 1 337 ? 22.509  93.025  43.357  1.00 33.57  ? 337 PHE A C     1 
ATOM   2707 O  O     . PHE A 1 337 ? 21.580  92.401  42.848  1.00 32.52  ? 337 PHE A O     1 
ATOM   2708 C  CB    . PHE A 1 337 ? 24.809  92.328  42.699  1.00 31.44  ? 337 PHE A CB    1 
ATOM   2709 C  CG    . PHE A 1 337 ? 26.132  91.747  43.105  1.00 33.00  ? 337 PHE A CG    1 
ATOM   2710 C  CD1   . PHE A 1 337 ? 27.069  92.519  43.758  1.00 33.65  ? 337 PHE A CD1   1 
ATOM   2711 C  CD2   . PHE A 1 337 ? 26.420  90.410  42.873  1.00 33.09  ? 337 PHE A CD2   1 
ATOM   2712 C  CE1   . PHE A 1 337 ? 28.285  91.981  44.152  1.00 34.14  ? 337 PHE A CE1   1 
ATOM   2713 C  CE2   . PHE A 1 337 ? 27.627  89.869  43.270  1.00 33.18  ? 337 PHE A CE2   1 
ATOM   2714 C  CZ    . PHE A 1 337 ? 28.560  90.656  43.912  1.00 33.74  ? 337 PHE A CZ    1 
ATOM   2715 N  N     . SER A 1 338 ? 22.490  94.344  43.524  1.00 35.70  ? 338 SER A N     1 
ATOM   2716 C  CA    . SER A 1 338 ? 21.280  95.133  43.262  1.00 37.54  ? 338 SER A CA    1 
ATOM   2717 C  C     . SER A 1 338 ? 21.667  96.603  43.166  1.00 39.87  ? 338 SER A C     1 
ATOM   2718 O  O     . SER A 1 338 ? 22.851  96.925  43.241  1.00 40.65  ? 338 SER A O     1 
ATOM   2719 C  CB    . SER A 1 338 ? 20.280  94.928  44.395  1.00 36.41  ? 338 SER A CB    1 
ATOM   2720 O  OG    . SER A 1 338 ? 20.894  95.254  45.636  1.00 37.09  ? 338 SER A OG    1 
ATOM   2721 N  N     . LYS A 1 339 ? 20.667  97.471  42.992  1.00 41.91  ? 339 LYS A N     1 
ATOM   2722 C  CA    . LYS A 1 339 ? 20.832  98.937  42.908  1.00 44.14  ? 339 LYS A CA    1 
ATOM   2723 C  C     . LYS A 1 339 ? 21.760  99.304  41.765  1.00 44.60  ? 339 LYS A C     1 
ATOM   2724 O  O     . LYS A 1 339 ? 22.783  99.963  41.966  1.00 46.11  ? 339 LYS A O     1 
ATOM   2725 C  CB    . LYS A 1 339 ? 21.362  99.539  44.225  1.00 46.36  ? 339 LYS A CB    1 
ATOM   2726 C  CG    . LYS A 1 339 ? 20.764  98.983  45.515  1.00 47.68  ? 339 LYS A CG    1 
ATOM   2727 C  CD    . LYS A 1 339 ? 19.678  99.856  46.119  1.00 50.48  ? 339 LYS A CD    1 
ATOM   2728 C  CE    . LYS A 1 339 ? 18.429  99.865  45.264  1.00 51.23  ? 339 LYS A CE    1 
ATOM   2729 N  NZ    . LYS A 1 339 ? 17.363  100.722 45.851  1.00 53.94  ? 339 LYS A NZ    1 
ATOM   2730 N  N     . PHE A 1 340 ? 21.399  98.887  40.560  1.00 45.37  ? 340 PHE A N     1 
ATOM   2731 C  CA    . PHE A 1 340 ? 22.277  99.046  39.408  1.00 47.50  ? 340 PHE A CA    1 
ATOM   2732 C  C     . PHE A 1 340 ? 22.370  100.499 38.941  1.00 53.12  ? 340 PHE A C     1 
ATOM   2733 O  O     . PHE A 1 340 ? 21.452  101.288 39.154  1.00 53.51  ? 340 PHE A O     1 
ATOM   2734 C  CB    . PHE A 1 340 ? 21.797  98.172  38.261  1.00 47.12  ? 340 PHE A CB    1 
ATOM   2735 C  CG    . PHE A 1 340 ? 21.647  96.729  38.623  1.00 45.52  ? 340 PHE A CG    1 
ATOM   2736 C  CD1   . PHE A 1 340 ? 22.703  96.026  39.187  1.00 44.76  ? 340 PHE A CD1   1 
ATOM   2737 C  CD2   . PHE A 1 340 ? 20.463  96.058  38.374  1.00 43.49  ? 340 PHE A CD2   1 
ATOM   2738 C  CE1   . PHE A 1 340 ? 22.565  94.685  39.510  1.00 42.00  ? 340 PHE A CE1   1 
ATOM   2739 C  CE2   . PHE A 1 340 ? 20.325  94.721  38.694  1.00 41.96  ? 340 PHE A CE2   1 
ATOM   2740 C  CZ    . PHE A 1 340 ? 21.378  94.035  39.268  1.00 40.04  ? 340 PHE A CZ    1 
ATOM   2741 N  N     . ILE A 1 341 ? 23.485  100.847 38.304  1.00 57.06  ? 341 ILE A N     1 
ATOM   2742 C  CA    . ILE A 1 341 ? 23.700  102.210 37.843  1.00 62.56  ? 341 ILE A CA    1 
ATOM   2743 C  C     . ILE A 1 341 ? 22.868  102.404 36.571  1.00 67.02  ? 341 ILE A C     1 
ATOM   2744 O  O     . ILE A 1 341 ? 22.973  101.615 35.635  1.00 67.13  ? 341 ILE A O     1 
ATOM   2745 C  CB    . ILE A 1 341 ? 25.192  102.502 37.535  1.00 63.85  ? 341 ILE A CB    1 
ATOM   2746 C  CG1   . ILE A 1 341 ? 26.118  102.103 38.703  1.00 63.45  ? 341 ILE A CG1   1 
ATOM   2747 C  CG2   . ILE A 1 341 ? 25.391  103.970 37.165  1.00 65.34  ? 341 ILE A CG2   1 
ATOM   2748 C  CD1   . ILE A 1 341 ? 26.412  103.182 39.729  1.00 64.30  ? 341 ILE A CD1   1 
ATOM   2749 N  N     . GLU A 1 342 ? 22.041  103.450 36.546  1.00 72.55  ? 342 GLU A N     1 
ATOM   2750 C  CA    . GLU A 1 342 ? 21.256  103.809 35.354  1.00 74.92  ? 342 GLU A CA    1 
ATOM   2751 C  C     . GLU A 1 342 ? 22.188  104.354 34.274  1.00 76.32  ? 342 GLU A C     1 
ATOM   2752 O  O     . GLU A 1 342 ? 22.815  103.591 33.540  1.00 75.36  ? 342 GLU A O     1 
ATOM   2753 C  CB    . GLU A 1 342 ? 20.177  104.852 35.713  1.00 76.51  ? 342 GLU A CB    1 
ATOM   2754 C  CG    . GLU A 1 342 ? 19.380  105.435 34.539  1.00 79.53  ? 342 GLU A CG    1 
ATOM   2755 C  CD    . GLU A 1 342 ? 18.296  104.505 33.993  1.00 79.30  ? 342 GLU A CD    1 
ATOM   2756 O  OE1   . GLU A 1 342 ? 18.115  103.381 34.514  1.00 74.16  ? 342 GLU A OE1   1 
ATOM   2757 O  OE2   . GLU A 1 342 ? 17.613  104.911 33.026  1.00 80.33  ? 342 GLU A OE2   1 
HETATM 2758 C  C2    . 2JV B 2 5   ? 12.453  70.531  47.597  1.00 56.40  ? 5   2JV B C2    1 
HETATM 2759 C  C5    . 2JV B 2 5   ? 12.644  69.628  50.205  1.00 66.14  ? 5   2JV B C5    1 
HETATM 2760 C  C6    . 2JV B 2 5   ? 11.369  70.106  49.648  1.00 63.58  ? 5   2JV B C6    1 
HETATM 2761 C  C4    . 2JV B 2 5   ? 13.804  69.646  49.314  1.00 64.53  ? 5   2JV B C4    1 
HETATM 2762 O  O6    . 2JV B 2 5   ? 10.337  70.118  50.346  1.00 68.47  ? 5   2JV B O6    1 
HETATM 2763 N  N7    . 2JV B 2 5   ? 13.062  69.156  51.387  1.00 68.86  ? 5   2JV B N7    1 
HETATM 2764 C  C8    . 2JV B 2 5   ? 14.382  68.886  51.268  1.00 69.25  ? 5   2JV B C8    1 
HETATM 2765 N  N9    . 2JV B 2 5   ? 14.830  69.186  50.027  1.00 67.54  ? 5   2JV B N9    1 
HETATM 2766 C  CAQ   . 2JV B 2 5   ? 16.204  69.045  49.458  1.00 67.33  ? 5   2JV B CAQ   1 
HETATM 2767 O  OAP   . 2JV B 2 5   ? 16.573  67.655  49.368  1.00 67.79  ? 5   2JV B OAP   1 
HETATM 2768 C  CAR   . 2JV B 2 5   ? 17.271  69.768  50.276  1.00 66.72  ? 5   2JV B CAR   1 
HETATM 2769 C  CAT   . 2JV B 2 5   ? 18.379  68.741  50.349  1.00 67.56  ? 5   2JV B CAT   1 
HETATM 2770 O  OAS   . 2JV B 2 5   ? 19.265  68.901  49.229  1.00 64.51  ? 5   2JV B OAS   1 
HETATM 2771 C  CAU   . 2JV B 2 5   ? 17.642  67.416  50.278  1.00 69.26  ? 5   2JV B CAU   1 
HETATM 2772 C  CAV   . 2JV B 2 5   ? 16.994  67.066  51.601  1.00 71.55  ? 5   2JV B CAV   1 
HETATM 2773 O  OAB   . 2JV B 2 5   ? 17.773  66.262  52.455  1.00 75.97  ? 5   2JV B OAB   1 
HETATM 2774 P  PAD   . 2JV B 2 5   ? 17.291  66.281  53.990  1.00 81.24  ? 5   2JV B PAD   1 
HETATM 2775 O  OAC   . 2JV B 2 5   ? 18.365  65.743  54.863  1.00 83.60  ? 5   2JV B OAC   1 
HETATM 2776 O  OAA   . 2JV B 2 5   ? 16.914  67.795  54.409  1.00 77.73  ? 5   2JV B OAA   1 
HETATM 2777 N  N1    . 2JV B 2 5   ? 11.350  70.522  48.384  1.00 59.93  ? 5   2JV B N1    1 
HETATM 2778 N  N3    . 2JV B 2 5   ? 13.655  70.094  48.046  1.00 59.14  ? 5   2JV B N3    1 
HETATM 2779 N  N2    . 2JV B 2 5   ? 12.267  70.997  46.333  1.00 50.95  ? 5   2JV B N2    1 
HETATM 2780 C  CBD   . 2JV B 2 5   ? 13.185  71.128  45.324  1.00 46.62  ? 5   2JV B CBD   1 
HETATM 2781 C  CBC   . 2JV B 2 5   ? 12.711  71.358  44.013  1.00 43.27  ? 5   2JV B CBC   1 
HETATM 2782 C  CAX   . 2JV B 2 5   ? 13.612  71.448  42.947  1.00 42.10  ? 5   2JV B CAX   1 
HETATM 2783 C  CBG   . 2JV B 2 5   ? 14.975  71.292  43.184  1.00 42.20  ? 5   2JV B CBG   1 
HETATM 2784 C  CBF   . 2JV B 2 5   ? 15.442  71.053  44.472  1.00 43.80  ? 5   2JV B CBF   1 
HETATM 2785 C  CBE   . 2JV B 2 5   ? 14.563  70.968  45.532  1.00 44.82  ? 5   2JV B CBE   1 
HETATM 2786 C  CBB   . 2JV B 2 5   ? 11.340  71.518  43.738  1.00 42.63  ? 5   2JV B CBB   1 
HETATM 2787 C  CBA   . 2JV B 2 5   ? 10.887  71.746  42.439  1.00 41.88  ? 5   2JV B CBA   1 
HETATM 2788 C  CAZ   . 2JV B 2 5   ? 11.785  71.840  41.372  1.00 40.76  ? 5   2JV B CAZ   1 
HETATM 2789 C  CAY   . 2JV B 2 5   ? 13.149  71.692  41.632  1.00 41.69  ? 5   2JV B CAY   1 
HETATM 2790 C  CBM   . 2JV B 2 5   ? 11.365  72.078  40.059  1.00 40.77  ? 5   2JV B CBM   1 
HETATM 2791 N  NAW   . 2JV B 2 5   ? 10.066  72.227  39.746  1.00 40.63  ? 5   2JV B NAW   1 
HETATM 2792 C  CBL   . 2JV B 2 5   ? 12.293  72.167  39.014  1.00 40.91  ? 5   2JV B CBL   1 
HETATM 2793 C  CBK   . 2JV B 2 5   ? 13.642  72.011  39.282  1.00 40.19  ? 5   2JV B CBK   1 
HETATM 2794 C  CBJ   . 2JV B 2 5   ? 14.066  71.771  40.582  1.00 41.45  ? 5   2JV B CBJ   1 
HETATM 2795 C  CBI   . 2JV B 2 5   ? 15.441  71.622  40.845  1.00 42.54  ? 5   2JV B CBI   1 
HETATM 2796 C  CBH   . 2JV B 2 5   ? 15.890  71.386  42.140  1.00 41.90  ? 5   2JV B CBH   1 
ATOM   2797 P  P     . DG  B 2 6   ? 20.556  69.594  48.984  1.00 53.03  ? 6   DG  B P     1 
ATOM   2798 O  OP1   . DG  B 2 6   ? 21.608  68.548  49.079  1.00 52.59  ? 6   DG  B OP1   1 
ATOM   2799 O  OP2   . DG  B 2 6   ? 20.530  70.717  49.963  1.00 50.13  ? 6   DG  B OP2   1 
ATOM   2800 O  "O5'" . DG  B 2 6   ? 20.651  70.155  47.500  1.00 48.53  ? 6   DG  B "O5'" 1 
ATOM   2801 C  "C5'" . DG  B 2 6   ? 19.497  70.704  46.843  1.00 45.58  ? 6   DG  B "C5'" 1 
ATOM   2802 C  "C4'" . DG  B 2 6   ? 19.944  71.524  45.657  1.00 43.45  ? 6   DG  B "C4'" 1 
ATOM   2803 O  "O4'" . DG  B 2 6   ? 18.795  72.066  44.969  1.00 41.55  ? 6   DG  B "O4'" 1 
ATOM   2804 C  "C3'" . DG  B 2 6   ? 20.806  72.733  45.997  1.00 43.02  ? 6   DG  B "C3'" 1 
ATOM   2805 O  "O3'" . DG  B 2 6   ? 21.652  72.924  44.863  1.00 41.90  ? 6   DG  B "O3'" 1 
ATOM   2806 C  "C2'" . DG  B 2 6   ? 19.769  73.816  46.240  1.00 41.60  ? 6   DG  B "C2'" 1 
ATOM   2807 C  "C1'" . DG  B 2 6   ? 18.676  73.464  45.230  1.00 40.26  ? 6   DG  B "C1'" 1 
ATOM   2808 N  N9    . DG  B 2 6   ? 17.292  73.717  45.626  1.00 37.71  ? 6   DG  B N9    1 
ATOM   2809 C  C8    . DG  B 2 6   ? 16.728  73.555  46.868  1.00 38.10  ? 6   DG  B C8    1 
ATOM   2810 N  N7    . DG  B 2 6   ? 15.451  73.829  46.890  1.00 38.00  ? 6   DG  B N7    1 
ATOM   2811 C  C5    . DG  B 2 6   ? 15.151  74.172  45.579  1.00 36.70  ? 6   DG  B C5    1 
ATOM   2812 C  C6    . DG  B 2 6   ? 13.916  74.544  44.983  1.00 35.14  ? 6   DG  B C6    1 
ATOM   2813 O  O6    . DG  B 2 6   ? 12.809  74.652  45.513  1.00 36.02  ? 6   DG  B O6    1 
ATOM   2814 N  N1    . DG  B 2 6   ? 14.058  74.798  43.625  1.00 34.64  ? 6   DG  B N1    1 
ATOM   2815 C  C2    . DG  B 2 6   ? 15.236  74.706  42.925  1.00 35.07  ? 6   DG  B C2    1 
ATOM   2816 N  N2    . DG  B 2 6   ? 15.172  74.996  41.622  1.00 35.58  ? 6   DG  B N2    1 
ATOM   2817 N  N3    . DG  B 2 6   ? 16.392  74.351  43.464  1.00 35.60  ? 6   DG  B N3    1 
ATOM   2818 C  C4    . DG  B 2 6   ? 16.274  74.090  44.783  1.00 36.43  ? 6   DG  B C4    1 
ATOM   2819 P  P     . DA  B 2 7   ? 22.628  74.175  44.757  1.00 43.28  ? 7   DA  B P     1 
ATOM   2820 O  OP1   . DA  B 2 7   ? 23.703  73.817  43.798  1.00 43.24  ? 7   DA  B OP1   1 
ATOM   2821 O  OP2   . DA  B 2 7   ? 22.986  74.630  46.137  1.00 43.58  ? 7   DA  B OP2   1 
ATOM   2822 O  "O5'" . DA  B 2 7   ? 21.719  75.270  44.035  1.00 39.65  ? 7   DA  B "O5'" 1 
ATOM   2823 C  "C5'" . DA  B 2 7   ? 21.400  75.114  42.643  1.00 36.98  ? 7   DA  B "C5'" 1 
ATOM   2824 C  "C4'" . DA  B 2 7   ? 20.634  76.320  42.157  1.00 34.71  ? 7   DA  B "C4'" 1 
ATOM   2825 O  "O4'" . DA  B 2 7   ? 19.315  76.341  42.750  1.00 32.53  ? 7   DA  B "O4'" 1 
ATOM   2826 C  "C3'" . DA  B 2 7   ? 21.283  77.660  42.506  1.00 34.96  ? 7   DA  B "C3'" 1 
ATOM   2827 O  "O3'" . DA  B 2 7   ? 21.317  78.419  41.294  1.00 35.40  ? 7   DA  B "O3'" 1 
ATOM   2828 C  "C2'" . DA  B 2 7   ? 20.378  78.228  43.589  1.00 33.57  ? 7   DA  B "C2'" 1 
ATOM   2829 C  "C1'" . DA  B 2 7   ? 19.031  77.654  43.183  1.00 31.81  ? 7   DA  B "C1'" 1 
ATOM   2830 N  N9    . DA  B 2 7   ? 18.023  77.573  44.236  1.00 30.65  ? 7   DA  B N9    1 
ATOM   2831 C  C8    . DA  B 2 7   ? 18.189  77.311  45.575  1.00 31.21  ? 7   DA  B C8    1 
ATOM   2832 N  N7    . DA  B 2 7   ? 17.068  77.333  46.260  1.00 30.61  ? 7   DA  B N7    1 
ATOM   2833 C  C5    . DA  B 2 7   ? 16.101  77.628  45.308  1.00 29.34  ? 7   DA  B C5    1 
ATOM   2834 C  C6    . DA  B 2 7   ? 14.704  77.801  45.393  1.00 28.96  ? 7   DA  B C6    1 
ATOM   2835 N  N6    . DA  B 2 7   ? 14.007  77.680  46.525  1.00 28.40  ? 7   DA  B N6    1 
ATOM   2836 N  N1    . DA  B 2 7   ? 14.039  78.105  44.258  1.00 28.59  ? 7   DA  B N1    1 
ATOM   2837 C  C2    . DA  B 2 7   ? 14.733  78.228  43.120  1.00 28.81  ? 7   DA  B C2    1 
ATOM   2838 N  N3    . DA  B 2 7   ? 16.045  78.106  42.917  1.00 29.37  ? 7   DA  B N3    1 
ATOM   2839 C  C4    . DA  B 2 7   ? 16.676  77.784  44.059  1.00 29.56  ? 7   DA  B C4    1 
ATOM   2840 P  P     . DC  B 2 8   ? 22.025  79.827  41.238  1.00 37.68  ? 8   DC  B P     1 
ATOM   2841 O  OP1   . DC  B 2 8   ? 22.274  80.169  39.819  1.00 39.05  ? 8   DC  B OP1   1 
ATOM   2842 O  OP2   . DC  B 2 8   ? 23.158  79.830  42.190  1.00 39.67  ? 8   DC  B OP2   1 
ATOM   2843 O  "O5'" . DC  B 2 8   ? 20.955  80.749  41.949  1.00 38.56  ? 8   DC  B "O5'" 1 
ATOM   2844 C  "C5'" . DC  B 2 8   ? 20.584  81.999  41.414  1.00 36.90  ? 8   DC  B "C5'" 1 
ATOM   2845 C  "C4'" . DC  B 2 8   ? 19.112  81.988  41.096  1.00 34.41  ? 8   DC  B "C4'" 1 
ATOM   2846 O  "O4'" . DC  B 2 8   ? 18.386  81.027  41.889  1.00 33.04  ? 8   DC  B "O4'" 1 
ATOM   2847 C  "C3'" . DC  B 2 8   ? 18.452  83.308  41.420  1.00 33.79  ? 8   DC  B "C3'" 1 
ATOM   2848 O  "O3'" . DC  B 2 8   ? 18.909  84.182  40.400  1.00 34.20  ? 8   DC  B "O3'" 1 
ATOM   2849 C  "C2'" . DC  B 2 8   ? 16.988  82.922  41.484  1.00 31.97  ? 8   DC  B "C2'" 1 
ATOM   2850 C  "C1'" . DC  B 2 8   ? 17.044  81.505  42.057  1.00 31.43  ? 8   DC  B "C1'" 1 
ATOM   2851 N  N1    . DC  B 2 8   ? 16.690  81.390  43.489  1.00 30.65  ? 8   DC  B N1    1 
ATOM   2852 C  C2    . DC  B 2 8   ? 15.367  81.609  43.865  1.00 29.05  ? 8   DC  B C2    1 
ATOM   2853 O  O2    . DC  B 2 8   ? 14.551  81.942  43.000  1.00 28.28  ? 8   DC  B O2    1 
ATOM   2854 N  N3    . DC  B 2 8   ? 15.012  81.466  45.164  1.00 28.71  ? 8   DC  B N3    1 
ATOM   2855 C  C4    . DC  B 2 8   ? 15.926  81.110  46.068  1.00 29.46  ? 8   DC  B C4    1 
ATOM   2856 N  N4    . DC  B 2 8   ? 15.536  80.987  47.340  1.00 29.58  ? 8   DC  B N4    1 
ATOM   2857 C  C5    . DC  B 2 8   ? 17.285  80.876  45.711  1.00 30.24  ? 8   DC  B C5    1 
ATOM   2858 C  C6    . DC  B 2 8   ? 17.617  81.008  44.420  1.00 30.50  ? 8   DC  B C6    1 
ATOM   2859 P  P     . DT  B 2 9   ? 19.180  85.704  40.736  1.00 35.41  ? 9   DT  B P     1 
ATOM   2860 O  OP1   . DT  B 2 9   ? 19.850  86.312  39.566  1.00 36.49  ? 9   DT  B OP1   1 
ATOM   2861 O  OP2   . DT  B 2 9   ? 19.787  85.804  42.094  1.00 35.35  ? 9   DT  B OP2   1 
ATOM   2862 O  "O5'" . DT  B 2 9   ? 17.701  86.272  40.864  1.00 34.24  ? 9   DT  B "O5'" 1 
ATOM   2863 C  "C5'" . DT  B 2 9   ? 16.735  86.000  39.834  1.00 34.52  ? 9   DT  B "C5'" 1 
ATOM   2864 C  "C4'" . DT  B 2 9   ? 15.369  86.445  40.299  1.00 34.40  ? 9   DT  B "C4'" 1 
ATOM   2865 O  "O4'" . DT  B 2 9   ? 14.943  85.618  41.410  1.00 33.12  ? 9   DT  B "O4'" 1 
ATOM   2866 C  "C3'" . DT  B 2 9   ? 15.318  87.901  40.781  1.00 35.14  ? 9   DT  B "C3'" 1 
ATOM   2867 O  "O3'" . DT  B 2 9   ? 14.264  88.581  40.115  1.00 38.26  ? 9   DT  B "O3'" 1 
ATOM   2868 C  "C2'" . DT  B 2 9   ? 15.048  87.797  42.268  1.00 34.19  ? 9   DT  B "C2'" 1 
ATOM   2869 C  "C1'" . DT  B 2 9   ? 14.431  86.426  42.455  1.00 32.80  ? 9   DT  B "C1'" 1 
ATOM   2870 N  N1    . DT  B 2 9   ? 14.820  85.810  43.747  1.00 32.00  ? 9   DT  B N1    1 
ATOM   2871 C  C2    . DT  B 2 9   ? 13.848  85.596  44.700  1.00 31.50  ? 9   DT  B C2    1 
ATOM   2872 O  O2    . DT  B 2 9   ? 12.668  85.844  44.519  1.00 31.42  ? 9   DT  B O2    1 
ATOM   2873 N  N3    . DT  B 2 9   ? 14.307  85.048  45.871  1.00 31.10  ? 9   DT  B N3    1 
ATOM   2874 C  C4    . DT  B 2 9   ? 15.613  84.734  46.190  1.00 31.25  ? 9   DT  B C4    1 
ATOM   2875 O  O4    . DT  B 2 9   ? 15.872  84.244  47.283  1.00 31.26  ? 9   DT  B O4    1 
ATOM   2876 C  C5    . DT  B 2 9   ? 16.583  85.012  45.158  1.00 31.83  ? 9   DT  B C5    1 
ATOM   2877 C  C7    . DT  B 2 9   ? 18.024  84.706  45.414  1.00 32.60  ? 9   DT  B C7    1 
ATOM   2878 C  C6    . DT  B 2 9   ? 16.145  85.536  44.005  1.00 32.21  ? 9   DT  B C6    1 
ATOM   2879 P  P     . DG  B 2 10  ? 13.957  90.124  40.377  1.00 40.36  ? 10  DG  B P     1 
ATOM   2880 O  OP1   . DG  B 2 10  ? 13.538  90.707  39.077  1.00 44.58  ? 10  DG  B OP1   1 
ATOM   2881 O  OP2   . DG  B 2 10  ? 15.054  90.729  41.160  1.00 41.75  ? 10  DG  B OP2   1 
ATOM   2882 O  "O5'" . DG  B 2 10  ? 12.665  90.064  41.299  1.00 38.84  ? 10  DG  B "O5'" 1 
ATOM   2883 C  "C5'" . DG  B 2 10  ? 11.443  89.488  40.814  1.00 36.78  ? 10  DG  B "C5'" 1 
ATOM   2884 C  "C4'" . DG  B 2 10  ? 10.324  89.794  41.781  1.00 35.69  ? 10  DG  B "C4'" 1 
ATOM   2885 O  "O4'" . DG  B 2 10  ? 10.552  89.085  43.023  1.00 34.14  ? 10  DG  B "O4'" 1 
ATOM   2886 C  "C3'" . DG  B 2 10  ? 10.177  91.268  42.158  1.00 35.63  ? 10  DG  B "C3'" 1 
ATOM   2887 O  "O3'" . DG  B 2 10  ? 8.779   91.538  42.315  1.00 36.16  ? 10  DG  B "O3'" 1 
ATOM   2888 C  "C2'" . DG  B 2 10  ? 10.965  91.368  43.453  1.00 34.93  ? 10  DG  B "C2'" 1 
ATOM   2889 C  "C1'" . DG  B 2 10  ? 10.728  90.006  44.094  1.00 33.67  ? 10  DG  B "C1'" 1 
ATOM   2890 N  N9    . DG  B 2 10  ? 11.817  89.528  44.942  1.00 32.01  ? 10  DG  B N9    1 
ATOM   2891 C  C8    . DG  B 2 10  ? 13.165  89.632  44.692  1.00 32.70  ? 10  DG  B C8    1 
ATOM   2892 N  N7    . DG  B 2 10  ? 13.905  89.148  45.653  1.00 31.83  ? 10  DG  B N7    1 
ATOM   2893 C  C5    . DG  B 2 10  ? 12.992  88.713  46.603  1.00 31.71  ? 10  DG  B C5    1 
ATOM   2894 C  C6    . DG  B 2 10  ? 13.201  88.082  47.856  1.00 31.35  ? 10  DG  B C6    1 
ATOM   2895 O  O6    . DG  B 2 10  ? 14.271  87.787  48.398  1.00 31.30  ? 10  DG  B O6    1 
ATOM   2896 N  N1    . DG  B 2 10  ? 11.998  87.816  48.505  1.00 30.88  ? 10  DG  B N1    1 
ATOM   2897 C  C2    . DG  B 2 10  ? 10.751  88.083  47.992  1.00 31.03  ? 10  DG  B C2    1 
ATOM   2898 N  N2    . DG  B 2 10  ? 9.708   87.735  48.759  1.00 30.75  ? 10  DG  B N2    1 
ATOM   2899 N  N3    . DG  B 2 10  ? 10.542  88.660  46.818  1.00 31.15  ? 10  DG  B N3    1 
ATOM   2900 C  C4    . DG  B 2 10  ? 11.698  88.939  46.179  1.00 31.39  ? 10  DG  B C4    1 
ATOM   2901 P  P     . DG  B 2 11  ? 8.239   92.965  42.806  1.00 37.02  ? 11  DG  B P     1 
ATOM   2902 O  OP1   . DG  B 2 11  ? 6.955   93.219  42.088  1.00 39.00  ? 11  DG  B OP1   1 
ATOM   2903 O  OP2   . DG  B 2 11  ? 9.337   93.958  42.699  1.00 38.14  ? 11  DG  B OP2   1 
ATOM   2904 O  "O5'" . DG  B 2 11  ? 7.902   92.727  44.349  1.00 35.25  ? 11  DG  B "O5'" 1 
ATOM   2905 C  "C5'" . DG  B 2 11  ? 6.880   91.779  44.731  1.00 34.16  ? 11  DG  B "C5'" 1 
ATOM   2906 C  "C4'" . DG  B 2 11  ? 6.681   91.777  46.228  1.00 33.66  ? 11  DG  B "C4'" 1 
ATOM   2907 O  "O4'" . DG  B 2 11  ? 7.857   91.268  46.897  1.00 32.57  ? 11  DG  B "O4'" 1 
ATOM   2908 C  "C3'" . DG  B 2 11  ? 6.408   93.143  46.857  1.00 34.09  ? 11  DG  B "C3'" 1 
ATOM   2909 O  "O3'" . DG  B 2 11  ? 5.430   92.934  47.871  1.00 34.12  ? 11  DG  B "O3'" 1 
ATOM   2910 C  "C2'" . DG  B 2 11  ? 7.754   93.534  47.442  1.00 33.07  ? 11  DG  B "C2'" 1 
ATOM   2911 C  "C1'" . DG  B 2 11  ? 8.299   92.192  47.887  1.00 32.11  ? 11  DG  B "C1'" 1 
ATOM   2912 N  N9    . DG  B 2 11  ? 9.757   92.110  47.954  1.00 31.69  ? 11  DG  B N9    1 
ATOM   2913 C  C8    . DG  B 2 11  ? 10.644  92.507  46.984  1.00 31.27  ? 11  DG  B C8    1 
ATOM   2914 N  N7    . DG  B 2 11  ? 11.888  92.292  47.309  1.00 31.42  ? 11  DG  B N7    1 
ATOM   2915 C  C5    . DG  B 2 11  ? 11.819  91.693  48.559  1.00 30.85  ? 11  DG  B C5    1 
ATOM   2916 C  C6    . DG  B 2 11  ? 12.851  91.232  49.417  1.00 31.19  ? 11  DG  B C6    1 
ATOM   2917 O  O6    . DG  B 2 11  ? 14.072  91.257  49.234  1.00 31.46  ? 11  DG  B O6    1 
ATOM   2918 N  N1    . DG  B 2 11  ? 12.337  90.692  50.591  1.00 31.15  ? 11  DG  B N1    1 
ATOM   2919 C  C2    . DG  B 2 11  ? 11.002  90.626  50.909  1.00 30.79  ? 11  DG  B C2    1 
ATOM   2920 N  N2    . DG  B 2 11  ? 10.698  90.086  52.096  1.00 31.26  ? 11  DG  B N2    1 
ATOM   2921 N  N3    . DG  B 2 11  ? 10.035  91.048  50.117  1.00 30.86  ? 11  DG  B N3    1 
ATOM   2922 C  C4    . DG  B 2 11  ? 10.510  91.563  48.967  1.00 30.75  ? 11  DG  B C4    1 
ATOM   2923 P  P     . DT  B 2 12  ? 4.765   94.151  48.662  1.00 36.05  ? 12  DT  B P     1 
ATOM   2924 O  OP1   . DT  B 2 12  ? 3.357   93.755  48.983  1.00 36.99  ? 12  DT  B OP1   1 
ATOM   2925 O  OP2   . DT  B 2 12  ? 5.018   95.407  47.919  1.00 35.67  ? 12  DT  B OP2   1 
ATOM   2926 O  "O5'" . DT  B 2 12  ? 5.553   94.121  50.040  1.00 35.70  ? 12  DT  B "O5'" 1 
ATOM   2927 C  "C5'" . DT  B 2 12  ? 5.361   93.006  50.933  1.00 36.49  ? 12  DT  B "C5'" 1 
ATOM   2928 C  "C4'" . DT  B 2 12  ? 6.104   93.261  52.219  1.00 36.96  ? 12  DT  B "C4'" 1 
ATOM   2929 O  "O4'" . DT  B 2 12  ? 7.520   93.109  51.954  1.00 35.93  ? 12  DT  B "O4'" 1 
ATOM   2930 C  "C3'" . DT  B 2 12  ? 5.930   94.680  52.773  1.00 38.19  ? 12  DT  B "C3'" 1 
ATOM   2931 O  "O3'" . DT  B 2 12  ? 5.997   94.690  54.196  1.00 40.20  ? 12  DT  B "O3'" 1 
ATOM   2932 C  "C2'" . DT  B 2 12  ? 7.175   95.390  52.291  1.00 37.44  ? 12  DT  B "C2'" 1 
ATOM   2933 C  "C1'" . DT  B 2 12  ? 8.184   94.261  52.435  1.00 36.16  ? 12  DT  B "C1'" 1 
ATOM   2934 N  N1    . DT  B 2 12  ? 9.446   94.397  51.705  1.00 34.94  ? 12  DT  B N1    1 
ATOM   2935 C  C2    . DT  B 2 12  ? 10.577  93.882  52.297  1.00 34.49  ? 12  DT  B C2    1 
ATOM   2936 O  O2    . DT  B 2 12  ? 10.567  93.330  53.384  1.00 34.53  ? 12  DT  B O2    1 
ATOM   2937 N  N3    . DT  B 2 12  ? 11.726  94.033  51.564  1.00 33.95  ? 12  DT  B N3    1 
ATOM   2938 C  C4    . DT  B 2 12  ? 11.857  94.658  50.341  1.00 34.07  ? 12  DT  B C4    1 
ATOM   2939 O  O4    . DT  B 2 12  ? 12.960  94.731  49.810  1.00 34.25  ? 12  DT  B O4    1 
ATOM   2940 C  C5    . DT  B 2 12  ? 10.627  95.167  49.771  1.00 34.39  ? 12  DT  B C5    1 
ATOM   2941 C  C7    . DT  B 2 12  ? 10.671  95.856  48.443  1.00 35.01  ? 12  DT  B C7    1 
ATOM   2942 C  C6    . DT  B 2 12  ? 9.498   95.012  50.473  1.00 34.85  ? 12  DT  B C6    1 
ATOM   2943 P  P     . DA  B 2 13  ? 4.733   95.149  55.060  1.00 43.23  ? 13  DA  B P     1 
ATOM   2944 O  OP1   . DA  B 2 13  ? 3.604   94.253  54.719  1.00 43.38  ? 13  DA  B OP1   1 
ATOM   2945 O  OP2   . DA  B 2 13  ? 4.576   96.616  54.884  1.00 42.07  ? 13  DA  B OP2   1 
ATOM   2946 O  "O5'" . DA  B 2 13  ? 5.180   94.720  56.532  1.00 44.93  ? 13  DA  B "O5'" 1 
ATOM   2947 C  "C5'" . DA  B 2 13  ? 5.525   93.338  56.789  1.00 45.06  ? 13  DA  B "C5'" 1 
ATOM   2948 C  "C4'" . DA  B 2 13  ? 6.583   93.196  57.862  1.00 45.98  ? 13  DA  B "C4'" 1 
ATOM   2949 O  "O4'" . DA  B 2 13  ? 7.914   93.428  57.338  1.00 44.47  ? 13  DA  B "O4'" 1 
ATOM   2950 C  "C3'" . DA  B 2 13  ? 6.456   94.122  59.069  1.00 47.89  ? 13  DA  B "C3'" 1 
ATOM   2951 O  "O3'" . DA  B 2 13  ? 6.926   93.355  60.177  1.00 50.75  ? 13  DA  B "O3'" 1 
ATOM   2952 C  "C2'" . DA  B 2 13  ? 7.360   95.286  58.704  1.00 46.14  ? 13  DA  B "C2'" 1 
ATOM   2953 C  "C1'" . DA  B 2 13  ? 8.471   94.623  57.887  1.00 43.99  ? 13  DA  B "C1'" 1 
ATOM   2954 N  N9    . DA  B 2 13  ? 8.983   95.404  56.765  1.00 41.66  ? 13  DA  B N9    1 
ATOM   2955 C  C8    . DA  B 2 13  ? 8.254   96.160  55.881  1.00 41.16  ? 13  DA  B C8    1 
ATOM   2956 N  N7    . DA  B 2 13  ? 8.967   96.668  54.908  1.00 39.76  ? 13  DA  B N7    1 
ATOM   2957 C  C5    . DA  B 2 13  ? 10.249  96.201  55.155  1.00 39.27  ? 13  DA  B C5    1 
ATOM   2958 C  C6    . DA  B 2 13  ? 11.470  96.395  54.487  1.00 38.15  ? 13  DA  B C6    1 
ATOM   2959 N  N6    . DA  B 2 13  ? 11.599  97.134  53.384  1.00 37.76  ? 13  DA  B N6    1 
ATOM   2960 N  N1    . DA  B 2 13  ? 12.568  95.794  54.997  1.00 37.85  ? 13  DA  B N1    1 
ATOM   2961 C  C2    . DA  B 2 13  ? 12.437  95.054  56.105  1.00 38.40  ? 13  DA  B C2    1 
ATOM   2962 N  N3    . DA  B 2 13  ? 11.344  94.798  56.822  1.00 39.65  ? 13  DA  B N3    1 
ATOM   2963 C  C4    . DA  B 2 13  ? 10.272  95.411  56.289  1.00 40.17  ? 13  DA  B C4    1 
ATOM   2964 P  P     . DT  B 2 14  ? 7.128   94.015  61.609  1.00 53.79  ? 14  DT  B P     1 
ATOM   2965 O  OP1   . DT  B 2 14  ? 6.897   92.948  62.618  1.00 55.57  ? 14  DT  B OP1   1 
ATOM   2966 O  OP2   . DT  B 2 14  ? 6.340   95.274  61.658  1.00 54.49  ? 14  DT  B OP2   1 
ATOM   2967 O  "O5'" . DT  B 2 14  ? 8.671   94.403  61.613  1.00 51.93  ? 14  DT  B "O5'" 1 
ATOM   2968 C  "C5'" . DT  B 2 14  ? 9.677   93.383  61.490  1.00 51.63  ? 14  DT  B "C5'" 1 
ATOM   2969 C  "C4'" . DT  B 2 14  ? 11.050  94.008  61.408  1.00 51.59  ? 14  DT  B "C4'" 1 
ATOM   2970 O  "O4'" . DT  B 2 14  ? 11.156  94.812  60.208  1.00 50.06  ? 14  DT  B "O4'" 1 
ATOM   2971 C  "C3'" . DT  B 2 14  ? 11.429  94.934  62.574  1.00 53.29  ? 14  DT  B "C3'" 1 
ATOM   2972 O  "O3'" . DT  B 2 14  ? 12.719  94.529  63.060  1.00 55.11  ? 14  DT  B "O3'" 1 
ATOM   2973 C  "C2'" . DT  B 2 14  ? 11.433  96.323  61.948  1.00 51.54  ? 14  DT  B "C2'" 1 
ATOM   2974 C  "C1'" . DT  B 2 14  ? 11.858  96.002  60.530  1.00 50.14  ? 14  DT  B "C1'" 1 
ATOM   2975 N  N1    . DT  B 2 14  ? 11.566  96.999  59.474  1.00 48.24  ? 14  DT  B N1    1 
ATOM   2976 C  C2    . DT  B 2 14  ? 12.608  97.401  58.666  1.00 46.85  ? 14  DT  B C2    1 
ATOM   2977 O  O2    . DT  B 2 14  ? 13.753  97.008  58.812  1.00 47.37  ? 14  DT  B O2    1 
ATOM   2978 N  N3    . DT  B 2 14  ? 12.257  98.284  57.674  1.00 46.55  ? 14  DT  B N3    1 
ATOM   2979 C  C4    . DT  B 2 14  ? 10.995  98.781  57.406  1.00 45.99  ? 14  DT  B C4    1 
ATOM   2980 O  O4    . DT  B 2 14  ? 10.836  99.572  56.480  1.00 45.13  ? 14  DT  B O4    1 
ATOM   2981 C  C5    . DT  B 2 14  ? 9.949   98.323  58.299  1.00 46.47  ? 14  DT  B C5    1 
ATOM   2982 C  C7    . DT  B 2 14  ? 8.551   98.816  58.095  1.00 46.09  ? 14  DT  B C7    1 
ATOM   2983 C  C6    . DT  B 2 14  ? 10.280  97.451  59.262  1.00 47.23  ? 14  DT  B C6    1 
ATOM   2984 P  P     . DT  B 2 15  ? 13.410  95.249  64.326  1.00 58.75  ? 15  DT  B P     1 
ATOM   2985 O  OP1   . DT  B 2 15  ? 14.198  94.224  65.054  1.00 59.69  ? 15  DT  B OP1   1 
ATOM   2986 O  OP2   . DT  B 2 15  ? 12.379  96.046  65.050  1.00 57.63  ? 15  DT  B OP2   1 
ATOM   2987 O  "O5'" . DT  B 2 15  ? 14.414  96.279  63.642  1.00 56.51  ? 15  DT  B "O5'" 1 
ATOM   2988 C  "C5'" . DT  B 2 15  ? 15.362  95.845  62.654  1.00 55.04  ? 15  DT  B "C5'" 1 
ATOM   2989 C  "C4'" . DT  B 2 15  ? 16.273  96.990  62.276  1.00 54.83  ? 15  DT  B "C4'" 1 
ATOM   2990 O  "O4'" . DT  B 2 15  ? 15.643  97.818  61.271  1.00 52.27  ? 15  DT  B "O4'" 1 
ATOM   2991 C  "C3'" . DT  B 2 15  ? 16.626  97.938  63.421  1.00 56.51  ? 15  DT  B "C3'" 1 
ATOM   2992 O  "O3'" . DT  B 2 15  ? 17.945  98.433  63.203  1.00 58.32  ? 15  DT  B "O3'" 1 
ATOM   2993 C  "C2'" . DT  B 2 15  ? 15.649  99.084  63.237  1.00 55.71  ? 15  DT  B "C2'" 1 
ATOM   2994 C  "C1'" . DT  B 2 15  ? 15.607  99.169  61.718  1.00 52.90  ? 15  DT  B "C1'" 1 
ATOM   2995 N  N1    . DT  B 2 15  ? 14.425  99.804  61.108  1.00 49.78  ? 15  DT  B N1    1 
ATOM   2996 C  C2    . DT  B 2 15  ? 14.599  100.486 59.922  1.00 48.25  ? 15  DT  B C2    1 
ATOM   2997 O  O2    . DT  B 2 15  ? 15.688  100.637 59.391  1.00 47.35  ? 15  DT  B O2    1 
ATOM   2998 N  N3    . DT  B 2 15  ? 13.444  100.997 59.382  1.00 47.04  ? 15  DT  B N3    1 
ATOM   2999 C  C4    . DT  B 2 15  ? 12.164  100.883 59.890  1.00 46.64  ? 15  DT  B C4    1 
ATOM   3000 O  O4    . DT  B 2 15  ? 11.222  101.386 59.287  1.00 46.13  ? 15  DT  B O4    1 
ATOM   3001 C  C5    . DT  B 2 15  ? 12.054  100.147 61.131  1.00 47.85  ? 15  DT  B C5    1 
ATOM   3002 C  C7    . DT  B 2 15  ? 10.708  99.977  61.761  1.00 47.92  ? 15  DT  B C7    1 
ATOM   3003 C  C6    . DT  B 2 15  ? 13.173  99.638  61.662  1.00 49.17  ? 15  DT  B C6    1 
ATOM   3004 P  P     . DG  B 2 16  ? 19.052  98.246  64.319  1.00 60.80  ? 16  DG  B P     1 
ATOM   3005 O  OP1   . DG  B 2 16  ? 19.500  96.834  64.284  1.00 60.86  ? 16  DG  B OP1   1 
ATOM   3006 O  OP2   . DG  B 2 16  ? 18.523  98.835  65.583  1.00 61.52  ? 16  DG  B OP2   1 
ATOM   3007 O  "O5'" . DG  B 2 16  ? 20.253  99.132  63.772  1.00 60.28  ? 16  DG  B "O5'" 1 
ATOM   3008 C  "C5'" . DG  B 2 16  ? 20.535  99.223  62.364  1.00 57.35  ? 16  DG  B "C5'" 1 
ATOM   3009 C  "C4'" . DG  B 2 16  ? 20.859  100.654 62.007  1.00 57.03  ? 16  DG  B "C4'" 1 
ATOM   3010 O  "O4'" . DG  B 2 16  ? 19.635  101.334 61.653  1.00 54.72  ? 16  DG  B "O4'" 1 
ATOM   3011 C  "C3'" . DG  B 2 16  ? 21.468  101.485 63.136  1.00 58.55  ? 16  DG  B "C3'" 1 
ATOM   3012 O  "O3'" . DG  B 2 16  ? 22.323  102.474 62.559  1.00 59.96  ? 16  DG  B "O3'" 1 
ATOM   3013 C  "C2'" . DG  B 2 16  ? 20.252  102.130 63.774  1.00 57.44  ? 16  DG  B "C2'" 1 
ATOM   3014 C  "C1'" . DG  B 2 16  ? 19.433  102.438 62.532  1.00 54.83  ? 16  DG  B "C1'" 1 
ATOM   3015 N  N9    . DG  B 2 16  ? 17.995  102.609 62.682  1.00 51.77  ? 16  DG  B N9    1 
ATOM   3016 C  C8    . DG  B 2 16  ? 17.179  102.194 63.708  1.00 51.76  ? 16  DG  B C8    1 
ATOM   3017 N  N7    . DG  B 2 16  ? 15.918  102.462 63.499  1.00 50.60  ? 16  DG  B N7    1 
ATOM   3018 C  C5    . DG  B 2 16  ? 15.900  103.072 62.251  1.00 48.72  ? 16  DG  B C5    1 
ATOM   3019 C  C6    . DG  B 2 16  ? 14.817  103.582 61.491  1.00 47.19  ? 16  DG  B C6    1 
ATOM   3020 O  O6    . DG  B 2 16  ? 13.614  103.594 61.776  1.00 47.43  ? 16  DG  B O6    1 
ATOM   3021 N  N1    . DG  B 2 16  ? 15.249  104.122 60.283  1.00 46.37  ? 16  DG  B N1    1 
ATOM   3022 C  C2    . DG  B 2 16  ? 16.555  104.169 59.861  1.00 46.79  ? 16  DG  B C2    1 
ATOM   3023 N  N2    . DG  B 2 16  ? 16.775  104.730 58.665  1.00 46.34  ? 16  DG  B N2    1 
ATOM   3024 N  N3    . DG  B 2 16  ? 17.572  103.696 60.560  1.00 48.59  ? 16  DG  B N3    1 
ATOM   3025 C  C4    . DG  B 2 16  ? 17.175  103.166 61.735  1.00 49.41  ? 16  DG  B C4    1 
ATOM   3026 P  P     . DG  B 2 17  ? 23.891  102.182 62.414  1.00 61.65  ? 17  DG  B P     1 
ATOM   3027 O  OP1   . DG  B 2 17  ? 24.040  100.938 61.623  1.00 61.27  ? 17  DG  B OP1   1 
ATOM   3028 O  OP2   . DG  B 2 17  ? 24.493  102.263 63.770  1.00 63.44  ? 17  DG  B OP2   1 
ATOM   3029 O  "O5'" . DG  B 2 17  ? 24.405  103.402 61.523  1.00 61.78  ? 17  DG  B "O5'" 1 
ATOM   3030 C  "C5'" . DG  B 2 17  ? 23.920  103.589 60.176  1.00 59.45  ? 17  DG  B "C5'" 1 
ATOM   3031 C  "C4'" . DG  B 2 17  ? 23.618  105.044 59.901  1.00 59.33  ? 17  DG  B "C4'" 1 
ATOM   3032 O  "O4'" . DG  B 2 17  ? 22.311  105.399 60.414  1.00 57.43  ? 17  DG  B "O4'" 1 
ATOM   3033 C  "C3'" . DG  B 2 17  ? 24.581  106.043 60.534  1.00 62.05  ? 17  DG  B "C3'" 1 
ATOM   3034 O  "O3'" . DG  B 2 17  ? 24.621  107.180 59.673  1.00 64.72  ? 17  DG  B "O3'" 1 
ATOM   3035 C  "C2'" . DG  B 2 17  ? 23.889  106.402 61.836  1.00 61.28  ? 17  DG  B "C2'" 1 
ATOM   3036 C  "C1'" . DG  B 2 17  ? 22.434  106.435 61.389  1.00 58.21  ? 17  DG  B "C1'" 1 
ATOM   3037 N  N9    . DG  B 2 17  ? 21.415  106.203 62.410  1.00 56.35  ? 17  DG  B N9    1 
ATOM   3038 C  C8    . DG  B 2 17  ? 21.575  105.649 63.659  1.00 57.11  ? 17  DG  B C8    1 
ATOM   3039 N  N7    . DG  B 2 17  ? 20.451  105.535 64.315  1.00 56.22  ? 17  DG  B N7    1 
ATOM   3040 C  C5    . DG  B 2 17  ? 19.491  106.031 63.444  1.00 53.99  ? 17  DG  B C5    1 
ATOM   3041 C  C6    . DG  B 2 17  ? 18.085  106.164 63.600  1.00 52.65  ? 17  DG  B C6    1 
ATOM   3042 O  O6    . DG  B 2 17  ? 17.383  105.849 64.567  1.00 52.82  ? 17  DG  B O6    1 
ATOM   3043 N  N1    . DG  B 2 17  ? 17.495  106.723 62.470  1.00 50.82  ? 17  DG  B N1    1 
ATOM   3044 C  C2    . DG  B 2 17  ? 18.168  107.100 61.334  1.00 50.32  ? 17  DG  B C2    1 
ATOM   3045 N  N2    . DG  B 2 17  ? 17.422  107.616 60.348  1.00 49.18  ? 17  DG  B N2    1 
ATOM   3046 N  N3    . DG  B 2 17  ? 19.476  106.981 61.176  1.00 51.43  ? 17  DG  B N3    1 
ATOM   3047 C  C4    . DG  B 2 17  ? 20.070  106.445 62.263  1.00 53.93  ? 17  DG  B C4    1 
ATOM   3048 P  P     . DG  B 2 18  ? 26.014  107.741 59.147  1.00 69.51  ? 18  DG  B P     1 
ATOM   3049 O  OP1   . DG  B 2 18  ? 26.424  106.918 57.983  1.00 68.18  ? 18  DG  B OP1   1 
ATOM   3050 O  OP2   . DG  B 2 18  ? 26.925  107.876 60.316  1.00 70.46  ? 18  DG  B OP2   1 
ATOM   3051 O  "O5'" . DG  B 2 18  ? 25.628  109.200 58.634  1.00 68.55  ? 18  DG  B "O5'" 1 
ATOM   3052 C  "C5'" . DG  B 2 18  ? 24.708  109.395 57.540  1.00 66.23  ? 18  DG  B "C5'" 1 
ATOM   3053 C  "C4'" . DG  B 2 18  ? 24.248  110.834 57.488  1.00 66.67  ? 18  DG  B "C4'" 1 
ATOM   3054 O  "O4'" . DG  B 2 18  ? 23.228  111.058 58.488  1.00 65.42  ? 18  DG  B "O4'" 1 
ATOM   3055 C  "C3'" . DG  B 2 18  ? 25.329  111.880 57.761  1.00 69.19  ? 18  DG  B "C3'" 1 
ATOM   3056 O  "O3'" . DG  B 2 18  ? 25.103  113.073 57.005  1.00 70.31  ? 18  DG  B "O3'" 1 
ATOM   3057 C  "C2'" . DG  B 2 18  ? 25.203  112.149 59.252  1.00 69.37  ? 18  DG  B "C2'" 1 
ATOM   3058 C  "C1'" . DG  B 2 18  ? 23.751  111.800 59.587  1.00 66.91  ? 18  DG  B "C1'" 1 
ATOM   3059 N  N9    . DG  B 2 18  ? 23.557  111.001 60.794  1.00 65.97  ? 18  DG  B N9    1 
ATOM   3060 C  C8    . DG  B 2 18  ? 24.518  110.358 61.539  1.00 67.06  ? 18  DG  B C8    1 
ATOM   3061 N  N7    . DG  B 2 18  ? 24.027  109.718 62.564  1.00 65.69  ? 18  DG  B N7    1 
ATOM   3062 C  C5    . DG  B 2 18  ? 22.660  109.945 62.490  1.00 62.95  ? 18  DG  B C5    1 
ATOM   3063 C  C6    . DG  B 2 18  ? 21.610  109.502 63.333  1.00 61.32  ? 18  DG  B C6    1 
ATOM   3064 O  O6    . DG  B 2 18  ? 21.681  108.799 64.346  1.00 61.21  ? 18  DG  B O6    1 
ATOM   3065 N  N1    . DG  B 2 18  ? 20.374  109.973 62.900  1.00 59.71  ? 18  DG  B N1    1 
ATOM   3066 C  C2    . DG  B 2 18  ? 20.174  110.769 61.799  1.00 59.14  ? 18  DG  B C2    1 
ATOM   3067 N  N2    . DG  B 2 18  ? 18.906  111.124 61.544  1.00 57.27  ? 18  DG  B N2    1 
ATOM   3068 N  N3    . DG  B 2 18  ? 21.146  111.189 61.005  1.00 60.61  ? 18  DG  B N3    1 
ATOM   3069 C  C4    . DG  B 2 18  ? 22.354  110.738 61.405  1.00 63.12  ? 18  DG  B C4    1 
ATOM   3070 P  P     . DC  C 3 1   ? 13.725  107.132 68.309  1.00 77.10  ? 1   DC  C P     1 
ATOM   3071 O  OP1   . DC  C 3 1   ? 15.053  107.379 68.948  1.00 69.20  ? 1   DC  C OP1   1 
ATOM   3072 O  OP2   . DC  C 3 1   ? 13.548  105.971 67.386  1.00 75.88  ? 1   DC  C OP2   1 
ATOM   3073 O  "O5'" . DC  C 3 1   ? 13.086  108.456 67.676  1.00 60.01  ? 1   DC  C "O5'" 1 
ATOM   3074 C  "C5'" . DC  C 3 1   ? 12.642  108.496 66.303  1.00 52.15  ? 1   DC  C "C5'" 1 
ATOM   3075 C  "C4'" . DC  C 3 1   ? 12.598  109.910 65.765  1.00 48.01  ? 1   DC  C "C4'" 1 
ATOM   3076 O  "O4'" . DC  C 3 1   ? 13.831  110.600 66.073  1.00 45.33  ? 1   DC  C "O4'" 1 
ATOM   3077 C  "C3'" . DC  C 3 1   ? 12.477  109.980 64.246  1.00 44.80  ? 1   DC  C "C3'" 1 
ATOM   3078 O  "O3'" . DC  C 3 1   ? 11.923  111.214 63.793  1.00 45.06  ? 1   DC  C "O3'" 1 
ATOM   3079 C  "C2'" . DC  C 3 1   ? 13.922  109.907 63.799  1.00 43.90  ? 1   DC  C "C2'" 1 
ATOM   3080 C  "C1'" . DC  C 3 1   ? 14.672  110.624 64.923  1.00 44.12  ? 1   DC  C "C1'" 1 
ATOM   3081 N  N1    . DC  C 3 1   ? 15.942  109.969 65.268  1.00 41.45  ? 1   DC  C N1    1 
ATOM   3082 C  C2    . DC  C 3 1   ? 17.000  110.079 64.369  1.00 41.49  ? 1   DC  C C2    1 
ATOM   3083 O  O2    . DC  C 3 1   ? 16.834  110.733 63.330  1.00 42.48  ? 1   DC  C O2    1 
ATOM   3084 N  N3    . DC  C 3 1   ? 18.178  109.479 64.655  1.00 41.88  ? 1   DC  C N3    1 
ATOM   3085 C  C4    . DC  C 3 1   ? 18.313  108.781 65.784  1.00 40.76  ? 1   DC  C C4    1 
ATOM   3086 N  N4    . DC  C 3 1   ? 19.490  108.198 66.020  1.00 40.95  ? 1   DC  C N4    1 
ATOM   3087 C  C5    . DC  C 3 1   ? 17.245  108.645 66.716  1.00 40.29  ? 1   DC  C C5    1 
ATOM   3088 C  C6    . DC  C 3 1   ? 16.087  109.248 66.420  1.00 41.20  ? 1   DC  C C6    1 
ATOM   3089 P  P     . DC  C 3 2   ? 10.360  111.336 63.474  1.00 46.77  ? 2   DC  C P     1 
ATOM   3090 O  OP1   . DC  C 3 2   ? 10.012  112.775 63.528  1.00 47.47  ? 2   DC  C OP1   1 
ATOM   3091 O  OP2   . DC  C 3 2   ? 9.635   110.370 64.328  1.00 47.36  ? 2   DC  C OP2   1 
ATOM   3092 O  "O5'" . DC  C 3 2   ? 10.251  110.780 61.984  1.00 46.17  ? 2   DC  C "O5'" 1 
ATOM   3093 C  "C5'" . DC  C 3 2   ? 10.899  111.467 60.902  1.00 47.34  ? 2   DC  C "C5'" 1 
ATOM   3094 C  "C4'" . DC  C 3 2   ? 11.374  110.488 59.855  1.00 47.79  ? 2   DC  C "C4'" 1 
ATOM   3095 O  "O4'" . DC  C 3 2   ? 12.406  109.618 60.384  1.00 45.15  ? 2   DC  C "O4'" 1 
ATOM   3096 C  "C3'" . DC  C 3 2   ? 10.296  109.558 59.301  1.00 48.11  ? 2   DC  C "C3'" 1 
ATOM   3097 O  "O3'" . DC  C 3 2   ? 10.616  109.302 57.943  1.00 51.47  ? 2   DC  C "O3'" 1 
ATOM   3098 C  "C2'" . DC  C 3 2   ? 10.514  108.270 60.069  1.00 45.81  ? 2   DC  C "C2'" 1 
ATOM   3099 C  "C1'" . DC  C 3 2   ? 12.031  108.254 60.185  1.00 44.10  ? 2   DC  C "C1'" 1 
ATOM   3100 N  N1    . DC  C 3 2   ? 12.606  107.472 61.295  1.00 42.16  ? 2   DC  C N1    1 
ATOM   3101 C  C2    . DC  C 3 2   ? 13.999  107.361 61.362  1.00 39.57  ? 2   DC  C C2    1 
ATOM   3102 O  O2    . DC  C 3 2   ? 14.686  107.890 60.476  1.00 38.55  ? 2   DC  C O2    1 
ATOM   3103 N  N3    . DC  C 3 2   ? 14.560  106.683 62.388  1.00 38.96  ? 2   DC  C N3    1 
ATOM   3104 C  C4    . DC  C 3 2   ? 13.788  106.154 63.340  1.00 40.39  ? 2   DC  C C4    1 
ATOM   3105 N  N4    . DC  C 3 2   ? 14.388  105.498 64.335  1.00 41.80  ? 2   DC  C N4    1 
ATOM   3106 C  C5    . DC  C 3 2   ? 12.366  106.254 63.300  1.00 40.24  ? 2   DC  C C5    1 
ATOM   3107 C  C6    . DC  C 3 2   ? 11.821  106.923 62.273  1.00 40.55  ? 2   DC  C C6    1 
ATOM   3108 P  P     . DC  C 3 3   ? 9.634   109.753 56.793  1.00 56.11  ? 3   DC  C P     1 
ATOM   3109 O  OP1   . DC  C 3 3   ? 9.526   111.229 56.844  1.00 56.58  ? 3   DC  C OP1   1 
ATOM   3110 O  OP2   . DC  C 3 3   ? 8.406   108.930 56.903  1.00 53.85  ? 3   DC  C OP2   1 
ATOM   3111 O  "O5'" . DC  C 3 3   ? 10.480  109.381 55.494  1.00 56.77  ? 3   DC  C "O5'" 1 
ATOM   3112 C  "C5'" . DC  C 3 3   ? 11.732  110.048 55.231  1.00 58.82  ? 3   DC  C "C5'" 1 
ATOM   3113 C  "C4'" . DC  C 3 3   ? 12.776  109.067 54.747  1.00 59.48  ? 3   DC  C "C4'" 1 
ATOM   3114 O  "O4'" . DC  C 3 3   ? 13.167  108.165 55.810  1.00 55.29  ? 3   DC  C "O4'" 1 
ATOM   3115 C  "C3'" . DC  C 3 3   ? 12.347  108.166 53.593  1.00 60.94  ? 3   DC  C "C3'" 1 
ATOM   3116 O  "O3'" . DC  C 3 3   ? 13.539  107.882 52.861  1.00 65.12  ? 3   DC  C "O3'" 1 
ATOM   3117 C  "C2'" . DC  C 3 3   ? 11.850  106.921 54.306  1.00 57.48  ? 3   DC  C "C2'" 1 
ATOM   3118 C  "C1'" . DC  C 3 3   ? 12.862  106.822 55.443  1.00 54.10  ? 3   DC  C "C1'" 1 
ATOM   3119 N  N1    . DC  C 3 3   ? 12.466  106.103 56.669  1.00 50.41  ? 3   DC  C N1    1 
ATOM   3120 C  C2    . DC  C 3 3   ? 13.479  105.657 57.526  1.00 48.31  ? 3   DC  C C2    1 
ATOM   3121 O  O2    . DC  C 3 3   ? 14.663  105.848 57.207  1.00 48.63  ? 3   DC  C O2    1 
ATOM   3122 N  N3    . DC  C 3 3   ? 13.144  105.021 58.673  1.00 46.84  ? 3   DC  C N3    1 
ATOM   3123 C  C4    . DC  C 3 3   ? 11.859  104.837 58.984  1.00 44.20  ? 3   DC  C C4    1 
ATOM   3124 N  N4    . DC  C 3 3   ? 11.578  104.204 60.125  1.00 42.77  ? 3   DC  C N4    1 
ATOM   3125 C  C5    . DC  C 3 3   ? 10.806  105.289 58.135  1.00 44.99  ? 3   DC  C C5    1 
ATOM   3126 C  C6    . DC  C 3 3   ? 11.151  105.920 57.003  1.00 48.35  ? 3   DC  C C6    1 
ATOM   3127 P  P     . DA  C 3 4   ? 13.490  107.612 51.291  1.00 71.62  ? 4   DA  C P     1 
ATOM   3128 O  OP1   . DA  C 3 4   ? 13.595  108.926 50.601  1.00 72.79  ? 4   DA  C OP1   1 
ATOM   3129 O  OP2   . DA  C 3 4   ? 12.332  106.714 51.013  1.00 69.57  ? 4   DA  C OP2   1 
ATOM   3130 O  "O5'" . DA  C 3 4   ? 14.851  106.818 51.041  1.00 66.26  ? 4   DA  C "O5'" 1 
ATOM   3131 C  "C5'" . DA  C 3 4   ? 16.120  107.451 51.300  1.00 63.25  ? 4   DA  C "C5'" 1 
ATOM   3132 C  "C4'" . DA  C 3 4   ? 17.151  106.438 51.742  1.00 59.27  ? 4   DA  C "C4'" 1 
ATOM   3133 O  "O4'" . DA  C 3 4   ? 16.713  105.755 52.938  1.00 54.55  ? 4   DA  C "O4'" 1 
ATOM   3134 C  "C3'" . DA  C 3 4   ? 17.467  105.344 50.725  1.00 58.23  ? 4   DA  C "C3'" 1 
ATOM   3135 O  "O3'" . DA  C 3 4   ? 18.884  105.141 50.774  1.00 59.25  ? 4   DA  C "O3'" 1 
ATOM   3136 C  "C2'" . DA  C 3 4   ? 16.590  104.185 51.175  1.00 54.79  ? 4   DA  C "C2'" 1 
ATOM   3137 C  "C1'" . DA  C 3 4   ? 16.489  104.374 52.687  1.00 54.17  ? 4   DA  C "C1'" 1 
ATOM   3138 N  N9    . DA  C 3 4   ? 15.206  104.014 53.298  1.00 52.76  ? 4   DA  C N9    1 
ATOM   3139 C  C8    . DA  C 3 4   ? 13.942  104.155 52.777  1.00 54.15  ? 4   DA  C C8    1 
ATOM   3140 N  N7    . DA  C 3 4   ? 12.990  103.757 53.586  1.00 53.40  ? 4   DA  C N7    1 
ATOM   3141 C  C5    . DA  C 3 4   ? 13.669  103.343 54.724  1.00 51.50  ? 4   DA  C C5    1 
ATOM   3142 C  C6    . DA  C 3 4   ? 13.229  102.804 55.948  1.00 49.14  ? 4   DA  C C6    1 
ATOM   3143 N  N6    . DA  C 3 4   ? 11.944  102.596 56.251  1.00 48.02  ? 4   DA  C N6    1 
ATOM   3144 N  N1    . DA  C 3 4   ? 14.167  102.476 56.862  1.00 47.08  ? 4   DA  C N1    1 
ATOM   3145 C  C2    . DA  C 3 4   ? 15.455  102.688 56.564  1.00 49.27  ? 4   DA  C C2    1 
ATOM   3146 N  N3    . DA  C 3 4   ? 15.992  103.187 55.451  1.00 52.87  ? 4   DA  C N3    1 
ATOM   3147 C  C4    . DA  C 3 4   ? 15.034  103.499 54.561  1.00 52.03  ? 4   DA  C C4    1 
ATOM   3148 P  P     . DA  C 3 5   ? 19.559  103.876 50.071  1.00 58.12  ? 5   DA  C P     1 
ATOM   3149 O  OP1   . DA  C 3 5   ? 20.949  104.247 49.710  1.00 62.33  ? 5   DA  C OP1   1 
ATOM   3150 O  OP2   . DA  C 3 5   ? 18.626  103.368 49.033  1.00 60.95  ? 5   DA  C OP2   1 
ATOM   3151 O  "O5'" . DA  C 3 5   ? 19.663  102.828 51.261  1.00 53.71  ? 5   DA  C "O5'" 1 
ATOM   3152 C  "C5'" . DA  C 3 5   ? 20.187  103.253 52.528  1.00 52.97  ? 5   DA  C "C5'" 1 
ATOM   3153 C  "C4'" . DA  C 3 5   ? 20.305  102.076 53.464  1.00 49.99  ? 5   DA  C "C4'" 1 
ATOM   3154 O  "O4'" . DA  C 3 5   ? 19.010  101.741 54.011  1.00 46.52  ? 5   DA  C "O4'" 1 
ATOM   3155 C  "C3'" . DA  C 3 5   ? 20.830  100.794 52.824  1.00 50.08  ? 5   DA  C "C3'" 1 
ATOM   3156 O  "O3'" . DA  C 3 5   ? 21.686  100.220 53.807  1.00 51.04  ? 5   DA  C "O3'" 1 
ATOM   3157 C  "C2'" . DA  C 3 5   ? 19.572  99.986  52.553  1.00 47.17  ? 5   DA  C "C2'" 1 
ATOM   3158 C  "C1'" . DA  C 3 5   ? 18.680  100.389 53.721  1.00 45.35  ? 5   DA  C "C1'" 1 
ATOM   3159 N  N9    . DA  C 3 5   ? 17.236  100.334 53.493  1.00 41.81  ? 5   DA  C N9    1 
ATOM   3160 C  C8    . DA  C 3 5   ? 16.534  100.795 52.406  1.00 42.24  ? 5   DA  C C8    1 
ATOM   3161 N  N7    . DA  C 3 5   ? 15.234  100.672 52.527  1.00 42.70  ? 5   DA  C N7    1 
ATOM   3162 C  C5    . DA  C 3 5   ? 15.068  100.119 53.789  1.00 39.88  ? 5   DA  C C5    1 
ATOM   3163 C  C6    . DA  C 3 5   ? 13.924  99.736  54.510  1.00 38.68  ? 5   DA  C C6    1 
ATOM   3164 N  N6    . DA  C 3 5   ? 12.681  99.867  54.047  1.00 41.35  ? 5   DA  C N6    1 
ATOM   3165 N  N1    . DA  C 3 5   ? 14.103  99.214  55.743  1.00 36.30  ? 5   DA  C N1    1 
ATOM   3166 C  C2    . DA  C 3 5   ? 15.353  99.081  56.208  1.00 37.49  ? 5   DA  C C2    1 
ATOM   3167 N  N3    . DA  C 3 5   ? 16.507  99.397  55.621  1.00 38.76  ? 5   DA  C N3    1 
ATOM   3168 C  C4    . DA  C 3 5   ? 16.292  99.918  54.400  1.00 39.42  ? 5   DA  C C4    1 
ATOM   3169 P  P     . DT  C 3 6   ? 22.736  99.136  53.402  1.00 53.77  ? 6   DT  C P     1 
ATOM   3170 O  OP1   . DT  C 3 6   ? 24.091  99.725  53.536  1.00 58.47  ? 6   DT  C OP1   1 
ATOM   3171 O  OP2   . DT  C 3 6   ? 22.323  98.562  52.103  1.00 53.30  ? 6   DT  C OP2   1 
ATOM   3172 O  "O5'" . DT  C 3 6   ? 22.510  98.061  54.544  1.00 51.17  ? 6   DT  C "O5'" 1 
ATOM   3173 C  "C5'" . DT  C 3 6   ? 21.601  96.994  54.304  1.00 48.74  ? 6   DT  C "C5'" 1 
ATOM   3174 C  "C4'" . DT  C 3 6   ? 20.735  96.757  55.516  1.00 45.05  ? 6   DT  C "C4'" 1 
ATOM   3175 O  "O4'" . DT  C 3 6   ? 19.396  97.231  55.243  1.00 43.12  ? 6   DT  C "O4'" 1 
ATOM   3176 C  "C3'" . DT  C 3 6   ? 20.623  95.271  55.847  1.00 43.70  ? 6   DT  C "C3'" 1 
ATOM   3177 O  "O3'" . DT  C 3 6   ? 21.106  95.017  57.169  1.00 40.39  ? 6   DT  C "O3'" 1 
ATOM   3178 C  "C2'" . DT  C 3 6   ? 19.182  94.902  55.524  1.00 42.53  ? 6   DT  C "C2'" 1 
ATOM   3179 C  "C1'" . DT  C 3 6   ? 18.433  96.220  55.512  1.00 41.99  ? 6   DT  C "C1'" 1 
ATOM   3180 N  N1    . DT  C 3 6   ? 17.347  96.338  54.502  1.00 39.35  ? 6   DT  C N1    1 
ATOM   3181 C  C2    . DT  C 3 6   ? 16.053  96.115  54.918  1.00 37.38  ? 6   DT  C C2    1 
ATOM   3182 O  O2    . DT  C 3 6   ? 15.767  95.772  56.052  1.00 38.43  ? 6   DT  C O2    1 
ATOM   3183 N  N3    . DT  C 3 6   ? 15.101  96.275  53.942  1.00 36.42  ? 6   DT  C N3    1 
ATOM   3184 C  C4    . DT  C 3 6   ? 15.306  96.660  52.632  1.00 36.91  ? 6   DT  C C4    1 
ATOM   3185 O  O4    . DT  C 3 6   ? 14.348  96.775  51.874  1.00 38.92  ? 6   DT  C O4    1 
ATOM   3186 C  C5    . DT  C 3 6   ? 16.687  96.890  52.264  1.00 37.40  ? 6   DT  C C5    1 
ATOM   3187 C  C7    . DT  C 3 6   ? 17.008  97.291  50.859  1.00 37.67  ? 6   DT  C C7    1 
ATOM   3188 C  C6    . DT  C 3 6   ? 17.626  96.722  53.206  1.00 37.86  ? 6   DT  C C6    1 
ATOM   3189 P  P     . DA  C 3 7   ? 21.900  93.663  57.450  1.00 37.83  ? 7   DA  C P     1 
ATOM   3190 O  OP1   . DA  C 3 7   ? 22.544  93.775  58.770  1.00 39.85  ? 7   DA  C OP1   1 
ATOM   3191 O  OP2   . DA  C 3 7   ? 22.711  93.331  56.247  1.00 38.04  ? 7   DA  C OP2   1 
ATOM   3192 O  "O5'" . DA  C 3 7   ? 20.725  92.594  57.555  1.00 37.53  ? 7   DA  C "O5'" 1 
ATOM   3193 C  "C5'" . DA  C 3 7   ? 19.680  92.741  58.542  1.00 37.45  ? 7   DA  C "C5'" 1 
ATOM   3194 C  "C4'" . DA  C 3 7   ? 18.547  91.788  58.238  1.00 36.82  ? 7   DA  C "C4'" 1 
ATOM   3195 O  "O4'" . DA  C 3 7   ? 17.776  92.281  57.121  1.00 35.44  ? 7   DA  C "O4'" 1 
ATOM   3196 C  "C3'" . DA  C 3 7   ? 18.985  90.378  57.846  1.00 37.83  ? 7   DA  C "C3'" 1 
ATOM   3197 O  "O3'" . DA  C 3 7   ? 18.078  89.446  58.414  1.00 38.36  ? 7   DA  C "O3'" 1 
ATOM   3198 C  "C2'" . DA  C 3 7   ? 18.838  90.368  56.339  1.00 37.26  ? 7   DA  C "C2'" 1 
ATOM   3199 C  "C1'" . DA  C 3 7   ? 17.606  91.234  56.188  1.00 35.82  ? 7   DA  C "C1'" 1 
ATOM   3200 N  N9    . DA  C 3 7   ? 17.394  91.835  54.875  1.00 34.80  ? 7   DA  C N9    1 
ATOM   3201 C  C8    . DA  C 3 7   ? 18.312  92.131  53.897  1.00 33.47  ? 7   DA  C C8    1 
ATOM   3202 N  N7    . DA  C 3 7   ? 17.784  92.672  52.825  1.00 32.87  ? 7   DA  C N7    1 
ATOM   3203 C  C5    . DA  C 3 7   ? 16.427  92.715  53.107  1.00 31.94  ? 7   DA  C C5    1 
ATOM   3204 C  C6    . DA  C 3 7   ? 15.322  93.169  52.369  1.00 30.93  ? 7   DA  C C6    1 
ATOM   3205 N  N6    . DA  C 3 7   ? 15.415  93.692  51.145  1.00 30.82  ? 7   DA  C N6    1 
ATOM   3206 N  N1    . DA  C 3 7   ? 14.104  93.093  52.951  1.00 30.30  ? 7   DA  C N1    1 
ATOM   3207 C  C2    . DA  C 3 7   ? 14.010  92.560  54.176  1.00 29.30  ? 7   DA  C C2    1 
ATOM   3208 N  N3    . DA  C 3 7   ? 14.974  92.083  54.961  1.00 30.84  ? 7   DA  C N3    1 
ATOM   3209 C  C4    . DA  C 3 7   ? 16.173  92.206  54.368  1.00 32.43  ? 7   DA  C C4    1 
ATOM   3210 P  P     . DC  C 3 8   ? 18.614  88.048  58.890  1.00 43.38  ? 8   DC  C P     1 
ATOM   3211 O  OP1   . DC  C 3 8   ? 19.407  88.278  60.118  1.00 48.50  ? 8   DC  C OP1   1 
ATOM   3212 O  OP2   . DC  C 3 8   ? 19.264  87.385  57.733  1.00 45.18  ? 8   DC  C OP2   1 
ATOM   3213 O  "O5'" . DC  C 3 8   ? 17.273  87.266  59.268  1.00 45.49  ? 8   DC  C "O5'" 1 
ATOM   3214 C  "C5'" . DC  C 3 8   ? 16.419  86.681  58.257  1.00 44.88  ? 8   DC  C "C5'" 1 
ATOM   3215 C  "C4'" . DC  C 3 8   ? 15.196  87.534  58.006  1.00 44.56  ? 8   DC  C "C4'" 1 
ATOM   3216 O  "O4'" . DC  C 3 8   ? 15.510  88.555  57.040  1.00 44.18  ? 8   DC  C "O4'" 1 
ATOM   3217 C  "C3'" . DC  C 3 8   ? 14.019  86.772  57.404  1.00 44.62  ? 8   DC  C "C3'" 1 
ATOM   3218 O  "O3'" . DC  C 3 8   ? 13.125  86.304  58.413  1.00 43.78  ? 8   DC  C "O3'" 1 
ATOM   3219 C  "C2'" . DC  C 3 8   ? 13.303  87.811  56.565  1.00 43.72  ? 8   DC  C "C2'" 1 
ATOM   3220 C  "C1'" . DC  C 3 8   ? 14.363  88.852  56.250  1.00 42.93  ? 8   DC  C "C1'" 1 
ATOM   3221 N  N1    . DC  C 3 8   ? 14.782  88.949  54.838  1.00 41.76  ? 8   DC  C N1    1 
ATOM   3222 C  C2    . DC  C 3 8   ? 13.835  89.341  53.893  1.00 38.57  ? 8   DC  C C2    1 
ATOM   3223 O  O2    . DC  C 3 8   ? 12.665  89.515  54.256  1.00 41.53  ? 8   DC  C O2    1 
ATOM   3224 N  N3    . DC  C 3 8   ? 14.215  89.524  52.611  1.00 38.45  ? 8   DC  C N3    1 
ATOM   3225 C  C4    . DC  C 3 8   ? 15.484  89.319  52.257  1.00 37.68  ? 8   DC  C C4    1 
ATOM   3226 N  N4    . DC  C 3 8   ? 15.809  89.488  50.975  1.00 35.92  ? 8   DC  C N4    1 
ATOM   3227 C  C5    . DC  C 3 8   ? 16.476  88.931  53.202  1.00 39.39  ? 8   DC  C C5    1 
ATOM   3228 C  C6    . DC  C 3 8   ? 16.085  88.761  54.470  1.00 40.51  ? 8   DC  C C6    1 
ATOM   3229 P  P     . DC  C 3 9   ? 12.386  84.915  58.218  1.00 43.74  ? 9   DC  C P     1 
ATOM   3230 O  OP1   . DC  C 3 9   ? 11.687  84.585  59.489  1.00 47.61  ? 9   DC  C OP1   1 
ATOM   3231 O  OP2   . DC  C 3 9   ? 13.343  83.950  57.625  1.00 44.00  ? 9   DC  C OP2   1 
ATOM   3232 O  "O5'" . DC  C 3 9   ? 11.273  85.265  57.137  1.00 42.14  ? 9   DC  C "O5'" 1 
ATOM   3233 C  "C5'" . DC  C 3 9   ? 10.326  86.313  57.404  1.00 39.86  ? 9   DC  C "C5'" 1 
ATOM   3234 C  "C4'" . DC  C 3 9   ? 9.301   86.358  56.299  1.00 38.68  ? 9   DC  C "C4'" 1 
ATOM   3235 O  "O4'" . DC  C 3 9   ? 9.910   86.877  55.095  1.00 34.86  ? 9   DC  C "O4'" 1 
ATOM   3236 C  "C3'" . DC  C 3 9   ? 8.707   84.998  55.929  1.00 37.02  ? 9   DC  C "C3'" 1 
ATOM   3237 O  "O3'" . DC  C 3 9   ? 7.306   85.192  55.723  1.00 36.75  ? 9   DC  C "O3'" 1 
ATOM   3238 C  "C2'" . DC  C 3 9   ? 9.473   84.602  54.683  1.00 35.27  ? 9   DC  C "C2'" 1 
ATOM   3239 C  "C1'" . DC  C 3 9   ? 9.775   85.946  54.038  1.00 34.85  ? 9   DC  C "C1'" 1 
ATOM   3240 N  N1    . DC  C 3 9   ? 11.011  86.008  53.245  1.00 35.02  ? 9   DC  C N1    1 
ATOM   3241 C  C2    . DC  C 3 9   ? 10.968  86.596  51.976  1.00 35.11  ? 9   DC  C C2    1 
ATOM   3242 O  O2    . DC  C 3 9   ? 9.881   86.999  51.538  1.00 34.39  ? 9   DC  C O2    1 
ATOM   3243 N  N3    . DC  C 3 9   ? 12.109  86.699  51.255  1.00 34.62  ? 9   DC  C N3    1 
ATOM   3244 C  C4    . DC  C 3 9   ? 13.260  86.246  51.760  1.00 33.16  ? 9   DC  C C4    1 
ATOM   3245 N  N4    . DC  C 3 9   ? 14.358  86.361  51.010  1.00 32.53  ? 9   DC  C N4    1 
ATOM   3246 C  C5    . DC  C 3 9   ? 13.338  85.670  53.062  1.00 33.75  ? 9   DC  C C5    1 
ATOM   3247 C  C6    . DC  C 3 9   ? 12.202  85.581  53.768  1.00 35.04  ? 9   DC  C C6    1 
ATOM   3248 P  P     . DA  C 3 10  ? 6.347   83.950  55.526  1.00 37.31  ? 10  DA  C P     1 
ATOM   3249 O  OP1   . DA  C 3 10  ? 4.956   84.406  55.818  1.00 39.52  ? 10  DA  C OP1   1 
ATOM   3250 O  OP2   . DA  C 3 10  ? 6.915   82.789  56.255  1.00 40.27  ? 10  DA  C OP2   1 
ATOM   3251 O  "O5'" . DA  C 3 10  ? 6.447   83.665  53.964  1.00 35.04  ? 10  DA  C "O5'" 1 
ATOM   3252 C  "C5'" . DA  C 3 10  ? 5.783   84.559  53.038  1.00 34.30  ? 10  DA  C "C5'" 1 
ATOM   3253 C  "C4'" . DA  C 3 10  ? 6.138   84.237  51.605  1.00 31.86  ? 10  DA  C "C4'" 1 
ATOM   3254 O  "O4'" . DA  C 3 10  ? 7.543   84.460  51.392  1.00 30.95  ? 10  DA  C "O4'" 1 
ATOM   3255 C  "C3'" . DA  C 3 10  ? 5.877   82.793  51.159  1.00 31.51  ? 10  DA  C "C3'" 1 
ATOM   3256 O  "O3'" . DA  C 3 10  ? 4.640   82.748  50.432  1.00 30.47  ? 10  DA  C "O3'" 1 
ATOM   3257 C  "C2'" . DA  C 3 10  ? 7.098   82.435  50.317  1.00 31.60  ? 10  DA  C "C2'" 1 
ATOM   3258 C  "C1'" . DA  C 3 10  ? 7.917   83.720  50.247  1.00 30.20  ? 10  DA  C "C1'" 1 
ATOM   3259 N  N9    . DA  C 3 10  ? 9.370   83.549  50.280  1.00 28.97  ? 10  DA  C N9    1 
ATOM   3260 C  C8    . DA  C 3 10  ? 10.130  83.049  51.310  1.00 29.54  ? 10  DA  C C8    1 
ATOM   3261 N  N7    . DA  C 3 10  ? 11.420  83.058  51.069  1.00 29.16  ? 10  DA  C N7    1 
ATOM   3262 C  C5    . DA  C 3 10  ? 11.517  83.599  49.793  1.00 28.60  ? 10  DA  C C5    1 
ATOM   3263 C  C6    . DA  C 3 10  ? 12.617  83.868  48.961  1.00 27.83  ? 10  DA  C C6    1 
ATOM   3264 N  N6    . DA  C 3 10  ? 13.880  83.611  49.299  1.00 28.47  ? 10  DA  C N6    1 
ATOM   3265 N  N1    . DA  C 3 10  ? 12.370  84.400  47.743  1.00 27.14  ? 10  DA  C N1    1 
ATOM   3266 C  C2    . DA  C 3 10  ? 11.098  84.643  47.397  1.00 28.50  ? 10  DA  C C2    1 
ATOM   3267 N  N3    . DA  C 3 10  ? 9.983   84.449  48.097  1.00 27.73  ? 10  DA  C N3    1 
ATOM   3268 C  C4    . DA  C 3 10  ? 10.262  83.906  49.296  1.00 28.63  ? 10  DA  C C4    1 
ATOM   3269 P  P     . DG  C 3 11  ? 4.086   81.369  49.754  1.00 31.80  ? 11  DG  C P     1 
ATOM   3270 O  OP1   . DG  C 3 11  ? 2.599   81.464  49.679  1.00 31.66  ? 11  DG  C OP1   1 
ATOM   3271 O  OP2   . DG  C 3 11  ? 4.716   80.206  50.429  1.00 32.59  ? 11  DG  C OP2   1 
ATOM   3272 O  "O5'" . DG  C 3 11  ? 4.655   81.430  48.271  1.00 28.92  ? 11  DG  C "O5'" 1 
ATOM   3273 C  "C5'" . DG  C 3 11  ? 4.518   82.618  47.466  1.00 28.80  ? 11  DG  C "C5'" 1 
ATOM   3274 C  "C4'" . DG  C 3 11  ? 5.022   82.343  46.068  1.00 28.03  ? 11  DG  C "C4'" 1 
ATOM   3275 O  "O4'" . DG  C 3 11  ? 6.464   82.440  46.069  1.00 27.02  ? 11  DG  C "O4'" 1 
ATOM   3276 C  "C3'" . DG  C 3 11  ? 4.679   80.949  45.539  1.00 28.10  ? 11  DG  C "C3'" 1 
ATOM   3277 O  "O3'" . DG  C 3 11  ? 4.151   81.023  44.213  1.00 29.52  ? 11  DG  C "O3'" 1 
ATOM   3278 C  "C2'" . DG  C 3 11  ? 5.973   80.172  45.688  1.00 27.67  ? 11  DG  C "C2'" 1 
ATOM   3279 C  "C1'" . DG  C 3 11  ? 7.046   81.240  45.577  1.00 26.82  ? 11  DG  C "C1'" 1 
ATOM   3280 N  N9    . DG  C 3 11  ? 8.244   80.973  46.363  1.00 25.53  ? 11  DG  C N9    1 
ATOM   3281 C  C8    . DG  C 3 11  ? 8.290   80.514  47.657  1.00 26.17  ? 11  DG  C C8    1 
ATOM   3282 N  N7    . DG  C 3 11  ? 9.506   80.411  48.121  1.00 25.91  ? 11  DG  C N7    1 
ATOM   3283 C  C5    . DG  C 3 11  ? 10.312  80.820  47.068  1.00 25.04  ? 11  DG  C C5    1 
ATOM   3284 C  C6    . DG  C 3 11  ? 11.726  80.902  46.971  1.00 24.99  ? 11  DG  C C6    1 
ATOM   3285 O  O6    . DG  C 3 11  ? 12.574  80.622  47.823  1.00 26.17  ? 11  DG  C O6    1 
ATOM   3286 N  N1    . DG  C 3 11  ? 12.126  81.351  45.719  1.00 24.60  ? 11  DG  C N1    1 
ATOM   3287 C  C2    . DG  C 3 11  ? 11.277  81.697  44.694  1.00 25.14  ? 11  DG  C C2    1 
ATOM   3288 N  N2    . DG  C 3 11  ? 11.861  82.112  43.557  1.00 24.69  ? 11  DG  C N2    1 
ATOM   3289 N  N3    . DG  C 3 11  ? 9.958   81.624  44.771  1.00 23.74  ? 11  DG  C N3    1 
ATOM   3290 C  C4    . DG  C 3 11  ? 9.548   81.175  45.976  1.00 24.59  ? 11  DG  C C4    1 
ATOM   3291 P  P     . DT  C 3 12  ? 3.937   79.689  43.328  1.00 31.21  ? 12  DT  C P     1 
ATOM   3292 O  OP1   . DT  C 3 12  ? 2.861   79.964  42.334  1.00 30.72  ? 12  DT  C OP1   1 
ATOM   3293 O  OP2   . DT  C 3 12  ? 3.799   78.542  44.252  1.00 31.28  ? 12  DT  C OP2   1 
ATOM   3294 O  "O5'" . DT  C 3 12  ? 5.305   79.616  42.528  1.00 30.88  ? 12  DT  C "O5'" 1 
ATOM   3295 C  "C5'" . DT  C 3 12  ? 5.813   80.837  41.960  1.00 32.15  ? 12  DT  C "C5'" 1 
ATOM   3296 C  "C4'" . DT  C 3 12  ? 6.940   80.536  41.002  1.00 32.99  ? 12  DT  C "C4'" 1 
ATOM   3297 O  "O4'" . DT  C 3 12  ? 8.175   80.372  41.737  1.00 31.85  ? 12  DT  C "O4'" 1 
ATOM   3298 C  "C3'" . DT  C 3 12  ? 6.748   79.259  40.190  1.00 33.74  ? 12  DT  C "C3'" 1 
ATOM   3299 O  "O3'" . DT  C 3 12  ? 7.177   79.565  38.878  1.00 37.36  ? 12  DT  C "O3'" 1 
ATOM   3300 C  "C2'" . DT  C 3 12  ? 7.660   78.250  40.859  1.00 33.05  ? 12  DT  C "C2'" 1 
ATOM   3301 C  "C1'" . DT  C 3 12  ? 8.760   79.112  41.469  1.00 32.10  ? 12  DT  C "C1'" 1 
ATOM   3302 N  N1    . DT  C 3 12  ? 9.363   78.625  42.735  1.00 30.70  ? 12  DT  C N1    1 
ATOM   3303 C  C2    . DT  C 3 12  ? 10.732  78.725  42.879  1.00 31.25  ? 12  DT  C C2    1 
ATOM   3304 O  O2    . DT  C 3 12  ? 11.468  79.133  41.998  1.00 33.06  ? 12  DT  C O2    1 
ATOM   3305 N  N3    . DT  C 3 12  ? 11.212  78.300  44.091  1.00 31.02  ? 12  DT  C N3    1 
ATOM   3306 C  C4    . DT  C 3 12  ? 10.480  77.811  45.152  1.00 29.98  ? 12  DT  C C4    1 
ATOM   3307 O  O4    . DT  C 3 12  ? 11.054  77.465  46.176  1.00 34.09  ? 12  DT  C O4    1 
ATOM   3308 C  C5    . DT  C 3 12  ? 9.053   77.733  44.934  1.00 29.35  ? 12  DT  C C5    1 
ATOM   3309 C  C7    . DT  C 3 12  ? 8.178   77.212  46.030  1.00 29.95  ? 12  DT  C C7    1 
ATOM   3310 C  C6    . DT  C 3 12  ? 8.572   78.151  43.756  1.00 28.79  ? 12  DT  C C6    1 
ATOM   3311 P  P     . DC  C 3 13  ? 6.690   78.703  37.646  1.00 39.14  ? 13  DC  C P     1 
ATOM   3312 O  OP1   . DC  C 3 13  ? 6.413   79.647  36.547  1.00 40.98  ? 13  DC  C OP1   1 
ATOM   3313 O  OP2   . DC  C 3 13  ? 5.637   77.770  38.098  1.00 39.87  ? 13  DC  C OP2   1 
ATOM   3314 O  "O5'" . DC  C 3 13  ? 7.978   77.817  37.343  1.00 39.09  ? 13  DC  C "O5'" 1 
ATOM   3315 C  "C5'" . DC  C 3 13  ? 9.215   78.414  36.923  1.00 38.53  ? 13  DC  C "C5'" 1 
ATOM   3316 C  "C4'" . DC  C 3 13  ? 10.332  77.397  37.013  1.00 39.31  ? 13  DC  C "C4'" 1 
ATOM   3317 O  "O4'" . DC  C 3 13  ? 10.671  77.178  38.405  1.00 37.82  ? 13  DC  C "O4'" 1 
ATOM   3318 C  "C3'" . DC  C 3 13  ? 10.001  76.015  36.435  1.00 40.14  ? 13  DC  C "C3'" 1 
ATOM   3319 O  "O3'" . DC  C 3 13  ? 11.066  75.494  35.636  1.00 40.26  ? 13  DC  C "O3'" 1 
ATOM   3320 C  "C2'" . DC  C 3 13  ? 9.828   75.143  37.664  1.00 39.16  ? 13  DC  C "C2'" 1 
ATOM   3321 C  "C1'" . DC  C 3 13  ? 10.815  75.786  38.616  1.00 38.48  ? 13  DC  C "C1'" 1 
ATOM   3322 N  N1    . DC  C 3 13  ? 10.618  75.512  40.051  1.00 37.16  ? 13  DC  C N1    1 
ATOM   3323 C  C2    . DC  C 3 13  ? 11.735  75.509  40.895  1.00 36.49  ? 13  DC  C C2    1 
ATOM   3324 O  O2    . DC  C 3 13  ? 12.853  75.750  40.414  1.00 37.03  ? 13  DC  C O2    1 
ATOM   3325 N  N3    . DC  C 3 13  ? 11.568  75.245  42.211  1.00 34.55  ? 13  DC  C N3    1 
ATOM   3326 C  C4    . DC  C 3 13  ? 10.348  74.993  42.691  1.00 34.46  ? 13  DC  C C4    1 
ATOM   3327 N  N4    . DC  C 3 13  ? 10.229  74.742  43.995  1.00 34.12  ? 13  DC  C N4    1 
ATOM   3328 C  C5    . DC  C 3 13  ? 9.196   74.982  41.854  1.00 35.30  ? 13  DC  C C5    1 
ATOM   3329 C  C6    . DC  C 3 13  ? 9.375   75.238  40.552  1.00 36.37  ? 13  DC  C C6    1 
ATOM   3330 N  N     . MET D 1 1   ? 17.275  81.547  -27.480 1.00 42.21  ? 1   MET D N     1 
ATOM   3331 C  CA    . MET D 1 1   ? 17.479  80.137  -27.043 1.00 40.74  ? 1   MET D CA    1 
ATOM   3332 C  C     . MET D 1 1   ? 16.129  79.435  -26.995 1.00 36.76  ? 1   MET D C     1 
ATOM   3333 O  O     . MET D 1 1   ? 15.164  80.014  -26.529 1.00 35.99  ? 1   MET D O     1 
ATOM   3334 C  CB    . MET D 1 1   ? 18.152  80.111  -25.681 1.00 44.74  ? 1   MET D CB    1 
ATOM   3335 C  CG    . MET D 1 1   ? 18.301  78.727  -25.064 1.00 49.92  ? 1   MET D CG    1 
ATOM   3336 S  SD    . MET D 1 1   ? 18.872  78.793  -23.341 1.00 57.75  ? 1   MET D SD    1 
ATOM   3337 C  CE    . MET D 1 1   ? 20.027  77.441  -23.360 1.00 54.69  ? 1   MET D CE    1 
ATOM   3338 N  N     . ILE D 1 2   ? 16.066  78.204  -27.496 1.00 33.94  ? 2   ILE D N     1 
ATOM   3339 C  CA    . ILE D 1 2   ? 14.831  77.413  -27.487 1.00 32.79  ? 2   ILE D CA    1 
ATOM   3340 C  C     . ILE D 1 2   ? 15.108  76.076  -26.810 1.00 29.98  ? 2   ILE D C     1 
ATOM   3341 O  O     . ILE D 1 2   ? 16.021  75.323  -27.207 1.00 28.73  ? 2   ILE D O     1 
ATOM   3342 C  CB    . ILE D 1 2   ? 14.257  77.175  -28.896 1.00 34.57  ? 2   ILE D CB    1 
ATOM   3343 C  CG1   . ILE D 1 2   ? 13.992  78.507  -29.604 1.00 36.30  ? 2   ILE D CG1   1 
ATOM   3344 C  CG2   . ILE D 1 2   ? 12.957  76.388  -28.814 1.00 34.63  ? 2   ILE D CG2   1 
ATOM   3345 C  CD1   . ILE D 1 2   ? 13.731  78.360  -31.090 1.00 37.85  ? 2   ILE D CD1   1 
ATOM   3346 N  N     . VAL D 1 3   ? 14.322  75.814  -25.769 1.00 27.81  ? 3   VAL D N     1 
ATOM   3347 C  CA    . VAL D 1 3   ? 14.486  74.634  -24.923 1.00 26.77  ? 3   VAL D CA    1 
ATOM   3348 C  C     . VAL D 1 3   ? 13.249  73.764  -25.029 1.00 25.97  ? 3   VAL D C     1 
ATOM   3349 O  O     . VAL D 1 3   ? 12.117  74.268  -24.911 1.00 25.61  ? 3   VAL D O     1 
ATOM   3350 C  CB    . VAL D 1 3   ? 14.730  75.035  -23.466 1.00 25.91  ? 3   VAL D CB    1 
ATOM   3351 C  CG1   . VAL D 1 3   ? 14.957  73.805  -22.592 1.00 25.75  ? 3   VAL D CG1   1 
ATOM   3352 C  CG2   . VAL D 1 3   ? 15.918  75.980  -23.382 1.00 25.89  ? 3   VAL D CG2   1 
ATOM   3353 N  N     . LEU D 1 4   ? 13.464  72.480  -25.306 1.00 25.66  ? 4   LEU D N     1 
ATOM   3354 C  CA    . LEU D 1 4   ? 12.377  71.493  -25.350 1.00 25.10  ? 4   LEU D CA    1 
ATOM   3355 C  C     . LEU D 1 4   ? 12.597  70.455  -24.255 1.00 25.48  ? 4   LEU D C     1 
ATOM   3356 O  O     . LEU D 1 4   ? 13.620  69.740  -24.260 1.00 25.60  ? 4   LEU D O     1 
ATOM   3357 C  CB    . LEU D 1 4   ? 12.328  70.805  -26.715 1.00 26.05  ? 4   LEU D CB    1 
ATOM   3358 C  CG    . LEU D 1 4   ? 11.109  69.916  -27.029 1.00 26.07  ? 4   LEU D CG    1 
ATOM   3359 C  CD1   . LEU D 1 4   ? 10.916  69.820  -28.527 1.00 27.26  ? 4   LEU D CD1   1 
ATOM   3360 C  CD2   . LEU D 1 4   ? 11.243  68.529  -26.441 1.00 25.22  ? 4   LEU D CD2   1 
ATOM   3361 N  N     . PHE D 1 5   ? 11.626  70.369  -23.340 1.00 25.12  ? 5   PHE D N     1 
ATOM   3362 C  CA    . PHE D 1 5   ? 11.686  69.518  -22.138 1.00 24.40  ? 5   PHE D CA    1 
ATOM   3363 C  C     . PHE D 1 5   ? 10.742  68.324  -22.314 1.00 24.55  ? 5   PHE D C     1 
ATOM   3364 O  O     . PHE D 1 5   ? 9.610   68.480  -22.813 1.00 23.81  ? 5   PHE D O     1 
ATOM   3365 C  CB    . PHE D 1 5   ? 11.301  70.346  -20.896 1.00 24.83  ? 5   PHE D CB    1 
ATOM   3366 C  CG    . PHE D 1 5   ? 11.156  69.536  -19.617 1.00 24.63  ? 5   PHE D CG    1 
ATOM   3367 C  CD1   . PHE D 1 5   ? 12.261  68.996  -18.980 1.00 24.86  ? 5   PHE D CD1   1 
ATOM   3368 C  CD2   . PHE D 1 5   ? 9.919   69.343  -19.055 1.00 24.74  ? 5   PHE D CD2   1 
ATOM   3369 C  CE1   . PHE D 1 5   ? 12.127  68.277  -17.794 1.00 24.81  ? 5   PHE D CE1   1 
ATOM   3370 C  CE2   . PHE D 1 5   ? 9.762   68.595  -17.888 1.00 25.15  ? 5   PHE D CE2   1 
ATOM   3371 C  CZ    . PHE D 1 5   ? 10.873  68.083  -17.247 1.00 24.57  ? 5   PHE D CZ    1 
ATOM   3372 N  N     . VAL D 1 6   ? 11.214  67.136  -21.938 1.00 23.31  ? 6   VAL D N     1 
ATOM   3373 C  CA    . VAL D 1 6   ? 10.393  65.934  -22.013 1.00 22.89  ? 6   VAL D CA    1 
ATOM   3374 C  C     . VAL D 1 6   ? 10.291  65.294  -20.632 1.00 22.63  ? 6   VAL D C     1 
ATOM   3375 O  O     . VAL D 1 6   ? 11.291  65.095  -19.967 1.00 24.09  ? 6   VAL D O     1 
ATOM   3376 C  CB    . VAL D 1 6   ? 10.968  64.911  -22.998 1.00 22.46  ? 6   VAL D CB    1 
ATOM   3377 C  CG1   . VAL D 1 6   ? 10.058  63.676  -23.069 1.00 22.78  ? 6   VAL D CG1   1 
ATOM   3378 C  CG2   . VAL D 1 6   ? 11.161  65.542  -24.372 1.00 22.82  ? 6   VAL D CG2   1 
ATOM   3379 N  N     . ASP D 1 7   ? 9.071   64.976  -20.224 1.00 24.17  ? 7   ASP D N     1 
ATOM   3380 C  CA    . ASP D 1 7   ? 8.763   64.354  -18.940 1.00 24.28  ? 7   ASP D CA    1 
ATOM   3381 C  C     . ASP D 1 7   ? 7.821   63.176  -19.203 1.00 24.53  ? 7   ASP D C     1 
ATOM   3382 O  O     . ASP D 1 7   ? 6.752   63.379  -19.764 1.00 24.66  ? 7   ASP D O     1 
ATOM   3383 C  CB    . ASP D 1 7   ? 8.050   65.367  -18.071 1.00 25.84  ? 7   ASP D CB    1 
ATOM   3384 C  CG    . ASP D 1 7   ? 7.866   64.900  -16.649 1.00 28.05  ? 7   ASP D CG    1 
ATOM   3385 O  OD1   . ASP D 1 7   ? 7.882   63.672  -16.356 1.00 28.21  ? 7   ASP D OD1   1 
ATOM   3386 O  OD2   . ASP D 1 7   ? 7.716   65.799  -15.807 1.00 30.63  ? 7   ASP D OD2   1 
ATOM   3387 N  N     . PHE D 1 8   ? 8.209   61.968  -18.797 1.00 23.57  ? 8   PHE D N     1 
ATOM   3388 C  CA    . PHE D 1 8   ? 7.459   60.787  -19.163 1.00 25.05  ? 8   PHE D CA    1 
ATOM   3389 C  C     . PHE D 1 8   ? 6.222   60.698  -18.261 1.00 25.28  ? 8   PHE D C     1 
ATOM   3390 O  O     . PHE D 1 8   ? 6.317   60.928  -17.063 1.00 26.21  ? 8   PHE D O     1 
ATOM   3391 C  CB    . PHE D 1 8   ? 8.307   59.509  -19.034 1.00 25.87  ? 8   PHE D CB    1 
ATOM   3392 C  CG    . PHE D 1 8   ? 9.660   59.563  -19.723 1.00 25.97  ? 8   PHE D CG    1 
ATOM   3393 C  CD1   . PHE D 1 8   ? 9.929   60.445  -20.753 1.00 26.19  ? 8   PHE D CD1   1 
ATOM   3394 C  CD2   . PHE D 1 8   ? 10.665  58.689  -19.332 1.00 26.69  ? 8   PHE D CD2   1 
ATOM   3395 C  CE1   . PHE D 1 8   ? 11.175  60.456  -21.369 1.00 27.48  ? 8   PHE D CE1   1 
ATOM   3396 C  CE2   . PHE D 1 8   ? 11.909  58.692  -19.951 1.00 26.38  ? 8   PHE D CE2   1 
ATOM   3397 C  CZ    . PHE D 1 8   ? 12.167  59.579  -20.962 1.00 27.02  ? 8   PHE D CZ    1 
ATOM   3398 N  N     . ASP D 1 9   ? 5.067   60.381  -18.833 1.00 25.54  ? 9   ASP D N     1 
ATOM   3399 C  CA    . ASP D 1 9   ? 3.804   60.387  -18.072 1.00 25.21  ? 9   ASP D CA    1 
ATOM   3400 C  C     . ASP D 1 9   ? 3.711   59.192  -17.124 1.00 25.39  ? 9   ASP D C     1 
ATOM   3401 O  O     . ASP D 1 9   ? 4.026   58.072  -17.529 1.00 25.33  ? 9   ASP D O     1 
ATOM   3402 C  CB    . ASP D 1 9   ? 2.622   60.297  -19.017 1.00 26.00  ? 9   ASP D CB    1 
ATOM   3403 C  CG    . ASP D 1 9   ? 2.513   61.477  -19.964 1.00 25.88  ? 9   ASP D CG    1 
ATOM   3404 O  OD1   . ASP D 1 9   ? 2.812   62.639  -19.606 1.00 24.78  ? 9   ASP D OD1   1 
ATOM   3405 O  OD2   . ASP D 1 9   ? 2.055   61.225  -21.073 1.00 27.06  ? 9   ASP D OD2   1 
ATOM   3406 N  N     . TYR D 1 10  ? 3.283   59.446  -15.881 1.00 24.69  ? 10  TYR D N     1 
ATOM   3407 C  CA    . TYR D 1 10  ? 3.108   58.424  -14.831 1.00 24.97  ? 10  TYR D CA    1 
ATOM   3408 C  C     . TYR D 1 10  ? 4.027   57.244  -15.015 1.00 24.68  ? 10  TYR D C     1 
ATOM   3409 O  O     . TYR D 1 10  ? 3.590   56.098  -15.096 1.00 24.15  ? 10  TYR D O     1 
ATOM   3410 C  CB    . TYR D 1 10  ? 1.643   57.986  -14.691 1.00 25.60  ? 10  TYR D CB    1 
ATOM   3411 C  CG    . TYR D 1 10  ? 1.005   57.307  -15.887 1.00 26.13  ? 10  TYR D CG    1 
ATOM   3412 C  CD1   . TYR D 1 10  ? 0.542   58.052  -16.972 1.00 26.83  ? 10  TYR D CD1   1 
ATOM   3413 C  CD2   . TYR D 1 10  ? 0.788   55.928  -15.904 1.00 26.51  ? 10  TYR D CD2   1 
ATOM   3414 C  CE1   . TYR D 1 10  ? -0.071  57.438  -18.070 1.00 26.09  ? 10  TYR D CE1   1 
ATOM   3415 C  CE2   . TYR D 1 10  ? 0.180   55.308  -16.993 1.00 26.39  ? 10  TYR D CE2   1 
ATOM   3416 C  CZ    . TYR D 1 10  ? -0.242  56.071  -18.067 1.00 26.91  ? 10  TYR D CZ    1 
ATOM   3417 O  OH    . TYR D 1 10  ? -0.846  55.452  -19.138 1.00 28.27  ? 10  TYR D OH    1 
ATOM   3418 N  N     . PHE D 1 11  ? 5.322   57.548  -15.040 1.00 25.10  ? 11  PHE D N     1 
ATOM   3419 C  CA    . PHE D 1 11  ? 6.289   56.680  -15.692 1.00 24.81  ? 11  PHE D CA    1 
ATOM   3420 C  C     . PHE D 1 11  ? 6.292   55.212  -15.225 1.00 24.73  ? 11  PHE D C     1 
ATOM   3421 O  O     . PHE D 1 11  ? 6.072   54.322  -16.031 1.00 23.03  ? 11  PHE D O     1 
ATOM   3422 C  CB    . PHE D 1 11  ? 7.705   57.269  -15.636 1.00 24.76  ? 11  PHE D CB    1 
ATOM   3423 C  CG    . PHE D 1 11  ? 8.708   56.473  -16.428 1.00 25.05  ? 11  PHE D CG    1 
ATOM   3424 C  CD1   . PHE D 1 11  ? 8.417   56.054  -17.696 1.00 25.54  ? 11  PHE D CD1   1 
ATOM   3425 C  CD2   . PHE D 1 11  ? 9.935   56.131  -15.884 1.00 26.40  ? 11  PHE D CD2   1 
ATOM   3426 C  CE1   . PHE D 1 11  ? 9.327   55.290  -18.427 1.00 27.42  ? 11  PHE D CE1   1 
ATOM   3427 C  CE2   . PHE D 1 11  ? 10.857  55.385  -16.607 1.00 27.02  ? 11  PHE D CE2   1 
ATOM   3428 C  CZ    . PHE D 1 11  ? 10.550  54.961  -17.884 1.00 26.85  ? 11  PHE D CZ    1 
ATOM   3429 N  N     . TYR D 1 12  ? 6.539   54.945  -13.950 1.00 26.58  ? 12  TYR D N     1 
ATOM   3430 C  CA    . TYR D 1 12  ? 6.684   53.541  -13.546 1.00 26.51  ? 12  TYR D CA    1 
ATOM   3431 C  C     . TYR D 1 12  ? 5.403   52.772  -13.837 1.00 26.49  ? 12  TYR D C     1 
ATOM   3432 O  O     . TYR D 1 12  ? 5.455   51.643  -14.298 1.00 25.63  ? 12  TYR D O     1 
ATOM   3433 C  CB    . TYR D 1 12  ? 7.082   53.379  -12.077 1.00 27.60  ? 12  TYR D CB    1 
ATOM   3434 C  CG    . TYR D 1 12  ? 8.418   53.996  -11.649 1.00 27.34  ? 12  TYR D CG    1 
ATOM   3435 C  CD1   . TYR D 1 12  ? 9.309   54.565  -12.572 1.00 28.12  ? 12  TYR D CD1   1 
ATOM   3436 C  CD2   . TYR D 1 12  ? 8.794   53.976  -10.308 1.00 27.05  ? 12  TYR D CD2   1 
ATOM   3437 C  CE1   . TYR D 1 12  ? 10.519  55.128  -12.156 1.00 28.58  ? 12  TYR D CE1   1 
ATOM   3438 C  CE2   . TYR D 1 12  ? 9.998   54.509  -9.883  1.00 28.64  ? 12  TYR D CE2   1 
ATOM   3439 C  CZ    . TYR D 1 12  ? 10.867  55.092  -10.805 1.00 29.37  ? 12  TYR D CZ    1 
ATOM   3440 O  OH    . TYR D 1 12  ? 12.053  55.644  -10.355 1.00 29.02  ? 12  TYR D OH    1 
ATOM   3441 N  N     . ALA D 1 13  ? 4.251   53.385  -13.576 1.00 26.18  ? 13  ALA D N     1 
ATOM   3442 C  CA    . ALA D 1 13  ? 2.966   52.696  -13.772 1.00 25.91  ? 13  ALA D CA    1 
ATOM   3443 C  C     . ALA D 1 13  ? 2.741   52.481  -15.244 1.00 26.10  ? 13  ALA D C     1 
ATOM   3444 O  O     . ALA D 1 13  ? 2.286   51.426  -15.660 1.00 26.14  ? 13  ALA D O     1 
ATOM   3445 C  CB    . ALA D 1 13  ? 1.809   53.488  -13.170 1.00 25.67  ? 13  ALA D CB    1 
ATOM   3446 N  N     . GLN D 1 14  ? 3.078   53.475  -16.051 1.00 26.72  ? 14  GLN D N     1 
ATOM   3447 C  CA    . GLN D 1 14  ? 2.896   53.327  -17.473 1.00 27.11  ? 14  GLN D CA    1 
ATOM   3448 C  C     . GLN D 1 14  ? 3.764   52.201  -18.057 1.00 26.84  ? 14  GLN D C     1 
ATOM   3449 O  O     . GLN D 1 14  ? 3.331   51.495  -18.944 1.00 25.81  ? 14  GLN D O     1 
ATOM   3450 C  CB    . GLN D 1 14  ? 3.169   54.621  -18.215 1.00 27.55  ? 14  GLN D CB    1 
ATOM   3451 C  CG    . GLN D 1 14  ? 2.533   54.591  -19.604 1.00 27.95  ? 14  GLN D CG    1 
ATOM   3452 C  CD    . GLN D 1 14  ? 2.788   55.837  -20.429 1.00 27.95  ? 14  GLN D CD    1 
ATOM   3453 O  OE1   . GLN D 1 14  ? 2.321   55.932  -21.572 1.00 27.21  ? 14  GLN D OE1   1 
ATOM   3454 N  NE2   . GLN D 1 14  ? 3.554   56.784  -19.878 1.00 27.16  ? 14  GLN D NE2   1 
ATOM   3455 N  N     . VAL D 1 15  ? 4.982   52.036  -17.570 1.00 27.40  ? 15  VAL D N     1 
ATOM   3456 C  CA    . VAL D 1 15  ? 5.806   50.929  -18.046 1.00 29.08  ? 15  VAL D CA    1 
ATOM   3457 C  C     . VAL D 1 15  ? 5.121   49.597  -17.689 1.00 30.59  ? 15  VAL D C     1 
ATOM   3458 O  O     . VAL D 1 15  ? 5.081   48.663  -18.482 1.00 30.47  ? 15  VAL D O     1 
ATOM   3459 C  CB    . VAL D 1 15  ? 7.227   50.964  -17.448 1.00 29.25  ? 15  VAL D CB    1 
ATOM   3460 C  CG1   . VAL D 1 15  ? 8.007   49.691  -17.808 1.00 29.87  ? 15  VAL D CG1   1 
ATOM   3461 C  CG2   . VAL D 1 15  ? 7.982   52.200  -17.932 1.00 28.74  ? 15  VAL D CG2   1 
ATOM   3462 N  N     . GLU D 1 16  ? 4.571   49.517  -16.486 1.00 32.11  ? 16  GLU D N     1 
ATOM   3463 C  CA    . GLU D 1 16  ? 3.893   48.280  -16.069 1.00 32.64  ? 16  GLU D CA    1 
ATOM   3464 C  C     . GLU D 1 16  ? 2.698   47.971  -16.986 1.00 33.31  ? 16  GLU D C     1 
ATOM   3465 O  O     . GLU D 1 16  ? 2.411   46.801  -17.264 1.00 35.27  ? 16  GLU D O     1 
ATOM   3466 C  CB    . GLU D 1 16  ? 3.479   48.373  -14.599 1.00 31.57  ? 16  GLU D CB    1 
ATOM   3467 C  CG    . GLU D 1 16  ? 4.650   48.443  -13.623 1.00 32.58  ? 16  GLU D CG    1 
ATOM   3468 C  CD    . GLU D 1 16  ? 5.490   47.168  -13.569 1.00 34.47  ? 16  GLU D CD    1 
ATOM   3469 O  OE1   . GLU D 1 16  ? 5.129   46.202  -14.258 1.00 37.52  ? 16  GLU D OE1   1 
ATOM   3470 O  OE2   . GLU D 1 16  ? 6.511   47.120  -12.837 1.00 32.75  ? 16  GLU D OE2   1 
ATOM   3471 N  N     . GLU D 1 17  ? 2.020   49.013  -17.465 1.00 34.08  ? 17  GLU D N     1 
ATOM   3472 C  CA    . GLU D 1 17  ? 0.927   48.852  -18.420 1.00 36.56  ? 17  GLU D CA    1 
ATOM   3473 C  C     . GLU D 1 17  ? 1.410   48.377  -19.793 1.00 36.72  ? 17  GLU D C     1 
ATOM   3474 O  O     . GLU D 1 17  ? 0.742   47.580  -20.453 1.00 36.22  ? 17  GLU D O     1 
ATOM   3475 C  CB    . GLU D 1 17  ? 0.138   50.157  -18.585 1.00 38.51  ? 17  GLU D CB    1 
ATOM   3476 C  CG    . GLU D 1 17  ? -0.609  50.608  -17.337 1.00 40.90  ? 17  GLU D CG    1 
ATOM   3477 C  CD    . GLU D 1 17  ? -1.399  51.898  -17.532 1.00 43.79  ? 17  GLU D CD    1 
ATOM   3478 O  OE1   . GLU D 1 17  ? -1.575  52.338  -18.690 1.00 44.64  ? 17  GLU D OE1   1 
ATOM   3479 O  OE2   . GLU D 1 17  ? -1.850  52.483  -16.518 1.00 46.84  ? 17  GLU D OE2   1 
ATOM   3480 N  N     . VAL D 1 18  ? 2.549   48.894  -20.241 1.00 36.56  ? 18  VAL D N     1 
ATOM   3481 C  CA    . VAL D 1 18  ? 3.141   48.453  -21.501 1.00 37.33  ? 18  VAL D CA    1 
ATOM   3482 C  C     . VAL D 1 18  ? 3.451   46.957  -21.432 1.00 38.07  ? 18  VAL D C     1 
ATOM   3483 O  O     . VAL D 1 18  ? 3.132   46.200  -22.355 1.00 39.23  ? 18  VAL D O     1 
ATOM   3484 C  CB    . VAL D 1 18  ? 4.436   49.243  -21.825 1.00 37.67  ? 18  VAL D CB    1 
ATOM   3485 C  CG1   . VAL D 1 18  ? 5.207   48.597  -22.977 1.00 38.16  ? 18  VAL D CG1   1 
ATOM   3486 C  CG2   . VAL D 1 18  ? 4.108   50.697  -22.149 1.00 36.68  ? 18  VAL D CG2   1 
ATOM   3487 N  N     . LEU D 1 19  ? 4.065   46.551  -20.327 1.00 37.93  ? 19  LEU D N     1 
ATOM   3488 C  CA    . LEU D 1 19  ? 4.458   45.158  -20.090 1.00 38.70  ? 19  LEU D CA    1 
ATOM   3489 C  C     . LEU D 1 19  ? 3.260   44.242  -19.838 1.00 40.33  ? 19  LEU D C     1 
ATOM   3490 O  O     . LEU D 1 19  ? 3.351   43.040  -20.080 1.00 45.67  ? 19  LEU D O     1 
ATOM   3491 C  CB    . LEU D 1 19  ? 5.448   45.082  -18.917 1.00 37.94  ? 19  LEU D CB    1 
ATOM   3492 C  CG    . LEU D 1 19  ? 6.803   45.788  -19.153 1.00 37.92  ? 19  LEU D CG    1 
ATOM   3493 C  CD1   . LEU D 1 19  ? 7.603   45.888  -17.868 1.00 37.56  ? 19  LEU D CD1   1 
ATOM   3494 C  CD2   . LEU D 1 19  ? 7.636   45.097  -20.220 1.00 38.12  ? 19  LEU D CD2   1 
ATOM   3495 N  N     . ASN D 1 20  ? 2.143   44.808  -19.377 1.00 39.39  ? 20  ASN D N     1 
ATOM   3496 C  CA    . ASN D 1 20  ? 0.915   44.055  -19.114 1.00 37.84  ? 20  ASN D CA    1 
ATOM   3497 C  C     . ASN D 1 20  ? -0.312  44.847  -19.520 1.00 38.05  ? 20  ASN D C     1 
ATOM   3498 O  O     . ASN D 1 20  ? -0.985  45.436  -18.667 1.00 36.24  ? 20  ASN D O     1 
ATOM   3499 C  CB    . ASN D 1 20  ? 0.812   43.694  -17.636 1.00 38.03  ? 20  ASN D CB    1 
ATOM   3500 C  CG    . ASN D 1 20  ? -0.378  42.817  -17.336 1.00 39.28  ? 20  ASN D CG    1 
ATOM   3501 O  OD1   . ASN D 1 20  ? -1.175  42.491  -18.222 1.00 39.03  ? 20  ASN D OD1   1 
ATOM   3502 N  ND2   . ASN D 1 20  ? -0.512  42.430  -16.081 1.00 40.46  ? 20  ASN D ND2   1 
ATOM   3503 N  N     . PRO D 1 21  ? -0.618  44.860  -20.831 1.00 38.59  ? 21  PRO D N     1 
ATOM   3504 C  CA    . PRO D 1 21  ? -1.660  45.732  -21.336 1.00 38.56  ? 21  PRO D CA    1 
ATOM   3505 C  C     . PRO D 1 21  ? -3.081  45.475  -20.808 1.00 39.38  ? 21  PRO D C     1 
ATOM   3506 O  O     . PRO D 1 21  ? -3.909  46.366  -20.900 1.00 38.36  ? 21  PRO D O     1 
ATOM   3507 C  CB    . PRO D 1 21  ? -1.568  45.560  -22.861 1.00 40.30  ? 21  PRO D CB    1 
ATOM   3508 C  CG    . PRO D 1 21  ? -0.751  44.337  -23.092 1.00 40.09  ? 21  PRO D CG    1 
ATOM   3509 C  CD    . PRO D 1 21  ? 0.132   44.191  -21.908 1.00 39.27  ? 21  PRO D CD    1 
ATOM   3510 N  N     . SER D 1 22  ? -3.366  44.309  -20.228 1.00 40.76  ? 22  SER D N     1 
ATOM   3511 C  CA    . SER D 1 22  ? -4.684  44.087  -19.610 1.00 39.80  ? 22  SER D CA    1 
ATOM   3512 C  C     . SER D 1 22  ? -4.943  45.020  -18.414 1.00 40.29  ? 22  SER D C     1 
ATOM   3513 O  O     . SER D 1 22  ? -6.088  45.130  -17.946 1.00 37.64  ? 22  SER D O     1 
ATOM   3514 C  CB    . SER D 1 22  ? -4.843  42.637  -19.153 1.00 39.52  ? 22  SER D CB    1 
ATOM   3515 O  OG    . SER D 1 22  ? -4.086  42.388  -17.987 1.00 39.95  ? 22  SER D OG    1 
ATOM   3516 N  N     . LEU D 1 23  ? -3.891  45.673  -17.915 1.00 40.06  ? 23  LEU D N     1 
ATOM   3517 C  CA    . LEU D 1 23  ? -4.035  46.638  -16.820 1.00 41.16  ? 23  LEU D CA    1 
ATOM   3518 C  C     . LEU D 1 23  ? -4.685  47.937  -17.240 1.00 42.59  ? 23  LEU D C     1 
ATOM   3519 O  O     . LEU D 1 23  ? -5.209  48.652  -16.392 1.00 45.04  ? 23  LEU D O     1 
ATOM   3520 C  CB    . LEU D 1 23  ? -2.682  46.968  -16.180 1.00 39.95  ? 23  LEU D CB    1 
ATOM   3521 C  CG    . LEU D 1 23  ? -1.932  45.826  -15.505 1.00 39.07  ? 23  LEU D CG    1 
ATOM   3522 C  CD1   . LEU D 1 23  ? -0.532  46.283  -15.130 1.00 39.56  ? 23  LEU D CD1   1 
ATOM   3523 C  CD2   . LEU D 1 23  ? -2.679  45.351  -14.267 1.00 40.16  ? 23  LEU D CD2   1 
ATOM   3524 N  N     . LYS D 1 24  ? -4.650  48.270  -18.523 1.00 44.56  ? 24  LYS D N     1 
ATOM   3525 C  CA    . LYS D 1 24  ? -5.201  49.551  -18.947 1.00 47.00  ? 24  LYS D CA    1 
ATOM   3526 C  C     . LYS D 1 24  ? -6.680  49.636  -18.581 1.00 45.75  ? 24  LYS D C     1 
ATOM   3527 O  O     . LYS D 1 24  ? -7.416  48.669  -18.730 1.00 47.27  ? 24  LYS D O     1 
ATOM   3528 C  CB    . LYS D 1 24  ? -4.978  49.810  -20.440 1.00 52.68  ? 24  LYS D CB    1 
ATOM   3529 C  CG    . LYS D 1 24  ? -3.723  50.648  -20.715 1.00 57.58  ? 24  LYS D CG    1 
ATOM   3530 C  CD    . LYS D 1 24  ? -3.638  51.134  -22.161 1.00 60.14  ? 24  LYS D CD    1 
ATOM   3531 C  CE    . LYS D 1 24  ? -3.522  49.980  -23.153 1.00 63.77  ? 24  LYS D CE    1 
ATOM   3532 N  NZ    . LYS D 1 24  ? -2.458  48.995  -22.796 1.00 64.60  ? 24  LYS D NZ    1 
ATOM   3533 N  N     . GLY D 1 25  ? -7.088  50.792  -18.063 1.00 44.00  ? 25  GLY D N     1 
ATOM   3534 C  CA    . GLY D 1 25  ? -8.431  50.994  -17.533 1.00 41.23  ? 25  GLY D CA    1 
ATOM   3535 C  C     . GLY D 1 25  ? -8.476  50.850  -16.028 1.00 40.75  ? 25  GLY D C     1 
ATOM   3536 O  O     . GLY D 1 25  ? -9.367  51.395  -15.377 1.00 42.24  ? 25  GLY D O     1 
ATOM   3537 N  N     . LYS D 1 26  ? -7.530  50.114  -15.458 1.00 39.14  ? 26  LYS D N     1 
ATOM   3538 C  CA    . LYS D 1 26  ? -7.531  49.890  -14.017 1.00 39.19  ? 26  LYS D CA    1 
ATOM   3539 C  C     . LYS D 1 26  ? -6.699  50.922  -13.264 1.00 36.52  ? 26  LYS D C     1 
ATOM   3540 O  O     . LYS D 1 26  ? -5.736  51.441  -13.778 1.00 34.87  ? 26  LYS D O     1 
ATOM   3541 C  CB    . LYS D 1 26  ? -6.981  48.508  -13.709 1.00 41.34  ? 26  LYS D CB    1 
ATOM   3542 C  CG    . LYS D 1 26  ? -7.745  47.391  -14.395 1.00 43.59  ? 26  LYS D CG    1 
ATOM   3543 C  CD    . LYS D 1 26  ? -7.492  46.054  -13.712 1.00 45.12  ? 26  LYS D CD    1 
ATOM   3544 C  CE    . LYS D 1 26  ? -8.306  44.950  -14.362 1.00 45.50  ? 26  LYS D CE    1 
ATOM   3545 N  NZ    . LYS D 1 26  ? -7.793  44.661  -15.724 1.00 45.36  ? 26  LYS D NZ    1 
ATOM   3546 N  N     . PRO D 1 27  ? -7.072  51.219  -12.025 1.00 36.85  ? 27  PRO D N     1 
ATOM   3547 C  CA    . PRO D 1 27  ? -6.083  51.932  -11.204 1.00 35.04  ? 27  PRO D CA    1 
ATOM   3548 C  C     . PRO D 1 27  ? -4.858  51.050  -10.928 1.00 33.28  ? 27  PRO D C     1 
ATOM   3549 O  O     . PRO D 1 27  ? -5.005  49.883  -10.515 1.00 33.99  ? 27  PRO D O     1 
ATOM   3550 C  CB    . PRO D 1 27  ? -6.835  52.266  -9.919  1.00 35.27  ? 27  PRO D CB    1 
ATOM   3551 C  CG    . PRO D 1 27  ? -8.133  51.502  -9.962  1.00 37.11  ? 27  PRO D CG    1 
ATOM   3552 C  CD    . PRO D 1 27  ? -8.366  51.012  -11.354 1.00 36.73  ? 27  PRO D CD    1 
ATOM   3553 N  N     . VAL D 1 28  ? -3.675  51.613  -11.170 1.00 30.59  ? 28  VAL D N     1 
ATOM   3554 C  CA    . VAL D 1 28  ? -2.380  50.928  -11.016 1.00 29.47  ? 28  VAL D CA    1 
ATOM   3555 C  C     . VAL D 1 28  ? -1.492  51.771  -10.111 1.00 29.61  ? 28  VAL D C     1 
ATOM   3556 O  O     . VAL D 1 28  ? -1.267  52.962  -10.366 1.00 28.03  ? 28  VAL D O     1 
ATOM   3557 C  CB    . VAL D 1 28  ? -1.645  50.769  -12.364 1.00 28.89  ? 28  VAL D CB    1 
ATOM   3558 C  CG1   . VAL D 1 28  ? -0.245  50.171  -12.168 1.00 28.42  ? 28  VAL D CG1   1 
ATOM   3559 C  CG2   . VAL D 1 28  ? -2.454  49.927  -13.338 1.00 28.66  ? 28  VAL D CG2   1 
ATOM   3560 N  N     . VAL D 1 29  ? -1.007  51.159  -9.040  1.00 29.61  ? 29  VAL D N     1 
ATOM   3561 C  CA    . VAL D 1 29  ? -0.195  51.856  -8.069  1.00 29.03  ? 29  VAL D CA    1 
ATOM   3562 C  C     . VAL D 1 29  ? 1.090   51.060  -7.920  1.00 30.29  ? 29  VAL D C     1 
ATOM   3563 O  O     . VAL D 1 29  ? 1.061   49.901  -7.527  1.00 30.62  ? 29  VAL D O     1 
ATOM   3564 C  CB    . VAL D 1 29  ? -0.874  51.937  -6.692  1.00 29.55  ? 29  VAL D CB    1 
ATOM   3565 C  CG1   . VAL D 1 29  ? -0.091  52.879  -5.778  1.00 30.57  ? 29  VAL D CG1   1 
ATOM   3566 C  CG2   . VAL D 1 29  ? -2.315  52.390  -6.820  1.00 28.99  ? 29  VAL D CG2   1 
ATOM   3567 N  N     . VAL D 1 30  ? 2.208   51.689  -8.247  1.00 29.47  ? 30  VAL D N     1 
ATOM   3568 C  CA    . VAL D 1 30  ? 3.508   51.075  -8.090  1.00 29.91  ? 30  VAL D CA    1 
ATOM   3569 C  C     . VAL D 1 30  ? 4.096   51.496  -6.734  1.00 30.30  ? 30  VAL D C     1 
ATOM   3570 O  O     . VAL D 1 30  ? 4.191   52.687  -6.418  1.00 28.29  ? 30  VAL D O     1 
ATOM   3571 C  CB    . VAL D 1 30  ? 4.432   51.482  -9.237  1.00 30.13  ? 30  VAL D CB    1 
ATOM   3572 C  CG1   . VAL D 1 30  ? 5.835   50.922  -9.038  1.00 30.87  ? 30  VAL D CG1   1 
ATOM   3573 C  CG2   . VAL D 1 30  ? 3.850   51.010  -10.560 1.00 31.28  ? 30  VAL D CG2   1 
ATOM   3574 N  N     . CYS D 1 31  ? 4.514   50.499  -5.971  1.00 31.79  ? 31  CYS D N     1 
ATOM   3575 C  CA    . CYS D 1 31  ? 4.805   50.637  -4.554  1.00 33.60  ? 31  CYS D CA    1 
ATOM   3576 C  C     . CYS D 1 31  ? 6.184   50.137  -4.196  1.00 34.03  ? 31  CYS D C     1 
ATOM   3577 O  O     . CYS D 1 31  ? 6.686   49.192  -4.807  1.00 31.94  ? 31  CYS D O     1 
ATOM   3578 C  CB    . CYS D 1 31  ? 3.821   49.796  -3.764  1.00 34.15  ? 31  CYS D CB    1 
ATOM   3579 S  SG    . CYS D 1 31  ? 2.111   50.318  -3.941  1.00 37.63  ? 31  CYS D SG    1 
ATOM   3580 N  N     . VAL D 1 32  ? 6.772   50.778  -3.190  1.00 35.80  ? 32  VAL D N     1 
ATOM   3581 C  CA    . VAL D 1 32  ? 7.920   50.232  -2.488  1.00 38.34  ? 32  VAL D CA    1 
ATOM   3582 C  C     . VAL D 1 32  ? 7.393   49.539  -1.229  1.00 40.89  ? 32  VAL D C     1 
ATOM   3583 O  O     . VAL D 1 32  ? 7.059   50.200  -0.237  1.00 39.05  ? 32  VAL D O     1 
ATOM   3584 C  CB    . VAL D 1 32  ? 8.959   51.327  -2.152  1.00 38.27  ? 32  VAL D CB    1 
ATOM   3585 C  CG1   . VAL D 1 32  ? 10.165  50.735  -1.461  1.00 38.08  ? 32  VAL D CG1   1 
ATOM   3586 C  CG2   . VAL D 1 32  ? 9.412   52.031  -3.426  1.00 38.10  ? 32  VAL D CG2   1 
ATOM   3587 N  N     . PHE D 1 33  ? 7.299   48.208  -1.291  1.00 45.47  ? 33  PHE D N     1 
ATOM   3588 C  CA    . PHE D 1 33  ? 6.935   47.383  -0.122  1.00 49.44  ? 33  PHE D CA    1 
ATOM   3589 C  C     . PHE D 1 33  ? 8.101   47.276  0.869   1.00 52.43  ? 33  PHE D C     1 
ATOM   3590 O  O     . PHE D 1 33  ? 9.239   47.045  0.472   1.00 50.43  ? 33  PHE D O     1 
ATOM   3591 C  CB    . PHE D 1 33  ? 6.487   45.987  -0.563  1.00 49.52  ? 33  PHE D CB    1 
ATOM   3592 C  CG    . PHE D 1 33  ? 5.203   45.989  -1.350  1.00 51.93  ? 33  PHE D CG    1 
ATOM   3593 C  CD1   . PHE D 1 33  ? 3.978   46.102  -0.705  1.00 52.81  ? 33  PHE D CD1   1 
ATOM   3594 C  CD2   . PHE D 1 33  ? 5.217   45.895  -2.737  1.00 52.16  ? 33  PHE D CD2   1 
ATOM   3595 C  CE1   . PHE D 1 33  ? 2.794   46.120  -1.428  1.00 53.56  ? 33  PHE D CE1   1 
ATOM   3596 C  CE2   . PHE D 1 33  ? 4.034   45.909  -3.463  1.00 52.73  ? 33  PHE D CE2   1 
ATOM   3597 C  CZ    . PHE D 1 33  ? 2.823   46.019  -2.807  1.00 54.00  ? 33  PHE D CZ    1 
ATOM   3598 N  N     . SER D 1 34  ? 7.806   47.442  2.155   1.00 59.58  ? 34  SER D N     1 
ATOM   3599 C  CA    . SER D 1 34  ? 8.832   47.422  3.210   1.00 66.80  ? 34  SER D CA    1 
ATOM   3600 C  C     . SER D 1 34  ? 9.340   46.008  3.494   1.00 70.56  ? 34  SER D C     1 
ATOM   3601 O  O     . SER D 1 34  ? 10.548  45.782  3.614   1.00 68.03  ? 34  SER D O     1 
ATOM   3602 C  CB    . SER D 1 34  ? 8.274   48.006  4.518   1.00 68.43  ? 34  SER D CB    1 
ATOM   3603 O  OG    . SER D 1 34  ? 7.592   49.225  4.290   1.00 70.79  ? 34  SER D OG    1 
ATOM   3604 N  N     . GLY D 1 35  ? 8.401   45.073  3.628   1.00 74.72  ? 35  GLY D N     1 
ATOM   3605 C  CA    . GLY D 1 35  ? 8.705   43.717  4.079   1.00 77.94  ? 35  GLY D CA    1 
ATOM   3606 C  C     . GLY D 1 35  ? 8.701   43.591  5.595   1.00 81.84  ? 35  GLY D C     1 
ATOM   3607 O  O     . GLY D 1 35  ? 8.629   42.478  6.121   1.00 83.11  ? 35  GLY D O     1 
ATOM   3608 N  N     . ARG D 1 36  ? 8.760   44.729  6.294   1.00 83.85  ? 36  ARG D N     1 
ATOM   3609 C  CA    . ARG D 1 36  ? 8.861   44.765  7.757   1.00 87.65  ? 36  ARG D CA    1 
ATOM   3610 C  C     . ARG D 1 36  ? 7.477   44.704  8.397   1.00 88.11  ? 36  ARG D C     1 
ATOM   3611 O  O     . ARG D 1 36  ? 7.123   43.699  9.005   1.00 90.33  ? 36  ARG D O     1 
ATOM   3612 C  CB    . ARG D 1 36  ? 9.616   46.025  8.207   1.00 88.69  ? 36  ARG D CB    1 
ATOM   3613 C  CG    . ARG D 1 36  ? 11.041  46.094  7.674   1.00 89.40  ? 36  ARG D CG    1 
ATOM   3614 C  CD    . ARG D 1 36  ? 11.609  47.506  7.644   1.00 89.24  ? 36  ARG D CD    1 
ATOM   3615 N  NE    . ARG D 1 36  ? 12.445  47.699  6.457   1.00 93.19  ? 36  ARG D NE    1 
ATOM   3616 C  CZ    . ARG D 1 36  ? 13.711  47.297  6.325   1.00 89.78  ? 36  ARG D CZ    1 
ATOM   3617 N  NH1   . ARG D 1 36  ? 14.347  46.675  7.313   1.00 89.11  ? 36  ARG D NH1   1 
ATOM   3618 N  NH2   . ARG D 1 36  ? 14.350  47.528  5.185   1.00 88.12  ? 36  ARG D NH2   1 
ATOM   3619 N  N     . PHE D 1 37  ? 6.698   45.774  8.243   1.00 90.97  ? 37  PHE D N     1 
ATOM   3620 C  CA    . PHE D 1 37  ? 5.301   45.819  8.702   1.00 91.27  ? 37  PHE D CA    1 
ATOM   3621 C  C     . PHE D 1 37  ? 4.484   44.970  7.718   1.00 89.45  ? 37  PHE D C     1 
ATOM   3622 O  O     . PHE D 1 37  ? 4.992   44.577  6.660   1.00 85.23  ? 37  PHE D O     1 
ATOM   3623 C  CB    . PHE D 1 37  ? 4.782   47.274  8.716   1.00 92.67  ? 37  PHE D CB    1 
ATOM   3624 C  CG    . PHE D 1 37  ? 4.122   47.698  10.008  1.00 96.04  ? 37  PHE D CG    1 
ATOM   3625 C  CD1   . PHE D 1 37  ? 4.891   48.096  11.105  1.00 98.18  ? 37  PHE D CD1   1 
ATOM   3626 C  CD2   . PHE D 1 37  ? 2.733   47.747  10.118  1.00 96.56  ? 37  PHE D CD2   1 
ATOM   3627 C  CE1   . PHE D 1 37  ? 4.289   48.504  12.291  1.00 96.48  ? 37  PHE D CE1   1 
ATOM   3628 C  CE2   . PHE D 1 37  ? 2.127   48.153  11.303  1.00 97.24  ? 37  PHE D CE2   1 
ATOM   3629 C  CZ    . PHE D 1 37  ? 2.907   48.532  12.389  1.00 97.08  ? 37  PHE D CZ    1 
ATOM   3630 N  N     . GLU D 1 38  ? 3.226   44.692  8.050   1.00 86.68  ? 38  GLU D N     1 
ATOM   3631 C  CA    . GLU D 1 38  ? 2.374   43.910  7.153   1.00 85.50  ? 38  GLU D CA    1 
ATOM   3632 C  C     . GLU D 1 38  ? 1.995   44.730  5.916   1.00 81.17  ? 38  GLU D C     1 
ATOM   3633 O  O     . GLU D 1 38  ? 1.290   45.738  6.021   1.00 78.40  ? 38  GLU D O     1 
ATOM   3634 C  CB    . GLU D 1 38  ? 1.108   43.398  7.874   1.00 88.74  ? 38  GLU D CB    1 
ATOM   3635 C  CG    . GLU D 1 38  ? -0.006  42.845  6.974   1.00 88.96  ? 38  GLU D CG    1 
ATOM   3636 C  CD    . GLU D 1 38  ? 0.479   41.921  5.853   1.00 90.24  ? 38  GLU D CD    1 
ATOM   3637 O  OE1   . GLU D 1 38  ? 1.604   41.383  5.938   1.00 90.19  ? 38  GLU D OE1   1 
ATOM   3638 O  OE2   . GLU D 1 38  ? -0.271  41.726  4.871   1.00 90.98  ? 38  GLU D OE2   1 
ATOM   3639 N  N     . ASP D 1 39  ? 2.472   44.298  4.749   1.00 75.06  ? 39  ASP D N     1 
ATOM   3640 C  CA    . ASP D 1 39  ? 2.070   44.908  3.487   1.00 72.28  ? 39  ASP D CA    1 
ATOM   3641 C  C     . ASP D 1 39  ? 2.094   46.443  3.590   1.00 69.70  ? 39  ASP D C     1 
ATOM   3642 O  O     . ASP D 1 39  ? 1.144   47.128  3.202   1.00 68.26  ? 39  ASP D O     1 
ATOM   3643 C  CB    . ASP D 1 39  ? 0.673   44.404  3.108   1.00 72.62  ? 39  ASP D CB    1 
ATOM   3644 C  CG    . ASP D 1 39  ? 0.220   44.896  1.749   1.00 69.61  ? 39  ASP D CG    1 
ATOM   3645 O  OD1   . ASP D 1 39  ? 0.938   44.657  0.762   1.00 69.95  ? 39  ASP D OD1   1 
ATOM   3646 O  OD2   . ASP D 1 39  ? -0.854  45.524  1.674   1.00 65.99  ? 39  ASP D OD2   1 
ATOM   3647 N  N     . SER D 1 40  ? 3.178   46.970  4.151   1.00 65.97  ? 40  SER D N     1 
ATOM   3648 C  CA    . SER D 1 40  ? 3.349   48.400  4.290   1.00 63.08  ? 40  SER D CA    1 
ATOM   3649 C  C     . SER D 1 40  ? 4.354   48.875  3.275   1.00 59.68  ? 40  SER D C     1 
ATOM   3650 O  O     . SER D 1 40  ? 5.117   48.092  2.690   1.00 59.06  ? 40  SER D O     1 
ATOM   3651 C  CB    . SER D 1 40  ? 3.853   48.771  5.684   1.00 66.34  ? 40  SER D CB    1 
ATOM   3652 O  OG    . SER D 1 40  ? 5.222   48.411  5.855   1.00 69.91  ? 40  SER D OG    1 
ATOM   3653 N  N     . GLY D 1 41  ? 4.363   50.182  3.095   1.00 52.31  ? 41  GLY D N     1 
ATOM   3654 C  CA    . GLY D 1 41  ? 5.250   50.791  2.160   1.00 47.89  ? 41  GLY D CA    1 
ATOM   3655 C  C     . GLY D 1 41  ? 4.715   52.123  1.729   1.00 43.71  ? 41  GLY D C     1 
ATOM   3656 O  O     . GLY D 1 41  ? 3.768   52.660  2.323   1.00 43.01  ? 41  GLY D O     1 
ATOM   3657 N  N     . ALA D 1 42  ? 5.321   52.651  0.675   1.00 38.51  ? 42  ALA D N     1 
ATOM   3658 C  CA    . ALA D 1 42  ? 4.912   53.922  0.122   1.00 35.54  ? 42  ALA D CA    1 
ATOM   3659 C  C     . ALA D 1 42  ? 4.644   53.745  -1.346  1.00 33.33  ? 42  ALA D C     1 
ATOM   3660 O  O     . ALA D 1 42  ? 5.198   52.842  -1.980  1.00 34.77  ? 42  ALA D O     1 
ATOM   3661 C  CB    . ALA D 1 42  ? 5.997   54.961  0.347   1.00 33.88  ? 42  ALA D CB    1 
ATOM   3662 N  N     . VAL D 1 43  ? 3.808   54.629  -1.886  1.00 31.58  ? 43  VAL D N     1 
ATOM   3663 C  CA    . VAL D 1 43  ? 3.535   54.682  -3.311  1.00 30.86  ? 43  VAL D CA    1 
ATOM   3664 C  C     . VAL D 1 43  ? 4.644   55.481  -3.994  1.00 30.48  ? 43  VAL D C     1 
ATOM   3665 O  O     . VAL D 1 43  ? 5.006   56.570  -3.536  1.00 29.50  ? 43  VAL D O     1 
ATOM   3666 C  CB    . VAL D 1 43  ? 2.186   55.391  -3.583  1.00 30.85  ? 43  VAL D CB    1 
ATOM   3667 C  CG1   . VAL D 1 43  ? 1.923   55.525  -5.086  1.00 29.90  ? 43  VAL D CG1   1 
ATOM   3668 C  CG2   . VAL D 1 43  ? 1.051   54.660  -2.888  1.00 30.33  ? 43  VAL D CG2   1 
ATOM   3669 N  N     . ALA D 1 44  ? 5.175   54.941  -5.086  1.00 30.12  ? 44  ALA D N     1 
ATOM   3670 C  CA    . ALA D 1 44  ? 6.149   55.662  -5.903  1.00 30.23  ? 44  ALA D CA    1 
ATOM   3671 C  C     . ALA D 1 44  ? 5.472   56.444  -7.025  1.00 29.85  ? 44  ALA D C     1 
ATOM   3672 O  O     . ALA D 1 44  ? 5.871   57.560  -7.324  1.00 30.70  ? 44  ALA D O     1 
ATOM   3673 C  CB    . ALA D 1 44  ? 7.180   54.711  -6.466  1.00 31.01  ? 44  ALA D CB    1 
ATOM   3674 N  N     . THR D 1 45  ? 4.494   55.830  -7.672  1.00 29.92  ? 45  THR D N     1 
ATOM   3675 C  CA    . THR D 1 45  ? 3.600   56.541  -8.563  1.00 31.19  ? 45  THR D CA    1 
ATOM   3676 C  C     . THR D 1 45  ? 2.289   55.791  -8.741  1.00 30.52  ? 45  THR D C     1 
ATOM   3677 O  O     . THR D 1 45  ? 2.194   54.595  -8.498  1.00 30.36  ? 45  THR D O     1 
ATOM   3678 C  CB    . THR D 1 45  ? 4.213   56.771  -9.954  1.00 32.48  ? 45  THR D CB    1 
ATOM   3679 O  OG1   . THR D 1 45  ? 3.370   57.660  -10.697 1.00 35.94  ? 45  THR D OG1   1 
ATOM   3680 C  CG2   . THR D 1 45  ? 4.326   55.495  -10.716 1.00 32.66  ? 45  THR D CG2   1 
ATOM   3681 N  N     . ALA D 1 46  ? 1.280   56.513  -9.185  1.00 29.66  ? 46  ALA D N     1 
ATOM   3682 C  CA    . ALA D 1 46  ? 0.012   55.908  -9.550  1.00 28.75  ? 46  ALA D CA    1 
ATOM   3683 C  C     . ALA D 1 46  ? -0.392  56.444  -10.913 1.00 28.02  ? 46  ALA D C     1 
ATOM   3684 O  O     . ALA D 1 46  ? -0.054  57.580  -11.259 1.00 27.37  ? 46  ALA D O     1 
ATOM   3685 C  CB    . ALA D 1 46  ? -1.029  56.250  -8.511  1.00 29.53  ? 46  ALA D CB    1 
ATOM   3686 N  N     . ASN D 1 47  ? -1.083  55.627  -11.696 1.00 27.98  ? 47  ASN D N     1 
ATOM   3687 C  CA    . ASN D 1 47  ? -1.661  56.095  -12.946 1.00 27.94  ? 47  ASN D CA    1 
ATOM   3688 C  C     . ASN D 1 47  ? -2.823  57.055  -12.683 1.00 27.41  ? 47  ASN D C     1 
ATOM   3689 O  O     . ASN D 1 47  ? -3.206  57.281  -11.517 1.00 26.82  ? 47  ASN D O     1 
ATOM   3690 C  CB    . ASN D 1 47  ? -2.029  54.939  -13.897 1.00 28.84  ? 47  ASN D CB    1 
ATOM   3691 C  CG    . ASN D 1 47  ? -3.236  54.118  -13.441 1.00 30.31  ? 47  ASN D CG    1 
ATOM   3692 O  OD1   . ASN D 1 47  ? -3.887  54.405  -12.440 1.00 31.25  ? 47  ASN D OD1   1 
ATOM   3693 N  ND2   . ASN D 1 47  ? -3.544  53.086  -14.213 1.00 29.87  ? 47  ASN D ND2   1 
ATOM   3694 N  N     . TYR D 1 48  ? -3.333  57.665  -13.746 1.00 27.97  ? 48  TYR D N     1 
ATOM   3695 C  CA    . TYR D 1 48  ? -4.323  58.747  -13.589 1.00 30.24  ? 48  TYR D CA    1 
ATOM   3696 C  C     . TYR D 1 48  ? -5.701  58.235  -13.141 1.00 30.77  ? 48  TYR D C     1 
ATOM   3697 O  O     . TYR D 1 48  ? -6.418  58.939  -12.413 1.00 31.47  ? 48  TYR D O     1 
ATOM   3698 C  CB    . TYR D 1 48  ? -4.388  59.660  -14.848 1.00 30.12  ? 48  TYR D CB    1 
ATOM   3699 C  CG    . TYR D 1 48  ? -3.221  60.654  -14.907 1.00 30.56  ? 48  TYR D CG    1 
ATOM   3700 C  CD1   . TYR D 1 48  ? -1.953  60.240  -15.311 1.00 31.08  ? 48  TYR D CD1   1 
ATOM   3701 C  CD2   . TYR D 1 48  ? -3.385  61.988  -14.537 1.00 32.25  ? 48  TYR D CD2   1 
ATOM   3702 C  CE1   . TYR D 1 48  ? -0.884  61.115  -15.353 1.00 32.92  ? 48  TYR D CE1   1 
ATOM   3703 C  CE2   . TYR D 1 48  ? -2.319  62.883  -14.578 1.00 33.97  ? 48  TYR D CE2   1 
ATOM   3704 C  CZ    . TYR D 1 48  ? -1.058  62.445  -14.985 1.00 33.88  ? 48  TYR D CZ    1 
ATOM   3705 O  OH    . TYR D 1 48  ? 0.030   63.325  -15.044 1.00 34.71  ? 48  TYR D OH    1 
ATOM   3706 N  N     . GLU D 1 49  ? -6.059  57.006  -13.518 1.00 32.25  ? 49  GLU D N     1 
ATOM   3707 C  CA    . GLU D 1 49  ? -7.299  56.412  -13.005 1.00 33.25  ? 49  GLU D CA    1 
ATOM   3708 C  C     . GLU D 1 49  ? -7.222  56.332  -11.477 1.00 31.99  ? 49  GLU D C     1 
ATOM   3709 O  O     . GLU D 1 49  ? -8.184  56.650  -10.780 1.00 31.99  ? 49  GLU D O     1 
ATOM   3710 C  CB    . GLU D 1 49  ? -7.566  55.036  -13.627 1.00 35.66  ? 49  GLU D CB    1 
ATOM   3711 C  CG    . GLU D 1 49  ? -8.886  54.360  -13.212 1.00 39.26  ? 49  GLU D CG    1 
ATOM   3712 C  CD    . GLU D 1 49  ? -10.157 55.064  -13.710 1.00 41.95  ? 49  GLU D CD    1 
ATOM   3713 O  OE1   . GLU D 1 49  ? -10.124 55.700  -14.793 1.00 44.60  ? 49  GLU D OE1   1 
ATOM   3714 O  OE2   . GLU D 1 49  ? -11.206 54.985  -13.021 1.00 42.16  ? 49  GLU D OE2   1 
ATOM   3715 N  N     . ALA D 1 50  ? -6.066  55.956  -10.953 1.00 29.98  ? 50  ALA D N     1 
ATOM   3716 C  CA    . ALA D 1 50  ? -5.878  55.909  -9.514  1.00 30.61  ? 50  ALA D CA    1 
ATOM   3717 C  C     . ALA D 1 50  ? -5.850  57.298  -8.880  1.00 31.31  ? 50  ALA D C     1 
ATOM   3718 O  O     . ALA D 1 50  ? -6.381  57.494  -7.768  1.00 32.00  ? 50  ALA D O     1 
ATOM   3719 C  CB    . ALA D 1 50  ? -4.602  55.153  -9.171  1.00 31.22  ? 50  ALA D CB    1 
ATOM   3720 N  N     . ARG D 1 51  ? -5.234  58.256  -9.576  1.00 31.12  ? 51  ARG D N     1 
ATOM   3721 C  CA    . ARG D 1 51  ? -5.080  59.612  -9.043  1.00 31.56  ? 51  ARG D CA    1 
ATOM   3722 C  C     . ARG D 1 51  ? -6.408  60.307  -8.863  1.00 33.96  ? 51  ARG D C     1 
ATOM   3723 O  O     . ARG D 1 51  ? -6.584  61.071  -7.933  1.00 34.45  ? 51  ARG D O     1 
ATOM   3724 C  CB    . ARG D 1 51  ? -4.186  60.467  -9.929  1.00 30.99  ? 51  ARG D CB    1 
ATOM   3725 C  CG    . ARG D 1 51  ? -2.712  60.145  -9.755  1.00 29.99  ? 51  ARG D CG    1 
ATOM   3726 C  CD    . ARG D 1 51  ? -1.877  60.916  -10.740 1.00 29.54  ? 51  ARG D CD    1 
ATOM   3727 N  NE    . ARG D 1 51  ? -0.623  60.240  -11.047 1.00 29.03  ? 51  ARG D NE    1 
ATOM   3728 C  CZ    . ARG D 1 51  ? 0.458   60.838  -11.535 1.00 27.58  ? 51  ARG D CZ    1 
ATOM   3729 N  NH1   . ARG D 1 51  ? 0.456   62.124  -11.778 1.00 27.97  ? 51  ARG D NH1   1 
ATOM   3730 N  NH2   . ARG D 1 51  ? 1.550   60.135  -11.779 1.00 27.51  ? 51  ARG D NH2   1 
ATOM   3731 N  N     . LYS D 1 52  ? -7.369  60.029  -9.720  1.00 36.18  ? 52  LYS D N     1 
ATOM   3732 C  CA    . LYS D 1 52  ? -8.597  60.769  -9.618  1.00 38.55  ? 52  LYS D CA    1 
ATOM   3733 C  C     . LYS D 1 52  ? -9.408  60.397  -8.363  1.00 38.32  ? 52  LYS D C     1 
ATOM   3734 O  O     . LYS D 1 52  ? -10.362 61.062  -8.056  1.00 38.42  ? 52  LYS D O     1 
ATOM   3735 C  CB    . LYS D 1 52  ? -9.397  60.703  -10.918 1.00 41.68  ? 52  LYS D CB    1 
ATOM   3736 C  CG    . LYS D 1 52  ? -9.988  59.370  -11.294 1.00 44.62  ? 52  LYS D CG    1 
ATOM   3737 C  CD    . LYS D 1 52  ? -10.749 59.536  -12.606 1.00 47.78  ? 52  LYS D CD    1 
ATOM   3738 C  CE    . LYS D 1 52  ? -11.584 58.311  -12.935 1.00 51.38  ? 52  LYS D CE    1 
ATOM   3739 N  NZ    . LYS D 1 52  ? -12.801 58.677  -13.708 1.00 55.76  ? 52  LYS D NZ    1 
ATOM   3740 N  N     . PHE D 1 53  ? -8.991  59.375  -7.617  1.00 37.90  ? 53  PHE D N     1 
ATOM   3741 C  CA    . PHE D 1 53  ? -9.566  59.097  -6.303  1.00 37.57  ? 53  PHE D CA    1 
ATOM   3742 C  C     . PHE D 1 53  ? -8.648  59.589  -5.177  1.00 38.38  ? 53  PHE D C     1 
ATOM   3743 O  O     . PHE D 1 53  ? -8.964  59.432  -4.003  1.00 41.92  ? 53  PHE D O     1 
ATOM   3744 C  CB    . PHE D 1 53  ? -9.902  57.600  -6.164  1.00 36.17  ? 53  PHE D CB    1 
ATOM   3745 C  CG    . PHE D 1 53  ? -10.958 57.131  -7.135  1.00 35.01  ? 53  PHE D CG    1 
ATOM   3746 C  CD1   . PHE D 1 53  ? -12.309 57.237  -6.822  1.00 36.21  ? 53  PHE D CD1   1 
ATOM   3747 C  CD2   . PHE D 1 53  ? -10.608 56.615  -8.372  1.00 33.55  ? 53  PHE D CD2   1 
ATOM   3748 C  CE1   . PHE D 1 53  ? -13.296 56.825  -7.730  1.00 36.62  ? 53  PHE D CE1   1 
ATOM   3749 C  CE2   . PHE D 1 53  ? -11.580 56.198  -9.281  1.00 34.32  ? 53  PHE D CE2   1 
ATOM   3750 C  CZ    . PHE D 1 53  ? -12.929 56.304  -8.961  1.00 35.21  ? 53  PHE D CZ    1 
ATOM   3751 N  N     . GLY D 1 54  ? -7.545  60.234  -5.539  1.00 39.14  ? 54  GLY D N     1 
ATOM   3752 C  CA    . GLY D 1 54  ? -6.630  60.842  -4.578  1.00 39.42  ? 54  GLY D CA    1 
ATOM   3753 C  C     . GLY D 1 54  ? -5.427  59.989  -4.204  1.00 40.96  ? 54  GLY D C     1 
ATOM   3754 O  O     . GLY D 1 54  ? -4.670  60.350  -3.302  1.00 42.69  ? 54  GLY D O     1 
ATOM   3755 N  N     . VAL D 1 55  ? -5.238  58.853  -4.870  1.00 40.92  ? 55  VAL D N     1 
ATOM   3756 C  CA    . VAL D 1 55  ? -4.021  58.062  -4.675  1.00 41.40  ? 55  VAL D CA    1 
ATOM   3757 C  C     . VAL D 1 55  ? -2.876  58.718  -5.421  1.00 40.86  ? 55  VAL D C     1 
ATOM   3758 O  O     . VAL D 1 55  ? -2.941  58.869  -6.628  1.00 41.33  ? 55  VAL D O     1 
ATOM   3759 C  CB    . VAL D 1 55  ? -4.147  56.622  -5.200  1.00 39.88  ? 55  VAL D CB    1 
ATOM   3760 C  CG1   . VAL D 1 55  ? -2.816  55.886  -5.059  1.00 40.14  ? 55  VAL D CG1   1 
ATOM   3761 C  CG2   . VAL D 1 55  ? -5.251  55.902  -4.462  1.00 40.82  ? 55  VAL D CG2   1 
ATOM   3762 N  N     . LYS D 1 56  ? -1.815  59.062  -4.695  1.00 42.90  ? 56  LYS D N     1 
ATOM   3763 C  CA    . LYS D 1 56  ? -0.666  59.739  -5.283  1.00 41.32  ? 56  LYS D CA    1 
ATOM   3764 C  C     . LYS D 1 56  ? 0.659   59.341  -4.629  1.00 37.87  ? 56  LYS D C     1 
ATOM   3765 O  O     . LYS D 1 56  ? 0.699   58.732  -3.569  1.00 35.01  ? 56  LYS D O     1 
ATOM   3766 C  CB    . LYS D 1 56  ? -0.861  61.250  -5.202  1.00 43.90  ? 56  LYS D CB    1 
ATOM   3767 C  CG    . LYS D 1 56  ? -1.139  61.755  -3.807  1.00 49.13  ? 56  LYS D CG    1 
ATOM   3768 C  CD    . LYS D 1 56  ? -1.250  63.266  -3.791  1.00 52.71  ? 56  LYS D CD    1 
ATOM   3769 C  CE    . LYS D 1 56  ? -1.594  63.772  -2.405  1.00 54.85  ? 56  LYS D CE    1 
ATOM   3770 N  NZ    . LYS D 1 56  ? -1.134  65.181  -2.252  1.00 59.33  ? 56  LYS D NZ    1 
ATOM   3771 N  N     . ALA D 1 57  ? 1.746   59.719  -5.281  1.00 37.77  ? 57  ALA D N     1 
ATOM   3772 C  CA    . ALA D 1 57  ? 3.078   59.336  -4.850  1.00 39.16  ? 57  ALA D CA    1 
ATOM   3773 C  C     . ALA D 1 57  ? 3.363   59.775  -3.418  1.00 40.21  ? 57  ALA D C     1 
ATOM   3774 O  O     . ALA D 1 57  ? 2.923   60.831  -2.976  1.00 38.90  ? 57  ALA D O     1 
ATOM   3775 C  CB    . ALA D 1 57  ? 4.122   59.891  -5.807  1.00 38.50  ? 57  ALA D CB    1 
ATOM   3776 N  N     . GLY D 1 58  ? 4.064   58.917  -2.686  1.00 41.61  ? 58  GLY D N     1 
ATOM   3777 C  CA    . GLY D 1 58  ? 4.565   59.254  -1.352  1.00 42.61  ? 58  GLY D CA    1 
ATOM   3778 C  C     . GLY D 1 58  ? 3.653   58.949  -0.176  1.00 42.93  ? 58  GLY D C     1 
ATOM   3779 O  O     . GLY D 1 58  ? 4.076   59.063  0.960   1.00 47.75  ? 58  GLY D O     1 
ATOM   3780 N  N     . ILE D 1 59  ? 2.404   58.575  -0.419  1.00 40.90  ? 59  ILE D N     1 
ATOM   3781 C  CA    . ILE D 1 59  ? 1.517   58.255  0.705   1.00 39.37  ? 59  ILE D CA    1 
ATOM   3782 C  C     . ILE D 1 59  ? 1.725   56.797  1.080   1.00 39.37  ? 59  ILE D C     1 
ATOM   3783 O  O     . ILE D 1 59  ? 2.275   56.029  0.278   1.00 37.58  ? 59  ILE D O     1 
ATOM   3784 C  CB    . ILE D 1 59  ? 0.048   58.529  0.390   1.00 37.45  ? 59  ILE D CB    1 
ATOM   3785 C  CG1   . ILE D 1 59  ? -0.502  57.463  -0.571  1.00 36.90  ? 59  ILE D CG1   1 
ATOM   3786 C  CG2   . ILE D 1 59  ? -0.104  59.953  -0.146  1.00 37.08  ? 59  ILE D CG2   1 
ATOM   3787 C  CD1   . ILE D 1 59  ? -1.944  57.659  -0.961  1.00 36.96  ? 59  ILE D CD1   1 
ATOM   3788 N  N     . PRO D 1 60  ? 1.332   56.419  2.308   1.00 39.55  ? 60  PRO D N     1 
ATOM   3789 C  CA    . PRO D 1 60  ? 1.399   55.026  2.712   1.00 39.45  ? 60  PRO D CA    1 
ATOM   3790 C  C     . PRO D 1 60  ? 0.474   54.130  1.906   1.00 38.35  ? 60  PRO D C     1 
ATOM   3791 O  O     . PRO D 1 60  ? -0.615  54.534  1.529   1.00 37.67  ? 60  PRO D O     1 
ATOM   3792 C  CB    . PRO D 1 60  ? 0.964   55.053  4.181   1.00 41.70  ? 60  PRO D CB    1 
ATOM   3793 C  CG    . PRO D 1 60  ? 1.263   56.435  4.637   1.00 42.71  ? 60  PRO D CG    1 
ATOM   3794 C  CD    . PRO D 1 60  ? 1.038   57.311  3.446   1.00 42.22  ? 60  PRO D CD    1 
ATOM   3795 N  N     . ILE D 1 61  ? 0.932   52.916  1.642   1.00 39.14  ? 61  ILE D N     1 
ATOM   3796 C  CA    . ILE D 1 61  ? 0.135   51.923  0.937   1.00 39.30  ? 61  ILE D CA    1 
ATOM   3797 C  C     . ILE D 1 61  ? -1.146  51.655  1.719   1.00 40.53  ? 61  ILE D C     1 
ATOM   3798 O  O     . ILE D 1 61  ? -2.224  51.551  1.138   1.00 39.62  ? 61  ILE D O     1 
ATOM   3799 C  CB    . ILE D 1 61  ? 0.940   50.632  0.758   1.00 40.49  ? 61  ILE D CB    1 
ATOM   3800 C  CG1   . ILE D 1 61  ? 2.100   50.877  -0.202  1.00 40.83  ? 61  ILE D CG1   1 
ATOM   3801 C  CG2   . ILE D 1 61  ? 0.072   49.510  0.219   1.00 41.22  ? 61  ILE D CG2   1 
ATOM   3802 C  CD1   . ILE D 1 61  ? 3.117   49.753  -0.233  1.00 42.29  ? 61  ILE D CD1   1 
ATOM   3803 N  N     . VAL D 1 62  ? -1.039  51.596  3.044   1.00 41.61  ? 62  VAL D N     1 
ATOM   3804 C  CA    . VAL D 1 62  ? -2.228  51.391  3.873   1.00 44.26  ? 62  VAL D CA    1 
ATOM   3805 C  C     . VAL D 1 62  ? -3.260  52.503  3.646   1.00 42.49  ? 62  VAL D C     1 
ATOM   3806 O  O     . VAL D 1 62  ? -4.450  52.233  3.576   1.00 44.75  ? 62  VAL D O     1 
ATOM   3807 C  CB    . VAL D 1 62  ? -1.882  51.232  5.373   1.00 46.89  ? 62  VAL D CB    1 
ATOM   3808 C  CG1   . VAL D 1 62  ? -0.971  50.022  5.570   1.00 47.32  ? 62  VAL D CG1   1 
ATOM   3809 C  CG2   . VAL D 1 62  ? -1.245  52.504  5.935   1.00 45.81  ? 62  VAL D CG2   1 
ATOM   3810 N  N     . GLU D 1 63  ? -2.802  53.740  3.485   1.00 41.03  ? 63  GLU D N     1 
ATOM   3811 C  CA    . GLU D 1 63  ? -3.701  54.835  3.122   1.00 40.17  ? 63  GLU D CA    1 
ATOM   3812 C  C     . GLU D 1 63  ? -4.247  54.678  1.704   1.00 38.74  ? 63  GLU D C     1 
ATOM   3813 O  O     . GLU D 1 63  ? -5.445  54.836  1.495   1.00 38.50  ? 63  GLU D O     1 
ATOM   3814 C  CB    . GLU D 1 63  ? -3.009  56.186  3.285   1.00 41.23  ? 63  GLU D CB    1 
ATOM   3815 C  CG    . GLU D 1 63  ? -2.732  56.554  4.731   1.00 42.91  ? 63  GLU D CG    1 
ATOM   3816 C  CD    . GLU D 1 63  ? -3.996  56.610  5.562   1.00 45.43  ? 63  GLU D CD    1 
ATOM   3817 O  OE1   . GLU D 1 63  ? -4.868  57.444  5.263   1.00 46.48  ? 63  GLU D OE1   1 
ATOM   3818 O  OE2   . GLU D 1 63  ? -4.124  55.810  6.509   1.00 47.96  ? 63  GLU D OE2   1 
ATOM   3819 N  N     . ALA D 1 64  ? -3.383  54.352  0.735   1.00 36.79  ? 64  ALA D N     1 
ATOM   3820 C  CA    . ALA D 1 64  ? -3.846  54.096  -0.644  1.00 36.76  ? 64  ALA D CA    1 
ATOM   3821 C  C     . ALA D 1 64  ? -4.963  53.056  -0.672  1.00 37.31  ? 64  ALA D C     1 
ATOM   3822 O  O     . ALA D 1 64  ? -5.965  53.221  -1.386  1.00 37.53  ? 64  ALA D O     1 
ATOM   3823 C  CB    . ALA D 1 64  ? -2.694  53.657  -1.538  1.00 36.35  ? 64  ALA D CB    1 
ATOM   3824 N  N     . LYS D 1 65  ? -4.805  52.005  0.132   1.00 38.88  ? 65  LYS D N     1 
ATOM   3825 C  CA    . LYS D 1 65  ? -5.788  50.918  0.194   1.00 41.44  ? 65  LYS D CA    1 
ATOM   3826 C  C     . LYS D 1 65  ? -7.143  51.291  0.809   1.00 42.74  ? 65  LYS D C     1 
ATOM   3827 O  O     . LYS D 1 65  ? -8.155  50.703  0.448   1.00 43.17  ? 65  LYS D O     1 
ATOM   3828 C  CB    . LYS D 1 65  ? -5.194  49.696  0.896   1.00 43.28  ? 65  LYS D CB    1 
ATOM   3829 C  CG    . LYS D 1 65  ? -4.203  48.974  0.006   1.00 44.17  ? 65  LYS D CG    1 
ATOM   3830 C  CD    . LYS D 1 65  ? -4.025  47.520  0.360   1.00 45.74  ? 65  LYS D CD    1 
ATOM   3831 C  CE    . LYS D 1 65  ? -2.995  46.906  -0.570  1.00 47.98  ? 65  LYS D CE    1 
ATOM   3832 N  NZ    . LYS D 1 65  ? -2.490  45.589  -0.079  1.00 50.47  ? 65  LYS D NZ    1 
ATOM   3833 N  N     . LYS D 1 66  ? -7.178  52.269  1.710   1.00 43.25  ? 66  LYS D N     1 
ATOM   3834 C  CA    . LYS D 1 66  ? -8.451  52.828  2.176   1.00 44.25  ? 66  LYS D CA    1 
ATOM   3835 C  C     . LYS D 1 66  ? -9.199  53.537  1.044   1.00 44.09  ? 66  LYS D C     1 
ATOM   3836 O  O     . LYS D 1 66  ? -10.419 53.427  0.923   1.00 44.48  ? 66  LYS D O     1 
ATOM   3837 C  CB    . LYS D 1 66  ? -8.213  53.829  3.308   1.00 46.28  ? 66  LYS D CB    1 
ATOM   3838 C  CG    . LYS D 1 66  ? -7.820  53.191  4.626   1.00 48.83  ? 66  LYS D CG    1 
ATOM   3839 C  CD    . LYS D 1 66  ? -7.150  54.189  5.558   1.00 50.41  ? 66  LYS D CD    1 
ATOM   3840 C  CE    . LYS D 1 66  ? -6.622  53.473  6.795   1.00 52.12  ? 66  LYS D CE    1 
ATOM   3841 N  NZ    . LYS D 1 66  ? -5.865  54.368  7.707   1.00 52.65  ? 66  LYS D NZ    1 
ATOM   3842 N  N     . ILE D 1 67  ? -8.456  54.271  0.219   1.00 43.03  ? 67  ILE D N     1 
ATOM   3843 C  CA    . ILE D 1 67  ? -9.042  55.054  -0.870  1.00 41.38  ? 67  ILE D CA    1 
ATOM   3844 C  C     . ILE D 1 67  ? -9.479  54.131  -2.006  1.00 40.29  ? 67  ILE D C     1 
ATOM   3845 O  O     . ILE D 1 67  ? -10.595 54.248  -2.505  1.00 39.32  ? 67  ILE D O     1 
ATOM   3846 C  CB    . ILE D 1 67  ? -8.024  56.064  -1.431  1.00 41.89  ? 67  ILE D CB    1 
ATOM   3847 C  CG1   . ILE D 1 67  ? -7.553  57.043  -0.353  1.00 40.92  ? 67  ILE D CG1   1 
ATOM   3848 C  CG2   . ILE D 1 67  ? -8.614  56.845  -2.603  1.00 43.08  ? 67  ILE D CG2   1 
ATOM   3849 C  CD1   . ILE D 1 67  ? -6.463  57.975  -0.842  1.00 39.21  ? 67  ILE D CD1   1 
ATOM   3850 N  N     . LEU D 1 68  ? -8.572  53.240  -2.428  1.00 38.95  ? 68  LEU D N     1 
ATOM   3851 C  CA    . LEU D 1 68  ? -8.824  52.286  -3.515  1.00 37.42  ? 68  LEU D CA    1 
ATOM   3852 C  C     . LEU D 1 68  ? -8.382  50.876  -3.130  1.00 37.23  ? 68  LEU D C     1 
ATOM   3853 O  O     . LEU D 1 68  ? -7.297  50.443  -3.505  1.00 37.19  ? 68  LEU D O     1 
ATOM   3854 C  CB    . LEU D 1 68  ? -8.061  52.703  -4.774  1.00 36.41  ? 68  LEU D CB    1 
ATOM   3855 C  CG    . LEU D 1 68  ? -8.572  53.853  -5.629  1.00 36.32  ? 68  LEU D CG    1 
ATOM   3856 C  CD1   . LEU D 1 68  ? -7.555  54.129  -6.735  1.00 36.55  ? 68  LEU D CD1   1 
ATOM   3857 C  CD2   . LEU D 1 68  ? -9.930  53.536  -6.217  1.00 36.90  ? 68  LEU D CD2   1 
ATOM   3858 N  N     . PRO D 1 69  ? -9.214  50.153  -2.370  1.00 38.25  ? 69  PRO D N     1 
ATOM   3859 C  CA    . PRO D 1 69  ? -8.861  48.791  -1.925  1.00 37.96  ? 69  PRO D CA    1 
ATOM   3860 C  C     . PRO D 1 69  ? -8.593  47.798  -3.067  1.00 38.28  ? 69  PRO D C     1 
ATOM   3861 O  O     . PRO D 1 69  ? -7.790  46.883  -2.896  1.00 37.00  ? 69  PRO D O     1 
ATOM   3862 C  CB    . PRO D 1 69  ? -10.088 48.337  -1.144  1.00 38.47  ? 69  PRO D CB    1 
ATOM   3863 C  CG    . PRO D 1 69  ? -10.839 49.571  -0.807  1.00 38.95  ? 69  PRO D CG    1 
ATOM   3864 C  CD    . PRO D 1 69  ? -10.444 50.659  -1.741  1.00 38.24  ? 69  PRO D CD    1 
ATOM   3865 N  N     . ASN D 1 70  ? -9.262  47.986  -4.204  1.00 37.99  ? 70  ASN D N     1 
ATOM   3866 C  CA    . ASN D 1 70  ? -9.229  47.017  -5.305  1.00 38.27  ? 70  ASN D CA    1 
ATOM   3867 C  C     . ASN D 1 70  ? -8.344  47.401  -6.479  1.00 38.42  ? 70  ASN D C     1 
ATOM   3868 O  O     . ASN D 1 70  ? -8.425  46.777  -7.536  1.00 38.69  ? 70  ASN D O     1 
ATOM   3869 C  CB    . ASN D 1 70  ? -10.654 46.763  -5.803  1.00 37.55  ? 70  ASN D CB    1 
ATOM   3870 C  CG    . ASN D 1 70  ? -11.499 46.019  -4.783  1.00 38.02  ? 70  ASN D CG    1 
ATOM   3871 O  OD1   . ASN D 1 70  ? -11.023 45.666  -3.714  1.00 37.97  ? 70  ASN D OD1   1 
ATOM   3872 N  ND2   . ASN D 1 70  ? -12.755 45.776  -5.114  1.00 38.70  ? 70  ASN D ND2   1 
ATOM   3873 N  N     . ALA D 1 71  ? -7.492  48.414  -6.298  1.00 38.39  ? 71  ALA D N     1 
ATOM   3874 C  CA    . ALA D 1 71  ? -6.519  48.794  -7.327  1.00 36.94  ? 71  ALA D CA    1 
ATOM   3875 C  C     . ALA D 1 71  ? -5.423  47.750  -7.405  1.00 36.03  ? 71  ALA D C     1 
ATOM   3876 O  O     . ALA D 1 71  ? -5.252  46.946  -6.488  1.00 35.99  ? 71  ALA D O     1 
ATOM   3877 C  CB    . ALA D 1 71  ? -5.913  50.161  -7.028  1.00 36.75  ? 71  ALA D CB    1 
ATOM   3878 N  N     . VAL D 1 72  ? -4.658  47.792  -8.492  1.00 33.54  ? 72  VAL D N     1 
ATOM   3879 C  CA    . VAL D 1 72  ? -3.566  46.856  -8.705  1.00 32.43  ? 72  VAL D CA    1 
ATOM   3880 C  C     . VAL D 1 72  ? -2.298  47.436  -8.088  1.00 32.06  ? 72  VAL D C     1 
ATOM   3881 O  O     . VAL D 1 72  ? -1.820  48.503  -8.498  1.00 31.60  ? 72  VAL D O     1 
ATOM   3882 C  CB    . VAL D 1 72  ? -3.353  46.578  -10.204 1.00 32.43  ? 72  VAL D CB    1 
ATOM   3883 C  CG1   . VAL D 1 72  ? -2.250  45.552  -10.405 1.00 32.57  ? 72  VAL D CG1   1 
ATOM   3884 C  CG2   . VAL D 1 72  ? -4.662  46.117  -10.836 1.00 32.24  ? 72  VAL D CG2   1 
ATOM   3885 N  N     . TYR D 1 73  ? -1.777  46.740  -7.085  1.00 32.50  ? 73  TYR D N     1 
ATOM   3886 C  CA    . TYR D 1 73  ? -0.626  47.205  -6.324  1.00 33.28  ? 73  TYR D CA    1 
ATOM   3887 C  C     . TYR D 1 73  ? 0.592   46.396  -6.756  1.00 34.40  ? 73  TYR D C     1 
ATOM   3888 O  O     . TYR D 1 73  ? 0.676   45.216  -6.468  1.00 35.35  ? 73  TYR D O     1 
ATOM   3889 C  CB    . TYR D 1 73  ? -0.907  47.092  -4.816  1.00 33.49  ? 73  TYR D CB    1 
ATOM   3890 C  CG    . TYR D 1 73  ? -1.925  48.126  -4.343  1.00 34.26  ? 73  TYR D CG    1 
ATOM   3891 C  CD1   . TYR D 1 73  ? -1.515  49.386  -3.929  1.00 33.24  ? 73  TYR D CD1   1 
ATOM   3892 C  CD2   . TYR D 1 73  ? -3.300  47.855  -4.337  1.00 35.14  ? 73  TYR D CD2   1 
ATOM   3893 C  CE1   . TYR D 1 73  ? -2.420  50.343  -3.519  1.00 33.45  ? 73  TYR D CE1   1 
ATOM   3894 C  CE2   . TYR D 1 73  ? -4.219  48.815  -3.913  1.00 35.33  ? 73  TYR D CE2   1 
ATOM   3895 C  CZ    . TYR D 1 73  ? -3.756  50.061  -3.510  1.00 34.94  ? 73  TYR D CZ    1 
ATOM   3896 O  OH    . TYR D 1 73  ? -4.608  51.052  -3.101  1.00 36.32  ? 73  TYR D OH    1 
ATOM   3897 N  N     . LEU D 1 74  ? 1.525   47.039  -7.459  1.00 34.02  ? 74  LEU D N     1 
ATOM   3898 C  CA    . LEU D 1 74  ? 2.679   46.368  -8.046  1.00 33.14  ? 74  LEU D CA    1 
ATOM   3899 C  C     . LEU D 1 74  ? 3.955   46.810  -7.358  1.00 33.98  ? 74  LEU D C     1 
ATOM   3900 O  O     . LEU D 1 74  ? 4.072   47.980  -6.988  1.00 32.28  ? 74  LEU D O     1 
ATOM   3901 C  CB    . LEU D 1 74  ? 2.771   46.700  -9.533  1.00 32.81  ? 74  LEU D CB    1 
ATOM   3902 C  CG    . LEU D 1 74  ? 1.609   46.165  -10.372 1.00 33.11  ? 74  LEU D CG    1 
ATOM   3903 C  CD1   . LEU D 1 74  ? 1.637   46.697  -11.796 1.00 32.49  ? 74  LEU D CD1   1 
ATOM   3904 C  CD2   . LEU D 1 74  ? 1.640   44.644  -10.365 1.00 34.10  ? 74  LEU D CD2   1 
ATOM   3905 N  N     . PRO D 1 75  ? 4.922   45.876  -7.190  1.00 34.79  ? 75  PRO D N     1 
ATOM   3906 C  CA    . PRO D 1 75  ? 6.202   46.238  -6.613  1.00 35.90  ? 75  PRO D CA    1 
ATOM   3907 C  C     . PRO D 1 75  ? 7.035   47.015  -7.628  1.00 35.70  ? 75  PRO D C     1 
ATOM   3908 O  O     . PRO D 1 75  ? 7.020   46.708  -8.825  1.00 36.12  ? 75  PRO D O     1 
ATOM   3909 C  CB    . PRO D 1 75  ? 6.834   44.877  -6.273  1.00 36.79  ? 75  PRO D CB    1 
ATOM   3910 C  CG    . PRO D 1 75  ? 6.298   43.954  -7.319  1.00 36.89  ? 75  PRO D CG    1 
ATOM   3911 C  CD    . PRO D 1 75  ? 4.908   44.469  -7.647  1.00 36.54  ? 75  PRO D CD    1 
ATOM   3912 N  N     . MET D 1 76  ? 7.719   48.048  -7.163  1.00 36.45  ? 76  MET D N     1 
ATOM   3913 C  CA    . MET D 1 76  ? 8.572   48.826  -8.041  1.00 37.83  ? 76  MET D CA    1 
ATOM   3914 C  C     . MET D 1 76  ? 9.674   47.938  -8.599  1.00 37.53  ? 76  MET D C     1 
ATOM   3915 O  O     . MET D 1 76  ? 10.366  47.288  -7.836  1.00 38.35  ? 76  MET D O     1 
ATOM   3916 C  CB    . MET D 1 76  ? 9.192   49.997  -7.281  1.00 39.12  ? 76  MET D CB    1 
ATOM   3917 C  CG    . MET D 1 76  ? 10.254  50.744  -8.062  1.00 40.78  ? 76  MET D CG    1 
ATOM   3918 S  SD    . MET D 1 76  ? 11.004  52.083  -7.132  1.00 43.04  ? 76  MET D SD    1 
ATOM   3919 C  CE    . MET D 1 76  ? 12.217  51.195  -6.144  1.00 43.06  ? 76  MET D CE    1 
ATOM   3920 N  N     . ARG D 1 77  ? 9.819   47.909  -9.924  1.00 37.52  ? 77  ARG D N     1 
ATOM   3921 C  CA    . ARG D 1 77  ? 10.965  47.273  -10.589 1.00 37.23  ? 77  ARG D CA    1 
ATOM   3922 C  C     . ARG D 1 77  ? 11.870  48.313  -11.275 1.00 36.91  ? 77  ARG D C     1 
ATOM   3923 O  O     . ARG D 1 77  ? 11.792  48.548  -12.483 1.00 34.26  ? 77  ARG D O     1 
ATOM   3924 C  CB    . ARG D 1 77  ? 10.476  46.256  -11.595 1.00 38.03  ? 77  ARG D CB    1 
ATOM   3925 C  CG    . ARG D 1 77  ? 9.711   45.125  -10.951 1.00 40.39  ? 77  ARG D CG    1 
ATOM   3926 C  CD    . ARG D 1 77  ? 9.333   44.068  -11.957 1.00 41.36  ? 77  ARG D CD    1 
ATOM   3927 N  NE    . ARG D 1 77  ? 8.381   44.519  -12.963 1.00 40.31  ? 77  ARG D NE    1 
ATOM   3928 C  CZ    . ARG D 1 77  ? 8.037   43.784  -14.018 1.00 44.19  ? 77  ARG D CZ    1 
ATOM   3929 N  NH1   . ARG D 1 77  ? 8.582   42.576  -14.204 1.00 46.02  ? 77  ARG D NH1   1 
ATOM   3930 N  NH2   . ARG D 1 77  ? 7.160   44.240  -14.898 1.00 43.89  ? 77  ARG D NH2   1 
ATOM   3931 N  N     . LYS D 1 78  ? 12.732  48.917  -10.469 1.00 38.71  ? 78  LYS D N     1 
ATOM   3932 C  CA    . LYS D 1 78  ? 13.581  50.032  -10.880 1.00 41.23  ? 78  LYS D CA    1 
ATOM   3933 C  C     . LYS D 1 78  ? 14.422  49.750  -12.136 1.00 39.87  ? 78  LYS D C     1 
ATOM   3934 O  O     . LYS D 1 78  ? 14.496  50.585  -13.035 1.00 38.88  ? 78  LYS D O     1 
ATOM   3935 C  CB    . LYS D 1 78  ? 14.504  50.422  -9.718  1.00 42.76  ? 78  LYS D CB    1 
ATOM   3936 C  CG    . LYS D 1 78  ? 14.510  51.909  -9.386  1.00 45.58  ? 78  LYS D CG    1 
ATOM   3937 C  CD    . LYS D 1 78  ? 15.027  52.779  -10.517 1.00 46.29  ? 78  LYS D CD    1 
ATOM   3938 C  CE    . LYS D 1 78  ? 14.895  54.258  -10.169 1.00 47.12  ? 78  LYS D CE    1 
ATOM   3939 N  NZ    . LYS D 1 78  ? 15.930  54.735  -9.203  1.00 46.83  ? 78  LYS D NZ    1 
ATOM   3940 N  N     . GLU D 1 79  ? 15.052  48.579  -12.188 1.00 41.53  ? 79  GLU D N     1 
ATOM   3941 C  CA    . GLU D 1 79  ? 15.942  48.213  -13.300 1.00 41.92  ? 79  GLU D CA    1 
ATOM   3942 C  C     . GLU D 1 79  ? 15.202  48.199  -14.613 1.00 39.19  ? 79  GLU D C     1 
ATOM   3943 O  O     . GLU D 1 79  ? 15.659  48.764  -15.598 1.00 37.70  ? 79  GLU D O     1 
ATOM   3944 C  CB    . GLU D 1 79  ? 16.513  46.810  -13.112 1.00 46.83  ? 79  GLU D CB    1 
ATOM   3945 C  CG    . GLU D 1 79  ? 17.586  46.688  -12.058 1.00 52.26  ? 79  GLU D CG    1 
ATOM   3946 C  CD    . GLU D 1 79  ? 18.545  45.550  -12.373 1.00 59.15  ? 79  GLU D CD    1 
ATOM   3947 O  OE1   . GLU D 1 79  ? 19.013  45.462  -13.538 1.00 62.36  ? 79  GLU D OE1   1 
ATOM   3948 O  OE2   . GLU D 1 79  ? 18.825  44.741  -11.465 1.00 61.48  ? 79  GLU D OE2   1 
ATOM   3949 N  N     . VAL D 1 80  ? 14.062  47.514  -14.616 1.00 37.29  ? 80  VAL D N     1 
ATOM   3950 C  CA    . VAL D 1 80  ? 13.169  47.471  -15.774 1.00 36.03  ? 80  VAL D CA    1 
ATOM   3951 C  C     . VAL D 1 80  ? 12.837  48.875  -16.291 1.00 34.11  ? 80  VAL D C     1 
ATOM   3952 O  O     . VAL D 1 80  ? 12.841  49.119  -17.499 1.00 33.75  ? 80  VAL D O     1 
ATOM   3953 C  CB    . VAL D 1 80  ? 11.854  46.745  -15.415 1.00 37.41  ? 80  VAL D CB    1 
ATOM   3954 C  CG1   . VAL D 1 80  ? 10.904  46.724  -16.600 1.00 36.20  ? 80  VAL D CG1   1 
ATOM   3955 C  CG2   . VAL D 1 80  ? 12.145  45.326  -14.926 1.00 37.83  ? 80  VAL D CG2   1 
ATOM   3956 N  N     . TYR D 1 81  ? 12.558  49.795  -15.373 1.00 32.46  ? 81  TYR D N     1 
ATOM   3957 C  CA    . TYR D 1 81  ? 12.181  51.153  -15.765 1.00 31.99  ? 81  TYR D CA    1 
ATOM   3958 C  C     . TYR D 1 81  ? 13.419  51.902  -16.268 1.00 31.79  ? 81  TYR D C     1 
ATOM   3959 O  O     . TYR D 1 81  ? 13.344  52.683  -17.204 1.00 28.16  ? 81  TYR D O     1 
ATOM   3960 C  CB    . TYR D 1 81  ? 11.504  51.924  -14.626 1.00 29.43  ? 81  TYR D CB    1 
ATOM   3961 C  CG    . TYR D 1 81  ? 10.443  51.145  -13.865 1.00 29.22  ? 81  TYR D CG    1 
ATOM   3962 C  CD1   . TYR D 1 81  ? 9.573   50.258  -14.517 1.00 29.38  ? 81  TYR D CD1   1 
ATOM   3963 C  CD2   . TYR D 1 81  ? 10.299  51.314  -12.492 1.00 28.89  ? 81  TYR D CD2   1 
ATOM   3964 C  CE1   . TYR D 1 81  ? 8.607   49.560  -13.811 1.00 29.09  ? 81  TYR D CE1   1 
ATOM   3965 C  CE2   . TYR D 1 81  ? 9.337   50.627  -11.778 1.00 28.63  ? 81  TYR D CE2   1 
ATOM   3966 C  CZ    . TYR D 1 81  ? 8.509   49.745  -12.433 1.00 29.57  ? 81  TYR D CZ    1 
ATOM   3967 O  OH    . TYR D 1 81  ? 7.583   49.061  -11.696 1.00 29.78  ? 81  TYR D OH    1 
ATOM   3968 N  N     . GLN D 1 82  ? 14.557  51.651  -15.632 1.00 34.75  ? 82  GLN D N     1 
ATOM   3969 C  CA    . GLN D 1 82  ? 15.812  52.266  -16.057 1.00 34.92  ? 82  GLN D CA    1 
ATOM   3970 C  C     . GLN D 1 82  ? 16.182  51.821  -17.471 1.00 35.37  ? 82  GLN D C     1 
ATOM   3971 O  O     . GLN D 1 82  ? 16.716  52.616  -18.230 1.00 36.23  ? 82  GLN D O     1 
ATOM   3972 C  CB    . GLN D 1 82  ? 16.929  51.984  -15.045 1.00 35.71  ? 82  GLN D CB    1 
ATOM   3973 C  CG    . GLN D 1 82  ? 18.294  52.550  -15.423 1.00 35.57  ? 82  GLN D CG    1 
ATOM   3974 C  CD    . GLN D 1 82  ? 18.237  54.035  -15.696 1.00 35.99  ? 82  GLN D CD    1 
ATOM   3975 O  OE1   . GLN D 1 82  ? 18.404  54.477  -16.836 1.00 36.16  ? 82  GLN D OE1   1 
ATOM   3976 N  NE2   . GLN D 1 82  ? 17.985  54.814  -14.657 1.00 35.56  ? 82  GLN D NE2   1 
ATOM   3977 N  N     . GLN D 1 83  ? 15.857  50.584  -17.850 1.00 36.98  ? 83  GLN D N     1 
ATOM   3978 C  CA    . GLN D 1 83  ? 16.100  50.122  -19.227 1.00 37.68  ? 83  GLN D CA    1 
ATOM   3979 C  C     . GLN D 1 83  ? 15.274  50.891  -20.228 1.00 36.64  ? 83  GLN D C     1 
ATOM   3980 O  O     . GLN D 1 83  ? 15.796  51.346  -21.255 1.00 35.50  ? 83  GLN D O     1 
ATOM   3981 C  CB    . GLN D 1 83  ? 15.803  48.630  -19.401 1.00 41.39  ? 83  GLN D CB    1 
ATOM   3982 C  CG    . GLN D 1 83  ? 17.021  47.744  -19.149 1.00 44.17  ? 83  GLN D CG    1 
ATOM   3983 C  CD    . GLN D 1 83  ? 16.667  46.397  -18.548 1.00 45.09  ? 83  GLN D CD    1 
ATOM   3984 O  OE1   . GLN D 1 83  ? 15.697  45.758  -18.941 1.00 45.11  ? 83  GLN D OE1   1 
ATOM   3985 N  NE2   . GLN D 1 83  ? 17.460  45.961  -17.583 1.00 48.49  ? 83  GLN D NE2   1 
ATOM   3986 N  N     . VAL D 1 84  ? 13.981  51.033  -19.942 1.00 34.64  ? 84  VAL D N     1 
ATOM   3987 C  CA    . VAL D 1 84  ? 13.112  51.806  -20.817 1.00 32.71  ? 84  VAL D CA    1 
ATOM   3988 C  C     . VAL D 1 84  ? 13.615  53.250  -20.900 1.00 30.96  ? 84  VAL D C     1 
ATOM   3989 O  O     . VAL D 1 84  ? 13.703  53.801  -21.991 1.00 31.56  ? 84  VAL D O     1 
ATOM   3990 C  CB    . VAL D 1 84  ? 11.630  51.757  -20.379 1.00 33.02  ? 84  VAL D CB    1 
ATOM   3991 C  CG1   . VAL D 1 84  ? 10.773  52.580  -21.317 1.00 32.61  ? 84  VAL D CG1   1 
ATOM   3992 C  CG2   . VAL D 1 84  ? 11.123  50.319  -20.361 1.00 33.98  ? 84  VAL D CG2   1 
ATOM   3993 N  N     . SER D 1 85  ? 13.978  53.846  -19.768 1.00 29.97  ? 85  SER D N     1 
ATOM   3994 C  CA    . SER D 1 85  ? 14.419  55.252  -19.737 1.00 29.73  ? 85  SER D CA    1 
ATOM   3995 C  C     . SER D 1 85  ? 15.642  55.478  -20.630 1.00 31.21  ? 85  SER D C     1 
ATOM   3996 O  O     . SER D 1 85  ? 15.656  56.383  -21.476 1.00 31.64  ? 85  SER D O     1 
ATOM   3997 C  CB    . SER D 1 85  ? 14.761  55.658  -18.318 1.00 29.47  ? 85  SER D CB    1 
ATOM   3998 O  OG    . SER D 1 85  ? 15.290  56.980  -18.250 1.00 28.86  ? 85  SER D OG    1 
ATOM   3999 N  N     . SER D 1 86  ? 16.652  54.637  -20.440 1.00 32.56  ? 86  SER D N     1 
ATOM   4000 C  CA    . SER D 1 86  ? 17.902  54.688  -21.210 1.00 34.06  ? 86  SER D CA    1 
ATOM   4001 C  C     . SER D 1 86  ? 17.677  54.602  -22.713 1.00 34.00  ? 86  SER D C     1 
ATOM   4002 O  O     . SER D 1 86  ? 18.279  55.352  -23.494 1.00 35.85  ? 86  SER D O     1 
ATOM   4003 C  CB    . SER D 1 86  ? 18.840  53.556  -20.763 1.00 36.03  ? 86  SER D CB    1 
ATOM   4004 O  OG    . SER D 1 86  ? 19.299  53.777  -19.435 1.00 35.98  ? 86  SER D OG    1 
ATOM   4005 N  N     . ARG D 1 87  ? 16.792  53.708  -23.128 1.00 33.33  ? 87  ARG D N     1 
ATOM   4006 C  CA    . ARG D 1 87  ? 16.439  53.623  -24.531 1.00 31.92  ? 87  ARG D CA    1 
ATOM   4007 C  C     . ARG D 1 87  ? 15.782  54.921  -24.984 1.00 30.27  ? 87  ARG D C     1 
ATOM   4008 O  O     . ARG D 1 87  ? 16.108  55.438  -26.033 1.00 31.07  ? 87  ARG D O     1 
ATOM   4009 C  CB    . ARG D 1 87  ? 15.535  52.418  -24.802 1.00 33.27  ? 87  ARG D CB    1 
ATOM   4010 C  CG    . ARG D 1 87  ? 16.256  51.071  -24.740 1.00 34.51  ? 87  ARG D CG    1 
ATOM   4011 C  CD    . ARG D 1 87  ? 15.562  50.014  -25.603 1.00 35.39  ? 87  ARG D CD    1 
ATOM   4012 N  NE    . ARG D 1 87  ? 14.195  49.780  -25.139 1.00 36.44  ? 87  ARG D NE    1 
ATOM   4013 C  CZ    . ARG D 1 87  ? 13.856  49.057  -24.072 1.00 36.48  ? 87  ARG D CZ    1 
ATOM   4014 N  NH1   . ARG D 1 87  ? 14.772  48.448  -23.317 1.00 36.74  ? 87  ARG D NH1   1 
ATOM   4015 N  NH2   . ARG D 1 87  ? 12.573  48.956  -23.746 1.00 36.77  ? 87  ARG D NH2   1 
ATOM   4016 N  N     . ILE D 1 88  ? 14.887  55.479  -24.183 1.00 29.75  ? 88  ILE D N     1 
ATOM   4017 C  CA    . ILE D 1 88  ? 14.202  56.725  -24.587 1.00 29.80  ? 88  ILE D CA    1 
ATOM   4018 C  C     . ILE D 1 88  ? 15.156  57.910  -24.652 1.00 29.11  ? 88  ILE D C     1 
ATOM   4019 O  O     . ILE D 1 88  ? 15.047  58.734  -25.554 1.00 29.99  ? 88  ILE D O     1 
ATOM   4020 C  CB    . ILE D 1 88  ? 13.005  57.089  -23.672 1.00 28.66  ? 88  ILE D CB    1 
ATOM   4021 C  CG1   . ILE D 1 88  ? 11.928  56.021  -23.803 1.00 29.68  ? 88  ILE D CG1   1 
ATOM   4022 C  CG2   . ILE D 1 88  ? 12.441  58.449  -24.062 1.00 27.91  ? 88  ILE D CG2   1 
ATOM   4023 C  CD1   . ILE D 1 88  ? 10.850  56.062  -22.739 1.00 31.01  ? 88  ILE D CD1   1 
ATOM   4024 N  N     . MET D 1 89  ? 16.074  58.008  -23.693 1.00 29.61  ? 89  MET D N     1 
ATOM   4025 C  CA    . MET D 1 89  ? 17.022  59.115  -23.692 1.00 29.72  ? 89  MET D CA    1 
ATOM   4026 C  C     . MET D 1 89  ? 17.881  59.045  -24.957 1.00 32.46  ? 89  MET D C     1 
ATOM   4027 O  O     . MET D 1 89  ? 18.171  60.062  -25.561 1.00 32.56  ? 89  MET D O     1 
ATOM   4028 C  CB    . MET D 1 89  ? 17.906  59.090  -22.452 1.00 30.72  ? 89  MET D CB    1 
ATOM   4029 C  CG    . MET D 1 89  ? 17.176  59.283  -21.125 1.00 30.84  ? 89  MET D CG    1 
ATOM   4030 S  SD    . MET D 1 89  ? 16.120  60.728  -21.142 1.00 31.18  ? 89  MET D SD    1 
ATOM   4031 C  CE    . MET D 1 89  ? 15.327  60.583  -19.541 1.00 32.51  ? 89  MET D CE    1 
ATOM   4032 N  N     . ASN D 1 90  ? 18.238  57.838  -25.384 1.00 34.58  ? 90  ASN D N     1 
ATOM   4033 C  CA    . ASN D 1 90  ? 18.985  57.675  -26.617 1.00 36.82  ? 90  ASN D CA    1 
ATOM   4034 C  C     . ASN D 1 90  ? 18.209  58.126  -27.820 1.00 35.14  ? 90  ASN D C     1 
ATOM   4035 O  O     . ASN D 1 90  ? 18.803  58.673  -28.720 1.00 38.18  ? 90  ASN D O     1 
ATOM   4036 C  CB    . ASN D 1 90  ? 19.468  56.245  -26.809 1.00 38.90  ? 90  ASN D CB    1 
ATOM   4037 C  CG    . ASN D 1 90  ? 20.647  55.916  -25.923 1.00 40.39  ? 90  ASN D CG    1 
ATOM   4038 O  OD1   . ASN D 1 90  ? 21.223  56.790  -25.276 1.00 43.11  ? 90  ASN D OD1   1 
ATOM   4039 N  ND2   . ASN D 1 90  ? 21.012  54.647  -25.884 1.00 43.67  ? 90  ASN D ND2   1 
ATOM   4040 N  N     . LEU D 1 91  ? 16.896  57.915  -27.842 1.00 33.79  ? 91  LEU D N     1 
ATOM   4041 C  CA    . LEU D 1 91  ? 16.087  58.456  -28.927 1.00 33.12  ? 91  LEU D CA    1 
ATOM   4042 C  C     . LEU D 1 91  ? 16.175  59.989  -28.898 1.00 33.29  ? 91  LEU D C     1 
ATOM   4043 O  O     . LEU D 1 91  ? 16.339  60.632  -29.944 1.00 31.66  ? 91  LEU D O     1 
ATOM   4044 C  CB    . LEU D 1 91  ? 14.631  58.001  -28.854 1.00 32.20  ? 91  LEU D CB    1 
ATOM   4045 C  CG    . LEU D 1 91  ? 14.315  56.502  -29.006 1.00 32.55  ? 91  LEU D CG    1 
ATOM   4046 C  CD1   . LEU D 1 91  ? 12.847  56.237  -28.689 1.00 31.67  ? 91  LEU D CD1   1 
ATOM   4047 C  CD2   . LEU D 1 91  ? 14.636  55.970  -30.408 1.00 33.62  ? 91  LEU D CD2   1 
ATOM   4048 N  N     . LEU D 1 92  ? 16.100  60.569  -27.703 1.00 32.50  ? 92  LEU D N     1 
ATOM   4049 C  CA    . LEU D 1 92  ? 16.125  62.026  -27.592 1.00 32.89  ? 92  LEU D CA    1 
ATOM   4050 C  C     . LEU D 1 92  ? 17.441  62.625  -28.091 1.00 33.94  ? 92  LEU D C     1 
ATOM   4051 O  O     . LEU D 1 92  ? 17.466  63.717  -28.663 1.00 31.75  ? 92  LEU D O     1 
ATOM   4052 C  CB    . LEU D 1 92  ? 15.849  62.456  -26.157 1.00 32.08  ? 92  LEU D CB    1 
ATOM   4053 C  CG    . LEU D 1 92  ? 14.408  62.217  -25.678 1.00 31.99  ? 92  LEU D CG    1 
ATOM   4054 C  CD1   . LEU D 1 92  ? 14.231  62.674  -24.234 1.00 32.04  ? 92  LEU D CD1   1 
ATOM   4055 C  CD2   . LEU D 1 92  ? 13.402  62.917  -26.569 1.00 32.45  ? 92  LEU D CD2   1 
ATOM   4056 N  N     . ARG D 1 93  ? 18.527  61.894  -27.873 1.00 36.04  ? 93  ARG D N     1 
ATOM   4057 C  CA    . ARG D 1 93  ? 19.854  62.330  -28.282 1.00 39.40  ? 93  ARG D CA    1 
ATOM   4058 C  C     . ARG D 1 93  ? 19.971  62.534  -29.782 1.00 38.63  ? 93  ARG D C     1 
ATOM   4059 O  O     . ARG D 1 93  ? 20.798  63.315  -30.226 1.00 38.00  ? 93  ARG D O     1 
ATOM   4060 C  CB    . ARG D 1 93  ? 20.921  61.336  -27.830 1.00 41.96  ? 93  ARG D CB    1 
ATOM   4061 C  CG    . ARG D 1 93  ? 21.595  61.739  -26.535 1.00 45.39  ? 93  ARG D CG    1 
ATOM   4062 C  CD    . ARG D 1 93  ? 22.717  60.785  -26.169 1.00 47.94  ? 93  ARG D CD    1 
ATOM   4063 N  NE    . ARG D 1 93  ? 22.259  59.782  -25.223 1.00 49.89  ? 93  ARG D NE    1 
ATOM   4064 C  CZ    . ARG D 1 93  ? 22.426  59.846  -23.904 1.00 49.54  ? 93  ARG D CZ    1 
ATOM   4065 N  NH1   . ARG D 1 93  ? 23.056  60.866  -23.344 1.00 50.38  ? 93  ARG D NH1   1 
ATOM   4066 N  NH2   . ARG D 1 93  ? 21.964  58.872  -23.138 1.00 49.58  ? 93  ARG D NH2   1 
ATOM   4067 N  N     . GLU D 1 94  ? 19.137  61.840  -30.547 1.00 37.16  ? 94  GLU D N     1 
ATOM   4068 C  CA    . GLU D 1 94  ? 19.175  61.937  -31.992 1.00 39.00  ? 94  GLU D CA    1 
ATOM   4069 C  C     . GLU D 1 94  ? 18.576  63.243  -32.498 1.00 37.34  ? 94  GLU D C     1 
ATOM   4070 O  O     . GLU D 1 94  ? 18.780  63.595  -33.658 1.00 37.16  ? 94  GLU D O     1 
ATOM   4071 C  CB    . GLU D 1 94  ? 18.449  60.747  -32.621 1.00 40.58  ? 94  GLU D CB    1 
ATOM   4072 C  CG    . GLU D 1 94  ? 19.025  59.407  -32.198 1.00 41.59  ? 94  GLU D CG    1 
ATOM   4073 C  CD    . GLU D 1 94  ? 18.475  58.266  -33.003 1.00 43.75  ? 94  GLU D CD    1 
ATOM   4074 O  OE1   . GLU D 1 94  ? 18.982  58.032  -34.115 1.00 50.05  ? 94  GLU D OE1   1 
ATOM   4075 O  OE2   . GLU D 1 94  ? 17.539  57.598  -32.529 1.00 47.58  ? 94  GLU D OE2   1 
ATOM   4076 N  N     . TYR D 1 95  ? 17.842  63.946  -31.639 1.00 35.56  ? 95  TYR D N     1 
ATOM   4077 C  CA    . TYR D 1 95  ? 17.221  65.222  -32.006 1.00 35.65  ? 95  TYR D CA    1 
ATOM   4078 C  C     . TYR D 1 95  ? 18.107  66.400  -31.637 1.00 37.23  ? 95  TYR D C     1 
ATOM   4079 O  O     . TYR D 1 95  ? 17.989  67.454  -32.234 1.00 38.20  ? 95  TYR D O     1 
ATOM   4080 C  CB    . TYR D 1 95  ? 15.827  65.369  -31.358 1.00 34.51  ? 95  TYR D CB    1 
ATOM   4081 C  CG    . TYR D 1 95  ? 14.834  64.376  -31.923 1.00 35.63  ? 95  TYR D CG    1 
ATOM   4082 C  CD1   . TYR D 1 95  ? 14.153  64.649  -33.122 1.00 36.84  ? 95  TYR D CD1   1 
ATOM   4083 C  CD2   . TYR D 1 95  ? 14.609  63.140  -31.296 1.00 33.98  ? 95  TYR D CD2   1 
ATOM   4084 C  CE1   . TYR D 1 95  ? 13.265  63.723  -33.671 1.00 37.01  ? 95  TYR D CE1   1 
ATOM   4085 C  CE2   . TYR D 1 95  ? 13.716  62.217  -31.829 1.00 34.27  ? 95  TYR D CE2   1 
ATOM   4086 C  CZ    . TYR D 1 95  ? 13.055  62.508  -33.012 1.00 37.07  ? 95  TYR D CZ    1 
ATOM   4087 O  OH    . TYR D 1 95  ? 12.196  61.589  -33.553 1.00 39.29  ? 95  TYR D OH    1 
ATOM   4088 N  N     . SER D 1 96  ? 18.968  66.231  -30.632 1.00 38.29  ? 96  SER D N     1 
ATOM   4089 C  CA    . SER D 1 96  ? 19.952  67.254  -30.286 1.00 40.17  ? 96  SER D CA    1 
ATOM   4090 C  C     . SER D 1 96  ? 21.100  66.677  -29.473 1.00 41.70  ? 96  SER D C     1 
ATOM   4091 O  O     . SER D 1 96  ? 20.891  65.896  -28.551 1.00 47.72  ? 96  SER D O     1 
ATOM   4092 C  CB    . SER D 1 96  ? 19.306  68.383  -29.493 1.00 39.36  ? 96  SER D CB    1 
ATOM   4093 O  OG    . SER D 1 96  ? 20.260  69.376  -29.151 1.00 39.46  ? 96  SER D OG    1 
ATOM   4094 N  N     . GLU D 1 97  ? 22.314  67.070  -29.817 1.00 43.24  ? 97  GLU D N     1 
ATOM   4095 C  CA    . GLU D 1 97  ? 23.480  66.679  -29.040 1.00 43.74  ? 97  GLU D CA    1 
ATOM   4096 C  C     . GLU D 1 97  ? 23.572  67.544  -27.772 1.00 40.36  ? 97  GLU D C     1 
ATOM   4097 O  O     . GLU D 1 97  ? 24.250  67.168  -26.820 1.00 41.34  ? 97  GLU D O     1 
ATOM   4098 C  CB    . GLU D 1 97  ? 24.765  66.690  -29.899 1.00 46.98  ? 97  GLU D CB    1 
ATOM   4099 C  CG    . GLU D 1 97  ? 25.365  68.048  -30.270 1.00 51.23  ? 97  GLU D CG    1 
ATOM   4100 C  CD    . GLU D 1 97  ? 24.535  68.875  -31.255 1.00 56.36  ? 97  GLU D CD    1 
ATOM   4101 O  OE1   . GLU D 1 97  ? 23.468  68.409  -31.725 1.00 56.48  ? 97  GLU D OE1   1 
ATOM   4102 O  OE2   . GLU D 1 97  ? 24.957  70.019  -31.557 1.00 60.14  ? 97  GLU D OE2   1 
ATOM   4103 N  N     . LYS D 1 98  ? 22.859  68.668  -27.734 1.00 34.90  ? 98  LYS D N     1 
ATOM   4104 C  CA    . LYS D 1 98  ? 22.769  69.445  -26.511 1.00 33.34  ? 98  LYS D CA    1 
ATOM   4105 C  C     . LYS D 1 98  ? 21.626  68.931  -25.639 1.00 32.32  ? 98  LYS D C     1 
ATOM   4106 O  O     . LYS D 1 98  ? 20.468  69.329  -25.791 1.00 30.37  ? 98  LYS D O     1 
ATOM   4107 C  CB    . LYS D 1 98  ? 22.605  70.924  -26.821 1.00 35.21  ? 98  LYS D CB    1 
ATOM   4108 C  CG    . LYS D 1 98  ? 23.750  71.498  -27.637 1.00 37.64  ? 98  LYS D CG    1 
ATOM   4109 C  CD    . LYS D 1 98  ? 24.099  72.890  -27.154 1.00 40.36  ? 98  LYS D CD    1 
ATOM   4110 C  CE    . LYS D 1 98  ? 25.283  73.471  -27.901 1.00 41.61  ? 98  LYS D CE    1 
ATOM   4111 N  NZ    . LYS D 1 98  ? 24.817  74.002  -29.206 1.00 43.48  ? 98  LYS D NZ    1 
ATOM   4112 N  N     . ILE D 1 99  ? 21.974  68.030  -24.729 1.00 31.76  ? 99  ILE D N     1 
ATOM   4113 C  CA    . ILE D 1 99  ? 21.004  67.326  -23.939 1.00 32.69  ? 99  ILE D CA    1 
ATOM   4114 C  C     . ILE D 1 99  ? 21.465  67.236  -22.489 1.00 33.25  ? 99  ILE D C     1 
ATOM   4115 O  O     . ILE D 1 99  ? 22.660  67.056  -22.225 1.00 32.44  ? 99  ILE D O     1 
ATOM   4116 C  CB    . ILE D 1 99  ? 20.749  65.919  -24.497 1.00 34.53  ? 99  ILE D CB    1 
ATOM   4117 C  CG1   . ILE D 1 99  ? 19.571  65.272  -23.781 1.00 34.67  ? 99  ILE D CG1   1 
ATOM   4118 C  CG2   . ILE D 1 99  ? 21.997  65.035  -24.378 1.00 36.01  ? 99  ILE D CG2   1 
ATOM   4119 C  CD1   . ILE D 1 99  ? 19.099  63.997  -24.439 1.00 35.27  ? 99  ILE D CD1   1 
ATOM   4120 N  N     . GLU D 1 100 ? 20.496  67.395  -21.584 1.00 30.95  ? 100 GLU D N     1 
ATOM   4121 C  CA    . GLU D 1 100 ? 20.677  67.294  -20.151 1.00 32.44  ? 100 GLU D CA    1 
ATOM   4122 C  C     . GLU D 1 100 ? 19.623  66.323  -19.595 1.00 31.82  ? 100 GLU D C     1 
ATOM   4123 O  O     . GLU D 1 100 ? 18.433  66.643  -19.538 1.00 33.24  ? 100 GLU D O     1 
ATOM   4124 C  CB    . GLU D 1 100 ? 20.526  68.683  -19.517 1.00 33.35  ? 100 GLU D CB    1 
ATOM   4125 C  CG    . GLU D 1 100 ? 20.630  68.717  -18.000 1.00 35.25  ? 100 GLU D CG    1 
ATOM   4126 C  CD    . GLU D 1 100 ? 20.733  70.133  -17.438 1.00 37.77  ? 100 GLU D CD    1 
ATOM   4127 O  OE1   . GLU D 1 100 ? 21.122  71.089  -18.159 1.00 37.17  ? 100 GLU D OE1   1 
ATOM   4128 O  OE2   . GLU D 1 100 ? 20.453  70.292  -16.243 1.00 43.19  ? 100 GLU D OE2   1 
ATOM   4129 N  N     . ILE D 1 101 ? 20.051  65.127  -19.222 1.00 31.32  ? 101 ILE D N     1 
ATOM   4130 C  CA    . ILE D 1 101 ? 19.169  64.152  -18.590 1.00 32.72  ? 101 ILE D CA    1 
ATOM   4131 C  C     . ILE D 1 101 ? 19.087  64.581  -17.126 1.00 33.48  ? 101 ILE D C     1 
ATOM   4132 O  O     . ILE D 1 101 ? 20.108  64.674  -16.447 1.00 34.68  ? 101 ILE D O     1 
ATOM   4133 C  CB    . ILE D 1 101 ? 19.734  62.717  -18.737 1.00 35.66  ? 101 ILE D CB    1 
ATOM   4134 C  CG1   . ILE D 1 101 ? 19.812  62.328  -20.208 1.00 37.08  ? 101 ILE D CG1   1 
ATOM   4135 C  CG2   . ILE D 1 101 ? 18.887  61.684  -18.006 1.00 35.01  ? 101 ILE D CG2   1 
ATOM   4136 C  CD1   . ILE D 1 101 ? 20.637  61.085  -20.448 1.00 40.35  ? 101 ILE D CD1   1 
ATOM   4137 N  N     . ALA D 1 102 ? 17.893  64.885  -16.640 1.00 32.95  ? 102 ALA D N     1 
ATOM   4138 C  CA    . ALA D 1 102 ? 17.760  65.402  -15.291 1.00 32.54  ? 102 ALA D CA    1 
ATOM   4139 C  C     . ALA D 1 102 ? 17.302  64.345  -14.297 1.00 33.26  ? 102 ALA D C     1 
ATOM   4140 O  O     . ALA D 1 102 ? 17.480  64.513  -13.110 1.00 35.38  ? 102 ALA D O     1 
ATOM   4141 C  CB    . ALA D 1 102 ? 16.801  66.578  -15.284 1.00 33.21  ? 102 ALA D CB    1 
ATOM   4142 N  N     . SER D 1 103 ? 16.646  63.296  -14.773 1.00 32.15  ? 103 SER D N     1 
ATOM   4143 C  CA    . SER D 1 103 ? 16.216  62.203  -13.905 1.00 32.10  ? 103 SER D CA    1 
ATOM   4144 C  C     . SER D 1 103 ? 15.890  61.000  -14.764 1.00 28.43  ? 103 SER D C     1 
ATOM   4145 O  O     . SER D 1 103 ? 15.976  61.061  -15.980 1.00 28.23  ? 103 SER D O     1 
ATOM   4146 C  CB    . SER D 1 103 ? 14.997  62.593  -13.052 1.00 32.11  ? 103 SER D CB    1 
ATOM   4147 O  OG    . SER D 1 103 ? 13.792  62.494  -13.799 1.00 33.55  ? 103 SER D OG    1 
ATOM   4148 N  N     . ILE D 1 104 ? 15.478  59.917  -14.134 1.00 27.97  ? 104 ILE D N     1 
ATOM   4149 C  CA    . ILE D 1 104 ? 15.054  58.722  -14.869 1.00 27.84  ? 104 ILE D CA    1 
ATOM   4150 C  C     . ILE D 1 104 ? 13.917  58.972  -15.883 1.00 27.04  ? 104 ILE D C     1 
ATOM   4151 O  O     . ILE D 1 104 ? 13.705  58.156  -16.777 1.00 29.92  ? 104 ILE D O     1 
ATOM   4152 C  CB    . ILE D 1 104 ? 14.653  57.588  -13.885 1.00 28.85  ? 104 ILE D CB    1 
ATOM   4153 C  CG1   . ILE D 1 104 ? 14.567  56.244  -14.638 1.00 29.84  ? 104 ILE D CG1   1 
ATOM   4154 C  CG2   . ILE D 1 104 ? 13.340  57.943  -13.165 1.00 28.64  ? 104 ILE D CG2   1 
ATOM   4155 C  CD1   . ILE D 1 104 ? 14.359  55.019  -13.776 1.00 29.92  ? 104 ILE D CD1   1 
ATOM   4156 N  N     . ASP D 1 105 ? 13.182  60.073  -15.770 1.00 26.44  ? 105 ASP D N     1 
ATOM   4157 C  CA    . ASP D 1 105 ? 12.017  60.289  -16.653 1.00 28.48  ? 105 ASP D CA    1 
ATOM   4158 C  C     . ASP D 1 105 ? 11.890  61.708  -17.281 1.00 27.95  ? 105 ASP D C     1 
ATOM   4159 O  O     . ASP D 1 105 ? 10.851  62.055  -17.852 1.00 27.07  ? 105 ASP D O     1 
ATOM   4160 C  CB    . ASP D 1 105 ? 10.716  59.877  -15.910 1.00 27.45  ? 105 ASP D CB    1 
ATOM   4161 C  CG    . ASP D 1 105 ? 10.001  61.046  -15.274 1.00 28.31  ? 105 ASP D CG    1 
ATOM   4162 O  OD1   . ASP D 1 105 ? 10.681  61.932  -14.710 1.00 29.41  ? 105 ASP D OD1   1 
ATOM   4163 O  OD2   . ASP D 1 105 ? 8.748   61.105  -15.361 1.00 26.33  ? 105 ASP D OD2   1 
ATOM   4164 N  N     . GLU D 1 106 ? 12.950  62.510  -17.216 1.00 28.28  ? 106 GLU D N     1 
ATOM   4165 C  CA    . GLU D 1 106 ? 12.899  63.826  -17.833 1.00 27.89  ? 106 GLU D CA    1 
ATOM   4166 C  C     . GLU D 1 106 ? 14.257  64.322  -18.315 1.00 27.36  ? 106 GLU D C     1 
ATOM   4167 O  O     . GLU D 1 106 ? 15.271  64.031  -17.710 1.00 28.86  ? 106 GLU D O     1 
ATOM   4168 C  CB    . GLU D 1 106 ? 12.235  64.824  -16.882 1.00 29.45  ? 106 GLU D CB    1 
ATOM   4169 C  CG    . GLU D 1 106 ? 13.133  65.319  -15.769 1.00 31.35  ? 106 GLU D CG    1 
ATOM   4170 C  CD    . GLU D 1 106 ? 12.360  66.028  -14.672 1.00 32.98  ? 106 GLU D CD    1 
ATOM   4171 O  OE1   . GLU D 1 106 ? 11.338  65.499  -14.268 1.00 34.93  ? 106 GLU D OE1   1 
ATOM   4172 O  OE2   . GLU D 1 106 ? 12.763  67.122  -14.217 1.00 34.17  ? 106 GLU D OE2   1 
ATOM   4173 N  N     . ALA D 1 107 ? 14.239  65.083  -19.415 1.00 26.74  ? 107 ALA D N     1 
ATOM   4174 C  CA    . ALA D 1 107 ? 15.427  65.580  -20.098 1.00 25.72  ? 107 ALA D CA    1 
ATOM   4175 C  C     . ALA D 1 107 ? 15.128  66.892  -20.806 1.00 26.12  ? 107 ALA D C     1 
ATOM   4176 O  O     . ALA D 1 107 ? 14.011  67.123  -21.294 1.00 25.23  ? 107 ALA D O     1 
ATOM   4177 C  CB    . ALA D 1 107 ? 15.916  64.571  -21.119 1.00 25.75  ? 107 ALA D CB    1 
ATOM   4178 N  N     . TYR D 1 108 ? 16.150  67.734  -20.871 1.00 26.26  ? 108 TYR D N     1 
ATOM   4179 C  CA    . TYR D 1 108 ? 16.103  68.964  -21.619 1.00 26.98  ? 108 TYR D CA    1 
ATOM   4180 C  C     . TYR D 1 108 ? 16.932  68.820  -22.907 1.00 27.59  ? 108 TYR D C     1 
ATOM   4181 O  O     . TYR D 1 108 ? 18.009  68.217  -22.911 1.00 27.42  ? 108 TYR D O     1 
ATOM   4182 C  CB    . TYR D 1 108 ? 16.636  70.111  -20.781 1.00 27.68  ? 108 TYR D CB    1 
ATOM   4183 C  CG    . TYR D 1 108 ? 15.926  70.332  -19.455 1.00 27.80  ? 108 TYR D CG    1 
ATOM   4184 C  CD1   . TYR D 1 108 ? 16.292  69.606  -18.313 1.00 28.30  ? 108 TYR D CD1   1 
ATOM   4185 C  CD2   . TYR D 1 108 ? 14.938  71.295  -19.324 1.00 27.81  ? 108 TYR D CD2   1 
ATOM   4186 C  CE1   . TYR D 1 108 ? 15.669  69.815  -17.091 1.00 27.80  ? 108 TYR D CE1   1 
ATOM   4187 C  CE2   . TYR D 1 108 ? 14.309  71.522  -18.103 1.00 29.20  ? 108 TYR D CE2   1 
ATOM   4188 C  CZ    . TYR D 1 108 ? 14.672  70.779  -16.984 1.00 28.95  ? 108 TYR D CZ    1 
ATOM   4189 O  OH    . TYR D 1 108 ? 14.034  71.005  -15.775 1.00 27.17  ? 108 TYR D OH    1 
ATOM   4190 N  N     . LEU D 1 109 ? 16.393  69.351  -24.000 1.00 27.28  ? 109 LEU D N     1 
ATOM   4191 C  CA    . LEU D 1 109 ? 17.110  69.475  -25.261 1.00 27.72  ? 109 LEU D CA    1 
ATOM   4192 C  C     . LEU D 1 109 ? 17.197  70.967  -25.619 1.00 28.02  ? 109 LEU D C     1 
ATOM   4193 O  O     . LEU D 1 109 ? 16.181  71.688  -25.582 1.00 26.90  ? 109 LEU D O     1 
ATOM   4194 C  CB    . LEU D 1 109 ? 16.362  68.732  -26.370 1.00 30.00  ? 109 LEU D CB    1 
ATOM   4195 C  CG    . LEU D 1 109 ? 16.357  67.195  -26.456 1.00 31.55  ? 109 LEU D CG    1 
ATOM   4196 C  CD1   . LEU D 1 109 ? 15.830  66.517  -25.211 1.00 32.20  ? 109 LEU D CD1   1 
ATOM   4197 C  CD2   . LEU D 1 109 ? 15.516  66.746  -27.641 1.00 33.69  ? 109 LEU D CD2   1 
ATOM   4198 N  N     . ASP D 1 110 ? 18.405  71.431  -25.937 1.00 27.47  ? 110 ASP D N     1 
ATOM   4199 C  CA    . ASP D 1 110 ? 18.585  72.734  -26.560 1.00 28.00  ? 110 ASP D CA    1 
ATOM   4200 C  C     . ASP D 1 110 ? 18.425  72.555  -28.069 1.00 28.16  ? 110 ASP D C     1 
ATOM   4201 O  O     . ASP D 1 110 ? 19.273  71.939  -28.753 1.00 26.56  ? 110 ASP D O     1 
ATOM   4202 C  CB    . ASP D 1 110 ? 19.959  73.305  -26.234 1.00 29.04  ? 110 ASP D CB    1 
ATOM   4203 C  CG    . ASP D 1 110 ? 20.127  74.749  -26.686 1.00 31.59  ? 110 ASP D CG    1 
ATOM   4204 O  OD1   . ASP D 1 110 ? 19.555  75.137  -27.732 1.00 31.71  ? 110 ASP D OD1   1 
ATOM   4205 O  OD2   . ASP D 1 110 ? 20.860  75.496  -25.977 1.00 32.33  ? 110 ASP D OD2   1 
ATOM   4206 N  N     . ILE D 1 111 ? 17.353  73.128  -28.589 1.00 28.15  ? 111 ILE D N     1 
ATOM   4207 C  CA    . ILE D 1 111 ? 17.079  73.047  -30.013 1.00 29.02  ? 111 ILE D CA    1 
ATOM   4208 C  C     . ILE D 1 111 ? 17.168  74.401  -30.717 1.00 29.16  ? 111 ILE D C     1 
ATOM   4209 O  O     . ILE D 1 111 ? 16.700  74.546  -31.851 1.00 31.00  ? 111 ILE D O     1 
ATOM   4210 C  CB    . ILE D 1 111 ? 15.723  72.351  -30.276 1.00 28.88  ? 111 ILE D CB    1 
ATOM   4211 C  CG1   . ILE D 1 111 ? 14.580  73.037  -29.523 1.00 29.17  ? 111 ILE D CG1   1 
ATOM   4212 C  CG2   . ILE D 1 111 ? 15.805  70.892  -29.855 1.00 28.88  ? 111 ILE D CG2   1 
ATOM   4213 C  CD1   . ILE D 1 111 ? 13.208  72.637  -30.025 1.00 29.56  ? 111 ILE D CD1   1 
ATOM   4214 N  N     . SER D 1 112 ? 17.799  75.374  -30.066 1.00 27.91  ? 112 SER D N     1 
ATOM   4215 C  CA    . SER D 1 112 ? 18.012  76.708  -30.646 1.00 28.72  ? 112 SER D CA    1 
ATOM   4216 C  C     . SER D 1 112 ? 18.504  76.642  -32.077 1.00 28.65  ? 112 SER D C     1 
ATOM   4217 O  O     . SER D 1 112 ? 17.992  77.325  -32.929 1.00 28.37  ? 112 SER D O     1 
ATOM   4218 C  CB    . SER D 1 112 ? 19.060  77.493  -29.828 1.00 28.27  ? 112 SER D CB    1 
ATOM   4219 O  OG    . SER D 1 112 ? 18.701  77.508  -28.468 1.00 26.71  ? 112 SER D OG    1 
ATOM   4220 N  N     . ASP D 1 113 ? 19.501  75.798  -32.310 1.00 29.37  ? 113 ASP D N     1 
ATOM   4221 C  CA    . ASP D 1 113 ? 20.173  75.677  -33.618 1.00 30.82  ? 113 ASP D CA    1 
ATOM   4222 C  C     . ASP D 1 113 ? 19.622  74.530  -34.457 1.00 31.38  ? 113 ASP D C     1 
ATOM   4223 O  O     . ASP D 1 113 ? 20.228  74.168  -35.451 1.00 31.85  ? 113 ASP D O     1 
ATOM   4224 C  CB    . ASP D 1 113 ? 21.693  75.489  -33.412 1.00 30.75  ? 113 ASP D CB    1 
ATOM   4225 C  CG    . ASP D 1 113 ? 22.328  76.630  -32.605 1.00 30.73  ? 113 ASP D CG    1 
ATOM   4226 O  OD1   . ASP D 1 113 ? 21.654  77.619  -32.334 1.00 31.29  ? 113 ASP D OD1   1 
ATOM   4227 O  OD2   . ASP D 1 113 ? 23.519  76.563  -32.267 1.00 31.70  ? 113 ASP D OD2   1 
ATOM   4228 N  N     . LYS D 1 114 ? 18.472  73.974  -34.066 1.00 32.12  ? 114 LYS D N     1 
ATOM   4229 C  CA    . LYS D 1 114 ? 17.813  72.903  -34.837 1.00 33.18  ? 114 LYS D CA    1 
ATOM   4230 C  C     . LYS D 1 114 ? 16.476  73.342  -35.438 1.00 33.63  ? 114 LYS D C     1 
ATOM   4231 O  O     . LYS D 1 114 ? 15.992  72.721  -36.380 1.00 32.92  ? 114 LYS D O     1 
ATOM   4232 C  CB    . LYS D 1 114 ? 17.560  71.663  -33.971 1.00 33.56  ? 114 LYS D CB    1 
ATOM   4233 C  CG    . LYS D 1 114 ? 18.756  71.120  -33.201 1.00 34.69  ? 114 LYS D CG    1 
ATOM   4234 C  CD    . LYS D 1 114 ? 19.863  70.578  -34.095 1.00 37.73  ? 114 LYS D CD    1 
ATOM   4235 C  CE    . LYS D 1 114 ? 19.442  69.333  -34.858 1.00 39.22  ? 114 LYS D CE    1 
ATOM   4236 N  NZ    . LYS D 1 114 ? 20.601  68.729  -35.574 1.00 41.25  ? 114 LYS D NZ    1 
ATOM   4237 N  N     . VAL D 1 115 ? 15.867  74.387  -34.879 1.00 33.85  ? 115 VAL D N     1 
ATOM   4238 C  CA    . VAL D 1 115 ? 14.601  74.908  -35.379 1.00 34.47  ? 115 VAL D CA    1 
ATOM   4239 C  C     . VAL D 1 115 ? 14.625  76.439  -35.375 1.00 35.52  ? 115 VAL D C     1 
ATOM   4240 O  O     . VAL D 1 115 ? 15.382  77.048  -34.628 1.00 35.03  ? 115 VAL D O     1 
ATOM   4241 C  CB    . VAL D 1 115 ? 13.390  74.375  -34.566 1.00 33.21  ? 115 VAL D CB    1 
ATOM   4242 C  CG1   . VAL D 1 115 ? 13.320  72.846  -34.629 1.00 33.87  ? 115 VAL D CG1   1 
ATOM   4243 C  CG2   . VAL D 1 115 ? 13.414  74.852  -33.128 1.00 32.45  ? 115 VAL D CG2   1 
ATOM   4244 N  N     . ARG D 1 116 ? 13.796  77.044  -36.216 1.00 38.21  ? 116 ARG D N     1 
ATOM   4245 C  CA    . ARG D 1 116 ? 13.789  78.507  -36.406 1.00 41.40  ? 116 ARG D CA    1 
ATOM   4246 C  C     . ARG D 1 116 ? 13.050  79.271  -35.320 1.00 39.95  ? 116 ARG D C     1 
ATOM   4247 O  O     . ARG D 1 116 ? 13.387  80.408  -35.018 1.00 39.98  ? 116 ARG D O     1 
ATOM   4248 C  CB    . ARG D 1 116 ? 13.101  78.878  -37.718 1.00 45.34  ? 116 ARG D CB    1 
ATOM   4249 C  CG    . ARG D 1 116 ? 13.917  78.665  -38.975 1.00 50.75  ? 116 ARG D CG    1 
ATOM   4250 C  CD    . ARG D 1 116 ? 13.327  79.478  -40.112 1.00 55.64  ? 116 ARG D CD    1 
ATOM   4251 N  NE    . ARG D 1 116 ? 12.036  78.963  -40.574 1.00 59.20  ? 116 ARG D NE    1 
ATOM   4252 C  CZ    . ARG D 1 116 ? 11.238  79.577  -41.454 1.00 63.53  ? 116 ARG D CZ    1 
ATOM   4253 N  NH1   . ARG D 1 116 ? 11.565  80.758  -41.978 1.00 66.62  ? 116 ARG D NH1   1 
ATOM   4254 N  NH2   . ARG D 1 116 ? 10.089  79.012  -41.807 1.00 65.78  ? 116 ARG D NH2   1 
ATOM   4255 N  N     . ASP D 1 117 ? 12.000  78.659  -34.794 1.00 37.47  ? 117 ASP D N     1 
ATOM   4256 C  CA    . ASP D 1 117 ? 11.009  79.356  -33.989 1.00 36.55  ? 117 ASP D CA    1 
ATOM   4257 C  C     . ASP D 1 117 ? 10.151  78.324  -33.236 1.00 35.58  ? 117 ASP D C     1 
ATOM   4258 O  O     . ASP D 1 117 ? 10.370  77.110  -33.374 1.00 33.42  ? 117 ASP D O     1 
ATOM   4259 C  CB    . ASP D 1 117 ? 10.141  80.230  -34.909 1.00 37.94  ? 117 ASP D CB    1 
ATOM   4260 C  CG    . ASP D 1 117 ? 9.479   79.434  -36.014 1.00 38.65  ? 117 ASP D CG    1 
ATOM   4261 O  OD1   . ASP D 1 117 ? 9.059   78.299  -35.748 1.00 38.07  ? 117 ASP D OD1   1 
ATOM   4262 O  OD2   . ASP D 1 117 ? 9.355   79.939  -37.147 1.00 41.33  ? 117 ASP D OD2   1 
ATOM   4263 N  N     . TYR D 1 118 ? 9.182   78.803  -32.454 1.00 35.48  ? 118 TYR D N     1 
ATOM   4264 C  CA    . TYR D 1 118 ? 8.396   77.932  -31.579 1.00 34.37  ? 118 TYR D CA    1 
ATOM   4265 C  C     . TYR D 1 118 ? 7.415   77.084  -32.367 1.00 34.84  ? 118 TYR D C     1 
ATOM   4266 O  O     . TYR D 1 118 ? 6.988   76.030  -31.897 1.00 34.43  ? 118 TYR D O     1 
ATOM   4267 C  CB    . TYR D 1 118 ? 7.653   78.730  -30.503 1.00 33.81  ? 118 TYR D CB    1 
ATOM   4268 C  CG    . TYR D 1 118 ? 8.530   79.296  -29.409 1.00 33.67  ? 118 TYR D CG    1 
ATOM   4269 C  CD1   . TYR D 1 118 ? 9.487   78.504  -28.766 1.00 32.98  ? 118 TYR D CD1   1 
ATOM   4270 C  CD2   . TYR D 1 118 ? 8.404   80.623  -29.005 1.00 34.88  ? 118 TYR D CD2   1 
ATOM   4271 C  CE1   . TYR D 1 118 ? 10.285  79.020  -27.765 1.00 33.06  ? 118 TYR D CE1   1 
ATOM   4272 C  CE2   . TYR D 1 118 ? 9.209   81.150  -28.005 1.00 35.25  ? 118 TYR D CE2   1 
ATOM   4273 C  CZ    . TYR D 1 118 ? 10.145  80.340  -27.386 1.00 34.67  ? 118 TYR D CZ    1 
ATOM   4274 O  OH    . TYR D 1 118 ? 10.951  80.847  -26.378 1.00 37.20  ? 118 TYR D OH    1 
ATOM   4275 N  N     . ARG D 1 119 ? 7.070   77.540  -33.566 1.00 35.18  ? 119 ARG D N     1 
ATOM   4276 C  CA    . ARG D 1 119 ? 6.225   76.767  -34.461 1.00 36.03  ? 119 ARG D CA    1 
ATOM   4277 C  C     . ARG D 1 119 ? 6.910   75.494  -34.976 1.00 34.19  ? 119 ARG D C     1 
ATOM   4278 O  O     . ARG D 1 119 ? 6.303   74.420  -35.000 1.00 32.80  ? 119 ARG D O     1 
ATOM   4279 C  CB    . ARG D 1 119 ? 5.775   77.635  -35.624 1.00 39.01  ? 119 ARG D CB    1 
ATOM   4280 C  CG    . ARG D 1 119 ? 4.829   76.926  -36.550 1.00 41.48  ? 119 ARG D CG    1 
ATOM   4281 C  CD    . ARG D 1 119 ? 4.021   77.950  -37.281 1.00 46.16  ? 119 ARG D CD    1 
ATOM   4282 N  NE    . ARG D 1 119 ? 3.270   77.345  -38.355 1.00 49.31  ? 119 ARG D NE    1 
ATOM   4283 C  CZ    . ARG D 1 119 ? 2.326   77.966  -39.044 1.00 51.18  ? 119 ARG D CZ    1 
ATOM   4284 N  NH1   . ARG D 1 119 ? 2.007   79.225  -38.769 1.00 51.01  ? 119 ARG D NH1   1 
ATOM   4285 N  NH2   . ARG D 1 119 ? 1.703   77.313  -40.015 1.00 53.48  ? 119 ARG D NH2   1 
ATOM   4286 N  N     . GLU D 1 120 ? 8.170   75.604  -35.376 1.00 33.29  ? 120 GLU D N     1 
ATOM   4287 C  CA    . GLU D 1 120 ? 8.929   74.412  -35.724 1.00 33.42  ? 120 GLU D CA    1 
ATOM   4288 C  C     . GLU D 1 120 ? 9.238   73.590  -34.478 1.00 31.83  ? 120 GLU D C     1 
ATOM   4289 O  O     . GLU D 1 120 ? 9.251   72.365  -34.565 1.00 31.63  ? 120 GLU D O     1 
ATOM   4290 C  CB    . GLU D 1 120 ? 10.212  74.746  -36.495 1.00 34.37  ? 120 GLU D CB    1 
ATOM   4291 C  CG    . GLU D 1 120 ? 9.948   75.158  -37.943 1.00 36.63  ? 120 GLU D CG    1 
ATOM   4292 C  CD    . GLU D 1 120 ? 11.211  75.509  -38.730 1.00 38.34  ? 120 GLU D CD    1 
ATOM   4293 O  OE1   . GLU D 1 120 ? 12.350  75.459  -38.184 1.00 36.89  ? 120 GLU D OE1   1 
ATOM   4294 O  OE2   . GLU D 1 120 ? 11.049  75.847  -39.923 1.00 43.50  ? 120 GLU D OE2   1 
ATOM   4295 N  N     . ALA D 1 121 ? 9.473   74.252  -33.335 1.00 30.75  ? 121 ALA D N     1 
ATOM   4296 C  CA    . ALA D 1 121 ? 9.664   73.548  -32.059 1.00 30.64  ? 121 ALA D CA    1 
ATOM   4297 C  C     . ALA D 1 121 ? 8.443   72.675  -31.763 1.00 30.51  ? 121 ALA D C     1 
ATOM   4298 O  O     . ALA D 1 121 ? 8.578   71.493  -31.497 1.00 30.18  ? 121 ALA D O     1 
ATOM   4299 C  CB    . ALA D 1 121 ? 9.896   74.524  -30.907 1.00 30.38  ? 121 ALA D CB    1 
ATOM   4300 N  N     . TYR D 1 122 ? 7.261   73.272  -31.838 1.00 31.93  ? 122 TYR D N     1 
ATOM   4301 C  CA    . TYR D 1 122 ? 6.013   72.561  -31.593 1.00 32.82  ? 122 TYR D CA    1 
ATOM   4302 C  C     . TYR D 1 122 ? 5.962   71.272  -32.408 1.00 33.98  ? 122 TYR D C     1 
ATOM   4303 O  O     . TYR D 1 122 ? 5.717   70.189  -31.853 1.00 34.34  ? 122 TYR D O     1 
ATOM   4304 C  CB    . TYR D 1 122 ? 4.798   73.435  -31.920 1.00 34.71  ? 122 TYR D CB    1 
ATOM   4305 C  CG    . TYR D 1 122 ? 3.508   72.868  -31.373 1.00 35.53  ? 122 TYR D CG    1 
ATOM   4306 C  CD1   . TYR D 1 122 ? 2.812   71.871  -32.059 1.00 36.95  ? 122 TYR D CD1   1 
ATOM   4307 C  CD2   . TYR D 1 122 ? 3.009   73.291  -30.152 1.00 36.01  ? 122 TYR D CD2   1 
ATOM   4308 C  CE1   . TYR D 1 122 ? 1.650   71.327  -31.540 1.00 37.70  ? 122 TYR D CE1   1 
ATOM   4309 C  CE2   . TYR D 1 122 ? 1.840   72.764  -29.629 1.00 36.96  ? 122 TYR D CE2   1 
ATOM   4310 C  CZ    . TYR D 1 122 ? 1.169   71.780  -30.326 1.00 37.71  ? 122 TYR D CZ    1 
ATOM   4311 O  OH    . TYR D 1 122 ? 0.011   71.266  -29.812 1.00 39.55  ? 122 TYR D OH    1 
ATOM   4312 N  N     . ASN D 1 123 ? 6.223   71.387  -33.713 1.00 33.66  ? 123 ASN D N     1 
ATOM   4313 C  CA    . ASN D 1 123 ? 6.189   70.228  -34.602 1.00 33.64  ? 123 ASN D CA    1 
ATOM   4314 C  C     . ASN D 1 123 ? 7.256   69.187  -34.307 1.00 31.71  ? 123 ASN D C     1 
ATOM   4315 O  O     . ASN D 1 123 ? 7.009   67.986  -34.441 1.00 29.44  ? 123 ASN D O     1 
ATOM   4316 C  CB    . ASN D 1 123 ? 6.214   70.653  -36.077 1.00 36.04  ? 123 ASN D CB    1 
ATOM   4317 C  CG    . ASN D 1 123 ? 4.833   71.043  -36.575 1.00 40.21  ? 123 ASN D CG    1 
ATOM   4318 O  OD1   . ASN D 1 123 ? 3.991   70.184  -36.848 1.00 43.28  ? 123 ASN D OD1   1 
ATOM   4319 N  ND2   . ASN D 1 123 ? 4.579   72.342  -36.666 1.00 42.67  ? 123 ASN D ND2   1 
ATOM   4320 N  N     . LEU D 1 124 ? 8.437   69.640  -33.913 1.00 31.26  ? 124 LEU D N     1 
ATOM   4321 C  CA    . LEU D 1 124 ? 9.483   68.713  -33.487 1.00 32.07  ? 124 LEU D CA    1 
ATOM   4322 C  C     . LEU D 1 124 ? 9.011   67.969  -32.237 1.00 30.42  ? 124 LEU D C     1 
ATOM   4323 O  O     . LEU D 1 124 ? 9.218   66.775  -32.109 1.00 30.99  ? 124 LEU D O     1 
ATOM   4324 C  CB    . LEU D 1 124 ? 10.808  69.442  -33.222 1.00 33.10  ? 124 LEU D CB    1 
ATOM   4325 C  CG    . LEU D 1 124 ? 12.012  68.504  -33.036 1.00 34.49  ? 124 LEU D CG    1 
ATOM   4326 C  CD1   . LEU D 1 124 ? 12.387  67.886  -34.380 1.00 36.63  ? 124 LEU D CD1   1 
ATOM   4327 C  CD2   . LEU D 1 124 ? 13.199  69.252  -32.441 1.00 34.63  ? 124 LEU D CD2   1 
ATOM   4328 N  N     . GLY D 1 125 ? 8.338   68.683  -31.344 1.00 30.57  ? 125 GLY D N     1 
ATOM   4329 C  CA    . GLY D 1 125 ? 7.780   68.090  -30.143 1.00 29.52  ? 125 GLY D CA    1 
ATOM   4330 C  C     . GLY D 1 125 ? 6.808   66.976  -30.458 1.00 28.75  ? 125 GLY D C     1 
ATOM   4331 O  O     . GLY D 1 125 ? 6.903   65.906  -29.880 1.00 28.97  ? 125 GLY D O     1 
ATOM   4332 N  N     . LEU D 1 126 ? 5.892   67.209  -31.393 1.00 29.08  ? 126 LEU D N     1 
ATOM   4333 C  CA    . LEU D 1 126 ? 5.011   66.142  -31.873 1.00 29.81  ? 126 LEU D CA    1 
ATOM   4334 C  C     . LEU D 1 126 ? 5.779   64.985  -32.508 1.00 30.26  ? 126 LEU D C     1 
ATOM   4335 O  O     . LEU D 1 126 ? 5.415   63.824  -32.321 1.00 29.64  ? 126 LEU D O     1 
ATOM   4336 C  CB    . LEU D 1 126 ? 4.014   66.654  -32.896 1.00 30.49  ? 126 LEU D CB    1 
ATOM   4337 C  CG    . LEU D 1 126 ? 3.060   67.759  -32.472 1.00 31.70  ? 126 LEU D CG    1 
ATOM   4338 C  CD1   . LEU D 1 126 ? 2.215   68.168  -33.685 1.00 32.78  ? 126 LEU D CD1   1 
ATOM   4339 C  CD2   . LEU D 1 126 ? 2.193   67.328  -31.302 1.00 30.86  ? 126 LEU D CD2   1 
ATOM   4340 N  N     . GLU D 1 127 ? 6.823   65.287  -33.279 1.00 30.33  ? 127 GLU D N     1 
ATOM   4341 C  CA    . GLU D 1 127 ? 7.637   64.224  -33.853 1.00 31.00  ? 127 GLU D CA    1 
ATOM   4342 C  C     . GLU D 1 127 ? 8.253   63.387  -32.748 1.00 29.84  ? 127 GLU D C     1 
ATOM   4343 O  O     . GLU D 1 127 ? 8.209   62.154  -32.792 1.00 28.37  ? 127 GLU D O     1 
ATOM   4344 C  CB    . GLU D 1 127 ? 8.716   64.775  -34.779 1.00 34.16  ? 127 GLU D CB    1 
ATOM   4345 C  CG    . GLU D 1 127 ? 8.160   65.176  -36.132 1.00 38.78  ? 127 GLU D CG    1 
ATOM   4346 C  CD    . GLU D 1 127 ? 9.179   65.808  -37.066 1.00 40.90  ? 127 GLU D CD    1 
ATOM   4347 O  OE1   . GLU D 1 127 ? 10.404  65.728  -36.795 1.00 42.75  ? 127 GLU D OE1   1 
ATOM   4348 O  OE2   . GLU D 1 127 ? 8.728   66.382  -38.083 1.00 42.62  ? 127 GLU D OE2   1 
ATOM   4349 N  N     . ILE D 1 128 ? 8.815   64.059  -31.747 1.00 29.59  ? 128 ILE D N     1 
ATOM   4350 C  CA    . ILE D 1 128 ? 9.412   63.366  -30.607 1.00 29.33  ? 128 ILE D CA    1 
ATOM   4351 C  C     . ILE D 1 128 ? 8.391   62.460  -29.911 1.00 28.78  ? 128 ILE D C     1 
ATOM   4352 O  O     . ILE D 1 128 ? 8.695   61.315  -29.618 1.00 28.49  ? 128 ILE D O     1 
ATOM   4353 C  CB    . ILE D 1 128 ? 10.065  64.356  -29.616 1.00 29.76  ? 128 ILE D CB    1 
ATOM   4354 C  CG1   . ILE D 1 128 ? 11.363  64.896  -30.240 1.00 30.28  ? 128 ILE D CG1   1 
ATOM   4355 C  CG2   . ILE D 1 128 ? 10.354  63.690  -28.276 1.00 28.31  ? 128 ILE D CG2   1 
ATOM   4356 C  CD1   . ILE D 1 128 ? 11.870  66.170  -29.613 1.00 30.76  ? 128 ILE D CD1   1 
ATOM   4357 N  N     . LYS D 1 129 ? 7.195   62.983  -29.665 1.00 28.78  ? 129 LYS D N     1 
ATOM   4358 C  CA    . LYS D 1 129 ? 6.137   62.240  -29.001 1.00 29.13  ? 129 LYS D CA    1 
ATOM   4359 C  C     . LYS D 1 129 ? 5.768   60.968  -29.783 1.00 30.52  ? 129 LYS D C     1 
ATOM   4360 O  O     . LYS D 1 129 ? 5.781   59.866  -29.253 1.00 30.57  ? 129 LYS D O     1 
ATOM   4361 C  CB    . LYS D 1 129 ? 4.911   63.136  -28.770 1.00 27.79  ? 129 LYS D CB    1 
ATOM   4362 C  CG    . LYS D 1 129 ? 5.094   64.075  -27.583 1.00 27.23  ? 129 LYS D CG    1 
ATOM   4363 C  CD    . LYS D 1 129 ? 4.137   65.257  -27.551 1.00 26.57  ? 129 LYS D CD    1 
ATOM   4364 C  CE    . LYS D 1 129 ? 2.668   64.851  -27.429 1.00 27.17  ? 129 LYS D CE    1 
ATOM   4365 N  NZ    . LYS D 1 129 ? 2.377   63.986  -26.257 1.00 26.75  ? 129 LYS D NZ    1 
ATOM   4366 N  N     . ASN D 1 130 ? 5.454   61.127  -31.047 1.00 32.82  ? 130 ASN D N     1 
ATOM   4367 C  CA    . ASN D 1 130 ? 5.249   59.976  -31.923 1.00 34.87  ? 130 ASN D CA    1 
ATOM   4368 C  C     . ASN D 1 130 ? 6.349   58.930  -31.922 1.00 34.92  ? 130 ASN D C     1 
ATOM   4369 O  O     . ASN D 1 130 ? 6.081   57.729  -31.883 1.00 34.28  ? 130 ASN D O     1 
ATOM   4370 C  CB    . ASN D 1 130 ? 5.093   60.448  -33.345 1.00 37.29  ? 130 ASN D CB    1 
ATOM   4371 C  CG    . ASN D 1 130 ? 3.677   60.724  -33.680 1.00 41.91  ? 130 ASN D CG    1 
ATOM   4372 O  OD1   . ASN D 1 130 ? 3.085   61.696  -33.201 1.00 45.43  ? 130 ASN D OD1   1 
ATOM   4373 N  ND2   . ASN D 1 130 ? 3.099   59.855  -34.499 1.00 45.40  ? 130 ASN D ND2   1 
ATOM   4374 N  N     . LYS D 1 131 ? 7.591   59.382  -31.999 1.00 33.95  ? 131 LYS D N     1 
ATOM   4375 C  CA    . LYS D 1 131 ? 8.711   58.466  -32.052 1.00 34.65  ? 131 LYS D CA    1 
ATOM   4376 C  C     . LYS D 1 131 ? 8.774   57.610  -30.790 1.00 32.88  ? 131 LYS D C     1 
ATOM   4377 O  O     . LYS D 1 131 ? 8.913   56.387  -30.867 1.00 30.19  ? 131 LYS D O     1 
ATOM   4378 C  CB    . LYS D 1 131 ? 10.014  59.247  -32.251 1.00 36.58  ? 131 LYS D CB    1 
ATOM   4379 C  CG    . LYS D 1 131 ? 11.254  58.388  -32.386 1.00 38.69  ? 131 LYS D CG    1 
ATOM   4380 C  CD    . LYS D 1 131 ? 11.196  57.492  -33.620 1.00 41.82  ? 131 LYS D CD    1 
ATOM   4381 C  CE    . LYS D 1 131 ? 12.521  56.766  -33.824 1.00 44.21  ? 131 LYS D CE    1 
ATOM   4382 N  NZ    . LYS D 1 131 ? 12.661  56.196  -35.195 1.00 44.96  ? 131 LYS D NZ    1 
ATOM   4383 N  N     . ILE D 1 132 ? 8.669   58.256  -29.626 1.00 32.15  ? 132 ILE D N     1 
ATOM   4384 C  CA    . ILE D 1 132 ? 8.678   57.536  -28.351 1.00 30.77  ? 132 ILE D CA    1 
ATOM   4385 C  C     . ILE D 1 132 ? 7.465   56.587  -28.251 1.00 31.42  ? 132 ILE D C     1 
ATOM   4386 O  O     . ILE D 1 132 ? 7.603   55.440  -27.775 1.00 30.36  ? 132 ILE D O     1 
ATOM   4387 C  CB    . ILE D 1 132 ? 8.755   58.510  -27.150 1.00 31.11  ? 132 ILE D CB    1 
ATOM   4388 C  CG1   . ILE D 1 132 ? 10.102  59.261  -27.165 1.00 31.23  ? 132 ILE D CG1   1 
ATOM   4389 C  CG2   . ILE D 1 132 ? 8.630   57.779  -25.834 1.00 29.67  ? 132 ILE D CG2   1 
ATOM   4390 C  CD1   . ILE D 1 132 ? 10.147  60.470  -26.254 1.00 31.08  ? 132 ILE D CD1   1 
ATOM   4391 N  N     . LEU D 1 133 ? 6.299   57.024  -28.730 1.00 30.68  ? 133 LEU D N     1 
ATOM   4392 C  CA    . LEU D 1 133 ? 5.110   56.159  -28.687 1.00 33.02  ? 133 LEU D CA    1 
ATOM   4393 C  C     . LEU D 1 133 ? 5.311   54.950  -29.591 1.00 34.03  ? 133 LEU D C     1 
ATOM   4394 O  O     . LEU D 1 133 ? 5.075   53.825  -29.183 1.00 32.79  ? 133 LEU D O     1 
ATOM   4395 C  CB    . LEU D 1 133 ? 3.851   56.938  -29.073 1.00 34.26  ? 133 LEU D CB    1 
ATOM   4396 C  CG    . LEU D 1 133 ? 2.480   56.233  -28.981 1.00 35.36  ? 133 LEU D CG    1 
ATOM   4397 C  CD1   . LEU D 1 133 ? 2.154   55.842  -27.549 1.00 34.11  ? 133 LEU D CD1   1 
ATOM   4398 C  CD2   . LEU D 1 133 ? 1.362   57.116  -29.547 1.00 34.68  ? 133 LEU D CD2   1 
ATOM   4399 N  N     . GLU D 1 134 ? 5.789   55.185  -30.807 1.00 36.75  ? 134 GLU D N     1 
ATOM   4400 C  CA    . GLU D 1 134 ? 6.081   54.105  -31.763 1.00 39.05  ? 134 GLU D CA    1 
ATOM   4401 C  C     . GLU D 1 134 ? 7.069   53.063  -31.215 1.00 37.25  ? 134 GLU D C     1 
ATOM   4402 O  O     . GLU D 1 134 ? 6.833   51.863  -31.306 1.00 34.88  ? 134 GLU D O     1 
ATOM   4403 C  CB    . GLU D 1 134 ? 6.636   54.682  -33.073 1.00 43.52  ? 134 GLU D CB    1 
ATOM   4404 C  CG    . GLU D 1 134 ? 7.435   53.667  -33.899 1.00 49.09  ? 134 GLU D CG    1 
ATOM   4405 C  CD    . GLU D 1 134 ? 8.003   54.236  -35.182 1.00 53.05  ? 134 GLU D CD    1 
ATOM   4406 O  OE1   . GLU D 1 134 ? 8.853   55.160  -35.115 1.00 54.15  ? 134 GLU D OE1   1 
ATOM   4407 O  OE2   . GLU D 1 134 ? 7.613   53.734  -36.258 1.00 56.54  ? 134 GLU D OE2   1 
ATOM   4408 N  N     . LYS D 1 135 ? 8.167   53.537  -30.646 1.00 35.86  ? 135 LYS D N     1 
ATOM   4409 C  CA    . LYS D 1 135 ? 9.270   52.674  -30.256 1.00 36.92  ? 135 LYS D CA    1 
ATOM   4410 C  C     . LYS D 1 135 ? 9.155   52.066  -28.870 1.00 36.57  ? 135 LYS D C     1 
ATOM   4411 O  O     . LYS D 1 135 ? 9.733   51.010  -28.615 1.00 37.68  ? 135 LYS D O     1 
ATOM   4412 C  CB    . LYS D 1 135 ? 10.577  53.460  -30.309 1.00 38.99  ? 135 LYS D CB    1 
ATOM   4413 C  CG    . LYS D 1 135 ? 10.886  54.075  -31.660 1.00 41.94  ? 135 LYS D CG    1 
ATOM   4414 C  CD    . LYS D 1 135 ? 11.147  53.042  -32.731 1.00 44.87  ? 135 LYS D CD    1 
ATOM   4415 C  CE    . LYS D 1 135 ? 12.387  52.224  -32.422 1.00 47.81  ? 135 LYS D CE    1 
ATOM   4416 N  NZ    . LYS D 1 135 ? 12.928  51.637  -33.690 1.00 52.36  ? 135 LYS D NZ    1 
ATOM   4417 N  N     . GLU D 1 136 ? 8.474   52.748  -27.954 1.00 36.01  ? 136 GLU D N     1 
ATOM   4418 C  CA    . GLU D 1 136 ? 8.374   52.270  -26.566 1.00 36.18  ? 136 GLU D CA    1 
ATOM   4419 C  C     . GLU D 1 136 ? 6.950   52.256  -25.994 1.00 36.15  ? 136 GLU D C     1 
ATOM   4420 O  O     . GLU D 1 136 ? 6.762   51.805  -24.868 1.00 36.39  ? 136 GLU D O     1 
ATOM   4421 C  CB    . GLU D 1 136 ? 9.293   53.084  -25.647 1.00 35.26  ? 136 GLU D CB    1 
ATOM   4422 C  CG    . GLU D 1 136 ? 10.782  52.986  -25.984 1.00 35.51  ? 136 GLU D CG    1 
ATOM   4423 C  CD    . GLU D 1 136 ? 11.398  51.630  -25.671 1.00 36.66  ? 136 GLU D CD    1 
ATOM   4424 O  OE1   . GLU D 1 136 ? 10.862  50.870  -24.823 1.00 38.12  ? 136 GLU D OE1   1 
ATOM   4425 O  OE2   . GLU D 1 136 ? 12.441  51.300  -26.276 1.00 35.97  ? 136 GLU D OE2   1 
ATOM   4426 N  N     . LYS D 1 137 ? 5.967   52.721  -26.769 1.00 37.14  ? 137 LYS D N     1 
ATOM   4427 C  CA    . LYS D 1 137 ? 4.549   52.774  -26.360 1.00 38.94  ? 137 LYS D CA    1 
ATOM   4428 C  C     . LYS D 1 137 ? 4.347   53.618  -25.100 1.00 35.52  ? 137 LYS D C     1 
ATOM   4429 O  O     . LYS D 1 137 ? 3.433   53.360  -24.308 1.00 36.74  ? 137 LYS D O     1 
ATOM   4430 C  CB    . LYS D 1 137 ? 3.973   51.365  -26.146 1.00 40.67  ? 137 LYS D CB    1 
ATOM   4431 C  CG    . LYS D 1 137 ? 4.343   50.347  -27.216 1.00 46.99  ? 137 LYS D CG    1 
ATOM   4432 C  CD    . LYS D 1 137 ? 3.837   50.763  -28.589 1.00 52.49  ? 137 LYS D CD    1 
ATOM   4433 C  CE    . LYS D 1 137 ? 3.828   49.602  -29.581 1.00 56.82  ? 137 LYS D CE    1 
ATOM   4434 N  NZ    . LYS D 1 137 ? 5.206   49.170  -29.961 1.00 58.73  ? 137 LYS D NZ    1 
ATOM   4435 N  N     . ILE D 1 138 ? 5.210   54.613  -24.926 1.00 31.85  ? 138 ILE D N     1 
ATOM   4436 C  CA    . ILE D 1 138 ? 5.185   55.526  -23.786 1.00 29.98  ? 138 ILE D CA    1 
ATOM   4437 C  C     . ILE D 1 138 ? 4.740   56.890  -24.277 1.00 28.51  ? 138 ILE D C     1 
ATOM   4438 O  O     . ILE D 1 138 ? 5.296   57.418  -25.274 1.00 27.35  ? 138 ILE D O     1 
ATOM   4439 C  CB    . ILE D 1 138 ? 6.589   55.650  -23.166 1.00 31.00  ? 138 ILE D CB    1 
ATOM   4440 C  CG1   . ILE D 1 138 ? 6.995   54.324  -22.523 1.00 31.09  ? 138 ILE D CG1   1 
ATOM   4441 C  CG2   . ILE D 1 138 ? 6.666   56.803  -22.175 1.00 29.99  ? 138 ILE D CG2   1 
ATOM   4442 C  CD1   . ILE D 1 138 ? 6.043   53.847  -21.461 1.00 32.42  ? 138 ILE D CD1   1 
ATOM   4443 N  N     . THR D 1 139 ? 3.709   57.429  -23.626 1.00 26.04  ? 139 THR D N     1 
ATOM   4444 C  CA    . THR D 1 139 ? 3.307   58.817  -23.825 1.00 25.36  ? 139 THR D CA    1 
ATOM   4445 C  C     . THR D 1 139 ? 4.115   59.684  -22.866 1.00 24.11  ? 139 THR D C     1 
ATOM   4446 O  O     . THR D 1 139 ? 4.426   59.277  -21.749 1.00 23.37  ? 139 THR D O     1 
ATOM   4447 C  CB    . THR D 1 139 ? 1.806   59.047  -23.554 1.00 26.27  ? 139 THR D CB    1 
ATOM   4448 O  OG1   . THR D 1 139 ? 1.514   58.754  -22.182 1.00 26.72  ? 139 THR D OG1   1 
ATOM   4449 C  CG2   . THR D 1 139 ? 0.935   58.155  -24.454 1.00 27.31  ? 139 THR D CG2   1 
ATOM   4450 N  N     . VAL D 1 140 ? 4.419   60.885  -23.323 1.00 24.82  ? 140 VAL D N     1 
ATOM   4451 C  CA    . VAL D 1 140 ? 5.249   61.850  -22.609 1.00 24.86  ? 140 VAL D CA    1 
ATOM   4452 C  C     . VAL D 1 140 ? 4.596   63.209  -22.759 1.00 24.75  ? 140 VAL D C     1 
ATOM   4453 O  O     . VAL D 1 140 ? 3.727   63.389  -23.613 1.00 25.07  ? 140 VAL D O     1 
ATOM   4454 C  CB    . VAL D 1 140 ? 6.690   61.905  -23.174 1.00 24.46  ? 140 VAL D CB    1 
ATOM   4455 C  CG1   . VAL D 1 140 ? 7.248   60.518  -23.332 1.00 24.25  ? 140 VAL D CG1   1 
ATOM   4456 C  CG2   . VAL D 1 140 ? 6.736   62.612  -24.531 1.00 25.59  ? 140 VAL D CG2   1 
ATOM   4457 N  N     . THR D 1 141 ? 5.010   64.155  -21.921 1.00 23.85  ? 141 THR D N     1 
ATOM   4458 C  CA    . THR D 1 141 ? 4.531   65.503  -22.038 1.00 24.11  ? 141 THR D CA    1 
ATOM   4459 C  C     . THR D 1 141 ? 5.725   66.379  -22.403 1.00 24.90  ? 141 THR D C     1 
ATOM   4460 O  O     . THR D 1 141 ? 6.829   66.226  -21.841 1.00 24.31  ? 141 THR D O     1 
ATOM   4461 C  CB    . THR D 1 141 ? 3.822   65.974  -20.755 1.00 24.04  ? 141 THR D CB    1 
ATOM   4462 O  OG1   . THR D 1 141 ? 2.667   65.156  -20.518 1.00 23.47  ? 141 THR D OG1   1 
ATOM   4463 C  CG2   . THR D 1 141 ? 3.388   67.436  -20.879 1.00 23.85  ? 141 THR D CG2   1 
ATOM   4464 N  N     . VAL D 1 142 ? 5.498   67.280  -23.360 1.00 25.36  ? 142 VAL D N     1 
ATOM   4465 C  CA    . VAL D 1 142 ? 6.536   68.147  -23.875 1.00 25.44  ? 142 VAL D CA    1 
ATOM   4466 C  C     . VAL D 1 142 ? 6.265   69.589  -23.433 1.00 26.04  ? 142 VAL D C     1 
ATOM   4467 O  O     . VAL D 1 142 ? 5.126   70.072  -23.491 1.00 27.20  ? 142 VAL D O     1 
ATOM   4468 C  CB    . VAL D 1 142 ? 6.571   68.049  -25.414 1.00 26.41  ? 142 VAL D CB    1 
ATOM   4469 C  CG1   . VAL D 1 142 ? 7.392   69.179  -26.040 1.00 25.79  ? 142 VAL D CG1   1 
ATOM   4470 C  CG2   . VAL D 1 142 ? 7.092   66.678  -25.840 1.00 27.02  ? 142 VAL D CG2   1 
ATOM   4471 N  N     . GLY D 1 143 ? 7.309   70.267  -22.980 1.00 25.59  ? 143 GLY D N     1 
ATOM   4472 C  CA    . GLY D 1 143 ? 7.239   71.698  -22.679 1.00 25.65  ? 143 GLY D CA    1 
ATOM   4473 C  C     . GLY D 1 143 ? 8.319   72.462  -23.416 1.00 25.45  ? 143 GLY D C     1 
ATOM   4474 O  O     . GLY D 1 143 ? 9.488   72.051  -23.430 1.00 25.96  ? 143 GLY D O     1 
ATOM   4475 N  N     . ILE D 1 144 ? 7.931   73.565  -24.036 1.00 25.89  ? 144 ILE D N     1 
ATOM   4476 C  CA    . ILE D 1 144 ? 8.810   74.307  -24.927 1.00 25.85  ? 144 ILE D CA    1 
ATOM   4477 C  C     . ILE D 1 144 ? 8.800   75.769  -24.537 1.00 26.33  ? 144 ILE D C     1 
ATOM   4478 O  O     . ILE D 1 144 ? 7.751   76.368  -24.391 1.00 25.61  ? 144 ILE D O     1 
ATOM   4479 C  CB    . ILE D 1 144 ? 8.355   74.182  -26.386 1.00 26.83  ? 144 ILE D CB    1 
ATOM   4480 C  CG1   . ILE D 1 144 ? 8.513   72.745  -26.869 1.00 27.16  ? 144 ILE D CG1   1 
ATOM   4481 C  CG2   . ILE D 1 144 ? 9.156   75.136  -27.282 1.00 27.26  ? 144 ILE D CG2   1 
ATOM   4482 C  CD1   . ILE D 1 144 ? 7.748   72.419  -28.138 1.00 27.22  ? 144 ILE D CD1   1 
ATOM   4483 N  N     . SER D 1 145 ? 9.985   76.343  -24.369 1.00 27.70  ? 145 SER D N     1 
ATOM   4484 C  CA    . SER D 1 145 ? 10.107  77.756  -24.051 1.00 27.41  ? 145 SER D CA    1 
ATOM   4485 C  C     . SER D 1 145 ? 11.547  78.218  -24.233 1.00 28.91  ? 145 SER D C     1 
ATOM   4486 O  O     . SER D 1 145 ? 12.373  77.514  -24.846 1.00 28.98  ? 145 SER D O     1 
ATOM   4487 C  CB    . SER D 1 145 ? 9.657   78.004  -22.616 1.00 27.37  ? 145 SER D CB    1 
ATOM   4488 O  OG    . SER D 1 145 ? 9.501   79.378  -22.374 1.00 26.96  ? 145 SER D OG    1 
ATOM   4489 N  N     . LYS D 1 146 ? 11.840  79.401  -23.697 1.00 29.02  ? 146 LYS D N     1 
ATOM   4490 C  CA    . LYS D 1 146 ? 13.129  80.049  -23.882 1.00 30.46  ? 146 LYS D CA    1 
ATOM   4491 C  C     . LYS D 1 146 ? 14.213  79.619  -22.893 1.00 29.62  ? 146 LYS D C     1 
ATOM   4492 O  O     . LYS D 1 146 ? 15.371  79.899  -23.125 1.00 29.94  ? 146 LYS D O     1 
ATOM   4493 C  CB    . LYS D 1 146 ? 12.989  81.573  -23.808 1.00 31.35  ? 146 LYS D CB    1 
ATOM   4494 C  CG    . LYS D 1 146 ? 12.676  82.069  -22.407 1.00 31.46  ? 146 LYS D CG    1 
ATOM   4495 C  CD    . LYS D 1 146 ? 12.306  83.526  -22.449 1.00 32.94  ? 146 LYS D CD    1 
ATOM   4496 C  CE    . LYS D 1 146 ? 13.525  84.375  -22.779 1.00 33.78  ? 146 LYS D CE    1 
ATOM   4497 N  NZ    . LYS D 1 146 ? 13.160  85.803  -22.740 1.00 36.67  ? 146 LYS D NZ    1 
ATOM   4498 N  N     . ASN D 1 147 ? 13.851  78.962  -21.800 1.00 28.85  ? 147 ASN D N     1 
ATOM   4499 C  CA    . ASN D 1 147 ? 14.864  78.396  -20.914 1.00 28.59  ? 147 ASN D CA    1 
ATOM   4500 C  C     . ASN D 1 147 ? 14.359  77.133  -20.218 1.00 27.45  ? 147 ASN D C     1 
ATOM   4501 O  O     . ASN D 1 147 ? 13.238  76.693  -20.462 1.00 27.85  ? 147 ASN D O     1 
ATOM   4502 C  CB    . ASN D 1 147 ? 15.364  79.456  -19.919 1.00 28.22  ? 147 ASN D CB    1 
ATOM   4503 C  CG    . ASN D 1 147 ? 14.268  79.952  -19.006 1.00 28.43  ? 147 ASN D CG    1 
ATOM   4504 O  OD1   . ASN D 1 147 ? 13.442  79.173  -18.523 1.00 27.96  ? 147 ASN D OD1   1 
ATOM   4505 N  ND2   . ASN D 1 147 ? 14.263  81.248  -18.748 1.00 28.21  ? 147 ASN D ND2   1 
ATOM   4506 N  N     . LYS D 1 148 ? 15.193  76.536  -19.379 1.00 26.92  ? 148 LYS D N     1 
ATOM   4507 C  CA    . LYS D 1 148 ? 14.877  75.228  -18.808 1.00 26.75  ? 148 LYS D CA    1 
ATOM   4508 C  C     . LYS D 1 148 ? 13.678  75.301  -17.875 1.00 26.05  ? 148 LYS D C     1 
ATOM   4509 O  O     . LYS D 1 148 ? 12.802  74.444  -17.905 1.00 23.53  ? 148 LYS D O     1 
ATOM   4510 C  CB    . LYS D 1 148 ? 16.069  74.635  -18.075 1.00 27.30  ? 148 LYS D CB    1 
ATOM   4511 C  CG    . LYS D 1 148 ? 17.161  74.167  -19.014 1.00 28.90  ? 148 LYS D CG    1 
ATOM   4512 C  CD    . LYS D 1 148 ? 18.197  73.315  -18.310 1.00 30.34  ? 148 LYS D CD    1 
ATOM   4513 C  CE    . LYS D 1 148 ? 19.188  74.151  -17.513 1.00 31.76  ? 148 LYS D CE    1 
ATOM   4514 N  NZ    . LYS D 1 148 ? 20.119  73.255  -16.769 1.00 31.96  ? 148 LYS D NZ    1 
ATOM   4515 N  N     . VAL D 1 149 ? 13.645  76.353  -17.071 1.00 25.62  ? 149 VAL D N     1 
ATOM   4516 C  CA    . VAL D 1 149 ? 12.658  76.462  -16.043 1.00 25.36  ? 149 VAL D CA    1 
ATOM   4517 C  C     . VAL D 1 149 ? 11.286  76.584  -16.675 1.00 25.27  ? 149 VAL D C     1 
ATOM   4518 O  O     . VAL D 1 149 ? 10.379  75.824  -16.348 1.00 23.98  ? 149 VAL D O     1 
ATOM   4519 C  CB    . VAL D 1 149 ? 12.961  77.648  -15.125 1.00 26.22  ? 149 VAL D CB    1 
ATOM   4520 C  CG1   . VAL D 1 149 ? 11.882  77.757  -14.054 1.00 27.40  ? 149 VAL D CG1   1 
ATOM   4521 C  CG2   . VAL D 1 149 ? 14.323  77.449  -14.487 1.00 25.46  ? 149 VAL D CG2   1 
ATOM   4522 N  N     . PHE D 1 150 ? 11.150  77.516  -17.612 1.00 26.20  ? 150 PHE D N     1 
ATOM   4523 C  CA    . PHE D 1 150 ? 9.876   77.733  -18.261 1.00 26.08  ? 150 PHE D CA    1 
ATOM   4524 C  C     . PHE D 1 150 ? 9.464   76.592  -19.183 1.00 26.01  ? 150 PHE D C     1 
ATOM   4525 O  O     . PHE D 1 150 ? 8.269   76.421  -19.442 1.00 26.54  ? 150 PHE D O     1 
ATOM   4526 C  CB    . PHE D 1 150 ? 9.856   79.089  -18.944 1.00 26.68  ? 150 PHE D CB    1 
ATOM   4527 C  CG    . PHE D 1 150 ? 9.541   80.171  -17.992 1.00 28.02  ? 150 PHE D CG    1 
ATOM   4528 C  CD1   . PHE D 1 150 ? 8.244   80.306  -17.512 1.00 28.67  ? 150 PHE D CD1   1 
ATOM   4529 C  CD2   . PHE D 1 150 ? 10.537  80.971  -17.468 1.00 28.78  ? 150 PHE D CD2   1 
ATOM   4530 C  CE1   . PHE D 1 150 ? 7.937   81.257  -16.565 1.00 28.94  ? 150 PHE D CE1   1 
ATOM   4531 C  CE2   . PHE D 1 150 ? 10.234  81.947  -16.539 1.00 29.46  ? 150 PHE D CE2   1 
ATOM   4532 C  CZ    . PHE D 1 150 ? 8.933   82.085  -16.084 1.00 30.12  ? 150 PHE D CZ    1 
ATOM   4533 N  N     . ALA D 1 151 ? 10.438  75.807  -19.650 1.00 24.80  ? 151 ALA D N     1 
ATOM   4534 C  CA    . ALA D 1 151 ? 10.121  74.594  -20.395 1.00 24.85  ? 151 ALA D CA    1 
ATOM   4535 C  C     . ALA D 1 151 ? 9.523   73.524  -19.463 1.00 24.12  ? 151 ALA D C     1 
ATOM   4536 O  O     . ALA D 1 151 ? 8.584   72.814  -19.832 1.00 23.01  ? 151 ALA D O     1 
ATOM   4537 C  CB    . ALA D 1 151 ? 11.356  74.063  -21.114 1.00 25.58  ? 151 ALA D CB    1 
ATOM   4538 N  N     . LYS D 1 152 ? 10.032  73.439  -18.245 1.00 23.67  ? 152 LYS D N     1 
ATOM   4539 C  CA    . LYS D 1 152 ? 9.467   72.505  -17.278 1.00 24.66  ? 152 LYS D CA    1 
ATOM   4540 C  C     . LYS D 1 152 ? 8.055   72.925  -16.811 1.00 24.36  ? 152 LYS D C     1 
ATOM   4541 O  O     . LYS D 1 152 ? 7.132   72.084  -16.708 1.00 24.47  ? 152 LYS D O     1 
ATOM   4542 C  CB    . LYS D 1 152 ? 10.402  72.345  -16.089 1.00 25.62  ? 152 LYS D CB    1 
ATOM   4543 C  CG    . LYS D 1 152 ? 9.874   71.402  -15.010 1.00 27.36  ? 152 LYS D CG    1 
ATOM   4544 C  CD    . LYS D 1 152 ? 11.004  71.012  -14.076 1.00 30.09  ? 152 LYS D CD    1 
ATOM   4545 C  CE    . LYS D 1 152 ? 10.523  70.155  -12.920 1.00 31.21  ? 152 LYS D CE    1 
ATOM   4546 N  NZ    . LYS D 1 152 ? 10.623  68.734  -13.315 1.00 33.07  ? 152 LYS D NZ    1 
ATOM   4547 N  N     . ILE D 1 153 ? 7.900   74.202  -16.501 1.00 24.13  ? 153 ILE D N     1 
ATOM   4548 C  CA    . ILE D 1 153 ? 6.587   74.753  -16.143 1.00 24.50  ? 153 ILE D CA    1 
ATOM   4549 C  C     . ILE D 1 153 ? 5.551   74.415  -17.240 1.00 24.33  ? 153 ILE D C     1 
ATOM   4550 O  O     . ILE D 1 153 ? 4.462   73.971  -16.943 1.00 23.56  ? 153 ILE D O     1 
ATOM   4551 C  CB    . ILE D 1 153 ? 6.702   76.262  -15.901 1.00 25.65  ? 153 ILE D CB    1 
ATOM   4552 C  CG1   . ILE D 1 153 ? 7.372   76.517  -14.551 1.00 26.23  ? 153 ILE D CG1   1 
ATOM   4553 C  CG2   . ILE D 1 153 ? 5.342   76.950  -15.923 1.00 26.51  ? 153 ILE D CG2   1 
ATOM   4554 C  CD1   . ILE D 1 153 ? 7.848   77.937  -14.400 1.00 27.61  ? 153 ILE D CD1   1 
ATOM   4555 N  N     . ALA D 1 154 ? 5.912   74.591  -18.512 1.00 24.52  ? 154 ALA D N     1 
ATOM   4556 C  CA    . ALA D 1 154 ? 4.980   74.310  -19.601 1.00 24.07  ? 154 ALA D CA    1 
ATOM   4557 C  C     . ALA D 1 154 ? 4.530   72.846  -19.567 1.00 24.63  ? 154 ALA D C     1 
ATOM   4558 O  O     . ALA D 1 154 ? 3.332   72.543  -19.714 1.00 24.69  ? 154 ALA D O     1 
ATOM   4559 C  CB    . ALA D 1 154 ? 5.616   74.625  -20.944 1.00 24.21  ? 154 ALA D CB    1 
ATOM   4560 N  N     . ALA D 1 155 ? 5.488   71.938  -19.417 1.00 23.36  ? 155 ALA D N     1 
ATOM   4561 C  CA    . ALA D 1 155 ? 5.149   70.529  -19.347 1.00 24.38  ? 155 ALA D CA    1 
ATOM   4562 C  C     . ALA D 1 155 ? 4.302   70.248  -18.121 1.00 25.32  ? 155 ALA D C     1 
ATOM   4563 O  O     . ALA D 1 155 ? 3.404   69.422  -18.192 1.00 26.06  ? 155 ALA D O     1 
ATOM   4564 C  CB    . ALA D 1 155 ? 6.390   69.663  -19.333 1.00 24.15  ? 155 ALA D CB    1 
ATOM   4565 N  N     . ASP D 1 156 ? 4.574   70.925  -17.008 1.00 25.97  ? 156 ASP D N     1 
ATOM   4566 C  CA    . ASP D 1 156 ? 3.763   70.749  -15.799 1.00 27.57  ? 156 ASP D CA    1 
ATOM   4567 C  C     . ASP D 1 156 ? 2.309   71.140  -16.108 1.00 28.40  ? 156 ASP D C     1 
ATOM   4568 O  O     . ASP D 1 156 ? 1.388   70.431  -15.744 1.00 27.54  ? 156 ASP D O     1 
ATOM   4569 C  CB    . ASP D 1 156 ? 4.287   71.587  -14.618 1.00 28.63  ? 156 ASP D CB    1 
ATOM   4570 C  CG    . ASP D 1 156 ? 5.593   71.060  -14.041 1.00 29.18  ? 156 ASP D CG    1 
ATOM   4571 O  OD1   . ASP D 1 156 ? 5.896   69.881  -14.204 1.00 28.82  ? 156 ASP D OD1   1 
ATOM   4572 O  OD2   . ASP D 1 156 ? 6.333   71.835  -13.407 1.00 31.53  ? 156 ASP D OD2   1 
ATOM   4573 N  N     . MET D 1 157 ? 2.120   72.264  -16.794 1.00 29.74  ? 157 MET D N     1 
ATOM   4574 C  CA    . MET D 1 157 ? 0.787   72.720  -17.203 1.00 30.89  ? 157 MET D CA    1 
ATOM   4575 C  C     . MET D 1 157 ? 0.031   71.761  -18.133 1.00 30.57  ? 157 MET D C     1 
ATOM   4576 O  O     . MET D 1 157 ? -1.194  71.730  -18.124 1.00 30.76  ? 157 MET D O     1 
ATOM   4577 C  CB    . MET D 1 157 ? 0.884   74.092  -17.877 1.00 33.23  ? 157 MET D CB    1 
ATOM   4578 C  CG    . MET D 1 157 ? 1.304   75.229  -16.937 1.00 34.62  ? 157 MET D CG    1 
ATOM   4579 S  SD    . MET D 1 157 ? 1.488   76.816  -17.784 1.00 38.43  ? 157 MET D SD    1 
ATOM   4580 C  CE    . MET D 1 157 ? 1.617   77.913  -16.366 1.00 39.15  ? 157 MET D CE    1 
ATOM   4581 N  N     . ALA D 1 158 ? 0.753   70.982  -18.928 1.00 29.40  ? 158 ALA D N     1 
ATOM   4582 C  CA    . ALA D 1 158 ? 0.140   70.177  -19.992 1.00 28.94  ? 158 ALA D CA    1 
ATOM   4583 C  C     . ALA D 1 158 ? 0.028   68.664  -19.706 1.00 29.04  ? 158 ALA D C     1 
ATOM   4584 O  O     . ALA D 1 158 ? -0.480  67.932  -20.540 1.00 29.11  ? 158 ALA D O     1 
ATOM   4585 C  CB    . ALA D 1 158 ? 0.929   70.391  -21.290 1.00 28.35  ? 158 ALA D CB    1 
ATOM   4586 N  N     . LYS D 1 159 ? 0.546   68.196  -18.573 1.00 28.97  ? 159 LYS D N     1 
ATOM   4587 C  CA    . LYS D 1 159 ? 0.510   66.770  -18.227 1.00 30.15  ? 159 LYS D CA    1 
ATOM   4588 C  C     . LYS D 1 159 ? -0.933  66.267  -18.126 1.00 29.65  ? 159 LYS D C     1 
ATOM   4589 O  O     . LYS D 1 159 ? -1.810  67.018  -17.711 1.00 29.16  ? 159 LYS D O     1 
ATOM   4590 C  CB    . LYS D 1 159 ? 1.144   66.539  -16.850 1.00 31.54  ? 159 LYS D CB    1 
ATOM   4591 C  CG    . LYS D 1 159 ? 2.625   66.726  -16.781 1.00 33.31  ? 159 LYS D CG    1 
ATOM   4592 C  CD    . LYS D 1 159 ? 3.173   66.355  -15.411 1.00 33.62  ? 159 LYS D CD    1 
ATOM   4593 C  CE    . LYS D 1 159 ? 4.687   66.595  -15.357 1.00 34.27  ? 159 LYS D CE    1 
ATOM   4594 N  NZ    . LYS D 1 159 ? 5.367   65.760  -14.328 1.00 34.42  ? 159 LYS D NZ    1 
ATOM   4595 N  N     . PRO D 1 160 ? -1.192  65.009  -18.505 1.00 28.35  ? 160 PRO D N     1 
ATOM   4596 C  CA    . PRO D 1 160 ? -0.349  64.029  -19.159 1.00 27.75  ? 160 PRO D CA    1 
ATOM   4597 C  C     . PRO D 1 160 ? -0.543  64.085  -20.661 1.00 27.66  ? 160 PRO D C     1 
ATOM   4598 O  O     . PRO D 1 160 ? -1.474  64.741  -21.137 1.00 27.12  ? 160 PRO D O     1 
ATOM   4599 C  CB    . PRO D 1 160 ? -0.912  62.712  -18.643 1.00 28.70  ? 160 PRO D CB    1 
ATOM   4600 C  CG    . PRO D 1 160 ? -2.389  62.971  -18.547 1.00 29.46  ? 160 PRO D CG    1 
ATOM   4601 C  CD    . PRO D 1 160 ? -2.528  64.443  -18.213 1.00 29.77  ? 160 PRO D CD    1 
ATOM   4602 N  N     . ASN D 1 161 ? 0.328   63.398  -21.393 1.00 27.54  ? 161 ASN D N     1 
ATOM   4603 C  CA    . ASN D 1 161 ? 0.242   63.316  -22.853 1.00 28.89  ? 161 ASN D CA    1 
ATOM   4604 C  C     . ASN D 1 161 ? 0.022   64.672  -23.539 1.00 27.84  ? 161 ASN D C     1 
ATOM   4605 O  O     . ASN D 1 161 ? -0.790  64.793  -24.445 1.00 28.74  ? 161 ASN D O     1 
ATOM   4606 C  CB    . ASN D 1 161 ? -0.899  62.389  -23.242 1.00 29.82  ? 161 ASN D CB    1 
ATOM   4607 C  CG    . ASN D 1 161 ? -0.830  61.946  -24.689 1.00 32.45  ? 161 ASN D CG    1 
ATOM   4608 O  OD1   . ASN D 1 161 ? 0.202   62.033  -25.366 1.00 30.95  ? 161 ASN D OD1   1 
ATOM   4609 N  ND2   . ASN D 1 161 ? -1.929  61.419  -25.157 1.00 35.56  ? 161 ASN D ND2   1 
ATOM   4610 N  N     . GLY D 1 162 ? 0.750   65.681  -23.109 1.00 26.21  ? 162 GLY D N     1 
ATOM   4611 C  CA    . GLY D 1 162 ? 0.522   67.028  -23.592 1.00 26.30  ? 162 GLY D CA    1 
ATOM   4612 C  C     . GLY D 1 162 ? 1.725   67.600  -24.295 1.00 25.82  ? 162 GLY D C     1 
ATOM   4613 O  O     . GLY D 1 162 ? 2.770   66.939  -24.420 1.00 24.55  ? 162 GLY D O     1 
ATOM   4614 N  N     . ILE D 1 163 ? 1.548   68.821  -24.788 1.00 26.68  ? 163 ILE D N     1 
ATOM   4615 C  CA    . ILE D 1 163 ? 2.626   69.586  -25.395 1.00 27.11  ? 163 ILE D CA    1 
ATOM   4616 C  C     . ILE D 1 163 ? 2.213   71.032  -25.281 1.00 27.15  ? 163 ILE D C     1 
ATOM   4617 O  O     . ILE D 1 163 ? 1.074   71.377  -25.553 1.00 26.87  ? 163 ILE D O     1 
ATOM   4618 C  CB    . ILE D 1 163 ? 2.895   69.191  -26.867 1.00 28.85  ? 163 ILE D CB    1 
ATOM   4619 C  CG1   . ILE D 1 163 ? 3.936   70.139  -27.499 1.00 29.03  ? 163 ILE D CG1   1 
ATOM   4620 C  CG2   . ILE D 1 163 ? 1.610   69.208  -27.697 1.00 29.98  ? 163 ILE D CG2   1 
ATOM   4621 C  CD1   . ILE D 1 163 ? 4.605   69.565  -28.734 1.00 29.47  ? 163 ILE D CD1   1 
ATOM   4622 N  N     . LYS D 1 164 ? 3.128   71.875  -24.841 1.00 27.38  ? 164 LYS D N     1 
ATOM   4623 C  CA    . LYS D 1 164 ? 2.804   73.267  -24.651 1.00 28.20  ? 164 LYS D CA    1 
ATOM   4624 C  C     . LYS D 1 164 ? 4.017   74.142  -24.872 1.00 27.41  ? 164 LYS D C     1 
ATOM   4625 O  O     . LYS D 1 164 ? 5.123   73.762  -24.491 1.00 25.17  ? 164 LYS D O     1 
ATOM   4626 C  CB    . LYS D 1 164 ? 2.258   73.511  -23.253 1.00 29.24  ? 164 LYS D CB    1 
ATOM   4627 C  CG    . LYS D 1 164 ? 1.910   74.971  -23.021 1.00 32.06  ? 164 LYS D CG    1 
ATOM   4628 C  CD    . LYS D 1 164 ? 1.069   75.155  -21.769 1.00 35.44  ? 164 LYS D CD    1 
ATOM   4629 C  CE    . LYS D 1 164 ? 0.972   76.613  -21.351 1.00 36.34  ? 164 LYS D CE    1 
ATOM   4630 N  NZ    . LYS D 1 164 ? 0.783   77.534  -22.498 1.00 37.95  ? 164 LYS D NZ    1 
ATOM   4631 N  N     . VAL D 1 165 ? 3.769   75.301  -25.493 1.00 26.67  ? 165 VAL D N     1 
ATOM   4632 C  CA    . VAL D 1 165 ? 4.761   76.336  -25.722 1.00 26.62  ? 165 VAL D CA    1 
ATOM   4633 C  C     . VAL D 1 165 ? 4.419   77.459  -24.773 1.00 26.76  ? 165 VAL D C     1 
ATOM   4634 O  O     . VAL D 1 165 ? 3.249   77.827  -24.645 1.00 25.90  ? 165 VAL D O     1 
ATOM   4635 C  CB    . VAL D 1 165 ? 4.723   76.917  -27.179 1.00 26.66  ? 165 VAL D CB    1 
ATOM   4636 C  CG1   . VAL D 1 165 ? 5.647   78.109  -27.323 1.00 26.11  ? 165 VAL D CG1   1 
ATOM   4637 C  CG2   . VAL D 1 165 ? 5.140   75.871  -28.211 1.00 27.34  ? 165 VAL D CG2   1 
ATOM   4638 N  N     . ILE D 1 166 ? 5.442   77.990  -24.111 1.00 27.12  ? 166 ILE D N     1 
ATOM   4639 C  CA    . ILE D 1 166 ? 5.338   79.249  -23.390 1.00 29.37  ? 166 ILE D CA    1 
ATOM   4640 C  C     . ILE D 1 166 ? 6.273   80.213  -24.115 1.00 29.81  ? 166 ILE D C     1 
ATOM   4641 O  O     . ILE D 1 166 ? 7.494   80.126  -23.971 1.00 29.26  ? 166 ILE D O     1 
ATOM   4642 C  CB    . ILE D 1 166 ? 5.708   79.087  -21.893 1.00 28.48  ? 166 ILE D CB    1 
ATOM   4643 C  CG1   . ILE D 1 166 ? 4.655   78.224  -21.191 1.00 27.96  ? 166 ILE D CG1   1 
ATOM   4644 C  CG2   . ILE D 1 166 ? 5.785   80.432  -21.192 1.00 28.48  ? 166 ILE D CG2   1 
ATOM   4645 C  CD1   . ILE D 1 166 ? 4.943   77.941  -19.719 1.00 26.92  ? 166 ILE D CD1   1 
ATOM   4646 N  N     . ASP D 1 167 ? 5.690   81.110  -24.912 1.00 32.72  ? 167 ASP D N     1 
ATOM   4647 C  CA    . ASP D 1 167 ? 6.472   82.031  -25.731 1.00 34.86  ? 167 ASP D CA    1 
ATOM   4648 C  C     . ASP D 1 167 ? 6.947   83.226  -24.898 1.00 36.79  ? 167 ASP D C     1 
ATOM   4649 O  O     . ASP D 1 167 ? 6.620   83.330  -23.712 1.00 34.79  ? 167 ASP D O     1 
ATOM   4650 C  CB    . ASP D 1 167 ? 5.699   82.484  -26.973 1.00 36.64  ? 167 ASP D CB    1 
ATOM   4651 C  CG    . ASP D 1 167 ? 4.454   83.302  -26.651 1.00 36.90  ? 167 ASP D CG    1 
ATOM   4652 O  OD1   . ASP D 1 167 ? 4.362   83.954  -25.599 1.00 36.21  ? 167 ASP D OD1   1 
ATOM   4653 O  OD2   . ASP D 1 167 ? 3.546   83.288  -27.492 1.00 40.21  ? 167 ASP D OD2   1 
ATOM   4654 N  N     . ASP D 1 168 ? 7.709   84.118  -25.531 1.00 38.98  ? 168 ASP D N     1 
ATOM   4655 C  CA    . ASP D 1 168 ? 8.350   85.208  -24.820 1.00 42.29  ? 168 ASP D CA    1 
ATOM   4656 C  C     . ASP D 1 168 ? 7.328   86.075  -24.116 1.00 42.38  ? 168 ASP D C     1 
ATOM   4657 O  O     . ASP D 1 168 ? 7.547   86.470  -22.972 1.00 42.33  ? 168 ASP D O     1 
ATOM   4658 C  CB    . ASP D 1 168 ? 9.228   86.043  -25.768 1.00 45.36  ? 168 ASP D CB    1 
ATOM   4659 C  CG    . ASP D 1 168 ? 10.486  85.295  -26.222 1.00 46.81  ? 168 ASP D CG    1 
ATOM   4660 O  OD1   . ASP D 1 168 ? 10.471  84.051  -26.325 1.00 49.70  ? 168 ASP D OD1   1 
ATOM   4661 O  OD2   . ASP D 1 168 ? 11.497  85.956  -26.489 1.00 50.36  ? 168 ASP D OD2   1 
ATOM   4662 N  N     . GLU D 1 169 ? 6.209   86.355  -24.781 1.00 43.45  ? 169 GLU D N     1 
ATOM   4663 C  CA    . GLU D 1 169 ? 5.159   87.160  -24.160 1.00 46.01  ? 169 GLU D CA    1 
ATOM   4664 C  C     . GLU D 1 169 ? 4.568   86.470  -22.937 1.00 42.46  ? 169 GLU D C     1 
ATOM   4665 O  O     . GLU D 1 169 ? 4.339   87.118  -21.933 1.00 41.03  ? 169 GLU D O     1 
ATOM   4666 C  CB    . GLU D 1 169 ? 4.031   87.523  -25.142 1.00 50.05  ? 169 GLU D CB    1 
ATOM   4667 C  CG    . GLU D 1 169 ? 3.325   88.836  -24.770 1.00 55.99  ? 169 GLU D CG    1 
ATOM   4668 C  CD    . GLU D 1 169 ? 2.150   89.204  -25.678 1.00 60.88  ? 169 GLU D CD    1 
ATOM   4669 O  OE1   . GLU D 1 169 ? 1.283   88.336  -25.941 1.00 64.82  ? 169 GLU D OE1   1 
ATOM   4670 O  OE2   . GLU D 1 169 ? 2.071   90.379  -26.115 1.00 64.75  ? 169 GLU D OE2   1 
ATOM   4671 N  N     . GLU D 1 170 ? 4.300   85.170  -23.015 1.00 39.87  ? 170 GLU D N     1 
ATOM   4672 C  CA    . GLU D 1 170 ? 3.709   84.493  -21.863 1.00 40.26  ? 170 GLU D CA    1 
ATOM   4673 C  C     . GLU D 1 170 ? 4.693   84.267  -20.715 1.00 37.19  ? 170 GLU D C     1 
ATOM   4674 O  O     . GLU D 1 170 ? 4.284   84.243  -19.567 1.00 35.32  ? 170 GLU D O     1 
ATOM   4675 C  CB    . GLU D 1 170 ? 3.032   83.186  -22.240 1.00 44.00  ? 170 GLU D CB    1 
ATOM   4676 C  CG    . GLU D 1 170 ? 1.819   82.937  -21.360 1.00 47.11  ? 170 GLU D CG    1 
ATOM   4677 C  CD    . GLU D 1 170 ? 1.353   81.508  -21.383 1.00 51.62  ? 170 GLU D CD    1 
ATOM   4678 O  OE1   . GLU D 1 170 ? 1.671   80.783  -22.355 1.00 55.61  ? 170 GLU D OE1   1 
ATOM   4679 O  OE2   . GLU D 1 170 ? 0.646   81.117  -20.430 1.00 54.77  ? 170 GLU D OE2   1 
ATOM   4680 N  N     . VAL D 1 171 ? 5.980   84.130  -21.012 1.00 36.18  ? 171 VAL D N     1 
ATOM   4681 C  CA    . VAL D 1 171 ? 6.991   84.199  -19.963 1.00 36.49  ? 171 VAL D CA    1 
ATOM   4682 C  C     . VAL D 1 171 ? 6.844   85.502  -19.157 1.00 38.41  ? 171 VAL D C     1 
ATOM   4683 O  O     . VAL D 1 171 ? 6.840   85.471  -17.924 1.00 37.93  ? 171 VAL D O     1 
ATOM   4684 C  CB    . VAL D 1 171 ? 8.432   84.081  -20.503 1.00 35.60  ? 171 VAL D CB    1 
ATOM   4685 C  CG1   . VAL D 1 171 ? 9.449   84.391  -19.404 1.00 35.36  ? 171 VAL D CG1   1 
ATOM   4686 C  CG2   . VAL D 1 171 ? 8.683   82.684  -21.047 1.00 36.39  ? 171 VAL D CG2   1 
ATOM   4687 N  N     . LYS D 1 172 ? 6.717   86.638  -19.841 1.00 39.51  ? 172 LYS D N     1 
ATOM   4688 C  CA    . LYS D 1 172 ? 6.555   87.926  -19.141 1.00 41.95  ? 172 LYS D CA    1 
ATOM   4689 C  C     . LYS D 1 172 ? 5.251   87.948  -18.353 1.00 39.80  ? 172 LYS D C     1 
ATOM   4690 O  O     . LYS D 1 172 ? 5.220   88.342  -17.188 1.00 39.82  ? 172 LYS D O     1 
ATOM   4691 C  CB    . LYS D 1 172 ? 6.595   89.101  -20.125 1.00 44.53  ? 172 LYS D CB    1 
ATOM   4692 C  CG    . LYS D 1 172 ? 7.955   89.324  -20.769 1.00 48.07  ? 172 LYS D CG    1 
ATOM   4693 C  CD    . LYS D 1 172 ? 7.869   90.362  -21.882 1.00 51.87  ? 172 LYS D CD    1 
ATOM   4694 C  CE    . LYS D 1 172 ? 9.240   90.746  -22.415 1.00 55.08  ? 172 LYS D CE    1 
ATOM   4695 N  NZ    . LYS D 1 172 ? 9.827   89.720  -23.322 1.00 54.90  ? 172 LYS D NZ    1 
ATOM   4696 N  N     . ARG D 1 173 ? 4.179   87.510  -18.991 1.00 39.49  ? 173 ARG D N     1 
ATOM   4697 C  CA    . ARG D 1 173 ? 2.904   87.355  -18.300 1.00 41.65  ? 173 ARG D CA    1 
ATOM   4698 C  C     . ARG D 1 173 ? 3.021   86.461  -17.043 1.00 39.77  ? 173 ARG D C     1 
ATOM   4699 O  O     . ARG D 1 173 ? 2.466   86.799  -15.998 1.00 39.54  ? 173 ARG D O     1 
ATOM   4700 C  CB    . ARG D 1 173 ? 1.827   86.791  -19.248 1.00 44.18  ? 173 ARG D CB    1 
ATOM   4701 C  CG    . ARG D 1 173 ? 0.406   87.138  -18.826 1.00 46.76  ? 173 ARG D CG    1 
ATOM   4702 C  CD    . ARG D 1 173 ? -0.625  86.125  -19.300 1.00 49.98  ? 173 ARG D CD    1 
ATOM   4703 N  NE    . ARG D 1 173 ? -0.831  85.084  -18.291 1.00 52.91  ? 173 ARG D NE    1 
ATOM   4704 C  CZ    . ARG D 1 173 ? -0.892  83.776  -18.524 1.00 54.78  ? 173 ARG D CZ    1 
ATOM   4705 N  NH1   . ARG D 1 173 ? -0.800  83.286  -19.752 1.00 58.43  ? 173 ARG D NH1   1 
ATOM   4706 N  NH2   . ARG D 1 173 ? -1.072  82.945  -17.513 1.00 56.45  ? 173 ARG D NH2   1 
ATOM   4707 N  N     . LEU D 1 174 ? 3.728   85.332  -17.135 1.00 36.52  ? 174 LEU D N     1 
ATOM   4708 C  CA    . LEU D 1 174 ? 3.820   84.414  -15.989 1.00 35.08  ? 174 LEU D CA    1 
ATOM   4709 C  C     . LEU D 1 174 ? 4.713   84.930  -14.850 1.00 34.75  ? 174 LEU D C     1 
ATOM   4710 O  O     . LEU D 1 174 ? 4.451   84.685  -13.667 1.00 34.39  ? 174 LEU D O     1 
ATOM   4711 C  CB    . LEU D 1 174 ? 4.288   83.026  -16.433 1.00 33.84  ? 174 LEU D CB    1 
ATOM   4712 C  CG    . LEU D 1 174 ? 3.302   82.182  -17.235 1.00 33.57  ? 174 LEU D CG    1 
ATOM   4713 C  CD1   . LEU D 1 174 ? 4.010   80.944  -17.717 1.00 33.98  ? 174 LEU D CD1   1 
ATOM   4714 C  CD2   . LEU D 1 174 ? 2.050   81.808  -16.464 1.00 34.19  ? 174 LEU D CD2   1 
ATOM   4715 N  N     . ILE D 1 175 ? 5.776   85.637  -15.190 1.00 35.46  ? 175 ILE D N     1 
ATOM   4716 C  CA    . ILE D 1 175 ? 6.594   86.285  -14.164 1.00 35.65  ? 175 ILE D CA    1 
ATOM   4717 C  C     . ILE D 1 175 ? 5.676   87.101  -13.229 1.00 38.12  ? 175 ILE D C     1 
ATOM   4718 O  O     . ILE D 1 175 ? 5.812   87.050  -11.994 1.00 35.99  ? 175 ILE D O     1 
ATOM   4719 C  CB    . ILE D 1 175 ? 7.695   87.143  -14.829 1.00 36.87  ? 175 ILE D CB    1 
ATOM   4720 C  CG1   . ILE D 1 175 ? 8.769   86.234  -15.440 1.00 35.10  ? 175 ILE D CG1   1 
ATOM   4721 C  CG2   . ILE D 1 175 ? 8.339   88.121  -13.840 1.00 37.11  ? 175 ILE D CG2   1 
ATOM   4722 C  CD1   . ILE D 1 175 ? 9.645   86.934  -16.463 1.00 35.63  ? 175 ILE D CD1   1 
ATOM   4723 N  N     . ARG D 1 176 ? 4.699   87.796  -13.819 1.00 40.79  ? 176 ARG D N     1 
ATOM   4724 C  CA    . ARG D 1 176 ? 3.738   88.586  -13.050 1.00 43.85  ? 176 ARG D CA    1 
ATOM   4725 C  C     . ARG D 1 176 ? 2.618   87.771  -12.400 1.00 43.51  ? 176 ARG D C     1 
ATOM   4726 O  O     . ARG D 1 176 ? 2.085   88.172  -11.364 1.00 44.14  ? 176 ARG D O     1 
ATOM   4727 C  CB    . ARG D 1 176 ? 3.143   89.707  -13.926 1.00 47.16  ? 176 ARG D CB    1 
ATOM   4728 C  CG    . ARG D 1 176 ? 4.151   90.810  -14.246 1.00 50.98  ? 176 ARG D CG    1 
ATOM   4729 C  CD    . ARG D 1 176 ? 3.540   91.962  -15.041 1.00 55.71  ? 176 ARG D CD    1 
ATOM   4730 N  NE    . ARG D 1 176 ? 3.358   91.617  -16.456 1.00 57.46  ? 176 ARG D NE    1 
ATOM   4731 C  CZ    . ARG D 1 176 ? 2.232   91.167  -17.014 1.00 58.76  ? 176 ARG D CZ    1 
ATOM   4732 N  NH1   . ARG D 1 176 ? 1.112   90.995  -16.304 1.00 59.43  ? 176 ARG D NH1   1 
ATOM   4733 N  NH2   . ARG D 1 176 ? 2.228   90.883  -18.314 1.00 60.76  ? 176 ARG D NH2   1 
ATOM   4734 N  N     . GLU D 1 177 ? 2.263   86.627  -12.978 1.00 43.08  ? 177 GLU D N     1 
ATOM   4735 C  CA    . GLU D 1 177 ? 1.020   85.950  -12.584 1.00 43.63  ? 177 GLU D CA    1 
ATOM   4736 C  C     . GLU D 1 177 ? 1.106   84.512  -12.059 1.00 41.74  ? 177 GLU D C     1 
ATOM   4737 O  O     . GLU D 1 177 ? 0.165   84.036  -11.394 1.00 37.18  ? 177 GLU D O     1 
ATOM   4738 C  CB    . GLU D 1 177 ? 0.059   85.981  -13.763 1.00 47.36  ? 177 GLU D CB    1 
ATOM   4739 C  CG    . GLU D 1 177 ? -0.197  87.385  -14.266 1.00 50.75  ? 177 GLU D CG    1 
ATOM   4740 C  CD    . GLU D 1 177 ? -1.635  87.588  -14.654 1.00 57.38  ? 177 GLU D CD    1 
ATOM   4741 O  OE1   . GLU D 1 177 ? -2.150  86.805  -15.496 1.00 57.80  ? 177 GLU D OE1   1 
ATOM   4742 O  OE2   . GLU D 1 177 ? -2.241  88.539  -14.108 1.00 63.26  ? 177 GLU D OE2   1 
ATOM   4743 N  N     . LEU D 1 178 ? 2.200   83.808  -12.354 1.00 39.70  ? 178 LEU D N     1 
ATOM   4744 C  CA    . LEU D 1 178 ? 2.309   82.422  -11.907 1.00 39.35  ? 178 LEU D CA    1 
ATOM   4745 C  C     . LEU D 1 178 ? 2.608   82.415  -10.438 1.00 38.85  ? 178 LEU D C     1 
ATOM   4746 O  O     . LEU D 1 178 ? 3.573   83.054  -9.974  1.00 38.10  ? 178 LEU D O     1 
ATOM   4747 C  CB    . LEU D 1 178 ? 3.405   81.637  -12.643 1.00 40.27  ? 178 LEU D CB    1 
ATOM   4748 C  CG    . LEU D 1 178 ? 3.444   80.128  -12.317 1.00 40.07  ? 178 LEU D CG    1 
ATOM   4749 C  CD1   . LEU D 1 178 ? 2.192   79.383  -12.802 1.00 40.83  ? 178 LEU D CD1   1 
ATOM   4750 C  CD2   . LEU D 1 178 ? 4.697   79.497  -12.896 1.00 40.55  ? 178 LEU D CD2   1 
ATOM   4751 N  N     . ASP D 1 179 ? 1.787   81.678  -9.711  1.00 37.52  ? 179 ASP D N     1 
ATOM   4752 C  CA    . ASP D 1 179 ? 2.058   81.398  -8.319  1.00 40.32  ? 179 ASP D CA    1 
ATOM   4753 C  C     . ASP D 1 179 ? 3.493   80.894  -8.194  1.00 39.50  ? 179 ASP D C     1 
ATOM   4754 O  O     . ASP D 1 179 ? 3.871   79.914  -8.845  1.00 36.59  ? 179 ASP D O     1 
ATOM   4755 C  CB    . ASP D 1 179 ? 1.098   80.324  -7.814  1.00 41.55  ? 179 ASP D CB    1 
ATOM   4756 C  CG    . ASP D 1 179 ? 1.275   80.040  -6.359  1.00 46.36  ? 179 ASP D CG    1 
ATOM   4757 O  OD1   . ASP D 1 179 ? 2.360   80.354  -5.807  1.00 50.33  ? 179 ASP D OD1   1 
ATOM   4758 O  OD2   . ASP D 1 179 ? 0.330   79.493  -5.757  1.00 54.02  ? 179 ASP D OD2   1 
ATOM   4759 N  N     . ILE D 1 180 ? 4.281   81.548  -7.348  1.00 39.28  ? 180 ILE D N     1 
ATOM   4760 C  CA    . ILE D 1 180 ? 5.681   81.174  -7.193  1.00 38.30  ? 180 ILE D CA    1 
ATOM   4761 C  C     . ILE D 1 180 ? 5.916   79.714  -6.748  1.00 37.48  ? 180 ILE D C     1 
ATOM   4762 O  O     . ILE D 1 180 ? 6.949   79.124  -7.091  1.00 37.74  ? 180 ILE D O     1 
ATOM   4763 C  CB    . ILE D 1 180 ? 6.434   82.145  -6.259  1.00 39.23  ? 180 ILE D CB    1 
ATOM   4764 C  CG1   . ILE D 1 180 ? 7.942   82.072  -6.552  1.00 38.50  ? 180 ILE D CG1   1 
ATOM   4765 C  CG2   . ILE D 1 180 ? 6.105   81.870  -4.796  1.00 38.84  ? 180 ILE D CG2   1 
ATOM   4766 C  CD1   . ILE D 1 180 ? 8.607   83.428  -6.585  1.00 38.14  ? 180 ILE D CD1   1 
ATOM   4767 N  N     . ALA D 1 181 ? 4.961   79.119  -6.034  1.00 35.32  ? 181 ALA D N     1 
ATOM   4768 C  CA    . ALA D 1 181 ? 5.078   77.713  -5.652  1.00 33.69  ? 181 ALA D CA    1 
ATOM   4769 C  C     . ALA D 1 181 ? 5.127   76.799  -6.868  1.00 32.92  ? 181 ALA D C     1 
ATOM   4770 O  O     . ALA D 1 181 ? 5.625   75.679  -6.776  1.00 31.40  ? 181 ALA D O     1 
ATOM   4771 C  CB    . ALA D 1 181 ? 3.952   77.292  -4.717  1.00 33.36  ? 181 ALA D CB    1 
ATOM   4772 N  N     . ASP D 1 182 ? 4.620   77.263  -8.006  1.00 33.06  ? 182 ASP D N     1 
ATOM   4773 C  CA    . ASP D 1 182 ? 4.737   76.501  -9.242  1.00 32.51  ? 182 ASP D CA    1 
ATOM   4774 C  C     . ASP D 1 182 ? 6.080   76.685  -9.951  1.00 30.01  ? 182 ASP D C     1 
ATOM   4775 O  O     . ASP D 1 182 ? 6.283   76.144  -11.024 1.00 31.71  ? 182 ASP D O     1 
ATOM   4776 C  CB    . ASP D 1 182 ? 3.583   76.836  -10.203 1.00 34.53  ? 182 ASP D CB    1 
ATOM   4777 C  CG    . ASP D 1 182 ? 2.205   76.467  -9.640  1.00 37.09  ? 182 ASP D CG    1 
ATOM   4778 O  OD1   . ASP D 1 182 ? 2.101   75.653  -8.698  1.00 39.20  ? 182 ASP D OD1   1 
ATOM   4779 O  OD2   . ASP D 1 182 ? 1.208   76.995  -10.163 1.00 41.01  ? 182 ASP D OD2   1 
ATOM   4780 N  N     . VAL D 1 183 ? 7.012   77.435  -9.384  1.00 29.91  ? 183 VAL D N     1 
ATOM   4781 C  CA    . VAL D 1 183 ? 8.360   77.503  -9.969  1.00 27.80  ? 183 VAL D CA    1 
ATOM   4782 C  C     . VAL D 1 183 ? 9.154   76.284  -9.487  1.00 27.37  ? 183 VAL D C     1 
ATOM   4783 O  O     . VAL D 1 183 ? 9.228   76.043  -8.299  1.00 27.63  ? 183 VAL D O     1 
ATOM   4784 C  CB    . VAL D 1 183 ? 9.071   78.805  -9.555  1.00 28.42  ? 183 VAL D CB    1 
ATOM   4785 C  CG1   . VAL D 1 183 ? 10.520  78.854  -10.042 1.00 27.11  ? 183 VAL D CG1   1 
ATOM   4786 C  CG2   . VAL D 1 183 ? 8.280   80.017  -10.051 1.00 29.07  ? 183 VAL D CG2   1 
ATOM   4787 N  N     . PRO D 1 184 ? 9.747   75.511  -10.404 1.00 27.06  ? 184 PRO D N     1 
ATOM   4788 C  CA    . PRO D 1 184 ? 10.642  74.415  -10.013 1.00 27.49  ? 184 PRO D CA    1 
ATOM   4789 C  C     . PRO D 1 184 ? 11.756  74.881  -9.090  1.00 29.03  ? 184 PRO D C     1 
ATOM   4790 O  O     . PRO D 1 184 ? 12.341  75.945  -9.321  1.00 31.70  ? 184 PRO D O     1 
ATOM   4791 C  CB    . PRO D 1 184 ? 11.228  73.946  -11.350 1.00 26.82  ? 184 PRO D CB    1 
ATOM   4792 C  CG    . PRO D 1 184 ? 10.181  74.309  -12.352 1.00 26.90  ? 184 PRO D CG    1 
ATOM   4793 C  CD    . PRO D 1 184 ? 9.642   75.621  -11.868 1.00 27.28  ? 184 PRO D CD    1 
ATOM   4794 N  N     . GLY D 1 185 ? 12.063  74.093  -8.063  1.00 28.75  ? 185 GLY D N     1 
ATOM   4795 C  CA    . GLY D 1 185 ? 13.001  74.536  -7.028  1.00 29.32  ? 185 GLY D CA    1 
ATOM   4796 C  C     . GLY D 1 185 ? 12.320  75.147  -5.802  1.00 32.09  ? 185 GLY D C     1 
ATOM   4797 O  O     . GLY D 1 185 ? 12.965  75.313  -4.781  1.00 34.37  ? 185 GLY D O     1 
ATOM   4798 N  N     . ILE D 1 186 ? 11.025  75.467  -5.902  1.00 33.66  ? 186 ILE D N     1 
ATOM   4799 C  CA    . ILE D 1 186 ? 10.225  76.027  -4.798  1.00 36.72  ? 186 ILE D CA    1 
ATOM   4800 C  C     . ILE D 1 186 ? 9.167   75.018  -4.345  1.00 37.25  ? 186 ILE D C     1 
ATOM   4801 O  O     . ILE D 1 186 ? 8.144   74.846  -5.003  1.00 39.23  ? 186 ILE D O     1 
ATOM   4802 C  CB    . ILE D 1 186 ? 9.506   77.321  -5.255  1.00 37.24  ? 186 ILE D CB    1 
ATOM   4803 C  CG1   . ILE D 1 186 ? 10.486  78.283  -5.932  1.00 38.37  ? 186 ILE D CG1   1 
ATOM   4804 C  CG2   . ILE D 1 186 ? 8.776   77.999  -4.105  1.00 38.36  ? 186 ILE D CG2   1 
ATOM   4805 C  CD1   . ILE D 1 186 ? 11.713  78.639  -5.128  1.00 38.62  ? 186 ILE D CD1   1 
ATOM   4806 N  N     . GLY D 1 187 ? 9.413   74.329  -3.237  1.00 39.86  ? 187 GLY D N     1 
ATOM   4807 C  CA    . GLY D 1 187 ? 8.394   73.450  -2.646  1.00 41.19  ? 187 GLY D CA    1 
ATOM   4808 C  C     . GLY D 1 187 ? 7.430   74.246  -1.777  1.00 42.51  ? 187 GLY D C     1 
ATOM   4809 O  O     . GLY D 1 187 ? 7.535   75.471  -1.685  1.00 45.20  ? 187 GLY D O     1 
ATOM   4810 N  N     . ASN D 1 188 ? 6.483   73.560  -1.145  1.00 43.93  ? 188 ASN D N     1 
ATOM   4811 C  CA    . ASN D 1 188 ? 5.548   74.213  -0.221  1.00 46.61  ? 188 ASN D CA    1 
ATOM   4812 C  C     . ASN D 1 188 ? 6.278   75.008  0.870   1.00 44.23  ? 188 ASN D C     1 
ATOM   4813 O  O     . ASN D 1 188 ? 5.957   76.176  1.120   1.00 42.43  ? 188 ASN D O     1 
ATOM   4814 C  CB    . ASN D 1 188 ? 4.607   73.177  0.420   1.00 50.06  ? 188 ASN D CB    1 
ATOM   4815 C  CG    . ASN D 1 188 ? 3.549   72.652  -0.554  1.00 53.73  ? 188 ASN D CG    1 
ATOM   4816 O  OD1   . ASN D 1 188 ? 3.235   73.280  -1.584  1.00 52.23  ? 188 ASN D OD1   1 
ATOM   4817 N  ND2   . ASN D 1 188 ? 2.981   71.494  -0.223  1.00 56.23  ? 188 ASN D ND2   1 
ATOM   4818 N  N     . ILE D 1 189 ? 7.290   74.380  1.467   1.00 43.70  ? 189 ILE D N     1 
ATOM   4819 C  CA    . ILE D 1 189 ? 8.097   74.992  2.519   1.00 42.27  ? 189 ILE D CA    1 
ATOM   4820 C  C     . ILE D 1 189 ? 8.656   76.349  2.087   1.00 41.77  ? 189 ILE D C     1 
ATOM   4821 O  O     . ILE D 1 189 ? 8.375   77.365  2.717   1.00 43.01  ? 189 ILE D O     1 
ATOM   4822 C  CB    . ILE D 1 189 ? 9.237   74.046  2.961   1.00 43.35  ? 189 ILE D CB    1 
ATOM   4823 C  CG1   . ILE D 1 189 ? 8.642   72.851  3.732   1.00 43.68  ? 189 ILE D CG1   1 
ATOM   4824 C  CG2   . ILE D 1 189 ? 10.237  74.786  3.845   1.00 42.52  ? 189 ILE D CG2   1 
ATOM   4825 C  CD1   . ILE D 1 189 ? 9.606   71.712  4.015   1.00 42.40  ? 189 ILE D CD1   1 
ATOM   4826 N  N     . THR D 1 190 ? 9.433   76.379  1.008   1.00 39.25  ? 190 THR D N     1 
ATOM   4827 C  CA    . THR D 1 190 ? 9.996   77.650  0.528   1.00 37.04  ? 190 THR D CA    1 
ATOM   4828 C  C     . THR D 1 190 ? 8.931   78.691  0.113   1.00 35.99  ? 190 THR D C     1 
ATOM   4829 O  O     . THR D 1 190 ? 9.110   79.890  0.338   1.00 35.25  ? 190 THR D O     1 
ATOM   4830 C  CB    . THR D 1 190 ? 10.946  77.419  -0.652  1.00 35.35  ? 190 THR D CB    1 
ATOM   4831 O  OG1   . THR D 1 190 ? 11.860  76.378  -0.319  1.00 35.65  ? 190 THR D OG1   1 
ATOM   4832 C  CG2   . THR D 1 190 ? 11.708  78.678  -0.991  1.00 35.23  ? 190 THR D CG2   1 
ATOM   4833 N  N     . ALA D 1 191 ? 7.848   78.230  -0.507  1.00 37.42  ? 191 ALA D N     1 
ATOM   4834 C  CA    . ALA D 1 191 ? 6.722   79.100  -0.879  1.00 39.77  ? 191 ALA D CA    1 
ATOM   4835 C  C     . ALA D 1 191 ? 6.111   79.837  0.333   1.00 42.26  ? 191 ALA D C     1 
ATOM   4836 O  O     . ALA D 1 191 ? 5.747   81.007  0.225   1.00 43.61  ? 191 ALA D O     1 
ATOM   4837 C  CB    . ALA D 1 191 ? 5.651   78.295  -1.602  1.00 41.46  ? 191 ALA D CB    1 
ATOM   4838 N  N     . GLU D 1 192 ? 6.045   79.174  1.487   1.00 44.62  ? 192 GLU D N     1 
ATOM   4839 C  CA    . GLU D 1 192 ? 5.525   79.808  2.704   1.00 47.35  ? 192 GLU D CA    1 
ATOM   4840 C  C     . GLU D 1 192 ? 6.494   80.837  3.262   1.00 47.54  ? 192 GLU D C     1 
ATOM   4841 O  O     . GLU D 1 192 ? 6.081   81.925  3.655   1.00 45.62  ? 192 GLU D O     1 
ATOM   4842 C  CB    . GLU D 1 192 ? 5.173   78.777  3.782   1.00 49.31  ? 192 GLU D CB    1 
ATOM   4843 C  CG    . GLU D 1 192 ? 3.785   78.176  3.618   1.00 54.03  ? 192 GLU D CG    1 
ATOM   4844 C  CD    . GLU D 1 192 ? 2.648   79.163  3.918   1.00 58.05  ? 192 GLU D CD    1 
ATOM   4845 O  OE1   . GLU D 1 192 ? 2.589   79.703  5.044   1.00 62.99  ? 192 GLU D OE1   1 
ATOM   4846 O  OE2   . GLU D 1 192 ? 1.798   79.394  3.028   1.00 60.27  ? 192 GLU D OE2   1 
ATOM   4847 N  N     . LYS D 1 193 ? 7.779   80.507  3.295   1.00 45.47  ? 193 LYS D N     1 
ATOM   4848 C  CA    . LYS D 1 193 ? 8.767   81.473  3.747   1.00 47.14  ? 193 LYS D CA    1 
ATOM   4849 C  C     . LYS D 1 193 ? 8.694   82.749  2.908   1.00 47.94  ? 193 LYS D C     1 
ATOM   4850 O  O     . LYS D 1 193 ? 8.812   83.856  3.432   1.00 48.72  ? 193 LYS D O     1 
ATOM   4851 C  CB    . LYS D 1 193 ? 10.171  80.891  3.646   1.00 48.67  ? 193 LYS D CB    1 
ATOM   4852 C  CG    . LYS D 1 193 ? 10.443  79.709  4.564   1.00 49.92  ? 193 LYS D CG    1 
ATOM   4853 C  CD    . LYS D 1 193 ? 11.819  79.123  4.282   1.00 50.26  ? 193 LYS D CD    1 
ATOM   4854 C  CE    . LYS D 1 193 ? 12.023  77.805  5.018   1.00 52.77  ? 193 LYS D CE    1 
ATOM   4855 N  NZ    . LYS D 1 193 ? 13.325  77.156  4.678   1.00 52.46  ? 193 LYS D NZ    1 
ATOM   4856 N  N     . LEU D 1 194 ? 8.515   82.574  1.598   1.00 49.24  ? 194 LEU D N     1 
ATOM   4857 C  CA    . LEU D 1 194 ? 8.374   83.690  0.659   1.00 49.65  ? 194 LEU D CA    1 
ATOM   4858 C  C     . LEU D 1 194 ? 7.063   84.452  0.837   1.00 49.39  ? 194 LEU D C     1 
ATOM   4859 O  O     . LEU D 1 194 ? 7.043   85.670  0.677   1.00 46.80  ? 194 LEU D O     1 
ATOM   4860 C  CB    . LEU D 1 194 ? 8.475   83.188  -0.792  1.00 48.86  ? 194 LEU D CB    1 
ATOM   4861 C  CG    . LEU D 1 194 ? 9.879   82.769  -1.241  1.00 48.83  ? 194 LEU D CG    1 
ATOM   4862 C  CD1   . LEU D 1 194 ? 9.855   82.228  -2.662  1.00 49.53  ? 194 LEU D CD1   1 
ATOM   4863 C  CD2   . LEU D 1 194 ? 10.855  83.928  -1.144  1.00 49.98  ? 194 LEU D CD2   1 
ATOM   4864 N  N     . LYS D 1 195 ? 5.985   83.726  1.136   1.00 50.93  ? 195 LYS D N     1 
ATOM   4865 C  CA    . LYS D 1 195 ? 4.677   84.323  1.448   1.00 55.20  ? 195 LYS D CA    1 
ATOM   4866 C  C     . LYS D 1 195 ? 4.772   85.346  2.565   1.00 54.25  ? 195 LYS D C     1 
ATOM   4867 O  O     . LYS D 1 195 ? 4.150   86.398  2.496   1.00 52.70  ? 195 LYS D O     1 
ATOM   4868 C  CB    . LYS D 1 195 ? 3.670   83.247  1.875   1.00 60.05  ? 195 LYS D CB    1 
ATOM   4869 C  CG    . LYS D 1 195 ? 2.885   82.604  0.741   1.00 63.09  ? 195 LYS D CG    1 
ATOM   4870 C  CD    . LYS D 1 195 ? 1.501   83.231  0.584   1.00 66.79  ? 195 LYS D CD    1 
ATOM   4871 C  CE    . LYS D 1 195 ? 0.513   82.709  1.615   1.00 69.50  ? 195 LYS D CE    1 
ATOM   4872 N  NZ    . LYS D 1 195 ? -0.751  83.504  1.624   1.00 72.34  ? 195 LYS D NZ    1 
ATOM   4873 N  N     . LYS D 1 196 ? 5.556   85.032  3.592   1.00 54.89  ? 196 LYS D N     1 
ATOM   4874 C  CA    . LYS D 1 196 ? 5.711   85.928  4.732   1.00 56.60  ? 196 LYS D CA    1 
ATOM   4875 C  C     . LYS D 1 196 ? 6.363   87.252  4.325   1.00 56.13  ? 196 LYS D C     1 
ATOM   4876 O  O     . LYS D 1 196 ? 6.012   88.313  4.847   1.00 56.32  ? 196 LYS D O     1 
ATOM   4877 C  CB    . LYS D 1 196 ? 6.521   85.248  5.834   1.00 58.10  ? 196 LYS D CB    1 
ATOM   4878 C  CG    . LYS D 1 196 ? 5.779   84.093  6.498   1.00 60.60  ? 196 LYS D CG    1 
ATOM   4879 C  CD    . LYS D 1 196 ? 6.402   83.676  7.826   1.00 63.38  ? 196 LYS D CD    1 
ATOM   4880 C  CE    . LYS D 1 196 ? 6.524   84.852  8.790   1.00 65.81  ? 196 LYS D CE    1 
ATOM   4881 N  NZ    . LYS D 1 196 ? 6.238   84.493  10.208  1.00 67.60  ? 196 LYS D NZ    1 
ATOM   4882 N  N     . LEU D 1 197 ? 7.301   87.178  3.385   1.00 53.81  ? 197 LEU D N     1 
ATOM   4883 C  CA    . LEU D 1 197 ? 7.960   88.366  2.843   1.00 53.05  ? 197 LEU D CA    1 
ATOM   4884 C  C     . LEU D 1 197 ? 7.076   89.130  1.849   1.00 54.26  ? 197 LEU D C     1 
ATOM   4885 O  O     . LEU D 1 197 ? 7.431   90.234  1.436   1.00 56.32  ? 197 LEU D O     1 
ATOM   4886 C  CB    . LEU D 1 197 ? 9.261   87.981  2.142   1.00 52.19  ? 197 LEU D CB    1 
ATOM   4887 C  CG    . LEU D 1 197 ? 10.282  87.164  2.934   1.00 52.02  ? 197 LEU D CG    1 
ATOM   4888 C  CD1   . LEU D 1 197 ? 11.368  86.607  2.017   1.00 50.17  ? 197 LEU D CD1   1 
ATOM   4889 C  CD2   . LEU D 1 197 ? 10.884  88.008  4.052   1.00 52.21  ? 197 LEU D CD2   1 
ATOM   4890 N  N     . GLY D 1 198 ? 5.947   88.546  1.446   1.00 52.71  ? 198 GLY D N     1 
ATOM   4891 C  CA    . GLY D 1 198 ? 5.018   89.216  0.533   1.00 52.06  ? 198 GLY D CA    1 
ATOM   4892 C  C     . GLY D 1 198 ? 5.313   88.925  -0.923  1.00 50.60  ? 198 GLY D C     1 
ATOM   4893 O  O     . GLY D 1 198 ? 4.937   89.685  -1.813  1.00 52.88  ? 198 GLY D O     1 
ATOM   4894 N  N     . ILE D 1 199 ? 5.982   87.806  -1.163  1.00 49.06  ? 199 ILE D N     1 
ATOM   4895 C  CA    . ILE D 1 199 ? 6.309   87.360  -2.494  1.00 45.49  ? 199 ILE D CA    1 
ATOM   4896 C  C     . ILE D 1 199 ? 5.396   86.171  -2.824  1.00 45.12  ? 199 ILE D C     1 
ATOM   4897 O  O     . ILE D 1 199 ? 5.555   85.072  -2.291  1.00 43.74  ? 199 ILE D O     1 
ATOM   4898 C  CB    . ILE D 1 199 ? 7.803   86.993  -2.585  1.00 45.37  ? 199 ILE D CB    1 
ATOM   4899 C  CG1   . ILE D 1 199 ? 8.649   88.275  -2.542  1.00 46.75  ? 199 ILE D CG1   1 
ATOM   4900 C  CG2   . ILE D 1 199 ? 8.093   86.197  -3.852  1.00 44.49  ? 199 ILE D CG2   1 
ATOM   4901 C  CD1   . ILE D 1 199 ? 10.094  88.054  -2.155  1.00 47.46  ? 199 ILE D CD1   1 
ATOM   4902 N  N     . ASN D 1 200 ? 4.402   86.445  -3.665  1.00 42.73  ? 200 ASN D N     1 
ATOM   4903 C  CA    . ASN D 1 200 ? 3.495   85.448  -4.175  1.00 41.16  ? 200 ASN D CA    1 
ATOM   4904 C  C     . ASN D 1 200 ? 3.813   85.090  -5.626  1.00 38.89  ? 200 ASN D C     1 
ATOM   4905 O  O     . ASN D 1 200 ? 3.455   84.019  -6.084  1.00 35.19  ? 200 ASN D O     1 
ATOM   4906 C  CB    . ASN D 1 200 ? 2.077   85.985  -4.057  1.00 42.44  ? 200 ASN D CB    1 
ATOM   4907 C  CG    . ASN D 1 200 ? 1.722   86.317  -2.625  1.00 44.73  ? 200 ASN D CG    1 
ATOM   4908 O  OD1   . ASN D 1 200 ? 1.776   87.472  -2.206  1.00 43.84  ? 200 ASN D OD1   1 
ATOM   4909 N  ND2   . ASN D 1 200 ? 1.432   85.290  -1.848  1.00 45.67  ? 200 ASN D ND2   1 
ATOM   4910 N  N     . LYS D 1 201 ? 4.502   86.000  -6.317  1.00 39.04  ? 201 LYS D N     1 
ATOM   4911 C  CA    . LYS D 1 201 ? 4.783   85.902  -7.743  1.00 39.89  ? 201 LYS D CA    1 
ATOM   4912 C  C     . LYS D 1 201 ? 6.256   86.195  -7.969  1.00 38.77  ? 201 LYS D C     1 
ATOM   4913 O  O     . LYS D 1 201 ? 6.914   86.799  -7.125  1.00 39.46  ? 201 LYS D O     1 
ATOM   4914 C  CB    . LYS D 1 201 ? 3.962   86.936  -8.526  1.00 41.25  ? 201 LYS D CB    1 
ATOM   4915 C  CG    . LYS D 1 201 ? 2.494   87.068  -8.132  1.00 42.26  ? 201 LYS D CG    1 
ATOM   4916 C  CD    . LYS D 1 201 ? 1.648   85.941  -8.707  1.00 42.70  ? 201 LYS D CD    1 
ATOM   4917 C  CE    . LYS D 1 201 ? 0.175   86.100  -8.330  1.00 42.33  ? 201 LYS D CE    1 
ATOM   4918 N  NZ    . LYS D 1 201 ? -0.552  84.817  -8.538  1.00 41.59  ? 201 LYS D NZ    1 
ATOM   4919 N  N     . LEU D 1 202 ? 6.776   85.769  -9.113  1.00 38.94  ? 202 LEU D N     1 
ATOM   4920 C  CA    . LEU D 1 202 ? 8.185   86.018  -9.426  1.00 38.18  ? 202 LEU D CA    1 
ATOM   4921 C  C     . LEU D 1 202 ? 8.546   87.487  -9.379  1.00 37.50  ? 202 LEU D C     1 
ATOM   4922 O  O     . LEU D 1 202 ? 9.599   87.822  -8.838  1.00 38.15  ? 202 LEU D O     1 
ATOM   4923 C  CB    . LEU D 1 202 ? 8.587   85.428  -10.778 1.00 36.73  ? 202 LEU D CB    1 
ATOM   4924 C  CG    . LEU D 1 202 ? 8.975   83.951  -10.765 1.00 36.21  ? 202 LEU D CG    1 
ATOM   4925 C  CD1   . LEU D 1 202 ? 9.125   83.452  -12.195 1.00 34.92  ? 202 LEU D CD1   1 
ATOM   4926 C  CD2   . LEU D 1 202 ? 10.258  83.724  -9.970  1.00 36.86  ? 202 LEU D CD2   1 
ATOM   4927 N  N     . VAL D 1 203 ? 7.705   88.362  -9.944  1.00 39.18  ? 203 VAL D N     1 
ATOM   4928 C  CA    . VAL D 1 203 ? 8.010   89.808  -9.943  1.00 40.23  ? 203 VAL D CA    1 
ATOM   4929 C  C     . VAL D 1 203 ? 8.237   90.333  -8.544  1.00 39.40  ? 203 VAL D C     1 
ATOM   4930 O  O     . VAL D 1 203 ? 9.090   91.201  -8.349  1.00 40.98  ? 203 VAL D O     1 
ATOM   4931 C  CB    . VAL D 1 203 ? 6.930   90.743  -10.564 1.00 43.46  ? 203 VAL D CB    1 
ATOM   4932 C  CG1   . VAL D 1 203 ? 6.993   90.739  -12.074 1.00 45.77  ? 203 VAL D CG1   1 
ATOM   4933 C  CG2   . VAL D 1 203 ? 5.525   90.440  -10.046 1.00 43.91  ? 203 VAL D CG2   1 
ATOM   4934 N  N     . ASP D 1 204 ? 7.479   89.824  -7.575  1.00 36.69  ? 204 ASP D N     1 
ATOM   4935 C  CA    . ASP D 1 204 ? 7.615   90.306  -6.203  1.00 36.62  ? 204 ASP D CA    1 
ATOM   4936 C  C     . ASP D 1 204 ? 9.067   90.205  -5.708  1.00 36.02  ? 204 ASP D C     1 
ATOM   4937 O  O     . ASP D 1 204 ? 9.476   90.986  -4.860  1.00 36.66  ? 204 ASP D O     1 
ATOM   4938 C  CB    . ASP D 1 204 ? 6.673   89.547  -5.257  1.00 36.23  ? 204 ASP D CB    1 
ATOM   4939 C  CG    . ASP D 1 204 ? 5.200   89.672  -5.657  1.00 36.46  ? 204 ASP D CG    1 
ATOM   4940 O  OD1   . ASP D 1 204 ? 4.829   90.688  -6.277  1.00 36.13  ? 204 ASP D OD1   1 
ATOM   4941 O  OD2   . ASP D 1 204 ? 4.403   88.749  -5.354  1.00 36.22  ? 204 ASP D OD2   1 
ATOM   4942 N  N     . THR D 1 205 ? 9.845   89.256  -6.229  1.00 34.54  ? 205 THR D N     1 
ATOM   4943 C  CA    . THR D 1 205 ? 11.225  89.085  -5.760  1.00 35.52  ? 205 THR D CA    1 
ATOM   4944 C  C     . THR D 1 205 ? 12.132  90.267  -6.086  1.00 36.01  ? 205 THR D C     1 
ATOM   4945 O  O     . THR D 1 205 ? 13.129  90.455  -5.416  1.00 36.68  ? 205 THR D O     1 
ATOM   4946 C  CB    . THR D 1 205 ? 11.918  87.803  -6.281  1.00 34.84  ? 205 THR D CB    1 
ATOM   4947 O  OG1   . THR D 1 205 ? 12.028  87.841  -7.710  1.00 33.57  ? 205 THR D OG1   1 
ATOM   4948 C  CG2   . THR D 1 205 ? 11.175  86.563  -5.826  1.00 34.84  ? 205 THR D CG2   1 
ATOM   4949 N  N     . LEU D 1 206 ? 11.762  91.053  -7.097  1.00 37.60  ? 206 LEU D N     1 
ATOM   4950 C  CA    . LEU D 1 206 ? 12.513  92.232  -7.504  1.00 39.50  ? 206 LEU D CA    1 
ATOM   4951 C  C     . LEU D 1 206 ? 12.282  93.431  -6.604  1.00 40.58  ? 206 LEU D C     1 
ATOM   4952 O  O     . LEU D 1 206 ? 13.137  94.309  -6.549  1.00 41.72  ? 206 LEU D O     1 
ATOM   4953 C  CB    . LEU D 1 206 ? 12.173  92.613  -8.956  1.00 41.07  ? 206 LEU D CB    1 
ATOM   4954 C  CG    . LEU D 1 206 ? 12.447  91.527  -10.012 1.00 40.72  ? 206 LEU D CG    1 
ATOM   4955 C  CD1   . LEU D 1 206 ? 12.255  92.104  -11.409 1.00 42.26  ? 206 LEU D CD1   1 
ATOM   4956 C  CD2   . LEU D 1 206 ? 13.845  90.953  -9.858  1.00 40.66  ? 206 LEU D CD2   1 
ATOM   4957 N  N     . SER D 1 207 ? 11.155  93.476  -5.892  1.00 41.05  ? 207 SER D N     1 
ATOM   4958 C  CA    . SER D 1 207 ? 10.848  94.635  -5.025  1.00 43.34  ? 207 SER D CA    1 
ATOM   4959 C  C     . SER D 1 207 ? 11.140  94.419  -3.535  1.00 42.80  ? 207 SER D C     1 
ATOM   4960 O  O     . SER D 1 207 ? 10.904  95.307  -2.717  1.00 45.01  ? 207 SER D O     1 
ATOM   4961 C  CB    . SER D 1 207 ? 9.396   95.075  -5.214  1.00 45.53  ? 207 SER D CB    1 
ATOM   4962 O  OG    . SER D 1 207 ? 8.528   93.968  -5.137  1.00 47.55  ? 207 SER D OG    1 
ATOM   4963 N  N     . ILE D 1 208 ? 11.636  93.244  -3.189  1.00 41.54  ? 208 ILE D N     1 
ATOM   4964 C  CA    . ILE D 1 208 ? 12.173  93.001  -1.851  1.00 43.13  ? 208 ILE D CA    1 
ATOM   4965 C  C     . ILE D 1 208 ? 13.700  93.166  -1.850  1.00 41.78  ? 208 ILE D C     1 
ATOM   4966 O  O     . ILE D 1 208 ? 14.349  92.935  -2.867  1.00 38.46  ? 208 ILE D O     1 
ATOM   4967 C  CB    . ILE D 1 208 ? 11.814  91.591  -1.349  1.00 44.17  ? 208 ILE D CB    1 
ATOM   4968 C  CG1   . ILE D 1 208 ? 12.434  91.338  0.021   1.00 46.08  ? 208 ILE D CG1   1 
ATOM   4969 C  CG2   . ILE D 1 208 ? 12.298  90.521  -2.326  1.00 44.15  ? 208 ILE D CG2   1 
ATOM   4970 C  CD1   . ILE D 1 208 ? 11.822  90.159  0.734   1.00 48.52  ? 208 ILE D CD1   1 
ATOM   4971 N  N     . GLU D 1 209 ? 14.263  93.563  -0.706  1.00 42.86  ? 209 GLU D N     1 
ATOM   4972 C  CA    . GLU D 1 209 ? 15.712  93.763  -0.571  1.00 44.53  ? 209 GLU D CA    1 
ATOM   4973 C  C     . GLU D 1 209 ? 16.440  92.437  -0.754  1.00 43.15  ? 209 GLU D C     1 
ATOM   4974 O  O     . GLU D 1 209 ? 16.160  91.470  -0.055  1.00 41.15  ? 209 GLU D O     1 
ATOM   4975 C  CB    . GLU D 1 209 ? 16.081  94.362  0.789   1.00 47.09  ? 209 GLU D CB    1 
ATOM   4976 C  CG    . GLU D 1 209 ? 15.375  95.665  1.121   1.00 50.18  ? 209 GLU D CG    1 
ATOM   4977 C  CD    . GLU D 1 209 ? 15.948  96.338  2.356   1.00 54.87  ? 209 GLU D CD    1 
ATOM   4978 O  OE1   . GLU D 1 209 ? 16.477  95.626  3.241   1.00 57.77  ? 209 GLU D OE1   1 
ATOM   4979 O  OE2   . GLU D 1 209 ? 15.866  97.582  2.450   1.00 58.20  ? 209 GLU D OE2   1 
ATOM   4980 N  N     . PHE D 1 210 ? 17.368  92.409  -1.703  1.00 43.15  ? 210 PHE D N     1 
ATOM   4981 C  CA    . PHE D 1 210 ? 18.077  91.189  -2.061  1.00 44.67  ? 210 PHE D CA    1 
ATOM   4982 C  C     . PHE D 1 210 ? 18.689  90.465  -0.843  1.00 43.35  ? 210 PHE D C     1 
ATOM   4983 O  O     . PHE D 1 210 ? 18.570  89.246  -0.711  1.00 40.55  ? 210 PHE D O     1 
ATOM   4984 C  CB    . PHE D 1 210 ? 19.153  91.497  -3.120  1.00 46.01  ? 210 PHE D CB    1 
ATOM   4985 C  CG    . PHE D 1 210 ? 20.053  90.327  -3.434  1.00 47.71  ? 210 PHE D CG    1 
ATOM   4986 C  CD1   . PHE D 1 210 ? 19.537  89.177  -3.993  1.00 46.82  ? 210 PHE D CD1   1 
ATOM   4987 C  CD2   . PHE D 1 210 ? 21.423  90.378  -3.162  1.00 50.40  ? 210 PHE D CD2   1 
ATOM   4988 C  CE1   . PHE D 1 210 ? 20.353  88.088  -4.270  1.00 47.48  ? 210 PHE D CE1   1 
ATOM   4989 C  CE2   . PHE D 1 210 ? 22.244  89.294  -3.442  1.00 49.49  ? 210 PHE D CE2   1 
ATOM   4990 C  CZ    . PHE D 1 210 ? 21.706  88.145  -3.992  1.00 47.02  ? 210 PHE D CZ    1 
ATOM   4991 N  N     . ASP D 1 211 ? 19.353  91.211  0.028   1.00 44.76  ? 211 ASP D N     1 
ATOM   4992 C  CA    . ASP D 1 211 ? 19.928  90.633  1.248   1.00 46.82  ? 211 ASP D CA    1 
ATOM   4993 C  C     . ASP D 1 211 ? 18.855  89.955  2.129   1.00 46.55  ? 211 ASP D C     1 
ATOM   4994 O  O     . ASP D 1 211 ? 19.105  88.935  2.746   1.00 45.11  ? 211 ASP D O     1 
ATOM   4995 C  CB    . ASP D 1 211 ? 20.709  91.707  2.029   1.00 48.72  ? 211 ASP D CB    1 
ATOM   4996 C  CG    . ASP D 1 211 ? 22.007  92.108  1.332   1.00 50.64  ? 211 ASP D CG    1 
ATOM   4997 O  OD1   . ASP D 1 211 ? 22.520  91.320  0.508   1.00 52.39  ? 211 ASP D OD1   1 
ATOM   4998 O  OD2   . ASP D 1 211 ? 22.518  93.218  1.592   1.00 54.04  ? 211 ASP D OD2   1 
ATOM   4999 N  N     . LYS D 1 212 ? 17.654  90.511  2.148   1.00 49.46  ? 212 LYS D N     1 
ATOM   5000 C  CA    . LYS D 1 212 ? 16.552  89.950  2.930   1.00 51.13  ? 212 LYS D CA    1 
ATOM   5001 C  C     . LYS D 1 212 ? 16.154  88.601  2.355   1.00 48.74  ? 212 LYS D C     1 
ATOM   5002 O  O     . LYS D 1 212 ? 15.996  87.621  3.080   1.00 47.13  ? 212 LYS D O     1 
ATOM   5003 C  CB    . LYS D 1 212 ? 15.364  90.914  2.917   1.00 54.87  ? 212 LYS D CB    1 
ATOM   5004 C  CG    . LYS D 1 212 ? 14.521  90.945  4.187   1.00 58.88  ? 212 LYS D CG    1 
ATOM   5005 C  CD    . LYS D 1 212 ? 13.770  92.270  4.285   1.00 61.76  ? 212 LYS D CD    1 
ATOM   5006 C  CE    . LYS D 1 212 ? 13.032  92.430  5.605   1.00 65.62  ? 212 LYS D CE    1 
ATOM   5007 N  NZ    . LYS D 1 212 ? 11.784  91.611  5.654   1.00 65.57  ? 212 LYS D NZ    1 
ATOM   5008 N  N     . LEU D 1 213 ? 16.007  88.547  1.036   1.00 48.03  ? 213 LEU D N     1 
ATOM   5009 C  CA    . LEU D 1 213 ? 15.633  87.301  0.374   1.00 46.57  ? 213 LEU D CA    1 
ATOM   5010 C  C     . LEU D 1 213 ? 16.744  86.246  0.526   1.00 45.72  ? 213 LEU D C     1 
ATOM   5011 O  O     . LEU D 1 213 ? 16.471  85.079  0.835   1.00 42.34  ? 213 LEU D O     1 
ATOM   5012 C  CB    . LEU D 1 213 ? 15.340  87.550  -1.103  1.00 46.55  ? 213 LEU D CB    1 
ATOM   5013 C  CG    . LEU D 1 213 ? 14.904  86.327  -1.929  1.00 45.27  ? 213 LEU D CG    1 
ATOM   5014 C  CD1   . LEU D 1 213 ? 13.462  85.939  -1.595  1.00 44.23  ? 213 LEU D CD1   1 
ATOM   5015 C  CD2   . LEU D 1 213 ? 15.070  86.592  -3.429  1.00 44.45  ? 213 LEU D CD2   1 
ATOM   5016 N  N     . LYS D 1 214 ? 17.989  86.667  0.311   1.00 45.25  ? 214 LYS D N     1 
ATOM   5017 C  CA    . LYS D 1 214 ? 19.146  85.772  0.444   1.00 47.98  ? 214 LYS D CA    1 
ATOM   5018 C  C     . LYS D 1 214 ? 19.212  85.134  1.846   1.00 47.30  ? 214 LYS D C     1 
ATOM   5019 O  O     . LYS D 1 214 ? 19.560  83.957  1.989   1.00 47.08  ? 214 LYS D O     1 
ATOM   5020 C  CB    . LYS D 1 214 ? 20.454  86.523  0.126   1.00 49.59  ? 214 LYS D CB    1 
ATOM   5021 C  CG    . LYS D 1 214 ? 21.698  85.842  0.669   1.00 52.58  ? 214 LYS D CG    1 
ATOM   5022 C  CD    . LYS D 1 214 ? 22.965  86.658  0.473   1.00 54.91  ? 214 LYS D CD    1 
ATOM   5023 C  CE    . LYS D 1 214 ? 23.945  86.345  1.597   1.00 57.16  ? 214 LYS D CE    1 
ATOM   5024 N  NZ    . LYS D 1 214 ? 25.369  86.511  1.198   1.00 58.74  ? 214 LYS D NZ    1 
ATOM   5025 N  N     . GLY D 1 215 ? 18.876  85.924  2.863   1.00 46.48  ? 215 GLY D N     1 
ATOM   5026 C  CA    . GLY D 1 215 ? 18.847  85.451  4.231   1.00 48.36  ? 215 GLY D CA    1 
ATOM   5027 C  C     . GLY D 1 215 ? 17.746  84.448  4.500   1.00 48.38  ? 215 GLY D C     1 
ATOM   5028 O  O     . GLY D 1 215 ? 17.889  83.590  5.360   1.00 47.82  ? 215 GLY D O     1 
ATOM   5029 N  N     . MET D 1 216 ? 16.640  84.553  3.773   1.00 48.92  ? 216 MET D N     1 
ATOM   5030 C  CA    . MET D 1 216 ? 15.509  83.679  4.016   1.00 50.56  ? 216 MET D CA    1 
ATOM   5031 C  C     . MET D 1 216 ? 15.678  82.326  3.331   1.00 48.14  ? 216 MET D C     1 
ATOM   5032 O  O     . MET D 1 216 ? 15.398  81.289  3.930   1.00 48.92  ? 216 MET D O     1 
ATOM   5033 C  CB    . MET D 1 216 ? 14.213  84.346  3.557   1.00 53.31  ? 216 MET D CB    1 
ATOM   5034 C  CG    . MET D 1 216 ? 12.955  83.537  3.846   1.00 55.64  ? 216 MET D CG    1 
ATOM   5035 S  SD    . MET D 1 216 ? 12.547  83.339  5.599   1.00 62.06  ? 216 MET D SD    1 
ATOM   5036 C  CE    . MET D 1 216 ? 13.491  81.892  6.083   1.00 61.43  ? 216 MET D CE    1 
ATOM   5037 N  N     . ILE D 1 217 ? 16.126  82.329  2.078   1.00 45.83  ? 217 ILE D N     1 
ATOM   5038 C  CA    . ILE D 1 217 ? 16.181  81.083  1.281   1.00 44.98  ? 217 ILE D CA    1 
ATOM   5039 C  C     . ILE D 1 217 ? 17.577  80.650  0.806   1.00 42.54  ? 217 ILE D C     1 
ATOM   5040 O  O     . ILE D 1 217 ? 17.707  79.623  0.134   1.00 41.52  ? 217 ILE D O     1 
ATOM   5041 C  CB    . ILE D 1 217 ? 15.222  81.145  0.062   1.00 43.76  ? 217 ILE D CB    1 
ATOM   5042 C  CG1   . ILE D 1 217 ? 15.542  82.335  -0.855  1.00 45.53  ? 217 ILE D CG1   1 
ATOM   5043 C  CG2   . ILE D 1 217 ? 13.784  81.235  0.538   1.00 44.19  ? 217 ILE D CG2   1 
ATOM   5044 C  CD1   . ILE D 1 217 ? 14.707  82.373  -2.126  1.00 46.16  ? 217 ILE D CD1   1 
ATOM   5045 N  N     . GLY D 1 218 ? 18.609  81.413  1.163   1.00 42.27  ? 218 GLY D N     1 
ATOM   5046 C  CA    . GLY D 1 218 ? 19.981  81.112  0.736   1.00 41.59  ? 218 GLY D CA    1 
ATOM   5047 C  C     . GLY D 1 218 ? 20.338  81.831  -0.550  1.00 43.01  ? 218 GLY D C     1 
ATOM   5048 O  O     . GLY D 1 218 ? 19.479  82.057  -1.423  1.00 43.15  ? 218 GLY D O     1 
ATOM   5049 N  N     . GLU D 1 219 ? 21.611  82.181  -0.680  1.00 43.60  ? 219 GLU D N     1 
ATOM   5050 C  CA    . GLU D 1 219 ? 22.084  82.975  -1.814  1.00 44.93  ? 219 GLU D CA    1 
ATOM   5051 C  C     . GLU D 1 219 ? 21.691  82.416  -3.195  1.00 42.25  ? 219 GLU D C     1 
ATOM   5052 O  O     . GLU D 1 219 ? 21.279  83.170  -4.092  1.00 38.29  ? 219 GLU D O     1 
ATOM   5053 C  CB    . GLU D 1 219 ? 23.603  83.105  -1.754  1.00 46.41  ? 219 GLU D CB    1 
ATOM   5054 C  CG    . GLU D 1 219 ? 24.208  83.843  -2.939  1.00 49.16  ? 219 GLU D CG    1 
ATOM   5055 C  CD    . GLU D 1 219 ? 25.658  84.207  -2.700  1.00 52.65  ? 219 GLU D CD    1 
ATOM   5056 O  OE1   . GLU D 1 219 ? 26.436  83.313  -2.304  1.00 52.94  ? 219 GLU D OE1   1 
ATOM   5057 O  OE2   . GLU D 1 219 ? 26.016  85.387  -2.909  1.00 55.84  ? 219 GLU D OE2   1 
ATOM   5058 N  N     . ALA D 1 220 ? 21.852  81.104  -3.355  1.00 40.49  ? 220 ALA D N     1 
ATOM   5059 C  CA    . ALA D 1 220 ? 21.745  80.464  -4.660  1.00 38.54  ? 220 ALA D CA    1 
ATOM   5060 C  C     . ALA D 1 220 ? 20.305  80.483  -5.136  1.00 37.71  ? 220 ALA D C     1 
ATOM   5061 O  O     . ALA D 1 220 ? 20.025  80.767  -6.293  1.00 37.69  ? 220 ALA D O     1 
ATOM   5062 C  CB    . ALA D 1 220 ? 22.262  79.035  -4.589  1.00 37.33  ? 220 ALA D CB    1 
ATOM   5063 N  N     . LYS D 1 221 ? 19.400  80.170  -4.225  1.00 37.53  ? 221 LYS D N     1 
ATOM   5064 C  CA    . LYS D 1 221 ? 17.979  80.202  -4.507  1.00 38.90  ? 221 LYS D CA    1 
ATOM   5065 C  C     . LYS D 1 221 ? 17.494  81.632  -4.861  1.00 37.94  ? 221 LYS D C     1 
ATOM   5066 O  O     . LYS D 1 221 ? 16.712  81.820  -5.803  1.00 36.40  ? 221 LYS D O     1 
ATOM   5067 C  CB    . LYS D 1 221 ? 17.240  79.651  -3.298  1.00 40.84  ? 221 LYS D CB    1 
ATOM   5068 C  CG    . LYS D 1 221 ? 15.754  79.471  -3.498  1.00 44.30  ? 221 LYS D CG    1 
ATOM   5069 C  CD    . LYS D 1 221 ? 15.411  78.077  -3.974  1.00 45.79  ? 221 LYS D CD    1 
ATOM   5070 C  CE    . LYS D 1 221 ? 15.461  77.062  -2.839  1.00 46.32  ? 221 LYS D CE    1 
ATOM   5071 N  NZ    . LYS D 1 221 ? 15.317  75.694  -3.400  1.00 46.06  ? 221 LYS D NZ    1 
ATOM   5072 N  N     . ALA D 1 222 ? 17.958  82.630  -4.113  1.00 35.99  ? 222 ALA D N     1 
ATOM   5073 C  CA    . ALA D 1 222 ? 17.582  84.019  -4.372  1.00 35.77  ? 222 ALA D CA    1 
ATOM   5074 C  C     . ALA D 1 222 ? 18.051  84.471  -5.752  1.00 35.80  ? 222 ALA D C     1 
ATOM   5075 O  O     . ALA D 1 222 ? 17.295  85.080  -6.500  1.00 37.15  ? 222 ALA D O     1 
ATOM   5076 C  CB    . ALA D 1 222 ? 18.170  84.926  -3.304  1.00 36.15  ? 222 ALA D CB    1 
ATOM   5077 N  N     . LYS D 1 223 ? 19.303  84.174  -6.088  1.00 36.57  ? 223 LYS D N     1 
ATOM   5078 C  CA    . LYS D 1 223 ? 19.863  84.530  -7.413  1.00 37.56  ? 223 LYS D CA    1 
ATOM   5079 C  C     . LYS D 1 223 ? 19.084  83.848  -8.517  1.00 34.13  ? 223 LYS D C     1 
ATOM   5080 O  O     . LYS D 1 223 ? 18.809  84.441  -9.561  1.00 33.86  ? 223 LYS D O     1 
ATOM   5081 C  CB    . LYS D 1 223 ? 21.339  84.118  -7.531  1.00 38.02  ? 223 LYS D CB    1 
ATOM   5082 C  CG    . LYS D 1 223 ? 22.311  85.135  -6.957  1.00 40.80  ? 223 LYS D CG    1 
ATOM   5083 C  CD    . LYS D 1 223 ? 23.740  84.606  -6.937  1.00 41.46  ? 223 LYS D CD    1 
ATOM   5084 C  CE    . LYS D 1 223 ? 24.704  85.743  -6.635  1.00 44.83  ? 223 LYS D CE    1 
ATOM   5085 N  NZ    . LYS D 1 223 ? 26.104  85.279  -6.743  1.00 45.59  ? 223 LYS D NZ    1 
ATOM   5086 N  N     . TYR D 1 224 ? 18.757  82.591  -8.271  1.00 31.82  ? 224 TYR D N     1 
ATOM   5087 C  CA    . TYR D 1 224 ? 17.896  81.820  -9.160  1.00 31.75  ? 224 TYR D CA    1 
ATOM   5088 C  C     . TYR D 1 224 ? 16.590  82.565  -9.415  1.00 30.91  ? 224 TYR D C     1 
ATOM   5089 O  O     . TYR D 1 224 ? 16.270  82.856  -10.551 1.00 30.77  ? 224 TYR D O     1 
ATOM   5090 C  CB    . TYR D 1 224 ? 17.668  80.433  -8.557  1.00 30.86  ? 224 TYR D CB    1 
ATOM   5091 C  CG    . TYR D 1 224 ? 16.708  79.521  -9.289  1.00 30.31  ? 224 TYR D CG    1 
ATOM   5092 C  CD1   . TYR D 1 224 ? 17.082  78.871  -10.465 1.00 30.14  ? 224 TYR D CD1   1 
ATOM   5093 C  CD2   . TYR D 1 224 ? 15.439  79.274  -8.773  1.00 29.93  ? 224 TYR D CD2   1 
ATOM   5094 C  CE1   . TYR D 1 224 ? 16.199  78.014  -11.112 1.00 29.80  ? 224 TYR D CE1   1 
ATOM   5095 C  CE2   . TYR D 1 224 ? 14.554  78.428  -9.405  1.00 29.71  ? 224 TYR D CE2   1 
ATOM   5096 C  CZ    . TYR D 1 224 ? 14.934  77.801  -10.578 1.00 29.22  ? 224 TYR D CZ    1 
ATOM   5097 O  OH    . TYR D 1 224 ? 14.054  76.958  -11.201 1.00 29.56  ? 224 TYR D OH    1 
ATOM   5098 N  N     . LEU D 1 225 ? 15.876  82.944  -8.361  1.00 32.14  ? 225 LEU D N     1 
ATOM   5099 C  CA    . LEU D 1 225 ? 14.562  83.581  -8.540  1.00 32.50  ? 225 LEU D CA    1 
ATOM   5100 C  C     . LEU D 1 225 ? 14.661  84.936  -9.232  1.00 32.68  ? 225 LEU D C     1 
ATOM   5101 O  O     . LEU D 1 225 ? 13.866  85.262  -10.114 1.00 31.91  ? 225 LEU D O     1 
ATOM   5102 C  CB    . LEU D 1 225 ? 13.838  83.728  -7.202  1.00 32.93  ? 225 LEU D CB    1 
ATOM   5103 C  CG    . LEU D 1 225 ? 13.341  82.416  -6.573  1.00 32.72  ? 225 LEU D CG    1 
ATOM   5104 C  CD1   . LEU D 1 225 ? 12.658  82.673  -5.235  1.00 32.46  ? 225 LEU D CD1   1 
ATOM   5105 C  CD2   . LEU D 1 225 ? 12.389  81.665  -7.497  1.00 33.10  ? 225 LEU D CD2   1 
ATOM   5106 N  N     . ILE D 1 226 ? 15.646  85.719  -8.833  1.00 33.37  ? 226 ILE D N     1 
ATOM   5107 C  CA    . ILE D 1 226 ? 15.851  87.026  -9.418  1.00 34.10  ? 226 ILE D CA    1 
ATOM   5108 C  C     . ILE D 1 226 ? 16.207  86.939  -10.913 1.00 34.47  ? 226 ILE D C     1 
ATOM   5109 O  O     . ILE D 1 226 ? 15.622  87.667  -11.716 1.00 33.81  ? 226 ILE D O     1 
ATOM   5110 C  CB    . ILE D 1 226 ? 16.911  87.798  -8.606  1.00 36.83  ? 226 ILE D CB    1 
ATOM   5111 C  CG1   . ILE D 1 226 ? 16.263  88.296  -7.308  1.00 38.14  ? 226 ILE D CG1   1 
ATOM   5112 C  CG2   . ILE D 1 226 ? 17.519  88.947  -9.399  1.00 36.53  ? 226 ILE D CG2   1 
ATOM   5113 C  CD1   . ILE D 1 226 ? 17.278  88.821  -6.317  1.00 40.03  ? 226 ILE D CD1   1 
ATOM   5114 N  N     . SER D 1 227 ? 17.114  86.039  -11.308 1.00 33.93  ? 227 SER D N     1 
ATOM   5115 C  CA    . SER D 1 227 ? 17.426  85.912  -12.744 1.00 35.37  ? 227 SER D CA    1 
ATOM   5116 C  C     . SER D 1 227 ? 16.173  85.493  -13.559 1.00 34.81  ? 227 SER D C     1 
ATOM   5117 O  O     . SER D 1 227 ? 15.992  85.904  -14.710 1.00 35.30  ? 227 SER D O     1 
ATOM   5118 C  CB    . SER D 1 227 ? 18.638  84.990  -12.998 1.00 35.57  ? 227 SER D CB    1 
ATOM   5119 O  OG    . SER D 1 227 ? 18.310  83.613  -12.956 1.00 37.34  ? 227 SER D OG    1 
ATOM   5120 N  N     . LEU D 1 228 ? 15.288  84.718  -12.942 1.00 33.96  ? 228 LEU D N     1 
ATOM   5121 C  CA    . LEU D 1 228 ? 14.026  84.355  -13.585 1.00 33.03  ? 228 LEU D CA    1 
ATOM   5122 C  C     . LEU D 1 228 ? 13.071  85.538  -13.704 1.00 33.02  ? 228 LEU D C     1 
ATOM   5123 O  O     . LEU D 1 228 ? 12.506  85.794  -14.776 1.00 31.37  ? 228 LEU D O     1 
ATOM   5124 C  CB    . LEU D 1 228 ? 13.340  83.244  -12.810 1.00 32.01  ? 228 LEU D CB    1 
ATOM   5125 C  CG    . LEU D 1 228 ? 13.895  81.852  -13.052 1.00 31.72  ? 228 LEU D CG    1 
ATOM   5126 C  CD1   . LEU D 1 228 ? 13.345  80.931  -11.982 1.00 30.46  ? 228 LEU D CD1   1 
ATOM   5127 C  CD2   . LEU D 1 228 ? 13.558  81.354  -14.457 1.00 30.79  ? 228 LEU D CD2   1 
ATOM   5128 N  N     . ALA D 1 229 ? 12.895  86.260  -12.604 1.00 33.59  ? 229 ALA D N     1 
ATOM   5129 C  CA    . ALA D 1 229 ? 11.989  87.403  -12.596 1.00 35.22  ? 229 ALA D CA    1 
ATOM   5130 C  C     . ALA D 1 229 ? 12.478  88.536  -13.505 1.00 36.20  ? 229 ALA D C     1 
ATOM   5131 O  O     . ALA D 1 229 ? 11.679  89.298  -14.004 1.00 35.65  ? 229 ALA D O     1 
ATOM   5132 C  CB    . ALA D 1 229 ? 11.787  87.907  -11.173 1.00 35.93  ? 229 ALA D CB    1 
ATOM   5133 N  N     . ARG D 1 230 ? 13.787  88.655  -13.709 1.00 36.95  ? 230 ARG D N     1 
ATOM   5134 C  CA    . ARG D 1 230 ? 14.311  89.644  -14.662 1.00 39.46  ? 230 ARG D CA    1 
ATOM   5135 C  C     . ARG D 1 230 ? 14.286  89.111  -16.092 1.00 39.58  ? 230 ARG D C     1 
ATOM   5136 O  O     . ARG D 1 230 ? 14.666  89.838  -16.997 1.00 40.16  ? 230 ARG D O     1 
ATOM   5137 C  CB    . ARG D 1 230 ? 15.752  90.037  -14.317 1.00 41.16  ? 230 ARG D CB    1 
ATOM   5138 C  CG    . ARG D 1 230 ? 15.873  91.034  -13.184 1.00 43.34  ? 230 ARG D CG    1 
ATOM   5139 C  CD    . ARG D 1 230 ? 17.320  91.185  -12.741 1.00 45.56  ? 230 ARG D CD    1 
ATOM   5140 N  NE    . ARG D 1 230 ? 17.470  92.147  -11.648 1.00 46.08  ? 230 ARG D NE    1 
ATOM   5141 C  CZ    . ARG D 1 230 ? 18.551  92.258  -10.878 1.00 47.02  ? 230 ARG D CZ    1 
ATOM   5142 N  NH1   . ARG D 1 230 ? 19.601  91.470  -11.065 1.00 46.71  ? 230 ARG D NH1   1 
ATOM   5143 N  NH2   . ARG D 1 230 ? 18.585  93.171  -9.907  1.00 48.76  ? 230 ARG D NH2   1 
ATOM   5144 N  N     . ASP D 1 231 ? 13.871  87.851  -16.286 1.00 38.95  ? 231 ASP D N     1 
ATOM   5145 C  CA    . ASP D 1 231 ? 13.872  87.204  -17.603 1.00 38.46  ? 231 ASP D CA    1 
ATOM   5146 C  C     . ASP D 1 231 ? 15.294  87.249  -18.170 1.00 38.83  ? 231 ASP D C     1 
ATOM   5147 O  O     . ASP D 1 231 ? 15.509  87.575  -19.328 1.00 37.02  ? 231 ASP D O     1 
ATOM   5148 C  CB    . ASP D 1 231 ? 12.854  87.894  -18.530 1.00 40.34  ? 231 ASP D CB    1 
ATOM   5149 C  CG    . ASP D 1 231 ? 12.572  87.115  -19.840 1.00 40.74  ? 231 ASP D CG    1 
ATOM   5150 O  OD1   . ASP D 1 231 ? 13.020  85.966  -20.047 1.00 37.56  ? 231 ASP D OD1   1 
ATOM   5151 O  OD2   . ASP D 1 231 ? 11.882  87.700  -20.688 1.00 43.37  ? 231 ASP D OD2   1 
ATOM   5152 N  N     . GLU D 1 232 ? 16.266  86.936  -17.316 1.00 39.61  ? 232 GLU D N     1 
ATOM   5153 C  CA    . GLU D 1 232 ? 17.668  86.865  -17.707 1.00 40.32  ? 232 GLU D CA    1 
ATOM   5154 C  C     . GLU D 1 232 ? 18.261  85.478  -17.455 1.00 40.63  ? 232 GLU D C     1 
ATOM   5155 O  O     . GLU D 1 232 ? 19.448  85.269  -17.689 1.00 44.44  ? 232 GLU D O     1 
ATOM   5156 C  CB    . GLU D 1 232 ? 18.484  87.937  -16.963 1.00 41.86  ? 232 GLU D CB    1 
ATOM   5157 C  CG    . GLU D 1 232 ? 18.232  89.353  -17.482 1.00 43.66  ? 232 GLU D CG    1 
ATOM   5158 C  CD    . GLU D 1 232 ? 18.955  90.464  -16.709 1.00 46.25  ? 232 GLU D CD    1 
ATOM   5159 O  OE1   . GLU D 1 232 ? 19.900  90.206  -15.933 1.00 45.07  ? 232 GLU D OE1   1 
ATOM   5160 O  OE2   . GLU D 1 232 ? 18.573  91.639  -16.899 1.00 48.58  ? 232 GLU D OE2   1 
ATOM   5161 N  N     . TYR D 1 233 ? 17.443  84.529  -17.008 1.00 39.18  ? 233 TYR D N     1 
ATOM   5162 C  CA    . TYR D 1 233 ? 17.898  83.163  -16.758 1.00 38.71  ? 233 TYR D CA    1 
ATOM   5163 C  C     . TYR D 1 233 ? 18.237  82.481  -18.093 1.00 41.34  ? 233 TYR D C     1 
ATOM   5164 O  O     . TYR D 1 233 ? 17.430  82.480  -19.014 1.00 44.17  ? 233 TYR D O     1 
ATOM   5165 C  CB    . TYR D 1 233 ? 16.800  82.380  -16.009 1.00 35.97  ? 233 TYR D CB    1 
ATOM   5166 C  CG    . TYR D 1 233 ? 17.155  80.947  -15.698 1.00 33.90  ? 233 TYR D CG    1 
ATOM   5167 C  CD1   . TYR D 1 233 ? 17.044  79.972  -16.679 1.00 33.80  ? 233 TYR D CD1   1 
ATOM   5168 C  CD2   . TYR D 1 233 ? 17.615  80.554  -14.431 1.00 32.16  ? 233 TYR D CD2   1 
ATOM   5169 C  CE1   . TYR D 1 233 ? 17.373  78.658  -16.427 1.00 32.35  ? 233 TYR D CE1   1 
ATOM   5170 C  CE2   . TYR D 1 233 ? 17.943  79.229  -14.170 1.00 31.30  ? 233 TYR D CE2   1 
ATOM   5171 C  CZ    . TYR D 1 233 ? 17.812  78.289  -15.182 1.00 32.36  ? 233 TYR D CZ    1 
ATOM   5172 O  OH    . TYR D 1 233 ? 18.143  76.965  -15.019 1.00 33.93  ? 233 TYR D OH    1 
ATOM   5173 N  N     . ASN D 1 234 ? 19.422  81.904  -18.212 1.00 44.40  ? 234 ASN D N     1 
ATOM   5174 C  CA    . ASN D 1 234 ? 19.743  81.150  -19.435 1.00 49.97  ? 234 ASN D CA    1 
ATOM   5175 C  C     . ASN D 1 234 ? 20.771  80.024  -19.255 1.00 46.52  ? 234 ASN D C     1 
ATOM   5176 O  O     . ASN D 1 234 ? 21.626  79.822  -20.113 1.00 51.88  ? 234 ASN D O     1 
ATOM   5177 C  CB    . ASN D 1 234 ? 20.227  82.123  -20.509 1.00 52.41  ? 234 ASN D CB    1 
ATOM   5178 C  CG    . ASN D 1 234 ? 21.459  82.869  -20.072 1.00 53.70  ? 234 ASN D CG    1 
ATOM   5179 O  OD1   . ASN D 1 234 ? 21.807  82.856  -18.885 1.00 55.11  ? 234 ASN D OD1   1 
ATOM   5180 N  ND2   . ASN D 1 234 ? 22.140  83.505  -21.020 1.00 55.27  ? 234 ASN D ND2   1 
ATOM   5181 N  N     . GLU D 1 235 ? 20.660  79.283  -18.160 1.00 42.50  ? 235 GLU D N     1 
ATOM   5182 C  CA    . GLU D 1 235 ? 21.555  78.163  -17.867 1.00 41.09  ? 235 GLU D CA    1 
ATOM   5183 C  C     . GLU D 1 235 ? 21.677  77.187  -19.045 1.00 38.12  ? 235 GLU D C     1 
ATOM   5184 O  O     . GLU D 1 235 ? 20.658  76.745  -19.569 1.00 37.27  ? 235 GLU D O     1 
ATOM   5185 C  CB    . GLU D 1 235 ? 21.019  77.393  -16.670 1.00 43.03  ? 235 GLU D CB    1 
ATOM   5186 C  CG    . GLU D 1 235 ? 21.113  78.145  -15.364 1.00 46.32  ? 235 GLU D CG    1 
ATOM   5187 C  CD    . GLU D 1 235 ? 22.543  78.256  -14.926 1.00 51.06  ? 235 GLU D CD    1 
ATOM   5188 O  OE1   . GLU D 1 235 ? 23.051  77.249  -14.384 1.00 55.72  ? 235 GLU D OE1   1 
ATOM   5189 O  OE2   . GLU D 1 235 ? 23.152  79.324  -15.158 1.00 49.77  ? 235 GLU D OE2   1 
ATOM   5190 N  N     . PRO D 1 236 ? 22.912  76.837  -19.457 1.00 35.19  ? 236 PRO D N     1 
ATOM   5191 C  CA    . PRO D 1 236 ? 23.063  75.952  -20.625 1.00 34.41  ? 236 PRO D CA    1 
ATOM   5192 C  C     . PRO D 1 236 ? 22.472  74.570  -20.407 1.00 32.96  ? 236 PRO D C     1 
ATOM   5193 O  O     . PRO D 1 236 ? 22.397  74.100  -19.282 1.00 31.50  ? 236 PRO D O     1 
ATOM   5194 C  CB    . PRO D 1 236 ? 24.583  75.833  -20.804 1.00 35.25  ? 236 PRO D CB    1 
ATOM   5195 C  CG    . PRO D 1 236 ? 25.162  76.975  -20.033 1.00 36.59  ? 236 PRO D CG    1 
ATOM   5196 C  CD    . PRO D 1 236 ? 24.220  77.215  -18.884 1.00 35.79  ? 236 PRO D CD    1 
ATOM   5197 N  N     . ILE D 1 237 ? 22.020  73.946  -21.483 1.00 33.45  ? 237 ILE D N     1 
ATOM   5198 C  CA    . ILE D 1 237 ? 21.513  72.592  -21.413 1.00 34.28  ? 237 ILE D CA    1 
ATOM   5199 C  C     . ILE D 1 237 ? 22.732  71.708  -21.563 1.00 37.15  ? 237 ILE D C     1 
ATOM   5200 O  O     . ILE D 1 237 ? 23.286  71.585  -22.644 1.00 35.49  ? 237 ILE D O     1 
ATOM   5201 C  CB    . ILE D 1 237 ? 20.474  72.273  -22.512 1.00 34.42  ? 237 ILE D CB    1 
ATOM   5202 C  CG1   . ILE D 1 237 ? 19.129  72.956  -22.235 1.00 33.80  ? 237 ILE D CG1   1 
ATOM   5203 C  CG2   . ILE D 1 237 ? 20.210  70.766  -22.586 1.00 33.82  ? 237 ILE D CG2   1 
ATOM   5204 C  CD1   . ILE D 1 237 ? 19.160  74.452  -22.210 1.00 34.15  ? 237 ILE D CD1   1 
ATOM   5205 N  N     . ARG D 1 238 ? 23.171  71.121  -20.460 1.00 41.34  ? 238 ARG D N     1 
ATOM   5206 C  CA    . ARG D 1 238 ? 24.282  70.187  -20.506 1.00 44.87  ? 238 ARG D CA    1 
ATOM   5207 C  C     . ARG D 1 238 ? 24.336  69.320  -19.270 1.00 44.78  ? 238 ARG D C     1 
ATOM   5208 O  O     . ARG D 1 238 ? 23.756  69.649  -18.238 1.00 39.46  ? 238 ARG D O     1 
ATOM   5209 C  CB    . ARG D 1 238 ? 25.611  70.914  -20.653 1.00 49.42  ? 238 ARG D CB    1 
ATOM   5210 C  CG    . ARG D 1 238 ? 25.977  71.819  -19.497 1.00 52.74  ? 238 ARG D CG    1 
ATOM   5211 C  CD    . ARG D 1 238 ? 27.484  71.987  -19.452 1.00 58.36  ? 238 ARG D CD    1 
ATOM   5212 N  NE    . ARG D 1 238 ? 27.857  73.262  -18.846 1.00 63.29  ? 238 ARG D NE    1 
ATOM   5213 C  CZ    . ARG D 1 238 ? 27.965  74.420  -19.498 1.00 66.43  ? 238 ARG D CZ    1 
ATOM   5214 N  NH1   . ARG D 1 238 ? 27.727  74.498  -20.807 1.00 69.83  ? 238 ARG D NH1   1 
ATOM   5215 N  NH2   . ARG D 1 238 ? 28.317  75.514  -18.832 1.00 64.85  ? 238 ARG D NH2   1 
ATOM   5216 N  N     . THR D 1 239 ? 25.063  68.217  -19.387 1.00 48.80  ? 239 THR D N     1 
ATOM   5217 C  CA    . THR D 1 239 ? 25.228  67.299  -18.272 1.00 49.95  ? 239 THR D CA    1 
ATOM   5218 C  C     . THR D 1 239 ? 25.986  68.027  -17.168 1.00 49.20  ? 239 THR D C     1 
ATOM   5219 O  O     . THR D 1 239 ? 27.008  68.649  -17.398 1.00 47.86  ? 239 THR D O     1 
ATOM   5220 C  CB    . THR D 1 239 ? 25.878  65.972  -18.720 1.00 52.26  ? 239 THR D CB    1 
ATOM   5221 O  OG1   . THR D 1 239 ? 26.861  66.221  -19.735 1.00 50.67  ? 239 THR D OG1   1 
ATOM   5222 C  CG2   . THR D 1 239 ? 24.798  65.047  -19.310 1.00 54.21  ? 239 THR D CG2   1 
ATOM   5223 N  N     . ARG D 1 240 ? 25.415  67.998  -15.979 1.00 51.25  ? 240 ARG D N     1 
ATOM   5224 C  CA    . ARG D 1 240 ? 25.850  68.847  -14.891 1.00 56.50  ? 240 ARG D CA    1 
ATOM   5225 C  C     . ARG D 1 240 ? 27.074  68.206  -14.236 1.00 54.30  ? 240 ARG D C     1 
ATOM   5226 O  O     . ARG D 1 240 ? 27.128  66.991  -14.086 1.00 53.74  ? 240 ARG D O     1 
ATOM   5227 C  CB    . ARG D 1 240 ? 24.692  68.988  -13.894 1.00 62.32  ? 240 ARG D CB    1 
ATOM   5228 C  CG    . ARG D 1 240 ? 24.569  70.336  -13.202 1.00 69.17  ? 240 ARG D CG    1 
ATOM   5229 C  CD    . ARG D 1 240 ? 23.094  70.711  -13.038 1.00 76.55  ? 240 ARG D CD    1 
ATOM   5230 N  NE    . ARG D 1 240 ? 22.849  71.595  -11.899 1.00 82.38  ? 240 ARG D NE    1 
ATOM   5231 C  CZ    . ARG D 1 240 ? 21.759  72.346  -11.727 1.00 86.42  ? 240 ARG D CZ    1 
ATOM   5232 N  NH1   . ARG D 1 240 ? 20.779  72.359  -12.626 1.00 86.40  ? 240 ARG D NH1   1 
ATOM   5233 N  NH2   . ARG D 1 240 ? 21.654  73.108  -10.642 1.00 88.30  ? 240 ARG D NH2   1 
ATOM   5234 N  N     . VAL D 1 241 ? 28.067  69.016  -13.879 1.00 54.80  ? 241 VAL D N     1 
ATOM   5235 C  CA    . VAL D 1 241 ? 29.249  68.501  -13.175 1.00 54.20  ? 241 VAL D CA    1 
ATOM   5236 C  C     . VAL D 1 241 ? 28.944  68.479  -11.687 1.00 49.82  ? 241 VAL D C     1 
ATOM   5237 O  O     . VAL D 1 241 ? 28.750  69.518  -11.064 1.00 46.30  ? 241 VAL D O     1 
ATOM   5238 C  CB    . VAL D 1 241 ? 30.529  69.312  -13.466 1.00 57.93  ? 241 VAL D CB    1 
ATOM   5239 C  CG1   . VAL D 1 241 ? 30.815  69.293  -14.965 1.00 59.30  ? 241 VAL D CG1   1 
ATOM   5240 C  CG2   . VAL D 1 241 ? 30.443  70.745  -12.934 1.00 57.93  ? 241 VAL D CG2   1 
ATOM   5241 N  N     . ARG D 1 242 ? 28.855  67.278  -11.135 1.00 48.76  ? 242 ARG D N     1 
ATOM   5242 C  CA    . ARG D 1 242 ? 28.409  67.117  -9.760  1.00 48.17  ? 242 ARG D CA    1 
ATOM   5243 C  C     . ARG D 1 242 ? 29.569  67.341  -8.812  1.00 46.00  ? 242 ARG D C     1 
ATOM   5244 O  O     . ARG D 1 242 ? 30.698  66.984  -9.120  1.00 43.18  ? 242 ARG D O     1 
ATOM   5245 C  CB    . ARG D 1 242 ? 27.789  65.739  -9.558  1.00 49.20  ? 242 ARG D CB    1 
ATOM   5246 C  CG    . ARG D 1 242 ? 26.444  65.596  -10.260 1.00 53.42  ? 242 ARG D CG    1 
ATOM   5247 C  CD    . ARG D 1 242 ? 26.167  64.157  -10.684 1.00 56.77  ? 242 ARG D CD    1 
ATOM   5248 N  NE    . ARG D 1 242 ? 25.349  64.106  -11.900 1.00 62.49  ? 242 ARG D NE    1 
ATOM   5249 C  CZ    . ARG D 1 242 ? 24.139  63.550  -12.023 1.00 63.32  ? 242 ARG D CZ    1 
ATOM   5250 N  NH1   . ARG D 1 242 ? 23.533  62.944  -11.001 1.00 63.04  ? 242 ARG D NH1   1 
ATOM   5251 N  NH2   . ARG D 1 242 ? 23.530  63.586  -13.207 1.00 64.16  ? 242 ARG D NH2   1 
ATOM   5252 N  N     . LYS D 1 243 ? 29.274  67.965  -7.677  1.00 45.78  ? 243 LYS D N     1 
ATOM   5253 C  CA    . LYS D 1 243 ? 30.249  68.202  -6.613  1.00 46.26  ? 243 LYS D CA    1 
ATOM   5254 C  C     . LYS D 1 243 ? 30.383  66.995  -5.697  1.00 44.15  ? 243 LYS D C     1 
ATOM   5255 O  O     . LYS D 1 243 ? 31.299  66.932  -4.878  1.00 43.09  ? 243 LYS D O     1 
ATOM   5256 C  CB    . LYS D 1 243 ? 29.818  69.400  -5.766  1.00 48.30  ? 243 LYS D CB    1 
ATOM   5257 C  CG    . LYS D 1 243 ? 29.958  70.733  -6.477  1.00 51.12  ? 243 LYS D CG    1 
ATOM   5258 C  CD    . LYS D 1 243 ? 29.341  71.852  -5.658  1.00 54.08  ? 243 LYS D CD    1 
ATOM   5259 C  CE    . LYS D 1 243 ? 29.501  73.190  -6.359  1.00 57.68  ? 243 LYS D CE    1 
ATOM   5260 N  NZ    . LYS D 1 243 ? 28.451  74.136  -5.905  1.00 60.66  ? 243 LYS D NZ    1 
ATOM   5261 N  N     . SER D 1 244 ? 29.452  66.056  -5.812  1.00 40.61  ? 244 SER D N     1 
ATOM   5262 C  CA    . SER D 1 244 ? 29.495  64.853  -5.008  1.00 39.70  ? 244 SER D CA    1 
ATOM   5263 C  C     . SER D 1 244 ? 28.803  63.740  -5.743  1.00 38.48  ? 244 SER D C     1 
ATOM   5264 O  O     . SER D 1 244 ? 27.862  63.982  -6.493  1.00 38.14  ? 244 SER D O     1 
ATOM   5265 C  CB    . SER D 1 244 ? 28.813  65.081  -3.653  1.00 39.68  ? 244 SER D CB    1 
ATOM   5266 O  OG    . SER D 1 244 ? 27.402  65.198  -3.797  1.00 40.40  ? 244 SER D OG    1 
ATOM   5267 N  N     . ILE D 1 245 ? 29.263  62.513  -5.552  1.00 38.07  ? 245 ILE D N     1 
ATOM   5268 C  CA    . ILE D 1 245 ? 28.508  61.380  -6.056  1.00 37.68  ? 245 ILE D CA    1 
ATOM   5269 C  C     . ILE D 1 245 ? 28.481  60.235  -5.034  1.00 38.49  ? 245 ILE D C     1 
ATOM   5270 O  O     . ILE D 1 245 ? 29.428  60.004  -4.277  1.00 35.40  ? 245 ILE D O     1 
ATOM   5271 C  CB    . ILE D 1 245 ? 28.937  60.943  -7.498  1.00 39.66  ? 245 ILE D CB    1 
ATOM   5272 C  CG1   . ILE D 1 245 ? 29.602  59.586  -7.536  1.00 39.94  ? 245 ILE D CG1   1 
ATOM   5273 C  CG2   . ILE D 1 245 ? 29.807  61.962  -8.224  1.00 40.72  ? 245 ILE D CG2   1 
ATOM   5274 C  CD1   . ILE D 1 245 ? 28.627  58.499  -7.898  1.00 41.04  ? 245 ILE D CD1   1 
ATOM   5275 N  N     . GLY D 1 246 ? 27.377  59.507  -5.026  1.00 39.36  ? 246 GLY D N     1 
ATOM   5276 C  CA    . GLY D 1 246 ? 27.155  58.537  -3.974  1.00 40.89  ? 246 GLY D CA    1 
ATOM   5277 C  C     . GLY D 1 246 ? 25.937  57.674  -4.175  1.00 39.73  ? 246 GLY D C     1 
ATOM   5278 O  O     . GLY D 1 246 ? 25.197  57.837  -5.144  1.00 39.55  ? 246 GLY D O     1 
ATOM   5279 N  N     . ARG D 1 247 ? 25.727  56.779  -3.218  1.00 39.87  ? 247 ARG D N     1 
ATOM   5280 C  CA    . ARG D 1 247 ? 24.719  55.741  -3.319  1.00 41.42  ? 247 ARG D CA    1 
ATOM   5281 C  C     . ARG D 1 247 ? 24.385  55.217  -1.911  1.00 38.25  ? 247 ARG D C     1 
ATOM   5282 O  O     . ARG D 1 247 ? 25.284  54.878  -1.142  1.00 36.37  ? 247 ARG D O     1 
ATOM   5283 C  CB    . ARG D 1 247 ? 25.284  54.643  -4.228  1.00 44.81  ? 247 ARG D CB    1 
ATOM   5284 C  CG    . ARG D 1 247 ? 24.492  53.351  -4.302  1.00 51.44  ? 247 ARG D CG    1 
ATOM   5285 C  CD    . ARG D 1 247 ? 23.098  53.528  -4.896  1.00 57.30  ? 247 ARG D CD    1 
ATOM   5286 N  NE    . ARG D 1 247 ? 22.465  52.220  -5.088  1.00 63.43  ? 247 ARG D NE    1 
ATOM   5287 C  CZ    . ARG D 1 247 ? 21.188  52.017  -5.402  1.00 65.96  ? 247 ARG D CZ    1 
ATOM   5288 N  NH1   . ARG D 1 247 ? 20.360  53.040  -5.584  1.00 65.53  ? 247 ARG D NH1   1 
ATOM   5289 N  NH2   . ARG D 1 247 ? 20.738  50.771  -5.541  1.00 69.55  ? 247 ARG D NH2   1 
ATOM   5290 N  N     . ILE D 1 248 ? 23.107  55.187  -1.567  1.00 36.02  ? 248 ILE D N     1 
ATOM   5291 C  CA    . ILE D 1 248 ? 22.658  54.613  -0.303  1.00 37.98  ? 248 ILE D CA    1 
ATOM   5292 C  C     . ILE D 1 248 ? 21.758  53.438  -0.650  1.00 38.15  ? 248 ILE D C     1 
ATOM   5293 O  O     . ILE D 1 248 ? 21.005  53.510  -1.600  1.00 36.74  ? 248 ILE D O     1 
ATOM   5294 C  CB    . ILE D 1 248 ? 21.884  55.620  0.575   1.00 40.00  ? 248 ILE D CB    1 
ATOM   5295 C  CG1   . ILE D 1 248 ? 22.670  56.921  0.770   1.00 41.76  ? 248 ILE D CG1   1 
ATOM   5296 C  CG2   . ILE D 1 248 ? 21.585  55.033  1.951   1.00 41.74  ? 248 ILE D CG2   1 
ATOM   5297 C  CD1   . ILE D 1 248 ? 21.826  58.072  1.303   1.00 41.29  ? 248 ILE D CD1   1 
ATOM   5298 N  N     . VAL D 1 249 ? 21.862  52.358  0.113   1.00 38.95  ? 249 VAL D N     1 
ATOM   5299 C  CA    . VAL D 1 249 ? 21.059  51.170  -0.103  1.00 40.06  ? 249 VAL D CA    1 
ATOM   5300 C  C     . VAL D 1 249 ? 20.338  50.743  1.183   1.00 41.01  ? 249 VAL D C     1 
ATOM   5301 O  O     . VAL D 1 249 ? 20.870  50.872  2.300   1.00 39.97  ? 249 VAL D O     1 
ATOM   5302 C  CB    . VAL D 1 249 ? 21.924  50.003  -0.613  1.00 41.72  ? 249 VAL D CB    1 
ATOM   5303 C  CG1   . VAL D 1 249 ? 21.089  48.736  -0.727  1.00 42.14  ? 249 VAL D CG1   1 
ATOM   5304 C  CG2   . VAL D 1 249 ? 22.539  50.354  -1.967  1.00 42.67  ? 249 VAL D CG2   1 
ATOM   5305 N  N     . THR D 1 250 ? 19.125  50.232  1.004   1.00 40.57  ? 250 THR D N     1 
ATOM   5306 C  CA    . THR D 1 250 ? 18.343  49.643  2.090   1.00 40.10  ? 250 THR D CA    1 
ATOM   5307 C  C     . THR D 1 250 ? 18.681  48.164  2.231   1.00 40.69  ? 250 THR D C     1 
ATOM   5308 O  O     . THR D 1 250 ? 18.720  47.429  1.251   1.00 42.22  ? 250 THR D O     1 
ATOM   5309 C  CB    . THR D 1 250 ? 16.845  49.839  1.842   1.00 38.98  ? 250 THR D CB    1 
ATOM   5310 O  OG1   . THR D 1 250 ? 16.569  51.248  1.823   1.00 36.20  ? 250 THR D OG1   1 
ATOM   5311 C  CG2   . THR D 1 250 ? 16.003  49.144  2.939   1.00 38.94  ? 250 THR D CG2   1 
ATOM   5312 N  N     . MET D 1 251 ? 18.956  47.747  3.454   1.00 41.27  ? 251 MET D N     1 
ATOM   5313 C  CA    . MET D 1 251 ? 19.269  46.359  3.736   1.00 43.12  ? 251 MET D CA    1 
ATOM   5314 C  C     . MET D 1 251 ? 17.978  45.590  3.959   1.00 43.32  ? 251 MET D C     1 
ATOM   5315 O  O     . MET D 1 251 ? 16.941  46.187  4.249   1.00 40.82  ? 251 MET D O     1 
ATOM   5316 C  CB    . MET D 1 251 ? 20.180  46.261  4.966   1.00 43.57  ? 251 MET D CB    1 
ATOM   5317 C  CG    . MET D 1 251 ? 21.460  47.073  4.812   1.00 43.60  ? 251 MET D CG    1 
ATOM   5318 S  SD    . MET D 1 251 ? 22.643  46.870  6.157   1.00 45.39  ? 251 MET D SD    1 
ATOM   5319 C  CE    . MET D 1 251 ? 21.703  47.591  7.495   1.00 45.34  ? 251 MET D CE    1 
ATOM   5320 N  N     . LYS D 1 252 ? 18.045  44.268  3.796   1.00 46.32  ? 252 LYS D N     1 
ATOM   5321 C  CA    . LYS D 1 252 ? 16.891  43.390  4.021   1.00 49.93  ? 252 LYS D CA    1 
ATOM   5322 C  C     . LYS D 1 252 ? 16.313  43.579  5.413   1.00 50.37  ? 252 LYS D C     1 
ATOM   5323 O  O     . LYS D 1 252 ? 15.099  43.693  5.580   1.00 49.50  ? 252 LYS D O     1 
ATOM   5324 C  CB    . LYS D 1 252 ? 17.284  41.925  3.859   1.00 53.74  ? 252 LYS D CB    1 
ATOM   5325 C  CG    . LYS D 1 252 ? 17.494  41.497  2.419   1.00 57.27  ? 252 LYS D CG    1 
ATOM   5326 C  CD    . LYS D 1 252 ? 17.121  40.036  2.220   1.00 61.75  ? 252 LYS D CD    1 
ATOM   5327 C  CE    . LYS D 1 252 ? 17.294  39.627  0.762   1.00 63.79  ? 252 LYS D CE    1 
ATOM   5328 N  NZ    . LYS D 1 252 ? 18.716  39.723  0.315   1.00 64.50  ? 252 LYS D NZ    1 
ATOM   5329 N  N     . ARG D 1 253 ? 17.206  43.622  6.399   1.00 50.23  ? 253 ARG D N     1 
ATOM   5330 C  CA    . ARG D 1 253 ? 16.830  43.788  7.794   1.00 50.31  ? 253 ARG D CA    1 
ATOM   5331 C  C     . ARG D 1 253 ? 17.801  44.711  8.506   1.00 45.85  ? 253 ARG D C     1 
ATOM   5332 O  O     . ARG D 1 253 ? 18.949  44.869  8.096   1.00 42.33  ? 253 ARG D O     1 
ATOM   5333 C  CB    . ARG D 1 253 ? 16.761  42.429  8.498   1.00 55.69  ? 253 ARG D CB    1 
ATOM   5334 C  CG    . ARG D 1 253 ? 17.831  41.433  8.067   1.00 61.71  ? 253 ARG D CG    1 
ATOM   5335 C  CD    . ARG D 1 253 ? 17.577  40.039  8.637   1.00 69.12  ? 253 ARG D CD    1 
ATOM   5336 N  NE    . ARG D 1 253 ? 16.593  39.284  7.849   1.00 75.06  ? 253 ARG D NE    1 
ATOM   5337 C  CZ    . ARG D 1 253 ? 16.847  38.645  6.702   1.00 79.46  ? 253 ARG D CZ    1 
ATOM   5338 N  NH1   . ARG D 1 253 ? 18.068  38.653  6.164   1.00 80.02  ? 253 ARG D NH1   1 
ATOM   5339 N  NH2   . ARG D 1 253 ? 15.864  37.995  6.078   1.00 80.44  ? 253 ARG D NH2   1 
ATOM   5340 N  N     . ASN D 1 254 ? 17.314  45.338  9.569   1.00 43.97  ? 254 ASN D N     1 
ATOM   5341 C  CA    . ASN D 1 254 ? 18.124  46.247  10.362  1.00 43.93  ? 254 ASN D CA    1 
ATOM   5342 C  C     . ASN D 1 254 ? 19.236  45.474  11.055  1.00 44.01  ? 254 ASN D C     1 
ATOM   5343 O  O     . ASN D 1 254 ? 19.033  44.341  11.480  1.00 43.30  ? 254 ASN D O     1 
ATOM   5344 C  CB    . ASN D 1 254 ? 17.274  46.971  11.402  1.00 44.67  ? 254 ASN D CB    1 
ATOM   5345 C  CG    . ASN D 1 254 ? 16.219  47.856  10.778  1.00 45.11  ? 254 ASN D CG    1 
ATOM   5346 O  OD1   . ASN D 1 254 ? 16.239  48.127  9.573   1.00 43.71  ? 254 ASN D OD1   1 
ATOM   5347 N  ND2   . ASN D 1 254 ? 15.285  48.316  11.602  1.00 46.32  ? 254 ASN D ND2   1 
ATOM   5348 N  N     . SER D 1 255 ? 20.416  46.078  11.159  1.00 42.61  ? 255 SER D N     1 
ATOM   5349 C  CA    . SER D 1 255 ? 21.565  45.332  11.664  1.00 42.87  ? 255 SER D CA    1 
ATOM   5350 C  C     . SER D 1 255 ? 22.656  46.199  12.281  1.00 43.06  ? 255 SER D C     1 
ATOM   5351 O  O     . SER D 1 255 ? 22.794  47.393  11.974  1.00 40.28  ? 255 SER D O     1 
ATOM   5352 C  CB    . SER D 1 255 ? 22.165  44.511  10.526  1.00 41.54  ? 255 SER D CB    1 
ATOM   5353 O  OG    . SER D 1 255 ? 23.138  43.610  10.999  1.00 42.53  ? 255 SER D OG    1 
ATOM   5354 N  N     . ARG D 1 256 ? 23.407  45.567  13.175  1.00 44.55  ? 256 ARG D N     1 
ATOM   5355 C  CA    . ARG D 1 256 ? 24.665  46.085  13.648  1.00 45.47  ? 256 ARG D CA    1 
ATOM   5356 C  C     . ARG D 1 256 ? 25.799  45.100  13.348  1.00 45.33  ? 256 ARG D C     1 
ATOM   5357 O  O     . ARG D 1 256 ? 26.921  45.316  13.789  1.00 46.72  ? 256 ARG D O     1 
ATOM   5358 C  CB    . ARG D 1 256 ? 24.618  46.323  15.155  1.00 47.86  ? 256 ARG D CB    1 
ATOM   5359 C  CG    . ARG D 1 256 ? 23.269  46.674  15.739  1.00 49.80  ? 256 ARG D CG    1 
ATOM   5360 C  CD    . ARG D 1 256 ? 23.420  47.277  17.137  1.00 52.26  ? 256 ARG D CD    1 
ATOM   5361 N  NE    . ARG D 1 256 ? 23.908  48.645  17.013  1.00 53.17  ? 256 ARG D NE    1 
ATOM   5362 C  CZ    . ARG D 1 256 ? 25.141  49.063  17.290  1.00 51.45  ? 256 ARG D CZ    1 
ATOM   5363 N  NH1   . ARG D 1 256 ? 26.064  48.239  17.749  1.00 50.06  ? 256 ARG D NH1   1 
ATOM   5364 N  NH2   . ARG D 1 256 ? 25.442  50.340  17.089  1.00 50.93  ? 256 ARG D NH2   1 
ATOM   5365 N  N     . ASN D 1 257 ? 25.508  44.023  12.622  1.00 44.65  ? 257 ASN D N     1 
ATOM   5366 C  CA    . ASN D 1 257 ? 26.520  43.054  12.243  1.00 44.73  ? 257 ASN D CA    1 
ATOM   5367 C  C     . ASN D 1 257 ? 27.374  43.575  11.103  1.00 45.15  ? 257 ASN D C     1 
ATOM   5368 O  O     . ASN D 1 257 ? 26.879  43.759  9.980   1.00 44.37  ? 257 ASN D O     1 
ATOM   5369 C  CB    . ASN D 1 257 ? 25.873  41.742  11.805  1.00 44.94  ? 257 ASN D CB    1 
ATOM   5370 C  CG    . ASN D 1 257 ? 26.892  40.631  11.621  1.00 45.87  ? 257 ASN D CG    1 
ATOM   5371 O  OD1   . ASN D 1 257 ? 28.059  40.885  11.309  1.00 44.79  ? 257 ASN D OD1   1 
ATOM   5372 N  ND2   . ASN D 1 257 ? 26.462  39.393  11.828  1.00 46.22  ? 257 ASN D ND2   1 
ATOM   5373 N  N     . LEU D 1 258 ? 28.660  43.770  11.382  1.00 46.42  ? 258 LEU D N     1 
ATOM   5374 C  CA    . LEU D 1 258 ? 29.612  44.315  10.411  1.00 46.76  ? 258 LEU D CA    1 
ATOM   5375 C  C     . LEU D 1 258 ? 29.681  43.509  9.102   1.00 45.93  ? 258 LEU D C     1 
ATOM   5376 O  O     . LEU D 1 258 ? 29.683  44.080  8.010   1.00 44.53  ? 258 LEU D O     1 
ATOM   5377 C  CB    . LEU D 1 258 ? 31.014  44.411  11.040  1.00 47.51  ? 258 LEU D CB    1 
ATOM   5378 C  CG    . LEU D 1 258 ? 32.085  45.079  10.171  1.00 47.87  ? 258 LEU D CG    1 
ATOM   5379 C  CD1   . LEU D 1 258 ? 31.698  46.508  9.803   1.00 47.71  ? 258 LEU D CD1   1 
ATOM   5380 C  CD2   . LEU D 1 258 ? 33.425  45.062  10.877  1.00 48.55  ? 258 LEU D CD2   1 
ATOM   5381 N  N     . GLU D 1 259 ? 29.704  42.193  9.234   1.00 46.51  ? 259 GLU D N     1 
ATOM   5382 C  CA    A GLU D 1 259 ? 29.880  41.300  8.087   0.50 46.79  ? 259 GLU D CA    1 
ATOM   5383 C  CA    B GLU D 1 259 ? 29.877  41.283  8.101   0.50 46.98  ? 259 GLU D CA    1 
ATOM   5384 C  C     . GLU D 1 259 ? 28.595  41.215  7.268   1.00 46.79  ? 259 GLU D C     1 
ATOM   5385 O  O     . GLU D 1 259 ? 28.620  40.882  6.082   1.00 47.29  ? 259 GLU D O     1 
ATOM   5386 C  CB    A GLU D 1 259 ? 30.302  39.895  8.546   0.50 47.28  ? 259 GLU D CB    1 
ATOM   5387 C  CB    B GLU D 1 259 ? 30.265  39.884  8.619   0.50 47.61  ? 259 GLU D CB    1 
ATOM   5388 C  CG    A GLU D 1 259 ? 31.445  39.866  9.552   0.50 47.56  ? 259 GLU D CG    1 
ATOM   5389 C  CG    B GLU D 1 259 ? 30.983  38.989  7.619   0.50 47.45  ? 259 GLU D CG    1 
ATOM   5390 C  CD    A GLU D 1 259 ? 32.617  40.738  9.150   0.50 47.17  ? 259 GLU D CD    1 
ATOM   5391 C  CD    B GLU D 1 259 ? 31.345  37.634  8.209   0.50 48.54  ? 259 GLU D CD    1 
ATOM   5392 O  OE1   A GLU D 1 259 ? 32.889  40.852  7.933   0.50 46.29  ? 259 GLU D OE1   1 
ATOM   5393 O  OE1   B GLU D 1 259 ? 32.008  37.599  9.265   0.50 48.92  ? 259 GLU D OE1   1 
ATOM   5394 O  OE2   A GLU D 1 259 ? 33.275  41.303  10.055  0.50 46.83  ? 259 GLU D OE2   1 
ATOM   5395 O  OE2   B GLU D 1 259 ? 30.970  36.602  7.620   0.50 48.27  ? 259 GLU D OE2   1 
ATOM   5396 N  N     . GLU D 1 260 ? 27.471  41.528  7.901   1.00 47.70  ? 260 GLU D N     1 
ATOM   5397 C  CA    . GLU D 1 260 ? 26.182  41.512  7.236   1.00 46.94  ? 260 GLU D CA    1 
ATOM   5398 C  C     . GLU D 1 260 ? 25.959  42.810  6.447   1.00 44.37  ? 260 GLU D C     1 
ATOM   5399 O  O     . GLU D 1 260 ? 25.432  42.774  5.352   1.00 43.71  ? 260 GLU D O     1 
ATOM   5400 C  CB    . GLU D 1 260 ? 25.082  41.309  8.284   1.00 51.15  ? 260 GLU D CB    1 
ATOM   5401 C  CG    . GLU D 1 260 ? 23.714  40.945  7.728   1.00 52.97  ? 260 GLU D CG    1 
ATOM   5402 C  CD    . GLU D 1 260 ? 22.633  40.934  8.794   1.00 56.81  ? 260 GLU D CD    1 
ATOM   5403 O  OE1   . GLU D 1 260 ? 22.949  41.050  10.003  1.00 59.14  ? 260 GLU D OE1   1 
ATOM   5404 O  OE2   . GLU D 1 260 ? 21.447  40.807  8.420   1.00 59.83  ? 260 GLU D OE2   1 
ATOM   5405 N  N     . ILE D 1 261 ? 26.387  43.942  7.007   1.00 42.51  ? 261 ILE D N     1 
ATOM   5406 C  CA    . ILE D 1 261 ? 26.259  45.252  6.370   1.00 40.09  ? 261 ILE D CA    1 
ATOM   5407 C  C     . ILE D 1 261 ? 27.250  45.474  5.222   1.00 39.82  ? 261 ILE D C     1 
ATOM   5408 O  O     . ILE D 1 261 ? 26.928  46.161  4.250   1.00 39.23  ? 261 ILE D O     1 
ATOM   5409 C  CB    . ILE D 1 261 ? 26.457  46.384  7.396   1.00 39.08  ? 261 ILE D CB    1 
ATOM   5410 C  CG1   . ILE D 1 261 ? 25.377  46.345  8.471   1.00 39.53  ? 261 ILE D CG1   1 
ATOM   5411 C  CG2   . ILE D 1 261 ? 26.445  47.748  6.727   1.00 38.45  ? 261 ILE D CG2   1 
ATOM   5412 C  CD1   . ILE D 1 261 ? 25.809  46.991  9.780   1.00 40.70  ? 261 ILE D CD1   1 
ATOM   5413 N  N     . LYS D 1 262 ? 28.446  44.913  5.346   1.00 41.57  ? 262 LYS D N     1 
ATOM   5414 C  CA    . LYS D 1 262 ? 29.547  45.118  4.374   1.00 43.07  ? 262 LYS D CA    1 
ATOM   5415 C  C     . LYS D 1 262 ? 29.180  45.003  2.893   1.00 41.81  ? 262 LYS D C     1 
ATOM   5416 O  O     . LYS D 1 262 ? 29.538  45.879  2.117   1.00 39.40  ? 262 LYS D O     1 
ATOM   5417 C  CB    . LYS D 1 262 ? 30.694  44.139  4.633   1.00 45.24  ? 262 LYS D CB    1 
ATOM   5418 C  CG    . LYS D 1 262 ? 31.872  44.691  5.403   1.00 47.78  ? 262 LYS D CG    1 
ATOM   5419 C  CD    . LYS D 1 262 ? 32.943  43.604  5.480   1.00 49.94  ? 262 LYS D CD    1 
ATOM   5420 C  CE    . LYS D 1 262 ? 33.960  43.888  6.561   1.00 52.56  ? 262 LYS D CE    1 
ATOM   5421 N  NZ    . LYS D 1 262 ? 34.685  42.648  6.971   1.00 55.40  ? 262 LYS D NZ    1 
ATOM   5422 N  N     . PRO D 1 263 ? 28.506  43.900  2.494   1.00 43.45  ? 263 PRO D N     1 
ATOM   5423 C  CA    . PRO D 1 263 ? 28.142  43.729  1.074   1.00 41.94  ? 263 PRO D CA    1 
ATOM   5424 C  C     . PRO D 1 263 ? 27.284  44.882  0.548   1.00 40.12  ? 263 PRO D C     1 
ATOM   5425 O  O     . PRO D 1 263 ? 27.447  45.319  -0.597  1.00 36.17  ? 263 PRO D O     1 
ATOM   5426 C  CB    . PRO D 1 263 ? 27.349  42.410  1.054   1.00 42.93  ? 263 PRO D CB    1 
ATOM   5427 C  CG    . PRO D 1 263 ? 27.735  41.686  2.311   1.00 45.61  ? 263 PRO D CG    1 
ATOM   5428 C  CD    . PRO D 1 263 ? 28.075  42.750  3.318   1.00 44.93  ? 263 PRO D CD    1 
ATOM   5429 N  N     . TYR D 1 264 ? 26.380  45.378  1.385   1.00 40.09  ? 264 TYR D N     1 
ATOM   5430 C  CA    . TYR D 1 264 ? 25.541  46.496  0.979   1.00 39.13  ? 264 TYR D CA    1 
ATOM   5431 C  C     . TYR D 1 264 ? 26.415  47.734  0.756   1.00 39.45  ? 264 TYR D C     1 
ATOM   5432 O  O     . TYR D 1 264 ? 26.253  48.445  -0.236  1.00 40.32  ? 264 TYR D O     1 
ATOM   5433 C  CB    . TYR D 1 264 ? 24.473  46.776  2.022   1.00 39.28  ? 264 TYR D CB    1 
ATOM   5434 C  CG    . TYR D 1 264 ? 23.443  45.687  2.169   1.00 40.55  ? 264 TYR D CG    1 
ATOM   5435 C  CD1   . TYR D 1 264 ? 22.379  45.596  1.274   1.00 40.39  ? 264 TYR D CD1   1 
ATOM   5436 C  CD2   . TYR D 1 264 ? 23.503  44.767  3.221   1.00 42.12  ? 264 TYR D CD2   1 
ATOM   5437 C  CE1   . TYR D 1 264 ? 21.419  44.623  1.402   1.00 40.70  ? 264 TYR D CE1   1 
ATOM   5438 C  CE2   . TYR D 1 264 ? 22.543  43.787  3.355   1.00 43.20  ? 264 TYR D CE2   1 
ATOM   5439 C  CZ    . TYR D 1 264 ? 21.500  43.735  2.438   1.00 42.59  ? 264 TYR D CZ    1 
ATOM   5440 O  OH    . TYR D 1 264 ? 20.534  42.788  2.532   1.00 43.47  ? 264 TYR D OH    1 
ATOM   5441 N  N     . LEU D 1 265 ? 27.351  47.971  1.674   1.00 38.69  ? 265 LEU D N     1 
ATOM   5442 C  CA    . LEU D 1 265 ? 28.318  49.062  1.543   1.00 37.41  ? 265 LEU D CA    1 
ATOM   5443 C  C     . LEU D 1 265 ? 29.190  48.932  0.294   1.00 36.43  ? 265 LEU D C     1 
ATOM   5444 O  O     . LEU D 1 265 ? 29.422  49.895  -0.419  1.00 34.10  ? 265 LEU D O     1 
ATOM   5445 C  CB    . LEU D 1 265 ? 29.214  49.120  2.787   1.00 36.98  ? 265 LEU D CB    1 
ATOM   5446 C  CG    . LEU D 1 265 ? 30.212  50.266  2.909   1.00 36.12  ? 265 LEU D CG    1 
ATOM   5447 C  CD1   . LEU D 1 265 ? 29.576  51.610  2.655   1.00 34.71  ? 265 LEU D CD1   1 
ATOM   5448 C  CD2   . LEU D 1 265 ? 30.848  50.245  4.289   1.00 37.47  ? 265 LEU D CD2   1 
ATOM   5449 N  N     . PHE D 1 266 ? 29.686  47.738  0.040   1.00 37.55  ? 266 PHE D N     1 
ATOM   5450 C  CA    . PHE D 1 266 ? 30.549  47.527  -1.111  1.00 39.48  ? 266 PHE D CA    1 
ATOM   5451 C  C     . PHE D 1 266 ? 29.812  47.711  -2.445  1.00 39.00  ? 266 PHE D C     1 
ATOM   5452 O  O     . PHE D 1 266 ? 30.389  48.206  -3.391  1.00 40.16  ? 266 PHE D O     1 
ATOM   5453 C  CB    . PHE D 1 266 ? 31.225  46.155  -1.023  1.00 40.17  ? 266 PHE D CB    1 
ATOM   5454 C  CG    . PHE D 1 266 ? 32.222  46.037  0.101   1.00 41.86  ? 266 PHE D CG    1 
ATOM   5455 C  CD1   . PHE D 1 266 ? 32.625  47.151  0.844   1.00 41.39  ? 266 PHE D CD1   1 
ATOM   5456 C  CD2   . PHE D 1 266 ? 32.798  44.803  0.398   1.00 43.10  ? 266 PHE D CD2   1 
ATOM   5457 C  CE1   . PHE D 1 266 ? 33.562  47.020  1.853   1.00 41.82  ? 266 PHE D CE1   1 
ATOM   5458 C  CE2   . PHE D 1 266 ? 33.737  44.681  1.405   1.00 43.05  ? 266 PHE D CE2   1 
ATOM   5459 C  CZ    . PHE D 1 266 ? 34.114  45.790  2.133   1.00 42.26  ? 266 PHE D CZ    1 
ATOM   5460 N  N     . ARG D 1 267 ? 28.535  47.354  -2.497  1.00 41.76  ? 267 ARG D N     1 
ATOM   5461 C  CA    . ARG D 1 267 ? 27.724  47.588  -3.687  1.00 43.77  ? 267 ARG D CA    1 
ATOM   5462 C  C     . ARG D 1 267 ? 27.580  49.087  -3.914  1.00 40.79  ? 267 ARG D C     1 
ATOM   5463 O  O     . ARG D 1 267 ? 27.732  49.566  -5.028  1.00 38.33  ? 267 ARG D O     1 
ATOM   5464 C  CB    . ARG D 1 267 ? 26.348  46.929  -3.570  1.00 48.66  ? 267 ARG D CB    1 
ATOM   5465 C  CG    . ARG D 1 267 ? 25.661  46.704  -4.917  1.00 56.18  ? 267 ARG D CG    1 
ATOM   5466 C  CD    . ARG D 1 267 ? 24.149  46.445  -4.833  1.00 60.38  ? 267 ARG D CD    1 
ATOM   5467 N  NE    . ARG D 1 267 ? 23.688  45.966  -3.523  1.00 66.75  ? 267 ARG D NE    1 
ATOM   5468 C  CZ    . ARG D 1 267 ? 24.002  44.787  -2.969  1.00 71.61  ? 267 ARG D CZ    1 
ATOM   5469 N  NH1   . ARG D 1 267 ? 24.811  43.927  -3.586  1.00 72.91  ? 267 ARG D NH1   1 
ATOM   5470 N  NH2   . ARG D 1 267 ? 23.515  44.470  -1.771  1.00 73.53  ? 267 ARG D NH2   1 
ATOM   5471 N  N     . ALA D 1 268 ? 27.316  49.840  -2.853  1.00 38.46  ? 268 ALA D N     1 
ATOM   5472 C  CA    . ALA D 1 268 ? 27.258  51.292  -2.978  1.00 36.45  ? 268 ALA D CA    1 
ATOM   5473 C  C     . ALA D 1 268 ? 28.546  51.859  -3.537  1.00 36.07  ? 268 ALA D C     1 
ATOM   5474 O  O     . ALA D 1 268 ? 28.519  52.794  -4.335  1.00 33.64  ? 268 ALA D O     1 
ATOM   5475 C  CB    . ALA D 1 268 ? 26.946  51.941  -1.643  1.00 36.61  ? 268 ALA D CB    1 
ATOM   5476 N  N     . ILE D 1 269 ? 29.676  51.296  -3.121  1.00 37.08  ? 269 ILE D N     1 
ATOM   5477 C  CA    . ILE D 1 269 ? 30.980  51.793  -3.571  1.00 37.46  ? 269 ILE D CA    1 
ATOM   5478 C  C     . ILE D 1 269 ? 31.208  51.531  -5.067  1.00 40.81  ? 269 ILE D C     1 
ATOM   5479 O  O     . ILE D 1 269 ? 31.646  52.423  -5.790  1.00 40.06  ? 269 ILE D O     1 
ATOM   5480 C  CB    . ILE D 1 269 ? 32.108  51.174  -2.738  1.00 37.26  ? 269 ILE D CB    1 
ATOM   5481 C  CG1   . ILE D 1 269 ? 32.070  51.784  -1.335  1.00 37.04  ? 269 ILE D CG1   1 
ATOM   5482 C  CG2   . ILE D 1 269 ? 33.471  51.402  -3.388  1.00 35.85  ? 269 ILE D CG2   1 
ATOM   5483 C  CD1   . ILE D 1 269 ? 33.067  51.178  -0.390  1.00 37.48  ? 269 ILE D CD1   1 
ATOM   5484 N  N     . GLU D 1 270 ? 30.931  50.304  -5.517  1.00 44.36  ? 270 GLU D N     1 
ATOM   5485 C  CA    . GLU D 1 270 ? 31.018  49.951  -6.946  1.00 45.23  ? 270 GLU D CA    1 
ATOM   5486 C  C     . GLU D 1 270 ? 30.160  50.851  -7.814  1.00 43.32  ? 270 GLU D C     1 
ATOM   5487 O  O     . GLU D 1 270 ? 30.640  51.460  -8.759  1.00 44.50  ? 270 GLU D O     1 
ATOM   5488 C  CB    . GLU D 1 270 ? 30.565  48.505  -7.177  1.00 47.96  ? 270 GLU D CB    1 
ATOM   5489 C  CG    . GLU D 1 270 ? 31.623  47.459  -6.891  1.00 51.66  ? 270 GLU D CG    1 
ATOM   5490 C  CD    . GLU D 1 270 ? 32.928  47.726  -7.622  1.00 52.88  ? 270 GLU D CD    1 
ATOM   5491 O  OE1   . GLU D 1 270 ? 32.876  48.171  -8.788  1.00 56.32  ? 270 GLU D OE1   1 
ATOM   5492 O  OE2   . GLU D 1 270 ? 34.006  47.498  -7.029  1.00 54.75  ? 270 GLU D OE2   1 
ATOM   5493 N  N     . GLU D 1 271 ? 28.883  50.942  -7.483  1.00 43.58  ? 271 GLU D N     1 
ATOM   5494 C  CA    . GLU D 1 271 ? 27.965  51.765  -8.264  1.00 44.08  ? 271 GLU D CA    1 
ATOM   5495 C  C     . GLU D 1 271 ? 28.448  53.217  -8.311  1.00 43.44  ? 271 GLU D C     1 
ATOM   5496 O  O     . GLU D 1 271 ? 28.476  53.831  -9.377  1.00 45.45  ? 271 GLU D O     1 
ATOM   5497 C  CB    . GLU D 1 271 ? 26.541  51.633  -7.727  1.00 46.90  ? 271 GLU D CB    1 
ATOM   5498 C  CG    . GLU D 1 271 ? 26.007  50.203  -7.861  1.00 50.75  ? 271 GLU D CG    1 
ATOM   5499 C  CD    . GLU D 1 271 ? 24.598  50.003  -7.322  1.00 56.46  ? 271 GLU D CD    1 
ATOM   5500 O  OE1   . GLU D 1 271 ? 23.917  51.006  -6.995  1.00 62.10  ? 271 GLU D OE1   1 
ATOM   5501 O  OE2   . GLU D 1 271 ? 24.169  48.825  -7.224  1.00 57.61  ? 271 GLU D OE2   1 
ATOM   5502 N  N     . SER D 1 272 ? 28.887  53.745  -7.175  1.00 41.79  ? 272 SER D N     1 
ATOM   5503 C  CA    . SER D 1 272 ? 29.444  55.095  -7.123  1.00 41.22  ? 272 SER D CA    1 
ATOM   5504 C  C     . SER D 1 272 ? 30.767  55.269  -7.895  1.00 41.53  ? 272 SER D C     1 
ATOM   5505 O  O     . SER D 1 272 ? 30.971  56.297  -8.527  1.00 40.14  ? 272 SER D O     1 
ATOM   5506 C  CB    . SER D 1 272 ? 29.622  55.540  -5.671  1.00 42.24  ? 272 SER D CB    1 
ATOM   5507 O  OG    . SER D 1 272 ? 28.405  55.404  -4.959  1.00 41.67  ? 272 SER D OG    1 
ATOM   5508 N  N     . TYR D 1 273 ? 31.669  54.292  -7.859  1.00 43.29  ? 273 TYR D N     1 
ATOM   5509 C  CA    . TYR D 1 273 ? 32.890  54.404  -8.669  1.00 45.52  ? 273 TYR D CA    1 
ATOM   5510 C  C     . TYR D 1 273 ? 32.610  54.327  -10.160 1.00 49.52  ? 273 TYR D C     1 
ATOM   5511 O  O     . TYR D 1 273 ? 33.249  55.033  -10.937 1.00 52.37  ? 273 TYR D O     1 
ATOM   5512 C  CB    . TYR D 1 273 ? 33.966  53.394  -8.273  1.00 45.87  ? 273 TYR D CB    1 
ATOM   5513 C  CG    . TYR D 1 273 ? 34.999  54.031  -7.405  1.00 45.20  ? 273 TYR D CG    1 
ATOM   5514 C  CD1   . TYR D 1 273 ? 34.736  54.269  -6.075  1.00 47.22  ? 273 TYR D CD1   1 
ATOM   5515 C  CD2   . TYR D 1 273 ? 36.228  54.441  -7.921  1.00 45.75  ? 273 TYR D CD2   1 
ATOM   5516 C  CE1   . TYR D 1 273 ? 35.673  54.883  -5.264  1.00 48.33  ? 273 TYR D CE1   1 
ATOM   5517 C  CE2   . TYR D 1 273 ? 37.170  55.060  -7.119  1.00 46.42  ? 273 TYR D CE2   1 
ATOM   5518 C  CZ    . TYR D 1 273 ? 36.882  55.276  -5.792  1.00 47.24  ? 273 TYR D CZ    1 
ATOM   5519 O  OH    . TYR D 1 273 ? 37.786  55.888  -4.960  1.00 51.04  ? 273 TYR D OH    1 
ATOM   5520 N  N     . TYR D 1 274 ? 31.666  53.475  -10.557 1.00 51.91  ? 274 TYR D N     1 
ATOM   5521 C  CA    . TYR D 1 274 ? 31.214  53.436  -11.946 1.00 54.62  ? 274 TYR D CA    1 
ATOM   5522 C  C     . TYR D 1 274 ? 30.822  54.846  -12.399 1.00 54.02  ? 274 TYR D C     1 
ATOM   5523 O  O     . TYR D 1 274 ? 31.351  55.362  -13.382 1.00 52.71  ? 274 TYR D O     1 
ATOM   5524 C  CB    . TYR D 1 274 ? 30.025  52.483  -12.113 1.00 58.29  ? 274 TYR D CB    1 
ATOM   5525 C  CG    . TYR D 1 274 ? 29.473  52.453  -13.522 1.00 62.17  ? 274 TYR D CG    1 
ATOM   5526 C  CD1   . TYR D 1 274 ? 30.096  51.702  -14.514 1.00 65.31  ? 274 TYR D CD1   1 
ATOM   5527 C  CD2   . TYR D 1 274 ? 28.339  53.191  -13.868 1.00 63.97  ? 274 TYR D CD2   1 
ATOM   5528 C  CE1   . TYR D 1 274 ? 29.609  51.678  -15.809 1.00 66.82  ? 274 TYR D CE1   1 
ATOM   5529 C  CE2   . TYR D 1 274 ? 27.842  53.173  -15.165 1.00 66.65  ? 274 TYR D CE2   1 
ATOM   5530 C  CZ    . TYR D 1 274 ? 28.483  52.412  -16.130 1.00 67.55  ? 274 TYR D CZ    1 
ATOM   5531 O  OH    . TYR D 1 274 ? 28.003  52.373  -17.421 1.00 71.13  ? 274 TYR D OH    1 
ATOM   5532 N  N     . LYS D 1 275 ? 29.918  55.468  -11.649 1.00 50.86  ? 275 LYS D N     1 
ATOM   5533 C  CA    . LYS D 1 275 ? 29.437  56.809  -11.959 1.00 52.51  ? 275 LYS D CA    1 
ATOM   5534 C  C     . LYS D 1 275 ? 30.516  57.902  -11.877 1.00 53.24  ? 275 LYS D C     1 
ATOM   5535 O  O     . LYS D 1 275 ? 30.356  58.963  -12.477 1.00 57.27  ? 275 LYS D O     1 
ATOM   5536 C  CB    . LYS D 1 275 ? 28.252  57.170  -11.052 1.00 52.98  ? 275 LYS D CB    1 
ATOM   5537 C  CG    . LYS D 1 275 ? 27.007  56.320  -11.294 1.00 56.90  ? 275 LYS D CG    1 
ATOM   5538 C  CD    . LYS D 1 275 ? 25.758  56.869  -10.587 1.00 60.96  ? 275 LYS D CD    1 
ATOM   5539 C  CE    . LYS D 1 275 ? 25.641  56.424  -9.127  1.00 63.20  ? 275 LYS D CE    1 
ATOM   5540 N  NZ    . LYS D 1 275 ? 24.683  57.241  -8.317  1.00 62.36  ? 275 LYS D NZ    1 
ATOM   5541 N  N     . LEU D 1 276 ? 31.596  57.656  -11.135 1.00 52.23  ? 276 LEU D N     1 
ATOM   5542 C  CA    . LEU D 1 276 ? 32.705  58.611  -11.034 1.00 52.85  ? 276 LEU D CA    1 
ATOM   5543 C  C     . LEU D 1 276 ? 33.500  58.669  -12.328 1.00 54.48  ? 276 LEU D C     1 
ATOM   5544 O  O     . LEU D 1 276 ? 33.883  59.749  -12.784 1.00 56.19  ? 276 LEU D O     1 
ATOM   5545 C  CB    . LEU D 1 276 ? 33.665  58.219  -9.905  1.00 52.38  ? 276 LEU D CB    1 
ATOM   5546 C  CG    . LEU D 1 276 ? 33.195  58.494  -8.482  1.00 52.87  ? 276 LEU D CG    1 
ATOM   5547 C  CD1   . LEU D 1 276 ? 34.121  57.838  -7.475  1.00 52.68  ? 276 LEU D CD1   1 
ATOM   5548 C  CD2   . LEU D 1 276 ? 33.114  59.985  -8.228  1.00 54.59  ? 276 LEU D CD2   1 
ATOM   5549 N  N     . ASP D 1 277 ? 33.765  57.482  -12.875 1.00 55.92  ? 277 ASP D N     1 
ATOM   5550 C  CA    . ASP D 1 277 ? 34.479  57.291  -14.131 1.00 57.49  ? 277 ASP D CA    1 
ATOM   5551 C  C     . ASP D 1 277 ? 35.962  57.700  -14.022 1.00 60.62  ? 277 ASP D C     1 
ATOM   5552 O  O     . ASP D 1 277 ? 36.769  56.946  -13.487 1.00 64.73  ? 277 ASP D O     1 
ATOM   5553 C  CB    . ASP D 1 277 ? 33.728  57.984  -15.284 1.00 58.32  ? 277 ASP D CB    1 
ATOM   5554 C  CG    . ASP D 1 277 ? 33.953  57.306  -16.635 1.00 58.87  ? 277 ASP D CG    1 
ATOM   5555 O  OD1   . ASP D 1 277 ? 34.619  56.249  -16.700 1.00 57.33  ? 277 ASP D OD1   1 
ATOM   5556 O  OD2   . ASP D 1 277 ? 33.435  57.839  -17.637 1.00 61.23  ? 277 ASP D OD2   1 
ATOM   5557 N  N     . LYS D 1 278 ? 36.326  58.880  -14.509 1.00 61.73  ? 278 LYS D N     1 
ATOM   5558 C  CA    . LYS D 1 278 ? 37.721  59.311  -14.496 1.00 61.93  ? 278 LYS D CA    1 
ATOM   5559 C  C     . LYS D 1 278 ? 37.980  60.159  -13.264 1.00 57.35  ? 278 LYS D C     1 
ATOM   5560 O  O     . LYS D 1 278 ? 39.120  60.301  -12.834 1.00 51.84  ? 278 LYS D O     1 
ATOM   5561 C  CB    . LYS D 1 278 ? 38.052  60.132  -15.746 1.00 65.05  ? 278 LYS D CB    1 
ATOM   5562 C  CG    . LYS D 1 278 ? 37.439  59.622  -17.043 1.00 68.31  ? 278 LYS D CG    1 
ATOM   5563 C  CD    . LYS D 1 278 ? 37.841  58.194  -17.364 1.00 71.66  ? 278 LYS D CD    1 
ATOM   5564 C  CE    . LYS D 1 278 ? 37.352  57.807  -18.755 1.00 74.12  ? 278 LYS D CE    1 
ATOM   5565 N  NZ    . LYS D 1 278 ? 37.553  56.363  -19.055 1.00 74.66  ? 278 LYS D NZ    1 
ATOM   5566 N  N     . ARG D 1 279 ? 36.914  60.738  -12.709 1.00 54.17  ? 279 ARG D N     1 
ATOM   5567 C  CA    . ARG D 1 279 ? 37.052  61.612  -11.559 1.00 50.22  ? 279 ARG D CA    1 
ATOM   5568 C  C     . ARG D 1 279 ? 37.552  60.806  -10.365 1.00 45.99  ? 279 ARG D C     1 
ATOM   5569 O  O     . ARG D 1 279 ? 37.044  59.729  -10.083 1.00 44.72  ? 279 ARG D O     1 
ATOM   5570 C  CB    . ARG D 1 279 ? 35.722  62.299  -11.238 1.00 51.66  ? 279 ARG D CB    1 
ATOM   5571 C  CG    . ARG D 1 279 ? 35.385  63.462  -12.155 1.00 53.16  ? 279 ARG D CG    1 
ATOM   5572 C  CD    . ARG D 1 279 ? 33.945  63.925  -11.936 1.00 54.33  ? 279 ARG D CD    1 
ATOM   5573 N  NE    . ARG D 1 279 ? 32.969  62.986  -12.510 1.00 56.33  ? 279 ARG D NE    1 
ATOM   5574 C  CZ    . ARG D 1 279 ? 31.657  62.980  -12.249 1.00 57.21  ? 279 ARG D CZ    1 
ATOM   5575 N  NH1   . ARG D 1 279 ? 31.122  63.853  -11.398 1.00 58.17  ? 279 ARG D NH1   1 
ATOM   5576 N  NH2   . ARG D 1 279 ? 30.871  62.081  -12.836 1.00 56.27  ? 279 ARG D NH2   1 
ATOM   5577 N  N     . ILE D 1 280 ? 38.560  61.337  -9.686  1.00 43.28  ? 280 ILE D N     1 
ATOM   5578 C  CA    . ILE D 1 280 ? 39.119  60.719  -8.508  1.00 42.16  ? 280 ILE D CA    1 
ATOM   5579 C  C     . ILE D 1 280 ? 38.807  61.634  -7.333  1.00 42.31  ? 280 ILE D C     1 
ATOM   5580 O  O     . ILE D 1 280 ? 39.234  62.786  -7.333  1.00 42.85  ? 280 ILE D O     1 
ATOM   5581 C  CB    . ILE D 1 280 ? 40.643  60.565  -8.647  1.00 43.11  ? 280 ILE D CB    1 
ATOM   5582 C  CG1   . ILE D 1 280 ? 40.958  59.526  -9.722  1.00 43.00  ? 280 ILE D CG1   1 
ATOM   5583 C  CG2   . ILE D 1 280 ? 41.272  60.179  -7.315  1.00 43.30  ? 280 ILE D CG2   1 
ATOM   5584 C  CD1   . ILE D 1 280 ? 42.416  59.481  -10.132 1.00 45.80  ? 280 ILE D CD1   1 
ATOM   5585 N  N     . PRO D 1 281 ? 38.035  61.136  -6.343  1.00 40.65  ? 281 PRO D N     1 
ATOM   5586 C  CA    . PRO D 1 281 ? 37.729  61.907  -5.134  1.00 39.94  ? 281 PRO D CA    1 
ATOM   5587 C  C     . PRO D 1 281 ? 38.870  61.919  -4.142  1.00 39.83  ? 281 PRO D C     1 
ATOM   5588 O  O     . PRO D 1 281 ? 39.691  61.006  -4.139  1.00 40.17  ? 281 PRO D O     1 
ATOM   5589 C  CB    . PRO D 1 281 ? 36.549  61.139  -4.526  1.00 38.95  ? 281 PRO D CB    1 
ATOM   5590 C  CG    . PRO D 1 281 ? 36.770  59.739  -4.956  1.00 38.19  ? 281 PRO D CG    1 
ATOM   5591 C  CD    . PRO D 1 281 ? 37.360  59.827  -6.334  1.00 38.17  ? 281 PRO D CD    1 
ATOM   5592 N  N     . LYS D 1 282 ? 38.902  62.963  -3.315  1.00 42.19  ? 282 LYS D N     1 
ATOM   5593 C  CA    . LYS D 1 282 ? 39.804  63.095  -2.177  1.00 43.07  ? 282 LYS D CA    1 
ATOM   5594 C  C     . LYS D 1 282 ? 39.068  62.918  -0.837  1.00 42.52  ? 282 LYS D C     1 
ATOM   5595 O  O     . LYS D 1 282 ? 39.708  62.850  0.226   1.00 41.74  ? 282 LYS D O     1 
ATOM   5596 C  CB    . LYS D 1 282 ? 40.439  64.488  -2.181  1.00 47.68  ? 282 LYS D CB    1 
ATOM   5597 C  CG    . LYS D 1 282 ? 41.481  64.737  -3.264  1.00 50.96  ? 282 LYS D CG    1 
ATOM   5598 C  CD    . LYS D 1 282 ? 42.025  66.163  -3.192  1.00 53.91  ? 282 LYS D CD    1 
ATOM   5599 C  CE    . LYS D 1 282 ? 41.002  67.158  -3.739  1.00 56.41  ? 282 LYS D CE    1 
ATOM   5600 N  NZ    . LYS D 1 282 ? 41.591  68.498  -4.019  1.00 58.85  ? 282 LYS D NZ    1 
ATOM   5601 N  N     . ALA D 1 283 ? 37.734  62.881  -0.884  1.00 38.64  ? 283 ALA D N     1 
ATOM   5602 C  CA    . ALA D 1 283 ? 36.921  62.736  0.320   1.00 37.56  ? 283 ALA D CA    1 
ATOM   5603 C  C     . ALA D 1 283 ? 35.884  61.639  0.159   1.00 34.77  ? 283 ALA D C     1 
ATOM   5604 O  O     . ALA D 1 283 ? 35.258  61.497  -0.899  1.00 35.21  ? 283 ALA D O     1 
ATOM   5605 C  CB    . ALA D 1 283 ? 36.233  64.049  0.662   1.00 37.38  ? 283 ALA D CB    1 
ATOM   5606 N  N     . ILE D 1 284 ? 35.720  60.878  1.230   1.00 34.53  ? 284 ILE D N     1 
ATOM   5607 C  CA    . ILE D 1 284 ? 34.747  59.795  1.315   1.00 34.65  ? 284 ILE D CA    1 
ATOM   5608 C  C     . ILE D 1 284 ? 33.923  59.981  2.597   1.00 34.34  ? 284 ILE D C     1 
ATOM   5609 O  O     . ILE D 1 284 ? 34.473  60.306  3.638   1.00 34.88  ? 284 ILE D O     1 
ATOM   5610 C  CB    . ILE D 1 284 ? 35.446  58.403  1.322   1.00 33.53  ? 284 ILE D CB    1 
ATOM   5611 C  CG1   . ILE D 1 284 ? 34.423  57.280  1.465   1.00 32.70  ? 284 ILE D CG1   1 
ATOM   5612 C  CG2   . ILE D 1 284 ? 36.476  58.292  2.441   1.00 33.32  ? 284 ILE D CG2   1 
ATOM   5613 C  CD1   . ILE D 1 284 ? 34.954  55.910  1.135   1.00 32.59  ? 284 ILE D CD1   1 
ATOM   5614 N  N     . HIS D 1 285 ? 32.612  59.780  2.505   1.00 33.90  ? 285 HIS D N     1 
ATOM   5615 C  CA    . HIS D 1 285 ? 31.737  59.742  3.682   1.00 34.81  ? 285 HIS D CA    1 
ATOM   5616 C  C     . HIS D 1 285 ? 30.907  58.468  3.639   1.00 32.85  ? 285 HIS D C     1 
ATOM   5617 O  O     . HIS D 1 285 ? 30.279  58.185  2.619   1.00 31.30  ? 285 HIS D O     1 
ATOM   5618 C  CB    . HIS D 1 285 ? 30.803  60.947  3.705   1.00 36.58  ? 285 HIS D CB    1 
ATOM   5619 C  CG    . HIS D 1 285 ? 31.507  62.239  3.921   1.00 39.03  ? 285 HIS D CG    1 
ATOM   5620 N  ND1   . HIS D 1 285 ? 31.621  62.825  5.163   1.00 43.70  ? 285 HIS D ND1   1 
ATOM   5621 C  CD2   . HIS D 1 285 ? 32.158  63.051  3.060   1.00 40.07  ? 285 HIS D CD2   1 
ATOM   5622 C  CE1   . HIS D 1 285 ? 32.311  63.946  5.055   1.00 43.86  ? 285 HIS D CE1   1 
ATOM   5623 N  NE2   . HIS D 1 285 ? 32.645  64.107  3.785   1.00 41.85  ? 285 HIS D NE2   1 
ATOM   5624 N  N     . VAL D 1 286 ? 30.920  57.690  4.719   1.00 31.12  ? 286 VAL D N     1 
ATOM   5625 C  CA    . VAL D 1 286 ? 29.958  56.595  4.866   1.00 31.18  ? 286 VAL D CA    1 
ATOM   5626 C  C     . VAL D 1 286 ? 28.711  57.162  5.553   1.00 32.20  ? 286 VAL D C     1 
ATOM   5627 O  O     . VAL D 1 286 ? 28.825  57.832  6.588   1.00 32.44  ? 286 VAL D O     1 
ATOM   5628 C  CB    . VAL D 1 286 ? 30.541  55.421  5.670   1.00 31.06  ? 286 VAL D CB    1 
ATOM   5629 C  CG1   . VAL D 1 286 ? 29.473  54.380  5.973   1.00 30.60  ? 286 VAL D CG1   1 
ATOM   5630 C  CG2   . VAL D 1 286 ? 31.704  54.796  4.909   1.00 31.29  ? 286 VAL D CG2   1 
ATOM   5631 N  N     . VAL D 1 287 ? 27.542  56.905  4.972   1.00 32.89  ? 287 VAL D N     1 
ATOM   5632 C  CA    . VAL D 1 287 ? 26.258  57.446  5.454   1.00 34.36  ? 287 VAL D CA    1 
ATOM   5633 C  C     . VAL D 1 287 ? 25.375  56.319  5.969   1.00 35.21  ? 287 VAL D C     1 
ATOM   5634 O  O     . VAL D 1 287 ? 25.100  55.372  5.232   1.00 34.86  ? 287 VAL D O     1 
ATOM   5635 C  CB    . VAL D 1 287 ? 25.482  58.136  4.316   1.00 34.44  ? 287 VAL D CB    1 
ATOM   5636 C  CG1   . VAL D 1 287 ? 24.230  58.830  4.834   1.00 34.47  ? 287 VAL D CG1   1 
ATOM   5637 C  CG2   . VAL D 1 287 ? 26.385  59.117  3.606   1.00 35.64  ? 287 VAL D CG2   1 
ATOM   5638 N  N     . ALA D 1 288 ? 24.945  56.426  7.231   1.00 34.74  ? 288 ALA D N     1 
ATOM   5639 C  CA    . ALA D 1 288 ? 24.056  55.457  7.835   1.00 35.80  ? 288 ALA D CA    1 
ATOM   5640 C  C     . ALA D 1 288 ? 22.667  56.053  8.131   1.00 37.34  ? 288 ALA D C     1 
ATOM   5641 O  O     . ALA D 1 288 ? 22.550  57.145  8.722   1.00 37.66  ? 288 ALA D O     1 
ATOM   5642 C  CB    . ALA D 1 288 ? 24.679  54.931  9.118   1.00 37.57  ? 288 ALA D CB    1 
ATOM   5643 N  N     . VAL D 1 289 ? 21.622  55.336  7.722   1.00 37.22  ? 289 VAL D N     1 
ATOM   5644 C  CA    . VAL D 1 289 ? 20.258  55.629  8.166   1.00 37.72  ? 289 VAL D CA    1 
ATOM   5645 C  C     . VAL D 1 289 ? 19.891  54.609  9.238   1.00 39.30  ? 289 VAL D C     1 
ATOM   5646 O  O     . VAL D 1 289 ? 19.855  53.411  8.961   1.00 39.30  ? 289 VAL D O     1 
ATOM   5647 C  CB    . VAL D 1 289 ? 19.249  55.525  7.015   1.00 37.39  ? 289 VAL D CB    1 
ATOM   5648 C  CG1   . VAL D 1 289 ? 17.828  55.825  7.507   1.00 38.10  ? 289 VAL D CG1   1 
ATOM   5649 C  CG2   . VAL D 1 289 ? 19.641  56.475  5.887   1.00 36.68  ? 289 VAL D CG2   1 
ATOM   5650 N  N     . THR D 1 290 ? 19.625  55.079  10.456  1.00 40.43  ? 290 THR D N     1 
ATOM   5651 C  CA    . THR D 1 290 ? 19.318  54.185  11.574  1.00 41.67  ? 290 THR D CA    1 
ATOM   5652 C  C     . THR D 1 290 ? 17.878  53.672  11.514  1.00 42.76  ? 290 THR D C     1 
ATOM   5653 O  O     . THR D 1 290 ? 17.080  54.147  10.712  1.00 40.48  ? 290 THR D O     1 
ATOM   5654 C  CB    . THR D 1 290 ? 19.552  54.884  12.925  1.00 42.82  ? 290 THR D CB    1 
ATOM   5655 O  OG1   . THR D 1 290 ? 18.833  56.123  12.961  1.00 42.66  ? 290 THR D OG1   1 
ATOM   5656 C  CG2   . THR D 1 290 ? 21.042  55.159  13.135  1.00 41.93  ? 290 THR D CG2   1 
ATOM   5657 N  N     . GLU D 1 291 ? 17.574  52.687  12.358  1.00 45.81  ? 291 GLU D N     1 
ATOM   5658 C  CA    . GLU D 1 291 ? 16.226  52.098  12.495  1.00 48.17  ? 291 GLU D CA    1 
ATOM   5659 C  C     . GLU D 1 291 ? 15.118  53.135  12.717  1.00 48.90  ? 291 GLU D C     1 
ATOM   5660 O  O     . GLU D 1 291 ? 14.025  53.005  12.158  1.00 47.53  ? 291 GLU D O     1 
ATOM   5661 C  CB    . GLU D 1 291 ? 16.195  51.059  13.635  1.00 49.81  ? 291 GLU D CB    1 
ATOM   5662 C  CG    . GLU D 1 291 ? 16.600  51.588  15.012  1.00 52.65  ? 291 GLU D CG    1 
ATOM   5663 C  CD    . GLU D 1 291 ? 16.701  50.496  16.069  1.00 54.40  ? 291 GLU D CD    1 
ATOM   5664 O  OE1   . GLU D 1 291 ? 15.711  49.773  16.274  1.00 56.17  ? 291 GLU D OE1   1 
ATOM   5665 O  OE2   . GLU D 1 291 ? 17.769  50.352  16.699  1.00 52.89  ? 291 GLU D OE2   1 
ATOM   5666 N  N     . ASP D 1 292 ? 15.418  54.155  13.522  1.00 49.18  ? 292 ASP D N     1 
ATOM   5667 C  CA    . ASP D 1 292 ? 14.507  55.283  13.768  1.00 50.07  ? 292 ASP D CA    1 
ATOM   5668 C  C     . ASP D 1 292 ? 14.688  56.404  12.736  1.00 49.60  ? 292 ASP D C     1 
ATOM   5669 O  O     . ASP D 1 292 ? 14.325  57.551  12.992  1.00 50.06  ? 292 ASP D O     1 
ATOM   5670 C  CB    . ASP D 1 292 ? 14.723  55.840  15.180  1.00 51.52  ? 292 ASP D CB    1 
ATOM   5671 C  CG    . ASP D 1 292 ? 16.169  56.290  15.424  1.00 53.67  ? 292 ASP D CG    1 
ATOM   5672 O  OD1   . ASP D 1 292 ? 16.918  56.485  14.442  1.00 55.20  ? 292 ASP D OD1   1 
ATOM   5673 O  OD2   . ASP D 1 292 ? 16.572  56.447  16.593  1.00 53.89  ? 292 ASP D OD2   1 
ATOM   5674 N  N     . LEU D 1 293 ? 15.287  56.067  11.592  1.00 51.94  ? 293 LEU D N     1 
ATOM   5675 C  CA    . LEU D 1 293 ? 15.415  56.950  10.422  1.00 50.35  ? 293 LEU D CA    1 
ATOM   5676 C  C     . LEU D 1 293 ? 16.238  58.228  10.632  1.00 48.38  ? 293 LEU D C     1 
ATOM   5677 O  O     . LEU D 1 293 ? 16.097  59.180  9.877   1.00 49.03  ? 293 LEU D O     1 
ATOM   5678 C  CB    . LEU D 1 293 ? 14.020  57.272  9.826   1.00 51.69  ? 293 LEU D CB    1 
ATOM   5679 C  CG    . LEU D 1 293 ? 13.242  56.139  9.122   1.00 53.69  ? 293 LEU D CG    1 
ATOM   5680 C  CD1   . LEU D 1 293 ? 14.051  55.495  8.000   1.00 53.21  ? 293 LEU D CD1   1 
ATOM   5681 C  CD2   . LEU D 1 293 ? 12.767  55.069  10.090  1.00 56.79  ? 293 LEU D CD2   1 
ATOM   5682 N  N     . ASP D 1 294 ? 17.115  58.250  11.624  1.00 49.57  ? 294 ASP D N     1 
ATOM   5683 C  CA    . ASP D 1 294 ? 18.091  59.335  11.748  1.00 50.82  ? 294 ASP D CA    1 
ATOM   5684 C  C     . ASP D 1 294 ? 19.227  59.092  10.735  1.00 50.61  ? 294 ASP D C     1 
ATOM   5685 O  O     . ASP D 1 294 ? 19.409  57.961  10.262  1.00 48.36  ? 294 ASP D O     1 
ATOM   5686 C  CB    . ASP D 1 294 ? 18.631  59.394  13.185  1.00 53.70  ? 294 ASP D CB    1 
ATOM   5687 C  CG    . ASP D 1 294 ? 19.420  60.679  13.492  1.00 55.24  ? 294 ASP D CG    1 
ATOM   5688 O  OD1   . ASP D 1 294 ? 19.449  61.598  12.643  1.00 56.25  ? 294 ASP D OD1   1 
ATOM   5689 O  OD2   . ASP D 1 294 ? 20.019  60.770  14.589  1.00 54.50  ? 294 ASP D OD2   1 
ATOM   5690 N  N     . ILE D 1 295 ? 19.956  60.158  10.390  1.00 50.88  ? 295 ILE D N     1 
ATOM   5691 C  CA    . ILE D 1 295 ? 21.075  60.110  9.448   1.00 50.75  ? 295 ILE D CA    1 
ATOM   5692 C  C     . ILE D 1 295 ? 22.372  60.374  10.187  1.00 49.73  ? 295 ILE D C     1 
ATOM   5693 O  O     . ILE D 1 295 ? 22.542  61.431  10.757  1.00 52.88  ? 295 ILE D O     1 
ATOM   5694 C  CB    . ILE D 1 295 ? 20.967  61.200  8.352   1.00 53.13  ? 295 ILE D CB    1 
ATOM   5695 C  CG1   . ILE D 1 295 ? 19.622  61.123  7.615   1.00 52.91  ? 295 ILE D CG1   1 
ATOM   5696 C  CG2   . ILE D 1 295 ? 22.139  61.099  7.371   1.00 50.85  ? 295 ILE D CG2   1 
ATOM   5697 C  CD1   . ILE D 1 295 ? 19.468  59.900  6.735   1.00 54.55  ? 295 ILE D CD1   1 
ATOM   5698 N  N     . VAL D 1 296 ? 23.285  59.413  10.149  1.00 48.74  ? 296 VAL D N     1 
ATOM   5699 C  CA    . VAL D 1 296 ? 24.572  59.500  10.819  1.00 47.72  ? 296 VAL D CA    1 
ATOM   5700 C  C     . VAL D 1 296 ? 25.650  59.299  9.767   1.00 46.74  ? 296 VAL D C     1 
ATOM   5701 O  O     . VAL D 1 296 ? 25.532  58.404  8.934   1.00 46.43  ? 296 VAL D O     1 
ATOM   5702 C  CB    . VAL D 1 296 ? 24.706  58.378  11.850  1.00 49.57  ? 296 VAL D CB    1 
ATOM   5703 C  CG1   . VAL D 1 296 ? 25.984  58.536  12.665  1.00 51.86  ? 296 VAL D CG1   1 
ATOM   5704 C  CG2   . VAL D 1 296 ? 23.478  58.355  12.752  1.00 52.97  ? 296 VAL D CG2   1 
ATOM   5705 N  N     . SER D 1 297 ? 26.703  60.107  9.798   1.00 43.87  ? 297 SER D N     1 
ATOM   5706 C  CA    . SER D 1 297 ? 27.768  59.928  8.839   1.00 42.32  ? 297 SER D CA    1 
ATOM   5707 C  C     . SER D 1 297 ? 29.162  60.148  9.427   1.00 41.99  ? 297 SER D C     1 
ATOM   5708 O  O     . SER D 1 297 ? 29.339  60.860  10.411  1.00 42.23  ? 297 SER D O     1 
ATOM   5709 C  CB    . SER D 1 297 ? 27.543  60.842  7.643   1.00 42.03  ? 297 SER D CB    1 
ATOM   5710 O  OG    . SER D 1 297 ? 27.752  62.193  8.000   1.00 44.17  ? 297 SER D OG    1 
ATOM   5711 N  N     . ARG D 1 298 ? 30.141  59.509  8.802   1.00 39.34  ? 298 ARG D N     1 
ATOM   5712 C  CA    . ARG D 1 298 ? 31.528  59.648  9.172   1.00 39.84  ? 298 ARG D CA    1 
ATOM   5713 C  C     . ARG D 1 298 ? 32.338  59.663  7.883   1.00 38.48  ? 298 ARG D C     1 
ATOM   5714 O  O     . ARG D 1 298 ? 32.147  58.817  7.020   1.00 36.34  ? 298 ARG D O     1 
ATOM   5715 C  CB    . ARG D 1 298 ? 31.976  58.478  10.053  1.00 40.29  ? 298 ARG D CB    1 
ATOM   5716 C  CG    . ARG D 1 298 ? 31.337  58.425  11.440  1.00 40.98  ? 298 ARG D CG    1 
ATOM   5717 C  CD    . ARG D 1 298 ? 31.709  59.635  12.299  1.00 41.47  ? 298 ARG D CD    1 
ATOM   5718 N  NE    . ARG D 1 298 ? 31.233  59.504  13.682  1.00 42.26  ? 298 ARG D NE    1 
ATOM   5719 C  CZ    . ARG D 1 298 ? 29.993  59.775  14.106  1.00 41.84  ? 298 ARG D CZ    1 
ATOM   5720 N  NH1   . ARG D 1 298 ? 29.057  60.209  13.278  1.00 40.95  ? 298 ARG D NH1   1 
ATOM   5721 N  NH2   . ARG D 1 298 ? 29.686  59.613  15.383  1.00 43.47  ? 298 ARG D NH2   1 
ATOM   5722 N  N     . GLY D 1 299 ? 33.242  60.622  7.758   1.00 38.56  ? 299 GLY D N     1 
ATOM   5723 C  CA    . GLY D 1 299 ? 34.024  60.740  6.549   1.00 39.78  ? 299 GLY D CA    1 
ATOM   5724 C  C     . GLY D 1 299 ? 35.487  61.000  6.784   1.00 40.42  ? 299 GLY D C     1 
ATOM   5725 O  O     . GLY D 1 299 ? 35.937  61.134  7.917   1.00 40.28  ? 299 GLY D O     1 
ATOM   5726 N  N     . ARG D 1 300 ? 36.229  61.047  5.689   1.00 41.24  ? 300 ARG D N     1 
ATOM   5727 C  CA    . ARG D 1 300 ? 37.638  61.386  5.748   1.00 44.06  ? 300 ARG D CA    1 
ATOM   5728 C  C     . ARG D 1 300 ? 38.027  62.019  4.439   1.00 42.52  ? 300 ARG D C     1 
ATOM   5729 O  O     . ARG D 1 300 ? 37.583  61.581  3.373   1.00 40.33  ? 300 ARG D O     1 
ATOM   5730 C  CB    . ARG D 1 300 ? 38.491  60.147  5.997   1.00 46.61  ? 300 ARG D CB    1 
ATOM   5731 C  CG    . ARG D 1 300 ? 39.957  60.474  6.197   1.00 50.38  ? 300 ARG D CG    1 
ATOM   5732 C  CD    . ARG D 1 300 ? 40.796  59.253  6.558   1.00 53.00  ? 300 ARG D CD    1 
ATOM   5733 N  NE    . ARG D 1 300 ? 42.220  59.549  6.386   1.00 56.60  ? 300 ARG D NE    1 
ATOM   5734 C  CZ    . ARG D 1 300 ? 43.217  58.673  6.532   1.00 58.49  ? 300 ARG D CZ    1 
ATOM   5735 N  NH1   . ARG D 1 300 ? 42.969  57.407  6.854   1.00 58.08  ? 300 ARG D NH1   1 
ATOM   5736 N  NH2   . ARG D 1 300 ? 44.479  59.071  6.357   1.00 58.21  ? 300 ARG D NH2   1 
ATOM   5737 N  N     . THR D 1 301 ? 38.828  63.071  4.539   1.00 41.76  ? 301 THR D N     1 
ATOM   5738 C  CA    . THR D 1 301 ? 39.478  63.671  3.393   1.00 41.65  ? 301 THR D CA    1 
ATOM   5739 C  C     . THR D 1 301 ? 40.950  63.271  3.404   1.00 43.94  ? 301 THR D C     1 
ATOM   5740 O  O     . THR D 1 301 ? 41.592  63.240  4.461   1.00 44.04  ? 301 THR D O     1 
ATOM   5741 C  CB    . THR D 1 301 ? 39.373  65.208  3.428   1.00 41.58  ? 301 THR D CB    1 
ATOM   5742 O  OG1   . THR D 1 301 ? 37.992  65.600  3.413   1.00 38.99  ? 301 THR D OG1   1 
ATOM   5743 C  CG2   . THR D 1 301 ? 40.081  65.834  2.225   1.00 41.87  ? 301 THR D CG2   1 
ATOM   5744 N  N     . PHE D 1 302 ? 41.472  62.964  2.225   1.00 44.03  ? 302 PHE D N     1 
ATOM   5745 C  CA    . PHE D 1 302 ? 42.870  62.641  2.054   1.00 44.85  ? 302 PHE D CA    1 
ATOM   5746 C  C     . PHE D 1 302 ? 43.561  63.774  1.313   1.00 47.04  ? 302 PHE D C     1 
ATOM   5747 O  O     . PHE D 1 302 ? 42.944  64.428  0.470   1.00 47.07  ? 302 PHE D O     1 
ATOM   5748 C  CB    . PHE D 1 302 ? 43.011  61.361  1.239   1.00 44.65  ? 302 PHE D CB    1 
ATOM   5749 C  CG    . PHE D 1 302 ? 42.543  60.128  1.955   1.00 45.26  ? 302 PHE D CG    1 
ATOM   5750 C  CD1   . PHE D 1 302 ? 41.190  59.817  2.013   1.00 44.09  ? 302 PHE D CD1   1 
ATOM   5751 C  CD2   . PHE D 1 302 ? 43.452  59.276  2.571   1.00 46.19  ? 302 PHE D CD2   1 
ATOM   5752 C  CE1   . PHE D 1 302 ? 40.748  58.682  2.668   1.00 44.94  ? 302 PHE D CE1   1 
ATOM   5753 C  CE2   . PHE D 1 302 ? 43.014  58.134  3.226   1.00 47.61  ? 302 PHE D CE2   1 
ATOM   5754 C  CZ    . PHE D 1 302 ? 41.657  57.837  3.274   1.00 45.84  ? 302 PHE D CZ    1 
ATOM   5755 N  N     . PRO D 1 303 ? 44.862  63.990  1.586   1.00 48.47  ? 303 PRO D N     1 
ATOM   5756 C  CA    . PRO D 1 303 ? 45.606  64.996  0.832   1.00 48.73  ? 303 PRO D CA    1 
ATOM   5757 C  C     . PRO D 1 303 ? 45.970  64.499  -0.569  1.00 49.89  ? 303 PRO D C     1 
ATOM   5758 O  O     . PRO D 1 303 ? 46.972  64.932  -1.137  1.00 53.13  ? 303 PRO D O     1 
ATOM   5759 C  CB    . PRO D 1 303 ? 46.864  65.204  1.688   1.00 50.79  ? 303 PRO D CB    1 
ATOM   5760 C  CG    . PRO D 1 303 ? 47.073  63.904  2.395   1.00 50.61  ? 303 PRO D CG    1 
ATOM   5761 C  CD    . PRO D 1 303 ? 45.712  63.268  2.555   1.00 49.79  ? 303 PRO D CD    1 
ATOM   5762 N  N     . HIS D 1 304 ? 45.151  63.603  -1.116  1.00 47.24  ? 304 HIS D N     1 
ATOM   5763 C  CA    . HIS D 1 304 ? 45.431  62.908  -2.367  1.00 45.72  ? 304 HIS D CA    1 
ATOM   5764 C  C     . HIS D 1 304 ? 44.200  62.096  -2.741  1.00 43.11  ? 304 HIS D C     1 
ATOM   5765 O  O     . HIS D 1 304 ? 43.267  61.962  -1.956  1.00 43.09  ? 304 HIS D O     1 
ATOM   5766 C  CB    . HIS D 1 304 ? 46.631  61.954  -2.220  1.00 47.34  ? 304 HIS D CB    1 
ATOM   5767 C  CG    . HIS D 1 304 ? 46.424  60.872  -1.200  1.00 48.54  ? 304 HIS D CG    1 
ATOM   5768 N  ND1   . HIS D 1 304 ? 46.908  60.958  0.089   1.00 49.88  ? 304 HIS D ND1   1 
ATOM   5769 C  CD2   . HIS D 1 304 ? 45.775  59.686  -1.276  1.00 47.28  ? 304 HIS D CD2   1 
ATOM   5770 C  CE1   . HIS D 1 304 ? 46.571  59.870  0.762   1.00 49.54  ? 304 HIS D CE1   1 
ATOM   5771 N  NE2   . HIS D 1 304 ? 45.875  59.086  -0.041  1.00 48.28  ? 304 HIS D NE2   1 
ATOM   5772 N  N     . GLY D 1 305 ? 44.210  61.531  -3.929  1.00 41.28  ? 305 GLY D N     1 
ATOM   5773 C  CA    . GLY D 1 305 ? 43.078  60.775  -4.409  1.00 39.71  ? 305 GLY D CA    1 
ATOM   5774 C  C     . GLY D 1 305 ? 42.849  59.472  -3.661  1.00 39.13  ? 305 GLY D C     1 
ATOM   5775 O  O     . GLY D 1 305 ? 43.756  58.910  -3.068  1.00 37.73  ? 305 GLY D O     1 
ATOM   5776 N  N     . ILE D 1 306 ? 41.609  59.004  -3.707  1.00 37.28  ? 306 ILE D N     1 
ATOM   5777 C  CA    . ILE D 1 306 ? 41.233  57.739  -3.119  1.00 36.47  ? 306 ILE D CA    1 
ATOM   5778 C  C     . ILE D 1 306 ? 41.088  56.738  -4.253  1.00 35.23  ? 306 ILE D C     1 
ATOM   5779 O  O     . ILE D 1 306 ? 40.274  56.933  -5.128  1.00 33.71  ? 306 ILE D O     1 
ATOM   5780 C  CB    . ILE D 1 306 ? 39.888  57.866  -2.361  1.00 35.78  ? 306 ILE D CB    1 
ATOM   5781 C  CG1   . ILE D 1 306 ? 40.022  58.890  -1.228  1.00 37.52  ? 306 ILE D CG1   1 
ATOM   5782 C  CG2   . ILE D 1 306 ? 39.450  56.505  -1.830  1.00 35.29  ? 306 ILE D CG2   1 
ATOM   5783 C  CD1   . ILE D 1 306 ? 38.690  59.312  -0.620  1.00 37.98  ? 306 ILE D CD1   1 
ATOM   5784 N  N     . SER D 1 307 ? 41.899  55.688  -4.241  1.00 36.65  ? 307 SER D N     1 
ATOM   5785 C  CA    . SER D 1 307 ? 41.729  54.561  -5.142  1.00 37.82  ? 307 SER D CA    1 
ATOM   5786 C  C     . SER D 1 307 ? 40.495  53.766  -4.721  1.00 37.52  ? 307 SER D C     1 
ATOM   5787 O  O     . SER D 1 307 ? 39.996  53.952  -3.615  1.00 35.87  ? 307 SER D O     1 
ATOM   5788 C  CB    . SER D 1 307 ? 42.933  53.641  -5.016  1.00 39.85  ? 307 SER D CB    1 
ATOM   5789 O  OG    . SER D 1 307 ? 43.149  53.295  -3.643  1.00 40.79  ? 307 SER D OG    1 
ATOM   5790 N  N     . LYS D 1 308 ? 40.036  52.850  -5.571  1.00 37.44  ? 308 LYS D N     1 
ATOM   5791 C  CA    . LYS D 1 308 ? 38.859  52.043  -5.238  1.00 37.63  ? 308 LYS D CA    1 
ATOM   5792 C  C     . LYS D 1 308 ? 39.112  51.138  -4.033  1.00 37.24  ? 308 LYS D C     1 
ATOM   5793 O  O     . LYS D 1 308 ? 38.286  51.079  -3.121  1.00 33.77  ? 308 LYS D O     1 
ATOM   5794 C  CB    . LYS D 1 308 ? 38.365  51.209  -6.428  1.00 39.06  ? 308 LYS D CB    1 
ATOM   5795 C  CG    . LYS D 1 308 ? 36.873  50.911  -6.330  1.00 39.89  ? 308 LYS D CG    1 
ATOM   5796 C  CD    . LYS D 1 308 ? 36.427  49.777  -7.244  1.00 42.70  ? 308 LYS D CD    1 
ATOM   5797 C  CE    . LYS D 1 308 ? 36.574  50.138  -8.707  1.00 43.44  ? 308 LYS D CE    1 
ATOM   5798 N  NZ    . LYS D 1 308 ? 35.870  49.157  -9.586  1.00 45.38  ? 308 LYS D NZ    1 
ATOM   5799 N  N     . GLU D 1 309 ? 40.260  50.461  -4.025  1.00 38.52  ? 309 GLU D N     1 
ATOM   5800 C  CA    . GLU D 1 309 ? 40.657  49.616  -2.886  1.00 40.34  ? 309 GLU D CA    1 
ATOM   5801 C  C     . GLU D 1 309 ? 40.759  50.394  -1.573  1.00 37.75  ? 309 GLU D C     1 
ATOM   5802 O  O     . GLU D 1 309 ? 40.289  49.941  -0.546  1.00 36.32  ? 309 GLU D O     1 
ATOM   5803 C  CB    . GLU D 1 309 ? 41.962  48.842  -3.137  1.00 44.80  ? 309 GLU D CB    1 
ATOM   5804 C  CG    . GLU D 1 309 ? 43.041  49.560  -3.944  1.00 49.13  ? 309 GLU D CG    1 
ATOM   5805 C  CD    . GLU D 1 309 ? 42.831  49.412  -5.442  1.00 51.60  ? 309 GLU D CD    1 
ATOM   5806 O  OE1   . GLU D 1 309 ? 42.914  48.266  -5.942  1.00 56.88  ? 309 GLU D OE1   1 
ATOM   5807 O  OE2   . GLU D 1 309 ? 42.555  50.433  -6.114  1.00 52.75  ? 309 GLU D OE2   1 
ATOM   5808 N  N     . THR D 1 310 ? 41.371  51.570  -1.612  1.00 37.08  ? 310 THR D N     1 
ATOM   5809 C  CA    . THR D 1 310 ? 41.400  52.445  -0.450  1.00 34.75  ? 310 THR D CA    1 
ATOM   5810 C  C     . THR D 1 310 ? 39.974  52.836  -0.053  1.00 33.19  ? 310 THR D C     1 
ATOM   5811 O  O     . THR D 1 310 ? 39.676  52.915  1.136   1.00 33.16  ? 310 THR D O     1 
ATOM   5812 C  CB    . THR D 1 310 ? 42.231  53.717  -0.693  1.00 34.62  ? 310 THR D CB    1 
ATOM   5813 O  OG1   . THR D 1 310 ? 43.590  53.368  -0.965  1.00 35.16  ? 310 THR D OG1   1 
ATOM   5814 C  CG2   . THR D 1 310 ? 42.204  54.625  0.546   1.00 35.04  ? 310 THR D CG2   1 
ATOM   5815 N  N     . ALA D 1 311 ? 39.100  53.062  -1.032  1.00 30.76  ? 311 ALA D N     1 
ATOM   5816 C  CA    . ALA D 1 311 ? 37.699  53.341  -0.720  1.00 31.42  ? 311 ALA D CA    1 
ATOM   5817 C  C     . ALA D 1 311 ? 37.056  52.190  0.037   1.00 32.18  ? 311 ALA D C     1 
ATOM   5818 O  O     . ALA D 1 311 ? 36.399  52.423  1.042   1.00 31.84  ? 311 ALA D O     1 
ATOM   5819 C  CB    . ALA D 1 311 ? 36.870  53.658  -1.963  1.00 29.73  ? 311 ALA D CB    1 
ATOM   5820 N  N     . TYR D 1 312 ? 37.203  50.971  -0.475  1.00 33.74  ? 312 TYR D N     1 
ATOM   5821 C  CA    . TYR D 1 312 ? 36.660  49.801  0.208   1.00 36.27  ? 312 TYR D CA    1 
ATOM   5822 C  C     . TYR D 1 312 ? 37.179  49.773  1.649   1.00 36.04  ? 312 TYR D C     1 
ATOM   5823 O  O     . TYR D 1 312 ? 36.413  49.754  2.598   1.00 34.35  ? 312 TYR D O     1 
ATOM   5824 C  CB    . TYR D 1 312 ? 37.069  48.517  -0.497  1.00 38.39  ? 312 TYR D CB    1 
ATOM   5825 C  CG    . TYR D 1 312 ? 36.146  48.095  -1.606  1.00 40.99  ? 312 TYR D CG    1 
ATOM   5826 C  CD1   . TYR D 1 312 ? 35.983  48.885  -2.744  1.00 41.75  ? 312 TYR D CD1   1 
ATOM   5827 C  CD2   . TYR D 1 312 ? 35.445  46.891  -1.531  1.00 43.79  ? 312 TYR D CD2   1 
ATOM   5828 C  CE1   . TYR D 1 312 ? 35.138  48.509  -3.765  1.00 41.79  ? 312 TYR D CE1   1 
ATOM   5829 C  CE2   . TYR D 1 312 ? 34.599  46.495  -2.552  1.00 44.79  ? 312 TYR D CE2   1 
ATOM   5830 C  CZ    . TYR D 1 312 ? 34.449  47.316  -3.663  1.00 44.86  ? 312 TYR D CZ    1 
ATOM   5831 O  OH    . TYR D 1 312 ? 33.618  46.936  -4.682  1.00 47.68  ? 312 TYR D OH    1 
ATOM   5832 N  N     . SER D 1 313 ? 38.498  49.807  1.776   1.00 36.47  ? 313 SER D N     1 
ATOM   5833 C  CA    . SER D 1 313 ? 39.170  49.686  3.067   1.00 37.59  ? 313 SER D CA    1 
ATOM   5834 C  C     . SER D 1 313 ? 38.803  50.810  4.029   1.00 36.67  ? 313 SER D C     1 
ATOM   5835 O  O     . SER D 1 313 ? 38.516  50.564  5.185   1.00 35.73  ? 313 SER D O     1 
ATOM   5836 C  CB    . SER D 1 313 ? 40.684  49.659  2.860   1.00 38.01  ? 313 SER D CB    1 
ATOM   5837 O  OG    . SER D 1 313 ? 41.335  50.004  4.064   1.00 40.79  ? 313 SER D OG    1 
ATOM   5838 N  N     . GLU D 1 314 ? 38.795  52.044  3.546   1.00 36.45  ? 314 GLU D N     1 
ATOM   5839 C  CA    . GLU D 1 314 ? 38.458  53.174  4.413   1.00 38.16  ? 314 GLU D CA    1 
ATOM   5840 C  C     . GLU D 1 314 ? 36.969  53.164  4.813   1.00 36.13  ? 314 GLU D C     1 
ATOM   5841 O  O     . GLU D 1 314 ? 36.627  53.511  5.948   1.00 35.27  ? 314 GLU D O     1 
ATOM   5842 C  CB    . GLU D 1 314 ? 38.822  54.493  3.727   1.00 40.07  ? 314 GLU D CB    1 
ATOM   5843 C  CG    . GLU D 1 314 ? 38.812  55.706  4.642   1.00 42.54  ? 314 GLU D CG    1 
ATOM   5844 C  CD    . GLU D 1 314 ? 39.781  55.593  5.809   1.00 44.71  ? 314 GLU D CD    1 
ATOM   5845 O  OE1   . GLU D 1 314 ? 40.820  54.896  5.704   1.00 46.36  ? 314 GLU D OE1   1 
ATOM   5846 O  OE2   . GLU D 1 314 ? 39.492  56.206  6.847   1.00 48.89  ? 314 GLU D OE2   1 
ATOM   5847 N  N     . SER D 1 315 ? 36.098  52.745  3.892   1.00 33.36  ? 315 SER D N     1 
ATOM   5848 C  CA    . SER D 1 315 ? 34.661  52.683  4.175   1.00 32.90  ? 315 SER D CA    1 
ATOM   5849 C  C     . SER D 1 315 ? 34.354  51.743  5.347   1.00 33.06  ? 315 SER D C     1 
ATOM   5850 O  O     . SER D 1 315 ? 33.471  52.030  6.158   1.00 32.11  ? 315 SER D O     1 
ATOM   5851 C  CB    . SER D 1 315 ? 33.862  52.271  2.926   1.00 32.80  ? 315 SER D CB    1 
ATOM   5852 O  OG    . SER D 1 315 ? 34.087  50.903  2.587   1.00 34.02  ? 315 SER D OG    1 
ATOM   5853 N  N     . VAL D 1 316 ? 35.104  50.651  5.464   1.00 33.06  ? 316 VAL D N     1 
ATOM   5854 C  CA    . VAL D 1 316 ? 34.867  49.705  6.546   1.00 34.95  ? 316 VAL D CA    1 
ATOM   5855 C  C     . VAL D 1 316 ? 35.211  50.378  7.887   1.00 36.14  ? 316 VAL D C     1 
ATOM   5856 O  O     . VAL D 1 316 ? 34.389  50.403  8.813   1.00 34.81  ? 316 VAL D O     1 
ATOM   5857 C  CB    . VAL D 1 316 ? 35.638  48.375  6.333   1.00 36.11  ? 316 VAL D CB    1 
ATOM   5858 C  CG1   . VAL D 1 316 ? 35.578  47.494  7.575   1.00 37.21  ? 316 VAL D CG1   1 
ATOM   5859 C  CG2   . VAL D 1 316 ? 35.079  47.621  5.129   1.00 35.68  ? 316 VAL D CG2   1 
ATOM   5860 N  N     . LYS D 1 317 ? 36.402  50.971  7.968   1.00 37.07  ? 317 LYS D N     1 
ATOM   5861 C  CA    . LYS D 1 317 ? 36.793  51.724  9.173   1.00 38.24  ? 317 LYS D CA    1 
ATOM   5862 C  C     . LYS D 1 317 ? 35.747  52.771  9.564   1.00 36.34  ? 317 LYS D C     1 
ATOM   5863 O  O     . LYS D 1 317 ? 35.468  52.967  10.747  1.00 36.12  ? 317 LYS D O     1 
ATOM   5864 C  CB    . LYS D 1 317 ? 38.141  52.408  8.973   1.00 39.44  ? 317 LYS D CB    1 
ATOM   5865 C  CG    . LYS D 1 317 ? 39.317  51.446  8.867   1.00 41.17  ? 317 LYS D CG    1 
ATOM   5866 C  CD    . LYS D 1 317 ? 40.515  52.169  8.289   1.00 42.41  ? 317 LYS D CD    1 
ATOM   5867 C  CE    . LYS D 1 317 ? 41.711  51.250  8.185   1.00 45.25  ? 317 LYS D CE    1 
ATOM   5868 N  NZ    . LYS D 1 317 ? 42.908  52.058  7.820   1.00 46.87  ? 317 LYS D NZ    1 
ATOM   5869 N  N     . LEU D 1 318 ? 35.152  53.436  8.580   1.00 34.14  ? 318 LEU D N     1 
ATOM   5870 C  CA    . LEU D 1 318 ? 34.189  54.480  8.905   1.00 33.08  ? 318 LEU D CA    1 
ATOM   5871 C  C     . LEU D 1 318 ? 32.896  53.868  9.418   1.00 33.55  ? 318 LEU D C     1 
ATOM   5872 O  O     . LEU D 1 318 ? 32.246  54.433  10.309  1.00 33.41  ? 318 LEU D O     1 
ATOM   5873 C  CB    . LEU D 1 318 ? 33.924  55.387  7.712   1.00 31.80  ? 318 LEU D CB    1 
ATOM   5874 C  CG    . LEU D 1 318 ? 35.136  56.215  7.306   1.00 31.86  ? 318 LEU D CG    1 
ATOM   5875 C  CD1   . LEU D 1 318 ? 34.914  56.851  5.930   1.00 30.92  ? 318 LEU D CD1   1 
ATOM   5876 C  CD2   . LEU D 1 318 ? 35.422  57.273  8.363   1.00 31.96  ? 318 LEU D CD2   1 
ATOM   5877 N  N     . LEU D 1 319 ? 32.528  52.721  8.844   1.00 33.00  ? 319 LEU D N     1 
ATOM   5878 C  CA    . LEU D 1 319 ? 31.354  51.979  9.274   1.00 32.93  ? 319 LEU D CA    1 
ATOM   5879 C  C     . LEU D 1 319 ? 31.566  51.548  10.704  1.00 34.55  ? 319 LEU D C     1 
ATOM   5880 O  O     . LEU D 1 319 ? 30.679  51.703  11.538  1.00 34.20  ? 319 LEU D O     1 
ATOM   5881 C  CB    . LEU D 1 319 ? 31.116  50.750  8.385   1.00 31.83  ? 319 LEU D CB    1 
ATOM   5882 C  CG    . LEU D 1 319 ? 29.952  49.838  8.757   1.00 32.00  ? 319 LEU D CG    1 
ATOM   5883 C  CD1   . LEU D 1 319 ? 28.654  50.622  8.945   1.00 31.63  ? 319 LEU D CD1   1 
ATOM   5884 C  CD2   . LEU D 1 319 ? 29.782  48.752  7.705   1.00 31.82  ? 319 LEU D CD2   1 
ATOM   5885 N  N     . GLN D 1 320 ? 32.755  51.011  10.972  1.00 36.94  ? 320 GLN D N     1 
ATOM   5886 C  CA    . GLN D 1 320 ? 33.144  50.601  12.326  1.00 39.35  ? 320 GLN D CA    1 
ATOM   5887 C  C     . GLN D 1 320 ? 33.081  51.758  13.326  1.00 39.76  ? 320 GLN D C     1 
ATOM   5888 O  O     . GLN D 1 320 ? 32.659  51.576  14.446  1.00 42.04  ? 320 GLN D O     1 
ATOM   5889 C  CB    . GLN D 1 320 ? 34.547  49.986  12.331  1.00 41.29  ? 320 GLN D CB    1 
ATOM   5890 C  CG    . GLN D 1 320 ? 34.605  48.547  11.811  1.00 42.98  ? 320 GLN D CG    1 
ATOM   5891 C  CD    . GLN D 1 320 ? 36.041  48.008  11.639  1.00 44.69  ? 320 GLN D CD    1 
ATOM   5892 O  OE1   . GLN D 1 320 ? 36.904  48.662  11.054  1.00 44.78  ? 320 GLN D OE1   1 
ATOM   5893 N  NE2   . GLN D 1 320 ? 36.282  46.800  12.127  1.00 45.60  ? 320 GLN D NE2   1 
ATOM   5894 N  N     . LYS D 1 321 ? 33.512  52.942  12.921  1.00 39.49  ? 321 LYS D N     1 
ATOM   5895 C  CA    . LYS D 1 321 ? 33.421  54.124  13.765  1.00 40.05  ? 321 LYS D CA    1 
ATOM   5896 C  C     . LYS D 1 321 ? 31.945  54.476  14.088  1.00 39.26  ? 321 LYS D C     1 
ATOM   5897 O  O     . LYS D 1 321 ? 31.606  54.818  15.234  1.00 39.12  ? 321 LYS D O     1 
ATOM   5898 C  CB    . LYS D 1 321 ? 34.133  55.277  13.065  1.00 40.78  ? 321 LYS D CB    1 
ATOM   5899 C  CG    . LYS D 1 321 ? 34.341  56.528  13.893  1.00 43.24  ? 321 LYS D CG    1 
ATOM   5900 C  CD    . LYS D 1 321 ? 35.169  57.542  13.107  1.00 44.47  ? 321 LYS D CD    1 
ATOM   5901 C  CE    . LYS D 1 321 ? 35.134  58.923  13.747  1.00 45.83  ? 321 LYS D CE    1 
ATOM   5902 N  NZ    . LYS D 1 321 ? 35.782  58.929  15.089  1.00 47.74  ? 321 LYS D NZ    1 
ATOM   5903 N  N     . ILE D 1 322 ? 31.071  54.362  13.088  1.00 36.69  ? 322 ILE D N     1 
ATOM   5904 C  CA    . ILE D 1 322 ? 29.637  54.567  13.299  1.00 36.39  ? 322 ILE D CA    1 
ATOM   5905 C  C     . ILE D 1 322 ? 29.053  53.581  14.316  1.00 37.29  ? 322 ILE D C     1 
ATOM   5906 O  O     . ILE D 1 322 ? 28.368  54.000  15.250  1.00 36.82  ? 322 ILE D O     1 
ATOM   5907 C  CB    . ILE D 1 322 ? 28.831  54.502  11.976  1.00 35.09  ? 322 ILE D CB    1 
ATOM   5908 C  CG1   . ILE D 1 322 ? 29.118  55.739  11.121  1.00 33.88  ? 322 ILE D CG1   1 
ATOM   5909 C  CG2   . ILE D 1 322 ? 27.333  54.442  12.248  1.00 35.08  ? 322 ILE D CG2   1 
ATOM   5910 C  CD1   . ILE D 1 322 ? 28.562  55.657  9.715   1.00 32.51  ? 322 ILE D CD1   1 
ATOM   5911 N  N     . LEU D 1 323 ? 29.331  52.288  14.136  1.00 37.89  ? 323 LEU D N     1 
ATOM   5912 C  CA    . LEU D 1 323 ? 28.802  51.251  15.030  1.00 39.56  ? 323 LEU D CA    1 
ATOM   5913 C  C     . LEU D 1 323 ? 29.288  51.422  16.487  1.00 42.66  ? 323 LEU D C     1 
ATOM   5914 O  O     . LEU D 1 323 ? 28.527  51.178  17.427  1.00 45.60  ? 323 LEU D O     1 
ATOM   5915 C  CB    . LEU D 1 323 ? 29.128  49.845  14.509  1.00 38.33  ? 323 LEU D CB    1 
ATOM   5916 C  CG    . LEU D 1 323 ? 28.451  49.449  13.178  1.00 37.51  ? 323 LEU D CG    1 
ATOM   5917 C  CD1   . LEU D 1 323 ? 29.117  48.238  12.533  1.00 37.41  ? 323 LEU D CD1   1 
ATOM   5918 C  CD2   . LEU D 1 323 ? 26.958  49.200  13.345  1.00 36.96  ? 323 LEU D CD2   1 
ATOM   5919 N  N     . GLU D 1 324 ? 30.535  51.836  16.678  1.00 44.06  ? 324 GLU D N     1 
ATOM   5920 C  CA    . GLU D 1 324 ? 31.060  52.081  18.026  1.00 46.61  ? 324 GLU D CA    1 
ATOM   5921 C  C     . GLU D 1 324 ? 30.449  53.311  18.673  1.00 46.79  ? 324 GLU D C     1 
ATOM   5922 O  O     . GLU D 1 324 ? 30.274  53.351  19.871  1.00 48.53  ? 324 GLU D O     1 
ATOM   5923 C  CB    . GLU D 1 324 ? 32.561  52.308  17.994  1.00 47.99  ? 324 GLU D CB    1 
ATOM   5924 C  CG    . GLU D 1 324 ? 33.382  51.076  17.675  1.00 49.79  ? 324 GLU D CG    1 
ATOM   5925 C  CD    . GLU D 1 324 ? 34.804  51.431  17.290  1.00 50.35  ? 324 GLU D CD    1 
ATOM   5926 O  OE1   . GLU D 1 324 ? 35.090  52.645  17.145  1.00 49.69  ? 324 GLU D OE1   1 
ATOM   5927 O  OE2   . GLU D 1 324 ? 35.624  50.501  17.124  1.00 51.04  ? 324 GLU D OE2   1 
ATOM   5928 N  N     . GLU D 1 325 ? 30.155  54.331  17.880  1.00 46.79  ? 325 GLU D N     1 
ATOM   5929 C  CA    . GLU D 1 325 ? 29.734  55.606  18.440  1.00 47.11  ? 325 GLU D CA    1 
ATOM   5930 C  C     . GLU D 1 325 ? 28.226  55.760  18.501  1.00 47.20  ? 325 GLU D C     1 
ATOM   5931 O  O     . GLU D 1 325 ? 27.726  56.679  19.128  1.00 49.55  ? 325 GLU D O     1 
ATOM   5932 C  CB    . GLU D 1 325 ? 30.379  56.740  17.663  1.00 45.07  ? 325 GLU D CB    1 
ATOM   5933 C  CG    . GLU D 1 325 ? 31.892  56.678  17.754  1.00 44.84  ? 325 GLU D CG    1 
ATOM   5934 C  CD    . GLU D 1 325 ? 32.576  57.809  17.040  1.00 44.09  ? 325 GLU D CD    1 
ATOM   5935 O  OE1   . GLU D 1 325 ? 31.889  58.720  16.551  1.00 45.17  ? 325 GLU D OE1   1 
ATOM   5936 O  OE2   . GLU D 1 325 ? 33.809  57.799  16.970  1.00 45.08  ? 325 GLU D OE2   1 
ATOM   5937 N  N     . ASP D 1 326 ? 27.505  54.853  17.860  1.00 47.37  ? 326 ASP D N     1 
ATOM   5938 C  CA    . ASP D 1 326 ? 26.056  54.895  17.865  1.00 47.43  ? 326 ASP D CA    1 
ATOM   5939 C  C     . ASP D 1 326 ? 25.519  53.496  18.057  1.00 47.60  ? 326 ASP D C     1 
ATOM   5940 O  O     . ASP D 1 326 ? 25.875  52.597  17.304  1.00 46.37  ? 326 ASP D O     1 
ATOM   5941 C  CB    . ASP D 1 326 ? 25.533  55.468  16.561  1.00 47.13  ? 326 ASP D CB    1 
ATOM   5942 C  CG    . ASP D 1 326 ? 24.055  55.762  16.619  1.00 47.84  ? 326 ASP D CG    1 
ATOM   5943 O  OD1   . ASP D 1 326 ? 23.283  54.823  16.894  1.00 50.04  ? 326 ASP D OD1   1 
ATOM   5944 O  OD2   . ASP D 1 326 ? 23.667  56.928  16.406  1.00 46.22  ? 326 ASP D OD2   1 
ATOM   5945 N  N     . GLU D 1 327 ? 24.643  53.354  19.055  1.00 49.06  ? 327 GLU D N     1 
ATOM   5946 C  CA    . GLU D 1 327 ? 24.113  52.070  19.534  1.00 49.81  ? 327 GLU D CA    1 
ATOM   5947 C  C     . GLU D 1 327 ? 22.944  51.499  18.719  1.00 47.68  ? 327 GLU D C     1 
ATOM   5948 O  O     . GLU D 1 327 ? 22.664  50.304  18.806  1.00 45.47  ? 327 GLU D O     1 
ATOM   5949 C  CB    . GLU D 1 327 ? 23.642  52.223  20.989  1.00 52.50  ? 327 GLU D CB    1 
ATOM   5950 C  CG    . GLU D 1 327 ? 24.741  52.654  21.948  1.00 55.93  ? 327 GLU D CG    1 
ATOM   5951 C  CD    . GLU D 1 327 ? 24.305  52.651  23.409  1.00 58.88  ? 327 GLU D CD    1 
ATOM   5952 O  OE1   . GLU D 1 327 ? 23.078  52.599  23.679  1.00 61.92  ? 327 GLU D OE1   1 
ATOM   5953 O  OE2   . GLU D 1 327 ? 25.192  52.706  24.291  1.00 59.37  ? 327 GLU D OE2   1 
ATOM   5954 N  N     . ARG D 1 328 ? 22.257  52.336  17.939  1.00 47.95  ? 328 ARG D N     1 
ATOM   5955 C  CA    . ARG D 1 328 ? 21.083  51.864  17.177  1.00 47.64  ? 328 ARG D CA    1 
ATOM   5956 C  C     . ARG D 1 328 ? 21.470  50.980  16.025  1.00 44.30  ? 328 ARG D C     1 
ATOM   5957 O  O     . ARG D 1 328 ? 22.618  50.958  15.612  1.00 43.31  ? 328 ARG D O     1 
ATOM   5958 C  CB    . ARG D 1 328 ? 20.232  53.006  16.643  1.00 48.13  ? 328 ARG D CB    1 
ATOM   5959 C  CG    . ARG D 1 328 ? 19.705  53.927  17.730  1.00 49.65  ? 328 ARG D CG    1 
ATOM   5960 C  CD    . ARG D 1 328 ? 20.352  55.290  17.611  1.00 50.28  ? 328 ARG D CD    1 
ATOM   5961 N  NE    . ARG D 1 328 ? 19.442  56.271  17.054  1.00 49.35  ? 328 ARG D NE    1 
ATOM   5962 C  CZ    . ARG D 1 328 ? 19.804  57.363  16.391  1.00 49.26  ? 328 ARG D CZ    1 
ATOM   5963 N  NH1   . ARG D 1 328 ? 21.073  57.646  16.139  1.00 48.48  ? 328 ARG D NH1   1 
ATOM   5964 N  NH2   . ARG D 1 328 ? 18.867  58.185  15.961  1.00 50.70  ? 328 ARG D NH2   1 
ATOM   5965 N  N     . LYS D 1 329 ? 20.497  50.232  15.535  1.00 43.76  ? 329 LYS D N     1 
ATOM   5966 C  CA    . LYS D 1 329 ? 20.675  49.418  14.341  1.00 43.70  ? 329 LYS D CA    1 
ATOM   5967 C  C     . LYS D 1 329 ? 20.638  50.306  13.113  1.00 41.55  ? 329 LYS D C     1 
ATOM   5968 O  O     . LYS D 1 329 ? 20.139  51.423  13.157  1.00 40.53  ? 329 LYS D O     1 
ATOM   5969 C  CB    . LYS D 1 329 ? 19.588  48.353  14.232  1.00 45.72  ? 329 LYS D CB    1 
ATOM   5970 C  CG    . LYS D 1 329 ? 19.526  47.421  15.425  1.00 48.43  ? 329 LYS D CG    1 
ATOM   5971 C  CD    . LYS D 1 329 ? 18.416  46.406  15.253  1.00 49.70  ? 329 LYS D CD    1 
ATOM   5972 C  CE    . LYS D 1 329 ? 18.466  45.385  16.370  1.00 52.17  ? 329 LYS D CE    1 
ATOM   5973 N  NZ    . LYS D 1 329 ? 17.601  44.230  16.034  1.00 54.06  ? 329 LYS D NZ    1 
ATOM   5974 N  N     . ILE D 1 330 ? 21.195  49.790  12.028  1.00 40.82  ? 330 ILE D N     1 
ATOM   5975 C  CA    . ILE D 1 330 ? 21.304  50.504  10.780  1.00 39.78  ? 330 ILE D CA    1 
ATOM   5976 C  C     . ILE D 1 330 ? 20.330  49.843  9.829   1.00 40.35  ? 330 ILE D C     1 
ATOM   5977 O  O     . ILE D 1 330 ? 20.273  48.622  9.749   1.00 40.82  ? 330 ILE D O     1 
ATOM   5978 C  CB    . ILE D 1 330 ? 22.749  50.459  10.263  1.00 39.47  ? 330 ILE D CB    1 
ATOM   5979 C  CG1   . ILE D 1 330 ? 23.620  51.317  11.193  1.00 39.98  ? 330 ILE D CG1   1 
ATOM   5980 C  CG2   . ILE D 1 330 ? 22.856  50.971  8.838   1.00 38.22  ? 330 ILE D CG2   1 
ATOM   5981 C  CD1   . ILE D 1 330 ? 25.102  51.197  10.932  1.00 40.62  ? 330 ILE D CD1   1 
ATOM   5982 N  N     . ARG D 1 331 ? 19.547  50.673  9.153   1.00 40.34  ? 331 ARG D N     1 
ATOM   5983 C  CA    . ARG D 1 331 ? 18.511  50.236  8.216   1.00 41.75  ? 331 ARG D CA    1 
ATOM   5984 C  C     . ARG D 1 331 ? 19.000  50.423  6.777   1.00 39.23  ? 331 ARG D C     1 
ATOM   5985 O  O     . ARG D 1 331 ? 18.792  49.558  5.920   1.00 36.47  ? 331 ARG D O     1 
ATOM   5986 C  CB    . ARG D 1 331 ? 17.234  51.055  8.471   1.00 43.63  ? 331 ARG D CB    1 
ATOM   5987 C  CG    . ARG D 1 331 ? 16.117  50.909  7.443   1.00 44.65  ? 331 ARG D CG    1 
ATOM   5988 C  CD    . ARG D 1 331 ? 14.782  51.380  8.023   1.00 45.69  ? 331 ARG D CD    1 
ATOM   5989 N  NE    . ARG D 1 331 ? 13.713  51.329  7.025   1.00 47.39  ? 331 ARG D NE    1 
ATOM   5990 C  CZ    . ARG D 1 331 ? 12.411  51.163  7.285   1.00 50.76  ? 331 ARG D CZ    1 
ATOM   5991 N  NH1   . ARG D 1 331 ? 11.958  51.019  8.538   1.00 50.99  ? 331 ARG D NH1   1 
ATOM   5992 N  NH2   . ARG D 1 331 ? 11.537  51.135  6.276   1.00 51.50  ? 331 ARG D NH2   1 
ATOM   5993 N  N     . ARG D 1 332 ? 19.661  51.552  6.525   1.00 38.42  ? 332 ARG D N     1 
ATOM   5994 C  CA    . ARG D 1 332 ? 20.262  51.822  5.219   1.00 37.89  ? 332 ARG D CA    1 
ATOM   5995 C  C     . ARG D 1 332 ? 21.733  52.207  5.387   1.00 35.46  ? 332 ARG D C     1 
ATOM   5996 O  O     . ARG D 1 332 ? 22.114  52.843  6.368   1.00 34.58  ? 332 ARG D O     1 
ATOM   5997 C  CB    . ARG D 1 332 ? 19.501  52.939  4.483   1.00 39.87  ? 332 ARG D CB    1 
ATOM   5998 C  CG    . ARG D 1 332 ? 17.992  52.893  4.656   1.00 43.40  ? 332 ARG D CG    1 
ATOM   5999 C  CD    . ARG D 1 332 ? 17.208  53.819  3.718   1.00 46.54  ? 332 ARG D CD    1 
ATOM   6000 N  NE    . ARG D 1 332 ? 15.780  53.474  3.807   1.00 53.06  ? 332 ARG D NE    1 
ATOM   6001 C  CZ    . ARG D 1 332 ? 14.807  54.222  4.344   1.00 55.28  ? 332 ARG D CZ    1 
ATOM   6002 N  NH1   . ARG D 1 332 ? 15.037  55.451  4.808   1.00 59.47  ? 332 ARG D NH1   1 
ATOM   6003 N  NH2   . ARG D 1 332 ? 13.565  53.746  4.373   1.00 54.28  ? 332 ARG D NH2   1 
ATOM   6004 N  N     . ILE D 1 333 ? 22.548  51.818  4.417   1.00 34.55  ? 333 ILE D N     1 
ATOM   6005 C  CA    . ILE D 1 333 ? 23.986  52.097  4.444   1.00 34.26  ? 333 ILE D CA    1 
ATOM   6006 C  C     . ILE D 1 333 ? 24.450  52.630  3.089   1.00 33.63  ? 333 ILE D C     1 
ATOM   6007 O  O     . ILE D 1 333 ? 24.090  52.086  2.052   1.00 33.02  ? 333 ILE D O     1 
ATOM   6008 C  CB    . ILE D 1 333 ? 24.789  50.836  4.848   1.00 34.74  ? 333 ILE D CB    1 
ATOM   6009 C  CG1   . ILE D 1 333 ? 26.263  51.194  5.086   1.00 35.04  ? 333 ILE D CG1   1 
ATOM   6010 C  CG2   . ILE D 1 333 ? 24.626  49.710  3.821   1.00 34.10  ? 333 ILE D CG2   1 
ATOM   6011 C  CD1   . ILE D 1 333 ? 26.467  52.188  6.212   1.00 35.40  ? 333 ILE D CD1   1 
ATOM   6012 N  N     . GLY D 1 334 ? 25.251  53.693  3.096   1.00 33.34  ? 334 GLY D N     1 
ATOM   6013 C  CA    . GLY D 1 334 ? 25.735  54.267  1.838   1.00 33.66  ? 334 GLY D CA    1 
ATOM   6014 C  C     . GLY D 1 334 ? 27.070  54.996  1.899   1.00 34.02  ? 334 GLY D C     1 
ATOM   6015 O  O     . GLY D 1 334 ? 27.726  55.043  2.936   1.00 32.78  ? 334 GLY D O     1 
ATOM   6016 N  N     . VAL D 1 335 ? 27.438  55.601  0.776   1.00 31.84  ? 335 VAL D N     1 
ATOM   6017 C  CA    . VAL D 1 335 ? 28.710  56.257  0.637   1.00 31.81  ? 335 VAL D CA    1 
ATOM   6018 C  C     . VAL D 1 335 ? 28.607  57.457  -0.279  1.00 31.76  ? 335 VAL D C     1 
ATOM   6019 O  O     . VAL D 1 335 ? 27.879  57.418  -1.267  1.00 34.67  ? 335 VAL D O     1 
ATOM   6020 C  CB    . VAL D 1 335 ? 29.719  55.278  0.044   1.00 31.90  ? 335 VAL D CB    1 
ATOM   6021 C  CG1   . VAL D 1 335 ? 29.364  54.946  -1.407  1.00 32.12  ? 335 VAL D CG1   1 
ATOM   6022 C  CG2   . VAL D 1 335 ? 31.112  55.839  0.144   1.00 32.76  ? 335 VAL D CG2   1 
ATOM   6023 N  N     . ARG D 1 336 ? 29.357  58.507  0.018   1.00 33.08  ? 336 ARG D N     1 
ATOM   6024 C  CA    . ARG D 1 336 ? 29.390  59.687  -0.831  1.00 35.42  ? 336 ARG D CA    1 
ATOM   6025 C  C     . ARG D 1 336 ? 30.828  60.125  -1.073  1.00 35.37  ? 336 ARG D C     1 
ATOM   6026 O  O     . ARG D 1 336 ? 31.626  60.181  -0.152  1.00 38.03  ? 336 ARG D O     1 
ATOM   6027 C  CB    . ARG D 1 336 ? 28.563  60.832  -0.221  1.00 36.77  ? 336 ARG D CB    1 
ATOM   6028 C  CG    . ARG D 1 336 ? 28.402  62.021  -1.170  1.00 39.63  ? 336 ARG D CG    1 
ATOM   6029 C  CD    . ARG D 1 336 ? 27.047  62.719  -1.045  1.00 42.02  ? 336 ARG D CD    1 
ATOM   6030 N  NE    . ARG D 1 336 ? 25.969  61.914  -1.636  1.00 44.52  ? 336 ARG D NE    1 
ATOM   6031 C  CZ    . ARG D 1 336 ? 25.561  61.963  -2.911  1.00 47.16  ? 336 ARG D CZ    1 
ATOM   6032 N  NH1   . ARG D 1 336 ? 26.111  62.793  -3.805  1.00 45.63  ? 336 ARG D NH1   1 
ATOM   6033 N  NH2   . ARG D 1 336 ? 24.584  61.154  -3.306  1.00 47.99  ? 336 ARG D NH2   1 
ATOM   6034 N  N     . PHE D 1 337 ? 31.141  60.442  -2.322  1.00 33.75  ? 337 PHE D N     1 
ATOM   6035 C  CA    . PHE D 1 337 ? 32.475  60.829  -2.708  1.00 33.82  ? 337 PHE D CA    1 
ATOM   6036 C  C     . PHE D 1 337 ? 32.456  62.275  -3.135  1.00 34.05  ? 337 PHE D C     1 
ATOM   6037 O  O     . PHE D 1 337 ? 31.498  62.725  -3.738  1.00 34.51  ? 337 PHE D O     1 
ATOM   6038 C  CB    . PHE D 1 337 ? 32.961  59.939  -3.842  1.00 33.34  ? 337 PHE D CB    1 
ATOM   6039 C  CG    . PHE D 1 337 ? 33.247  58.536  -3.407  1.00 32.54  ? 337 PHE D CG    1 
ATOM   6040 C  CD1   . PHE D 1 337 ? 34.435  58.234  -2.765  1.00 33.22  ? 337 PHE D CD1   1 
ATOM   6041 C  CD2   . PHE D 1 337 ? 32.321  57.529  -3.606  1.00 31.86  ? 337 PHE D CD2   1 
ATOM   6042 C  CE1   . PHE D 1 337 ? 34.706  56.944  -2.333  1.00 33.07  ? 337 PHE D CE1   1 
ATOM   6043 C  CE2   . PHE D 1 337 ? 32.587  56.235  -3.169  1.00 32.68  ? 337 PHE D CE2   1 
ATOM   6044 C  CZ    . PHE D 1 337 ? 33.787  55.949  -2.538  1.00 32.65  ? 337 PHE D CZ    1 
ATOM   6045 N  N     . SER D 1 338 ? 33.503  63.003  -2.787  1.00 34.24  ? 338 SER D N     1 
ATOM   6046 C  CA    . SER D 1 338 ? 33.575  64.434  -3.075  1.00 35.01  ? 338 SER D CA    1 
ATOM   6047 C  C     . SER D 1 338 ? 35.014  64.928  -3.180  1.00 35.95  ? 338 SER D C     1 
ATOM   6048 O  O     . SER D 1 338 ? 35.976  64.146  -3.020  1.00 34.62  ? 338 SER D O     1 
ATOM   6049 C  CB    . SER D 1 338 ? 32.831  65.222  -1.999  1.00 35.13  ? 338 SER D CB    1 
ATOM   6050 O  OG    . SER D 1 338 ? 33.371  64.963  -0.721  1.00 36.02  ? 338 SER D OG    1 
ATOM   6051 N  N     . LYS D 1 339 ? 35.134  66.231  -3.456  1.00 36.93  ? 339 LYS D N     1 
ATOM   6052 C  CA    . LYS D 1 339 ? 36.401  66.924  -3.620  1.00 39.08  ? 339 LYS D CA    1 
ATOM   6053 C  C     . LYS D 1 339 ? 37.237  66.257  -4.692  1.00 40.57  ? 339 LYS D C     1 
ATOM   6054 O  O     . LYS D 1 339 ? 38.293  65.679  -4.422  1.00 40.89  ? 339 LYS D O     1 
ATOM   6055 C  CB    . LYS D 1 339 ? 37.158  67.019  -2.292  1.00 40.06  ? 339 LYS D CB    1 
ATOM   6056 C  CG    . LYS D 1 339 ? 36.350  67.728  -1.206  1.00 42.20  ? 339 LYS D CG    1 
ATOM   6057 C  CD    . LYS D 1 339 ? 37.176  67.905  0.054   1.00 43.45  ? 339 LYS D CD    1 
ATOM   6058 C  CE    . LYS D 1 339 ? 36.328  67.940  1.311   1.00 45.34  ? 339 LYS D CE    1 
ATOM   6059 N  NZ    . LYS D 1 339 ? 37.192  67.897  2.522   1.00 46.09  ? 339 LYS D NZ    1 
ATOM   6060 N  N     . PHE D 1 340 ? 36.752  66.344  -5.917  1.00 42.35  ? 340 PHE D N     1 
ATOM   6061 C  CA    . PHE D 1 340 ? 37.423  65.720  -7.036  1.00 46.97  ? 340 PHE D CA    1 
ATOM   6062 C  C     . PHE D 1 340 ? 38.649  66.524  -7.440  1.00 51.28  ? 340 PHE D C     1 
ATOM   6063 O  O     . PHE D 1 340 ? 38.702  67.743  -7.230  1.00 51.03  ? 340 PHE D O     1 
ATOM   6064 C  CB    . PHE D 1 340 ? 36.454  65.551  -8.191  1.00 48.18  ? 340 PHE D CB    1 
ATOM   6065 C  CG    . PHE D 1 340 ? 35.233  64.779  -7.812  1.00 48.31  ? 340 PHE D CG    1 
ATOM   6066 C  CD1   . PHE D 1 340 ? 35.350  63.479  -7.346  1.00 49.09  ? 340 PHE D CD1   1 
ATOM   6067 C  CD2   . PHE D 1 340 ? 33.981  65.353  -7.869  1.00 48.08  ? 340 PHE D CD2   1 
ATOM   6068 C  CE1   . PHE D 1 340 ? 34.232  62.759  -6.965  1.00 48.98  ? 340 PHE D CE1   1 
ATOM   6069 C  CE2   . PHE D 1 340 ? 32.859  64.634  -7.493  1.00 48.02  ? 340 PHE D CE2   1 
ATOM   6070 C  CZ    . PHE D 1 340 ? 32.983  63.338  -7.040  1.00 47.38  ? 340 PHE D CZ    1 
ATOM   6071 N  N     . ILE D 1 341 ? 39.651  65.818  -7.959  1.00 53.49  ? 341 ILE D N     1 
ATOM   6072 C  CA    . ILE D 1 341 ? 40.839  66.453  -8.513  1.00 55.50  ? 341 ILE D CA    1 
ATOM   6073 C  C     . ILE D 1 341 ? 40.453  66.923  -9.902  1.00 59.11  ? 341 ILE D C     1 
ATOM   6074 O  O     . ILE D 1 341 ? 39.786  66.199  -10.641 1.00 57.82  ? 341 ILE D O     1 
ATOM   6075 C  CB    . ILE D 1 341 ? 42.044  65.486  -8.594  1.00 55.24  ? 341 ILE D CB    1 
ATOM   6076 C  CG1   . ILE D 1 341 ? 42.424  64.991  -7.196  1.00 53.69  ? 341 ILE D CG1   1 
ATOM   6077 C  CG2   . ILE D 1 341 ? 43.250  66.179  -9.232  1.00 54.19  ? 341 ILE D CG2   1 
ATOM   6078 C  CD1   . ILE D 1 341 ? 43.242  63.720  -7.204  1.00 55.29  ? 341 ILE D CD1   1 
ATOM   6079 N  N     . GLU D 1 342 ? 40.874  68.137  -10.243 1.00 65.02  ? 342 GLU D N     1 
ATOM   6080 C  CA    . GLU D 1 342 ? 40.490  68.783  -11.499 1.00 68.31  ? 342 GLU D CA    1 
ATOM   6081 C  C     . GLU D 1 342 ? 41.067  68.075  -12.723 1.00 65.62  ? 342 GLU D C     1 
ATOM   6082 O  O     . GLU D 1 342 ? 42.277  68.069  -12.931 1.00 66.66  ? 342 GLU D O     1 
ATOM   6083 C  CB    . GLU D 1 342 ? 40.948  70.243  -11.484 1.00 72.20  ? 342 GLU D CB    1 
ATOM   6084 C  CG    . GLU D 1 342 ? 40.255  71.101  -10.429 1.00 73.90  ? 342 GLU D CG    1 
ATOM   6085 C  CD    . GLU D 1 342 ? 41.059  72.337  -10.048 1.00 77.66  ? 342 GLU D CD    1 
ATOM   6086 O  OE1   . GLU D 1 342 ? 41.791  72.885  -10.908 1.00 78.87  ? 342 GLU D OE1   1 
ATOM   6087 O  OE2   . GLU D 1 342 ? 40.956  72.762  -8.879  1.00 78.01  ? 342 GLU D OE2   1 
ATOM   6088 P  P     . DT  E 2 1   ? -0.580  54.856  8.085   1.00 106.79 ? 1   DT  E P     1 
ATOM   6089 O  OP1   . DT  E 2 1   ? -1.296  56.094  7.691   1.00 106.81 ? 1   DT  E OP1   1 
ATOM   6090 O  OP2   . DT  E 2 1   ? -1.184  53.952  9.100   1.00 110.25 ? 1   DT  E OP2   1 
ATOM   6091 O  "O5'" . DT  E 2 1   ? 0.947   55.157  8.438   1.00 108.17 ? 1   DT  E "O5'" 1 
ATOM   6092 C  "C5'" . DT  E 2 1   ? 1.565   56.431  8.148   1.00 107.91 ? 1   DT  E "C5'" 1 
ATOM   6093 C  "C4'" . DT  E 2 1   ? 1.879   57.172  9.428   1.00 111.58 ? 1   DT  E "C4'" 1 
ATOM   6094 O  "O4'" . DT  E 2 1   ? 0.650   57.455  10.133  1.00 116.56 ? 1   DT  E "O4'" 1 
ATOM   6095 C  "C3'" . DT  E 2 1   ? 2.747   56.405  10.423  1.00 113.02 ? 1   DT  E "C3'" 1 
ATOM   6096 O  "O3'" . DT  E 2 1   ? 4.139   56.668  10.197  1.00 109.51 ? 1   DT  E "O3'" 1 
ATOM   6097 C  "C2'" . DT  E 2 1   ? 2.280   56.917  11.778  1.00 116.69 ? 1   DT  E "C2'" 1 
ATOM   6098 C  "C1'" . DT  E 2 1   ? 0.900   57.534  11.530  1.00 118.91 ? 1   DT  E "C1'" 1 
ATOM   6099 N  N1    . DT  E 2 1   ? -0.222  56.872  12.237  1.00 122.93 ? 1   DT  E N1    1 
ATOM   6100 C  C2    . DT  E 2 1   ? -0.245  56.938  13.612  1.00 126.83 ? 1   DT  E C2    1 
ATOM   6101 O  O2    . DT  E 2 1   ? 0.615   57.505  14.267  1.00 128.64 ? 1   DT  E O2    1 
ATOM   6102 N  N3    . DT  E 2 1   ? -1.316  56.306  14.198  1.00 129.78 ? 1   DT  E N3    1 
ATOM   6103 C  C4    . DT  E 2 1   ? -2.341  55.634  13.559  1.00 130.53 ? 1   DT  E C4    1 
ATOM   6104 O  O4    . DT  E 2 1   ? -3.237  55.113  14.218  1.00 133.99 ? 1   DT  E O4    1 
ATOM   6105 C  C5    . DT  E 2 1   ? -2.256  55.609  12.115  1.00 127.06 ? 1   DT  E C5    1 
ATOM   6106 C  C7    . DT  E 2 1   ? -3.323  54.906  11.336  1.00 125.79 ? 1   DT  E C7    1 
ATOM   6107 C  C6    . DT  E 2 1   ? -1.216  56.222  11.535  1.00 123.83 ? 1   DT  E C6    1 
ATOM   6108 P  P     . DT  E 2 2   ? 5.100   55.502  9.644   1.00 108.65 ? 2   DT  E P     1 
ATOM   6109 O  OP1   . DT  E 2 2   ? 4.471   54.940  8.416   1.00 106.09 ? 2   DT  E OP1   1 
ATOM   6110 O  OP2   . DT  E 2 2   ? 5.410   54.598  10.784  1.00 107.89 ? 2   DT  E OP2   1 
ATOM   6111 O  "O5'" . DT  E 2 2   ? 6.445   56.276  9.263   1.00 98.60  ? 2   DT  E "O5'" 1 
ATOM   6112 C  "C5'" . DT  E 2 2   ? 7.075   56.160  7.961   1.00 88.88  ? 2   DT  E "C5'" 1 
ATOM   6113 C  "C4'" . DT  E 2 2   ? 8.145   55.090  7.963   1.00 84.42  ? 2   DT  E "C4'" 1 
ATOM   6114 O  "O4'" . DT  E 2 2   ? 8.743   54.986  9.276   1.00 87.77  ? 2   DT  E "O4'" 1 
ATOM   6115 C  "C3'" . DT  E 2 2   ? 7.649   53.684  7.607   1.00 83.05  ? 2   DT  E "C3'" 1 
ATOM   6116 O  "O3'" . DT  E 2 2   ? 8.141   53.226  6.344   1.00 73.86  ? 2   DT  E "O3'" 1 
ATOM   6117 C  "C2'" . DT  E 2 2   ? 8.149   52.796  8.737   1.00 86.98  ? 2   DT  E "C2'" 1 
ATOM   6118 C  "C1'" . DT  E 2 2   ? 9.168   53.649  9.474   1.00 89.57  ? 2   DT  E "C1'" 1 
ATOM   6119 N  N1    . DT  E 2 2   ? 9.255   53.394  10.937  1.00 94.32  ? 2   DT  E N1    1 
ATOM   6120 C  C2    . DT  E 2 2   ? 9.763   54.379  11.757  1.00 94.97  ? 2   DT  E C2    1 
ATOM   6121 O  O2    . DT  E 2 2   ? 10.127  55.469  11.346  1.00 91.87  ? 2   DT  E O2    1 
ATOM   6122 N  N3    . DT  E 2 2   ? 9.814   54.045  13.089  1.00 98.81  ? 2   DT  E N3    1 
ATOM   6123 C  C4    . DT  E 2 2   ? 9.421   52.850  13.668  1.00 101.69 ? 2   DT  E C4    1 
ATOM   6124 O  O4    . DT  E 2 2   ? 9.525   52.694  14.882  1.00 105.08 ? 2   DT  E O4    1 
ATOM   6125 C  C5    . DT  E 2 2   ? 8.908   51.860  12.749  1.00 100.26 ? 2   DT  E C5    1 
ATOM   6126 C  C7    . DT  E 2 2   ? 8.463   50.535  13.283  1.00 102.30 ? 2   DT  E C7    1 
ATOM   6127 C  C6    . DT  E 2 2   ? 8.857   52.174  11.447  1.00 97.10  ? 2   DT  E C6    1 
ATOM   6128 P  P     . DG  E 2 3   ? 7.461   51.964  5.640   1.00 69.28  ? 3   DG  E P     1 
ATOM   6129 O  OP1   . DG  E 2 3   ? 6.058   52.319  5.292   1.00 67.18  ? 3   DG  E OP1   1 
ATOM   6130 O  OP2   . DG  E 2 3   ? 7.737   50.764  6.458   1.00 71.85  ? 3   DG  E OP2   1 
ATOM   6131 O  "O5'" . DG  E 2 3   ? 8.330   51.781  4.320   1.00 66.26  ? 3   DG  E "O5'" 1 
ATOM   6132 C  "C5'" . DG  E 2 3   ? 8.296   52.752  3.270   1.00 60.83  ? 3   DG  E "C5'" 1 
ATOM   6133 C  "C4'" . DG  E 2 3   ? 9.204   52.285  2.160   1.00 59.49  ? 3   DG  E "C4'" 1 
ATOM   6134 O  "O4'" . DG  E 2 3   ? 9.024   53.122  0.997   1.00 56.49  ? 3   DG  E "O4'" 1 
ATOM   6135 C  "C3'" . DG  E 2 3   ? 10.689  52.374  2.491   1.00 59.17  ? 3   DG  E "C3'" 1 
ATOM   6136 O  "O3'" . DG  E 2 3   ? 11.363  51.339  1.752   1.00 60.56  ? 3   DG  E "O3'" 1 
ATOM   6137 C  "C2'" . DG  E 2 3   ? 11.026  53.792  2.063   1.00 56.08  ? 3   DG  E "C2'" 1 
ATOM   6138 C  "C1'" . DG  E 2 3   ? 10.178  53.940  0.803   1.00 54.09  ? 3   DG  E "C1'" 1 
ATOM   6139 N  N9    . DG  E 2 3   ? 9.703   55.271  0.441   1.00 51.45  ? 3   DG  E N9    1 
ATOM   6140 C  C8    . DG  E 2 3   ? 9.079   56.190  1.251   1.00 51.17  ? 3   DG  E C8    1 
ATOM   6141 N  N7    . DG  E 2 3   ? 8.680   57.253  0.605   1.00 49.53  ? 3   DG  E N7    1 
ATOM   6142 C  C5    . DG  E 2 3   ? 9.031   57.004  -0.715  1.00 48.47  ? 3   DG  E C5    1 
ATOM   6143 C  C6    . DG  E 2 3   ? 8.853   57.798  -1.883  1.00 46.42  ? 3   DG  E C6    1 
ATOM   6144 O  O6    . DG  E 2 3   ? 8.316   58.906  -1.988  1.00 45.02  ? 3   DG  E O6    1 
ATOM   6145 N  N1    . DG  E 2 3   ? 9.351   57.160  -3.016  1.00 43.98  ? 3   DG  E N1    1 
ATOM   6146 C  C2    . DG  E 2 3   ? 9.951   55.923  -3.027  1.00 45.72  ? 3   DG  E C2    1 
ATOM   6147 N  N2    . DG  E 2 3   ? 10.383  55.480  -4.220  1.00 44.15  ? 3   DG  E N2    1 
ATOM   6148 N  N3    . DG  E 2 3   ? 10.120  55.176  -1.948  1.00 48.08  ? 3   DG  E N3    1 
ATOM   6149 C  C4    . DG  E 2 3   ? 9.648   55.777  -0.835  1.00 49.00  ? 3   DG  E C4    1 
ATOM   6150 P  P     . DC  E 2 4   ? 12.741  50.710  2.289   1.00 59.84  ? 4   DC  E P     1 
ATOM   6151 O  OP1   . DC  E 2 4   ? 12.484  50.135  3.635   1.00 63.14  ? 4   DC  E OP1   1 
ATOM   6152 O  OP2   . DC  E 2 4   ? 13.783  51.749  2.143   1.00 57.71  ? 4   DC  E OP2   1 
ATOM   6153 O  "O5'" . DC  E 2 4   ? 13.049  49.557  1.228   1.00 60.75  ? 4   DC  E "O5'" 1 
ATOM   6154 C  "C5'" . DC  E 2 4   ? 12.541  48.215  1.378   1.00 65.36  ? 4   DC  E "C5'" 1 
ATOM   6155 C  "C4'" . DC  E 2 4   ? 13.082  47.314  0.289   1.00 68.01  ? 4   DC  E "C4'" 1 
ATOM   6156 O  "O4'" . DC  E 2 4   ? 12.573  45.967  0.459   1.00 72.16  ? 4   DC  E "O4'" 1 
ATOM   6157 C  "C3'" . DC  E 2 4   ? 12.716  47.737  -1.142  1.00 67.76  ? 4   DC  E "C3'" 1 
ATOM   6158 O  "O3'" . DC  E 2 4   ? 13.872  47.931  -1.971  1.00 67.42  ? 4   DC  E "O3'" 1 
ATOM   6159 C  "C2'" . DC  E 2 4   ? 11.853  46.599  -1.668  1.00 70.34  ? 4   DC  E "C2'" 1 
ATOM   6160 C  "C1'" . DC  E 2 4   ? 12.291  45.415  -0.818  1.00 73.92  ? 4   DC  E "C1'" 1 
ATOM   6161 N  N1    . DC  E 2 4   ? 11.289  44.342  -0.645  1.00 79.17  ? 4   DC  E N1    1 
ATOM   6162 C  C2    . DC  E 2 4   ? 11.538  43.331  0.291   1.00 82.92  ? 4   DC  E C2    1 
ATOM   6163 O  O2    . DC  E 2 4   ? 12.586  43.371  0.953   1.00 83.58  ? 4   DC  E O2    1 
ATOM   6164 N  N3    . DC  E 2 4   ? 10.629  42.340  0.452   1.00 85.87  ? 4   DC  E N3    1 
ATOM   6165 C  C4    . DC  E 2 4   ? 9.512   42.333  -0.280  1.00 85.00  ? 4   DC  E C4    1 
ATOM   6166 N  N4    . DC  E 2 4   ? 8.645   41.338  -0.088  1.00 87.81  ? 4   DC  E N4    1 
ATOM   6167 C  C5    . DC  E 2 4   ? 9.239   43.344  -1.246  1.00 82.85  ? 4   DC  E C5    1 
ATOM   6168 C  C6    . DC  E 2 4   ? 10.147  44.316  -1.399  1.00 80.16  ? 4   DC  E C6    1 
HETATM 6169 C  C2    . 2JV E 2 5   ? 12.067  58.620  -0.426  1.00 49.98  ? 5   2JV E C2    1 
HETATM 6170 C  C5    . 2JV E 2 5   ? 13.254  56.755  1.244   1.00 52.15  ? 5   2JV E C5    1 
HETATM 6171 C  C6    . 2JV E 2 5   ? 12.729  58.038  1.763   1.00 53.06  ? 5   2JV E C6    1 
HETATM 6172 C  C4    . 2JV E 2 5   ? 13.115  56.513  -0.190  1.00 51.38  ? 5   2JV E C4    1 
HETATM 6173 O  O6    . 2JV E 2 5   ? 12.817  58.319  2.980   1.00 55.76  ? 5   2JV E O6    1 
HETATM 6174 N  N7    . 2JV E 2 5   ? 13.866  55.673  1.751   1.00 53.60  ? 5   2JV E N7    1 
HETATM 6175 C  C8    . 2JV E 2 5   ? 14.106  54.804  0.739   1.00 54.15  ? 5   2JV E C8    1 
HETATM 6176 N  N9    . 2JV E 2 5   ? 13.656  55.319  -0.420  1.00 53.32  ? 5   2JV E N9    1 
HETATM 6177 C  CAQ   . 2JV E 2 5   ? 13.712  54.676  -1.745  1.00 54.24  ? 5   2JV E CAQ   1 
HETATM 6178 O  OAP   . 2JV E 2 5   ? 12.886  53.524  -1.674  1.00 56.58  ? 5   2JV E OAP   1 
HETATM 6179 C  CAR   . 2JV E 2 5   ? 15.081  54.177  -2.172  1.00 54.91  ? 5   2JV E CAR   1 
HETATM 6180 C  CAT   . 2JV E 2 5   ? 14.740  52.975  -3.038  1.00 56.25  ? 5   2JV E CAT   1 
HETATM 6181 O  OAS   . 2JV E 2 5   ? 14.474  53.297  -4.420  1.00 56.83  ? 5   2JV E OAS   1 
HETATM 6182 C  CAU   . 2JV E 2 5   ? 13.468  52.435  -2.405  1.00 58.86  ? 5   2JV E CAU   1 
HETATM 6183 C  CAV   . 2JV E 2 5   ? 13.717  51.260  -1.465  1.00 61.88  ? 5   2JV E CAV   1 
HETATM 6184 O  OAB   . 2JV E 2 5   ? 14.853  50.509  -1.896  1.00 64.97  ? 5   2JV E OAB   1 
HETATM 6185 P  PAD   . 2JV E 2 5   ? 14.698  49.043  -2.533  1.00 64.70  ? 5   2JV E PAD   1 
HETATM 6186 O  OAC   . 2JV E 2 5   ? 14.057  49.122  -3.863  1.00 64.02  ? 5   2JV E OAC   1 
HETATM 6187 O  OAA   . 2JV E 2 5   ? 16.151  48.386  -2.668  1.00 68.93  ? 5   2JV E OAA   1 
HETATM 6188 N  N1    . 2JV E 2 5   ? 12.168  58.896  0.896   1.00 51.61  ? 5   2JV E N1    1 
HETATM 6189 N  N3    . 2JV E 2 5   ? 12.524  57.457  -0.958  1.00 49.76  ? 5   2JV E N3    1 
HETATM 6190 N  N2    . 2JV E 2 5   ? 11.565  59.601  -1.216  1.00 49.15  ? 5   2JV E N2    1 
HETATM 6191 C  CBD   . 2JV E 2 5   ? 11.769  59.774  -2.565  1.00 46.99  ? 5   2JV E CBD   1 
HETATM 6192 C  CBC   . 2JV E 2 5   ? 11.114  60.844  -3.213  1.00 45.46  ? 5   2JV E CBC   1 
HETATM 6193 C  CAX   . 2JV E 2 5   ? 11.265  61.023  -4.594  1.00 43.63  ? 5   2JV E CAX   1 
HETATM 6194 C  CBG   . 2JV E 2 5   ? 12.066  60.151  -5.345  1.00 43.61  ? 5   2JV E CBG   1 
HETATM 6195 C  CBF   . 2JV E 2 5   ? 12.720  59.104  -4.711  1.00 44.88  ? 5   2JV E CBF   1 
HETATM 6196 C  CBE   . 2JV E 2 5   ? 12.579  58.922  -3.336  1.00 46.35  ? 5   2JV E CBE   1 
HETATM 6197 C  CBB   . 2JV E 2 5   ? 10.297  61.739  -2.493  1.00 46.49  ? 5   2JV E CBB   1 
HETATM 6198 C  CBA   . 2JV E 2 5   ? 9.651   62.781  -3.139  1.00 46.29  ? 5   2JV E CBA   1 
HETATM 6199 C  CAZ   . 2JV E 2 5   ? 9.815   62.959  -4.519  1.00 45.76  ? 5   2JV E CAZ   1 
HETATM 6200 C  CAY   . 2JV E 2 5   ? 10.618  62.074  -5.242  1.00 44.11  ? 5   2JV E CAY   1 
HETATM 6201 C  CBM   . 2JV E 2 5   ? 9.165   63.997  -5.193  1.00 46.97  ? 5   2JV E CBM   1 
HETATM 6202 N  NAW   . 2JV E 2 5   ? 8.365   64.891  -4.544  1.00 49.90  ? 5   2JV E NAW   1 
HETATM 6203 C  CBL   . 2JV E 2 5   ? 9.327   64.147  -6.570  1.00 45.81  ? 5   2JV E CBL   1 
HETATM 6204 C  CBK   . 2JV E 2 5   ? 10.130  63.271  -7.286  1.00 44.38  ? 5   2JV E CBK   1 
HETATM 6205 C  CBJ   . 2JV E 2 5   ? 10.777  62.236  -6.628  1.00 43.94  ? 5   2JV E CBJ   1 
HETATM 6206 C  CBI   . 2JV E 2 5   ? 11.575  61.360  -7.369  1.00 42.61  ? 5   2JV E CBI   1 
HETATM 6207 C  CBH   . 2JV E 2 5   ? 12.223  60.312  -6.722  1.00 42.53  ? 5   2JV E CBH   1 
ATOM   6208 P  P     . DG  E 2 6   ? 15.209  53.684  -5.659  1.00 57.10  ? 6   DG  E P     1 
ATOM   6209 O  OP1   . DG  E 2 6   ? 16.172  52.621  -6.037  1.00 57.90  ? 6   DG  E OP1   1 
ATOM   6210 O  OP2   . DG  E 2 6   ? 14.326  54.278  -6.702  1.00 55.35  ? 6   DG  E OP2   1 
ATOM   6211 O  "O5'" . DG  E 2 6   ? 16.095  54.890  -5.118  1.00 56.64  ? 6   DG  E "O5'" 1 
ATOM   6212 C  "C5'" . DG  E 2 6   ? 15.637  56.240  -5.256  1.00 59.64  ? 6   DG  E "C5'" 1 
ATOM   6213 C  "C4'" . DG  E 2 6   ? 16.803  57.197  -5.224  1.00 62.24  ? 6   DG  E "C4'" 1 
ATOM   6214 O  "O4'" . DG  E 2 6   ? 16.293  58.487  -4.809  1.00 62.79  ? 6   DG  E "O4'" 1 
ATOM   6215 C  "C3'" . DG  E 2 6   ? 17.902  56.860  -4.212  1.00 65.10  ? 6   DG  E "C3'" 1 
ATOM   6216 O  "O3'" . DG  E 2 6   ? 19.090  57.567  -4.593  1.00 67.48  ? 6   DG  E "O3'" 1 
ATOM   6217 C  "C2'" . DG  E 2 6   ? 17.385  57.537  -2.958  1.00 63.97  ? 6   DG  E "C2'" 1 
ATOM   6218 C  "C1'" . DG  E 2 6   ? 16.922  58.844  -3.582  1.00 60.93  ? 6   DG  E "C1'" 1 
ATOM   6219 N  N9    . DG  E 2 6   ? 16.008  59.693  -2.828  1.00 56.94  ? 6   DG  E N9    1 
ATOM   6220 C  C8    . DG  E 2 6   ? 15.640  59.589  -1.508  1.00 56.61  ? 6   DG  E C8    1 
ATOM   6221 N  N7    . DG  E 2 6   ? 14.836  60.544  -1.125  1.00 54.76  ? 6   DG  E N7    1 
ATOM   6222 C  C5    . DG  E 2 6   ? 14.676  61.332  -2.257  1.00 55.91  ? 6   DG  E C5    1 
ATOM   6223 C  C6    . DG  E 2 6   ? 13.915  62.514  -2.456  1.00 56.41  ? 6   DG  E C6    1 
ATOM   6224 O  O6    . DG  E 2 6   ? 13.210  63.122  -1.645  1.00 58.29  ? 6   DG  E O6    1 
ATOM   6225 N  N1    . DG  E 2 6   ? 14.040  62.989  -3.759  1.00 54.37  ? 6   DG  E N1    1 
ATOM   6226 C  C2    . DG  E 2 6   ? 14.795  62.404  -4.743  1.00 54.03  ? 6   DG  E C2    1 
ATOM   6227 N  N2    . DG  E 2 6   ? 14.786  63.014  -5.938  1.00 53.90  ? 6   DG  E N2    1 
ATOM   6228 N  N3    . DG  E 2 6   ? 15.501  61.299  -4.573  1.00 53.59  ? 6   DG  E N3    1 
ATOM   6229 C  C4    . DG  E 2 6   ? 15.399  60.823  -3.313  1.00 54.84  ? 6   DG  E C4    1 
ATOM   6230 P  P     . DA  E 2 7   ? 20.484  56.812  -4.931  1.00 67.63  ? 7   DA  E P     1 
ATOM   6231 O  OP1   . DA  E 2 7   ? 20.200  55.687  -5.863  1.00 66.26  ? 7   DA  E OP1   1 
ATOM   6232 O  OP2   . DA  E 2 7   ? 21.200  56.563  -3.650  1.00 63.00  ? 7   DA  E OP2   1 
ATOM   6233 O  "O5'" . DA  E 2 7   ? 21.255  57.920  -5.784  1.00 59.95  ? 7   DA  E "O5'" 1 
ATOM   6234 C  "C5'" . DA  E 2 7   ? 20.730  58.393  -7.054  1.00 53.41  ? 7   DA  E "C5'" 1 
ATOM   6235 C  "C4'" . DA  E 2 7   ? 20.988  59.874  -7.223  1.00 49.94  ? 7   DA  E "C4'" 1 
ATOM   6236 O  "O4'" . DA  E 2 7   ? 19.974  60.635  -6.523  1.00 48.53  ? 7   DA  E "O4'" 1 
ATOM   6237 C  "C3'" . DA  E 2 7   ? 22.339  60.370  -6.694  1.00 48.16  ? 7   DA  E "C3'" 1 
ATOM   6238 O  "O3'" . DA  E 2 7   ? 22.961  61.233  -7.639  1.00 47.09  ? 7   DA  E "O3'" 1 
ATOM   6239 C  "C2'" . DA  E 2 7   ? 21.984  61.164  -5.452  1.00 46.99  ? 7   DA  E "C2'" 1 
ATOM   6240 C  "C1'" . DA  E 2 7   ? 20.581  61.654  -5.750  1.00 45.49  ? 7   DA  E "C1'" 1 
ATOM   6241 N  N9    . DA  E 2 7   ? 19.771  61.855  -4.551  1.00 44.17  ? 7   DA  E N9    1 
ATOM   6242 C  C8    . DA  E 2 7   ? 19.687  61.030  -3.456  1.00 44.29  ? 7   DA  E C8    1 
ATOM   6243 N  N7    . DA  E 2 7   ? 18.899  61.484  -2.512  1.00 44.30  ? 7   DA  E N7    1 
ATOM   6244 C  C5    . DA  E 2 7   ? 18.427  62.686  -3.020  1.00 44.13  ? 7   DA  E C5    1 
ATOM   6245 C  C6    . DA  E 2 7   ? 17.543  63.650  -2.504  1.00 42.34  ? 7   DA  E C6    1 
ATOM   6246 N  N6    . DA  E 2 7   ? 16.941  63.542  -1.317  1.00 41.58  ? 7   DA  E N6    1 
ATOM   6247 N  N1    . DA  E 2 7   ? 17.293  64.742  -3.260  1.00 41.50  ? 7   DA  E N1    1 
ATOM   6248 C  C2    . DA  E 2 7   ? 17.881  64.840  -4.460  1.00 41.00  ? 7   DA  E C2    1 
ATOM   6249 N  N3    . DA  E 2 7   ? 18.730  64.003  -5.052  1.00 42.00  ? 7   DA  E N3    1 
ATOM   6250 C  C4    . DA  E 2 7   ? 18.964  62.932  -4.272  1.00 44.18  ? 7   DA  E C4    1 
ATOM   6251 P  P     . DC  E 2 8   ? 24.502  61.639  -7.500  1.00 47.52  ? 8   DC  E P     1 
ATOM   6252 O  OP1   . DC  E 2 8   ? 25.090  61.621  -8.856  1.00 51.46  ? 8   DC  E OP1   1 
ATOM   6253 O  OP2   . DC  E 2 8   ? 25.134  60.852  -6.413  1.00 48.37  ? 8   DC  E OP2   1 
ATOM   6254 O  "O5'" . DC  E 2 8   ? 24.416  63.148  -7.009  1.00 45.89  ? 8   DC  E "O5'" 1 
ATOM   6255 C  "C5'" . DC  E 2 8   ? 23.676  64.083  -7.796  1.00 45.13  ? 8   DC  E "C5'" 1 
ATOM   6256 C  "C4'" . DC  E 2 8   ? 23.137  65.191  -6.927  1.00 43.70  ? 8   DC  E "C4'" 1 
ATOM   6257 O  "O4'" . DC  E 2 8   ? 22.286  64.681  -5.882  1.00 42.30  ? 8   DC  E "O4'" 1 
ATOM   6258 C  "C3'" . DC  E 2 8   ? 24.188  66.007  -6.187  1.00 42.76  ? 8   DC  E "C3'" 1 
ATOM   6259 O  "O3'" . DC  E 2 8   ? 24.696  67.076  -6.986  1.00 43.07  ? 8   DC  E "O3'" 1 
ATOM   6260 C  "C2'" . DC  E 2 8   ? 23.421  66.537  -4.986  1.00 42.37  ? 8   DC  E "C2'" 1 
ATOM   6261 C  "C1'" . DC  E 2 8   ? 22.097  65.781  -5.014  1.00 42.12  ? 8   DC  E "C1'" 1 
ATOM   6262 N  N1    . DC  E 2 8   ? 21.669  65.283  -3.699  1.00 41.92  ? 8   DC  E N1    1 
ATOM   6263 C  C2    . DC  E 2 8   ? 20.734  66.039  -2.995  1.00 41.03  ? 8   DC  E C2    1 
ATOM   6264 O  O2    . DC  E 2 8   ? 20.272  67.058  -3.523  1.00 41.09  ? 8   DC  E O2    1 
ATOM   6265 N  N3    . DC  E 2 8   ? 20.341  65.633  -1.768  1.00 42.15  ? 8   DC  E N3    1 
ATOM   6266 C  C4    . DC  E 2 8   ? 20.863  64.528  -1.232  1.00 41.41  ? 8   DC  E C4    1 
ATOM   6267 N  N4    . DC  E 2 8   ? 20.436  64.162  -0.022  1.00 41.02  ? 8   DC  E N4    1 
ATOM   6268 C  C5    . DC  E 2 8   ? 21.840  63.749  -1.916  1.00 41.05  ? 8   DC  E C5    1 
ATOM   6269 C  C6    . DC  E 2 8   ? 22.216  64.162  -3.135  1.00 42.15  ? 8   DC  E C6    1 
ATOM   6270 P  P     . DT  E 2 9   ? 25.826  68.029  -6.389  1.00 45.27  ? 9   DT  E P     1 
ATOM   6271 O  OP1   . DT  E 2 9   ? 26.722  68.416  -7.496  1.00 48.21  ? 9   DT  E OP1   1 
ATOM   6272 O  OP2   . DT  E 2 9   ? 26.405  67.397  -5.169  1.00 45.79  ? 9   DT  E OP2   1 
ATOM   6273 O  "O5'" . DT  E 2 9   ? 24.999  69.257  -5.793  1.00 44.81  ? 9   DT  E "O5'" 1 
ATOM   6274 C  "C5'" . DT  E 2 9   ? 23.856  69.836  -6.447  1.00 42.60  ? 9   DT  E "C5'" 1 
ATOM   6275 C  "C4'" . DT  E 2 9   ? 23.231  70.873  -5.541  1.00 42.73  ? 9   DT  E "C4'" 1 
ATOM   6276 O  "O4'" . DT  E 2 9   ? 22.522  70.238  -4.451  1.00 41.86  ? 9   DT  E "O4'" 1 
ATOM   6277 C  "C3'" . DT  E 2 9   ? 24.233  71.836  -4.902  1.00 43.05  ? 9   DT  E "C3'" 1 
ATOM   6278 O  "O3'" . DT  E 2 9   ? 23.821  73.181  -5.137  1.00 44.35  ? 9   DT  E "O3'" 1 
ATOM   6279 C  "C2'" . DT  E 2 9   ? 24.227  71.478  -3.425  1.00 42.66  ? 9   DT  E "C2'" 1 
ATOM   6280 C  "C1'" . DT  E 2 9   ? 22.866  70.843  -3.212  1.00 42.53  ? 9   DT  E "C1'" 1 
ATOM   6281 N  N1    . DT  E 2 9   ? 22.841  69.790  -2.170  1.00 42.43  ? 9   DT  E N1    1 
ATOM   6282 C  C2    . DT  E 2 9   ? 21.930  69.891  -1.140  1.00 43.39  ? 9   DT  E C2    1 
ATOM   6283 O  O2    . DT  E 2 9   ? 21.143  70.818  -1.031  1.00 45.99  ? 9   DT  E O2    1 
ATOM   6284 N  N3    . DT  E 2 9   ? 21.980  68.865  -0.230  1.00 42.63  ? 9   DT  E N3    1 
ATOM   6285 C  C4    . DT  E 2 9   ? 22.828  67.773  -0.249  1.00 42.36  ? 9   DT  E C4    1 
ATOM   6286 O  O4    . DT  E 2 9   ? 22.760  66.933  0.641   1.00 42.67  ? 9   DT  E O4    1 
ATOM   6287 C  C5    . DT  E 2 9   ? 23.761  67.734  -1.352  1.00 41.67  ? 9   DT  E C5    1 
ATOM   6288 C  C7    . DT  E 2 9   ? 24.713  66.585  -1.455  1.00 41.78  ? 9   DT  E C7    1 
ATOM   6289 C  C6    . DT  E 2 9   ? 23.724  68.732  -2.244  1.00 41.67  ? 9   DT  E C6    1 
ATOM   6290 P  P     . DG  E 2 10  ? 24.751  74.375  -4.675  1.00 46.88  ? 10  DG  E P     1 
ATOM   6291 O  OP1   . DG  E 2 10  ? 24.433  75.541  -5.530  1.00 48.60  ? 10  DG  E OP1   1 
ATOM   6292 O  OP2   . DG  E 2 10  ? 26.151  73.876  -4.552  1.00 46.74  ? 10  DG  E OP2   1 
ATOM   6293 O  "O5'" . DG  E 2 10  ? 24.257  74.653  -3.194  1.00 45.85  ? 10  DG  E "O5'" 1 
ATOM   6294 C  "C5'" . DG  E 2 10  ? 22.873  74.923  -2.918  1.00 47.27  ? 10  DG  E "C5'" 1 
ATOM   6295 C  "C4'" . DG  E 2 10  ? 22.735  75.248  -1.452  1.00 48.16  ? 10  DG  E "C4'" 1 
ATOM   6296 O  "O4'" . DG  E 2 10  ? 22.750  74.014  -0.694  1.00 46.34  ? 10  DG  E "O4'" 1 
ATOM   6297 C  "C3'" . DG  E 2 10  ? 23.891  76.082  -0.895  1.00 50.82  ? 10  DG  E "C3'" 1 
ATOM   6298 O  "O3'" . DG  E 2 10  ? 23.372  76.905  0.146   1.00 55.96  ? 10  DG  E "O3'" 1 
ATOM   6299 C  "C2'" . DG  E 2 10  ? 24.801  75.032  -0.286  1.00 48.48  ? 10  DG  E "C2'" 1 
ATOM   6300 C  "C1'" . DG  E 2 10  ? 23.750  74.115  0.302   1.00 47.36  ? 10  DG  E "C1'" 1 
ATOM   6301 N  N9    . DG  E 2 10  ? 24.161  72.768  0.687   1.00 45.58  ? 10  DG  E N9    1 
ATOM   6302 C  C8    . DG  E 2 10  ? 25.151  71.986  0.141   1.00 43.91  ? 10  DG  E C8    1 
ATOM   6303 N  N7    . DG  E 2 10  ? 25.281  70.834  0.743   1.00 43.79  ? 10  DG  E N7    1 
ATOM   6304 C  C5    . DG  E 2 10  ? 24.335  70.868  1.758   1.00 44.01  ? 10  DG  E C5    1 
ATOM   6305 C  C6    . DG  E 2 10  ? 24.011  69.904  2.750   1.00 43.40  ? 10  DG  E C6    1 
ATOM   6306 O  O6    . DG  E 2 10  ? 24.508  68.789  2.933   1.00 44.02  ? 10  DG  E O6    1 
ATOM   6307 N  N1    . DG  E 2 10  ? 22.996  70.353  3.588   1.00 43.58  ? 10  DG  E N1    1 
ATOM   6308 C  C2    . DG  E 2 10  ? 22.371  71.569  3.487   1.00 45.10  ? 10  DG  E C2    1 
ATOM   6309 N  N2    . DG  E 2 10  ? 21.407  71.815  4.386   1.00 46.14  ? 10  DG  E N2    1 
ATOM   6310 N  N3    . DG  E 2 10  ? 22.650  72.469  2.558   1.00 46.13  ? 10  DG  E N3    1 
ATOM   6311 C  C4    . DG  E 2 10  ? 23.637  72.056  1.737   1.00 45.01  ? 10  DG  E C4    1 
ATOM   6312 P  P     . DG  E 2 11  ? 23.702  78.453  0.208   1.00 60.88  ? 11  DG  E P     1 
ATOM   6313 O  OP1   . DG  E 2 11  ? 22.623  79.168  -0.518  1.00 62.85  ? 11  DG  E OP1   1 
ATOM   6314 O  OP2   . DG  E 2 11  ? 25.108  78.644  -0.228  1.00 62.93  ? 11  DG  E OP2   1 
ATOM   6315 O  "O5'" . DG  E 2 11  ? 23.618  78.718  1.779   1.00 61.15  ? 11  DG  E "O5'" 1 
ATOM   6316 C  "C5'" . DG  E 2 11  ? 22.350  78.635  2.467   1.00 59.67  ? 11  DG  E "C5'" 1 
ATOM   6317 C  "C4'" . DG  E 2 11  ? 22.450  77.849  3.758   1.00 58.24  ? 11  DG  E "C4'" 1 
ATOM   6318 O  "O4'" . DG  E 2 11  ? 22.786  76.471  3.505   1.00 55.45  ? 11  DG  E "O4'" 1 
ATOM   6319 C  "C3'" . DG  E 2 11  ? 23.496  78.304  4.773   1.00 58.36  ? 11  DG  E "C3'" 1 
ATOM   6320 O  "O3'" . DG  E 2 11  ? 23.045  79.251  5.745   1.00 60.12  ? 11  DG  E "O3'" 1 
ATOM   6321 C  "C2'" . DG  E 2 11  ? 23.783  77.041  5.565   1.00 56.58  ? 11  DG  E "C2'" 1 
ATOM   6322 C  "C1'" . DG  E 2 11  ? 23.137  75.921  4.765   1.00 55.33  ? 11  DG  E "C1'" 1 
ATOM   6323 N  N9    . DG  E 2 11  ? 24.059  74.813  4.557   1.00 52.34  ? 11  DG  E N9    1 
ATOM   6324 C  C8    . DG  E 2 11  ? 24.976  74.646  3.547   1.00 51.78  ? 11  DG  E C8    1 
ATOM   6325 N  N7    . DG  E 2 11  ? 25.681  73.554  3.673   1.00 50.00  ? 11  DG  E N7    1 
ATOM   6326 C  C5    . DG  E 2 11  ? 25.227  72.987  4.855   1.00 48.39  ? 11  DG  E C5    1 
ATOM   6327 C  C6    . DG  E 2 11  ? 25.617  71.793  5.510   1.00 47.52  ? 11  DG  E C6    1 
ATOM   6328 O  O6    . DG  E 2 11  ? 26.473  70.972  5.167   1.00 47.41  ? 11  DG  E O6    1 
ATOM   6329 N  N1    . DG  E 2 11  ? 24.893  71.591  6.680   1.00 48.85  ? 11  DG  E N1    1 
ATOM   6330 C  C2    . DG  E 2 11  ? 23.910  72.424  7.155   1.00 49.05  ? 11  DG  E C2    1 
ATOM   6331 N  N2    . DG  E 2 11  ? 23.324  72.056  8.304   1.00 49.12  ? 11  DG  E N2    1 
ATOM   6332 N  N3    . DG  E 2 11  ? 23.537  73.541  6.555   1.00 50.45  ? 11  DG  E N3    1 
ATOM   6333 C  C4    . DG  E 2 11  ? 24.235  73.760  5.419   1.00 50.85  ? 11  DG  E C4    1 
ATOM   6334 P  P     . DT  E 2 12  ? 24.092  79.846  6.808   1.00 61.16  ? 12  DT  E P     1 
ATOM   6335 O  OP1   . DT  E 2 12  ? 23.716  81.254  7.081   1.00 64.71  ? 12  DT  E OP1   1 
ATOM   6336 O  OP2   . DT  E 2 12  ? 25.464  79.536  6.324   1.00 58.49  ? 12  DT  E OP2   1 
ATOM   6337 O  "O5'" . DT  E 2 12  ? 23.844  78.975  8.123   1.00 59.20  ? 12  DT  E "O5'" 1 
ATOM   6338 C  "C5'" . DT  E 2 12  ? 22.531  78.622  8.600   1.00 57.40  ? 12  DT  E "C5'" 1 
ATOM   6339 C  "C4'" . DT  E 2 12  ? 22.651  77.601  9.710   1.00 56.29  ? 12  DT  E "C4'" 1 
ATOM   6340 O  "O4'" . DT  E 2 12  ? 23.303  76.401  9.224   1.00 53.87  ? 12  DT  E "O4'" 1 
ATOM   6341 C  "C3'" . DT  E 2 12  ? 23.479  78.062  10.911  1.00 57.50  ? 12  DT  E "C3'" 1 
ATOM   6342 O  "O3'" . DT  E 2 12  ? 22.878  77.631  12.138  1.00 59.01  ? 12  DT  E "O3'" 1 
ATOM   6343 C  "C2'" . DT  E 2 12  ? 24.824  77.395  10.686  1.00 55.14  ? 12  DT  E "C2'" 1 
ATOM   6344 C  "C1'" . DT  E 2 12  ? 24.409  76.078  10.063  1.00 52.60  ? 12  DT  E "C1'" 1 
ATOM   6345 N  N1    . DT  E 2 12  ? 25.447  75.421  9.228   1.00 48.80  ? 12  DT  E N1    1 
ATOM   6346 C  C2    . DT  E 2 12  ? 25.882  74.155  9.563   1.00 46.49  ? 12  DT  E C2    1 
ATOM   6347 O  O2    . DT  E 2 12  ? 25.462  73.535  10.525  1.00 46.13  ? 12  DT  E O2    1 
ATOM   6348 N  N3    . DT  E 2 12  ? 26.840  73.640  8.726   1.00 45.63  ? 12  DT  E N3    1 
ATOM   6349 C  C4    . DT  E 2 12  ? 27.379  74.240  7.606   1.00 45.65  ? 12  DT  E C4    1 
ATOM   6350 O  O4    . DT  E 2 12  ? 28.218  73.643  6.939   1.00 46.79  ? 12  DT  E O4    1 
ATOM   6351 C  C5    . DT  E 2 12  ? 26.882  75.566  7.316   1.00 46.76  ? 12  DT  E C5    1 
ATOM   6352 C  C7    . DT  E 2 12  ? 27.418  76.298  6.127   1.00 46.70  ? 12  DT  E C7    1 
ATOM   6353 C  C6    . DT  E 2 12  ? 25.949  76.080  8.127   1.00 48.34  ? 12  DT  E C6    1 
ATOM   6354 P  P     . DA  E 2 13  ? 23.550  78.017  13.541  1.00 62.20  ? 13  DA  E P     1 
ATOM   6355 O  OP1   . DA  E 2 13  ? 22.459  78.291  14.510  1.00 62.00  ? 13  DA  E OP1   1 
ATOM   6356 O  OP2   . DA  E 2 13  ? 24.605  79.035  13.292  1.00 61.47  ? 13  DA  E OP2   1 
ATOM   6357 O  "O5'" . DA  E 2 13  ? 24.258  76.663  13.984  1.00 60.65  ? 13  DA  E "O5'" 1 
ATOM   6358 C  "C5'" . DA  E 2 13  ? 23.464  75.479  14.178  1.00 59.63  ? 13  DA  E "C5'" 1 
ATOM   6359 C  "C4'" . DA  E 2 13  ? 24.304  74.381  14.784  1.00 57.29  ? 13  DA  E "C4'" 1 
ATOM   6360 O  "O4'" . DA  E 2 13  ? 25.256  73.890  13.809  1.00 52.78  ? 13  DA  E "O4'" 1 
ATOM   6361 C  "C3'" . DA  E 2 13  ? 25.125  74.805  16.000  1.00 57.55  ? 13  DA  E "C3'" 1 
ATOM   6362 O  "O3'" . DA  E 2 13  ? 25.033  73.733  16.940  1.00 59.68  ? 13  DA  E "O3'" 1 
ATOM   6363 C  "C2'" . DA  E 2 13  ? 26.513  75.036  15.427  1.00 54.57  ? 13  DA  E "C2'" 1 
ATOM   6364 C  "C1'" . DA  E 2 13  ? 26.578  73.998  14.319  1.00 52.83  ? 13  DA  E "C1'" 1 
ATOM   6365 N  N9    . DA  E 2 13  ? 27.455  74.322  13.197  1.00 50.51  ? 13  DA  E N9    1 
ATOM   6366 C  C8    . DA  E 2 13  ? 27.443  75.456  12.424  1.00 49.61  ? 13  DA  E C8    1 
ATOM   6367 N  N7    . DA  E 2 13  ? 28.329  75.445  11.458  1.00 47.85  ? 13  DA  E N7    1 
ATOM   6368 C  C5    . DA  E 2 13  ? 28.949  74.210  11.588  1.00 46.80  ? 13  DA  E C5    1 
ATOM   6369 C  C6    . DA  E 2 13  ? 29.984  73.591  10.866  1.00 44.95  ? 13  DA  E C6    1 
ATOM   6370 N  N6    . DA  E 2 13  ? 30.588  74.148  9.817   1.00 44.69  ? 13  DA  E N6    1 
ATOM   6371 N  N1    . DA  E 2 13  ? 30.370  72.356  11.254  1.00 44.59  ? 13  DA  E N1    1 
ATOM   6372 C  C2    . DA  E 2 13  ? 29.758  71.796  12.306  1.00 45.06  ? 13  DA  E C2    1 
ATOM   6373 N  N3    . DA  E 2 13  ? 28.783  72.282  13.070  1.00 46.08  ? 13  DA  E N3    1 
ATOM   6374 C  C4    . DA  E 2 13  ? 28.414  73.504  12.649  1.00 47.56  ? 13  DA  E C4    1 
ATOM   6375 P  P     . DT  E 2 14  ? 25.791  73.811  18.335  1.00 62.31  ? 14  DT  E P     1 
ATOM   6376 O  OP1   . DT  E 2 14  ? 24.964  73.089  19.334  1.00 64.08  ? 14  DT  E OP1   1 
ATOM   6377 O  OP2   . DT  E 2 14  ? 26.175  75.226  18.575  1.00 62.80  ? 14  DT  E OP2   1 
ATOM   6378 O  "O5'" . DT  E 2 14  ? 27.090  72.932  18.062  1.00 60.40  ? 14  DT  E "O5'" 1 
ATOM   6379 C  "C5'" . DT  E 2 14  ? 26.960  71.672  17.372  1.00 59.92  ? 14  DT  E "C5'" 1 
ATOM   6380 C  "C4'" . DT  E 2 14  ? 28.261  70.904  17.384  1.00 58.64  ? 14  DT  E "C4'" 1 
ATOM   6381 O  "O4'" . DT  E 2 14  ? 29.081  71.288  16.256  1.00 56.25  ? 14  DT  E "O4'" 1 
ATOM   6382 C  "C3'" . DT  E 2 14  ? 29.131  71.111  18.622  1.00 59.49  ? 14  DT  E "C3'" 1 
ATOM   6383 O  "O3'" . DT  E 2 14  ? 29.691  69.834  18.928  1.00 61.01  ? 14  DT  E "O3'" 1 
ATOM   6384 C  "C2'" . DT  E 2 14  ? 30.156  72.134  18.161  1.00 57.93  ? 14  DT  E "C2'" 1 
ATOM   6385 C  "C1'" . DT  E 2 14  ? 30.350  71.743  16.704  1.00 55.08  ? 14  DT  E "C1'" 1 
ATOM   6386 N  N1    . DT  E 2 14  ? 30.782  72.813  15.785  1.00 51.70  ? 14  DT  E N1    1 
ATOM   6387 C  C2    . DT  E 2 14  ? 31.734  72.506  14.839  1.00 49.69  ? 14  DT  E C2    1 
ATOM   6388 O  O2    . DT  E 2 14  ? 32.278  71.417  14.772  1.00 47.94  ? 14  DT  E O2    1 
ATOM   6389 N  N3    . DT  E 2 14  ? 32.051  73.537  13.991  1.00 48.35  ? 14  DT  E N3    1 
ATOM   6390 C  C4    . DT  E 2 14  ? 31.505  74.807  13.981  1.00 49.46  ? 14  DT  E C4    1 
ATOM   6391 O  O4    . DT  E 2 14  ? 31.891  75.632  13.158  1.00 49.27  ? 14  DT  E O4    1 
ATOM   6392 C  C5    . DT  E 2 14  ? 30.504  75.055  14.993  1.00 51.12  ? 14  DT  E C5    1 
ATOM   6393 C  C7    . DT  E 2 14  ? 29.859  76.403  15.063  1.00 52.12  ? 14  DT  E C7    1 
ATOM   6394 C  C6    . DT  E 2 14  ? 30.191  74.056  15.827  1.00 51.46  ? 14  DT  E C6    1 
ATOM   6395 P  P     . DT  E 2 15  ? 30.586  69.638  20.215  1.00 61.86  ? 15  DT  E P     1 
ATOM   6396 O  OP1   . DT  E 2 15  ? 30.308  68.286  20.753  1.00 62.61  ? 15  DT  E OP1   1 
ATOM   6397 O  OP2   . DT  E 2 15  ? 30.434  70.836  21.086  1.00 63.48  ? 15  DT  E OP2   1 
ATOM   6398 O  "O5'" . DT  E 2 15  ? 32.064  69.701  19.627  1.00 59.97  ? 15  DT  E "O5'" 1 
ATOM   6399 C  "C5'" . DT  E 2 15  ? 32.545  68.714  18.699  1.00 59.31  ? 15  DT  E "C5'" 1 
ATOM   6400 C  "C4'" . DT  E 2 15  ? 34.027  68.912  18.481  1.00 57.56  ? 15  DT  E "C4'" 1 
ATOM   6401 O  "O4'" . DT  E 2 15  ? 34.230  70.031  17.588  1.00 55.01  ? 15  DT  E "O4'" 1 
ATOM   6402 C  "C3'" . DT  E 2 15  ? 34.810  69.253  19.749  1.00 59.66  ? 15  DT  E "C3'" 1 
ATOM   6403 O  "O3'" . DT  E 2 15  ? 36.120  68.685  19.677  1.00 61.01  ? 15  DT  E "O3'" 1 
ATOM   6404 C  "C2'" . DT  E 2 15  ? 34.878  70.769  19.711  1.00 58.19  ? 15  DT  E "C2'" 1 
ATOM   6405 C  "C1'" . DT  E 2 15  ? 35.058  70.997  18.219  1.00 55.30  ? 15  DT  E "C1'" 1 
ATOM   6406 N  N1    . DT  E 2 15  ? 34.704  72.327  17.676  1.00 52.65  ? 15  DT  E N1    1 
ATOM   6407 C  C2    . DT  E 2 15  ? 35.276  72.677  16.474  1.00 50.59  ? 15  DT  E C2    1 
ATOM   6408 O  O2    . DT  E 2 15  ? 36.032  71.946  15.857  1.00 49.97  ? 15  DT  E O2    1 
ATOM   6409 N  N3    . DT  E 2 15  ? 34.920  73.918  16.011  1.00 49.52  ? 15  DT  E N3    1 
ATOM   6410 C  C4    . DT  E 2 15  ? 34.067  74.820  16.614  1.00 50.78  ? 15  DT  E C4    1 
ATOM   6411 O  O4    . DT  E 2 15  ? 33.842  75.900  16.076  1.00 52.23  ? 15  DT  E O4    1 
ATOM   6412 C  C5    . DT  E 2 15  ? 33.510  74.393  17.878  1.00 52.07  ? 15  DT  E C5    1 
ATOM   6413 C  C7    . DT  E 2 15  ? 32.582  75.311  18.610  1.00 53.07  ? 15  DT  E C7    1 
ATOM   6414 C  C6    . DT  E 2 15  ? 33.854  73.185  18.342  1.00 52.27  ? 15  DT  E C6    1 
ATOM   6415 P  P     . DG  E 2 16  ? 36.445  67.326  20.453  1.00 64.74  ? 16  DG  E P     1 
ATOM   6416 O  OP1   . DG  E 2 16  ? 35.413  66.328  20.074  1.00 63.27  ? 16  DG  E OP1   1 
ATOM   6417 O  OP2   . DG  E 2 16  ? 36.674  67.656  21.883  1.00 62.89  ? 16  DG  E OP2   1 
ATOM   6418 O  "O5'" . DG  E 2 16  ? 37.836  66.873  19.816  1.00 63.58  ? 16  DG  E "O5'" 1 
ATOM   6419 C  "C5'" . DG  E 2 16  ? 37.912  66.370  18.464  1.00 61.98  ? 16  DG  E "C5'" 1 
ATOM   6420 C  "C4'" . DG  E 2 16  ? 39.127  66.918  17.748  1.00 61.76  ? 16  DG  E "C4'" 1 
ATOM   6421 O  "O4'" . DG  E 2 16  ? 38.977  68.341  17.535  1.00 58.76  ? 16  DG  E "O4'" 1 
ATOM   6422 C  "C3'" . DG  E 2 16  ? 40.454  66.776  18.487  1.00 62.57  ? 16  DG  E "C3'" 1 
ATOM   6423 O  "O3'" . DG  E 2 16  ? 41.528  66.841  17.544  1.00 66.23  ? 16  DG  E "O3'" 1 
ATOM   6424 C  "C2'" . DG  E 2 16  ? 40.498  68.047  19.310  1.00 60.72  ? 16  DG  E "C2'" 1 
ATOM   6425 C  "C1'" . DG  E 2 16  ? 39.963  69.043  18.290  1.00 57.61  ? 16  DG  E "C1'" 1 
ATOM   6426 N  N9    . DG  E 2 16  ? 39.333  70.249  18.812  1.00 53.46  ? 16  DG  E N9    1 
ATOM   6427 C  C8    . DG  E 2 16  ? 38.747  70.437  20.040  1.00 53.49  ? 16  DG  E C8    1 
ATOM   6428 N  N7    . DG  E 2 16  ? 38.241  71.631  20.187  1.00 52.09  ? 16  DG  E N7    1 
ATOM   6429 C  C5    . DG  E 2 16  ? 38.488  72.259  18.975  1.00 50.01  ? 16  DG  E C5    1 
ATOM   6430 C  C6    . DG  E 2 16  ? 38.161  73.566  18.534  1.00 48.61  ? 16  DG  E C6    1 
ATOM   6431 O  O6    . DG  E 2 16  ? 37.564  74.459  19.147  1.00 48.38  ? 16  DG  E O6    1 
ATOM   6432 N  N1    . DG  E 2 16  ? 38.604  73.793  17.235  1.00 47.50  ? 16  DG  E N1    1 
ATOM   6433 C  C2    . DG  E 2 16  ? 39.280  72.881  16.461  1.00 46.90  ? 16  DG  E C2    1 
ATOM   6434 N  N2    . DG  E 2 16  ? 39.629  73.285  15.234  1.00 46.14  ? 16  DG  E N2    1 
ATOM   6435 N  N3    . DG  E 2 16  ? 39.582  71.658  16.857  1.00 47.85  ? 16  DG  E N3    1 
ATOM   6436 C  C4    . DG  E 2 16  ? 39.159  71.417  18.115  1.00 49.93  ? 16  DG  E C4    1 
ATOM   6437 P  P     . DG  E 2 17  ? 42.084  65.513  16.853  1.00 70.44  ? 17  DG  E P     1 
ATOM   6438 O  OP1   . DG  E 2 17  ? 40.988  64.927  16.036  1.00 68.29  ? 17  DG  E OP1   1 
ATOM   6439 O  OP2   . DG  E 2 17  ? 42.751  64.702  17.905  1.00 68.45  ? 17  DG  E OP2   1 
ATOM   6440 O  "O5'" . DG  E 2 17  ? 43.192  66.066  15.851  1.00 66.39  ? 17  DG  E "O5'" 1 
ATOM   6441 C  "C5'" . DG  E 2 17  ? 42.835  66.717  14.619  1.00 63.29  ? 17  DG  E "C5'" 1 
ATOM   6442 C  "C4'" . DG  E 2 17  ? 43.733  67.910  14.392  1.00 62.47  ? 17  DG  E "C4'" 1 
ATOM   6443 O  "O4'" . DG  E 2 17  ? 43.318  68.991  15.259  1.00 61.37  ? 17  DG  E "O4'" 1 
ATOM   6444 C  "C3'" . DG  E 2 17  ? 45.210  67.691  14.717  1.00 63.15  ? 17  DG  E "C3'" 1 
ATOM   6445 O  "O3'" . DG  E 2 17  ? 45.991  68.572  13.909  1.00 62.98  ? 17  DG  E "O3'" 1 
ATOM   6446 C  "C2'" . DG  E 2 17  ? 45.318  68.175  16.150  1.00 61.73  ? 17  DG  E "C2'" 1 
ATOM   6447 C  "C1'" . DG  E 2 17  ? 44.418  69.392  16.072  1.00 59.65  ? 17  DG  E "C1'" 1 
ATOM   6448 N  N9    . DG  E 2 17  ? 43.876  69.894  17.328  1.00 56.78  ? 17  DG  E N9    1 
ATOM   6449 C  C8    . DG  E 2 17  ? 43.720  69.215  18.511  1.00 56.47  ? 17  DG  E C8    1 
ATOM   6450 N  N7    . DG  E 2 17  ? 43.168  69.939  19.446  1.00 56.13  ? 17  DG  E N7    1 
ATOM   6451 C  C5    . DG  E 2 17  ? 42.924  71.161  18.836  1.00 54.53  ? 17  DG  E C5    1 
ATOM   6452 C  C6    . DG  E 2 17  ? 42.330  72.342  19.349  1.00 52.61  ? 17  DG  E C6    1 
ATOM   6453 O  O6    . DG  E 2 17  ? 41.887  72.551  20.482  1.00 54.36  ? 17  DG  E O6    1 
ATOM   6454 N  N1    . DG  E 2 17  ? 42.278  73.348  18.389  1.00 51.64  ? 17  DG  E N1    1 
ATOM   6455 C  C2    . DG  E 2 17  ? 42.747  73.235  17.103  1.00 51.43  ? 17  DG  E C2    1 
ATOM   6456 N  N2    . DG  E 2 17  ? 42.617  74.320  16.326  1.00 50.68  ? 17  DG  E N2    1 
ATOM   6457 N  N3    . DG  E 2 17  ? 43.299  72.138  16.613  1.00 52.54  ? 17  DG  E N3    1 
ATOM   6458 C  C4    . DG  E 2 17  ? 43.350  71.147  17.526  1.00 54.51  ? 17  DG  E C4    1 
ATOM   6459 P  P     . DG  E 2 18  ? 46.966  67.980  12.809  1.00 64.43  ? 18  DG  E P     1 
ATOM   6460 O  OP1   . DG  E 2 18  ? 46.120  67.451  11.712  1.00 64.19  ? 18  DG  E OP1   1 
ATOM   6461 O  OP2   . DG  E 2 18  ? 47.931  67.083  13.494  1.00 64.12  ? 18  DG  E OP2   1 
ATOM   6462 O  "O5'" . DG  E 2 18  ? 47.765  69.266  12.306  1.00 62.99  ? 18  DG  E "O5'" 1 
ATOM   6463 C  "C5'" . DG  E 2 18  ? 47.082  70.406  11.742  1.00 60.25  ? 18  DG  E "C5'" 1 
ATOM   6464 C  "C4'" . DG  E 2 18  ? 48.012  71.593  11.624  1.00 59.95  ? 18  DG  E "C4'" 1 
ATOM   6465 O  "O4'" . DG  E 2 18  ? 47.922  72.394  12.822  1.00 58.50  ? 18  DG  E "O4'" 1 
ATOM   6466 C  "C3'" . DG  E 2 18  ? 49.497  71.274  11.481  1.00 61.05  ? 18  DG  E "C3'" 1 
ATOM   6467 O  "O3'" . DG  E 2 18  ? 50.150  72.361  10.821  1.00 63.49  ? 18  DG  E "O3'" 1 
ATOM   6468 C  "C2'" . DG  E 2 18  ? 49.973  71.179  12.921  1.00 59.81  ? 18  DG  E "C2'" 1 
ATOM   6469 C  "C1'" . DG  E 2 18  ? 49.016  72.099  13.688  1.00 57.31  ? 18  DG  E "C1'" 1 
ATOM   6470 N  N9    . DG  E 2 18  ? 48.460  71.577  14.934  1.00 54.62  ? 18  DG  E N9    1 
ATOM   6471 C  C8    . DG  E 2 18  ? 48.588  70.315  15.465  1.00 54.43  ? 18  DG  E C8    1 
ATOM   6472 N  N7    . DG  E 2 18  ? 47.965  70.174  16.604  1.00 53.07  ? 18  DG  E N7    1 
ATOM   6473 C  C5    . DG  E 2 18  ? 47.383  71.414  16.833  1.00 51.41  ? 18  DG  E C5    1 
ATOM   6474 C  C6    . DG  E 2 18  ? 46.585  71.870  17.913  1.00 50.19  ? 18  DG  E C6    1 
ATOM   6475 O  O6    . DG  E 2 18  ? 46.211  71.245  18.912  1.00 51.56  ? 18  DG  E O6    1 
ATOM   6476 N  N1    . DG  E 2 18  ? 46.220  73.203  17.753  1.00 49.16  ? 18  DG  E N1    1 
ATOM   6477 C  C2    . DG  E 2 18  ? 46.578  73.997  16.691  1.00 48.81  ? 18  DG  E C2    1 
ATOM   6478 N  N2    . DG  E 2 18  ? 46.120  75.256  16.709  1.00 48.25  ? 18  DG  E N2    1 
ATOM   6479 N  N3    . DG  E 2 18  ? 47.314  73.581  15.675  1.00 49.75  ? 18  DG  E N3    1 
ATOM   6480 C  C4    . DG  E 2 18  ? 47.680  72.290  15.811  1.00 51.76  ? 18  DG  E C4    1 
ATOM   6481 P  P     . DC  F 3 1   ? 41.928  76.879  24.798  1.00 79.41  ? 1   DC  F P     1 
ATOM   6482 O  OP1   . DC  F 3 1   ? 41.981  75.401  24.602  1.00 81.93  ? 1   DC  F OP1   1 
ATOM   6483 O  OP2   . DC  F 3 1   ? 43.083  77.583  25.430  1.00 82.48  ? 1   DC  F OP2   1 
ATOM   6484 O  "O5'" . DC  F 3 1   ? 41.601  77.561  23.396  1.00 63.30  ? 1   DC  F "O5'" 1 
ATOM   6485 C  "C5'" . DC  F 3 1   ? 41.617  78.985  23.262  1.00 57.67  ? 1   DC  F "C5'" 1 
ATOM   6486 C  "C4'" . DC  F 3 1   ? 42.803  79.410  22.430  1.00 53.00  ? 1   DC  F "C4'" 1 
ATOM   6487 O  "O4'" . DC  F 3 1   ? 43.854  78.415  22.489  1.00 47.96  ? 1   DC  F "O4'" 1 
ATOM   6488 C  "C3'" . DC  F 3 1   ? 42.484  79.606  20.951  1.00 50.29  ? 1   DC  F "C3'" 1 
ATOM   6489 O  "O3'" . DC  F 3 1   ? 43.154  80.786  20.522  1.00 51.04  ? 1   DC  F "O3'" 1 
ATOM   6490 C  "C2'" . DC  F 3 1   ? 42.998  78.334  20.303  1.00 47.55  ? 1   DC  F "C2'" 1 
ATOM   6491 C  "C1'" . DC  F 3 1   ? 44.185  77.967  21.182  1.00 46.86  ? 1   DC  F "C1'" 1 
ATOM   6492 N  N1    . DC  F 3 1   ? 44.450  76.519  21.249  1.00 44.74  ? 1   DC  F N1    1 
ATOM   6493 C  C2    . DC  F 3 1   ? 44.845  75.848  20.085  1.00 43.59  ? 1   DC  F C2    1 
ATOM   6494 O  O2    . DC  F 3 1   ? 44.985  76.493  19.038  1.00 42.60  ? 1   DC  F O2    1 
ATOM   6495 N  N3    . DC  F 3 1   ? 45.072  74.516  20.134  1.00 42.84  ? 1   DC  F N3    1 
ATOM   6496 C  C4    . DC  F 3 1   ? 44.914  73.855  21.281  1.00 43.28  ? 1   DC  F C4    1 
ATOM   6497 N  N4    . DC  F 3 1   ? 45.154  72.542  21.283  1.00 43.96  ? 1   DC  F N4    1 
ATOM   6498 C  C5    . DC  F 3 1   ? 44.511  74.512  22.481  1.00 43.74  ? 1   DC  F C5    1 
ATOM   6499 C  C6    . DC  F 3 1   ? 44.286  75.831  22.419  1.00 44.27  ? 1   DC  F C6    1 
ATOM   6500 P  P     . DC  F 3 2   ? 42.437  82.198  20.664  1.00 53.27  ? 2   DC  F P     1 
ATOM   6501 O  OP1   . DC  F 3 2   ? 43.480  83.228  20.890  1.00 54.92  ? 2   DC  F OP1   1 
ATOM   6502 O  OP2   . DC  F 3 2   ? 41.336  82.054  21.641  1.00 53.62  ? 2   DC  F OP2   1 
ATOM   6503 O  "O5'" . DC  F 3 2   ? 41.903  82.436  19.185  1.00 53.54  ? 2   DC  F "O5'" 1 
ATOM   6504 C  "C5'" . DC  F 3 2   ? 40.550  82.185  18.844  1.00 55.12  ? 2   DC  F "C5'" 1 
ATOM   6505 C  "C4'" . DC  F 3 2   ? 40.482  81.357  17.585  1.00 55.23  ? 2   DC  F "C4'" 1 
ATOM   6506 O  "O4'" . DC  F 3 2   ? 41.136  80.091  17.841  1.00 52.34  ? 2   DC  F "O4'" 1 
ATOM   6507 C  "C3'" . DC  F 3 2   ? 39.050  81.014  17.190  1.00 54.90  ? 2   DC  F "C3'" 1 
ATOM   6508 O  "O3'" . DC  F 3 2   ? 38.380  81.963  16.332  1.00 61.19  ? 2   DC  F "O3'" 1 
ATOM   6509 C  "C2'" . DC  F 3 2   ? 39.156  79.608  16.633  1.00 53.35  ? 2   DC  F "C2'" 1 
ATOM   6510 C  "C1'" . DC  F 3 2   ? 40.428  79.025  17.218  1.00 50.75  ? 2   DC  F "C1'" 1 
ATOM   6511 N  N1    . DC  F 3 2   ? 40.210  77.967  18.220  1.00 46.61  ? 2   DC  F N1    1 
ATOM   6512 C  C2    . DC  F 3 2   ? 40.718  76.688  17.970  1.00 44.64  ? 2   DC  F C2    1 
ATOM   6513 O  O2    . DC  F 3 2   ? 41.326  76.481  16.910  1.00 42.88  ? 2   DC  F O2    1 
ATOM   6514 N  N3    . DC  F 3 2   ? 40.557  75.718  18.899  1.00 44.32  ? 2   DC  F N3    1 
ATOM   6515 C  C4    . DC  F 3 2   ? 39.905  75.983  20.033  1.00 44.96  ? 2   DC  F C4    1 
ATOM   6516 N  N4    . DC  F 3 2   ? 39.762  74.991  20.914  1.00 45.38  ? 2   DC  F N4    1 
ATOM   6517 C  C5    . DC  F 3 2   ? 39.364  77.273  20.308  1.00 45.65  ? 2   DC  F C5    1 
ATOM   6518 C  C6    . DC  F 3 2   ? 39.542  78.228  19.385  1.00 46.97  ? 2   DC  F C6    1 
ATOM   6519 P  P     . DC  F 3 3   ? 38.930  82.388  14.866  1.00 62.35  ? 3   DC  F P     1 
ATOM   6520 O  OP1   . DC  F 3 3   ? 39.881  83.513  15.041  1.00 68.62  ? 3   DC  F OP1   1 
ATOM   6521 O  OP2   . DC  F 3 3   ? 37.773  82.539  13.970  1.00 62.92  ? 3   DC  F OP2   1 
ATOM   6522 O  "O5'" . DC  F 3 3   ? 39.734  81.125  14.335  1.00 61.31  ? 3   DC  F "O5'" 1 
ATOM   6523 C  "C5'" . DC  F 3 3   ? 40.285  81.137  13.008  1.00 62.03  ? 3   DC  F "C5'" 1 
ATOM   6524 C  "C4'" . DC  F 3 3   ? 40.129  79.776  12.375  1.00 60.75  ? 3   DC  F "C4'" 1 
ATOM   6525 O  "O4'" . DC  F 3 3   ? 39.824  78.792  13.396  1.00 58.75  ? 3   DC  F "O4'" 1 
ATOM   6526 C  "C3'" . DC  F 3 3   ? 38.986  79.677  11.371  1.00 61.88  ? 3   DC  F "C3'" 1 
ATOM   6527 O  "O3'" . DC  F 3 3   ? 39.301  78.678  10.407  1.00 64.20  ? 3   DC  F "O3'" 1 
ATOM   6528 C  "C2'" . DC  F 3 3   ? 37.835  79.199  12.228  1.00 58.41  ? 3   DC  F "C2'" 1 
ATOM   6529 C  "C1'" . DC  F 3 3   ? 38.562  78.197  13.106  1.00 56.00  ? 3   DC  F "C1'" 1 
ATOM   6530 N  N1    . DC  F 3 3   ? 37.911  77.852  14.383  1.00 52.07  ? 3   DC  F N1    1 
ATOM   6531 C  C2    . DC  F 3 3   ? 38.259  76.646  14.999  1.00 48.62  ? 3   DC  F C2    1 
ATOM   6532 O  O2    . DC  F 3 3   ? 39.093  75.909  14.447  1.00 46.42  ? 3   DC  F O2    1 
ATOM   6533 N  N3    . DC  F 3 3   ? 37.667  76.304  16.167  1.00 46.00  ? 3   DC  F N3    1 
ATOM   6534 C  C4    . DC  F 3 3   ? 36.768  77.120  16.723  1.00 47.85  ? 3   DC  F C4    1 
ATOM   6535 N  N4    . DC  F 3 3   ? 36.217  76.746  17.878  1.00 48.56  ? 3   DC  F N4    1 
ATOM   6536 C  C5    . DC  F 3 3   ? 36.398  78.358  16.120  1.00 50.37  ? 3   DC  F C5    1 
ATOM   6537 C  C6    . DC  F 3 3   ? 36.981  78.677  14.956  1.00 52.24  ? 3   DC  F C6    1 
ATOM   6538 P  P     . DA  F 3 4   ? 39.981  79.099  9.038   1.00 70.53  ? 4   DA  F P     1 
ATOM   6539 O  OP1   . DA  F 3 4   ? 40.792  80.317  9.290   1.00 72.27  ? 4   DA  F OP1   1 
ATOM   6540 O  OP2   . DA  F 3 4   ? 38.921  79.118  7.997   1.00 69.61  ? 4   DA  F OP2   1 
ATOM   6541 O  "O5'" . DA  F 3 4   ? 41.002  77.909  8.770   1.00 70.13  ? 4   DA  F "O5'" 1 
ATOM   6542 C  "C5'" . DA  F 3 4   ? 40.832  77.027  7.651   1.00 70.70  ? 4   DA  F "C5'" 1 
ATOM   6543 C  "C4'" . DA  F 3 4   ? 41.048  75.597  8.082   1.00 69.42  ? 4   DA  F "C4'" 1 
ATOM   6544 O  "O4'" . DA  F 3 4   ? 40.485  75.380  9.399   1.00 67.19  ? 4   DA  F "O4'" 1 
ATOM   6545 C  "C3'" . DA  F 3 4   ? 40.391  74.568  7.167   1.00 69.71  ? 4   DA  F "C3'" 1 
ATOM   6546 O  "O3'" . DA  F 3 4   ? 41.295  73.470  7.003   1.00 73.73  ? 4   DA  F "O3'" 1 
ATOM   6547 C  "C2'" . DA  F 3 4   ? 39.069  74.280  7.858   1.00 65.63  ? 4   DA  F "C2'" 1 
ATOM   6548 C  "C1'" . DA  F 3 4   ? 39.356  74.514  9.335   1.00 63.76  ? 4   DA  F "C1'" 1 
ATOM   6549 N  N9    . DA  F 3 4   ? 38.260  75.147  10.076  1.00 59.06  ? 4   DA  F N9    1 
ATOM   6550 C  C8    . DA  F 3 4   ? 37.564  76.278  9.724   1.00 58.24  ? 4   DA  F C8    1 
ATOM   6551 N  N7    . DA  F 3 4   ? 36.639  76.620  10.588  1.00 56.43  ? 4   DA  F N7    1 
ATOM   6552 C  C5    . DA  F 3 4   ? 36.731  75.651  11.577  1.00 54.12  ? 4   DA  F C5    1 
ATOM   6553 C  C6    . DA  F 3 4   ? 36.023  75.454  12.779  1.00 52.05  ? 4   DA  F C6    1 
ATOM   6554 N  N6    . DA  F 3 4   ? 35.039  76.252  13.198  1.00 52.84  ? 4   DA  F N6    1 
ATOM   6555 N  N1    . DA  F 3 4   ? 36.361  74.389  13.539  1.00 50.76  ? 4   DA  F N1    1 
ATOM   6556 C  C2    . DA  F 3 4   ? 37.346  73.584  13.114  1.00 52.46  ? 4   DA  F C2    1 
ATOM   6557 N  N3    . DA  F 3 4   ? 38.090  73.671  12.010  1.00 53.69  ? 4   DA  F N3    1 
ATOM   6558 C  C4    . DA  F 3 4   ? 37.727  74.738  11.276  1.00 55.33  ? 4   DA  F C4    1 
ATOM   6559 P  P     . DA  F 3 5   ? 40.782  72.053  6.469   1.00 80.78  ? 5   DA  F P     1 
ATOM   6560 O  OP1   . DA  F 3 5   ? 41.961  71.333  5.914   1.00 81.31  ? 5   DA  F OP1   1 
ATOM   6561 O  OP2   . DA  F 3 5   ? 39.574  72.279  5.619   1.00 75.81  ? 5   DA  F OP2   1 
ATOM   6562 O  "O5'" . DA  F 3 5   ? 40.344  71.311  7.812   1.00 76.59  ? 5   DA  F "O5'" 1 
ATOM   6563 C  "C5'" . DA  F 3 5   ? 40.560  69.896  8.017   1.00 74.11  ? 5   DA  F "C5'" 1 
ATOM   6564 C  "C4'" . DA  F 3 5   ? 39.292  69.259  8.534   1.00 70.09  ? 5   DA  F "C4'" 1 
ATOM   6565 O  "O4'" . DA  F 3 5   ? 38.595  70.228  9.349   1.00 66.28  ? 5   DA  F "O4'" 1 
ATOM   6566 C  "C3'" . DA  F 3 5   ? 38.303  68.863  7.433   1.00 68.10  ? 5   DA  F "C3'" 1 
ATOM   6567 O  "O3'" . DA  F 3 5   ? 38.422  67.523  6.906   1.00 70.65  ? 5   DA  F "O3'" 1 
ATOM   6568 C  "C2'" . DA  F 3 5   ? 36.939  69.202  8.014   1.00 65.54  ? 5   DA  F "C2'" 1 
ATOM   6569 C  "C1'" . DA  F 3 5   ? 37.210  69.937  9.323   1.00 63.65  ? 5   DA  F "C1'" 1 
ATOM   6570 N  N9    . DA  F 3 5   ? 36.475  71.197  9.434   1.00 58.80  ? 5   DA  F N9    1 
ATOM   6571 C  C8    . DA  F 3 5   ? 36.467  72.249  8.551   1.00 57.37  ? 5   DA  F C8    1 
ATOM   6572 N  N7    . DA  F 3 5   ? 35.676  73.231  8.907   1.00 56.48  ? 5   DA  F N7    1 
ATOM   6573 C  C5    . DA  F 3 5   ? 35.105  72.787  10.092  1.00 52.79  ? 5   DA  F C5    1 
ATOM   6574 C  C6    . DA  F 3 5   ? 34.176  73.369  10.971  1.00 51.27  ? 5   DA  F C6    1 
ATOM   6575 N  N6    . DA  F 3 5   ? 33.633  74.574  10.782  1.00 50.61  ? 5   DA  F N6    1 
ATOM   6576 N  N1    . DA  F 3 5   ? 33.825  72.666  12.071  1.00 49.77  ? 5   DA  F N1    1 
ATOM   6577 C  C2    . DA  F 3 5   ? 34.369  71.456  12.258  1.00 49.59  ? 5   DA  F C2    1 
ATOM   6578 N  N3    . DA  F 3 5   ? 35.255  70.806  11.507  1.00 50.83  ? 5   DA  F N3    1 
ATOM   6579 C  C4    . DA  F 3 5   ? 35.584  71.534  10.425  1.00 53.60  ? 5   DA  F C4    1 
ATOM   6580 P  P     . DT  F 3 6   ? 38.312  66.197  7.833   1.00 69.32  ? 6   DT  F P     1 
ATOM   6581 O  OP1   . DT  F 3 6   ? 39.462  66.195  8.771   1.00 69.02  ? 6   DT  F OP1   1 
ATOM   6582 O  OP2   . DT  F 3 6   ? 38.091  65.033  6.937   1.00 69.17  ? 6   DT  F OP2   1 
ATOM   6583 O  "O5'" . DT  F 3 6   ? 36.955  66.392  8.641   1.00 62.57  ? 6   DT  F "O5'" 1 
ATOM   6584 C  "C5'" . DT  F 3 6   ? 36.921  66.185  10.060  1.00 58.36  ? 6   DT  F "C5'" 1 
ATOM   6585 C  "C4'" . DT  F 3 6   ? 35.512  66.339  10.581  1.00 55.20  ? 6   DT  F "C4'" 1 
ATOM   6586 O  "O4'" . DT  F 3 6   ? 35.053  67.689  10.375  1.00 53.98  ? 6   DT  F "O4'" 1 
ATOM   6587 C  "C3'" . DT  F 3 6   ? 34.460  65.426  9.939   1.00 53.41  ? 6   DT  F "C3'" 1 
ATOM   6588 O  "O3'" . DT  F 3 6   ? 34.092  64.478  10.947  1.00 52.05  ? 6   DT  F "O3'" 1 
ATOM   6589 C  "C2'" . DT  F 3 6   ? 33.325  66.363  9.546   1.00 52.46  ? 6   DT  F "C2'" 1 
ATOM   6590 C  "C1'" . DT  F 3 6   ? 33.643  67.658  10.276  1.00 52.34  ? 6   DT  F "C1'" 1 
ATOM   6591 N  N1    . DT  F 3 6   ? 33.214  68.908  9.615   1.00 51.47  ? 6   DT  F N1    1 
ATOM   6592 C  C2    . DT  F 3 6   ? 32.368  69.756  10.296  1.00 49.03  ? 6   DT  F C2    1 
ATOM   6593 O  O2    . DT  F 3 6   ? 31.914  69.501  11.397  1.00 47.80  ? 6   DT  F O2    1 
ATOM   6594 N  N3    . DT  F 3 6   ? 32.044  70.905  9.620   1.00 49.60  ? 6   DT  F N3    1 
ATOM   6595 C  C4    . DT  F 3 6   ? 32.479  71.286  8.364   1.00 51.10  ? 6   DT  F C4    1 
ATOM   6596 O  O4    . DT  F 3 6   ? 32.109  72.354  7.887   1.00 51.38  ? 6   DT  F O4    1 
ATOM   6597 C  C5    . DT  F 3 6   ? 33.377  70.358  7.715   1.00 52.41  ? 6   DT  F C5    1 
ATOM   6598 C  C7    . DT  F 3 6   ? 33.909  70.691  6.357   1.00 54.34  ? 6   DT  F C7    1 
ATOM   6599 C  C6    . DT  F 3 6   ? 33.697  69.232  8.365   1.00 52.28  ? 6   DT  F C6    1 
ATOM   6600 P  P     . DA  F 3 7   ? 33.115  63.241  10.645  1.00 51.67  ? 7   DA  F P     1 
ATOM   6601 O  OP1   . DA  F 3 7   ? 33.480  62.151  11.575  1.00 49.98  ? 7   DA  F OP1   1 
ATOM   6602 O  OP2   . DA  F 3 7   ? 33.095  62.988  9.176   1.00 50.30  ? 7   DA  F OP2   1 
ATOM   6603 O  "O5'" . DA  F 3 7   ? 31.699  63.787  11.129  1.00 51.47  ? 7   DA  F "O5'" 1 
ATOM   6604 C  "C5'" . DA  F 3 7   ? 31.530  64.231  12.490  1.00 51.86  ? 7   DA  F "C5'" 1 
ATOM   6605 C  "C4'" . DA  F 3 7   ? 30.186  64.896  12.667  1.00 52.28  ? 7   DA  F "C4'" 1 
ATOM   6606 O  "O4'" . DA  F 3 7   ? 30.194  66.186  12.017  1.00 51.79  ? 7   DA  F "O4'" 1 
ATOM   6607 C  "C3'" . DA  F 3 7   ? 29.002  64.116  12.085  1.00 53.63  ? 7   DA  F "C3'" 1 
ATOM   6608 O  "O3'" . DA  F 3 7   ? 28.114  63.837  13.175  1.00 56.23  ? 7   DA  F "O3'" 1 
ATOM   6609 C  "C2'" . DA  F 3 7   ? 28.469  65.007  10.972  1.00 51.95  ? 7   DA  F "C2'" 1 
ATOM   6610 C  "C1'" . DA  F 3 7   ? 28.962  66.391  11.352  1.00 51.76  ? 7   DA  F "C1'" 1 
ATOM   6611 N  N9    . DA  F 3 7   ? 29.208  67.307  10.235  1.00 49.45  ? 7   DA  F N9    1 
ATOM   6612 C  C8    . DA  F 3 7   ? 30.006  67.111  9.134   1.00 47.36  ? 7   DA  F C8    1 
ATOM   6613 N  N7    . DA  F 3 7   ? 30.048  68.141  8.323   1.00 46.19  ? 7   DA  F N7    1 
ATOM   6614 C  C5    . DA  F 3 7   ? 29.220  69.076  8.927   1.00 45.81  ? 7   DA  F C5    1 
ATOM   6615 C  C6    . DA  F 3 7   ? 28.844  70.383  8.566   1.00 45.06  ? 7   DA  F C6    1 
ATOM   6616 N  N6    . DA  F 3 7   ? 29.257  70.992  7.453   1.00 45.84  ? 7   DA  F N6    1 
ATOM   6617 N  N1    . DA  F 3 7   ? 28.011  71.049  9.393   1.00 44.62  ? 7   DA  F N1    1 
ATOM   6618 C  C2    . DA  F 3 7   ? 27.595  70.439  10.512  1.00 46.26  ? 7   DA  F C2    1 
ATOM   6619 N  N3    . DA  F 3 7   ? 27.882  69.217  10.962  1.00 47.10  ? 7   DA  F N3    1 
ATOM   6620 C  C4    . DA  F 3 7   ? 28.710  68.582  10.115  1.00 47.09  ? 7   DA  F C4    1 
ATOM   6621 P  P     . DC  F 3 8   ? 26.709  63.108  12.939  1.00 58.26  ? 8   DC  F P     1 
ATOM   6622 O  OP1   . DC  F 3 8   ? 26.346  62.420  14.203  1.00 59.25  ? 8   DC  F OP1   1 
ATOM   6623 O  OP2   . DC  F 3 8   ? 26.774  62.332  11.677  1.00 57.05  ? 8   DC  F OP2   1 
ATOM   6624 O  "O5'" . DC  F 3 8   ? 25.722  64.340  12.721  1.00 57.42  ? 8   DC  F "O5'" 1 
ATOM   6625 C  "C5'" . DC  F 3 8   ? 25.678  65.419  13.681  1.00 55.25  ? 8   DC  F "C5'" 1 
ATOM   6626 C  "C4'" . DC  F 3 8   ? 24.739  66.502  13.205  1.00 52.45  ? 8   DC  F "C4'" 1 
ATOM   6627 O  "O4'" . DC  F 3 8   ? 25.330  67.228  12.104  1.00 50.49  ? 8   DC  F "O4'" 1 
ATOM   6628 C  "C3'" . DC  F 3 8   ? 23.377  66.000  12.711  1.00 52.27  ? 8   DC  F "C3'" 1 
ATOM   6629 O  "O3'" . DC  F 3 8   ? 22.388  66.660  13.498  1.00 51.76  ? 8   DC  F "O3'" 1 
ATOM   6630 C  "C2'" . DC  F 3 8   ? 23.330  66.404  11.246  1.00 49.23  ? 8   DC  F "C2'" 1 
ATOM   6631 C  "C1'" . DC  F 3 8   ? 24.316  67.553  11.174  1.00 47.96  ? 8   DC  F "C1'" 1 
ATOM   6632 N  N1    . DC  F 3 8   ? 24.959  67.762  9.865   1.00 46.51  ? 8   DC  F N1    1 
ATOM   6633 C  C2    . DC  F 3 8   ? 24.873  69.021  9.257   1.00 45.61  ? 8   DC  F C2    1 
ATOM   6634 O  O2    . DC  F 3 8   ? 24.236  69.922  9.827   1.00 46.36  ? 8   DC  F O2    1 
ATOM   6635 N  N3    . DC  F 3 8   ? 25.477  69.221  8.063   1.00 42.73  ? 8   DC  F N3    1 
ATOM   6636 C  C4    . DC  F 3 8   ? 26.145  68.224  7.478   1.00 41.93  ? 8   DC  F C4    1 
ATOM   6637 N  N4    . DC  F 3 8   ? 26.713  68.462  6.299   1.00 40.67  ? 8   DC  F N4    1 
ATOM   6638 C  C5    . DC  F 3 8   ? 26.253  66.935  8.076   1.00 43.81  ? 8   DC  F C5    1 
ATOM   6639 C  C6    . DC  F 3 8   ? 25.653  66.750  9.260   1.00 45.55  ? 8   DC  F C6    1 
ATOM   6640 P  P     . DC  F 3 9   ? 20.895  66.164  13.504  1.00 54.39  ? 9   DC  F P     1 
ATOM   6641 O  OP1   . DC  F 3 9   ? 20.326  66.498  14.828  1.00 59.16  ? 9   DC  F OP1   1 
ATOM   6642 O  OP2   . DC  F 3 9   ? 20.860  64.761  13.029  1.00 56.61  ? 9   DC  F OP2   1 
ATOM   6643 O  "O5'" . DC  F 3 9   ? 20.220  67.149  12.453  1.00 54.49  ? 9   DC  F "O5'" 1 
ATOM   6644 C  "C5'" . DC  F 3 9   ? 20.567  68.547  12.498  1.00 53.75  ? 9   DC  F "C5'" 1 
ATOM   6645 C  "C4'" . DC  F 3 9   ? 20.157  69.237  11.221  1.00 52.79  ? 9   DC  F "C4'" 1 
ATOM   6646 O  "O4'" . DC  F 3 9   ? 21.136  68.984  10.189  1.00 52.27  ? 9   DC  F "O4'" 1 
ATOM   6647 C  "C3'" . DC  F 3 9   ? 18.807  68.788  10.645  1.00 54.30  ? 9   DC  F "C3'" 1 
ATOM   6648 O  "O3'" . DC  F 3 9   ? 17.897  69.885  10.778  1.00 56.85  ? 9   DC  F "O3'" 1 
ATOM   6649 C  "C2'" . DC  F 3 9   ? 19.116  68.404  9.201   1.00 50.78  ? 9   DC  F "C2'" 1 
ATOM   6650 C  "C1'" . DC  F 3 9   ? 20.461  69.065  8.952   1.00 49.38  ? 9   DC  F "C1'" 1 
ATOM   6651 N  N1    . DC  F 3 9   ? 21.319  68.449  7.925   1.00 47.42  ? 9   DC  F N1    1 
ATOM   6652 C  C2    . DC  F 3 9   ? 21.592  69.168  6.759   1.00 45.74  ? 9   DC  F C2    1 
ATOM   6653 O  O2    . DC  F 3 9   ? 21.093  70.293  6.617   1.00 46.48  ? 9   DC  F O2    1 
ATOM   6654 N  N3    . DC  F 3 9   ? 22.398  68.623  5.819   1.00 43.42  ? 9   DC  F N3    1 
ATOM   6655 C  C4    . DC  F 3 9   ? 22.905  67.403  6.003   1.00 42.73  ? 9   DC  F C4    1 
ATOM   6656 N  N4    . DC  F 3 9   ? 23.688  66.902  5.047   1.00 41.72  ? 9   DC  F N4    1 
ATOM   6657 C  C5    . DC  F 3 9   ? 22.632  66.643  7.177   1.00 44.40  ? 9   DC  F C5    1 
ATOM   6658 C  C6    . DC  F 3 9   ? 21.854  67.205  8.110   1.00 46.48  ? 9   DC  F C6    1 
ATOM   6659 P  P     . DA  F 3 10  ? 16.360  69.744  10.343  1.00 59.08  ? 10  DA  F P     1 
ATOM   6660 O  OP1   . DA  F 3 10  ? 15.550  70.531  11.296  1.00 62.47  ? 10  DA  F OP1   1 
ATOM   6661 O  OP2   . DA  F 3 10  ? 16.053  68.303  10.100  1.00 58.63  ? 10  DA  F OP2   1 
ATOM   6662 O  "O5'" . DA  F 3 10  ? 16.322  70.505  8.946   1.00 55.49  ? 10  DA  F "O5'" 1 
ATOM   6663 C  "C5'" . DA  F 3 10  ? 16.979  71.781  8.800   1.00 51.44  ? 10  DA  F "C5'" 1 
ATOM   6664 C  "C4'" . DA  F 3 10  ? 16.678  72.366  7.440   1.00 48.12  ? 10  DA  F "C4'" 1 
ATOM   6665 O  "O4'" . DA  F 3 10  ? 17.623  71.866  6.464   1.00 43.29  ? 10  DA  F "O4'" 1 
ATOM   6666 C  "C3'" . DA  F 3 10  ? 15.293  72.029  6.889   1.00 46.40  ? 10  DA  F "C3'" 1 
ATOM   6667 O  "O3'" . DA  F 3 10  ? 14.844  73.196  6.196   1.00 45.24  ? 10  DA  F "O3'" 1 
ATOM   6668 C  "C2'" . DA  F 3 10  ? 15.562  70.828  5.998   1.00 43.86  ? 10  DA  F "C2'" 1 
ATOM   6669 C  "C1'" . DA  F 3 10  ? 16.948  71.132  5.451   1.00 42.02  ? 10  DA  F "C1'" 1 
ATOM   6670 N  N9    . DA  F 3 10  ? 17.786  69.979  5.105   1.00 39.62  ? 10  DA  F N9    1 
ATOM   6671 C  C8    . DA  F 3 10  ? 17.966  68.804  5.793   1.00 38.29  ? 10  DA  F C8    1 
ATOM   6672 N  N7    . DA  F 3 10  ? 18.812  67.980  5.221   1.00 37.04  ? 10  DA  F N7    1 
ATOM   6673 C  C5    . DA  F 3 10  ? 19.219  68.659  4.081   1.00 35.08  ? 10  DA  F C5    1 
ATOM   6674 C  C6    . DA  F 3 10  ? 20.113  68.325  3.047   1.00 35.14  ? 10  DA  F C6    1 
ATOM   6675 N  N6    . DA  F 3 10  ? 20.775  67.167  2.983   1.00 34.73  ? 10  DA  F N6    1 
ATOM   6676 N  N1    . DA  F 3 10  ? 20.284  69.221  2.051   1.00 33.88  ? 10  DA  F N1    1 
ATOM   6677 C  C2    . DA  F 3 10  ? 19.612  70.378  2.107   1.00 35.27  ? 10  DA  F C2    1 
ATOM   6678 N  N3    . DA  F 3 10  ? 18.743  70.805  3.024   1.00 36.55  ? 10  DA  F N3    1 
ATOM   6679 C  C4    . DA  F 3 10  ? 18.591  69.889  3.995   1.00 36.50  ? 10  DA  F C4    1 
ATOM   6680 P  P     . DG  F 3 11  ? 13.327  73.348  5.754   1.00 46.56  ? 11  DG  F P     1 
ATOM   6681 O  OP1   . DG  F 3 11  ? 12.953  74.770  5.922   1.00 49.15  ? 11  DG  F OP1   1 
ATOM   6682 O  OP2   . DG  F 3 11  ? 12.534  72.269  6.397   1.00 47.45  ? 11  DG  F OP2   1 
ATOM   6683 O  "O5'" . DG  F 3 11  ? 13.354  73.036  4.190   1.00 42.07  ? 11  DG  F "O5'" 1 
ATOM   6684 C  "C5'" . DG  F 3 11  ? 14.237  73.757  3.315   1.00 39.65  ? 11  DG  F "C5'" 1 
ATOM   6685 C  "C4'" . DG  F 3 11  ? 14.434  73.013  2.014   1.00 37.54  ? 11  DG  F "C4'" 1 
ATOM   6686 O  "O4'" . DG  F 3 11  ? 15.352  71.925  2.205   1.00 35.19  ? 11  DG  F "O4'" 1 
ATOM   6687 C  "C3'" . DG  F 3 11  ? 13.187  72.381  1.377   1.00 37.46  ? 11  DG  F "C3'" 1 
ATOM   6688 O  "O3'" . DG  F 3 11  ? 12.640  73.242  0.370   1.00 38.35  ? 11  DG  F "O3'" 1 
ATOM   6689 C  "C2'" . DG  F 3 11  ? 13.718  71.101  0.743   1.00 36.55  ? 11  DG  F "C2'" 1 
ATOM   6690 C  "C1'" . DG  F 3 11  ? 15.215  71.113  1.062   1.00 35.31  ? 11  DG  F "C1'" 1 
ATOM   6691 N  N9    . DG  F 3 11  ? 15.796  69.806  1.350   1.00 34.68  ? 11  DG  F N9    1 
ATOM   6692 C  C8    . DG  F 3 11  ? 15.536  68.987  2.422   1.00 34.38  ? 11  DG  F C8    1 
ATOM   6693 N  N7    . DG  F 3 11  ? 16.203  67.864  2.380   1.00 34.82  ? 11  DG  F N7    1 
ATOM   6694 C  C5    . DG  F 3 11  ? 16.934  67.941  1.202   1.00 33.76  ? 11  DG  F C5    1 
ATOM   6695 C  C6    . DG  F 3 11  ? 17.844  67.019  0.620   1.00 34.51  ? 11  DG  F C6    1 
ATOM   6696 O  O6    . DG  F 3 11  ? 18.187  65.905  1.031   1.00 35.46  ? 11  DG  F O6    1 
ATOM   6697 N  N1    . DG  F 3 11  ? 18.371  67.504  -0.571  1.00 35.37  ? 11  DG  F N1    1 
ATOM   6698 C  C2    . DG  F 3 11  ? 18.056  68.714  -1.137  1.00 35.51  ? 11  DG  F C2    1 
ATOM   6699 N  N2    . DG  F 3 11  ? 18.660  68.998  -2.295  1.00 35.94  ? 11  DG  F N2    1 
ATOM   6700 N  N3    . DG  F 3 11  ? 17.210  69.579  -0.607  1.00 35.00  ? 11  DG  F N3    1 
ATOM   6701 C  C4    . DG  F 3 11  ? 16.693  69.133  0.555   1.00 33.96  ? 11  DG  F C4    1 
ATOM   6702 P  P     . DT  F 3 12  ? 11.260  72.898  -0.383  1.00 40.85  ? 12  DT  F P     1 
ATOM   6703 O  OP1   . DT  F 3 12  ? 10.590  74.186  -0.691  1.00 42.56  ? 12  DT  F OP1   1 
ATOM   6704 O  OP2   . DT  F 3 12  ? 10.530  71.844  0.370   1.00 40.45  ? 12  DT  F OP2   1 
ATOM   6705 O  "O5'" . DT  F 3 12  ? 11.747  72.211  -1.740  1.00 40.20  ? 12  DT  F "O5'" 1 
ATOM   6706 C  "C5'" . DT  F 3 12  ? 12.747  72.821  -2.581  1.00 39.72  ? 12  DT  F "C5'" 1 
ATOM   6707 C  "C4'" . DT  F 3 12  ? 13.126  71.887  -3.707  1.00 39.15  ? 12  DT  F "C4'" 1 
ATOM   6708 O  "O4'" . DT  F 3 12  ? 14.035  70.877  -3.222  1.00 37.83  ? 12  DT  F "O4'" 1 
ATOM   6709 C  "C3'" . DT  F 3 12  ? 11.944  71.141  -4.328  1.00 40.00  ? 12  DT  F "C3'" 1 
ATOM   6710 O  "O3'" . DT  F 3 12  ? 11.617  71.698  -5.604  1.00 39.71  ? 12  DT  F "O3'" 1 
ATOM   6711 C  "C2'" . DT  F 3 12  ? 12.404  69.693  -4.445  1.00 40.27  ? 12  DT  F "C2'" 1 
ATOM   6712 C  "C1'" . DT  F 3 12  ? 13.843  69.672  -3.944  1.00 38.86  ? 12  DT  F "C1'" 1 
ATOM   6713 N  N1    . DT  F 3 12  ? 14.153  68.559  -3.031  1.00 37.60  ? 12  DT  F N1    1 
ATOM   6714 C  C2    . DT  F 3 12  ? 15.175  67.694  -3.353  1.00 36.54  ? 12  DT  F C2    1 
ATOM   6715 O  O2    . DT  F 3 12  ? 15.797  67.760  -4.397  1.00 36.63  ? 12  DT  F O2    1 
ATOM   6716 N  N3    . DT  F 3 12  ? 15.413  66.714  -2.421  1.00 36.11  ? 12  DT  F N3    1 
ATOM   6717 C  C4    . DT  F 3 12  ? 14.761  66.533  -1.217  1.00 36.79  ? 12  DT  F C4    1 
ATOM   6718 O  O4    . DT  F 3 12  ? 15.086  65.607  -0.481  1.00 37.61  ? 12  DT  F O4    1 
ATOM   6719 C  C5    . DT  F 3 12  ? 13.707  67.485  -0.937  1.00 37.68  ? 12  DT  F C5    1 
ATOM   6720 C  C7    . DT  F 3 12  ? 12.934  67.359  0.338   1.00 37.69  ? 12  DT  F C7    1 
ATOM   6721 C  C6    . DT  F 3 12  ? 13.461  68.437  -1.845  1.00 37.73  ? 12  DT  F C6    1 
ATOM   6722 P  P     . DC  F 3 13  ? 10.230  71.329  -6.286  1.00 40.23  ? 13  DC  F P     1 
ATOM   6723 O  OP1   . DC  F 3 13  ? 9.836   72.445  -7.181  1.00 42.50  ? 13  DC  F OP1   1 
ATOM   6724 O  OP2   . DC  F 3 13  ? 9.301   70.859  -5.238  1.00 42.01  ? 13  DC  F OP2   1 
ATOM   6725 O  "O5'" . DC  F 3 13  ? 10.609  70.101  -7.206  1.00 41.33  ? 13  DC  F "O5'" 1 
ATOM   6726 C  "C5'" . DC  F 3 13  ? 11.586  70.258  -8.231  1.00 43.82  ? 13  DC  F "C5'" 1 
ATOM   6727 C  "C4'" . DC  F 3 13  ? 11.711  68.949  -8.965  1.00 45.80  ? 13  DC  F "C4'" 1 
ATOM   6728 O  "O4'" . DC  F 3 13  ? 12.261  67.978  -8.047  1.00 45.48  ? 13  DC  F "O4'" 1 
ATOM   6729 C  "C3'" . DC  F 3 13  ? 10.372  68.380  -9.431  1.00 46.63  ? 13  DC  F "C3'" 1 
ATOM   6730 O  "O3'" . DC  F 3 13  ? 10.520  67.714  -10.683 1.00 50.20  ? 13  DC  F "O3'" 1 
ATOM   6731 C  "C2'" . DC  F 3 13  ? 9.985   67.434  -8.312  1.00 47.37  ? 13  DC  F "C2'" 1 
ATOM   6732 C  "C1'" . DC  F 3 13  ? 11.335  66.932  -7.817  1.00 46.75  ? 13  DC  F "C1'" 1 
ATOM   6733 N  N1    . DC  F 3 13  ? 11.439  66.541  -6.395  1.00 46.77  ? 13  DC  F N1    1 
ATOM   6734 C  C2    . DC  F 3 13  ? 12.516  65.737  -6.015  1.00 45.88  ? 13  DC  F C2    1 
ATOM   6735 O  O2    . DC  F 3 13  ? 13.335  65.388  -6.877  1.00 46.78  ? 13  DC  F O2    1 
ATOM   6736 N  N3    . DC  F 3 13  ? 12.632  65.350  -4.724  1.00 45.43  ? 13  DC  F N3    1 
ATOM   6737 C  C4    . DC  F 3 13  ? 11.726  65.741  -3.826  1.00 45.38  ? 13  DC  F C4    1 
ATOM   6738 N  N4    . DC  F 3 13  ? 11.885  65.339  -2.564  1.00 45.21  ? 13  DC  F N4    1 
ATOM   6739 C  C5    . DC  F 3 13  ? 10.622  66.570  -4.183  1.00 46.19  ? 13  DC  F C5    1 
ATOM   6740 C  C6    . DC  F 3 13  ? 10.518  66.944  -5.467  1.00 47.39  ? 13  DC  F C6    1 
HETATM 6741 CA CA    . CA  G 4 .   ? 7.047   74.402  34.028  1.00 77.48  ? 401 CA  A CA    1 
HETATM 6742 CA CA    . CA  H 4 .   ? 7.375   71.843  32.452  1.00 69.94  ? 402 CA  A CA    1 
HETATM 6743 NA NA    . NA  I 5 .   ? -0.066  77.249  45.056  1.00 28.69  ? 403 NA  A NA    1 
HETATM 6744 C  C     . TRS J 6 .   ? 14.038  73.507  50.997  1.00 62.65  ? 101 TRS B C     1 
HETATM 6745 C  C1    . TRS J 6 .   ? 12.610  73.859  51.418  1.00 64.17  ? 101 TRS B C1    1 
HETATM 6746 C  C2    . TRS J 6 .   ? 14.995  74.680  51.213  1.00 61.09  ? 101 TRS B C2    1 
HETATM 6747 C  C3    . TRS J 6 .   ? 13.984  73.060  49.539  1.00 60.34  ? 101 TRS B C3    1 
HETATM 6748 N  N     . TRS J 6 .   ? 14.564  72.382  51.830  1.00 65.17  ? 101 TRS B N     1 
HETATM 6749 O  O1    . TRS J 6 .   ? 11.817  74.188  50.259  1.00 62.64  ? 101 TRS B O1    1 
HETATM 6750 O  O2    . TRS J 6 .   ? 16.324  74.334  50.801  1.00 55.44  ? 101 TRS B O2    1 
HETATM 6751 O  O3    . TRS J 6 .   ? 13.620  74.142  48.668  1.00 57.42  ? 101 TRS B O3    1 
HETATM 6752 N  N1    . DCP K 7 .   ? 8.983   58.783  -7.937  1.00 31.15  ? 401 DCP D N1    1 
HETATM 6753 C  C2    . DCP K 7 .   ? 9.195   58.074  -6.735  1.00 31.11  ? 401 DCP D C2    1 
HETATM 6754 N  N3    . DCP K 7 .   ? 8.765   58.576  -5.553  1.00 31.15  ? 401 DCP D N3    1 
HETATM 6755 C  C4    . DCP K 7 .   ? 8.102   59.762  -5.529  1.00 30.51  ? 401 DCP D C4    1 
HETATM 6756 C  C5    . DCP K 7 .   ? 7.877   60.459  -6.714  1.00 30.05  ? 401 DCP D C5    1 
HETATM 6757 C  C6    . DCP K 7 .   ? 8.333   59.943  -7.915  1.00 29.13  ? 401 DCP D C6    1 
HETATM 6758 O  O2    . DCP K 7 .   ? 9.800   56.986  -6.778  1.00 29.29  ? 401 DCP D O2    1 
HETATM 6759 N  N4    . DCP K 7 .   ? 7.652   60.279  -4.363  1.00 30.73  ? 401 DCP D N4    1 
HETATM 6760 C  "C1'" . DCP K 7 .   ? 9.452   58.186  -9.209  1.00 32.92  ? 401 DCP D "C1'" 1 
HETATM 6761 C  "C2'" . DCP K 7 .   ? 8.253   57.464  -9.807  1.00 32.58  ? 401 DCP D "C2'" 1 
HETATM 6762 C  "C3'" . DCP K 7 .   ? 7.763   58.367  -10.914 1.00 30.70  ? 401 DCP D "C3'" 1 
HETATM 6763 C  "C4'" . DCP K 7 .   ? 9.053   59.015  -11.385 1.00 30.51  ? 401 DCP D "C4'" 1 
HETATM 6764 O  "O4'" . DCP K 7 .   ? 9.846   59.155  -10.191 1.00 33.25  ? 401 DCP D "O4'" 1 
HETATM 6765 O  "O3'" . DCP K 7 .   ? 7.071   57.640  -11.943 1.00 27.79  ? 401 DCP D "O3'" 1 
HETATM 6766 C  "C5'" . DCP K 7 .   ? 8.858   60.363  -12.086 1.00 30.87  ? 401 DCP D "C5'" 1 
HETATM 6767 O  "O5'" . DCP K 7 .   ? 8.267   61.293  -11.188 1.00 29.99  ? 401 DCP D "O5'" 1 
HETATM 6768 P  PA    . DCP K 7 .   ? 7.239   62.413  -11.674 1.00 32.21  ? 401 DCP D PA    1 
HETATM 6769 O  O1A   . DCP K 7 .   ? 7.394   62.797  -13.132 1.00 30.91  ? 401 DCP D O1A   1 
HETATM 6770 O  O2A   . DCP K 7 .   ? 7.297   63.476  -10.626 1.00 30.87  ? 401 DCP D O2A   1 
HETATM 6771 O  O3A   . DCP K 7 .   ? 5.790   61.668  -11.627 1.00 31.05  ? 401 DCP D O3A   1 
HETATM 6772 P  PB    . DCP K 7 .   ? 5.206   60.567  -12.675 1.00 29.10  ? 401 DCP D PB    1 
HETATM 6773 O  O1B   . DCP K 7 .   ? 6.036   60.402  -13.956 1.00 25.87  ? 401 DCP D O1B   1 
HETATM 6774 O  O2B   . DCP K 7 .   ? 4.963   59.264  -11.940 1.00 28.09  ? 401 DCP D O2B   1 
HETATM 6775 O  O3B   . DCP K 7 .   ? 3.786   61.186  -13.044 1.00 27.92  ? 401 DCP D O3B   1 
HETATM 6776 P  PG    . DCP K 7 .   ? 3.493   62.559  -13.895 1.00 30.96  ? 401 DCP D PG    1 
HETATM 6777 O  O1G   . DCP K 7 .   ? 2.602   62.075  -15.014 1.00 27.92  ? 401 DCP D O1G   1 
HETATM 6778 O  O2G   . DCP K 7 .   ? 4.828   63.064  -14.386 1.00 30.75  ? 401 DCP D O2G   1 
HETATM 6779 O  O3G   . DCP K 7 .   ? 2.759   63.434  -12.924 1.00 29.47  ? 401 DCP D O3G   1 
HETATM 6780 CA CA    . CA  L 4 .   ? 6.778   62.185  -15.156 1.00 25.22  ? 402 CA  D CA    1 
HETATM 6781 CA CA    . CA  M 4 .   ? 9.458   64.010  -13.909 1.00 44.55  ? 403 CA  D CA    1 
HETATM 6782 NA NA    . NA  N 5 .   ? 5.750   73.659  -5.963  1.00 39.44  ? 404 NA  D NA    1 
HETATM 6783 C  C1    . GOL O 8 .   ? 11.166  46.145  -21.554 1.00 58.54  ? 405 GOL D C1    1 
HETATM 6784 O  O1    . GOL O 8 .   ? 10.688  47.465  -21.809 1.00 55.45  ? 405 GOL D O1    1 
HETATM 6785 C  C2    . GOL O 8 .   ? 11.783  46.054  -20.159 1.00 60.54  ? 405 GOL D C2    1 
HETATM 6786 O  O2    . GOL O 8 .   ? 11.991  47.347  -19.581 1.00 65.82  ? 405 GOL D O2    1 
HETATM 6787 C  C3    . GOL O 8 .   ? 13.143  45.383  -20.247 1.00 60.08  ? 405 GOL D C3    1 
HETATM 6788 O  O3    . GOL O 8 .   ? 14.061  46.315  -20.827 1.00 55.51  ? 405 GOL D O3    1 
HETATM 6789 C  C1    . GOL P 8 .   ? 17.714  73.649  -13.779 1.00 66.80  ? 406 GOL D C1    1 
HETATM 6790 O  O1    . GOL P 8 .   ? 16.754  74.487  -14.436 1.00 64.51  ? 406 GOL D O1    1 
HETATM 6791 C  C2    . GOL P 8 .   ? 17.529  72.202  -14.233 1.00 65.89  ? 406 GOL D C2    1 
HETATM 6792 O  O2    . GOL P 8 .   ? 18.654  71.823  -15.027 1.00 67.10  ? 406 GOL D O2    1 
HETATM 6793 C  C3    . GOL P 8 .   ? 17.403  71.237  -13.057 1.00 66.15  ? 406 GOL D C3    1 
HETATM 6794 O  O3    . GOL P 8 .   ? 18.043  70.004  -13.404 1.00 66.99  ? 406 GOL D O3    1 
HETATM 6795 O  O     . HOH Q 9 .   ? 8.696   69.908  34.277  1.00 35.91  ? 501 HOH A O     1 
HETATM 6796 O  O     . HOH Q 9 .   ? 5.471   74.588  35.918  1.00 35.03  ? 502 HOH A O     1 
HETATM 6797 O  O     . HOH Q 9 .   ? 7.752   72.102  35.529  1.00 43.11  ? 503 HOH A O     1 
HETATM 6798 O  O     . HOH Q 9 .   ? 4.242   71.219  30.711  1.00 46.12  ? 504 HOH A O     1 
HETATM 6799 O  O     . HOH Q 9 .   ? -10.618 81.295  42.280  1.00 27.84  ? 505 HOH A O     1 
HETATM 6800 O  O     . HOH Q 9 .   ? -1.973  89.520  30.922  1.00 28.30  ? 506 HOH A O     1 
HETATM 6801 O  O     . HOH Q 9 .   ? 2.267   91.136  48.722  1.00 26.14  ? 507 HOH A O     1 
HETATM 6802 O  O     . HOH Q 9 .   ? 0.234   78.272  42.996  1.00 31.36  ? 508 HOH A O     1 
HETATM 6803 O  O     . HOH Q 9 .   ? -10.812 84.223  28.302  1.00 31.78  ? 509 HOH A O     1 
HETATM 6804 O  O     . HOH Q 9 .   ? 19.550  88.921  51.088  1.00 28.97  ? 510 HOH A O     1 
HETATM 6805 O  O     . HOH Q 9 .   ? -13.021 77.572  28.151  1.00 26.10  ? 511 HOH A O     1 
HETATM 6806 O  O     . HOH Q 9 .   ? 36.746  80.424  43.717  1.00 31.04  ? 512 HOH A O     1 
HETATM 6807 O  O     . HOH Q 9 .   ? 15.207  82.908  61.380  1.00 50.10  ? 513 HOH A O     1 
HETATM 6808 O  O     . HOH Q 9 .   ? 38.156  73.627  58.166  1.00 36.41  ? 514 HOH A O     1 
HETATM 6809 O  O     . HOH Q 9 .   ? -16.640 81.407  47.951  1.00 29.88  ? 515 HOH A O     1 
HETATM 6810 O  O     . HOH Q 9 .   ? 5.309   67.929  32.567  1.00 44.25  ? 516 HOH A O     1 
HETATM 6811 O  O     . HOH Q 9 .   ? 36.958  74.506  60.324  1.00 30.26  ? 517 HOH A O     1 
HETATM 6812 O  O     . HOH Q 9 .   ? 1.214   92.603  26.033  1.00 25.17  ? 518 HOH A O     1 
HETATM 6813 O  O     . HOH Q 9 .   ? 32.817  74.323  53.253  1.00 33.82  ? 519 HOH A O     1 
HETATM 6814 O  O     . HOH Q 9 .   ? 38.127  92.022  53.104  1.00 33.76  ? 520 HOH A O     1 
HETATM 6815 O  O     . HOH Q 9 .   ? -3.022  76.196  38.559  1.00 32.30  ? 521 HOH A O     1 
HETATM 6816 O  O     . HOH Q 9 .   ? -0.455  76.904  47.569  1.00 44.21  ? 522 HOH A O     1 
HETATM 6817 O  O     . HOH Q 9 .   ? -13.188 92.487  56.112  1.00 39.03  ? 523 HOH A O     1 
HETATM 6818 O  O     . HOH Q 9 .   ? -9.901  74.017  25.346  1.00 30.65  ? 524 HOH A O     1 
HETATM 6819 O  O     . HOH Q 9 .   ? 34.287  99.191  43.501  1.00 36.70  ? 525 HOH A O     1 
HETATM 6820 O  O     . HOH Q 9 .   ? 2.324   95.777  51.857  1.00 31.09  ? 526 HOH A O     1 
HETATM 6821 O  O     . HOH Q 9 .   ? -17.437 77.907  31.786  1.00 43.82  ? 527 HOH A O     1 
HETATM 6822 O  O     . HOH Q 9 .   ? 40.577  94.323  51.515  1.00 42.84  ? 528 HOH A O     1 
HETATM 6823 O  O     . HOH Q 9 .   ? -5.154  69.265  26.335  1.00 45.62  ? 529 HOH A O     1 
HETATM 6824 O  O     . HOH Q 9 .   ? -16.807 82.694  26.663  1.00 45.73  ? 530 HOH A O     1 
HETATM 6825 O  O     . HOH Q 9 .   ? -1.663  93.400  23.484  1.00 38.37  ? 531 HOH A O     1 
HETATM 6826 O  O     . HOH Q 9 .   ? 3.357   69.253  22.154  1.00 39.44  ? 532 HOH A O     1 
HETATM 6827 O  O     . HOH Q 9 .   ? 4.146   87.021  34.477  1.00 37.91  ? 533 HOH A O     1 
HETATM 6828 O  O     . HOH Q 9 .   ? -14.968 86.688  51.734  1.00 34.36  ? 534 HOH A O     1 
HETATM 6829 O  O     . HOH Q 9 .   ? 26.037  60.629  44.791  1.00 45.67  ? 535 HOH A O     1 
HETATM 6830 O  O     . HOH Q 9 .   ? -16.999 78.307  29.017  1.00 35.39  ? 536 HOH A O     1 
HETATM 6831 O  O     . HOH Q 9 .   ? 39.146  86.848  40.157  1.00 34.03  ? 537 HOH A O     1 
HETATM 6832 O  O     . HOH Q 9 .   ? 18.809  94.587  35.168  1.00 41.34  ? 538 HOH A O     1 
HETATM 6833 O  O     . HOH Q 9 .   ? -14.716 80.616  51.301  1.00 36.00  ? 539 HOH A O     1 
HETATM 6834 O  O     . HOH Q 9 .   ? 11.933  70.251  34.093  1.00 45.50  ? 540 HOH A O     1 
HETATM 6835 O  O     . HOH Q 9 .   ? 10.592  72.515  35.431  1.00 48.72  ? 541 HOH A O     1 
HETATM 6836 O  O     . HOH Q 9 .   ? -9.404  89.227  33.217  1.00 42.14  ? 542 HOH A O     1 
HETATM 6837 O  O     . HOH Q 9 .   ? -17.264 80.679  45.330  1.00 28.64  ? 543 HOH A O     1 
HETATM 6838 O  O     . HOH Q 9 .   ? 7.345   58.507  31.634  1.00 47.39  ? 544 HOH A O     1 
HETATM 6839 O  O     . HOH Q 9 .   ? -12.317 74.408  39.022  1.00 42.15  ? 545 HOH A O     1 
HETATM 6840 O  O     . HOH Q 9 .   ? -12.061 97.028  50.965  1.00 34.46  ? 546 HOH A O     1 
HETATM 6841 O  O     . HOH Q 9 .   ? -10.716 93.701  49.317  1.00 37.70  ? 547 HOH A O     1 
HETATM 6842 O  O     . HOH Q 9 .   ? 18.247  86.494  50.296  1.00 41.16  ? 548 HOH A O     1 
HETATM 6843 O  O     . HOH Q 9 .   ? -15.157 75.239  37.797  1.00 49.43  ? 549 HOH A O     1 
HETATM 6844 O  O     . HOH Q 9 .   ? -0.034  90.728  19.673  1.00 40.92  ? 550 HOH A O     1 
HETATM 6845 O  O     . HOH Q 9 .   ? 1.070   84.330  35.221  1.00 40.72  ? 551 HOH A O     1 
HETATM 6846 O  O     . HOH Q 9 .   ? 3.181   91.097  35.086  1.00 40.43  ? 552 HOH A O     1 
HETATM 6847 O  O     . HOH Q 9 .   ? -8.462  84.673  61.233  1.00 43.14  ? 553 HOH A O     1 
HETATM 6848 O  O     . HOH Q 9 .   ? -9.814  98.402  53.626  1.00 50.06  ? 554 HOH A O     1 
HETATM 6849 O  O     . HOH Q 9 .   ? 4.455   76.559  48.314  1.00 36.84  ? 555 HOH A O     1 
HETATM 6850 O  O     . HOH Q 9 .   ? -11.825 79.586  55.239  1.00 39.51  ? 556 HOH A O     1 
HETATM 6851 O  O     . HOH Q 9 .   ? 16.897  69.449  15.544  1.00 53.61  ? 557 HOH A O     1 
HETATM 6852 O  O     . HOH Q 9 .   ? 35.757  96.761  50.866  1.00 48.14  ? 558 HOH A O     1 
HETATM 6853 O  O     . HOH Q 9 .   ? 24.310  76.405  27.709  1.00 58.59  ? 559 HOH A O     1 
HETATM 6854 O  O     . HOH Q 9 .   ? 23.605  59.118  39.271  1.00 51.31  ? 560 HOH A O     1 
HETATM 6855 O  O     . HOH Q 9 .   ? -14.507 83.626  25.028  1.00 42.83  ? 561 HOH A O     1 
HETATM 6856 O  O     . HOH Q 9 .   ? 36.117  82.012  60.584  1.00 35.84  ? 562 HOH A O     1 
HETATM 6857 O  O     . HOH Q 9 .   ? 24.440  99.719  35.991  1.00 53.13  ? 563 HOH A O     1 
HETATM 6858 O  O     . HOH Q 9 .   ? -14.548 86.854  31.506  1.00 34.77  ? 564 HOH A O     1 
HETATM 6859 O  O     . HOH Q 9 .   ? 36.699  81.996  36.270  1.00 39.59  ? 565 HOH A O     1 
HETATM 6860 O  O     . HOH Q 9 .   ? 34.275  76.294  44.709  1.00 44.48  ? 566 HOH A O     1 
HETATM 6861 O  O     . HOH Q 9 .   ? 38.462  91.440  55.749  1.00 36.90  ? 567 HOH A O     1 
HETATM 6862 O  O     . HOH Q 9 .   ? 40.623  89.772  55.221  1.00 39.76  ? 568 HOH A O     1 
HETATM 6863 O  O     . HOH Q 9 .   ? 34.518  86.841  61.482  1.00 46.00  ? 569 HOH A O     1 
HETATM 6864 O  O     . HOH Q 9 .   ? 8.742   66.274  37.786  1.00 38.77  ? 570 HOH A O     1 
HETATM 6865 O  O     . HOH Q 9 .   ? -17.074 85.605  37.907  0.50 20.31  ? 571 HOH A O     1 
HETATM 6866 O  O     . HOH Q 9 .   ? 4.508   63.533  32.613  1.00 50.65  ? 572 HOH A O     1 
HETATM 6867 O  O     . HOH Q 9 .   ? 34.115  75.050  60.788  1.00 42.03  ? 573 HOH A O     1 
HETATM 6868 O  O     . HOH Q 9 .   ? 5.376   70.360  33.029  1.00 51.38  ? 574 HOH A O     1 
HETATM 6869 O  O     . HOH R 9 .   ? 19.526  87.889  43.684  1.00 33.19  ? 201 HOH B O     1 
HETATM 6870 O  O     . HOH R 9 .   ? 8.930   92.028  55.039  1.00 37.70  ? 202 HOH B O     1 
HETATM 6871 O  O     . HOH R 9 .   ? 9.511   71.944  47.016  1.00 47.00  ? 203 HOH B O     1 
HETATM 6872 O  O     . HOH R 9 .   ? 10.175  85.916  43.454  1.00 31.70  ? 204 HOH B O     1 
HETATM 6873 O  O     . HOH R 9 .   ? 19.065  91.814  47.997  1.00 42.95  ? 205 HOH B O     1 
HETATM 6874 O  O     . HOH R 9 .   ? 15.979  92.104  47.592  1.00 33.01  ? 206 HOH B O     1 
HETATM 6875 O  O     . HOH R 9 .   ? 16.711  77.909  40.291  1.00 34.13  ? 207 HOH B O     1 
HETATM 6876 O  O     . HOH R 9 .   ? 16.282  76.711  48.813  1.00 39.40  ? 208 HOH B O     1 
HETATM 6877 O  O     . HOH R 9 .   ? 7.535   90.088  53.519  1.00 41.72  ? 209 HOH B O     1 
HETATM 6878 O  O     . HOH S 9 .   ? 2.095   76.649  44.874  1.00 35.48  ? 101 HOH C O     1 
HETATM 6879 O  O     . HOH S 9 .   ? 7.696   84.987  46.596  1.00 24.69  ? 102 HOH C O     1 
HETATM 6880 O  O     . HOH S 9 .   ? 18.653  86.796  55.336  1.00 38.96  ? 103 HOH C O     1 
HETATM 6881 O  O     . HOH S 9 .   ? 6.888   87.315  50.772  1.00 37.03  ? 104 HOH C O     1 
HETATM 6882 O  O     . HOH S 9 .   ? 13.215  108.601 71.026  1.00 34.73  ? 105 HOH C O     1 
HETATM 6883 O  O     . HOH S 9 .   ? 16.649  84.840  51.839  1.00 35.92  ? 106 HOH C O     1 
HETATM 6884 O  O     . HOH S 9 .   ? 13.888  76.877  36.085  1.00 45.90  ? 107 HOH C O     1 
HETATM 6885 O  O     . HOH S 9 .   ? 13.064  81.939  52.807  1.00 36.76  ? 108 HOH C O     1 
HETATM 6886 O  O     . HOH T 9 .   ? 18.011  77.575  -19.853 1.00 27.38  ? 501 HOH D O     1 
HETATM 6887 O  O     . HOH T 9 .   ? 8.321   65.531  -13.139 1.00 40.09  ? 502 HOH D O     1 
HETATM 6888 O  O     . HOH T 9 .   ? 10.921  63.255  -12.301 1.00 42.61  ? 503 HOH D O     1 
HETATM 6889 O  O     . HOH T 9 .   ? 4.223   63.895  -17.415 1.00 54.82  ? 504 HOH D O     1 
HETATM 6890 O  O     . HOH T 9 .   ? 9.717   81.969  -24.405 1.00 40.65  ? 505 HOH D O     1 
HETATM 6891 O  O     . HOH T 9 .   ? 7.666   74.011  -7.593  1.00 36.09  ? 506 HOH D O     1 
HETATM 6892 O  O     . HOH T 9 .   ? 3.370   61.491  -26.166 1.00 25.80  ? 507 HOH D O     1 
HETATM 6893 O  O     . HOH T 9 .   ? 32.294  62.910  0.310   1.00 33.37  ? 508 HOH D O     1 
HETATM 6894 O  O     . HOH T 9 .   ? 5.856   45.311  -10.670 1.00 35.81  ? 509 HOH D O     1 
HETATM 6895 O  O     . HOH T 9 .   ? -12.365 56.132  -2.483  1.00 33.66  ? 510 HOH D O     1 
HETATM 6896 O  O     . HOH T 9 .   ? 1.004   60.650  -27.381 1.00 32.24  ? 511 HOH D O     1 
HETATM 6897 O  O     . HOH T 9 .   ? -3.041  57.131  -16.569 1.00 29.07  ? 512 HOH D O     1 
HETATM 6898 O  O     . HOH T 9 .   ? 14.455  69.159  -14.255 1.00 25.88  ? 513 HOH D O     1 
HETATM 6899 O  O     . HOH T 9 .   ? 5.032   74.238  -12.456 1.00 25.72  ? 514 HOH D O     1 
HETATM 6900 O  O     . HOH T 9 .   ? 22.343  75.197  -24.150 1.00 33.36  ? 515 HOH D O     1 
HETATM 6901 O  O     . HOH T 9 .   ? 1.067   75.657  -26.558 1.00 27.43  ? 516 HOH D O     1 
HETATM 6902 O  O     . HOH T 9 .   ? 21.608  80.456  -8.153  1.00 38.86  ? 517 HOH D O     1 
HETATM 6903 O  O     . HOH T 9 .   ? -10.674 50.240  -5.304  1.00 48.85  ? 518 HOH D O     1 
HETATM 6904 O  O     . HOH T 9 .   ? -11.094 43.216  -6.849  1.00 36.78  ? 519 HOH D O     1 
HETATM 6905 O  O     . HOH T 9 .   ? 11.185  63.102  -36.124 1.00 46.05  ? 520 HOH D O     1 
HETATM 6906 O  O     . HOH T 9 .   ? 5.345   59.764  -26.584 1.00 29.25  ? 521 HOH D O     1 
HETATM 6907 O  O     . HOH T 9 .   ? 21.149  57.960  -29.676 1.00 37.77  ? 522 HOH D O     1 
HETATM 6908 O  O     . HOH T 9 .   ? 12.091  55.991  -7.553  1.00 33.82  ? 523 HOH D O     1 
HETATM 6909 O  O     . HOH T 9 .   ? 39.569  63.740  -11.138 1.00 37.27  ? 524 HOH D O     1 
HETATM 6910 O  O     . HOH T 9 .   ? 40.077  47.225  0.213   1.00 46.92  ? 525 HOH D O     1 
HETATM 6911 O  O     . HOH T 9 .   ? 36.760  44.349  9.644   1.00 52.20  ? 526 HOH D O     1 
HETATM 6912 O  O     . HOH T 9 .   ? 7.956   71.338  -10.973 1.00 46.00  ? 527 HOH D O     1 
HETATM 6913 O  O     . HOH T 9 .   ? 8.539   93.881  -7.986  1.00 46.02  ? 528 HOH D O     1 
HETATM 6914 O  O     . HOH T 9 .   ? -6.326  45.518  -4.399  1.00 34.03  ? 529 HOH D O     1 
HETATM 6915 O  O     . HOH T 9 .   ? 1.808   59.527  -8.529  1.00 37.00  ? 530 HOH D O     1 
HETATM 6916 O  O     . HOH T 9 .   ? 33.098  68.496  -4.055  1.00 38.55  ? 531 HOH D O     1 
HETATM 6917 O  O     . HOH T 9 .   ? 6.432   71.166  -1.658  1.00 44.54  ? 532 HOH D O     1 
HETATM 6918 O  O     . HOH T 9 .   ? 20.767  73.826  -30.482 1.00 33.27  ? 533 HOH D O     1 
HETATM 6919 O  O     . HOH T 9 .   ? 1.263   43.345  -14.112 1.00 42.44  ? 534 HOH D O     1 
HETATM 6920 O  O     . HOH T 9 .   ? 19.949  78.879  -1.782  1.00 39.91  ? 535 HOH D O     1 
HETATM 6921 O  O     . HOH T 9 .   ? 14.878  75.371  -39.647 1.00 44.77  ? 536 HOH D O     1 
HETATM 6922 O  O     . HOH T 9 .   ? 6.148   86.192  -27.853 1.00 40.72  ? 537 HOH D O     1 
HETATM 6923 O  O     . HOH T 9 .   ? 14.525  46.183  -10.734 1.00 47.79  ? 538 HOH D O     1 
HETATM 6924 O  O     . HOH T 9 .   ? 3.035   44.924  -15.383 1.00 34.61  ? 539 HOH D O     1 
HETATM 6925 O  O     . HOH T 9 .   ? 24.661  59.115  -0.549  1.00 50.13  ? 540 HOH D O     1 
HETATM 6926 O  O     . HOH T 9 .   ? 1.098   54.027  -22.780 1.00 49.33  ? 541 HOH D O     1 
HETATM 6927 O  O     . HOH T 9 .   ? -5.374  55.620  -15.809 1.00 40.21  ? 542 HOH D O     1 
HETATM 6928 O  O     . HOH T 9 .   ? 15.199  74.474  -11.889 1.00 34.50  ? 543 HOH D O     1 
HETATM 6929 O  O     . HOH T 9 .   ? -4.369  61.040  -23.054 1.00 60.83  ? 544 HOH D O     1 
HETATM 6930 O  O     . HOH T 9 .   ? -4.810  63.799  -21.955 1.00 47.95  ? 545 HOH D O     1 
HETATM 6931 O  O     . HOH T 9 .   ? 10.170  87.041  -22.746 1.00 37.14  ? 546 HOH D O     1 
HETATM 6932 O  O     . HOH T 9 .   ? 8.633   50.531  -23.305 1.00 38.88  ? 547 HOH D O     1 
HETATM 6933 O  O     . HOH T 9 .   ? 17.722  52.896  -0.485  1.00 40.34  ? 548 HOH D O     1 
HETATM 6934 O  O     . HOH T 9 .   ? 35.998  55.250  -11.552 1.00 43.80  ? 549 HOH D O     1 
HETATM 6935 O  O     . HOH T 9 .   ? -1.271  69.442  -24.519 1.00 34.99  ? 550 HOH D O     1 
HETATM 6936 O  O     . HOH T 9 .   ? 7.989   84.159  -28.682 1.00 47.24  ? 551 HOH D O     1 
HETATM 6937 O  O     . HOH T 9 .   ? 17.343  57.393  -36.634 1.00 44.09  ? 552 HOH D O     1 
HETATM 6938 O  O     . HOH T 9 .   ? 18.073  57.275  -17.864 1.00 31.93  ? 553 HOH D O     1 
HETATM 6939 O  O     . HOH T 9 .   ? 27.506  74.493  -29.706 1.00 48.98  ? 554 HOH D O     1 
HETATM 6940 O  O     . HOH T 9 .   ? -10.442 49.777  -7.871  1.00 46.07  ? 555 HOH D O     1 
HETATM 6941 O  O     . HOH T 9 .   ? 19.982  57.208  -19.677 1.00 40.92  ? 556 HOH D O     1 
HETATM 6942 O  O     . HOH T 9 .   ? 20.678  56.604  -22.257 1.00 40.15  ? 557 HOH D O     1 
HETATM 6943 O  O     . HOH T 9 .   ? 20.443  81.486  -12.544 1.00 42.97  ? 558 HOH D O     1 
HETATM 6944 O  O     . HOH T 9 .   ? -0.841  72.978  -27.490 1.00 41.91  ? 559 HOH D O     1 
HETATM 6945 O  O     . HOH T 9 .   ? 7.562   71.896  0.721   1.00 46.98  ? 560 HOH D O     1 
HETATM 6946 O  O     . HOH T 9 .   ? 6.053   62.576  -3.929  1.00 46.59  ? 561 HOH D O     1 
HETATM 6947 O  O     . HOH T 9 .   ? 8.478   46.727  -3.298  1.00 37.12  ? 562 HOH D O     1 
HETATM 6948 O  O     . HOH U 9 .   ? 28.620  77.488  9.714   1.00 48.16  ? 101 HOH E O     1 
HETATM 6949 O  O     . HOH V 9 .   ? 6.999   72.040  -5.819  1.00 36.69  ? 101 HOH F O     1 
HETATM 6950 O  O     . HOH V 9 .   ? 10.301  69.383  -1.274  1.00 33.77  ? 102 HOH F O     1 
HETATM 6951 O  O     . HOH V 9 .   ? 8.392   69.738  -2.940  1.00 38.43  ? 103 HOH F O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 1   ? 0.4423 0.6114 0.5870 -0.0881 -0.1534 0.1668  1   MET A N     
2    C CA    . MET A 1   ? 0.4319 0.6183 0.5466 -0.0903 -0.1408 0.1619  1   MET A CA    
3    C C     . MET A 1   ? 0.3981 0.5929 0.4807 -0.0851 -0.1249 0.1420  1   MET A C     
4    O O     . MET A 1   ? 0.3645 0.5430 0.4488 -0.0757 -0.1203 0.1276  1   MET A O     
5    C CB    . MET A 1   ? 0.4538 0.6206 0.5775 -0.0800 -0.1354 0.1498  1   MET A CB    
6    C CG    . MET A 1   ? 0.4953 0.6757 0.5950 -0.0808 -0.1239 0.1445  1   MET A CG    
7    S SD    . MET A 1   ? 0.5481 0.7053 0.6656 -0.0708 -0.1225 0.1356  1   MET A SD    
8    C CE    . MET A 1   ? 0.4852 0.6147 0.6110 -0.0538 -0.1150 0.1102  1   MET A CE    
9    N N     . ILE A 2   ? 0.3803 0.6019 0.4367 -0.0911 -0.1171 0.1402  2   ILE A N     
10   C CA    . ILE A 2   ? 0.3607 0.5893 0.3920 -0.0849 -0.1032 0.1180  2   ILE A CA    
11   C C     . ILE A 2   ? 0.3500 0.5881 0.3663 -0.0819 -0.0924 0.1068  2   ILE A C     
12   O O     . ILE A 2   ? 0.3526 0.6175 0.3626 -0.0924 -0.0947 0.1184  2   ILE A O     
13   C CB    . ILE A 2   ? 0.3692 0.6293 0.3857 -0.0958 -0.1060 0.1230  2   ILE A CB    
14   C CG1   . ILE A 2   ? 0.3696 0.6165 0.4007 -0.0963 -0.1154 0.1302  2   ILE A CG1   
15   C CG2   . ILE A 2   ? 0.3599 0.6327 0.3532 -0.0901 -0.0929 0.0980  2   ILE A CG2   
16   C CD1   . ILE A 2   ? 0.3944 0.6727 0.4136 -0.1087 -0.1208 0.1387  2   ILE A CD1   
17   N N     . VAL A 3   ? 0.3384 0.5567 0.3496 -0.0686 -0.0814 0.0852  3   VAL A N     
18   C CA    . VAL A 3   ? 0.3345 0.5568 0.3361 -0.0642 -0.0723 0.0742  3   VAL A CA    
19   C C     . VAL A 3   ? 0.3315 0.5624 0.3172 -0.0585 -0.0625 0.0521  3   VAL A C     
20   O O     . VAL A 3   ? 0.3214 0.5368 0.3083 -0.0519 -0.0608 0.0415  3   VAL A O     
21   C CB    . VAL A 3   ? 0.3143 0.5059 0.3281 -0.0537 -0.0695 0.0689  3   VAL A CB    
22   C CG1   . VAL A 3   ? 0.3069 0.5034 0.3111 -0.0498 -0.0609 0.0587  3   VAL A CG1   
23   C CG2   . VAL A 3   ? 0.3195 0.5013 0.3550 -0.0578 -0.0806 0.0868  3   VAL A CG2   
24   N N     . LEU A 4   ? 0.3338 0.5903 0.3078 -0.0611 -0.0572 0.0447  4   LEU A N     
25   C CA    . LEU A 4   ? 0.3386 0.6045 0.3035 -0.0547 -0.0495 0.0206  4   LEU A CA    
26   C C     . LEU A 4   ? 0.3398 0.5997 0.3050 -0.0471 -0.0426 0.0087  4   LEU A C     
27   O O     . LEU A 4   ? 0.3572 0.6383 0.3186 -0.0525 -0.0412 0.0136  4   LEU A O     
28   C CB    . LEU A 4   ? 0.3530 0.6632 0.3056 -0.0648 -0.0500 0.0171  4   LEU A CB    
29   C CG    . LEU A 4   ? 0.3565 0.6811 0.3043 -0.0586 -0.0445 -0.0111 4   LEU A CG    
30   C CD1   . LEU A 4   ? 0.3576 0.7233 0.2952 -0.0692 -0.0474 -0.0130 4   LEU A CD1   
31   C CD2   . LEU A 4   ? 0.3596 0.6961 0.3070 -0.0530 -0.0374 -0.0287 4   LEU A CD2   
32   N N     . PHE A 5   ? 0.3206 0.5536 0.2914 -0.0357 -0.0390 -0.0054 5   PHE A N     
33   C CA    . PHE A 5   ? 0.3162 0.5400 0.2900 -0.0280 -0.0338 -0.0157 5   PHE A CA    
34   C C     . PHE A 5   ? 0.3167 0.5542 0.2906 -0.0229 -0.0306 -0.0391 5   PHE A C     
35   O O     . PHE A 5   ? 0.3157 0.5491 0.2928 -0.0199 -0.0324 -0.0499 5   PHE A O     
36   C CB    . PHE A 5   ? 0.3157 0.5027 0.2982 -0.0202 -0.0338 -0.0135 5   PHE A CB    
37   C CG    . PHE A 5   ? 0.3120 0.4874 0.2986 -0.0126 -0.0299 -0.0228 5   PHE A CG    
38   C CD1   . PHE A 5   ? 0.3067 0.4838 0.2931 -0.0133 -0.0281 -0.0168 5   PHE A CD1   
39   C CD2   . PHE A 5   ? 0.3132 0.4744 0.3061 -0.0055 -0.0297 -0.0353 5   PHE A CD2   
40   C CE1   . PHE A 5   ? 0.3050 0.4710 0.2956 -0.0068 -0.0252 -0.0241 5   PHE A CE1   
41   C CE2   . PHE A 5   ? 0.3240 0.4739 0.3229 0.0003  -0.0280 -0.0408 5   PHE A CE2   
42   C CZ    . PHE A 5   ? 0.3099 0.4625 0.3068 -0.0001 -0.0254 -0.0356 5   PHE A CZ    
43   N N     . VAL A 6   ? 0.3163 0.5703 0.2899 -0.0216 -0.0267 -0.0478 6   VAL A N     
44   C CA    . VAL A 6   ? 0.3314 0.6006 0.3106 -0.0157 -0.0246 -0.0731 6   VAL A CA    
45   C C     . VAL A 6   ? 0.3312 0.5785 0.3217 -0.0063 -0.0231 -0.0804 6   VAL A C     
46   O O     . VAL A 6   ? 0.3284 0.5740 0.3166 -0.0074 -0.0207 -0.0709 6   VAL A O     
47   C CB    . VAL A 6   ? 0.3253 0.6430 0.2966 -0.0228 -0.0213 -0.0812 6   VAL A CB    
48   C CG1   . VAL A 6   ? 0.3344 0.6706 0.3163 -0.0153 -0.0200 -0.1127 6   VAL A CG1   
49   C CG2   . VAL A 6   ? 0.3310 0.6752 0.2897 -0.0351 -0.0238 -0.0687 6   VAL A CG2   
50   N N     . ASP A 7   ? 0.3494 0.5818 0.3540 0.0021  -0.0259 -0.0967 7   ASP A N     
51   C CA    . ASP A 7   ? 0.3526 0.5625 0.3713 0.0102  -0.0272 -0.1017 7   ASP A CA    
52   C C     . ASP A 7   ? 0.3505 0.5724 0.3874 0.0171  -0.0302 -0.1287 7   ASP A C     
53   O O     . ASP A 7   ? 0.3628 0.5804 0.4097 0.0196  -0.0353 -0.1394 7   ASP A O     
54   C CB    . ASP A 7   ? 0.3724 0.5459 0.3960 0.0124  -0.0312 -0.0894 7   ASP A CB    
55   C CG    . ASP A 7   ? 0.3823 0.5342 0.4193 0.0184  -0.0337 -0.0893 7   ASP A CG    
56   O OD1   . ASP A 7   ? 0.4208 0.5803 0.4701 0.0232  -0.0348 -0.1036 7   ASP A OD1   
57   O OD2   . ASP A 7   ? 0.4105 0.5396 0.4473 0.0178  -0.0352 -0.0752 7   ASP A OD2   
58   N N     . PHE A 8   ? 0.3575 0.5943 0.4022 0.0208  -0.0281 -0.1409 8   PHE A N     
59   C CA    . PHE A 8   ? 0.3814 0.6359 0.4478 0.0279  -0.0315 -0.1710 8   PHE A CA    
60   C C     . PHE A 8   ? 0.3867 0.6062 0.4794 0.0362  -0.0413 -0.1757 8   PHE A C     
61   O O     . PHE A 8   ? 0.3745 0.5670 0.4696 0.0373  -0.0430 -0.1597 8   PHE A O     
62   C CB    . PHE A 8   ? 0.3914 0.6765 0.4606 0.0293  -0.0264 -0.1843 8   PHE A CB    
63   C CG    . PHE A 8   ? 0.3894 0.7058 0.4330 0.0188  -0.0180 -0.1710 8   PHE A CG    
64   C CD1   . PHE A 8   ? 0.4052 0.7330 0.4290 0.0093  -0.0164 -0.1572 8   PHE A CD1   
65   C CD2   . PHE A 8   ? 0.4011 0.7364 0.4429 0.0178  -0.0129 -0.1710 8   PHE A CD2   
66   C CE1   . PHE A 8   ? 0.4232 0.7797 0.4274 -0.0019 -0.0113 -0.1415 8   PHE A CE1   
67   C CE2   . PHE A 8   ? 0.4057 0.7705 0.4268 0.0066  -0.0070 -0.1560 8   PHE A CE2   
68   C CZ    . PHE A 8   ? 0.4133 0.7885 0.4164 -0.0037 -0.0068 -0.1403 8   PHE A CZ    
69   N N     . ASP A 9   ? 0.4157 0.6376 0.5294 0.0411  -0.0488 -0.1968 9   ASP A N     
70   C CA    . ASP A 9   ? 0.4269 0.6154 0.5694 0.0470  -0.0611 -0.1981 9   ASP A CA    
71   C C     . ASP A 9   ? 0.4410 0.6220 0.6108 0.0545  -0.0670 -0.2079 9   ASP A C     
72   O O     . ASP A 9   ? 0.4274 0.6354 0.6110 0.0598  -0.0661 -0.2335 9   ASP A O     
73   C CB    . ASP A 9   ? 0.4342 0.6286 0.5966 0.0502  -0.0693 -0.2200 9   ASP A CB    
74   C CG    . ASP A 9   ? 0.4306 0.6270 0.5699 0.0429  -0.0659 -0.2084 9   ASP A CG    
75   O OD1   . ASP A 9   ? 0.4334 0.6086 0.5537 0.0370  -0.0629 -0.1802 9   ASP A OD1   
76   O OD2   . ASP A 9   ? 0.4306 0.6517 0.5727 0.0431  -0.0666 -0.2290 9   ASP A OD2   
77   N N     . TYR A 10  ? 0.4501 0.5973 0.6282 0.0543  -0.0735 -0.1873 10  TYR A N     
78   C CA    . TYR A 10  ? 0.4519 0.5864 0.6571 0.0599  -0.0816 -0.1900 10  TYR A CA    
79   C C     . TYR A 10  ? 0.4310 0.5952 0.6400 0.0648  -0.0755 -0.2113 10  TYR A C     
80   O O     . TYR A 10  ? 0.4557 0.6287 0.6986 0.0731  -0.0836 -0.2370 10  TYR A O     
81   C CB    . TYR A 10  ? 0.4905 0.6042 0.7379 0.0647  -0.0998 -0.1988 10  TYR A CB    
82   C CG    . TYR A 10  ? 0.5378 0.6697 0.8121 0.0716  -0.1065 -0.2336 10  TYR A CG    
83   C CD1   . TYR A 10  ? 0.5468 0.6812 0.8144 0.0687  -0.1070 -0.2372 10  TYR A CD1   
84   C CD2   . TYR A 10  ? 0.5629 0.7099 0.8733 0.0814  -0.1135 -0.2649 10  TYR A CD2   
85   C CE1   . TYR A 10  ? 0.5509 0.7038 0.8443 0.0750  -0.1137 -0.2711 10  TYR A CE1   
86   C CE2   . TYR A 10  ? 0.5666 0.7332 0.9052 0.0883  -0.1202 -0.3008 10  TYR A CE2   
87   C CZ    . TYR A 10  ? 0.5751 0.7448 0.9044 0.0850  -0.1203 -0.3038 10  TYR A CZ    
88   O OH    . TYR A 10  ? 0.6077 0.7993 0.9659 0.0920  -0.1273 -0.3417 10  TYR A OH    
89   N N     . PHE A 11  ? 0.4016 0.5820 0.5778 0.0594  -0.0620 -0.1998 11  PHE A N     
90   C CA    . PHE A 11  ? 0.4002 0.6209 0.5699 0.0603  -0.0529 -0.2190 11  PHE A CA    
91   C C     . PHE A 11  ? 0.4104 0.6415 0.6120 0.0693  -0.0579 -0.2420 11  PHE A C     
92   O O     . PHE A 11  ? 0.4255 0.6878 0.6453 0.0747  -0.0587 -0.2738 11  PHE A O     
93   C CB    . PHE A 11  ? 0.3898 0.6202 0.5230 0.0516  -0.0404 -0.1964 11  PHE A CB    
94   C CG    . PHE A 11  ? 0.3813 0.6582 0.5039 0.0490  -0.0310 -0.2108 11  PHE A CG    
95   C CD1   . PHE A 11  ? 0.3843 0.6980 0.5047 0.0473  -0.0283 -0.2314 11  PHE A CD1   
96   C CD2   . PHE A 11  ? 0.3828 0.6700 0.4973 0.0470  -0.0249 -0.2029 11  PHE A CD2   
97   C CE1   . PHE A 11  ? 0.3904 0.7539 0.5003 0.0429  -0.0196 -0.2436 11  PHE A CE1   
98   C CE2   . PHE A 11  ? 0.3800 0.7140 0.4854 0.0430  -0.0166 -0.2143 11  PHE A CE2   
99   C CZ    . PHE A 11  ? 0.3847 0.7589 0.4872 0.0404  -0.0137 -0.2341 11  PHE A CZ    
100  N N     . TYR A 12  ? 0.4057 0.6133 0.6154 0.0709  -0.0617 -0.2273 12  TYR A N     
101  C CA    . TYR A 12  ? 0.4089 0.6276 0.6469 0.0787  -0.0656 -0.2460 12  TYR A CA    
102  C C     . TYR A 12  ? 0.4200 0.6379 0.7054 0.0889  -0.0803 -0.2762 12  TYR A C     
103  O O     . TYR A 12  ? 0.4121 0.6626 0.7183 0.0958  -0.0797 -0.3088 12  TYR A O     
104  C CB    . TYR A 12  ? 0.3974 0.5877 0.6367 0.0778  -0.0692 -0.2220 12  TYR A CB    
105  C CG    . TYR A 12  ? 0.3844 0.5763 0.5845 0.0695  -0.0565 -0.1965 12  TYR A CG    
106  C CD1   . TYR A 12  ? 0.3823 0.6026 0.5515 0.0632  -0.0432 -0.1954 12  TYR A CD1   
107  C CD2   . TYR A 12  ? 0.3748 0.5411 0.5720 0.0674  -0.0594 -0.1734 12  TYR A CD2   
108  C CE1   . TYR A 12  ? 0.3687 0.5878 0.5088 0.0558  -0.0345 -0.1722 12  TYR A CE1   
109  C CE2   . TYR A 12  ? 0.3602 0.5275 0.5267 0.0607  -0.0495 -0.1531 12  TYR A CE2   
110  C CZ    . TYR A 12  ? 0.3638 0.5557 0.5036 0.0553  -0.0376 -0.1527 12  TYR A CZ    
111  O OH    . TYR A 12  ? 0.3710 0.5616 0.4861 0.0488  -0.0304 -0.1325 12  TYR A OH    
112  N N     . ALA A 13  ? 0.4391 0.6221 0.7434 0.0894  -0.0939 -0.2658 13  ALA A N     
113  C CA    . ALA A 13  ? 0.4429 0.6209 0.7968 0.0983  -0.1109 -0.2924 13  ALA A CA    
114  C C     . ALA A 13  ? 0.4715 0.6860 0.8279 0.1017  -0.1064 -0.3269 13  ALA A C     
115  O O     . ALA A 13  ? 0.5050 0.7388 0.9017 0.1117  -0.1146 -0.3639 13  ALA A O     
116  C CB    . ALA A 13  ? 0.4329 0.5692 0.8016 0.0950  -0.1259 -0.2695 13  ALA A CB    
117  N N     . GLN A 14  ? 0.4742 0.7012 0.7898 0.0935  -0.0942 -0.3165 14  GLN A N     
118  C CA    . GLN A 14  ? 0.4957 0.7609 0.8101 0.0947  -0.0899 -0.3469 14  GLN A CA    
119  C C     . GLN A 14  ? 0.5068 0.8244 0.8215 0.0980  -0.0799 -0.3768 14  GLN A C     
120  O O     . GLN A 14  ? 0.5011 0.8530 0.8399 0.1044  -0.0827 -0.4160 14  GLN A O     
121  C CB    . GLN A 14  ? 0.4863 0.7555 0.7558 0.0837  -0.0792 -0.3259 14  GLN A CB    
122  C CG    . GLN A 14  ? 0.5100 0.7991 0.7883 0.0850  -0.0827 -0.3509 14  GLN A CG    
123  C CD    . GLN A 14  ? 0.4968 0.7990 0.7311 0.0738  -0.0716 -0.3334 14  GLN A CD    
124  O OE1   . GLN A 14  ? 0.5016 0.8367 0.7332 0.0727  -0.0698 -0.3552 14  GLN A OE1   
125  N NE2   . GLN A 14  ? 0.4863 0.7647 0.6882 0.0655  -0.0652 -0.2951 14  GLN A NE2   
126  N N     . VAL A 15  ? 0.5129 0.8396 0.8016 0.0931  -0.0685 -0.3592 15  VAL A N     
127  C CA    . VAL A 15  ? 0.5415 0.9208 0.8275 0.0941  -0.0581 -0.3829 15  VAL A CA    
128  C C     . VAL A 15  ? 0.5706 0.9586 0.9095 0.1079  -0.0688 -0.4192 15  VAL A C     
129  O O     . VAL A 15  ? 0.5758 1.0155 0.9288 0.1123  -0.0646 -0.4570 15  VAL A O     
130  C CB    . VAL A 15  ? 0.5293 0.9126 0.7789 0.0852  -0.0453 -0.3530 15  VAL A CB    
131  C CG1   . VAL A 15  ? 0.5404 0.9770 0.7942 0.0866  -0.0366 -0.3772 15  VAL A CG1   
132  C CG2   . VAL A 15  ? 0.5085 0.8947 0.7113 0.0718  -0.0352 -0.3243 15  VAL A CG2   
133  N N     . GLU A 16  ? 0.5855 0.9261 0.9558 0.1142  -0.0836 -0.4084 16  GLU A N     
134  C CA    . GLU A 16  ? 0.6120 0.9540 1.0408 0.1278  -0.0981 -0.4413 16  GLU A CA    
135  C C     . GLU A 16  ? 0.6309 0.9894 1.0995 0.1366  -0.1093 -0.4828 16  GLU A C     
136  O O     . GLU A 16  ? 0.6335 1.0235 1.1437 0.1476  -0.1146 -0.5257 16  GLU A O     
137  C CB    . GLU A 16  ? 0.6048 0.8909 1.0594 0.1303  -0.1143 -0.4153 16  GLU A CB    
138  C CG    . GLU A 16  ? 0.6021 0.8755 1.0265 0.1238  -0.1053 -0.3816 16  GLU A CG    
139  C CD    . GLU A 16  ? 0.6126 0.9240 1.0452 0.1287  -0.0976 -0.4033 16  GLU A CD    
140  O OE1   . GLU A 16  ? 0.6067 0.9381 1.0873 0.1403  -0.1068 -0.4421 16  GLU A OE1   
141  O OE2   . GLU A 16  ? 0.6039 0.9256 0.9975 0.1209  -0.0831 -0.3820 16  GLU A OE2   
142  N N     . GLU A 17  ? 0.6364 0.9747 1.0942 0.1321  -0.1133 -0.4715 17  GLU A N     
143  C CA    . GLU A 17  ? 0.6639 1.0177 1.1555 0.1391  -0.1235 -0.5093 17  GLU A CA    
144  C C     . GLU A 17  ? 0.6550 1.0781 1.1306 0.1387  -0.1087 -0.5460 17  GLU A C     
145  O O     . GLU A 17  ? 0.6716 1.1249 1.1882 0.1487  -0.1166 -0.5931 17  GLU A O     
146  C CB    . GLU A 17  ? 0.6814 1.0009 1.1585 0.1325  -0.1290 -0.4854 17  GLU A CB    
147  C CG    . GLU A 17  ? 0.7016 0.9584 1.2020 0.1322  -0.1470 -0.4536 17  GLU A CG    
148  C CD    . GLU A 17  ? 0.7307 0.9641 1.2397 0.1297  -0.1579 -0.4487 17  GLU A CD    
149  O OE1   . GLU A 17  ? 0.7343 0.9773 1.2895 0.1388  -0.1718 -0.4860 17  GLU A OE1   
150  O OE2   . GLU A 17  ? 0.7138 0.9216 1.1853 0.1190  -0.1528 -0.4098 17  GLU A OE2   
151  N N     . VAL A 18  ? 0.6409 1.0911 1.0587 0.1262  -0.0886 -0.5244 18  VAL A N     
152  C CA    . VAL A 18  ? 0.6516 1.1746 1.0504 0.1227  -0.0737 -0.5536 18  VAL A CA    
153  C C     . VAL A 18  ? 0.6542 1.2154 1.0884 0.1328  -0.0737 -0.5910 18  VAL A C     
154  O O     . VAL A 18  ? 0.6632 1.2693 1.1309 0.1414  -0.0771 -0.6408 18  VAL A O     
155  C CB    . VAL A 18  ? 0.6426 1.1847 0.9766 0.1058  -0.0545 -0.5165 18  VAL A CB    
156  C CG1   . VAL A 18  ? 0.6384 1.2607 0.9565 0.1006  -0.0398 -0.5425 18  VAL A CG1   
157  C CG2   . VAL A 18  ? 0.6348 1.1554 0.9370 0.0962  -0.0538 -0.4903 18  VAL A CG2   
158  N N     . LEU A 19  ? 0.6636 1.2070 1.0927 0.1323  -0.0706 -0.5684 19  LEU A N     
159  C CA    . LEU A 19  ? 0.6707 1.2495 1.1308 0.1411  -0.0696 -0.5996 19  LEU A CA    
160  C C     . LEU A 19  ? 0.6993 1.2640 1.2331 0.1592  -0.0905 -0.6401 19  LEU A C     
161  O O     . LEU A 19  ? 0.7062 1.3099 1.2746 0.1687  -0.0911 -0.6783 19  LEU A O     
162  C CB    . LEU A 19  ? 0.6523 1.2088 1.0908 0.1361  -0.0631 -0.5626 19  LEU A CB    
163  C CG    . LEU A 19  ? 0.6504 1.2315 1.0246 0.1190  -0.0432 -0.5291 19  LEU A CG    
164  C CD1   . LEU A 19  ? 0.6521 1.2032 1.0101 0.1151  -0.0397 -0.4927 19  LEU A CD1   
165  C CD2   . LEU A 19  ? 0.6568 1.3218 1.0180 0.1140  -0.0288 -0.5599 19  LEU A CD2   
166  N N     . ASN A 20  ? 0.7239 1.2343 1.2843 0.1636  -0.1087 -0.6315 20  ASN A N     
167  C CA    . ASN A 20  ? 0.7526 1.2492 1.3877 0.1798  -0.1318 -0.6700 20  ASN A CA    
168  C C     . ASN A 20  ? 0.7669 1.2385 1.4193 0.1811  -0.1457 -0.6758 20  ASN A C     
169  O O     . ASN A 20  ? 0.7614 1.1710 1.4224 0.1790  -0.1599 -0.6419 20  ASN A O     
170  C CB    . ASN A 20  ? 0.7622 1.2040 1.4331 0.1855  -0.1483 -0.6480 20  ASN A CB    
171  C CG    . ASN A 20  ? 0.7869 1.2084 1.5413 0.2014  -0.1763 -0.6829 20  ASN A CG    
172  O OD1   . ASN A 20  ? 0.7509 1.2102 1.5423 0.2111  -0.1816 -0.7346 20  ASN A OD1   
173  N ND2   . ASN A 20  ? 0.8034 1.1665 1.5896 0.2033  -0.1957 -0.6546 20  ASN A ND2   
174  N N     . PRO A 21  ? 0.7771 1.2999 1.4365 0.1841  -0.1422 -0.7195 21  PRO A N     
175  C CA    . PRO A 21  ? 0.7890 1.2930 1.4645 0.1852  -0.1548 -0.7279 21  PRO A CA    
176  C C     . PRO A 21  ? 0.8041 1.2458 1.5462 0.1953  -0.1848 -0.7269 21  PRO A C     
177  O O     . PRO A 21  ? 0.8051 1.2093 1.5481 0.1915  -0.1953 -0.7085 21  PRO A O     
178  C CB    . PRO A 21  ? 0.7988 1.3771 1.4915 0.1915  -0.1499 -0.7899 21  PRO A CB    
179  C CG    . PRO A 21  ? 0.7911 1.4312 1.4391 0.1843  -0.1253 -0.7926 21  PRO A CG    
180  C CD    . PRO A 21  ? 0.7805 1.3864 1.4298 0.1850  -0.1254 -0.7620 21  PRO A CD    
181  N N     . SER A 22  ? 0.8213 1.2530 1.6190 0.2071  -0.1991 -0.7442 22  SER A N     
182  C CA    . SER A 22  ? 0.8417 1.2164 1.7098 0.2160  -0.2305 -0.7416 22  SER A CA    
183  C C     . SER A 22  ? 0.8466 1.1530 1.6928 0.2043  -0.2387 -0.6788 22  SER A C     
184  O O     . SER A 22  ? 0.8583 1.1237 1.7503 0.2068  -0.2633 -0.6743 22  SER A O     
185  C CB    . SER A 22  ? 0.8534 1.2262 1.7711 0.2269  -0.2410 -0.7561 22  SER A CB    
186  O OG    . SER A 22  ? 0.8653 1.1782 1.8457 0.2320  -0.2721 -0.7408 22  SER A OG    
187  N N     . LEU A 23  ? 0.8506 1.1474 1.6292 0.1911  -0.2191 -0.6313 23  LEU A N     
188  C CA    . LEU A 23  ? 0.8473 1.0858 1.6029 0.1795  -0.2249 -0.5723 23  LEU A CA    
189  C C     . LEU A 23  ? 0.8450 1.0673 1.5807 0.1719  -0.2265 -0.5582 23  LEU A C     
190  O O     . LEU A 23  ? 0.8147 0.9903 1.5435 0.1633  -0.2356 -0.5152 23  LEU A O     
191  C CB    . LEU A 23  ? 0.8550 1.0934 1.5453 0.1685  -0.2027 -0.5315 23  LEU A CB    
192  C CG    . LEU A 23  ? 0.8549 1.1042 1.5629 0.1747  -0.2017 -0.5389 23  LEU A CG    
193  C CD1   . LEU A 23  ? 0.8345 1.0940 1.4744 0.1637  -0.1772 -0.5054 23  LEU A CD1   
194  C CD2   . LEU A 23  ? 0.8488 1.0499 1.6146 0.1791  -0.2290 -0.5235 23  LEU A CD2   
195  N N     . LYS A 24  ? 0.8469 1.1119 1.5722 0.1743  -0.2171 -0.5942 24  LYS A N     
196  C CA    . LYS A 24  ? 0.8476 1.1026 1.5765 0.1716  -0.2247 -0.5975 24  LYS A CA    
197  C C     . LYS A 24  ? 0.8443 1.0397 1.6239 0.1721  -0.2535 -0.5753 24  LYS A C     
198  O O     . LYS A 24  ? 0.8631 1.0455 1.7130 0.1831  -0.2770 -0.5981 24  LYS A O     
199  C CB    . LYS A 24  ? 0.8812 1.1879 1.6427 0.1827  -0.2266 -0.6614 24  LYS A CB    
200  C CG    . LYS A 24  ? 0.9081 1.2034 1.7059 0.1860  -0.2445 -0.6814 24  LYS A CG    
201  C CD    . LYS A 24  ? 0.9030 1.1966 1.6402 0.1725  -0.2306 -0.6531 24  LYS A CD    
202  C CE    . LYS A 24  ? 0.9168 1.2133 1.6891 0.1768  -0.2457 -0.6837 24  LYS A CE    
203  N NZ    . LYS A 24  ? 0.9126 1.2117 1.6260 0.1638  -0.2317 -0.6583 24  LYS A NZ    
204  N N     . GLY A 25  ? 0.8269 0.9877 1.5728 0.1595  -0.2526 -0.5297 25  GLY A N     
205  C CA    . GLY A 25  ? 0.8387 0.9485 1.6288 0.1569  -0.2797 -0.5057 25  GLY A CA    
206  C C     . GLY A 25  ? 0.8428 0.9126 1.6458 0.1518  -0.2913 -0.4634 25  GLY A C     
207  O O     . GLY A 25  ? 0.8741 0.9056 1.6792 0.1416  -0.3035 -0.4227 25  GLY A O     
208  N N     . LYS A 26  ? 0.8176 0.8993 1.6298 0.1580  -0.2879 -0.4728 26  LYS A N     
209  C CA    . LYS A 26  ? 0.8052 0.8538 1.6297 0.1532  -0.2987 -0.4346 26  LYS A CA    
210  C C     . LYS A 26  ? 0.7922 0.8294 1.5437 0.1377  -0.2787 -0.3822 26  LYS A C     
211  O O     . LYS A 26  ? 0.7356 0.8005 1.4265 0.1346  -0.2514 -0.3831 26  LYS A O     
212  C CB    . LYS A 26  ? 0.8012 0.8698 1.6519 0.1643  -0.2983 -0.4612 26  LYS A CB    
213  C CG    . LYS A 26  ? 0.8212 0.8831 1.7641 0.1786  -0.3287 -0.4985 26  LYS A CG    
214  C CD    . LYS A 26  ? 0.8147 0.9015 1.7788 0.1896  -0.3253 -0.5262 26  LYS A CD    
215  C CE    . LYS A 26  ? 0.8280 0.8936 1.8876 0.2011  -0.3603 -0.5458 26  LYS A CE    
216  N NZ    . LYS A 26  ? 0.8474 0.9141 1.9717 0.2114  -0.3823 -0.5875 26  LYS A NZ    
217  N N     . PRO A 27  ? 0.7915 0.7906 1.5511 0.1274  -0.2932 -0.3366 27  PRO A N     
218  C CA    . PRO A 27  ? 0.7420 0.7353 1.4389 0.1146  -0.2749 -0.2924 27  PRO A CA    
219  C C     . PRO A 27  ? 0.7005 0.7130 1.3796 0.1193  -0.2607 -0.2998 27  PRO A C     
220  O O     . PRO A 27  ? 0.6955 0.7051 1.4234 0.1275  -0.2758 -0.3147 27  PRO A O     
221  C CB    . PRO A 27  ? 0.7672 0.7227 1.4914 0.1039  -0.2981 -0.2491 27  PRO A CB    
222  C CG    . PRO A 27  ? 0.8002 0.7414 1.6084 0.1133  -0.3297 -0.2714 27  PRO A CG    
223  C CD    . PRO A 27  ? 0.8088 0.7724 1.6368 0.1263  -0.3276 -0.3235 27  PRO A CD    
224  N N     . VAL A 28  ? 0.6350 0.6666 1.2476 0.1138  -0.2331 -0.2890 28  VAL A N     
225  C CA    . VAL A 28  ? 0.5909 0.6460 1.1809 0.1176  -0.2167 -0.2982 28  VAL A CA    
226  C C     . VAL A 28  ? 0.5605 0.6051 1.0964 0.1053  -0.2026 -0.2546 28  VAL A C     
227  O O     . VAL A 28  ? 0.5424 0.5825 1.0362 0.0959  -0.1918 -0.2326 28  VAL A O     
228  C CB    . VAL A 28  ? 0.5780 0.6767 1.1429 0.1236  -0.1965 -0.3351 28  VAL A CB    
229  C CG1   . VAL A 28  ? 0.5738 0.6983 1.1098 0.1246  -0.1784 -0.3384 28  VAL A CG1   
230  C CG2   . VAL A 28  ? 0.5909 0.7062 1.2114 0.1364  -0.2102 -0.3833 28  VAL A CG2   
231  N N     . VAL A 29  ? 0.5292 0.5707 1.0696 0.1058  -0.2036 -0.2443 29  VAL A N     
232  C CA    . VAL A 29  ? 0.5051 0.5364 1.0037 0.0950  -0.1939 -0.2054 29  VAL A CA    
233  C C     . VAL A 29  ? 0.4999 0.5520 0.9800 0.0988  -0.1795 -0.2141 29  VAL A C     
234  O O     . VAL A 29  ? 0.5137 0.5670 1.0318 0.1062  -0.1901 -0.2275 29  VAL A O     
235  C CB    . VAL A 29  ? 0.5038 0.5039 1.0321 0.0879  -0.2160 -0.1729 29  VAL A CB    
236  C CG1   . VAL A 29  ? 0.4813 0.4774 0.9654 0.0767  -0.2050 -0.1361 29  VAL A CG1   
237  C CG2   . VAL A 29  ? 0.4982 0.4788 1.0474 0.0825  -0.2318 -0.1611 29  VAL A CG2   
238  N N     . VAL A 30  ? 0.4810 0.5496 0.9057 0.0936  -0.1566 -0.2063 30  VAL A N     
239  C CA    . VAL A 30  ? 0.4809 0.5690 0.8834 0.0948  -0.1423 -0.2091 30  VAL A CA    
240  C C     . VAL A 30  ? 0.4900 0.5589 0.8700 0.0857  -0.1415 -0.1717 30  VAL A C     
241  O O     . VAL A 30  ? 0.4990 0.5542 0.8516 0.0763  -0.1387 -0.1453 30  VAL A O     
242  C CB    . VAL A 30  ? 0.4732 0.5928 0.8334 0.0936  -0.1201 -0.2218 30  VAL A CB    
243  C CG1   . VAL A 30  ? 0.4739 0.6119 0.8097 0.0925  -0.1062 -0.2185 30  VAL A CG1   
244  C CG2   . VAL A 30  ? 0.4868 0.6330 0.8711 0.1023  -0.1212 -0.2618 30  VAL A CG2   
245  N N     . CYS A 31  ? 0.4978 0.5687 0.8911 0.0887  -0.1443 -0.1716 31  CYS A N     
246  C CA    . CYS A 31  ? 0.5049 0.5599 0.8842 0.0806  -0.1465 -0.1390 31  CYS A CA    
247  C C     . CYS A 31  ? 0.4771 0.5491 0.8310 0.0810  -0.1318 -0.1397 31  CYS A C     
248  O O     . CYS A 31  ? 0.4647 0.5599 0.8265 0.0888  -0.1250 -0.1663 31  CYS A O     
249  C CB    . CYS A 31  ? 0.5350 0.5699 0.9641 0.0818  -0.1708 -0.1310 31  CYS A CB    
250  S SG    . CYS A 31  ? 0.5724 0.5860 1.0465 0.0817  -0.1942 -0.1305 31  CYS A SG    
251  N N     . VAL A 32  ? 0.4483 0.5112 0.7736 0.0721  -0.1275 -0.1109 32  VAL A N     
252  C CA    . VAL A 32  ? 0.4510 0.5244 0.7586 0.0716  -0.1180 -0.1068 32  VAL A CA    
253  C C     . VAL A 32  ? 0.4498 0.5098 0.7900 0.0718  -0.1350 -0.0960 32  VAL A C     
254  O O     . VAL A 32  ? 0.4321 0.4768 0.7670 0.0629  -0.1429 -0.0683 32  VAL A O     
255  C CB    . VAL A 32  ? 0.4329 0.5065 0.6919 0.0621  -0.1039 -0.0846 32  VAL A CB    
256  C CG1   . VAL A 32  ? 0.4437 0.5274 0.6875 0.0614  -0.0956 -0.0810 32  VAL A CG1   
257  C CG2   . VAL A 32  ? 0.4289 0.5136 0.6608 0.0612  -0.0903 -0.0929 32  VAL A CG2   
258  N N     . PHE A 33  ? 0.4690 0.5375 0.8448 0.0814  -0.1415 -0.1182 33  PHE A N     
259  C CA    . PHE A 33  ? 0.4919 0.5488 0.9042 0.0825  -0.1591 -0.1097 33  PHE A CA    
260  C C     . PHE A 33  ? 0.4808 0.5447 0.8655 0.0783  -0.1492 -0.0961 33  PHE A C     
261  O O     . PHE A 33  ? 0.4760 0.5599 0.8527 0.0837  -0.1369 -0.1139 33  PHE A O     
262  C CB    . PHE A 33  ? 0.4983 0.5632 0.9638 0.0956  -0.1703 -0.1421 33  PHE A CB    
263  C CG    . PHE A 33  ? 0.5288 0.5817 1.0352 0.1000  -0.1872 -0.1540 33  PHE A CG    
264  C CD1   . PHE A 33  ? 0.5467 0.5740 1.0947 0.0968  -0.2127 -0.1357 33  PHE A CD1   
265  C CD2   . PHE A 33  ? 0.5444 0.6129 1.0491 0.1062  -0.1787 -0.1824 33  PHE A CD2   
266  C CE1   . PHE A 33  ? 0.5751 0.5901 1.1648 0.1004  -0.2302 -0.1460 33  PHE A CE1   
267  C CE2   . PHE A 33  ? 0.5563 0.6137 1.1006 0.1104  -0.1950 -0.1950 33  PHE A CE2   
268  C CZ    . PHE A 33  ? 0.5746 0.6039 1.1629 0.1079  -0.2212 -0.1770 33  PHE A CZ    
269  N N     . SER A 34  ? 0.4681 0.5183 0.8387 0.0679  -0.1548 -0.0647 34  SER A N     
270  C CA    . SER A 34  ? 0.4532 0.5099 0.7936 0.0625  -0.1452 -0.0504 34  SER A CA    
271  C C     . SER A 34  ? 0.4703 0.5291 0.8400 0.0670  -0.1545 -0.0539 34  SER A C     
272  O O     . SER A 34  ? 0.4545 0.5228 0.8032 0.0654  -0.1450 -0.0501 34  SER A O     
273  C CB    . SER A 34  ? 0.4413 0.4888 0.7548 0.0493  -0.1469 -0.0185 34  SER A CB    
274  O OG    . SER A 34  ? 0.4411 0.4740 0.7853 0.0440  -0.1683 -0.0008 34  SER A OG    
275  N N     . GLY A 35  ? 0.4938 0.5435 0.9148 0.0726  -0.1744 -0.0609 35  GLY A N     
276  C CA    . GLY A 35  ? 0.5119 0.5647 0.9690 0.0791  -0.1846 -0.0696 35  GLY A CA    
277  C C     . GLY A 35  ? 0.5340 0.5767 0.9947 0.0701  -0.1974 -0.0394 35  GLY A C     
278  O O     . GLY A 35  ? 0.5481 0.5963 1.0274 0.0743  -0.2014 -0.0444 35  GLY A O     
279  N N     . ARG A 36  ? 0.5382 0.5698 0.9821 0.0572  -0.2039 -0.0087 36  ARG A N     
280  C CA    . ARG A 36  ? 0.5486 0.5763 0.9909 0.0457  -0.2158 0.0229  36  ARG A CA    
281  C C     . ARG A 36  ? 0.5762 0.5886 1.0756 0.0437  -0.2460 0.0364  36  ARG A C     
282  O O     . ARG A 36  ? 0.5673 0.5783 1.0831 0.0382  -0.2599 0.0549  36  ARG A O     
283  C CB    . ARG A 36  ? 0.5467 0.5774 0.9421 0.0313  -0.2076 0.0488  36  ARG A CB    
284  C CG    . ARG A 36  ? 0.5455 0.5904 0.8893 0.0318  -0.1817 0.0400  36  ARG A CG    
285  C CD    . ARG A 36  ? 0.5428 0.5919 0.8458 0.0208  -0.1724 0.0562  36  ARG A CD    
286  N NE    . ARG A 36  ? 0.5569 0.6095 0.8556 0.0064  -0.1845 0.0871  36  ARG A NE    
287  C CZ    . ARG A 36  ? 0.5787 0.6430 0.8583 -0.0002 -0.1820 0.0987  36  ARG A CZ    
288  N NH1   . ARG A 36  ? 0.5743 0.6448 0.8392 0.0067  -0.1687 0.0831  36  ARG A NH1   
289  N NH2   . ARG A 36  ? 0.6034 0.6758 0.8797 -0.0149 -0.1939 0.1270  36  ARG A NH2   
290  N N     . PHE A 37  ? 0.5840 0.5850 1.1147 0.0475  -0.2573 0.0282  37  PHE A N     
291  C CA    . PHE A 37  ? 0.6087 0.5935 1.2049 0.0486  -0.2880 0.0343  37  PHE A CA    
292  C C     . PHE A 37  ? 0.6185 0.5959 1.2425 0.0583  -0.2915 0.0090  37  PHE A C     
293  O O     . PHE A 37  ? 0.5907 0.5762 1.1776 0.0611  -0.2705 -0.0063 37  PHE A O     
294  C CB    . PHE A 37  ? 0.6248 0.6018 1.2241 0.0296  -0.3079 0.0797  37  PHE A CB    
295  C CG    . PHE A 37  ? 0.6379 0.6172 1.1977 0.0177  -0.2993 0.0978  37  PHE A CG    
296  C CD1   . PHE A 37  ? 0.6255 0.6209 1.1228 0.0083  -0.2779 0.1108  37  PHE A CD1   
297  C CD2   . PHE A 37  ? 0.6535 0.6196 1.2422 0.0160  -0.3138 0.1011  37  PHE A CD2   
298  C CE1   . PHE A 37  ? 0.6399 0.6400 1.1040 -0.0021 -0.2703 0.1253  37  PHE A CE1   
299  C CE2   . PHE A 37  ? 0.6496 0.6195 1.2032 0.0048  -0.3061 0.1179  37  PHE A CE2   
300  C CZ    . PHE A 37  ? 0.6404 0.6283 1.1315 -0.0041 -0.2838 0.1296  37  PHE A CZ    
301  N N     . GLU A 38  ? 0.6380 0.6003 1.3291 0.0631  -0.3192 0.0045  38  GLU A N     
302  C CA    . GLU A 38  ? 0.6411 0.5966 1.3647 0.0727  -0.3251 -0.0218 38  GLU A CA    
303  C C     . GLU A 38  ? 0.6322 0.5848 1.3163 0.0626  -0.3158 -0.0062 38  GLU A C     
304  O O     . GLU A 38  ? 0.6243 0.5693 1.2971 0.0462  -0.3258 0.0327  38  GLU A O     
305  C CB    . GLU A 38  ? 0.6566 0.5926 1.4632 0.0762  -0.3617 -0.0211 38  GLU A CB    
306  C CG    . GLU A 38  ? 0.6656 0.5969 1.5149 0.0896  -0.3688 -0.0575 38  GLU A CG    
307  C CD    . GLU A 38  ? 0.6898 0.5983 1.6242 0.0910  -0.4084 -0.0526 38  GLU A CD    
308  O OE1   . GLU A 38  ? 0.7122 0.6155 1.6923 0.0938  -0.4275 -0.0493 38  GLU A OE1   
309  O OE2   . GLU A 38  ? 0.7047 0.5999 1.6630 0.0891  -0.4215 -0.0517 38  GLU A OE2   
310  N N     . ASP A 39  ? 0.6242 0.5863 1.2876 0.0719  -0.2965 -0.0370 39  ASP A N     
311  C CA    . ASP A 39  ? 0.6087 0.5705 1.2330 0.0648  -0.2844 -0.0289 39  ASP A CA    
312  C C     . ASP A 39  ? 0.5769 0.5471 1.1344 0.0507  -0.2656 0.0006  39  ASP A C     
313  O O     . ASP A 39  ? 0.5693 0.5369 1.1022 0.0414  -0.2621 0.0170  39  ASP A O     
314  C CB    . ASP A 39  ? 0.6241 0.5660 1.2919 0.0592  -0.3105 -0.0143 39  ASP A CB    
315  C CG    . ASP A 39  ? 0.6415 0.5759 1.3760 0.0744  -0.3281 -0.0496 39  ASP A CG    
316  O OD1   . ASP A 39  ? 0.6428 0.5931 1.3795 0.0897  -0.3143 -0.0906 39  ASP A OD1   
317  O OD2   . ASP A 39  ? 0.6608 0.5757 1.4482 0.0706  -0.3570 -0.0363 39  ASP A OD2   
318  N N     . SER A 40  ? 0.5305 0.5119 1.0603 0.0496  -0.2537 0.0053  40  SER A N     
319  C CA    . SER A 40  ? 0.5052 0.4973 0.9738 0.0385  -0.2345 0.0257  40  SER A CA    
320  C C     . SER A 40  ? 0.4876 0.4899 0.9177 0.0446  -0.2098 0.0030  40  SER A C     
321  O O     . SER A 40  ? 0.4977 0.5081 0.9354 0.0572  -0.2009 -0.0286 40  SER A O     
322  C CB    . SER A 40  ? 0.4863 0.4882 0.9375 0.0366  -0.2284 0.0332  40  SER A CB    
323  O OG    . SER A 40  ? 0.4587 0.4720 0.9018 0.0493  -0.2120 0.0029  40  SER A OG    
324  N N     . GLY A 41  ? 0.4820 0.4869 0.8726 0.0350  -0.1994 0.0189  41  GLY A N     
325  C CA    . GLY A 41  ? 0.4677 0.4821 0.8215 0.0392  -0.1772 0.0013  41  GLY A CA    
326  C C     . GLY A 41  ? 0.4759 0.4842 0.8232 0.0338  -0.1787 0.0088  41  GLY A C     
327  O O     . GLY A 41  ? 0.4813 0.4805 0.8450 0.0242  -0.1950 0.0325  41  GLY A O     
328  N N     . ALA A 42  ? 0.4505 0.4656 0.7746 0.0390  -0.1624 -0.0100 42  ALA A N     
329  C CA    . ALA A 42  ? 0.4400 0.4514 0.7520 0.0341  -0.1606 -0.0043 42  ALA A CA    
330  C C     . ALA A 42  ? 0.4254 0.4397 0.7453 0.0443  -0.1550 -0.0338 42  ALA A C     
331  O O     . ALA A 42  ? 0.4073 0.4332 0.7292 0.0538  -0.1467 -0.0586 42  ALA A O     
332  C CB    . ALA A 42  ? 0.4276 0.4483 0.6905 0.0256  -0.1440 0.0107  42  ALA A CB    
333  N N     . VAL A 43  ? 0.4191 0.4262 0.7433 0.0411  -0.1599 -0.0303 43  VAL A N     
334  C CA    . VAL A 43  ? 0.4203 0.4317 0.7503 0.0490  -0.1554 -0.0566 43  VAL A CA    
335  C C     . VAL A 43  ? 0.4033 0.4298 0.6854 0.0484  -0.1323 -0.0621 43  VAL A C     
336  O O     . VAL A 43  ? 0.3868 0.4124 0.6380 0.0398  -0.1250 -0.0420 43  VAL A O     
337  C CB    . VAL A 43  ? 0.4345 0.4320 0.7848 0.0445  -0.1693 -0.0479 43  VAL A CB    
338  C CG1   . VAL A 43  ? 0.4323 0.4365 0.7807 0.0511  -0.1626 -0.0734 43  VAL A CG1   
339  C CG2   . VAL A 43  ? 0.4652 0.4468 0.8711 0.0451  -0.1957 -0.0431 43  VAL A CG2   
340  N N     . ALA A 44  ? 0.3988 0.4417 0.6774 0.0569  -0.1220 -0.0889 44  ALA A N     
341  C CA    . ALA A 44  ? 0.4011 0.4596 0.6397 0.0555  -0.1029 -0.0937 44  ALA A CA    
342  C C     . ALA A 44  ? 0.4201 0.4790 0.6551 0.0550  -0.1019 -0.1009 44  ALA A C     
343  O O     . ALA A 44  ? 0.4067 0.4649 0.6118 0.0486  -0.0932 -0.0876 44  ALA A O     
344  C CB    . ALA A 44  ? 0.3794 0.4608 0.6135 0.0618  -0.0924 -0.1151 44  ALA A CB    
345  N N     . THR A 45  ? 0.4635 0.5248 0.7312 0.0621  -0.1113 -0.1237 45  THR A N     
346  C CA    . THR A 45  ? 0.4688 0.5319 0.7382 0.0625  -0.1121 -0.1343 45  THR A CA    
347  C C     . THR A 45  ? 0.5035 0.5538 0.8219 0.0675  -0.1322 -0.1466 45  THR A C     
348  O O     . THR A 45  ? 0.5084 0.5624 0.8624 0.0757  -0.1415 -0.1659 45  THR A O     
349  C CB    . THR A 45  ? 0.4599 0.5520 0.7165 0.0672  -0.0997 -0.1611 45  THR A CB    
350  O OG1   . THR A 45  ? 0.4481 0.5566 0.6724 0.0646  -0.0844 -0.1558 45  THR A OG1   
351  C CG2   . THR A 45  ? 0.4673 0.5614 0.7092 0.0638  -0.0964 -0.1620 45  THR A CG2   
352  N N     . ALA A 46  ? 0.5143 0.5509 0.8367 0.0629  -0.1394 -0.1364 46  ALA A N     
353  C CA    . ALA A 46  ? 0.5383 0.5617 0.9083 0.0666  -0.1597 -0.1471 46  ALA A CA    
354  C C     . ALA A 46  ? 0.5347 0.5681 0.8998 0.0688  -0.1558 -0.1663 46  ALA A C     
355  O O     . ALA A 46  ? 0.4858 0.5201 0.8154 0.0617  -0.1451 -0.1517 46  ALA A O     
356  C CB    . ALA A 46  ? 0.5499 0.5480 0.9332 0.0569  -0.1750 -0.1136 46  ALA A CB    
357  N N     . ASN A 47  ? 0.5538 0.5964 0.9565 0.0786  -0.1650 -0.2001 47  ASN A N     
358  C CA    . ASN A 47  ? 0.5697 0.6238 0.9721 0.0806  -0.1634 -0.2207 47  ASN A CA    
359  C C     . ASN A 47  ? 0.6006 0.6290 1.0185 0.0744  -0.1777 -0.2021 47  ASN A C     
360  O O     . ASN A 47  ? 0.5881 0.5923 1.0207 0.0682  -0.1903 -0.1739 47  ASN A O     
361  C CB    . ASN A 47  ? 0.5777 0.6543 1.0165 0.0929  -0.1689 -0.2659 47  ASN A CB    
362  C CG    . ASN A 47  ? 0.6063 0.6626 1.1118 0.0997  -0.1955 -0.2782 47  ASN A CG    
363  O OD1   . ASN A 47  ? 0.6051 0.6296 1.1307 0.0939  -0.2117 -0.2500 47  ASN A OD1   
364  N ND2   . ASN A 47  ? 0.6097 0.6873 1.1524 0.1117  -0.2013 -0.3210 47  ASN A ND2   
365  N N     . TYR A 48  ? 0.6361 0.6727 1.0503 0.0750  -0.1761 -0.2167 48  TYR A N     
366  C CA    . TYR A 48  ? 0.6778 0.6935 1.0996 0.0678  -0.1867 -0.1978 48  TYR A CA    
367  C C     . TYR A 48  ? 0.6479 0.6372 1.1286 0.0683  -0.2144 -0.1921 48  TYR A C     
368  O O     . TYR A 48  ? 0.6170 0.5853 1.1011 0.0581  -0.2241 -0.1591 48  TYR A O     
369  C CB    . TYR A 48  ? 0.7429 0.7743 1.1559 0.0697  -0.1816 -0.2199 48  TYR A CB    
370  C CG    . TYR A 48  ? 0.7981 0.8089 1.2404 0.0663  -0.1993 -0.2131 48  TYR A CG    
371  C CD1   . TYR A 48  ? 0.8244 0.8205 1.2428 0.0548  -0.1971 -0.1787 48  TYR A CD1   
372  C CD2   . TYR A 48  ? 0.8313 0.8384 1.3288 0.0745  -0.2192 -0.2418 48  TYR A CD2   
373  C CE1   . TYR A 48  ? 0.8667 0.8454 1.3130 0.0505  -0.2137 -0.1708 48  TYR A CE1   
374  C CE2   . TYR A 48  ? 0.8835 0.8706 1.4115 0.0707  -0.2372 -0.2346 48  TYR A CE2   
375  C CZ    . TYR A 48  ? 0.8905 0.8635 1.3919 0.0583  -0.2343 -0.1979 48  TYR A CZ    
376  O OH    . TYR A 48  ? 0.9606 0.9155 1.4939 0.0538  -0.2528 -0.1900 48  TYR A OH    
377  N N     . GLU A 49  ? 0.6316 0.6244 1.1606 0.0795  -0.2280 -0.2241 49  GLU A N     
378  C CA    . GLU A 49  ? 0.6649 0.6322 1.2577 0.0807  -0.2573 -0.2198 49  GLU A CA    
379  C C     . GLU A 49  ? 0.6523 0.6005 1.2433 0.0712  -0.2638 -0.1787 49  GLU A C     
380  O O     . GLU A 49  ? 0.6352 0.5619 1.2425 0.0605  -0.2796 -0.1467 49  GLU A O     
381  C CB    . GLU A 49  ? 0.6804 0.6581 1.3266 0.0959  -0.2697 -0.2643 49  GLU A CB    
382  C CG    . GLU A 49  ? 0.7031 0.6970 1.3721 0.1049  -0.2732 -0.3066 49  GLU A CG    
383  C CD    . GLU A 49  ? 0.7200 0.6903 1.4162 0.0992  -0.2920 -0.2946 49  GLU A CD    
384  O OE1   . GLU A 49  ? 0.7240 0.6952 1.3765 0.0902  -0.2794 -0.2758 49  GLU A OE1   
385  O OE2   . GLU A 49  ? 0.7410 0.6923 1.5049 0.1037  -0.3204 -0.3045 49  GLU A OE2   
386  N N     . ALA A 50  ? 0.6458 0.6050 1.2158 0.0738  -0.2512 -0.1787 50  ALA A N     
387  C CA    . ALA A 50  ? 0.6203 0.5656 1.1885 0.0652  -0.2570 -0.1429 50  ALA A CA    
388  C C     . ALA A 50  ? 0.6160 0.5542 1.1448 0.0496  -0.2505 -0.1015 50  ALA A C     
389  O O     . ALA A 50  ? 0.6223 0.5459 1.1658 0.0388  -0.2652 -0.0678 50  ALA A O     
390  C CB    . ALA A 50  ? 0.6072 0.5689 1.1499 0.0703  -0.2405 -0.1507 50  ALA A CB    
391  N N     . ARG A 51  ? 0.5930 0.5443 1.0744 0.0476  -0.2297 -0.1043 51  ARG A N     
392  C CA    . ARG A 51  ? 0.6012 0.5509 1.0431 0.0342  -0.2206 -0.0702 51  ARG A CA    
393  C C     . ARG A 51  ? 0.6058 0.5393 1.0758 0.0247  -0.2401 -0.0493 51  ARG A C     
394  O O     . ARG A 51  ? 0.6039 0.5330 1.0668 0.0115  -0.2450 -0.0136 51  ARG A O     
395  C CB    . ARG A 51  ? 0.6106 0.5779 1.0007 0.0353  -0.1955 -0.0803 51  ARG A CB    
396  C CG    . ARG A 51  ? 0.6084 0.5927 0.9612 0.0395  -0.1749 -0.0883 51  ARG A CG    
397  C CD    . ARG A 51  ? 0.6214 0.6225 0.9300 0.0396  -0.1539 -0.0966 51  ARG A CD    
398  N NE    . ARG A 51  ? 0.6325 0.6517 0.9152 0.0446  -0.1375 -0.1091 51  ARG A NE    
399  C CZ    . ARG A 51  ? 0.6499 0.6842 0.8917 0.0427  -0.1192 -0.1089 51  ARG A CZ    
400  N NH1   . ARG A 51  ? 0.6421 0.6756 0.8627 0.0369  -0.1138 -0.0981 51  ARG A NH1   
401  N NH2   . ARG A 51  ? 0.6377 0.6885 0.8620 0.0463  -0.1073 -0.1184 51  ARG A NH2   
402  N N     . LYS A 52  ? 0.6143 0.5419 1.1173 0.0304  -0.2519 -0.0709 52  LYS A N     
403  C CA    . LYS A 52  ? 0.6402 0.5523 1.1721 0.0208  -0.2715 -0.0501 52  LYS A CA    
404  C C     . LYS A 52  ? 0.6386 0.5328 1.2208 0.0137  -0.2994 -0.0255 52  LYS A C     
405  O O     . LYS A 52  ? 0.6259 0.5107 1.2238 0.0000  -0.3147 0.0065  52  LYS A O     
406  C CB    . LYS A 52  ? 0.6891 0.5990 1.2461 0.0285  -0.2785 -0.0801 52  LYS A CB    
407  C CG    . LYS A 52  ? 0.7364 0.6436 1.3467 0.0434  -0.2937 -0.1198 52  LYS A CG    
408  C CD    . LYS A 52  ? 0.7504 0.6527 1.3956 0.0479  -0.3073 -0.1433 52  LYS A CD    
409  C CE    . LYS A 52  ? 0.7887 0.6839 1.5041 0.0608  -0.3311 -0.1777 52  LYS A CE    
410  N NZ    . LYS A 52  ? 0.8180 0.7077 1.5753 0.0655  -0.3477 -0.2023 52  LYS A NZ    
411  N N     . PHE A 53  ? 0.6385 0.5303 1.2458 0.0219  -0.3061 -0.0382 53  PHE A N     
412  C CA    . PHE A 53  ? 0.6548 0.5321 1.3040 0.0142  -0.3308 -0.0108 53  PHE A CA    
413  C C     . PHE A 53  ? 0.6431 0.5307 1.2518 0.0045  -0.3183 0.0194  53  PHE A C     
414  O O     . PHE A 53  ? 0.6572 0.5386 1.2931 0.0025  -0.3328 0.0321  53  PHE A O     
415  C CB    . PHE A 53  ? 0.6744 0.5417 1.3855 0.0287  -0.3503 -0.0422 53  PHE A CB    
416  C CG    . PHE A 53  ? 0.6945 0.5488 1.4617 0.0353  -0.3719 -0.0657 53  PHE A CG    
417  C CD1   . PHE A 53  ? 0.7264 0.5605 1.5404 0.0235  -0.4013 -0.0370 53  PHE A CD1   
418  C CD2   . PHE A 53  ? 0.7029 0.5682 1.4773 0.0522  -0.3636 -0.1160 53  PHE A CD2   
419  C CE1   . PHE A 53  ? 0.7409 0.5617 1.6102 0.0296  -0.4228 -0.0592 53  PHE A CE1   
420  C CE2   . PHE A 53  ? 0.7372 0.5926 1.5651 0.0587  -0.3840 -0.1406 53  PHE A CE2   
421  C CZ    . PHE A 53  ? 0.7470 0.5782 1.6236 0.0479  -0.4140 -0.1127 53  PHE A CZ    
422  N N     . GLY A 54  ? 0.6259 0.5299 1.1720 -0.0012 -0.2924 0.0297  54  GLY A N     
423  C CA    . GLY A 54  ? 0.6188 0.5347 1.1271 -0.0134 -0.2822 0.0616  54  GLY A CA    
424  C C     . GLY A 54  ? 0.6094 0.5338 1.0973 -0.0061 -0.2689 0.0512  54  GLY A C     
425  O O     . GLY A 54  ? 0.6125 0.5437 1.0861 -0.0160 -0.2687 0.0777  54  GLY A O     
426  N N     . VAL A 55  ? 0.6008 0.5276 1.0881 0.0102  -0.2583 0.0130  55  VAL A N     
427  C CA    . VAL A 55  ? 0.5877 0.5254 1.0513 0.0177  -0.2427 0.0003  55  VAL A CA    
428  C C     . VAL A 55  ? 0.5775 0.5323 0.9832 0.0204  -0.2133 -0.0115 55  VAL A C     
429  O O     . VAL A 55  ? 0.5593 0.5170 0.9580 0.0247  -0.2068 -0.0291 55  VAL A O     
430  C CB    . VAL A 55  ? 0.5907 0.5247 1.0969 0.0332  -0.2520 -0.0343 55  VAL A CB    
431  C CG1   . VAL A 55  ? 0.5927 0.5439 1.0674 0.0423  -0.2304 -0.0551 55  VAL A CG1   
432  C CG2   . VAL A 55  ? 0.6044 0.5221 1.1666 0.0304  -0.2806 -0.0195 55  VAL A CG2   
433  N N     . LYS A 56  ? 0.5681 0.5342 0.9356 0.0174  -0.1974 -0.0013 56  LYS A N     
434  C CA    . LYS A 56  ? 0.5626 0.5439 0.8789 0.0189  -0.1719 -0.0089 56  LYS A CA    
435  C C     . LYS A 56  ? 0.5360 0.5279 0.8267 0.0210  -0.1584 -0.0095 56  LYS A C     
436  O O     . LYS A 56  ? 0.5083 0.4968 0.8145 0.0192  -0.1675 0.0011  56  LYS A O     
437  C CB    . LYS A 56  ? 0.5921 0.5771 0.8810 0.0071  -0.1662 0.0144  56  LYS A CB    
438  C CG    . LYS A 56  ? 0.6435 0.6288 0.9354 -0.0066 -0.1762 0.0482  56  LYS A CG    
439  C CD    . LYS A 56  ? 0.6710 0.6686 0.9306 -0.0178 -0.1664 0.0673  56  LYS A CD    
440  C CE    . LYS A 56  ? 0.7154 0.7208 0.9797 -0.0333 -0.1775 0.1009  56  LYS A CE    
441  N NZ    . LYS A 56  ? 0.7280 0.7556 0.9511 -0.0417 -0.1612 0.1129  56  LYS A NZ    
442  N N     . ALA A 57  ? 0.5302 0.5349 0.7832 0.0242  -0.1380 -0.0205 57  ALA A N     
443  C CA    . ALA A 57  ? 0.4989 0.5137 0.7294 0.0263  -0.1257 -0.0220 57  ALA A CA    
444  C C     . ALA A 57  ? 0.4964 0.5121 0.7128 0.0164  -0.1263 0.0048  57  ALA A C     
445  O O     . ALA A 57  ? 0.4790 0.4962 0.6830 0.0068  -0.1266 0.0239  57  ALA A O     
446  C CB    . ALA A 57  ? 0.4916 0.5197 0.6871 0.0293  -0.1062 -0.0345 57  ALA A CB    
447  N N     . GLY A 58  ? 0.5066 0.5248 0.7254 0.0184  -0.1264 0.0052  58  GLY A N     
448  C CA    . GLY A 58  ? 0.5117 0.5361 0.7125 0.0099  -0.1242 0.0263  58  GLY A CA    
449  C C     . GLY A 58  ? 0.5523 0.5716 0.7771 0.0005  -0.1428 0.0502  58  GLY A C     
450  O O     . GLY A 58  ? 0.5717 0.6011 0.7804 -0.0091 -0.1419 0.0699  58  GLY A O     
451  N N     . ILE A 59  ? 0.5607 0.5666 0.8257 0.0023  -0.1610 0.0491  59  ILE A N     
452  C CA    . ILE A 59  ? 0.5895 0.5901 0.8837 -0.0071 -0.1819 0.0739  59  ILE A CA    
453  C C     . ILE A 59  ? 0.5960 0.5887 0.9231 0.0009  -0.1931 0.0641  59  ILE A C     
454  O O     . ILE A 59  ? 0.5586 0.5481 0.8974 0.0144  -0.1887 0.0350  59  ILE A O     
455  C CB    . ILE A 59  ? 0.6094 0.6004 0.9320 -0.0145 -0.1998 0.0883  59  ILE A CB    
456  C CG1   . ILE A 59  ? 0.6223 0.5968 0.9854 -0.0025 -0.2108 0.0636  59  ILE A CG1   
457  C CG2   . ILE A 59  ? 0.5937 0.5954 0.8830 -0.0225 -0.1877 0.0974  59  ILE A CG2   
458  C CD1   . ILE A 59  ? 0.6425 0.6053 1.0396 -0.0098 -0.2312 0.0779  59  ILE A CD1   
459  N N     . PRO A 60  ? 0.6128 0.6057 0.9553 -0.0082 -0.2077 0.0884  60  PRO A N     
460  C CA    . PRO A 60  ? 0.6190 0.6050 0.9935 -0.0008 -0.2185 0.0800  60  PRO A CA    
461  C C     . PRO A 60  ? 0.6162 0.5861 1.0420 0.0106  -0.2342 0.0582  60  PRO A C     
462  O O     . PRO A 60  ? 0.6066 0.5668 1.0543 0.0080  -0.2460 0.0616  60  PRO A O     
463  C CB    . PRO A 60  ? 0.6320 0.6206 1.0189 -0.0159 -0.2362 0.1160  60  PRO A CB    
464  C CG    . PRO A 60  ? 0.6410 0.6478 0.9836 -0.0298 -0.2242 0.1373  60  PRO A CG    
465  C CD    . PRO A 60  ? 0.6356 0.6395 0.9655 -0.0262 -0.2141 0.1241  60  PRO A CD    
466  N N     . ILE A 61  ? 0.5910 0.5604 1.0362 0.0233  -0.2339 0.0340  61  ILE A N     
467  C CA    . ILE A 61  ? 0.6354 0.5942 1.1335 0.0358  -0.2487 0.0073  61  ILE A CA    
468  C C     . ILE A 61  ? 0.6963 0.6370 1.2510 0.0289  -0.2814 0.0290  61  ILE A C     
469  O O     . ILE A 61  ? 0.7147 0.6433 1.3115 0.0340  -0.2969 0.0160  61  ILE A O     
470  C CB    . ILE A 61  ? 0.6148 0.5818 1.1251 0.0494  -0.2431 -0.0210 61  ILE A CB    
471  C CG1   . ILE A 61  ? 0.5882 0.5746 1.0476 0.0552  -0.2131 -0.0416 61  ILE A CG1   
472  C CG2   . ILE A 61  ? 0.6319 0.5916 1.2040 0.0627  -0.2607 -0.0512 61  ILE A CG2   
473  C CD1   . ILE A 61  ? 0.5853 0.5847 1.0439 0.0638  -0.2044 -0.0598 61  ILE A CD1   
474  N N     . VAL A 62  ? 0.7428 0.6828 1.2997 0.0166  -0.2928 0.0625  62  VAL A N     
475  C CA    . VAL A 62  ? 0.7872 0.7119 1.3997 0.0071  -0.3266 0.0897  62  VAL A CA    
476  C C     . VAL A 62  ? 0.8085 0.7296 1.4194 -0.0078 -0.3361 0.1177  62  VAL A C     
477  O O     . VAL A 62  ? 0.8353 0.7399 1.5001 -0.0101 -0.3628 0.1250  62  VAL A O     
478  C CB    . VAL A 62  ? 0.7744 0.7036 1.3900 -0.0034 -0.3372 0.1199  62  VAL A CB    
479  C CG1   . VAL A 62  ? 0.7519 0.6849 1.3715 0.0110  -0.3287 0.0931  62  VAL A CG1   
480  C CG2   . VAL A 62  ? 0.7635 0.7122 1.3199 -0.0208 -0.3224 0.1519  62  VAL A CG2   
481  N N     . GLU A 63  ? 0.8038 0.7413 1.3555 -0.0178 -0.3150 0.1324  63  GLU A N     
482  C CA    . GLU A 63  ? 0.8375 0.7774 1.3802 -0.0322 -0.3196 0.1571  63  GLU A CA    
483  C C     . GLU A 63  ? 0.8274 0.7546 1.3879 -0.0213 -0.3194 0.1299  63  GLU A C     
484  O O     . GLU A 63  ? 0.8124 0.7317 1.3967 -0.0300 -0.3355 0.1460  63  GLU A O     
485  C CB    . GLU A 63  ? 0.8479 0.8120 1.3229 -0.0422 -0.2939 0.1704  63  GLU A CB    
486  C CG    . GLU A 63  ? 0.8819 0.8590 1.3484 -0.0640 -0.3031 0.2103  63  GLU A CG    
487  C CD    . GLU A 63  ? 0.9093 0.8828 1.3734 -0.0651 -0.3005 0.2065  63  GLU A CD    
488  O OE1   . GLU A 63  ? 0.9119 0.8885 1.3410 -0.0547 -0.2765 0.1800  63  GLU A OE1   
489  O OE2   . GLU A 63  ? 0.9341 0.9023 1.4321 -0.0775 -0.3235 0.2319  63  GLU A OE2   
490  N N     . ALA A 64  ? 0.8171 0.7450 1.3661 -0.0033 -0.3013 0.0891  64  ALA A N     
491  C CA    . ALA A 64  ? 0.8214 0.7414 1.3885 0.0088  -0.3004 0.0572  64  ALA A CA    
492  C C     . ALA A 64  ? 0.8301 0.7313 1.4722 0.0172  -0.3296 0.0426  64  ALA A C     
493  O O     . ALA A 64  ? 0.8438 0.7338 1.5176 0.0184  -0.3431 0.0360  64  ALA A O     
494  C CB    . ALA A 64  ? 0.8033 0.7367 1.3332 0.0233  -0.2722 0.0204  64  ALA A CB    
495  N N     . LYS A 65  ? 0.8003 0.6984 1.4734 0.0237  -0.3399 0.0357  65  LYS A N     
496  C CA    . LYS A 65  ? 0.8261 0.7066 1.5779 0.0324  -0.3703 0.0205  65  LYS A CA    
497  C C     . LYS A 65  ? 0.8223 0.6846 1.6216 0.0168  -0.4043 0.0604  65  LYS A C     
498  O O     . LYS A 65  ? 0.8222 0.6668 1.6919 0.0227  -0.4327 0.0499  65  LYS A O     
499  C CB    . LYS A 65  ? 0.8306 0.7141 1.6052 0.0437  -0.3726 0.0020  65  LYS A CB    
500  C CG    . LYS A 65  ? 0.8188 0.7174 1.5852 0.0637  -0.3521 -0.0503 65  LYS A CG    
501  C CD    . LYS A 65  ? 0.8043 0.7093 1.5928 0.0739  -0.3539 -0.0674 65  LYS A CD    
502  C CE    . LYS A 65  ? 0.7769 0.7031 1.5598 0.0923  -0.3343 -0.1196 65  LYS A CE    
503  N NZ    . LYS A 65  ? 0.7444 0.6816 1.5440 0.1019  -0.3329 -0.1370 65  LYS A NZ    
504  N N     . LYS A 66  ? 0.8350 0.7045 1.5983 -0.0036 -0.4024 0.1056  66  LYS A N     
505  C CA    . LYS A 66  ? 0.8654 0.7242 1.6639 -0.0220 -0.4314 0.1469  66  LYS A CA    
506  C C     . LYS A 66  ? 0.8540 0.7075 1.6531 -0.0221 -0.4303 0.1384  66  LYS A C     
507  O O     . LYS A 66  ? 0.8638 0.6979 1.7258 -0.0201 -0.4578 0.1345  66  LYS A O     
508  C CB    . LYS A 66  ? 0.8883 0.7655 1.6430 -0.0452 -0.4270 0.1963  66  LYS A CB    
509  C CG    . LYS A 66  ? 0.9268 0.8089 1.6910 -0.0517 -0.4375 0.2181  66  LYS A CG    
510  C CD    . LYS A 66  ? 0.9443 0.8509 1.6639 -0.0761 -0.4330 0.2655  66  LYS A CD    
511  C CE    . LYS A 66  ? 0.9451 0.8670 1.6348 -0.0769 -0.4215 0.2704  66  LYS A CE    
512  N NZ    . LYS A 66  ? 0.9646 0.8692 1.7129 -0.0688 -0.4453 0.2649  66  LYS A NZ    
513  N N     . ILE A 67  ? 0.8359 0.7063 1.5673 -0.0242 -0.3994 0.1353  67  ILE A N     
514  C CA    . ILE A 67  ? 0.8184 0.6875 1.5404 -0.0276 -0.3958 0.1340  67  ILE A CA    
515  C C     . ILE A 67  ? 0.8316 0.6839 1.6016 -0.0097 -0.4060 0.0919  67  ILE A C     
516  O O     . ILE A 67  ? 0.8394 0.6792 1.6447 -0.0143 -0.4249 0.0983  67  ILE A O     
517  C CB    . ILE A 67  ? 0.8057 0.6964 1.4483 -0.0293 -0.3591 0.1303  67  ILE A CB    
518  C CG1   . ILE A 67  ? 0.7982 0.7086 1.3997 -0.0490 -0.3524 0.1725  67  ILE A CG1   
519  C CG2   . ILE A 67  ? 0.7976 0.6860 1.4337 -0.0302 -0.3552 0.1235  67  ILE A CG2   
520  C CD1   . ILE A 67  ? 0.7852 0.7176 1.3136 -0.0487 -0.3173 0.1655  67  ILE A CD1   
521  N N     . LEU A 68  ? 0.8294 0.6845 1.6022 0.0099  -0.3943 0.0487  68  LEU A N     
522  C CA    . LEU A 68  ? 0.8484 0.6922 1.6786 0.0274  -0.4084 0.0058  68  LEU A CA    
523  C C     . LEU A 68  ? 0.8501 0.6975 1.7055 0.0439  -0.4084 -0.0273 68  LEU A C     
524  O O     . LEU A 68  ? 0.8274 0.6936 1.6430 0.0553  -0.3811 -0.0575 68  LEU A O     
525  C CB    . LEU A 68  ? 0.8634 0.7157 1.6647 0.0352  -0.3889 -0.0244 68  LEU A CB    
526  C CG    . LEU A 68  ? 0.8575 0.7324 1.6096 0.0493  -0.3555 -0.0640 68  LEU A CG    
527  C CD1   . LEU A 68  ? 0.8702 0.7482 1.6697 0.0689  -0.3626 -0.1164 68  LEU A CD1   
528  C CD2   . LEU A 68  ? 0.8595 0.7448 1.5564 0.0445  -0.3331 -0.0620 68  LEU A CD2   
529  N N     . PRO A 69  ? 0.8858 0.7164 1.8105 0.0445  -0.4405 -0.0200 69  PRO A N     
530  C CA    . PRO A 69  ? 0.8957 0.7306 1.8497 0.0601  -0.4424 -0.0510 69  PRO A CA    
531  C C     . PRO A 69  ? 0.8933 0.7356 1.8817 0.0824  -0.4404 -0.1123 69  PRO A C     
532  O O     . PRO A 69  ? 0.8769 0.7315 1.8789 0.0966  -0.4347 -0.1448 69  PRO A O     
533  C CB    . PRO A 69  ? 0.9233 0.7360 1.9491 0.0526  -0.4821 -0.0220 69  PRO A CB    
534  C CG    . PRO A 69  ? 0.9325 0.7326 1.9605 0.0310  -0.4993 0.0278  69  PRO A CG    
535  C CD    . PRO A 69  ? 0.9043 0.7122 1.8882 0.0308  -0.4783 0.0164  69  PRO A CD    
536  N N     . ASN A 70  ? 0.9052 0.7437 1.9067 0.0849  -0.4443 -0.1287 70  ASN A N     
537  C CA    . ASN A 70  ? 0.9122 0.7600 1.9538 0.1047  -0.4466 -0.1873 70  ASN A CA    
538  C C     . ASN A 70  ? 0.8775 0.7600 1.8629 0.1167  -0.4096 -0.2279 70  ASN A C     
539  O O     . ASN A 70  ? 0.9046 0.8039 1.9244 0.1339  -0.4102 -0.2794 70  ASN A O     
540  C CB    . ASN A 70  ? 0.9288 0.7627 2.0002 0.1023  -0.4628 -0.1903 70  ASN A CB    
541  C CG    . ASN A 70  ? 0.9485 0.7496 2.0908 0.0917  -0.5045 -0.1557 70  ASN A CG    
542  O OD1   . ASN A 70  ? 0.9256 0.7138 2.1472 0.1010  -0.5340 -0.1730 70  ASN A OD1   
543  N ND2   . ASN A 70  ? 0.9679 0.7573 2.0843 0.0716  -0.5083 -0.1059 70  ASN A ND2   
544  N N     . ALA A 71  ? 0.8023 0.6981 1.7049 0.1072  -0.3788 -0.2055 71  ALA A N     
545  C CA    . ALA A 71  ? 0.7461 0.6743 1.5933 0.1151  -0.3452 -0.2377 71  ALA A CA    
546  C C     . ALA A 71  ? 0.7142 0.6656 1.5620 0.1268  -0.3337 -0.2663 71  ALA A C     
547  O O     . ALA A 71  ? 0.6985 0.6397 1.5745 0.1270  -0.3468 -0.2539 71  ALA A O     
548  C CB    . ALA A 71  ? 0.7456 0.6793 1.5111 0.1014  -0.3188 -0.2045 71  ALA A CB    
549  N N     . VAL A 72  ? 0.6710 0.6561 1.4874 0.1355  -0.3096 -0.3033 72  VAL A N     
550  C CA    . VAL A 72  ? 0.6477 0.6626 1.4545 0.1449  -0.2939 -0.3300 72  VAL A CA    
551  C C     . VAL A 72  ? 0.6350 0.6576 1.3653 0.1340  -0.2671 -0.2978 72  VAL A C     
552  O O     . VAL A 72  ? 0.6098 0.6390 1.2831 0.1260  -0.2477 -0.2841 72  VAL A O     
553  C CB    . VAL A 72  ? 0.6361 0.6906 1.4526 0.1587  -0.2832 -0.3874 72  VAL A CB    
554  C CG1   . VAL A 72  ? 0.6475 0.7117 1.4271 0.1541  -0.2705 -0.3916 72  VAL A CG1   
555  C CG2   . VAL A 72  ? 0.6224 0.7154 1.4067 0.1634  -0.2593 -0.4067 72  VAL A CG2   
556  N N     . TYR A 73  ? 0.6128 0.6336 1.3457 0.1339  -0.2678 -0.2855 73  TYR A N     
557  C CA    . TYR A 73  ? 0.6062 0.6322 1.2751 0.1242  -0.2460 -0.2557 73  TYR A CA    
558  C C     . TYR A 73  ? 0.6025 0.6634 1.2556 0.1326  -0.2270 -0.2842 73  TYR A C     
559  O O     . TYR A 73  ? 0.6324 0.7006 1.3312 0.1427  -0.2377 -0.3073 73  TYR A O     
560  C CB    . TYR A 73  ? 0.6047 0.6026 1.2847 0.1148  -0.2617 -0.2140 73  TYR A CB    
561  C CG    . TYR A 73  ? 0.6172 0.5865 1.3047 0.1028  -0.2782 -0.1793 73  TYR A CG    
562  C CD1   . TYR A 73  ? 0.6262 0.5751 1.3808 0.1055  -0.3084 -0.1834 73  TYR A CD1   
563  C CD2   . TYR A 73  ? 0.6086 0.5735 1.2388 0.0884  -0.2646 -0.1429 73  TYR A CD2   
564  C CE1   . TYR A 73  ? 0.6345 0.5599 1.3969 0.0928  -0.3244 -0.1490 73  TYR A CE1   
565  C CE2   . TYR A 73  ? 0.6103 0.5546 1.2467 0.0764  -0.2790 -0.1111 73  TYR A CE2   
566  C CZ    . TYR A 73  ? 0.6348 0.5597 1.3362 0.0778  -0.3088 -0.1126 73  TYR A CZ    
567  O OH    . TYR A 73  ? 0.6296 0.5367 1.3376 0.0641  -0.3237 -0.0783 73  TYR A OH    
568  N N     . LEU A 74  ? 0.6098 0.6938 1.2014 0.1280  -0.2001 -0.2829 74  LEU A N     
569  C CA    . LEU A 74  ? 0.6045 0.7260 1.1760 0.1332  -0.1809 -0.3062 74  LEU A CA    
570  C C     . LEU A 74  ? 0.5818 0.7041 1.0963 0.1231  -0.1627 -0.2742 74  LEU A C     
571  O O     . LEU A 74  ? 0.5427 0.6419 1.0262 0.1124  -0.1611 -0.2385 74  LEU A O     
572  C CB    . LEU A 74  ? 0.6085 0.7673 1.1629 0.1369  -0.1657 -0.3395 74  LEU A CB    
573  C CG    . LEU A 74  ? 0.6312 0.8009 1.2361 0.1478  -0.1793 -0.3805 74  LEU A CG    
574  C CD1   . LEU A 74  ? 0.6299 0.7909 1.3083 0.1598  -0.2029 -0.4030 74  LEU A CD1   
575  C CD2   . LEU A 74  ? 0.6330 0.7769 1.2352 0.1422  -0.1877 -0.3657 74  LEU A CD2   
576  N N     . PRO A 75  ? 0.5863 0.7378 1.0898 0.1266  -0.1495 -0.2887 75  PRO A N     
577  C CA    . PRO A 75  ? 0.5784 0.7328 1.0337 0.1180  -0.1334 -0.2624 75  PRO A CA    
578  C C     . PRO A 75  ? 0.5824 0.7668 0.9875 0.1128  -0.1104 -0.2660 75  PRO A C     
579  O O     . PRO A 75  ? 0.5709 0.7839 0.9795 0.1168  -0.1049 -0.2944 75  PRO A O     
580  C CB    . PRO A 75  ? 0.5717 0.7399 1.0542 0.1251  -0.1363 -0.2764 75  PRO A CB    
581  C CG    . PRO A 75  ? 0.5835 0.7695 1.1220 0.1385  -0.1479 -0.3193 75  PRO A CG    
582  C CD    . PRO A 75  ? 0.5942 0.7765 1.1388 0.1392  -0.1523 -0.3308 75  PRO A CD    
583  N N     . MET A 76  ? 0.6140 0.7934 0.9749 0.1034  -0.0982 -0.2373 76  MET A N     
584  C CA    . MET A 76  ? 0.6365 0.8412 0.9515 0.0967  -0.0787 -0.2342 76  MET A CA    
585  C C     . MET A 76  ? 0.6514 0.9023 0.9684 0.1003  -0.0680 -0.2620 76  MET A C     
586  O O     . MET A 76  ? 0.7024 0.9637 1.0386 0.1050  -0.0696 -0.2710 76  MET A O     
587  C CB    . MET A 76  ? 0.6373 0.8266 0.9149 0.0872  -0.0711 -0.2001 76  MET A CB    
588  C CG    . MET A 76  ? 0.6472 0.8020 0.9111 0.0809  -0.0766 -0.1727 76  MET A CG    
589  S SD    . MET A 76  ? 0.6324 0.7940 0.8605 0.0742  -0.0655 -0.1680 76  MET A SD    
590  C CE    . MET A 76  ? 0.6053 0.7783 0.7909 0.0657  -0.0498 -0.1486 76  MET A CE    
591  N N     . ARG A 77  ? 0.6564 0.9380 0.9537 0.0973  -0.0573 -0.2748 77  ARG A N     
592  C CA    . ARG A 77  ? 0.6839 1.0161 0.9689 0.0954  -0.0437 -0.2920 77  ARG A CA    
593  C C     . ARG A 77  ? 0.6657 1.0072 0.9017 0.0825  -0.0303 -0.2677 77  ARG A C     
594  O O     . ARG A 77  ? 0.6760 1.0532 0.8974 0.0781  -0.0223 -0.2793 77  ARG A O     
595  C CB    . ARG A 77  ? 0.7242 1.0957 1.0356 0.1028  -0.0446 -0.3338 77  ARG A CB    
596  C CG    . ARG A 77  ? 0.7490 1.1159 1.1172 0.1169  -0.0596 -0.3638 77  ARG A CG    
597  C CD    . ARG A 77  ? 0.7792 1.1731 1.1737 0.1241  -0.0637 -0.4029 77  ARG A CD    
598  N NE    . ARG A 77  ? 0.8143 1.1928 1.2699 0.1380  -0.0829 -0.4297 77  ARG A NE    
599  C CZ    . ARG A 77  ? 0.8186 1.1453 1.2999 0.1411  -0.1010 -0.4148 77  ARG A CZ    
600  N NH1   . ARG A 77  ? 0.7948 1.0816 1.2441 0.1315  -0.1012 -0.3743 77  ARG A NH1   
601  N NH2   . ARG A 77  ? 0.8465 1.1634 1.3891 0.1534  -0.1203 -0.4407 77  ARG A NH2   
602  N N     . LYS A 78  ? 0.6644 0.9753 0.8775 0.0760  -0.0291 -0.2344 78  LYS A N     
603  C CA    . LYS A 78  ? 0.6683 0.9818 0.8407 0.0642  -0.0193 -0.2094 78  LYS A CA    
604  C C     . LYS A 78  ? 0.6345 1.0006 0.7910 0.0575  -0.0080 -0.2195 78  LYS A C     
605  O O     . LYS A 78  ? 0.6003 0.9779 0.7338 0.0495  -0.0032 -0.2112 78  LYS A O     
606  C CB    . LYS A 78  ? 0.6848 0.9739 0.8424 0.0597  -0.0184 -0.1812 78  LYS A CB    
607  C CG    . LYS A 78  ? 0.7128 0.9884 0.8371 0.0495  -0.0135 -0.1535 78  LYS A CG    
608  C CD    . LYS A 78  ? 0.7190 0.9614 0.8399 0.0499  -0.0193 -0.1441 78  LYS A CD    
609  C CE    . LYS A 78  ? 0.7269 0.9390 0.8300 0.0447  -0.0198 -0.1167 78  LYS A CE    
610  N NZ    . LYS A 78  ? 0.7361 0.9600 0.8140 0.0356  -0.0123 -0.1018 78  LYS A NZ    
611  N N     . GLU A 79  ? 0.5952 0.9961 0.7654 0.0600  -0.0044 -0.2371 79  GLU A N     
612  C CA    . GLU A 79  ? 0.5907 1.0491 0.7467 0.0518  0.0063  -0.2456 79  GLU A CA    
613  C C     . GLU A 79  ? 0.5542 1.0478 0.7137 0.0524  0.0080  -0.2715 79  GLU A C     
614  O O     . GLU A 79  ? 0.5483 1.0754 0.6827 0.0408  0.0153  -0.2640 79  GLU A O     
615  C CB    . GLU A 79  ? 0.6105 1.1018 0.7827 0.0545  0.0098  -0.2604 79  GLU A CB    
616  C CG    . GLU A 79  ? 0.6319 1.1047 0.7901 0.0486  0.0116  -0.2310 79  GLU A CG    
617  C CD    . GLU A 79  ? 0.6623 1.1757 0.8320 0.0485  0.0167  -0.2431 79  GLU A CD    
618  O OE1   . GLU A 79  ? 0.6842 1.2565 0.8534 0.0440  0.0243  -0.2618 79  GLU A OE1   
619  O OE2   . GLU A 79  ? 0.6632 1.1527 0.8425 0.0521  0.0132  -0.2340 79  GLU A OE2   
620  N N     . VAL A 80  ? 0.5376 1.0245 0.7300 0.0651  0.0001  -0.3011 80  VAL A N     
621  C CA    . VAL A 80  ? 0.5466 1.0634 0.7467 0.0671  -0.0001 -0.3291 80  VAL A CA    
622  C C     . VAL A 80  ? 0.5477 1.0373 0.7227 0.0603  -0.0013 -0.3069 80  VAL A C     
623  O O     . VAL A 80  ? 0.5288 1.0531 0.6848 0.0522  0.0045  -0.3104 80  VAL A O     
624  C CB    . VAL A 80  ? 0.5597 1.0682 0.8081 0.0834  -0.0117 -0.3658 80  VAL A CB    
625  C CG1   . VAL A 80  ? 0.5767 1.1022 0.8334 0.0860  -0.0146 -0.3909 80  VAL A CG1   
626  C CG2   . VAL A 80  ? 0.5663 1.1167 0.8430 0.0905  -0.0097 -0.3969 80  VAL A CG2   
627  N N     . TYR A 81  ? 0.5514 0.9819 0.7263 0.0628  -0.0090 -0.2836 81  TYR A N     
628  C CA    . TYR A 81  ? 0.5345 0.9379 0.6863 0.0563  -0.0100 -0.2609 81  TYR A CA    
629  C C     . TYR A 81  ? 0.5234 0.9483 0.6376 0.0417  -0.0001 -0.2360 81  TYR A C     
630  O O     . TYR A 81  ? 0.4867 0.9199 0.5833 0.0348  0.0016  -0.2298 81  TYR A O     
631  C CB    . TYR A 81  ? 0.5379 0.8809 0.6943 0.0597  -0.0186 -0.2381 81  TYR A CB    
632  C CG    . TYR A 81  ? 0.5531 0.8724 0.7498 0.0720  -0.0312 -0.2558 81  TYR A CG    
633  C CD1   . TYR A 81  ? 0.5830 0.9227 0.8110 0.0806  -0.0371 -0.2914 81  TYR A CD1   
634  C CD2   . TYR A 81  ? 0.5641 0.8418 0.7702 0.0745  -0.0389 -0.2368 81  TYR A CD2   
635  C CE1   . TYR A 81  ? 0.5878 0.9037 0.8589 0.0916  -0.0517 -0.3064 81  TYR A CE1   
636  C CE2   . TYR A 81  ? 0.5810 0.8369 0.8267 0.0840  -0.0530 -0.2489 81  TYR A CE2   
637  C CZ    . TYR A 81  ? 0.5935 0.8669 0.8736 0.0927  -0.0602 -0.2832 81  TYR A CZ    
638  O OH    . TYR A 81  ? 0.6119 0.8620 0.9377 0.1020  -0.0771 -0.2944 81  TYR A OH    
639  N N     . GLN A 82  ? 0.5281 0.9634 0.6329 0.0367  0.0051  -0.2221 82  GLN A N     
640  C CA    . GLN A 82  ? 0.5256 0.9775 0.6003 0.0221  0.0115  -0.1947 82  GLN A CA    
641  C C     . GLN A 82  ? 0.5372 1.0519 0.6014 0.0128  0.0182  -0.2065 82  GLN A C     
642  O O     . GLN A 82  ? 0.5825 1.1099 0.6238 0.0002  0.0201  -0.1859 82  GLN A O     
643  C CB    . GLN A 82  ? 0.5199 0.9658 0.5917 0.0193  0.0136  -0.1773 82  GLN A CB    
644  C CG    . GLN A 82  ? 0.5204 0.9753 0.5671 0.0044  0.0168  -0.1458 82  GLN A CG    
645  C CD    . GLN A 82  ? 0.5394 0.9557 0.5719 0.0006  0.0125  -0.1222 82  GLN A CD    
646  O OE1   . GLN A 82  ? 0.5223 0.9560 0.5392 -0.0103 0.0133  -0.1087 82  GLN A OE1   
647  N NE2   . GLN A 82  ? 0.5439 0.9101 0.5831 0.0089  0.0075  -0.1169 82  GLN A NE2   
648  N N     . GLN A 83  ? 0.5299 1.0873 0.6123 0.0183  0.0210  -0.2398 83  GLN A N     
649  C CA    . GLN A 83  ? 0.5128 1.1383 0.5859 0.0091  0.0276  -0.2554 83  GLN A CA    
650  C C     . GLN A 83  ? 0.4846 1.1107 0.5502 0.0074  0.0250  -0.2610 83  GLN A C     
651  O O     . GLN A 83  ? 0.4701 1.1278 0.5119 -0.0070 0.0283  -0.2461 83  GLN A O     
652  C CB    . GLN A 83  ? 0.5340 1.2074 0.6325 0.0172  0.0309  -0.2957 83  GLN A CB    
653  C CG    . GLN A 83  ? 0.5429 1.2378 0.6419 0.0133  0.0362  -0.2882 83  GLN A CG    
654  C CD    . GLN A 83  ? 0.5617 1.2989 0.6911 0.0236  0.0385  -0.3300 83  GLN A CD    
655  O OE1   . GLN A 83  ? 0.5969 1.3362 0.7533 0.0365  0.0340  -0.3658 83  GLN A OE1   
656  N NE2   . GLN A 83  ? 0.5618 1.3337 0.6902 0.0181  0.0447  -0.3266 83  GLN A NE2   
657  N N     . VAL A 84  ? 0.4564 1.0470 0.5434 0.0210  0.0178  -0.2800 84  VAL A N     
658  C CA    . VAL A 84  ? 0.4629 1.0469 0.5446 0.0202  0.0142  -0.2841 84  VAL A CA    
659  C C     . VAL A 84  ? 0.4415 0.9945 0.4946 0.0092  0.0134  -0.2435 84  VAL A C     
660  O O     . VAL A 84  ? 0.4387 1.0153 0.4734 -0.0011 0.0148  -0.2362 84  VAL A O     
661  C CB    . VAL A 84  ? 0.4622 1.0028 0.5746 0.0361  0.0041  -0.3045 84  VAL A CB    
662  C CG1   . VAL A 84  ? 0.4693 1.0018 0.5745 0.0340  0.0003  -0.3054 84  VAL A CG1   
663  C CG2   . VAL A 84  ? 0.4766 1.0470 0.6253 0.0484  0.0020  -0.3486 84  VAL A CG2   
664  N N     . SER A 85  ? 0.4343 0.9357 0.4862 0.0116  0.0104  -0.2185 85  SER A N     
665  C CA    . SER A 85  ? 0.4351 0.9040 0.4659 0.0033  0.0088  -0.1829 85  SER A CA    
666  C C     . SER A 85  ? 0.4427 0.9519 0.4501 -0.0136 0.0133  -0.1621 85  SER A C     
667  O O     . SER A 85  ? 0.4504 0.9635 0.4428 -0.0227 0.0116  -0.1473 85  SER A O     
668  C CB    . SER A 85  ? 0.4129 0.8326 0.4478 0.0081  0.0061  -0.1638 85  SER A CB    
669  O OG    . SER A 85  ? 0.4164 0.8096 0.4341 0.0005  0.0044  -0.1330 85  SER A OG    
670  N N     . SER A 86  ? 0.4271 0.9667 0.4336 -0.0185 0.0179  -0.1599 86  SER A N     
671  C CA    . SER A 86  ? 0.4434 1.0241 0.4313 -0.0363 0.0207  -0.1368 86  SER A CA    
672  C C     . SER A 86  ? 0.4486 1.0852 0.4250 -0.0471 0.0229  -0.1454 86  SER A C     
673  O O     . SER A 86  ? 0.4613 1.1134 0.4208 -0.0625 0.0206  -0.1185 86  SER A O     
674  C CB    . SER A 86  ? 0.4455 1.0566 0.4384 -0.0388 0.0256  -0.1393 86  SER A CB    
675  O OG    . SER A 86  ? 0.4556 1.0166 0.4604 -0.0279 0.0233  -0.1348 86  SER A OG    
676  N N     . ARG A 87  ? 0.4496 1.1182 0.4375 -0.0392 0.0261  -0.1834 87  ARG A N     
677  C CA    . ARG A 87  ? 0.4636 1.1901 0.4412 -0.0487 0.0284  -0.1966 87  ARG A CA    
678  C C     . ARG A 87  ? 0.4514 1.1469 0.4198 -0.0505 0.0224  -0.1838 87  ARG A C     
679  O O     . ARG A 87  ? 0.4481 1.1745 0.3981 -0.0661 0.0214  -0.1657 87  ARG A O     
680  C CB    . ARG A 87  ? 0.4828 1.2497 0.4800 -0.0377 0.0323  -0.2458 87  ARG A CB    
681  C CG    . ARG A 87  ? 0.4874 1.3096 0.4909 -0.0402 0.0397  -0.2614 87  ARG A CG    
682  C CD    . ARG A 87  ? 0.5074 1.3938 0.5255 -0.0353 0.0441  -0.3101 87  ARG A CD    
683  N NE    . ARG A 87  ? 0.5183 1.3661 0.5673 -0.0140 0.0383  -0.3449 87  ARG A NE    
684  C CZ    . ARG A 87  ? 0.5115 1.3340 0.5906 0.0023  0.0360  -0.3660 87  ARG A CZ    
685  N NH1   . ARG A 87  ? 0.5126 1.3443 0.5939 0.0009  0.0404  -0.3582 87  ARG A NH1   
686  N NH2   . ARG A 87  ? 0.5106 1.2982 0.6203 0.0196  0.0280  -0.3943 87  ARG A NH2   
687  N N     . ILE A 88  ? 0.4408 1.0760 0.4230 -0.0354 0.0175  -0.1910 88  ILE A N     
688  C CA    . ILE A 88  ? 0.4351 1.0370 0.4107 -0.0360 0.0117  -0.1790 88  ILE A CA    
689  C C     . ILE A 88  ? 0.4388 1.0232 0.3961 -0.0495 0.0086  -0.1358 88  ILE A C     
690  O O     . ILE A 88  ? 0.4671 1.0616 0.4124 -0.0590 0.0054  -0.1231 88  ILE A O     
691  C CB    . ILE A 88  ? 0.4267 0.9671 0.4215 -0.0189 0.0066  -0.1901 88  ILE A CB    
692  C CG1   . ILE A 88  ? 0.4262 0.9856 0.4443 -0.0067 0.0061  -0.2334 88  ILE A CG1   
693  C CG2   . ILE A 88  ? 0.4258 0.9310 0.4126 -0.0209 0.0010  -0.1730 88  ILE A CG2   
694  C CD1   . ILE A 88  ? 0.4265 0.9292 0.4695 0.0092  -0.0009 -0.2434 88  ILE A CD1   
695  N N     . MET A 89  ? 0.4479 1.0084 0.4057 -0.0505 0.0084  -0.1142 89  MET A N     
696  C CA    . MET A 89  ? 0.4482 0.9949 0.3947 -0.0632 0.0036  -0.0752 89  MET A CA    
697  C C     . MET A 89  ? 0.4627 1.0692 0.3946 -0.0831 0.0031  -0.0599 89  MET A C     
698  O O     . MET A 89  ? 0.4809 1.0837 0.4050 -0.0938 -0.0034 -0.0354 89  MET A O     
699  C CB    . MET A 89  ? 0.4335 0.9522 0.3857 -0.0614 0.0031  -0.0583 89  MET A CB    
700  C CG    . MET A 89  ? 0.4133 0.8708 0.3775 -0.0454 0.0017  -0.0638 89  MET A CG    
701  S SD    . MET A 89  ? 0.4067 0.8172 0.3719 -0.0387 -0.0037 -0.0616 89  MET A SD    
702  C CE    . MET A 89  ? 0.3985 0.7624 0.3798 -0.0210 -0.0032 -0.0772 89  MET A CE    
703  N N     . ASN A 90  ? 0.4853 1.1494 0.4148 -0.0887 0.0094  -0.0739 90  ASN A N     
704  C CA    . ASN A 90  ? 0.4929 1.2255 0.4077 -0.1096 0.0094  -0.0610 90  ASN A CA    
705  C C     . ASN A 90  ? 0.4727 1.2303 0.3781 -0.1147 0.0076  -0.0695 90  ASN A C     
706  O O     . ASN A 90  ? 0.4576 1.2429 0.3505 -0.1330 0.0020  -0.0425 90  ASN A O     
707  C CB    . ASN A 90  ? 0.5275 1.3238 0.4425 -0.1137 0.0180  -0.0802 90  ASN A CB    
708  C CG    . ASN A 90  ? 0.5629 1.3527 0.4817 -0.1187 0.0177  -0.0575 90  ASN A CG    
709  O OD1   . ASN A 90  ? 0.6000 1.3633 0.5167 -0.1282 0.0098  -0.0199 90  ASN A OD1   
710  N ND2   . ASN A 90  ? 0.5732 1.3878 0.5004 -0.1121 0.0255  -0.0812 90  ASN A ND2   
711  N N     . LEU A 91  ? 0.4628 1.2104 0.3762 -0.0993 0.0106  -0.1057 91  LEU A N     
712  C CA    . LEU A 91  ? 0.4658 1.2275 0.3722 -0.1024 0.0077  -0.1139 91  LEU A CA    
713  C C     . LEU A 91  ? 0.4700 1.1820 0.3719 -0.1064 -0.0015 -0.0806 91  LEU A C     
714  O O     . LEU A 91  ? 0.4724 1.2103 0.3626 -0.1195 -0.0061 -0.0674 91  LEU A O     
715  C CB    . LEU A 91  ? 0.4623 1.2116 0.3840 -0.0836 0.0102  -0.1578 91  LEU A CB    
716  C CG    . LEU A 91  ? 0.4763 1.2802 0.4081 -0.0781 0.0178  -0.1991 91  LEU A CG    
717  C CD1   . LEU A 91  ? 0.4794 1.2560 0.4343 -0.0578 0.0163  -0.2392 91  LEU A CD1   
718  C CD2   . LEU A 91  ? 0.4811 1.3743 0.3967 -0.0958 0.0218  -0.2062 91  LEU A CD2   
719  N N     . LEU A 92  ? 0.4652 1.1095 0.3773 -0.0954 -0.0044 -0.0681 92  LEU A N     
720  C CA    . LEU A 92  ? 0.4653 1.0618 0.3773 -0.0971 -0.0129 -0.0406 92  LEU A CA    
721  C C     . LEU A 92  ? 0.4825 1.0976 0.3873 -0.1167 -0.0201 -0.0009 92  LEU A C     
722  O O     . LEU A 92  ? 0.4752 1.0820 0.3773 -0.1248 -0.0283 0.0197  92  LEU A O     
723  C CB    . LEU A 92  ? 0.4555 0.9833 0.3809 -0.0812 -0.0136 -0.0394 92  LEU A CB    
724  C CG    . LEU A 92  ? 0.4648 0.9635 0.4013 -0.0628 -0.0104 -0.0713 92  LEU A CG    
725  C CD1   . LEU A 92  ? 0.4589 0.8971 0.4065 -0.0508 -0.0117 -0.0647 92  LEU A CD1   
726  C CD2   . LEU A 92  ? 0.4572 0.9541 0.3920 -0.0617 -0.0137 -0.0809 92  LEU A CD2   
727  N N     . ARG A 93  ? 0.5208 1.1607 0.4252 -0.1247 -0.0184 0.0106  93  ARG A N     
728  C CA    . ARG A 93  ? 0.5509 1.2186 0.4513 -0.1462 -0.0268 0.0491  93  ARG A CA    
729  C C     . ARG A 93  ? 0.5489 1.2725 0.4357 -0.1645 -0.0310 0.0588  93  ARG A C     
730  O O     . ARG A 93  ? 0.5648 1.2906 0.4523 -0.1801 -0.0428 0.0943  93  ARG A O     
731  C CB    . ARG A 93  ? 0.5812 1.2813 0.4821 -0.1530 -0.0228 0.0542  93  ARG A CB    
732  C CG    . ARG A 93  ? 0.5910 1.2391 0.5062 -0.1466 -0.0266 0.0706  93  ARG A CG    
733  C CD    . ARG A 93  ? 0.6195 1.3008 0.5356 -0.1521 -0.0217 0.0719  93  ARG A CD    
734  N NE    . ARG A 93  ? 0.6159 1.2724 0.5386 -0.1323 -0.0118 0.0409  93  ARG A NE    
735  C CZ    . ARG A 93  ? 0.6219 1.2186 0.5566 -0.1187 -0.0133 0.0421  93  ARG A CZ    
736  N NH1   . ARG A 93  ? 0.6411 1.1962 0.5839 -0.1214 -0.0236 0.0693  93  ARG A NH1   
737  N NH2   . ARG A 93  ? 0.6294 1.2096 0.5700 -0.1025 -0.0053 0.0150  93  ARG A NH2   
738  N N     . GLU A 94  ? 0.5461 1.3142 0.4230 -0.1624 -0.0227 0.0266  94  GLU A N     
739  C CA    . GLU A 94  ? 0.5676 1.3944 0.4299 -0.1796 -0.0258 0.0315  94  GLU A CA    
740  C C     . GLU A 94  ? 0.5488 1.3382 0.4127 -0.1813 -0.0366 0.0508  94  GLU A C     
741  O O     . GLU A 94  ? 0.5563 1.3798 0.4125 -0.2011 -0.0456 0.0781  94  GLU A O     
742  C CB    . GLU A 94  ? 0.5925 1.4650 0.4483 -0.1722 -0.0151 -0.0148 94  GLU A CB    
743  C CG    . GLU A 94  ? 0.6115 1.5291 0.4684 -0.1695 -0.0041 -0.0408 94  GLU A CG    
744  C CD    . GLU A 94  ? 0.6477 1.6439 0.4912 -0.1950 -0.0044 -0.0184 94  GLU A CD    
745  O OE1   . GLU A 94  ? 0.7086 1.7711 0.5377 -0.2106 -0.0047 -0.0209 94  GLU A OE1   
746  O OE2   . GLU A 94  ? 0.6661 1.6604 0.5136 -0.2005 -0.0048 0.0023  94  GLU A OE2   
747  N N     . TYR A 95  ? 0.5198 1.2414 0.3949 -0.1613 -0.0361 0.0377  95  TYR A N     
748  C CA    . TYR A 95  ? 0.5143 1.1988 0.3930 -0.1603 -0.0451 0.0510  95  TYR A CA    
749  C C     . TYR A 95  ? 0.4905 1.1324 0.3821 -0.1655 -0.0570 0.0899  95  TYR A C     
750  O O     . TYR A 95  ? 0.4812 1.1105 0.3765 -0.1723 -0.0675 0.1103  95  TYR A O     
751  C CB    . TYR A 95  ? 0.5115 1.1487 0.3972 -0.1379 -0.0396 0.0187  95  TYR A CB    
752  C CG    . TYR A 95  ? 0.5226 1.2007 0.4018 -0.1327 -0.0313 -0.0209 95  TYR A CG    
753  C CD1   . TYR A 95  ? 0.5289 1.2405 0.3989 -0.1402 -0.0340 -0.0280 95  TYR A CD1   
754  C CD2   . TYR A 95  ? 0.5256 1.2106 0.4105 -0.1203 -0.0217 -0.0523 95  TYR A CD2   
755  C CE1   . TYR A 95  ? 0.5425 1.2931 0.4099 -0.1348 -0.0273 -0.0676 95  TYR A CE1   
756  C CE2   . TYR A 95  ? 0.5194 1.2423 0.4043 -0.1146 -0.0157 -0.0916 95  TYR A CE2   
757  C CZ    . TYR A 95  ? 0.5376 1.2934 0.4142 -0.1216 -0.0185 -0.1001 95  TYR A CZ    
758  O OH    . TYR A 95  ? 0.5623 1.3574 0.4423 -0.1152 -0.0134 -0.1427 95  TYR A OH    
759  N N     . SER A 96  ? 0.4777 1.0988 0.3788 -0.1625 -0.0565 0.0994  96  SER A N     
760  C CA    . SER A 96  ? 0.4742 1.0588 0.3919 -0.1677 -0.0692 0.1339  96  SER A CA    
761  C C     . SER A 96  ? 0.4870 1.0700 0.4123 -0.1692 -0.0684 0.1439  96  SER A C     
762  O O     . SER A 96  ? 0.4739 1.0451 0.3979 -0.1554 -0.0572 0.1194  96  SER A O     
763  C CB    . SER A 96  ? 0.4523 0.9691 0.3839 -0.1502 -0.0714 0.1273  96  SER A CB    
764  O OG    . SER A 96  ? 0.4439 0.9299 0.3954 -0.1551 -0.0849 0.1575  96  SER A OG    
765  N N     . GLU A 97  ? 0.5128 1.1074 0.4484 -0.1868 -0.0819 0.1812  97  GLU A N     
766  C CA    . GLU A 97  ? 0.5175 1.1082 0.4643 -0.1903 -0.0844 0.1960  97  GLU A CA    
767  C C     . GLU A 97  ? 0.4856 1.0061 0.4528 -0.1727 -0.0869 0.1924  97  GLU A C     
768  O O     . GLU A 97  ? 0.4888 0.9965 0.4630 -0.1677 -0.0840 0.1904  97  GLU A O     
769  C CB    . GLU A 97  ? 0.5604 1.1892 0.5152 -0.2169 -0.1006 0.2396  97  GLU A CB    
770  C CG    . GLU A 97  ? 0.5880 1.1799 0.5691 -0.2231 -0.1212 0.2722  97  GLU A CG    
771  C CD    . GLU A 97  ? 0.6215 1.2180 0.5994 -0.2283 -0.1283 0.2784  97  GLU A CD    
772  O OE1   . GLU A 97  ? 0.6409 1.2554 0.5968 -0.2222 -0.1162 0.2521  97  GLU A OE1   
773  O OE2   . GLU A 97  ? 0.6544 1.2348 0.6555 -0.2383 -0.1477 0.3099  97  GLU A OE2   
774  N N     . LYS A 98  ? 0.4601 0.9389 0.4369 -0.1636 -0.0920 0.1904  98  LYS A N     
775  C CA    . LYS A 98  ? 0.4380 0.8564 0.4336 -0.1469 -0.0936 0.1835  98  LYS A CA    
776  C C     . LYS A 98  ? 0.4176 0.8136 0.4012 -0.1265 -0.0775 0.1469  98  LYS A C     
777  O O     . LYS A 98  ? 0.4099 0.7887 0.3893 -0.1176 -0.0743 0.1320  98  LYS A O     
778  C CB    . LYS A 98  ? 0.4350 0.8232 0.4500 -0.1475 -0.1076 0.1988  98  LYS A CB    
779  C CG    . LYS A 98  ? 0.4511 0.8540 0.4867 -0.1672 -0.1275 0.2377  98  LYS A CG    
780  C CD    . LYS A 98  ? 0.4517 0.8308 0.5082 -0.1686 -0.1424 0.2517  98  LYS A CD    
781  C CE    . LYS A 98  ? 0.4711 0.8682 0.5515 -0.1901 -0.1650 0.2931  98  LYS A CE    
782  N NZ    . LYS A 98  ? 0.4725 0.8387 0.5825 -0.1890 -0.1818 0.3054  98  LYS A NZ    
783  N N     . ILE A 99  ? 0.4062 0.8039 0.3863 -0.1204 -0.0687 0.1345  99  ILE A N     
784  C CA    . ILE A 99  ? 0.4059 0.7873 0.3776 -0.1031 -0.0550 0.1024  99  ILE A CA    
785  C C     . ILE A 99  ? 0.3993 0.7412 0.3838 -0.0918 -0.0541 0.0992  99  ILE A C     
786  O O     . ILE A 99  ? 0.4184 0.7621 0.4129 -0.0984 -0.0599 0.1160  99  ILE A O     
787  C CB    . ILE A 99  ? 0.4067 0.8344 0.3624 -0.1056 -0.0445 0.0852  99  ILE A CB    
788  C CG1   . ILE A 99  ? 0.4015 0.8089 0.3550 -0.0873 -0.0334 0.0526  99  ILE A CG1   
789  C CG2   . ILE A 99  ? 0.4120 0.8689 0.3694 -0.1167 -0.0456 0.1001  99  ILE A CG2   
790  C CD1   . ILE A 99  ? 0.4112 0.8628 0.3546 -0.0872 -0.0242 0.0294  99  ILE A CD1   
791  N N     . GLU A 100 ? 0.3814 0.6897 0.3661 -0.0759 -0.0478 0.0786  100 GLU A N     
792  C CA    . GLU A 100 ? 0.3646 0.6412 0.3581 -0.0651 -0.0454 0.0720  100 GLU A CA    
793  C C     . GLU A 100 ? 0.3464 0.6204 0.3309 -0.0534 -0.0344 0.0463  100 GLU A C     
794  O O     . GLU A 100 ? 0.3548 0.6170 0.3359 -0.0463 -0.0316 0.0329  100 GLU A O     
795  C CB    . GLU A 100 ? 0.3681 0.6052 0.3754 -0.0584 -0.0512 0.0751  100 GLU A CB    
796  C CG    . GLU A 100 ? 0.3855 0.5945 0.4000 -0.0473 -0.0479 0.0653  100 GLU A CG    
797  C CD    . GLU A 100 ? 0.3915 0.5699 0.4220 -0.0420 -0.0540 0.0674  100 GLU A CD    
798  O OE1   . GLU A 100 ? 0.4111 0.5876 0.4536 -0.0478 -0.0636 0.0805  100 GLU A OE1   
799  O OE2   . GLU A 100 ? 0.4085 0.5672 0.4410 -0.0323 -0.0496 0.0553  100 GLU A OE2   
800  N N     . ILE A 101 ? 0.3573 0.6430 0.3406 -0.0520 -0.0295 0.0402  101 ILE A N     
801  C CA    . ILE A 101 ? 0.3684 0.6516 0.3487 -0.0409 -0.0212 0.0164  101 ILE A CA    
802  C C     . ILE A 101 ? 0.3536 0.5968 0.3418 -0.0305 -0.0214 0.0137  101 ILE A C     
803  O O     . ILE A 101 ? 0.3889 0.6231 0.3833 -0.0319 -0.0239 0.0238  101 ILE A O     
804  C CB    . ILE A 101 ? 0.3796 0.6955 0.3575 -0.0442 -0.0164 0.0110  101 ILE A CB    
805  C CG1   . ILE A 101 ? 0.3910 0.7561 0.3598 -0.0565 -0.0158 0.0133  101 ILE A CG1   
806  C CG2   . ILE A 101 ? 0.3790 0.6872 0.3603 -0.0314 -0.0102 -0.0136 101 ILE A CG2   
807  C CD1   . ILE A 101 ? 0.3976 0.8039 0.3643 -0.0632 -0.0117 0.0120  101 ILE A CD1   
808  N N     . ALA A 102 ? 0.3468 0.5685 0.3356 -0.0214 -0.0196 0.0010  102 ALA A N     
809  C CA    . ALA A 102 ? 0.3487 0.5373 0.3436 -0.0133 -0.0201 -0.0004 102 ALA A CA    
810  C C     . ALA A 102 ? 0.3608 0.5447 0.3583 -0.0056 -0.0162 -0.0136 102 ALA A C     
811  O O     . ALA A 102 ? 0.3676 0.5329 0.3693 -0.0017 -0.0166 -0.0117 102 ALA A O     
812  C CB    . ALA A 102 ? 0.3405 0.5104 0.3361 -0.0099 -0.0217 -0.0025 102 ALA A CB    
813  N N     . SER A 103 ? 0.3609 0.5630 0.3581 -0.0035 -0.0133 -0.0280 103 SER A N     
814  C CA    . SER A 103 ? 0.3528 0.5533 0.3575 0.0037  -0.0114 -0.0415 103 SER A CA    
815  C C     . SER A 103 ? 0.3658 0.5969 0.3727 0.0042  -0.0089 -0.0587 103 SER A C     
816  O O     . SER A 103 ? 0.3513 0.6036 0.3517 -0.0012 -0.0083 -0.0600 103 SER A O     
817  C CB    . SER A 103 ? 0.3460 0.5188 0.3581 0.0112  -0.0141 -0.0467 103 SER A CB    
818  O OG    . SER A 103 ? 0.3503 0.5245 0.3649 0.0131  -0.0157 -0.0565 103 SER A OG    
819  N N     . ILE A 104 ? 0.3730 0.6076 0.3911 0.0109  -0.0082 -0.0733 104 ILE A N     
820  C CA    . ILE A 104 ? 0.3862 0.6526 0.4119 0.0132  -0.0061 -0.0952 104 ILE A CA    
821  C C     . ILE A 104 ? 0.3899 0.6643 0.4179 0.0146  -0.0078 -0.1091 104 ILE A C     
822  O O     . ILE A 104 ? 0.3866 0.6973 0.4168 0.0136  -0.0053 -0.1269 104 ILE A O     
823  C CB    . ILE A 104 ? 0.3968 0.6571 0.4415 0.0226  -0.0078 -0.1106 104 ILE A CB    
824  C CG1   . ILE A 104 ? 0.4168 0.7187 0.4712 0.0244  -0.0047 -0.1350 104 ILE A CG1   
825  C CG2   . ILE A 104 ? 0.3957 0.6228 0.4546 0.0302  -0.0148 -0.1150 104 ILE A CG2   
826  C CD1   . ILE A 104 ? 0.4245 0.7269 0.4988 0.0323  -0.0060 -0.1482 104 ILE A CD1   
827  N N     . ASP A 105 ? 0.3903 0.6345 0.4181 0.0164  -0.0120 -0.1023 105 ASP A N     
828  C CA    . ASP A 105 ? 0.4179 0.6660 0.4496 0.0178  -0.0148 -0.1147 105 ASP A CA    
829  C C     . ASP A 105 ? 0.3992 0.6368 0.4169 0.0116  -0.0157 -0.0983 105 ASP A C     
830  O O     . ASP A 105 ? 0.4124 0.6407 0.4348 0.0138  -0.0194 -0.1046 105 ASP A O     
831  C CB    . ASP A 105 ? 0.4618 0.6851 0.5156 0.0275  -0.0216 -0.1274 105 ASP A CB    
832  C CG    . ASP A 105 ? 0.5026 0.6875 0.5572 0.0286  -0.0252 -0.1086 105 ASP A CG    
833  O OD1   . ASP A 105 ? 0.4860 0.6640 0.5279 0.0247  -0.0217 -0.0914 105 ASP A OD1   
834  O OD2   . ASP A 105 ? 0.5656 0.7296 0.6352 0.0329  -0.0322 -0.1117 105 ASP A OD2   
835  N N     . GLU A 106 ? 0.3719 0.6106 0.3759 0.0040  -0.0136 -0.0778 106 GLU A N     
836  C CA    . GLU A 106 ? 0.3607 0.5871 0.3560 -0.0014 -0.0158 -0.0614 106 GLU A CA    
837  C C     . GLU A 106 ? 0.3398 0.5851 0.3244 -0.0120 -0.0153 -0.0440 106 GLU A C     
838  O O     . GLU A 106 ? 0.3188 0.5689 0.3029 -0.0146 -0.0141 -0.0357 106 GLU A O     
839  C CB    . GLU A 106 ? 0.3762 0.5657 0.3749 0.0023  -0.0180 -0.0500 106 GLU A CB    
840  C CG    . GLU A 106 ? 0.3971 0.5656 0.4068 0.0098  -0.0208 -0.0598 106 GLU A CG    
841  C CD    . GLU A 106 ? 0.4151 0.5562 0.4269 0.0117  -0.0223 -0.0483 106 GLU A CD    
842  O OE1   . GLU A 106 ? 0.4188 0.5546 0.4241 0.0081  -0.0213 -0.0350 106 GLU A OE1   
843  O OE2   . GLU A 106 ? 0.4535 0.5805 0.4757 0.0165  -0.0254 -0.0530 106 GLU A OE2   
844  N N     . ALA A 107 ? 0.3125 0.5669 0.2907 -0.0186 -0.0179 -0.0366 107 ALA A N     
845  C CA    . ALA A 107 ? 0.3036 0.5738 0.2758 -0.0302 -0.0208 -0.0158 107 ALA A CA    
846  C C     . ALA A 107 ? 0.2994 0.5618 0.2699 -0.0348 -0.0260 -0.0046 107 ALA A C     
847  O O     . ALA A 107 ? 0.2985 0.5606 0.2677 -0.0320 -0.0260 -0.0157 107 ALA A O     
848  C CB    . ALA A 107 ? 0.3082 0.6253 0.2731 -0.0389 -0.0182 -0.0189 107 ALA A CB    
849  N N     . TYR A 108 ? 0.3061 0.5628 0.2798 -0.0419 -0.0317 0.0170  108 TYR A N     
850  C CA    . TYR A 108 ? 0.3218 0.5749 0.2973 -0.0479 -0.0386 0.0304  108 TYR A CA    
851  C C     . TYR A 108 ? 0.3331 0.6246 0.3028 -0.0629 -0.0433 0.0456  108 TYR A C     
852  O O     . TYR A 108 ? 0.3427 0.6560 0.3114 -0.0703 -0.0435 0.0545  108 TYR A O     
853  C CB    . TYR A 108 ? 0.3236 0.5460 0.3129 -0.0461 -0.0446 0.0442  108 TYR A CB    
854  C CG    . TYR A 108 ? 0.3052 0.4955 0.2997 -0.0337 -0.0405 0.0321  108 TYR A CG    
855  C CD1   . TYR A 108 ? 0.3146 0.4971 0.3102 -0.0282 -0.0361 0.0259  108 TYR A CD1   
856  C CD2   . TYR A 108 ? 0.3068 0.4777 0.3053 -0.0288 -0.0415 0.0282  108 TYR A CD2   
857  C CE1   . TYR A 108 ? 0.2934 0.4511 0.2931 -0.0188 -0.0332 0.0170  108 TYR A CE1   
858  C CE2   . TYR A 108 ? 0.3016 0.4496 0.3041 -0.0197 -0.0381 0.0192  108 TYR A CE2   
859  C CZ    . TYR A 108 ? 0.3034 0.4456 0.3061 -0.0151 -0.0341 0.0141  108 TYR A CZ    
860  O OH    . TYR A 108 ? 0.2966 0.4202 0.3027 -0.0081 -0.0316 0.0074  108 TYR A OH    
861  N N     . LEU A 109 ? 0.3306 0.6329 0.2966 -0.0685 -0.0473 0.0494  109 LEU A N     
862  C CA    . LEU A 109 ? 0.3417 0.6795 0.3039 -0.0850 -0.0544 0.0693  109 LEU A CA    
863  C C     . LEU A 109 ? 0.3464 0.6635 0.3205 -0.0887 -0.0654 0.0878  109 LEU A C     
864  O O     . LEU A 109 ? 0.3524 0.6471 0.3287 -0.0808 -0.0649 0.0784  109 LEU A O     
865  C CB    . LEU A 109 ? 0.3423 0.7230 0.2887 -0.0903 -0.0499 0.0555  109 LEU A CB    
866  C CG    . LEU A 109 ? 0.3463 0.7529 0.2848 -0.0859 -0.0396 0.0322  109 LEU A CG    
867  C CD1   . LEU A 109 ? 0.3586 0.8106 0.2850 -0.0910 -0.0364 0.0154  109 LEU A CD1   
868  C CD2   . LEU A 109 ? 0.3512 0.7795 0.2898 -0.0942 -0.0394 0.0456  109 LEU A CD2   
869  N N     . ASP A 110 ? 0.3497 0.6735 0.3349 -0.1005 -0.0764 0.1144  110 ASP A N     
870  C CA    . ASP A 110 ? 0.3601 0.6707 0.3609 -0.1060 -0.0894 0.1337  110 ASP A CA    
871  C C     . ASP A 110 ? 0.3730 0.7252 0.3618 -0.1213 -0.0940 0.1450  110 ASP A C     
872  O O     . ASP A 110 ? 0.3687 0.7586 0.3526 -0.1363 -0.0980 0.1617  110 ASP A O     
873  C CB    . ASP A 110 ? 0.3612 0.6585 0.3861 -0.1118 -0.1021 0.1573  110 ASP A CB    
874  C CG    . ASP A 110 ? 0.3717 0.6553 0.4195 -0.1173 -0.1182 0.1769  110 ASP A CG    
875  O OD1   . ASP A 110 ? 0.3803 0.6728 0.4222 -0.1208 -0.1205 0.1782  110 ASP A OD1   
876  O OD2   . ASP A 110 ? 0.3718 0.6355 0.4465 -0.1179 -0.1296 0.1905  110 ASP A OD2   
877  N N     . ILE A 111 ? 0.3848 0.7334 0.3685 -0.1182 -0.0934 0.1360  111 ILE A N     
878  C CA    . ILE A 111 ? 0.3991 0.7891 0.3704 -0.1326 -0.0978 0.1447  111 ILE A CA    
879  C C     . ILE A 111 ? 0.4131 0.7904 0.4008 -0.1392 -0.1128 0.1665  111 ILE A C     
880  O O     . ILE A 111 ? 0.4268 0.8257 0.4054 -0.1463 -0.1157 0.1682  111 ILE A O     
881  C CB    . ILE A 111 ? 0.3905 0.7956 0.3421 -0.1253 -0.0858 0.1144  111 ILE A CB    
882  C CG1   . ILE A 111 ? 0.3758 0.7352 0.3348 -0.1082 -0.0819 0.0962  111 ILE A CG1   
883  C CG2   . ILE A 111 ? 0.3872 0.8160 0.3256 -0.1215 -0.0735 0.0936  111 ILE A CG2   
884  C CD1   . ILE A 111 ? 0.3796 0.7511 0.3258 -0.1031 -0.0752 0.0714  111 ILE A CD1   
885  N N     . SER A 112 ? 0.4110 0.7550 0.4249 -0.1368 -0.1230 0.1820  112 SER A N     
886  C CA    . SER A 112 ? 0.4283 0.7583 0.4649 -0.1422 -0.1393 0.2023  112 SER A CA    
887  C C     . SER A 112 ? 0.4471 0.8201 0.4815 -0.1650 -0.1529 0.2322  112 SER A C     
888  O O     . SER A 112 ? 0.4614 0.8356 0.5038 -0.1708 -0.1633 0.2438  112 SER A O     
889  C CB    . SER A 112 ? 0.4275 0.7198 0.4976 -0.1363 -0.1494 0.2118  112 SER A CB    
890  O OG    . SER A 112 ? 0.4052 0.6649 0.4746 -0.1173 -0.1364 0.1849  112 SER A OG    
891  N N     . ASP A 113 ? 0.4451 0.8565 0.4680 -0.1784 -0.1526 0.2444  113 ASP A N     
892  C CA    . ASP A 113 ? 0.4704 0.9303 0.4898 -0.2028 -0.1655 0.2755  113 ASP A CA    
893  C C     . ASP A 113 ? 0.4973 1.0122 0.4814 -0.2109 -0.1539 0.2619  113 ASP A C     
894  O O     . ASP A 113 ? 0.5256 1.0871 0.5028 -0.2319 -0.1638 0.2853  113 ASP A O     
895  C CB    . ASP A 113 ? 0.4623 0.9353 0.4966 -0.2162 -0.1761 0.3037  113 ASP A CB    
896  C CG    . ASP A 113 ? 0.4519 0.8770 0.5279 -0.2116 -0.1929 0.3205  113 ASP A CG    
897  O OD1   . ASP A 113 ? 0.4647 0.8529 0.5583 -0.2004 -0.1975 0.3133  113 ASP A OD1   
898  O OD2   . ASP A 113 ? 0.4552 0.8804 0.5490 -0.2188 -0.2020 0.3397  113 ASP A OD2   
899  N N     . LYS A 114 ? 0.4892 1.0003 0.4534 -0.1950 -0.1346 0.2243  114 LYS A N     
900  C CA    . LYS A 114 ? 0.5136 1.0769 0.4489 -0.2001 -0.1233 0.2046  114 LYS A CA    
901  C C     . LYS A 114 ? 0.5107 1.0704 0.4374 -0.1936 -0.1205 0.1853  114 LYS A C     
902  O O     . LYS A 114 ? 0.5149 1.1227 0.4208 -0.2005 -0.1149 0.1713  114 LYS A O     
903  C CB    . LYS A 114 ? 0.5264 1.0948 0.4492 -0.1881 -0.1060 0.1744  114 LYS A CB    
904  C CG    . LYS A 114 ? 0.5624 1.1302 0.4940 -0.1922 -0.1075 0.1903  114 LYS A CG    
905  C CD    . LYS A 114 ? 0.5945 1.2319 0.5118 -0.2134 -0.1077 0.2045  114 LYS A CD    
906  C CE    . LYS A 114 ? 0.6376 1.3223 0.5501 -0.2376 -0.1214 0.2343  114 LYS A CE    
907  N NZ    . LYS A 114 ? 0.6648 1.4211 0.5651 -0.2611 -0.1232 0.2538  114 LYS A NZ    
908  N N     . VAL A 115 ? 0.4892 0.9957 0.4331 -0.1811 -0.1248 0.1840  115 VAL A N     
909  C CA    . VAL A 115 ? 0.4808 0.9779 0.4211 -0.1752 -0.1243 0.1697  115 VAL A CA    
910  C C     . VAL A 115 ? 0.4774 0.9319 0.4429 -0.1727 -0.1376 0.1887  115 VAL A C     
911  O O     . VAL A 115 ? 0.4640 0.8889 0.4516 -0.1705 -0.1447 0.2045  115 VAL A O     
912  C CB    . VAL A 115 ? 0.4765 0.9494 0.4090 -0.1543 -0.1083 0.1294  115 VAL A CB    
913  C CG1   . VAL A 115 ? 0.4811 0.9960 0.3937 -0.1548 -0.0961 0.1057  115 VAL A CG1   
914  C CG2   . VAL A 115 ? 0.4632 0.8789 0.4126 -0.1369 -0.1045 0.1230  115 VAL A CG2   
915  N N     . ARG A 116 ? 0.4895 0.9418 0.4540 -0.1722 -0.1409 0.1845  116 ARG A N     
916  C CA    . ARG A 116 ? 0.5065 0.9272 0.4962 -0.1720 -0.1551 0.2030  116 ARG A CA    
917  C C     . ARG A 116 ? 0.4811 0.8508 0.4830 -0.1514 -0.1484 0.1815  116 ARG A C     
918  O O     . ARG A 116 ? 0.4846 0.8213 0.5133 -0.1471 -0.1580 0.1931  116 ARG A O     
919  C CB    . ARG A 116 ? 0.5423 0.9942 0.5255 -0.1861 -0.1649 0.2153  116 ARG A CB    
920  C CG    . ARG A 116 ? 0.5971 1.1052 0.5705 -0.2106 -0.1749 0.2433  116 ARG A CG    
921  C CD    . ARG A 116 ? 0.6564 1.1872 0.6352 -0.2274 -0.1920 0.2691  116 ARG A CD    
922  N NE    . ARG A 116 ? 0.7207 1.2803 0.7112 -0.2498 -0.2096 0.3107  116 ARG A NE    
923  C CZ    . ARG A 116 ? 0.7650 1.3808 0.7358 -0.2676 -0.2084 0.3222  116 ARG A CZ    
924  N NH1   . ARG A 116 ? 0.7642 1.4163 0.7028 -0.2649 -0.1901 0.2920  116 ARG A NH1   
925  N NH2   . ARG A 116 ? 0.8129 1.4515 0.7988 -0.2889 -0.2269 0.3642  116 ARG A NH2   
926  N N     . ASP A 117 ? 0.4522 0.8184 0.4367 -0.1394 -0.1334 0.1503  117 ASP A N     
927  C CA    . ASP A 117 ? 0.4279 0.7526 0.4216 -0.1222 -0.1272 0.1309  117 ASP A CA    
928  C C     . ASP A 117 ? 0.4192 0.7404 0.3972 -0.1100 -0.1114 0.1001  117 ASP A C     
929  O O     . ASP A 117 ? 0.4229 0.7718 0.3857 -0.1135 -0.1052 0.0926  117 ASP A O     
930  C CB    . ASP A 117 ? 0.4408 0.7656 0.4379 -0.1247 -0.1340 0.1327  117 ASP A CB    
931  C CG    . ASP A 117 ? 0.4457 0.8138 0.4202 -0.1347 -0.1329 0.1259  117 ASP A CG    
932  O OD1   . ASP A 117 ? 0.4400 0.8219 0.3975 -0.1294 -0.1212 0.1010  117 ASP A OD1   
933  O OD2   . ASP A 117 ? 0.4766 0.8671 0.4523 -0.1484 -0.1447 0.1452  117 ASP A OD2   
934  N N     . TYR A 118 ? 0.4055 0.6944 0.3898 -0.0962 -0.1058 0.0830  118 TYR A N     
935  C CA    . TYR A 118 ? 0.4077 0.6876 0.3838 -0.0845 -0.0936 0.0565  118 TYR A CA    
936  C C     . TYR A 118 ? 0.4356 0.7428 0.3970 -0.0859 -0.0901 0.0364  118 TYR A C     
937  O O     . TYR A 118 ? 0.4366 0.7485 0.3920 -0.0793 -0.0821 0.0153  118 TYR A O     
938  C CB    . TYR A 118 ? 0.3877 0.6270 0.3772 -0.0714 -0.0904 0.0483  118 TYR A CB    
939  C CG    . TYR A 118 ? 0.3879 0.6024 0.3917 -0.0666 -0.0906 0.0581  118 TYR A CG    
940  C CD1   . TYR A 118 ? 0.3762 0.5942 0.3767 -0.0663 -0.0867 0.0596  118 TYR A CD1   
941  C CD2   . TYR A 118 ? 0.3850 0.5745 0.4070 -0.0618 -0.0944 0.0633  118 TYR A CD2   
942  C CE1   . TYR A 118 ? 0.3826 0.5787 0.3973 -0.0615 -0.0873 0.0660  118 TYR A CE1   
943  C CE2   . TYR A 118 ? 0.3819 0.5524 0.4191 -0.0567 -0.0946 0.0679  118 TYR A CE2   
944  C CZ    . TYR A 118 ? 0.3811 0.5542 0.4144 -0.0565 -0.0913 0.0690  118 TYR A CZ    
945  O OH    . TYR A 118 ? 0.3681 0.5235 0.4176 -0.0514 -0.0921 0.0717  118 TYR A OH    
946  N N     . ARG A 119 ? 0.4574 0.7822 0.4159 -0.0941 -0.0972 0.0416  119 ARG A N     
947  C CA    . ARG A 119 ? 0.4813 0.8398 0.4268 -0.0975 -0.0956 0.0224  119 ARG A CA    
948  C C     . ARG A 119 ? 0.4540 0.8554 0.3848 -0.1048 -0.0914 0.0168  119 ARG A C     
949  O O     . ARG A 119 ? 0.4545 0.8703 0.3802 -0.0988 -0.0843 -0.0103 119 ARG A O     
950  C CB    . ARG A 119 ? 0.5241 0.9013 0.4676 -0.1085 -0.1054 0.0344  119 ARG A CB    
951  C CG    . ARG A 119 ? 0.5673 0.9784 0.4993 -0.1110 -0.1043 0.0111  119 ARG A CG    
952  C CD    . ARG A 119 ? 0.6084 1.0493 0.5346 -0.1257 -0.1146 0.0266  119 ARG A CD    
953  N NE    . ARG A 119 ? 0.6457 1.1295 0.5590 -0.1300 -0.1134 0.0027  119 ARG A NE    
954  C CZ    . ARG A 119 ? 0.6769 1.1519 0.5950 -0.1224 -0.1135 -0.0203 119 ARG A CZ    
955  N NH1   . ARG A 119 ? 0.6802 1.1058 0.6145 -0.1111 -0.1143 -0.0208 119 ARG A NH1   
956  N NH2   . ARG A 119 ? 0.7086 1.2277 0.6168 -0.1268 -0.1132 -0.0438 119 ARG A NH2   
957  N N     . GLU A 120 ? 0.4478 0.8704 0.3749 -0.1180 -0.0968 0.0430  120 GLU A N     
958  C CA    . GLU A 120 ? 0.4414 0.9087 0.3551 -0.1276 -0.0934 0.0434  120 GLU A CA    
959  C C     . GLU A 120 ? 0.4182 0.8666 0.3353 -0.1171 -0.0844 0.0336  120 GLU A C     
960  O O     . GLU A 120 ? 0.4201 0.9018 0.3274 -0.1188 -0.0777 0.0193  120 GLU A O     
961  C CB    . GLU A 120 ? 0.4601 0.9528 0.3727 -0.1466 -0.1046 0.0799  120 GLU A CB    
962  C CG    . GLU A 120 ? 0.4822 1.0006 0.3907 -0.1598 -0.1150 0.0928  120 GLU A CG    
963  C CD    . GLU A 120 ? 0.5019 1.0588 0.4080 -0.1822 -0.1272 0.1293  120 GLU A CD    
964  O OE1   . GLU A 120 ? 0.5014 1.0537 0.4149 -0.1867 -0.1301 0.1494  120 GLU A OE1   
965  O OE2   . GLU A 120 ? 0.5440 1.1377 0.4417 -0.1964 -0.1351 0.1389  120 GLU A OE2   
966  N N     . ALA A 121 ? 0.3911 0.7895 0.3228 -0.1066 -0.0843 0.0404  121 ALA A N     
967  C CA    . ALA A 121 ? 0.3758 0.7547 0.3111 -0.0961 -0.0760 0.0303  121 ALA A CA    
968  C C     . ALA A 121 ? 0.3743 0.7534 0.3073 -0.0844 -0.0676 -0.0035 121 ALA A C     
969  O O     . ALA A 121 ? 0.3651 0.7631 0.2936 -0.0822 -0.0610 -0.0183 121 ALA A O     
970  C CB    . ALA A 121 ? 0.3586 0.6878 0.3101 -0.0874 -0.0777 0.0419  121 ALA A CB    
971  N N     . TYR A 122 ? 0.3902 0.7503 0.3290 -0.0777 -0.0690 -0.0157 122 TYR A N     
972  C CA    . TYR A 122 ? 0.4113 0.7680 0.3544 -0.0668 -0.0644 -0.0470 122 TYR A CA    
973  C C     . TYR A 122 ? 0.4293 0.8384 0.3623 -0.0721 -0.0618 -0.0674 122 TYR A C     
974  O O     . TYR A 122 ? 0.4267 0.8443 0.3636 -0.0648 -0.0564 -0.0902 122 TYR A O     
975  C CB    . TYR A 122 ? 0.4344 0.7695 0.3857 -0.0624 -0.0689 -0.0530 122 TYR A CB    
976  C CG    . TYR A 122 ? 0.4468 0.7664 0.4104 -0.0502 -0.0671 -0.0811 122 TYR A CG    
977  C CD1   . TYR A 122 ? 0.4535 0.8047 0.4177 -0.0492 -0.0670 -0.1092 122 TYR A CD1   
978  C CD2   . TYR A 122 ? 0.4520 0.7275 0.4295 -0.0404 -0.0669 -0.0794 122 TYR A CD2   
979  C CE1   . TYR A 122 ? 0.4586 0.7934 0.4406 -0.0379 -0.0683 -0.1345 122 TYR A CE1   
980  C CE2   . TYR A 122 ? 0.4549 0.7158 0.4474 -0.0310 -0.0680 -0.1009 122 TYR A CE2   
981  C CZ    . TYR A 122 ? 0.4604 0.7487 0.4569 -0.0294 -0.0695 -0.1282 122 TYR A CZ    
982  O OH    . TYR A 122 ? 0.4704 0.7418 0.4880 -0.0199 -0.0732 -0.1491 122 TYR A OH    
983  N N     . ASN A 123 ? 0.4339 0.8816 0.3554 -0.0852 -0.0662 -0.0601 123 ASN A N     
984  C CA    . ASN A 123 ? 0.4670 0.9728 0.3779 -0.0917 -0.0634 -0.0808 123 ASN A CA    
985  C C     . ASN A 123 ? 0.4511 0.9842 0.3561 -0.0946 -0.0569 -0.0819 123 ASN A C     
986  O O     . ASN A 123 ? 0.4547 1.0161 0.3612 -0.0897 -0.0513 -0.1119 123 ASN A O     
987  C CB    . ASN A 123 ? 0.4999 1.0490 0.3971 -0.1083 -0.0696 -0.0684 123 ASN A CB    
988  C CG    . ASN A 123 ? 0.5451 1.1549 0.4337 -0.1126 -0.0666 -0.0987 123 ASN A CG    
989  O OD1   . ASN A 123 ? 0.5663 1.1748 0.4635 -0.1036 -0.0668 -0.1291 123 ASN A OD1   
990  N ND2   . ASN A 123 ? 0.5823 1.2477 0.4563 -0.1262 -0.0640 -0.0926 123 ASN A ND2   
991  N N     . LEU A 124 ? 0.4303 0.9544 0.3317 -0.1018 -0.0582 -0.0507 124 LEU A N     
992  C CA    . LEU A 124 ? 0.4302 0.9769 0.3275 -0.1046 -0.0525 -0.0496 124 LEU A CA    
993  C C     . LEU A 124 ? 0.4159 0.9300 0.3261 -0.0868 -0.0455 -0.0730 124 LEU A C     
994  O O     . LEU A 124 ? 0.4019 0.9435 0.3113 -0.0852 -0.0392 -0.0895 124 LEU A O     
995  C CB    . LEU A 124 ? 0.4353 0.9702 0.3318 -0.1147 -0.0576 -0.0106 124 LEU A CB    
996  C CG    . LEU A 124 ? 0.4404 1.0080 0.3310 -0.1231 -0.0541 -0.0017 124 LEU A CG    
997  C CD1   . LEU A 124 ? 0.4585 1.0994 0.3327 -0.1421 -0.0555 0.0021  124 LEU A CD1   
998  C CD2   . LEU A 124 ? 0.4340 0.9691 0.3329 -0.1272 -0.0605 0.0330  124 LEU A CD2   
999  N N     . GLY A 125 ? 0.3899 0.8479 0.3131 -0.0744 -0.0472 -0.0733 125 GLY A N     
1000 C CA    . GLY A 125 ? 0.3710 0.7962 0.3083 -0.0587 -0.0429 -0.0923 125 GLY A CA    
1001 C C     . GLY A 125 ? 0.3734 0.8246 0.3180 -0.0518 -0.0404 -0.1299 125 GLY A C     
1002 O O     . GLY A 125 ? 0.3460 0.8026 0.2985 -0.0447 -0.0359 -0.1471 125 GLY A O     
1003 N N     . LEU A 126 ? 0.3802 0.8491 0.3247 -0.0538 -0.0442 -0.1438 126 LEU A N     
1004 C CA    . LEU A 126 ? 0.3961 0.8955 0.3509 -0.0477 -0.0436 -0.1833 126 LEU A CA    
1005 C C     . LEU A 126 ? 0.4053 0.9669 0.3506 -0.0546 -0.0376 -0.1975 126 LEU A C     
1006 O O     . LEU A 126 ? 0.4096 0.9852 0.3696 -0.0452 -0.0347 -0.2290 126 LEU A O     
1007 C CB    . LEU A 126 ? 0.4049 0.9169 0.3600 -0.0504 -0.0494 -0.1945 126 LEU A CB    
1008 C CG    . LEU A 126 ? 0.3957 0.8527 0.3631 -0.0434 -0.0558 -0.1861 126 LEU A CG    
1009 C CD1   . LEU A 126 ? 0.4066 0.8852 0.3722 -0.0481 -0.0614 -0.1972 126 LEU A CD1   
1010 C CD2   . LEU A 126 ? 0.3858 0.8027 0.3792 -0.0277 -0.0577 -0.2044 126 LEU A CD2   
1011 N N     . GLU A 127 ? 0.4204 1.0213 0.3437 -0.0716 -0.0366 -0.1743 127 GLU A N     
1012 C CA    . GLU A 127 ? 0.4340 1.1000 0.3459 -0.0814 -0.0307 -0.1824 127 GLU A CA    
1013 C C     . GLU A 127 ? 0.4214 1.0716 0.3430 -0.0725 -0.0250 -0.1870 127 GLU A C     
1014 O O     . GLU A 127 ? 0.4145 1.1040 0.3418 -0.0693 -0.0197 -0.2156 127 GLU A O     
1015 C CB    . GLU A 127 ? 0.4523 1.1507 0.3418 -0.1025 -0.0325 -0.1441 127 GLU A CB    
1016 C CG    . GLU A 127 ? 0.4834 1.2136 0.3597 -0.1164 -0.0386 -0.1343 127 GLU A CG    
1017 C CD    . GLU A 127 ? 0.5121 1.2960 0.3684 -0.1399 -0.0408 -0.1022 127 GLU A CD    
1018 O OE1   . GLU A 127 ? 0.4971 1.3208 0.3476 -0.1466 -0.0353 -0.1021 127 GLU A OE1   
1019 O OE2   . GLU A 127 ? 0.5528 1.3413 0.4006 -0.1528 -0.0491 -0.0759 127 GLU A OE2   
1020 N N     . ILE A 128 ? 0.4158 1.0101 0.3404 -0.0685 -0.0263 -0.1598 128 ILE A N     
1021 C CA    . ILE A 128 ? 0.4038 0.9814 0.3362 -0.0613 -0.0215 -0.1600 128 ILE A CA    
1022 C C     . ILE A 128 ? 0.3932 0.9529 0.3492 -0.0435 -0.0206 -0.1966 128 ILE A C     
1023 O O     . ILE A 128 ? 0.3789 0.9641 0.3430 -0.0391 -0.0158 -0.2177 128 ILE A O     
1024 C CB    . ILE A 128 ? 0.4023 0.9272 0.3332 -0.0618 -0.0240 -0.1237 128 ILE A CB    
1025 C CG1   . ILE A 128 ? 0.4064 0.9597 0.3201 -0.0803 -0.0261 -0.0902 128 ILE A CG1   
1026 C CG2   . ILE A 128 ? 0.4101 0.9073 0.3521 -0.0513 -0.0201 -0.1272 128 ILE A CG2   
1027 C CD1   . ILE A 128 ? 0.4027 0.9085 0.3181 -0.0822 -0.0316 -0.0557 128 ILE A CD1   
1028 N N     . LYS A 129 ? 0.3981 0.9165 0.3678 -0.0339 -0.0263 -0.2042 129 LYS A N     
1029 C CA    . LYS A 129 ? 0.4045 0.9059 0.4018 -0.0182 -0.0290 -0.2375 129 LYS A CA    
1030 C C     . LYS A 129 ? 0.4201 0.9814 0.4258 -0.0169 -0.0270 -0.2779 129 LYS A C     
1031 O O     . LYS A 129 ? 0.4177 0.9888 0.4414 -0.0081 -0.0251 -0.3020 129 LYS A O     
1032 C CB    . LYS A 129 ? 0.3992 0.8531 0.4095 -0.0114 -0.0371 -0.2361 129 LYS A CB    
1033 C CG    . LYS A 129 ? 0.3984 0.7943 0.4080 -0.0090 -0.0383 -0.2045 129 LYS A CG    
1034 C CD    . LYS A 129 ? 0.3931 0.7495 0.4087 -0.0069 -0.0451 -0.1946 129 LYS A CD    
1035 C CE    . LYS A 129 ? 0.3993 0.7371 0.4444 0.0045  -0.0528 -0.2208 129 LYS A CE    
1036 N NZ    . LYS A 129 ? 0.3939 0.7065 0.4605 0.0145  -0.0547 -0.2276 129 LYS A NZ    
1037 N N     . ASN A 130 ? 0.4417 1.0460 0.4350 -0.0262 -0.0275 -0.2859 130 ASN A N     
1038 C CA    . ASN A 130 ? 0.4587 1.1309 0.4573 -0.0270 -0.0248 -0.3256 130 ASN A CA    
1039 C C     . ASN A 130 ? 0.4389 1.1564 0.4304 -0.0316 -0.0160 -0.3294 130 ASN A C     
1040 O O     . ASN A 130 ? 0.4260 1.1642 0.4397 -0.0213 -0.0143 -0.3653 130 ASN A O     
1041 C CB    . ASN A 130 ? 0.4911 1.2103 0.4696 -0.0408 -0.0257 -0.3252 130 ASN A CB    
1042 C CG    . ASN A 130 ? 0.5239 1.2059 0.5127 -0.0355 -0.0347 -0.3287 130 ASN A CG    
1043 O OD1   . ASN A 130 ? 0.5463 1.2491 0.5177 -0.0468 -0.0370 -0.3181 130 ASN A OD1   
1044 N ND2   . ASN A 130 ? 0.5374 1.1653 0.5555 -0.0193 -0.0407 -0.3420 130 ASN A ND2   
1045 N N     . LYS A 131 ? 0.4266 1.1581 0.3907 -0.0470 -0.0117 -0.2920 131 LYS A N     
1046 C CA    . LYS A 131 ? 0.4373 1.2167 0.3924 -0.0547 -0.0038 -0.2907 131 LYS A CA    
1047 C C     . LYS A 131 ? 0.4289 1.1787 0.4057 -0.0400 -0.0014 -0.3030 131 LYS A C     
1048 O O     . LYS A 131 ? 0.4161 1.2133 0.4004 -0.0386 0.0044  -0.3284 131 LYS A O     
1049 C CB    . LYS A 131 ? 0.4448 1.2310 0.3719 -0.0737 -0.0029 -0.2418 131 LYS A CB    
1050 C CG    . LYS A 131 ? 0.4588 1.3005 0.3748 -0.0854 0.0041  -0.2350 131 LYS A CG    
1051 C CD    . LYS A 131 ? 0.4796 1.4150 0.3820 -0.1002 0.0082  -0.2536 131 LYS A CD    
1052 C CE    . LYS A 131 ? 0.4929 1.4524 0.3702 -0.1217 0.0031  -0.2177 131 LYS A CE    
1053 N NZ    . LYS A 131 ? 0.5260 1.5838 0.3849 -0.1419 0.0071  -0.2230 131 LYS A NZ    
1054 N N     . ILE A 132 ? 0.4217 1.0973 0.4089 -0.0299 -0.0058 -0.2851 132 ILE A N     
1055 C CA    . ILE A 132 ? 0.4175 1.0627 0.4246 -0.0174 -0.0048 -0.2923 132 ILE A CA    
1056 C C     . ILE A 132 ? 0.4326 1.0780 0.4745 -0.0008 -0.0089 -0.3380 132 ILE A C     
1057 O O     . ILE A 132 ? 0.4395 1.1014 0.4992 0.0067  -0.0063 -0.3597 132 ILE A O     
1058 C CB    . ILE A 132 ? 0.4124 0.9842 0.4188 -0.0135 -0.0084 -0.2581 132 ILE A CB    
1059 C CG1   . ILE A 132 ? 0.4058 0.9817 0.3847 -0.0288 -0.0052 -0.2169 132 ILE A CG1   
1060 C CG2   . ILE A 132 ? 0.4021 0.9417 0.4316 0.0000  -0.0092 -0.2678 132 ILE A CG2   
1061 C CD1   . ILE A 132 ? 0.3910 0.9025 0.3684 -0.0263 -0.0089 -0.1852 132 ILE A CD1   
1062 N N     . LEU A 133 ? 0.4424 1.0708 0.4972 0.0049  -0.0164 -0.3529 133 LEU A N     
1063 C CA    . LEU A 133 ? 0.4707 1.0990 0.5641 0.0202  -0.0234 -0.3971 133 LEU A CA    
1064 C C     . LEU A 133 ? 0.5076 1.2149 0.6075 0.0193  -0.0180 -0.4387 133 LEU A C     
1065 O O     . LEU A 133 ? 0.5083 1.2261 0.6422 0.0322  -0.0207 -0.4754 133 LEU A O     
1066 C CB    . LEU A 133 ? 0.4751 1.0765 0.5780 0.0233  -0.0329 -0.4024 133 LEU A CB    
1067 C CG    . LEU A 133 ? 0.4905 1.0829 0.6396 0.0393  -0.0441 -0.4456 133 LEU A CG    
1068 C CD1   . LEU A 133 ? 0.4863 1.0181 0.6651 0.0515  -0.0521 -0.4386 133 LEU A CD1   
1069 C CD2   . LEU A 133 ? 0.5062 1.0866 0.6603 0.0390  -0.0525 -0.4517 133 LEU A CD2   
1070 N N     . GLU A 134 ? 0.5292 1.2937 0.5978 0.0034  -0.0110 -0.4320 134 GLU A N     
1071 C CA    . GLU A 134 ? 0.5641 1.4150 0.6322 -0.0015 -0.0046 -0.4683 134 GLU A CA    
1072 C C     . GLU A 134 ? 0.5724 1.4582 0.6407 -0.0027 0.0040  -0.4727 134 GLU A C     
1073 O O     . GLU A 134 ? 0.5563 1.4929 0.6472 0.0043  0.0065  -0.5174 134 GLU A O     
1074 C CB    . GLU A 134 ? 0.5963 1.4964 0.6261 -0.0220 -0.0003 -0.4483 134 GLU A CB    
1075 C CG    . GLU A 134 ? 0.6374 1.6354 0.6622 -0.0303 0.0058  -0.4849 134 GLU A CG    
1076 C CD    . GLU A 134 ? 0.6679 1.7097 0.6550 -0.0523 0.0076  -0.4591 134 GLU A CD    
1077 O OE1   . GLU A 134 ? 0.6626 1.6638 0.6263 -0.0626 0.0057  -0.4084 134 GLU A OE1   
1078 O OE2   . GLU A 134 ? 0.7274 1.8459 0.7102 -0.0593 0.0102  -0.4902 134 GLU A OE2   
1079 N N     . LYS A 135 ? 0.5599 1.4206 0.6050 -0.0116 0.0083  -0.4278 135 LYS A N     
1080 C CA    . LYS A 135 ? 0.5551 1.4493 0.5966 -0.0154 0.0165  -0.4256 135 LYS A CA    
1081 C C     . LYS A 135 ? 0.5485 1.3933 0.6226 0.0029  0.0130  -0.4375 135 LYS A C     
1082 O O     . LYS A 135 ? 0.5402 1.4211 0.6274 0.0064  0.0181  -0.4589 135 LYS A O     
1083 C CB    . LYS A 135 ? 0.5598 1.4518 0.5648 -0.0340 0.0209  -0.3720 135 LYS A CB    
1084 C CG    . LYS A 135 ? 0.5748 1.5230 0.5479 -0.0554 0.0232  -0.3542 135 LYS A CG    
1085 C CD    . LYS A 135 ? 0.6004 1.6484 0.5656 -0.0673 0.0319  -0.3773 135 LYS A CD    
1086 C CE    . LYS A 135 ? 0.6138 1.7137 0.5428 -0.0940 0.0336  -0.3404 135 LYS A CE    
1087 N NZ    . LYS A 135 ? 0.6386 1.8461 0.5584 -0.1074 0.0413  -0.3664 135 LYS A NZ    
1088 N N     . GLU A 136 ? 0.5534 1.3186 0.6410 0.0134  0.0041  -0.4228 136 GLU A N     
1089 C CA    . GLU A 136 ? 0.5296 1.2445 0.6446 0.0277  -0.0003 -0.4242 136 GLU A CA    
1090 C C     . GLU A 136 ? 0.5296 1.1926 0.6846 0.0451  -0.0135 -0.4455 136 GLU A C     
1091 O O     . GLU A 136 ? 0.5216 1.1431 0.7007 0.0557  -0.0189 -0.4441 136 GLU A O     
1092 C CB    . GLU A 136 ? 0.5089 1.1762 0.6003 0.0208  0.0018  -0.3741 136 GLU A CB    
1093 C CG    . GLU A 136 ? 0.5056 1.2172 0.5669 0.0050  0.0121  -0.3513 136 GLU A CG    
1094 C CD    . GLU A 136 ? 0.4970 1.2467 0.5733 0.0091  0.0177  -0.3731 136 GLU A CD    
1095 O OE1   . GLU A 136 ? 0.4740 1.1998 0.5844 0.0253  0.0127  -0.3982 136 GLU A OE1   
1096 O OE2   . GLU A 136 ? 0.4998 1.3041 0.5551 -0.0048 0.0262  -0.3635 136 GLU A OE2   
1097 N N     . LYS A 137 ? 0.5345 1.2006 0.6985 0.0473  -0.0198 -0.4641 137 LYS A N     
1098 C CA    . LYS A 137 ? 0.5498 1.1688 0.7555 0.0625  -0.0345 -0.4836 137 LYS A CA    
1099 C C     . LYS A 137 ? 0.5448 1.0854 0.7519 0.0652  -0.0412 -0.4450 137 LYS A C     
1100 O O     . LYS A 137 ? 0.5630 1.0644 0.8084 0.0774  -0.0531 -0.4550 137 LYS A O     
1101 C CB    . LYS A 137 ? 0.5766 1.2194 0.8303 0.0774  -0.0402 -0.5325 137 LYS A CB    
1102 C CG    . LYS A 137 ? 0.5954 1.3256 0.8478 0.0746  -0.0312 -0.5732 137 LYS A CG    
1103 C CD    . LYS A 137 ? 0.6194 1.3722 0.9283 0.0918  -0.0398 -0.6297 137 LYS A CD    
1104 C CE    . LYS A 137 ? 0.6445 1.3809 0.9909 0.1021  -0.0550 -0.6609 137 LYS A CE    
1105 N NZ    . LYS A 137 ? 0.6653 1.4546 1.0603 0.1152  -0.0604 -0.7259 137 LYS A NZ    
1106 N N     . ILE A 138 ? 0.5208 1.0424 0.6880 0.0531  -0.0344 -0.4013 138 ILE A N     
1107 C CA    . ILE A 138 ? 0.5032 0.9594 0.6652 0.0533  -0.0386 -0.3635 138 ILE A CA    
1108 C C     . ILE A 138 ? 0.4803 0.9167 0.6202 0.0454  -0.0400 -0.3405 138 ILE A C     
1109 O O     . ILE A 138 ? 0.4664 0.9354 0.5756 0.0338  -0.0323 -0.3302 138 ILE A O     
1110 C CB    . ILE A 138 ? 0.4984 0.9522 0.6360 0.0468  -0.0293 -0.3341 138 ILE A CB    
1111 C CG1   . ILE A 138 ? 0.5094 0.9726 0.6730 0.0560  -0.0298 -0.3542 138 ILE A CG1   
1112 C CG2   . ILE A 138 ? 0.4803 0.8774 0.6030 0.0434  -0.0312 -0.2930 138 ILE A CG2   
1113 C CD1   . ILE A 138 ? 0.5118 0.9211 0.7088 0.0674  -0.0418 -0.3527 138 ILE A CD1   
1114 N N     . THR A 139 ? 0.4641 0.8507 0.6219 0.0509  -0.0506 -0.3329 139 THR A N     
1115 C CA    . THR A 139 ? 0.4422 0.8034 0.5798 0.0437  -0.0518 -0.3066 139 THR A CA    
1116 C C     . THR A 139 ? 0.4196 0.7497 0.5318 0.0372  -0.0464 -0.2654 139 THR A C     
1117 O O     . THR A 139 ? 0.4073 0.7159 0.5269 0.0410  -0.0466 -0.2562 139 THR A O     
1118 C CB    . THR A 139 ? 0.4366 0.7578 0.6029 0.0505  -0.0655 -0.3112 139 THR A CB    
1119 O OG1   . THR A 139 ? 0.4236 0.7015 0.6087 0.0559  -0.0720 -0.2967 139 THR A OG1   
1120 C CG2   . THR A 139 ? 0.4448 0.7900 0.6446 0.0586  -0.0740 -0.3541 139 THR A CG2   
1121 N N     . VAL A 140 ? 0.3973 0.7256 0.4822 0.0275  -0.0427 -0.2420 140 VAL A N     
1122 C CA    . VAL A 140 ? 0.3818 0.6815 0.4466 0.0219  -0.0391 -0.2062 140 VAL A CA    
1123 C C     . VAL A 140 ? 0.3664 0.6362 0.4270 0.0193  -0.0438 -0.1894 140 VAL A C     
1124 O O     . VAL A 140 ? 0.3493 0.6260 0.4169 0.0197  -0.0485 -0.2029 140 VAL A O     
1125 C CB    . VAL A 140 ? 0.3879 0.7192 0.4246 0.0112  -0.0300 -0.1907 140 VAL A CB    
1126 C CG1   . VAL A 140 ? 0.3932 0.7584 0.4344 0.0130  -0.0250 -0.2075 140 VAL A CG1   
1127 C CG2   . VAL A 140 ? 0.3944 0.7575 0.4142 0.0017  -0.0289 -0.1898 140 VAL A CG2   
1128 N N     . THR A 141 ? 0.3456 0.5841 0.3964 0.0168  -0.0425 -0.1615 141 THR A N     
1129 C CA    . THR A 141 ? 0.3248 0.5404 0.3687 0.0130  -0.0450 -0.1431 141 THR A CA    
1130 C C     . THR A 141 ? 0.3151 0.5393 0.3344 0.0040  -0.0391 -0.1203 141 THR A C     
1131 O O     . THR A 141 ? 0.3171 0.5421 0.3288 0.0023  -0.0346 -0.1089 141 THR A O     
1132 C CB    . THR A 141 ? 0.3230 0.4983 0.3802 0.0173  -0.0499 -0.1314 141 THR A CB    
1133 O OG1   . THR A 141 ? 0.3276 0.4946 0.4122 0.0242  -0.0588 -0.1504 141 THR A OG1   
1134 C CG2   . THR A 141 ? 0.3234 0.4798 0.3721 0.0126  -0.0511 -0.1118 141 THR A CG2   
1135 N N     . VAL A 142 ? 0.3032 0.5342 0.3134 -0.0020 -0.0406 -0.1137 142 VAL A N     
1136 C CA    . VAL A 142 ? 0.2906 0.5307 0.2829 -0.0114 -0.0383 -0.0917 142 VAL A CA    
1137 C C     . VAL A 142 ? 0.2777 0.4875 0.2708 -0.0121 -0.0413 -0.0740 142 VAL A C     
1138 O O     . VAL A 142 ? 0.2831 0.4832 0.2827 -0.0104 -0.0453 -0.0794 142 VAL A O     
1139 C CB    . VAL A 142 ? 0.2985 0.5780 0.2800 -0.0197 -0.0387 -0.0970 142 VAL A CB    
1140 C CG1   . VAL A 142 ? 0.2961 0.5814 0.2643 -0.0305 -0.0401 -0.0709 142 VAL A CG1   
1141 C CG2   . VAL A 142 ? 0.3062 0.6252 0.2855 -0.0207 -0.0347 -0.1149 142 VAL A CG2   
1142 N N     . GLY A 143 ? 0.2607 0.4580 0.2490 -0.0146 -0.0397 -0.0546 143 GLY A N     
1143 C CA    . GLY A 143 ? 0.2612 0.4364 0.2513 -0.0156 -0.0420 -0.0390 143 GLY A CA    
1144 C C     . GLY A 143 ? 0.2665 0.4546 0.2496 -0.0244 -0.0441 -0.0219 143 GLY A C     
1145 O O     . GLY A 143 ? 0.2692 0.4735 0.2470 -0.0289 -0.0430 -0.0156 143 GLY A O     
1146 N N     . ILE A 144 ? 0.2655 0.4468 0.2512 -0.0271 -0.0484 -0.0135 144 ILE A N     
1147 C CA    . ILE A 144 ? 0.2700 0.4635 0.2537 -0.0362 -0.0536 0.0034  144 ILE A CA    
1148 C C     . ILE A 144 ? 0.2656 0.4356 0.2608 -0.0345 -0.0573 0.0145  144 ILE A C     
1149 O O     . ILE A 144 ? 0.2617 0.4187 0.2614 -0.0306 -0.0574 0.0091  144 ILE A O     
1150 C CB    . ILE A 144 ? 0.2723 0.4918 0.2484 -0.0430 -0.0569 -0.0003 144 ILE A CB    
1151 C CG1   . ILE A 144 ? 0.2808 0.5333 0.2466 -0.0460 -0.0533 -0.0126 144 ILE A CG1   
1152 C CG2   . ILE A 144 ? 0.2803 0.5101 0.2573 -0.0533 -0.0647 0.0205  144 ILE A CG2   
1153 C CD1   . ILE A 144 ? 0.2884 0.5699 0.2474 -0.0502 -0.0548 -0.0260 144 ILE A CD1   
1154 N N     . SER A 145 ? 0.2711 0.4368 0.2739 -0.0372 -0.0608 0.0289  145 SER A N     
1155 C CA    . SER A 145 ? 0.2679 0.4158 0.2861 -0.0354 -0.0654 0.0366  145 SER A CA    
1156 C C     . SER A 145 ? 0.2887 0.4406 0.3188 -0.0419 -0.0740 0.0541  145 SER A C     
1157 O O     . SER A 145 ? 0.2878 0.4595 0.3118 -0.0504 -0.0774 0.0640  145 SER A O     
1158 C CB    . SER A 145 ? 0.2606 0.3875 0.2851 -0.0260 -0.0597 0.0275  145 SER A CB    
1159 O OG    . SER A 145 ? 0.2462 0.3618 0.2848 -0.0237 -0.0627 0.0292  145 SER A OG    
1160 N N     . LYS A 146 ? 0.3014 0.4369 0.3513 -0.0385 -0.0788 0.0579  146 LYS A N     
1161 C CA    . LYS A 146 ? 0.3052 0.4407 0.3753 -0.0438 -0.0904 0.0741  146 LYS A CA    
1162 C C     . LYS A 146 ? 0.3042 0.4333 0.3817 -0.0411 -0.0896 0.0743  146 LYS A C     
1163 O O     . LYS A 146 ? 0.3104 0.4386 0.4076 -0.0456 -0.1003 0.0875  146 LYS A O     
1164 C CB    . LYS A 146 ? 0.2996 0.4219 0.3933 -0.0404 -0.0973 0.0744  146 LYS A CB    
1165 C CG    . LYS A 146 ? 0.2877 0.3940 0.3932 -0.0295 -0.0916 0.0596  146 LYS A CG    
1166 C CD    . LYS A 146 ? 0.2885 0.3878 0.4115 -0.0249 -0.0942 0.0534  146 LYS A CD    
1167 C CE    . LYS A 146 ? 0.2936 0.3892 0.4503 -0.0266 -0.1089 0.0624  146 LYS A CE    
1168 N NZ    . LYS A 146 ? 0.3063 0.3989 0.4792 -0.0226 -0.1112 0.0556  146 LYS A NZ    
1169 N N     . ASN A 147 ? 0.3014 0.4258 0.3659 -0.0342 -0.0785 0.0604  147 ASN A N     
1170 C CA    . ASN A 147 ? 0.2952 0.4152 0.3640 -0.0318 -0.0769 0.0596  147 ASN A CA    
1171 C C     . ASN A 147 ? 0.2951 0.4177 0.3433 -0.0278 -0.0654 0.0480  147 ASN A C     
1172 O O     . ASN A 147 ? 0.2902 0.4158 0.3244 -0.0259 -0.0593 0.0392  147 ASN A O     
1173 C CB    . ASN A 147 ? 0.2839 0.3875 0.3770 -0.0247 -0.0802 0.0539  147 ASN A CB    
1174 C CG    . ASN A 147 ? 0.2709 0.3662 0.3598 -0.0158 -0.0708 0.0368  147 ASN A CG    
1175 O OD1   . ASN A 147 ? 0.2730 0.3691 0.3433 -0.0131 -0.0613 0.0289  147 ASN A OD1   
1176 N ND2   . ASN A 147 ? 0.2720 0.3615 0.3817 -0.0116 -0.0745 0.0312  147 ASN A ND2   
1177 N N     . LYS A 148 ? 0.3121 0.4331 0.3621 -0.0265 -0.0639 0.0481  148 LYS A N     
1178 C CA    . LYS A 148 ? 0.3033 0.4279 0.3374 -0.0233 -0.0548 0.0389  148 LYS A CA    
1179 C C     . LYS A 148 ? 0.2838 0.3965 0.3128 -0.0151 -0.0473 0.0247  148 LYS A C     
1180 O O     . LYS A 148 ? 0.2541 0.3704 0.2708 -0.0132 -0.0417 0.0166  148 LYS A O     
1181 C CB    . LYS A 148 ? 0.3199 0.4432 0.3602 -0.0233 -0.0557 0.0424  148 LYS A CB    
1182 C CG    . LYS A 148 ? 0.3525 0.4940 0.3923 -0.0333 -0.0613 0.0573  148 LYS A CG    
1183 C CD    . LYS A 148 ? 0.3432 0.4852 0.3854 -0.0330 -0.0602 0.0586  148 LYS A CD    
1184 C CE    . LYS A 148 ? 0.3540 0.4804 0.4201 -0.0313 -0.0685 0.0634  148 LYS A CE    
1185 N NZ    . LYS A 148 ? 0.3655 0.4915 0.4333 -0.0302 -0.0669 0.0626  148 LYS A NZ    
1186 N N     . VAL A 149 ? 0.2620 0.3630 0.3033 -0.0107 -0.0482 0.0215  149 VAL A N     
1187 C CA    . VAL A 149 ? 0.2481 0.3421 0.2858 -0.0051 -0.0420 0.0111  149 VAL A CA    
1188 C C     . VAL A 149 ? 0.2413 0.3359 0.2720 -0.0054 -0.0405 0.0082  149 VAL A C     
1189 O O     . VAL A 149 ? 0.2406 0.3335 0.2632 -0.0035 -0.0364 0.0025  149 VAL A O     
1190 C CB    . VAL A 149 ? 0.2392 0.3284 0.2924 -0.0014 -0.0430 0.0068  149 VAL A CB    
1191 C CG1   . VAL A 149 ? 0.2393 0.3282 0.2875 0.0018  -0.0369 -0.0013 149 VAL A CG1   
1192 C CG2   . VAL A 149 ? 0.2379 0.3261 0.2993 -0.0003 -0.0449 0.0069  149 VAL A CG2   
1193 N N     . PHE A 150 ? 0.2429 0.3391 0.2794 -0.0081 -0.0451 0.0126  150 PHE A N     
1194 C CA    . PHE A 150 ? 0.2611 0.3580 0.2923 -0.0089 -0.0446 0.0098  150 PHE A CA    
1195 C C     . PHE A 150 ? 0.2616 0.3677 0.2804 -0.0116 -0.0442 0.0079  150 PHE A C     
1196 O O     . PHE A 150 ? 0.2511 0.3562 0.2660 -0.0104 -0.0430 0.0012  150 PHE A O     
1197 C CB    . PHE A 150 ? 0.2688 0.3652 0.3113 -0.0106 -0.0499 0.0141  150 PHE A CB    
1198 C CG    . PHE A 150 ? 0.2729 0.3645 0.3278 -0.0065 -0.0485 0.0094  150 PHE A CG    
1199 C CD1   . PHE A 150 ? 0.2737 0.3643 0.3249 -0.0047 -0.0436 0.0036  150 PHE A CD1   
1200 C CD2   . PHE A 150 ? 0.2773 0.3681 0.3492 -0.0050 -0.0524 0.0099  150 PHE A CD2   
1201 C CE1   . PHE A 150 ? 0.2933 0.3869 0.3544 -0.0023 -0.0414 -0.0013 150 PHE A CE1   
1202 C CE2   . PHE A 150 ? 0.2954 0.3876 0.3798 -0.0009 -0.0504 0.0014  150 PHE A CE2   
1203 C CZ    . PHE A 150 ? 0.2908 0.3868 0.3680 0.0001  -0.0440 -0.0043 150 PHE A CZ    
1204 N N     . ALA A 151 ? 0.2739 0.3912 0.2884 -0.0155 -0.0456 0.0127  151 ALA A N     
1205 C CA    . ALA A 151 ? 0.2709 0.4037 0.2741 -0.0178 -0.0439 0.0070  151 ALA A CA    
1206 C C     . ALA A 151 ? 0.2671 0.3948 0.2676 -0.0118 -0.0387 -0.0051 151 ALA A C     
1207 O O     . ALA A 151 ? 0.2490 0.3819 0.2471 -0.0102 -0.0381 -0.0161 151 ALA A O     
1208 C CB    . ALA A 151 ? 0.2780 0.4288 0.2778 -0.0247 -0.0463 0.0164  151 ALA A CB    
1209 N N     . LYS A 152 ? 0.2503 0.3679 0.2539 -0.0084 -0.0362 -0.0036 152 LYS A N     
1210 C CA    . LYS A 152 ? 0.2616 0.3728 0.2653 -0.0034 -0.0330 -0.0119 152 LYS A CA    
1211 C C     . LYS A 152 ? 0.2666 0.3660 0.2754 -0.0006 -0.0338 -0.0161 152 LYS A C     
1212 O O     . LYS A 152 ? 0.2769 0.3746 0.2888 0.0020  -0.0347 -0.0242 152 LYS A O     
1213 C CB    . LYS A 152 ? 0.2693 0.3740 0.2752 -0.0015 -0.0309 -0.0080 152 LYS A CB    
1214 C CG    . LYS A 152 ? 0.2672 0.3679 0.2734 0.0025  -0.0286 -0.0145 152 LYS A CG    
1215 C CD    . LYS A 152 ? 0.2758 0.3754 0.2821 0.0032  -0.0267 -0.0108 152 LYS A CD    
1216 C CE    . LYS A 152 ? 0.2899 0.3919 0.2958 0.0059  -0.0251 -0.0167 152 LYS A CE    
1217 N NZ    . LYS A 152 ? 0.3001 0.3933 0.3113 0.0089  -0.0266 -0.0213 152 LYS A NZ    
1218 N N     . ILE A 153 ? 0.2639 0.3564 0.2766 -0.0013 -0.0346 -0.0105 153 ILE A N     
1219 C CA    . ILE A 153 ? 0.2556 0.3406 0.2733 -0.0008 -0.0360 -0.0115 153 ILE A CA    
1220 C C     . ILE A 153 ? 0.2701 0.3572 0.2892 -0.0016 -0.0396 -0.0170 153 ILE A C     
1221 O O     . ILE A 153 ? 0.2675 0.3487 0.2934 -0.0005 -0.0426 -0.0208 153 ILE A O     
1222 C CB    . ILE A 153 ? 0.2578 0.3413 0.2798 -0.0020 -0.0355 -0.0059 153 ILE A CB    
1223 C CG1   . ILE A 153 ? 0.2539 0.3378 0.2774 -0.0006 -0.0323 -0.0044 153 ILE A CG1   
1224 C CG2   . ILE A 153 ? 0.2558 0.3364 0.2828 -0.0034 -0.0374 -0.0051 153 ILE A CG2   
1225 C CD1   . ILE A 153 ? 0.2473 0.3347 0.2783 -0.0006 -0.0322 -0.0033 153 ILE A CD1   
1226 N N     . ALA A 154 ? 0.2771 0.3738 0.2918 -0.0042 -0.0407 -0.0171 154 ALA A N     
1227 C CA    . ALA A 154 ? 0.2908 0.3939 0.3059 -0.0053 -0.0441 -0.0248 154 ALA A CA    
1228 C C     . ALA A 154 ? 0.2953 0.4015 0.3139 -0.0019 -0.0450 -0.0378 154 ALA A C     
1229 O O     . ALA A 154 ? 0.2969 0.3986 0.3250 -0.0002 -0.0494 -0.0459 154 ALA A O     
1230 C CB    . ALA A 154 ? 0.3006 0.4198 0.3082 -0.0101 -0.0452 -0.0219 154 ALA A CB    
1231 N N     . ALA A 155 ? 0.3046 0.4191 0.3188 -0.0008 -0.0418 -0.0406 155 ALA A N     
1232 C CA    . ALA A 155 ? 0.3280 0.4485 0.3487 0.0031  -0.0428 -0.0555 155 ALA A CA    
1233 C C     . ALA A 155 ? 0.3418 0.4430 0.3766 0.0072  -0.0464 -0.0561 155 ALA A C     
1234 O O     . ALA A 155 ? 0.3376 0.4372 0.3867 0.0104  -0.0520 -0.0686 155 ALA A O     
1235 C CB    . ALA A 155 ? 0.3235 0.4589 0.3370 0.0029  -0.0383 -0.0574 155 ALA A CB    
1236 N N     . ASP A 156 ? 0.3421 0.4309 0.3752 0.0063  -0.0446 -0.0429 156 ASP A N     
1237 C CA    . ASP A 156 ? 0.3618 0.4366 0.4071 0.0075  -0.0488 -0.0389 156 ASP A CA    
1238 C C     . ASP A 156 ? 0.3647 0.4320 0.4224 0.0061  -0.0559 -0.0391 156 ASP A C     
1239 O O     . ASP A 156 ? 0.3901 0.4488 0.4649 0.0071  -0.0635 -0.0409 156 ASP A O     
1240 C CB    . ASP A 156 ? 0.3741 0.4440 0.4132 0.0050  -0.0451 -0.0249 156 ASP A CB    
1241 C CG    . ASP A 156 ? 0.3881 0.4624 0.4194 0.0066  -0.0399 -0.0242 156 ASP A CG    
1242 O OD1   . ASP A 156 ? 0.4081 0.4858 0.4422 0.0096  -0.0403 -0.0323 156 ASP A OD1   
1243 O OD2   . ASP A 156 ? 0.4119 0.4871 0.4364 0.0049  -0.0360 -0.0167 156 ASP A OD2   
1244 N N     . MET A 157 ? 0.3741 0.4442 0.4256 0.0032  -0.0548 -0.0360 157 MET A N     
1245 C CA    . MET A 157 ? 0.3910 0.4553 0.4538 0.0013  -0.0615 -0.0360 157 MET A CA    
1246 C C     . MET A 157 ? 0.4006 0.4682 0.4752 0.0044  -0.0678 -0.0532 157 MET A C     
1247 O O     . MET A 157 ? 0.4241 0.4836 0.5159 0.0039  -0.0764 -0.0553 157 MET A O     
1248 C CB    . MET A 157 ? 0.3933 0.4616 0.4465 -0.0022 -0.0584 -0.0293 157 MET A CB    
1249 C CG    . MET A 157 ? 0.4101 0.4770 0.4585 -0.0050 -0.0540 -0.0158 157 MET A CG    
1250 S SD    . MET A 157 ? 0.4520 0.5249 0.4940 -0.0076 -0.0513 -0.0113 157 MET A SD    
1251 C CE    . MET A 157 ? 0.4624 0.5374 0.5053 -0.0096 -0.0469 -0.0013 157 MET A CE    
1252 N N     . ALA A 158 ? 0.4053 0.4879 0.4725 0.0069  -0.0642 -0.0661 158 ALA A N     
1253 C CA    . ALA A 158 ? 0.4027 0.4965 0.4795 0.0095  -0.0691 -0.0863 158 ALA A CA    
1254 C C     . ALA A 158 ? 0.4042 0.5005 0.4985 0.0155  -0.0733 -0.1035 158 ALA A C     
1255 O O     . ALA A 158 ? 0.4015 0.5080 0.5100 0.0189  -0.0787 -0.1244 158 ALA A O     
1256 C CB    . ALA A 158 ? 0.3889 0.5059 0.4469 0.0065  -0.0632 -0.0906 158 ALA A CB    
1257 N N     . LYS A 159 ? 0.4112 0.4998 0.5066 0.0172  -0.0714 -0.0963 159 LYS A N     
1258 C CA    . LYS A 159 ? 0.4215 0.5117 0.5361 0.0233  -0.0759 -0.1117 159 LYS A CA    
1259 C C     . LYS A 159 ? 0.4311 0.5085 0.5790 0.0266  -0.0901 -0.1220 159 LYS A C     
1260 O O     . LYS A 159 ? 0.4645 0.5246 0.6204 0.0228  -0.0965 -0.1076 159 LYS A O     
1261 C CB    . LYS A 159 ? 0.4354 0.5145 0.5482 0.0233  -0.0738 -0.0975 159 LYS A CB    
1262 C CG    . LYS A 159 ? 0.4545 0.5485 0.5457 0.0230  -0.0628 -0.0961 159 LYS A CG    
1263 C CD    . LYS A 159 ? 0.4631 0.5454 0.5522 0.0225  -0.0611 -0.0814 159 LYS A CD    
1264 C CE    . LYS A 159 ? 0.4710 0.5648 0.5361 0.0201  -0.0504 -0.0742 159 LYS A CE    
1265 N NZ    . LYS A 159 ? 0.4767 0.5674 0.5411 0.0215  -0.0480 -0.0690 159 LYS A NZ    
1266 N N     . PRO A 160 ? 0.4315 0.5187 0.6020 0.0334  -0.0960 -0.1474 160 PRO A N     
1267 C CA    . PRO A 160 ? 0.4259 0.5409 0.5900 0.0376  -0.0888 -0.1688 160 PRO A CA    
1268 C C     . PRO A 160 ? 0.4225 0.5636 0.5823 0.0376  -0.0874 -0.1900 160 PRO A C     
1269 O O     . PRO A 160 ? 0.4274 0.5607 0.5919 0.0354  -0.0929 -0.1887 160 PRO A O     
1270 C CB    . PRO A 160 ? 0.4309 0.5400 0.6310 0.0454  -0.0994 -0.1855 160 PRO A CB    
1271 C CG    . PRO A 160 ? 0.4523 0.5354 0.6843 0.0457  -0.1156 -0.1814 160 PRO A CG    
1272 C CD    . PRO A 160 ? 0.4460 0.5175 0.6572 0.0375  -0.1128 -0.1575 160 PRO A CD    
1273 N N     . ASN A 161 ? 0.4123 0.5871 0.5626 0.0389  -0.0800 -0.2086 161 ASN A N     
1274 C CA    . ASN A 161 ? 0.4051 0.6138 0.5481 0.0372  -0.0776 -0.2290 161 ASN A CA    
1275 C C     . ASN A 161 ? 0.3876 0.5911 0.5115 0.0297  -0.0765 -0.2125 161 ASN A C     
1276 O O     . ASN A 161 ? 0.3796 0.5873 0.5155 0.0305  -0.0832 -0.2267 161 ASN A O     
1277 C CB    . ASN A 161 ? 0.4216 0.6391 0.6020 0.0457  -0.0889 -0.2642 161 ASN A CB    
1278 C CG    . ASN A 161 ? 0.4300 0.6926 0.6037 0.0444  -0.0854 -0.2916 161 ASN A CG    
1279 O OD1   . ASN A 161 ? 0.4321 0.7258 0.5736 0.0369  -0.0741 -0.2851 161 ASN A OD1   
1280 N ND2   . ASN A 161 ? 0.4516 0.7202 0.6577 0.0510  -0.0964 -0.3220 161 ASN A ND2   
1281 N N     . GLY A 162 ? 0.3677 0.5617 0.4650 0.0229  -0.0690 -0.1835 162 GLY A N     
1282 C CA    . GLY A 162 ? 0.3571 0.5445 0.4396 0.0164  -0.0687 -0.1670 162 GLY A CA    
1283 C C     . GLY A 162 ? 0.3402 0.5492 0.3928 0.0081  -0.0598 -0.1527 162 GLY A C     
1284 O O     . GLY A 162 ? 0.3278 0.5581 0.3692 0.0064  -0.0535 -0.1534 162 GLY A O     
1285 N N     . ILE A 163 ? 0.3353 0.5386 0.3779 0.0025  -0.0608 -0.1385 163 ILE A N     
1286 C CA    . ILE A 163 ? 0.3370 0.5539 0.3568 -0.0060 -0.0558 -0.1199 163 ILE A CA    
1287 C C     . ILE A 163 ? 0.3491 0.5416 0.3675 -0.0087 -0.0584 -0.1006 163 ILE A C     
1288 O O     . ILE A 163 ? 0.3689 0.5528 0.3975 -0.0075 -0.0640 -0.1068 163 ILE A O     
1289 C CB    . ILE A 163 ? 0.3484 0.6083 0.3574 -0.0121 -0.0550 -0.1325 163 ILE A CB    
1290 C CG1   . ILE A 163 ? 0.3449 0.6183 0.3338 -0.0230 -0.0531 -0.1087 163 ILE A CG1   
1291 C CG2   . ILE A 163 ? 0.3548 0.6217 0.3762 -0.0097 -0.0615 -0.1537 163 ILE A CG2   
1292 C CD1   . ILE A 163 ? 0.3573 0.6809 0.3326 -0.0318 -0.0516 -0.1164 163 ILE A CD1   
1293 N N     . LYS A 164 ? 0.3442 0.5260 0.3530 -0.0120 -0.0550 -0.0788 164 LYS A N     
1294 C CA    . LYS A 164 ? 0.3334 0.4945 0.3440 -0.0137 -0.0572 -0.0630 164 LYS A CA    
1295 C C     . LYS A 164 ? 0.3165 0.4818 0.3166 -0.0197 -0.0554 -0.0438 164 LYS A C     
1296 O O     . LYS A 164 ? 0.3057 0.4755 0.3004 -0.0207 -0.0520 -0.0369 164 LYS A O     
1297 C CB    . LYS A 164 ? 0.3456 0.4785 0.3676 -0.0085 -0.0573 -0.0586 164 LYS A CB    
1298 C CG    . LYS A 164 ? 0.3711 0.4882 0.3964 -0.0104 -0.0589 -0.0450 164 LYS A CG    
1299 C CD    . LYS A 164 ? 0.4009 0.4979 0.4389 -0.0073 -0.0606 -0.0427 164 LYS A CD    
1300 C CE    . LYS A 164 ? 0.4019 0.4893 0.4429 -0.0099 -0.0608 -0.0296 164 LYS A CE    
1301 N NZ    . LYS A 164 ? 0.4136 0.5076 0.4515 -0.0134 -0.0626 -0.0264 164 LYS A NZ    
1302 N N     . VAL A 165 ? 0.2986 0.4616 0.2993 -0.0235 -0.0591 -0.0351 165 VAL A N     
1303 C CA    . VAL A 165 ? 0.2918 0.4538 0.2906 -0.0284 -0.0606 -0.0166 165 VAL A CA    
1304 C C     . VAL A 165 ? 0.2800 0.4174 0.2893 -0.0245 -0.0604 -0.0100 165 VAL A C     
1305 O O     . VAL A 165 ? 0.2526 0.3809 0.2681 -0.0225 -0.0620 -0.0145 165 VAL A O     
1306 C CB    . VAL A 165 ? 0.3032 0.4821 0.2983 -0.0360 -0.0663 -0.0113 165 VAL A CB    
1307 C CG1   . VAL A 165 ? 0.2986 0.4723 0.2990 -0.0405 -0.0705 0.0087  165 VAL A CG1   
1308 C CG2   . VAL A 165 ? 0.3104 0.5229 0.2934 -0.0420 -0.0664 -0.0181 165 VAL A CG2   
1309 N N     . ILE A 166 ? 0.2757 0.4051 0.2884 -0.0236 -0.0587 -0.0002 166 ILE A N     
1310 C CA    . ILE A 166 ? 0.2826 0.3971 0.3064 -0.0212 -0.0589 0.0054  166 ILE A CA    
1311 C C     . ILE A 166 ? 0.2928 0.4123 0.3229 -0.0258 -0.0647 0.0173  166 ILE A C     
1312 O O     . ILE A 166 ? 0.2774 0.4001 0.3098 -0.0277 -0.0664 0.0250  166 ILE A O     
1313 C CB    . ILE A 166 ? 0.2846 0.3891 0.3116 -0.0165 -0.0540 0.0049  166 ILE A CB    
1314 C CG1   . ILE A 166 ? 0.2986 0.3970 0.3233 -0.0129 -0.0506 -0.0039 166 ILE A CG1   
1315 C CG2   . ILE A 166 ? 0.2805 0.3779 0.3201 -0.0147 -0.0542 0.0088  166 ILE A CG2   
1316 C CD1   . ILE A 166 ? 0.2988 0.3913 0.3241 -0.0096 -0.0462 -0.0038 166 ILE A CD1   
1317 N N     . ASP A 167 ? 0.3088 0.4289 0.3442 -0.0280 -0.0692 0.0196  167 ASP A N     
1318 C CA    . ASP A 167 ? 0.3228 0.4477 0.3679 -0.0330 -0.0771 0.0319  167 ASP A CA    
1319 C C     . ASP A 167 ? 0.3314 0.4446 0.3958 -0.0288 -0.0784 0.0349  167 ASP A C     
1320 O O     . ASP A 167 ? 0.3130 0.4180 0.3801 -0.0228 -0.0720 0.0271  167 ASP A O     
1321 C CB    . ASP A 167 ? 0.3390 0.4720 0.3825 -0.0377 -0.0825 0.0334  167 ASP A CB    
1322 C CG    . ASP A 167 ? 0.3405 0.4626 0.3914 -0.0336 -0.0809 0.0267  167 ASP A CG    
1323 O OD1   . ASP A 167 ? 0.3413 0.4526 0.4034 -0.0286 -0.0778 0.0250  167 ASP A OD1   
1324 O OD2   . ASP A 167 ? 0.3304 0.4580 0.3765 -0.0363 -0.0833 0.0231  167 ASP A OD2   
1325 N N     . ASP A 168 ? 0.3578 0.4731 0.4378 -0.0324 -0.0876 0.0457  168 ASP A N     
1326 C CA    . ASP A 168 ? 0.3708 0.4777 0.4754 -0.0278 -0.0909 0.0456  168 ASP A CA    
1327 C C     . ASP A 168 ? 0.3671 0.4692 0.4789 -0.0217 -0.0853 0.0341  168 ASP A C     
1328 O O     . ASP A 168 ? 0.3436 0.4429 0.4678 -0.0161 -0.0819 0.0263  168 ASP A O     
1329 C CB    . ASP A 168 ? 0.3912 0.5008 0.5164 -0.0332 -0.1049 0.0596  168 ASP A CB    
1330 C CG    . ASP A 168 ? 0.4276 0.5431 0.5535 -0.0398 -0.1120 0.0735  168 ASP A CG    
1331 O OD1   . ASP A 168 ? 0.4498 0.5709 0.5548 -0.0413 -0.1053 0.0720  168 ASP A OD1   
1332 O OD2   . ASP A 168 ? 0.4930 0.6084 0.6423 -0.0441 -0.1253 0.0866  168 ASP A OD2   
1333 N N     . GLU A 169 ? 0.3867 0.4908 0.4909 -0.0236 -0.0843 0.0327  169 GLU A N     
1334 C CA    . GLU A 169 ? 0.3941 0.4971 0.5048 -0.0197 -0.0794 0.0242  169 GLU A CA    
1335 C C     . GLU A 169 ? 0.3613 0.4626 0.4594 -0.0168 -0.0697 0.0165  169 GLU A C     
1336 O O     . GLU A 169 ? 0.3201 0.4246 0.4265 -0.0138 -0.0650 0.0104  169 GLU A O     
1337 C CB    . GLU A 169 ? 0.4367 0.5420 0.5457 -0.0233 -0.0828 0.0264  169 GLU A CB    
1338 C CG    . GLU A 169 ? 0.4928 0.6004 0.6219 -0.0252 -0.0927 0.0333  169 GLU A CG    
1339 C CD    . GLU A 169 ? 0.5407 0.6497 0.6939 -0.0199 -0.0919 0.0260  169 GLU A CD    
1340 O OE1   . GLU A 169 ? 0.5901 0.7027 0.7418 -0.0187 -0.0859 0.0195  169 GLU A OE1   
1341 O OE2   . GLU A 169 ? 0.5491 0.6578 0.7247 -0.0173 -0.0978 0.0263  169 GLU A OE2   
1342 N N     . GLU A 170 ? 0.3521 0.4515 0.4320 -0.0184 -0.0672 0.0164  170 GLU A N     
1343 C CA    . GLU A 170 ? 0.3502 0.4469 0.4215 -0.0160 -0.0602 0.0108  170 GLU A CA    
1344 C C     . GLU A 170 ? 0.3164 0.4132 0.3911 -0.0126 -0.0564 0.0088  170 GLU A C     
1345 O O     . GLU A 170 ? 0.2902 0.3887 0.3646 -0.0108 -0.0511 0.0048  170 GLU A O     
1346 C CB    . GLU A 170 ? 0.3789 0.4737 0.4353 -0.0175 -0.0598 0.0085  170 GLU A CB    
1347 C CG    . GLU A 170 ? 0.4046 0.4951 0.4576 -0.0154 -0.0551 0.0045  170 GLU A CG    
1348 C CD    . GLU A 170 ? 0.4498 0.5372 0.4970 -0.0159 -0.0569 -0.0005 170 GLU A CD    
1349 O OE1   . GLU A 170 ? 0.4740 0.5659 0.5152 -0.0170 -0.0598 -0.0042 170 GLU A OE1   
1350 O OE2   . GLU A 170 ? 0.4657 0.5484 0.5165 -0.0157 -0.0564 -0.0011 170 GLU A OE2   
1351 N N     . VAL A 171 ? 0.3032 0.3998 0.3826 -0.0125 -0.0602 0.0124  171 VAL A N     
1352 C CA    . VAL A 171 ? 0.3063 0.4027 0.3938 -0.0089 -0.0582 0.0092  171 VAL A CA    
1353 C C     . VAL A 171 ? 0.3115 0.4139 0.4158 -0.0054 -0.0563 0.0014  171 VAL A C     
1354 O O     . VAL A 171 ? 0.2834 0.3910 0.3867 -0.0029 -0.0501 -0.0056 171 VAL A O     
1355 C CB    . VAL A 171 ? 0.3108 0.4060 0.4076 -0.0103 -0.0657 0.0162  171 VAL A CB    
1356 C CG1   . VAL A 171 ? 0.3124 0.4069 0.4248 -0.0058 -0.0656 0.0105  171 VAL A CG1   
1357 C CG2   . VAL A 171 ? 0.3266 0.4230 0.4049 -0.0143 -0.0654 0.0222  171 VAL A CG2   
1358 N N     . LYS A 172 ? 0.3238 0.4287 0.4441 -0.0056 -0.0616 0.0019  172 LYS A N     
1359 C CA    . LYS A 172 ? 0.3374 0.4530 0.4771 -0.0020 -0.0598 -0.0083 172 LYS A CA    
1360 C C     . LYS A 172 ? 0.3219 0.4473 0.4500 -0.0033 -0.0510 -0.0124 172 LYS A C     
1361 O O     . LYS A 172 ? 0.3240 0.4624 0.4568 -0.0012 -0.0456 -0.0214 172 LYS A O     
1362 C CB    . LYS A 172 ? 0.3506 0.4676 0.5103 -0.0023 -0.0675 -0.0070 172 LYS A CB    
1363 C CG    . LYS A 172 ? 0.3779 0.4888 0.5595 -0.0011 -0.0787 -0.0031 172 LYS A CG    
1364 C CD    . LYS A 172 ? 0.4337 0.5467 0.6395 -0.0011 -0.0875 -0.0021 172 LYS A CD    
1365 C CE    . LYS A 172 ? 0.4765 0.5805 0.6916 -0.0058 -0.1012 0.0135  172 LYS A CE    
1366 N NZ    . LYS A 172 ? 0.5221 0.6279 0.7474 -0.0086 -0.1081 0.0190  172 LYS A NZ    
1367 N N     . ARG A 173 ? 0.3038 0.4250 0.4182 -0.0075 -0.0506 -0.0056 173 ARG A N     
1368 C CA    . ARG A 173 ? 0.3304 0.4594 0.4355 -0.0105 -0.0447 -0.0054 173 ARG A CA    
1369 C C     . ARG A 173 ? 0.2981 0.4290 0.3924 -0.0102 -0.0394 -0.0066 173 ARG A C     
1370 O O     . ARG A 173 ? 0.2736 0.4209 0.3693 -0.0118 -0.0344 -0.0097 173 ARG A O     
1371 C CB    . ARG A 173 ? 0.3726 0.4930 0.4679 -0.0148 -0.0475 0.0020  173 ARG A CB    
1372 C CG    . ARG A 173 ? 0.4252 0.5557 0.5208 -0.0194 -0.0451 0.0048  173 ARG A CG    
1373 C CD    . ARG A 173 ? 0.4955 0.6145 0.5846 -0.0232 -0.0498 0.0110  173 ARG A CD    
1374 N NE    . ARG A 173 ? 0.5455 0.6543 0.6240 -0.0227 -0.0499 0.0121  173 ARG A NE    
1375 C CZ    . ARG A 173 ? 0.6176 0.7142 0.6892 -0.0209 -0.0533 0.0100  173 ARG A CZ    
1376 N NH1   . ARG A 173 ? 0.6901 0.7837 0.7615 -0.0205 -0.0572 0.0084  173 ARG A NH1   
1377 N NH2   . ARG A 173 ? 0.6084 0.6987 0.6738 -0.0200 -0.0531 0.0091  173 ARG A NH2   
1378 N N     . LEU A 174 ? 0.2723 0.3900 0.3559 -0.0090 -0.0406 -0.0038 174 LEU A N     
1379 C CA    . LEU A 174 ? 0.2725 0.3905 0.3462 -0.0089 -0.0365 -0.0041 174 LEU A CA    
1380 C C     . LEU A 174 ? 0.2543 0.3849 0.3356 -0.0060 -0.0327 -0.0120 174 LEU A C     
1381 O O     . LEU A 174 ? 0.2489 0.3901 0.3250 -0.0078 -0.0283 -0.0129 174 LEU A O     
1382 C CB    . LEU A 174 ? 0.2794 0.3835 0.3421 -0.0078 -0.0384 -0.0013 174 LEU A CB    
1383 C CG    . LEU A 174 ? 0.2981 0.3939 0.3532 -0.0103 -0.0416 0.0022  174 LEU A CG    
1384 C CD1   . LEU A 174 ? 0.3070 0.3963 0.3534 -0.0090 -0.0431 0.0016  174 LEU A CD1   
1385 C CD2   . LEU A 174 ? 0.3022 0.3988 0.3558 -0.0131 -0.0410 0.0050  174 LEU A CD2   
1386 N N     . ILE A 175 ? 0.2453 0.3761 0.3414 -0.0021 -0.0357 -0.0179 175 ILE A N     
1387 C CA    . ILE A 175 ? 0.2456 0.3900 0.3557 0.0017  -0.0338 -0.0297 175 ILE A CA    
1388 C C     . ILE A 175 ? 0.2342 0.4042 0.3478 -0.0003 -0.0277 -0.0371 175 ILE A C     
1389 O O     . ILE A 175 ? 0.2069 0.3935 0.3208 0.0003  -0.0232 -0.0454 175 ILE A O     
1390 C CB    . ILE A 175 ? 0.2456 0.3865 0.3800 0.0061  -0.0411 -0.0352 175 ILE A CB    
1391 C CG1   . ILE A 175 ? 0.2444 0.3670 0.3770 0.0066  -0.0473 -0.0272 175 ILE A CG1   
1392 C CG2   . ILE A 175 ? 0.2389 0.3990 0.3949 0.0109  -0.0397 -0.0528 175 ILE A CG2   
1393 C CD1   . ILE A 175 ? 0.2566 0.3727 0.4130 0.0079  -0.0580 -0.0252 175 ILE A CD1   
1394 N N     . ARG A 176 ? 0.2299 0.4062 0.3459 -0.0036 -0.0279 -0.0338 176 ARG A N     
1395 C CA    . ARG A 176 ? 0.2378 0.4427 0.3554 -0.0080 -0.0223 -0.0375 176 ARG A CA    
1396 C C     . ARG A 176 ? 0.2442 0.4521 0.3428 -0.0160 -0.0197 -0.0243 176 ARG A C     
1397 O O     . ARG A 176 ? 0.2233 0.4581 0.3194 -0.0210 -0.0149 -0.0254 176 ARG A O     
1398 C CB    . ARG A 176 ? 0.2395 0.4525 0.3705 -0.0090 -0.0242 -0.0389 176 ARG A CB    
1399 C CG    . ARG A 176 ? 0.2463 0.4691 0.4039 -0.0020 -0.0265 -0.0555 176 ARG A CG    
1400 C CD    . ARG A 176 ? 0.2537 0.4882 0.4256 -0.0033 -0.0279 -0.0574 176 ARG A CD    
1401 N NE    . ARG A 176 ? 0.2610 0.4715 0.4238 -0.0063 -0.0332 -0.0417 176 ARG A NE    
1402 C CZ    . ARG A 176 ? 0.2670 0.4765 0.4148 -0.0135 -0.0319 -0.0293 176 ARG A CZ    
1403 N NH1   . ARG A 176 ? 0.2672 0.4985 0.4070 -0.0199 -0.0261 -0.0264 176 ARG A NH1   
1404 N NH2   . ARG A 176 ? 0.2851 0.4732 0.4280 -0.0150 -0.0378 -0.0190 176 ARG A NH2   
1405 N N     . GLU A 177 ? 0.2583 0.4414 0.3460 -0.0176 -0.0240 -0.0121 177 GLU A N     
1406 C CA    . GLU A 177 ? 0.2916 0.4751 0.3695 -0.0253 -0.0250 0.0011  177 GLU A CA    
1407 C C     . GLU A 177 ? 0.2900 0.4610 0.3565 -0.0259 -0.0261 0.0072  177 GLU A C     
1408 O O     . GLU A 177 ? 0.2901 0.4671 0.3530 -0.0328 -0.0277 0.0177  177 GLU A O     
1409 C CB    . GLU A 177 ? 0.3244 0.4937 0.4045 -0.0275 -0.0306 0.0086  177 GLU A CB    
1410 C CG    . GLU A 177 ? 0.3502 0.5362 0.4424 -0.0287 -0.0296 0.0047  177 GLU A CG    
1411 C CD    . GLU A 177 ? 0.4005 0.5775 0.4957 -0.0327 -0.0351 0.0130  177 GLU A CD    
1412 O OE1   . GLU A 177 ? 0.4156 0.5717 0.5047 -0.0336 -0.0404 0.0197  177 GLU A OE1   
1413 O OE2   . GLU A 177 ? 0.4390 0.6318 0.5446 -0.0347 -0.0343 0.0111  177 GLU A OE2   
1414 N N     . LEU A 178 ? 0.2999 0.4556 0.3629 -0.0194 -0.0261 0.0016  178 LEU A N     
1415 C CA    . LEU A 178 ? 0.3113 0.4558 0.3649 -0.0194 -0.0271 0.0062  178 LEU A CA    
1416 C C     . LEU A 178 ? 0.3075 0.4705 0.3577 -0.0221 -0.0231 0.0057  178 LEU A C     
1417 O O     . LEU A 178 ? 0.2786 0.4540 0.3322 -0.0185 -0.0189 -0.0049 178 LEU A O     
1418 C CB    . LEU A 178 ? 0.3123 0.4384 0.3628 -0.0128 -0.0281 0.0013  178 LEU A CB    
1419 C CG    . LEU A 178 ? 0.3266 0.4419 0.3690 -0.0124 -0.0293 0.0047  178 LEU A CG    
1420 C CD1   . LEU A 178 ? 0.3395 0.4443 0.3823 -0.0154 -0.0348 0.0113  178 LEU A CD1   
1421 C CD2   . LEU A 178 ? 0.3332 0.4376 0.3725 -0.0071 -0.0292 -0.0002 178 LEU A CD2   
1422 N N     . ASP A 179 ? 0.3162 0.4817 0.3622 -0.0285 -0.0256 0.0171  179 ASP A N     
1423 C CA    A ASP A 179 ? 0.3181 0.5017 0.3592 -0.0323 -0.0230 0.0191  179 ASP A CA    
1424 C CA    B ASP A 179 ? 0.3193 0.5031 0.3605 -0.0322 -0.0229 0.0189  179 ASP A CA    
1425 C C     . ASP A 179 ? 0.3132 0.4874 0.3509 -0.0243 -0.0201 0.0084  179 ASP A C     
1426 O O     . ASP A 179 ? 0.3225 0.4730 0.3579 -0.0195 -0.0228 0.0085  179 ASP A O     
1427 C CB    A ASP A 179 ? 0.3292 0.5077 0.3691 -0.0395 -0.0296 0.0353  179 ASP A CB    
1428 C CB    B ASP A 179 ? 0.3306 0.5110 0.3705 -0.0398 -0.0294 0.0353  179 ASP A CB    
1429 C CG    A ASP A 179 ? 0.3348 0.5356 0.3696 -0.0458 -0.0283 0.0408  179 ASP A CG    
1430 C CG    B ASP A 179 ? 0.3411 0.5387 0.3866 -0.0507 -0.0331 0.0488  179 ASP A CG    
1431 O OD1   A ASP A 179 ? 0.3324 0.5506 0.3630 -0.0431 -0.0215 0.0293  179 ASP A OD1   
1432 O OD1   B ASP A 179 ? 0.3405 0.5637 0.3871 -0.0536 -0.0279 0.0444  179 ASP A OD1   
1433 O OD2   A ASP A 179 ? 0.3475 0.5488 0.3847 -0.0539 -0.0354 0.0571  179 ASP A OD2   
1434 O OD2   B ASP A 179 ? 0.3506 0.5372 0.4020 -0.0563 -0.0421 0.0634  179 ASP A OD2   
1435 N N     . ILE A 180 ? 0.3121 0.5075 0.3509 -0.0233 -0.0151 -0.0017 180 ILE A N     
1436 C CA    . ILE A 180 ? 0.3088 0.4956 0.3487 -0.0156 -0.0135 -0.0128 180 ILE A CA    
1437 C C     . ILE A 180 ? 0.3153 0.4901 0.3464 -0.0157 -0.0152 -0.0064 180 ILE A C     
1438 O O     . ILE A 180 ? 0.3438 0.5033 0.3748 -0.0098 -0.0156 -0.0112 180 ILE A O     
1439 C CB    . ILE A 180 ? 0.3102 0.5241 0.3584 -0.0138 -0.0090 -0.0287 180 ILE A CB    
1440 C CG1   . ILE A 180 ? 0.3097 0.5093 0.3673 -0.0049 -0.0104 -0.0407 180 ILE A CG1   
1441 C CG2   . ILE A 180 ? 0.3079 0.5502 0.3486 -0.0204 -0.0059 -0.0276 180 ILE A CG2   
1442 C CD1   . ILE A 180 ? 0.3182 0.5414 0.3923 -0.0012 -0.0084 -0.0601 180 ILE A CD1   
1443 N N     . ALA A 181 ? 0.3066 0.4889 0.3323 -0.0232 -0.0173 0.0058  181 ALA A N     
1444 C CA    . ALA A 181 ? 0.3213 0.4902 0.3424 -0.0238 -0.0210 0.0140  181 ALA A CA    
1445 C C     . ALA A 181 ? 0.3250 0.4639 0.3473 -0.0178 -0.0246 0.0141  181 ALA A C     
1446 O O     . ALA A 181 ? 0.3238 0.4517 0.3439 -0.0147 -0.0258 0.0138  181 ALA A O     
1447 C CB    . ALA A 181 ? 0.3252 0.5060 0.3461 -0.0343 -0.0260 0.0305  181 ALA A CB    
1448 N N     . ASP A 182 ? 0.3335 0.4627 0.3597 -0.0165 -0.0263 0.0136  182 ASP A N     
1449 C CA    . ASP A 182 ? 0.3386 0.4465 0.3655 -0.0116 -0.0292 0.0113  182 ASP A CA    
1450 C C     . ASP A 182 ? 0.3078 0.4101 0.3328 -0.0055 -0.0262 0.0024  182 ASP A C     
1451 O O     . ASP A 182 ? 0.3087 0.3999 0.3328 -0.0028 -0.0280 0.0005  182 ASP A O     
1452 C CB    . ASP A 182 ? 0.3565 0.4585 0.3890 -0.0138 -0.0336 0.0150  182 ASP A CB    
1453 C CG    . ASP A 182 ? 0.3872 0.4901 0.4265 -0.0204 -0.0402 0.0264  182 ASP A CG    
1454 O OD1   . ASP A 182 ? 0.4223 0.5267 0.4619 -0.0223 -0.0424 0.0316  182 ASP A OD1   
1455 O OD2   . ASP A 182 ? 0.4513 0.5534 0.4975 -0.0242 -0.0446 0.0315  182 ASP A OD2   
1456 N N     . VAL A 183 ? 0.2917 0.4041 0.3183 -0.0041 -0.0226 -0.0031 183 VAL A N     
1457 C CA    . VAL A 183 ? 0.2799 0.3865 0.3092 0.0004  -0.0224 -0.0088 183 VAL A CA    
1458 C C     . VAL A 183 ? 0.2841 0.3857 0.3091 0.0024  -0.0220 -0.0090 183 VAL A C     
1459 O O     . VAL A 183 ? 0.2871 0.3964 0.3105 0.0017  -0.0203 -0.0100 183 VAL A O     
1460 C CB    . VAL A 183 ? 0.2707 0.3893 0.3101 0.0020  -0.0210 -0.0168 183 VAL A CB    
1461 C CG1   . VAL A 183 ? 0.2621 0.3733 0.3099 0.0057  -0.0238 -0.0203 183 VAL A CG1   
1462 C CG2   . VAL A 183 ? 0.2707 0.3960 0.3162 0.0003  -0.0213 -0.0174 183 VAL A CG2   
1463 N N     . PRO A 184 ? 0.2815 0.3739 0.3046 0.0041  -0.0237 -0.0081 184 PRO A N     
1464 C CA    . PRO A 184 ? 0.2775 0.3676 0.2977 0.0057  -0.0232 -0.0084 184 PRO A CA    
1465 C C     . PRO A 184 ? 0.2884 0.3841 0.3137 0.0070  -0.0221 -0.0123 184 PRO A C     
1466 O O     . PRO A 184 ? 0.3100 0.4089 0.3451 0.0079  -0.0235 -0.0162 184 PRO A O     
1467 C CB    . PRO A 184 ? 0.2790 0.3660 0.2987 0.0056  -0.0252 -0.0068 184 PRO A CB    
1468 C CG    . PRO A 184 ? 0.2917 0.3776 0.3104 0.0042  -0.0267 -0.0059 184 PRO A CG    
1469 C CD    . PRO A 184 ? 0.2831 0.3709 0.3062 0.0036  -0.0261 -0.0065 184 PRO A CD    
1470 N N     . GLY A 185 ? 0.2885 0.3861 0.3099 0.0072  -0.0208 -0.0126 185 GLY A N     
1471 C CA    . GLY A 185 ? 0.2705 0.3751 0.2970 0.0085  -0.0202 -0.0182 185 GLY A CA    
1472 C C     . GLY A 185 ? 0.2798 0.3994 0.3049 0.0063  -0.0178 -0.0215 185 GLY A C     
1473 O O     . GLY A 185 ? 0.3005 0.4301 0.3277 0.0067  -0.0169 -0.0273 185 GLY A O     
1474 N N     . ILE A 186 ? 0.2608 0.3850 0.2826 0.0030  -0.0172 -0.0173 186 ILE A N     
1475 C CA    . ILE A 186 ? 0.2721 0.4163 0.2918 -0.0016 -0.0153 -0.0175 186 ILE A CA    
1476 C C     . ILE A 186 ? 0.2885 0.4325 0.3010 -0.0068 -0.0175 -0.0053 186 ILE A C     
1477 O O     . ILE A 186 ? 0.3055 0.4407 0.3182 -0.0088 -0.0203 0.0025  186 ILE A O     
1478 C CB    . ILE A 186 ? 0.2645 0.4186 0.2888 -0.0034 -0.0143 -0.0195 186 ILE A CB    
1479 C CG1   . ILE A 186 ? 0.2625 0.4160 0.2994 0.0018  -0.0144 -0.0312 186 ILE A CG1   
1480 C CG2   . ILE A 186 ? 0.2627 0.4447 0.2840 -0.0103 -0.0120 -0.0184 186 ILE A CG2   
1481 C CD1   . ILE A 186 ? 0.2652 0.4295 0.3107 0.0051  -0.0138 -0.0441 186 ILE A CD1   
1482 N N     . GLY A 187 ? 0.3005 0.4548 0.3093 -0.0093 -0.0175 -0.0037 187 GLY A N     
1483 C CA    . GLY A 187 ? 0.3122 0.4673 0.3181 -0.0151 -0.0219 0.0098  187 GLY A CA    
1484 C C     . GLY A 187 ? 0.3316 0.5140 0.3350 -0.0249 -0.0224 0.0173  187 GLY A C     
1485 O O     . GLY A 187 ? 0.3132 0.5164 0.3162 -0.0265 -0.0179 0.0095  187 GLY A O     
1486 N N     . ASN A 188 ? 0.3523 0.5372 0.3559 -0.0320 -0.0287 0.0327  188 ASN A N     
1487 C CA    . ASN A 188 ? 0.3937 0.6086 0.3949 -0.0444 -0.0309 0.0450  188 ASN A CA    
1488 C C     . ASN A 188 ? 0.3723 0.6222 0.3658 -0.0472 -0.0240 0.0340  188 ASN A C     
1489 O O     . ASN A 188 ? 0.3487 0.6282 0.3403 -0.0536 -0.0207 0.0325  188 ASN A O     
1490 C CB    . ASN A 188 ? 0.4582 0.6708 0.4638 -0.0523 -0.0411 0.0650  188 ASN A CB    
1491 C CG    . ASN A 188 ? 0.5148 0.6991 0.5339 -0.0511 -0.0502 0.0751  188 ASN A CG    
1492 O OD1   . ASN A 188 ? 0.5428 0.7242 0.5664 -0.0526 -0.0512 0.0773  188 ASN A OD1   
1493 N ND2   . ASN A 188 ? 0.5691 0.7339 0.5972 -0.0484 -0.0578 0.0799  188 ASN A ND2   
1494 N N     . ILE A 189 ? 0.3560 0.6044 0.3467 -0.0422 -0.0219 0.0244  189 ILE A N     
1495 C CA    . ILE A 189 ? 0.3533 0.6363 0.3394 -0.0443 -0.0164 0.0109  189 ILE A CA    
1496 C C     . ILE A 189 ? 0.3247 0.6183 0.3164 -0.0382 -0.0097 -0.0100 189 ILE A C     
1497 O O     . ILE A 189 ? 0.3051 0.6369 0.2956 -0.0438 -0.0058 -0.0179 189 ILE A O     
1498 C CB    . ILE A 189 ? 0.3668 0.6435 0.3513 -0.0396 -0.0167 0.0041  189 ILE A CB    
1499 C CG1   . ILE A 189 ? 0.3761 0.6511 0.3569 -0.0475 -0.0241 0.0248  189 ILE A CG1   
1500 C CG2   . ILE A 189 ? 0.3873 0.6991 0.3704 -0.0401 -0.0114 -0.0150 189 ILE A CG2   
1501 C CD1   . ILE A 189 ? 0.3735 0.6280 0.3554 -0.0406 -0.0258 0.0211  189 ILE A CD1   
1502 N N     . THR A 190 ? 0.2921 0.5549 0.2916 -0.0275 -0.0091 -0.0188 190 THR A N     
1503 C CA    . THR A 190 ? 0.2918 0.5616 0.3013 -0.0218 -0.0052 -0.0367 190 THR A CA    
1504 C C     . THR A 190 ? 0.2901 0.5754 0.2998 -0.0277 -0.0039 -0.0313 190 THR A C     
1505 O O     . THR A 190 ? 0.2800 0.5958 0.2952 -0.0287 0.0002  -0.0453 190 THR A O     
1506 C CB    . THR A 190 ? 0.2825 0.5172 0.3014 -0.0113 -0.0069 -0.0426 190 THR A CB    
1507 O OG1   . THR A 190 ? 0.2974 0.5187 0.3160 -0.0074 -0.0086 -0.0445 190 THR A OG1   
1508 C CG2   . THR A 190 ? 0.2959 0.5388 0.3304 -0.0054 -0.0053 -0.0615 190 THR A CG2   
1509 N N     . ALA A 191 ? 0.2985 0.5651 0.3043 -0.0316 -0.0078 -0.0125 191 ALA A N     
1510 C CA    . ALA A 191 ? 0.3128 0.5932 0.3196 -0.0383 -0.0078 -0.0047 191 ALA A CA    
1511 C C     . ALA A 191 ? 0.3259 0.6557 0.3280 -0.0500 -0.0050 -0.0033 191 ALA A C     
1512 O O     . ALA A 191 ? 0.3197 0.6757 0.3257 -0.0530 -0.0012 -0.0101 191 ALA A O     
1513 C CB    . ALA A 191 ? 0.3101 0.5653 0.3159 -0.0422 -0.0148 0.0162  191 ALA A CB    
1514 N N     . GLU A 192 ? 0.3376 0.6827 0.3316 -0.0575 -0.0073 0.0064  192 GLU A N     
1515 C CA    . GLU A 192 ? 0.3709 0.7682 0.3583 -0.0708 -0.0053 0.0100  192 GLU A CA    
1516 C C     . GLU A 192 ? 0.3535 0.7873 0.3442 -0.0664 0.0032  -0.0193 192 GLU A C     
1517 O O     . GLU A 192 ? 0.3648 0.8451 0.3551 -0.0745 0.0076  -0.0247 192 GLU A O     
1518 C CB    . GLU A 192 ? 0.4156 0.8205 0.3945 -0.0805 -0.0113 0.0288  192 GLU A CB    
1519 C CG    . GLU A 192 ? 0.4669 0.8717 0.4459 -0.0942 -0.0208 0.0605  192 GLU A CG    
1520 C CD    . GLU A 192 ? 0.5334 0.9884 0.5097 -0.1091 -0.0190 0.0685  192 GLU A CD    
1521 O OE1   . GLU A 192 ? 0.6558 1.1613 0.6237 -0.1183 -0.0149 0.0637  192 GLU A OE1   
1522 O OE2   . GLU A 192 ? 0.5438 0.9914 0.5264 -0.1122 -0.0215 0.0784  192 GLU A OE2   
1523 N N     . LYS A 193 ? 0.3138 0.7295 0.3104 -0.0541 0.0048  -0.0389 193 LYS A N     
1524 C CA    . LYS A 193 ? 0.3046 0.7507 0.3117 -0.0480 0.0106  -0.0700 193 LYS A CA    
1525 C C     . LYS A 193 ? 0.2886 0.7359 0.3093 -0.0429 0.0133  -0.0819 193 LYS A C     
1526 O O     . LYS A 193 ? 0.2729 0.7650 0.2995 -0.0460 0.0183  -0.0983 193 LYS A O     
1527 C CB    . LYS A 193 ? 0.3069 0.7266 0.3233 -0.0354 0.0092  -0.0868 193 LYS A CB    
1528 C CG    . LYS A 193 ? 0.3142 0.7406 0.3198 -0.0393 0.0074  -0.0820 193 LYS A CG    
1529 C CD    . LYS A 193 ? 0.3170 0.7036 0.3314 -0.0272 0.0041  -0.0901 193 LYS A CD    
1530 C CE    . LYS A 193 ? 0.3312 0.7213 0.3355 -0.0308 0.0020  -0.0841 193 LYS A CE    
1531 N NZ    . LYS A 193 ? 0.3310 0.6893 0.3466 -0.0195 -0.0009 -0.0951 193 LYS A NZ    
1532 N N     . LEU A 194 ? 0.2834 0.6837 0.3096 -0.0354 0.0098  -0.0742 194 LEU A N     
1533 C CA    . LEU A 194 ? 0.2829 0.6795 0.3231 -0.0302 0.0110  -0.0837 194 LEU A CA    
1534 C C     . LEU A 194 ? 0.2946 0.7291 0.3301 -0.0417 0.0142  -0.0761 194 LEU A C     
1535 O O     . LEU A 194 ? 0.2978 0.7653 0.3455 -0.0405 0.0186  -0.0955 194 LEU A O     
1536 C CB    . LEU A 194 ? 0.2753 0.6192 0.3178 -0.0235 0.0061  -0.0715 194 LEU A CB    
1537 C CG    . LEU A 194 ? 0.2679 0.5797 0.3203 -0.0122 0.0028  -0.0816 194 LEU A CG    
1538 C CD1   . LEU A 194 ? 0.2580 0.5252 0.3086 -0.0084 -0.0018 -0.0668 194 LEU A CD1   
1539 C CD2   . LEU A 194 ? 0.2763 0.6017 0.3526 -0.0037 0.0030  -0.1089 194 LEU A CD2   
1540 N N     . LYS A 195 ? 0.3069 0.7402 0.3274 -0.0534 0.0112  -0.0484 195 LYS A N     
1541 C CA    . LYS A 195 ? 0.3358 0.8040 0.3524 -0.0666 0.0124  -0.0356 195 LYS A CA    
1542 C C     . LYS A 195 ? 0.3287 0.8644 0.3446 -0.0747 0.0193  -0.0513 195 LYS A C     
1543 O O     . LYS A 195 ? 0.3112 0.8815 0.3323 -0.0799 0.0233  -0.0563 195 LYS A O     
1544 C CB    . LYS A 195 ? 0.3769 0.8330 0.3821 -0.0789 0.0050  -0.0017 195 LYS A CB    
1545 C CG    . LYS A 195 ? 0.4278 0.9247 0.4299 -0.0959 0.0042  0.0164  195 LYS A CG    
1546 C CD    . LYS A 195 ? 0.4686 0.9466 0.4664 -0.1074 -0.0068 0.0511  195 LYS A CD    
1547 C CE    . LYS A 195 ? 0.5014 1.0200 0.4990 -0.1261 -0.0098 0.0728  195 LYS A CE    
1548 N NZ    . LYS A 195 ? 0.5288 1.0144 0.5319 -0.1336 -0.0232 0.1044  195 LYS A NZ    
1549 N N     . LYS A 196 ? 0.3172 0.8749 0.3273 -0.0760 0.0209  -0.0605 196 LYS A N     
1550 C CA    . LYS A 196 ? 0.3354 0.9636 0.3438 -0.0846 0.0276  -0.0773 196 LYS A CA    
1551 C C     . LYS A 196 ? 0.3242 0.9732 0.3537 -0.0722 0.0337  -0.1168 196 LYS A C     
1552 O O     . LYS A 196 ? 0.3209 1.0324 0.3536 -0.0784 0.0401  -0.1346 196 LYS A O     
1553 C CB    . LYS A 196 ? 0.3575 1.0036 0.3547 -0.0889 0.0269  -0.0780 196 LYS A CB    
1554 C CG    . LYS A 196 ? 0.3826 1.0237 0.3619 -0.1042 0.0198  -0.0398 196 LYS A CG    
1555 C CD    . LYS A 196 ? 0.4003 1.0328 0.3721 -0.1025 0.0170  -0.0404 196 LYS A CD    
1556 C CE    . LYS A 196 ? 0.4208 1.0950 0.3765 -0.1229 0.0130  -0.0147 196 LYS A CE    
1557 N NZ    . LYS A 196 ? 0.4398 1.1242 0.3890 -0.1217 0.0126  -0.0242 196 LYS A NZ    
1558 N N     . LEU A 197 ? 0.3175 0.9165 0.3635 -0.0551 0.0309  -0.1307 197 LEU A N     
1559 C CA    . LEU A 197 ? 0.3066 0.9147 0.3796 -0.0423 0.0332  -0.1650 197 LEU A CA    
1560 C C     . LEU A 197 ? 0.2959 0.8948 0.3790 -0.0410 0.0333  -0.1608 197 LEU A C     
1561 O O     . LEU A 197 ? 0.2968 0.8994 0.4054 -0.0303 0.0336  -0.1868 197 LEU A O     
1562 C CB    . LEU A 197 ? 0.3034 0.8625 0.3929 -0.0261 0.0275  -0.1788 197 LEU A CB    
1563 C CG    . LEU A 197 ? 0.3190 0.8785 0.4042 -0.0241 0.0261  -0.1865 197 LEU A CG    
1564 C CD1   . LEU A 197 ? 0.3229 0.8323 0.4295 -0.0086 0.0191  -0.1978 197 LEU A CD1   
1565 C CD2   . LEU A 197 ? 0.3299 0.9569 0.4205 -0.0276 0.0318  -0.2156 197 LEU A CD2   
1566 N N     . GLY A 198 ? 0.2941 0.8799 0.3605 -0.0516 0.0317  -0.1286 198 GLY A N     
1567 C CA    . GLY A 198 ? 0.2793 0.8582 0.3535 -0.0520 0.0315  -0.1221 198 GLY A CA    
1568 C C     . GLY A 198 ? 0.2694 0.7822 0.3522 -0.0400 0.0250  -0.1159 198 GLY A C     
1569 O O     . GLY A 198 ? 0.2633 0.7677 0.3621 -0.0342 0.0242  -0.1237 198 GLY A O     
1570 N N     . ILE A 199 ? 0.2647 0.7337 0.3373 -0.0368 0.0201  -0.1021 199 ILE A N     
1571 C CA    . ILE A 199 ? 0.2635 0.6761 0.3432 -0.0262 0.0142  -0.0978 199 ILE A CA    
1572 C C     . ILE A 199 ? 0.2652 0.6446 0.3266 -0.0323 0.0100  -0.0676 199 ILE A C     
1573 O O     . ILE A 199 ? 0.2722 0.6383 0.3213 -0.0344 0.0080  -0.0568 199 ILE A O     
1574 C CB    . ILE A 199 ? 0.2624 0.6547 0.3523 -0.0150 0.0115  -0.1137 199 ILE A CB    
1575 C CG1   . ILE A 199 ? 0.2768 0.6968 0.3938 -0.0069 0.0129  -0.1465 199 ILE A CG1   
1576 C CG2   . ILE A 199 ? 0.2579 0.5956 0.3502 -0.0077 0.0049  -0.1027 199 ILE A CG2   
1577 C CD1   . ILE A 199 ? 0.2924 0.6988 0.4234 0.0027  0.0089  -0.1634 199 ILE A CD1   
1578 N N     . ASN A 200 ? 0.2624 0.6312 0.3246 -0.0354 0.0081  -0.0553 200 ASN A N     
1579 C CA    . ASN A 200 ? 0.2668 0.6062 0.3170 -0.0409 0.0027  -0.0295 200 ASN A CA    
1580 C C     . ASN A 200 ? 0.2568 0.5519 0.3121 -0.0325 -0.0019 -0.0271 200 ASN A C     
1581 O O     . ASN A 200 ? 0.2795 0.5469 0.3275 -0.0344 -0.0069 -0.0109 200 ASN A O     
1582 C CB    . ASN A 200 ? 0.2727 0.6401 0.3193 -0.0543 0.0026  -0.0139 200 ASN A CB    
1583 C CG    . ASN A 200 ? 0.2890 0.7040 0.3275 -0.0657 0.0061  -0.0113 200 ASN A CG    
1584 O OD1   . ASN A 200 ? 0.3101 0.7207 0.3384 -0.0709 0.0028  0.0021  200 ASN A OD1   
1585 N ND2   . ASN A 200 ? 0.2970 0.7606 0.3413 -0.0696 0.0125  -0.0255 200 ASN A ND2   
1586 N N     . LYS A 201 ? 0.2461 0.5365 0.3159 -0.0235 -0.0013 -0.0438 201 LYS A N     
1587 C CA    . LYS A 201 ? 0.2567 0.5119 0.3322 -0.0172 -0.0061 -0.0411 201 LYS A CA    
1588 C C     . LYS A 201 ? 0.2352 0.4814 0.3256 -0.0072 -0.0076 -0.0577 201 LYS A C     
1589 O O     . LYS A 201 ? 0.2336 0.5052 0.3362 -0.0045 -0.0049 -0.0754 201 LYS A O     
1590 C CB    . LYS A 201 ? 0.2637 0.5269 0.3481 -0.0193 -0.0065 -0.0403 201 LYS A CB    
1591 C CG    . LYS A 201 ? 0.2849 0.5673 0.3611 -0.0307 -0.0056 -0.0257 201 LYS A CG    
1592 C CD    . LYS A 201 ? 0.3024 0.5544 0.3683 -0.0343 -0.0115 -0.0060 201 LYS A CD    
1593 C CE    . LYS A 201 ? 0.3101 0.5794 0.3740 -0.0462 -0.0134 0.0102  201 LYS A CE    
1594 N NZ    . LYS A 201 ? 0.3336 0.5725 0.3928 -0.0488 -0.0213 0.0267  201 LYS A NZ    
1595 N N     . LEU A 202 ? 0.2169 0.4300 0.3086 -0.0024 -0.0130 -0.0523 202 LEU A N     
1596 C CA    . LEU A 202 ? 0.2095 0.4115 0.3183 0.0054  -0.0173 -0.0633 202 LEU A CA    
1597 C C     . LEU A 202 ? 0.2108 0.4332 0.3455 0.0098  -0.0181 -0.0819 202 LEU A C     
1598 O O     . LEU A 202 ? 0.2111 0.4439 0.3633 0.0151  -0.0194 -0.0988 202 LEU A O     
1599 C CB    . LEU A 202 ? 0.2058 0.3766 0.3134 0.0070  -0.0237 -0.0517 202 LEU A CB    
1600 C CG    . LEU A 202 ? 0.2077 0.3594 0.3003 0.0066  -0.0247 -0.0421 202 LEU A CG    
1601 C CD1   . LEU A 202 ? 0.2058 0.3360 0.2967 0.0064  -0.0304 -0.0317 202 LEU A CD1   
1602 C CD2   . LEU A 202 ? 0.2038 0.3578 0.3054 0.0107  -0.0256 -0.0517 202 LEU A CD2   
1603 N N     . VAL A 203 ? 0.2079 0.4371 0.3476 0.0078  -0.0180 -0.0802 203 VAL A N     
1604 C CA    . VAL A 203 ? 0.2098 0.4576 0.3777 0.0125  -0.0197 -0.0982 203 VAL A CA    
1605 C C     . VAL A 203 ? 0.2065 0.4932 0.3852 0.0139  -0.0141 -0.1205 203 VAL A C     
1606 O O     . VAL A 203 ? 0.2021 0.5012 0.4111 0.0212  -0.0176 -0.1421 203 VAL A O     
1607 C CB    . VAL A 203 ? 0.2076 0.4613 0.3769 0.0088  -0.0193 -0.0923 203 VAL A CB    
1608 C CG1   . VAL A 203 ? 0.2091 0.4903 0.3598 -0.0003 -0.0110 -0.0862 203 VAL A CG1   
1609 C CG2   . VAL A 203 ? 0.2102 0.4784 0.4136 0.0153  -0.0232 -0.1115 203 VAL A CG2   
1610 N N     . ASP A 204 ? 0.2075 0.5147 0.3637 0.0069  -0.0066 -0.1158 204 ASP A N     
1611 C CA    . ASP A 204 ? 0.2085 0.5613 0.3699 0.0055  -0.0001 -0.1356 204 ASP A CA    
1612 C C     . ASP A 204 ? 0.2044 0.5575 0.3848 0.0143  -0.0033 -0.1569 204 ASP A C     
1613 O O     . ASP A 204 ? 0.1958 0.5860 0.3951 0.0175  -0.0007 -0.1831 204 ASP A O     
1614 C CB    . ASP A 204 ? 0.2189 0.5911 0.3507 -0.0060 0.0064  -0.1202 204 ASP A CB    
1615 C CG    . ASP A 204 ? 0.2336 0.6136 0.3519 -0.0164 0.0084  -0.1005 204 ASP A CG    
1616 O OD1   . ASP A 204 ? 0.2249 0.6172 0.3571 -0.0158 0.0088  -0.1066 204 ASP A OD1   
1617 O OD2   . ASP A 204 ? 0.2372 0.6122 0.3335 -0.0254 0.0087  -0.0788 204 ASP A OD2   
1618 N N     . THR A 205 ? 0.2066 0.5209 0.3837 0.0179  -0.0094 -0.1466 205 THR A N     
1619 C CA    . THR A 205 ? 0.2082 0.5175 0.4061 0.0259  -0.0148 -0.1637 205 THR A CA    
1620 C C     . THR A 205 ? 0.2155 0.5288 0.4562 0.0353  -0.0228 -0.1868 205 THR A C     
1621 O O     . THR A 205 ? 0.2211 0.5401 0.4871 0.0423  -0.0279 -0.2077 205 THR A O     
1622 C CB    . THR A 205 ? 0.2011 0.4680 0.3890 0.0269  -0.0209 -0.1454 205 THR A CB    
1623 O OG1   . THR A 205 ? 0.1947 0.4307 0.3890 0.0280  -0.0281 -0.1311 205 THR A OG1   
1624 C CG2   . THR A 205 ? 0.1982 0.4604 0.3500 0.0191  -0.0146 -0.1257 205 THR A CG2   
1625 N N     . LEU A 206 ? 0.2142 0.5237 0.4657 0.0357  -0.0252 -0.1835 206 LEU A N     
1626 C CA    . LEU A 206 ? 0.2285 0.5431 0.5243 0.0445  -0.0340 -0.2049 206 LEU A CA    
1627 C C     . LEU A 206 ? 0.2273 0.5936 0.5421 0.0468  -0.0275 -0.2357 206 LEU A C     
1628 O O     . LEU A 206 ? 0.2303 0.6055 0.5875 0.0555  -0.0352 -0.2594 206 LEU A O     
1629 C CB    . LEU A 206 ? 0.2313 0.5185 0.5326 0.0437  -0.0409 -0.1869 206 LEU A CB    
1630 C CG    . LEU A 206 ? 0.2362 0.4785 0.5222 0.0410  -0.0481 -0.1587 206 LEU A CG    
1631 C CD1   . LEU A 206 ? 0.2397 0.4613 0.5259 0.0385  -0.0537 -0.1405 206 LEU A CD1   
1632 C CD2   . LEU A 206 ? 0.2428 0.4670 0.5564 0.0470  -0.0602 -0.1648 206 LEU A CD2   
1633 N N     . SER A 207 ? 0.2281 0.6307 0.5142 0.0386  -0.0145 -0.2356 207 SER A N     
1634 C CA    . SER A 207 ? 0.2382 0.6991 0.5379 0.0384  -0.0069 -0.2638 207 SER A CA    
1635 C C     . SER A 207 ? 0.2464 0.7461 0.5359 0.0357  0.0004  -0.2806 207 SER A C     
1636 O O     . SER A 207 ? 0.2435 0.7997 0.5307 0.0308  0.0097  -0.2976 207 SER A O     
1637 C CB    . SER A 207 ? 0.2462 0.7285 0.5253 0.0284  0.0015  -0.2489 207 SER A CB    
1638 O OG    . SER A 207 ? 0.2488 0.7161 0.4851 0.0170  0.0064  -0.2161 207 SER A OG    
1639 N N     . ILE A 208 ? 0.2521 0.7249 0.5361 0.0383  -0.0040 -0.2759 208 ILE A N     
1640 C CA    . ILE A 208 ? 0.2623 0.7685 0.5432 0.0379  0.0003  -0.2955 208 ILE A CA    
1641 C C     . ILE A 208 ? 0.2691 0.7596 0.5914 0.0512  -0.0113 -0.3215 208 ILE A C     
1642 O O     . ILE A 208 ? 0.2585 0.7002 0.5981 0.0572  -0.0230 -0.3102 208 ILE A O     
1643 C CB    . ILE A 208 ? 0.2597 0.7507 0.4970 0.0280  0.0049  -0.2662 208 ILE A CB    
1644 C CG1   . ILE A 208 ? 0.2693 0.8064 0.4990 0.0245  0.0111  -0.2849 208 ILE A CG1   
1645 C CG2   . ILE A 208 ? 0.2525 0.6827 0.4885 0.0327  -0.0044 -0.2467 208 ILE A CG2   
1646 C CD1   . ILE A 208 ? 0.2771 0.8045 0.4666 0.0141  0.0150  -0.2567 208 ILE A CD1   
1647 N N     . GLU A 209 ? 0.2753 0.8088 0.6144 0.0548  -0.0091 -0.3554 209 GLU A N     
1648 C CA    . GLU A 209 ? 0.2957 0.8145 0.6737 0.0665  -0.0212 -0.3797 209 GLU A CA    
1649 C C     . GLU A 209 ? 0.2946 0.7637 0.6524 0.0646  -0.0265 -0.3519 209 GLU A C     
1650 O O     . GLU A 209 ? 0.2789 0.7530 0.5954 0.0553  -0.0178 -0.3334 209 GLU A O     
1651 C CB    . GLU A 209 ? 0.3162 0.8955 0.7105 0.0693  -0.0165 -0.4220 209 GLU A CB    
1652 C CG    . GLU A 209 ? 0.3437 0.9755 0.7718 0.0745  -0.0138 -0.4595 209 GLU A CG    
1653 C CD    . GLU A 209 ? 0.3668 0.9717 0.8557 0.0894  -0.0305 -0.4804 209 GLU A CD    
1654 O OE1   . GLU A 209 ? 0.4027 0.9812 0.9247 0.0986  -0.0442 -0.4932 209 GLU A OE1   
1655 O OE2   . GLU A 209 ? 0.3865 0.9964 0.8921 0.0914  -0.0312 -0.4829 209 GLU A OE2   
1656 N N     . PHE A 210 ? 0.3030 0.7265 0.6923 0.0726  -0.0418 -0.3482 210 PHE A N     
1657 C CA    . PHE A 210 ? 0.3191 0.6968 0.6943 0.0708  -0.0481 -0.3225 210 PHE A CA    
1658 C C     . PHE A 210 ? 0.3129 0.7096 0.6717 0.0687  -0.0431 -0.3317 210 PHE A C     
1659 O O     . PHE A 210 ? 0.2957 0.6757 0.6148 0.0610  -0.0375 -0.3045 210 PHE A O     
1660 C CB    . PHE A 210 ? 0.3182 0.6570 0.7406 0.0795  -0.0676 -0.3243 210 PHE A CB    
1661 C CG    . PHE A 210 ? 0.3159 0.6124 0.7267 0.0766  -0.0747 -0.2979 210 PHE A CG    
1662 C CD1   . PHE A 210 ? 0.3139 0.5792 0.6877 0.0686  -0.0714 -0.2594 210 PHE A CD1   
1663 C CD2   . PHE A 210 ? 0.3311 0.6221 0.7698 0.0819  -0.0850 -0.3132 210 PHE A CD2   
1664 C CE1   . PHE A 210 ? 0.3144 0.5464 0.6779 0.0656  -0.0773 -0.2364 210 PHE A CE1   
1665 C CE2   . PHE A 210 ? 0.3354 0.5904 0.7642 0.0784  -0.0916 -0.2879 210 PHE A CE2   
1666 C CZ    . PHE A 210 ? 0.3311 0.5580 0.7214 0.0701  -0.0872 -0.2494 210 PHE A CZ    
1667 N N     . ASP A 211 ? 0.3242 0.7575 0.7151 0.0756  -0.0454 -0.3716 211 ASP A N     
1668 C CA    . ASP A 211 ? 0.3459 0.8005 0.7275 0.0745  -0.0424 -0.3854 211 ASP A CA    
1669 C C     . ASP A 211 ? 0.3384 0.8219 0.6654 0.0618  -0.0261 -0.3686 211 ASP A C     
1670 O O     . ASP A 211 ? 0.3307 0.8055 0.6329 0.0570  -0.0242 -0.3551 211 ASP A O     
1671 C CB    . ASP A 211 ? 0.3775 0.8775 0.8038 0.0839  -0.0463 -0.4366 211 ASP A CB    
1672 C CG    . ASP A 211 ? 0.4030 0.8709 0.8889 0.0966  -0.0667 -0.4545 211 ASP A CG    
1673 O OD1   . ASP A 211 ? 0.4423 0.8571 0.9290 0.0962  -0.0771 -0.4263 211 ASP A OD1   
1674 O OD2   . ASP A 211 ? 0.4310 0.9291 0.9657 0.1065  -0.0734 -0.4972 211 ASP A OD2   
1675 N N     . LYS A 212 ? 0.3457 0.8642 0.6563 0.0556  -0.0155 -0.3682 212 LYS A N     
1676 C CA    . LYS A 212 ? 0.3517 0.8972 0.6136 0.0415  -0.0024 -0.3471 212 LYS A CA    
1677 C C     . LYS A 212 ? 0.3399 0.8341 0.5672 0.0349  -0.0026 -0.3019 212 LYS A C     
1678 O O     . LYS A 212 ? 0.3352 0.8323 0.5305 0.0265  0.0020  -0.2841 212 LYS A O     
1679 C CB    . LYS A 212 ? 0.3724 0.9657 0.6277 0.0352  0.0072  -0.3534 212 LYS A CB    
1680 C CG    . LYS A 212 ? 0.3931 1.0270 0.6048 0.0190  0.0188  -0.3359 212 LYS A CG    
1681 C CD    . LYS A 212 ? 0.4223 1.1362 0.6398 0.0142  0.0275  -0.3670 212 LYS A CD    
1682 C CE    . LYS A 212 ? 0.4300 1.1660 0.6463 0.0090  0.0331  -0.3613 212 LYS A CE    
1683 N NZ    . LYS A 212 ? 0.4410 1.1900 0.6133 -0.0092 0.0402  -0.3227 212 LYS A NZ    
1684 N N     . LEU A 213 ? 0.3141 0.7638 0.5499 0.0387  -0.0087 -0.2847 213 LEU A N     
1685 C CA    . LEU A 213 ? 0.3039 0.7075 0.5109 0.0336  -0.0094 -0.2463 213 LEU A CA    
1686 C C     . LEU A 213 ? 0.3015 0.6764 0.5068 0.0360  -0.0152 -0.2401 213 LEU A C     
1687 O O     . LEU A 213 ? 0.2829 0.6531 0.4575 0.0290  -0.0108 -0.2207 213 LEU A O     
1688 C CB    . LEU A 213 ? 0.2968 0.6636 0.5170 0.0374  -0.0157 -0.2333 213 LEU A CB    
1689 C CG    . LEU A 213 ? 0.3047 0.6297 0.4970 0.0322  -0.0161 -0.1970 213 LEU A CG    
1690 C CD1   . LEU A 213 ? 0.3061 0.6484 0.4619 0.0212  -0.0062 -0.1785 213 LEU A CD1   
1691 C CD2   . LEU A 213 ? 0.3054 0.6015 0.5148 0.0360  -0.0232 -0.1889 213 LEU A CD2   
1692 N N     . LYS A 214 ? 0.3103 0.6671 0.5519 0.0457  -0.0261 -0.2563 214 LYS A N     
1693 C CA    . LYS A 214 ? 0.3225 0.6550 0.5704 0.0486  -0.0334 -0.2539 214 LYS A CA    
1694 C C     . LYS A 214 ? 0.3224 0.6855 0.5520 0.0445  -0.0270 -0.2635 214 LYS A C     
1695 O O     . LYS A 214 ? 0.3209 0.6654 0.5279 0.0405  -0.0263 -0.2442 214 LYS A O     
1696 C CB    . LYS A 214 ? 0.3355 0.6560 0.6349 0.0592  -0.0478 -0.2765 214 LYS A CB    
1697 C CG    . LYS A 214 ? 0.3569 0.6666 0.6759 0.0634  -0.0570 -0.2865 214 LYS A CG    
1698 C CD    . LYS A 214 ? 0.3762 0.6815 0.7546 0.0740  -0.0729 -0.3134 214 LYS A CD    
1699 C CE    . LYS A 214 ? 0.3952 0.6640 0.7978 0.0765  -0.0882 -0.3047 214 LYS A CE    
1700 N NZ    . LYS A 214 ? 0.3893 0.6717 0.7849 0.0763  -0.0863 -0.3165 214 LYS A NZ    
1701 N N     . GLY A 215 ? 0.3224 0.7357 0.5614 0.0451  -0.0221 -0.2932 215 GLY A N     
1702 C CA    . GLY A 215 ? 0.3344 0.7863 0.5557 0.0397  -0.0158 -0.3040 215 GLY A CA    
1703 C C     . GLY A 215 ? 0.3470 0.8019 0.5213 0.0269  -0.0069 -0.2717 215 GLY A C     
1704 O O     . GLY A 215 ? 0.3411 0.8050 0.4971 0.0220  -0.0051 -0.2665 215 GLY A O     
1705 N N     . MET A 216 ? 0.3429 0.7885 0.4999 0.0216  -0.0026 -0.2492 216 MET A N     
1706 C CA    . MET A 216 ? 0.3475 0.7943 0.4659 0.0094  0.0033  -0.2182 216 MET A CA    
1707 C C     . MET A 216 ? 0.3237 0.7155 0.4278 0.0095  -0.0008 -0.1873 216 MET A C     
1708 O O     . MET A 216 ? 0.3324 0.7216 0.4122 0.0022  0.0009  -0.1678 216 MET A O     
1709 C CB    . MET A 216 ? 0.3707 0.8421 0.4791 0.0021  0.0095  -0.2105 216 MET A CB    
1710 C CG    . MET A 216 ? 0.3957 0.8664 0.4702 -0.0110 0.0129  -0.1765 216 MET A CG    
1711 S SD    . MET A 216 ? 0.4630 0.9762 0.5155 -0.0227 0.0158  -0.1733 216 MET A SD    
1712 C CE    . MET A 216 ? 0.4395 1.0266 0.5075 -0.0235 0.0219  -0.2130 216 MET A CE    
1713 N N     . ILE A 217 ? 0.2998 0.6511 0.4198 0.0170  -0.0067 -0.1828 217 ILE A N     
1714 C CA    . ILE A 217 ? 0.2965 0.6027 0.4020 0.0162  -0.0097 -0.1548 217 ILE A CA    
1715 C C     . ILE A 217 ? 0.2744 0.5476 0.3985 0.0236  -0.0180 -0.1568 217 ILE A C     
1716 O O     . ILE A 217 ? 0.2785 0.5192 0.3929 0.0230  -0.0204 -0.1363 217 ILE A O     
1717 C CB    . ILE A 217 ? 0.2922 0.5801 0.3898 0.0139  -0.0086 -0.1366 217 ILE A CB    
1718 C CG1   . ILE A 217 ? 0.2841 0.5627 0.4093 0.0212  -0.0134 -0.1489 217 ILE A CG1   
1719 C CG2   . ILE A 217 ? 0.2959 0.6145 0.3748 0.0046  -0.0017 -0.1293 217 ILE A CG2   
1720 C CD1   . ILE A 217 ? 0.2802 0.5333 0.3988 0.0198  -0.0143 -0.1296 217 ILE A CD1   
1721 N N     . GLY A 218 ? 0.2818 0.5661 0.4345 0.0302  -0.0232 -0.1821 218 GLY A N     
1722 C CA    . GLY A 218 ? 0.2830 0.5377 0.4597 0.0364  -0.0337 -0.1836 218 GLY A CA    
1723 C C     . GLY A 218 ? 0.2834 0.5144 0.4838 0.0406  -0.0415 -0.1800 218 GLY A C     
1724 O O     . GLY A 218 ? 0.2649 0.4926 0.4549 0.0382  -0.0379 -0.1690 218 GLY A O     
1725 N N     . GLU A 219 ? 0.3004 0.5151 0.5344 0.0461  -0.0537 -0.1879 219 GLU A N     
1726 C CA    . GLU A 219 ? 0.3107 0.5062 0.5765 0.0499  -0.0648 -0.1867 219 GLU A CA    
1727 C C     . GLU A 219 ? 0.3054 0.4721 0.5532 0.0447  -0.0655 -0.1551 219 GLU A C     
1728 O O     . GLU A 219 ? 0.2972 0.4578 0.5560 0.0453  -0.0689 -0.1511 219 GLU A O     
1729 C CB    . GLU A 219 ? 0.3367 0.5199 0.6441 0.0552  -0.0802 -0.1980 219 GLU A CB    
1730 C CG    . GLU A 219 ? 0.3597 0.5226 0.7073 0.0582  -0.0957 -0.1949 219 GLU A CG    
1731 C CD    . GLU A 219 ? 0.3942 0.5495 0.7908 0.0637  -0.1130 -0.2102 219 GLU A CD    
1732 O OE1   . GLU A 219 ? 0.4317 0.5688 0.8278 0.0603  -0.1192 -0.1950 219 GLU A OE1   
1733 O OE2   . GLU A 219 ? 0.4454 0.6143 0.8834 0.0714  -0.1210 -0.2388 219 GLU A OE2   
1734 N N     . ALA A 220 ? 0.2945 0.4464 0.5164 0.0398  -0.0625 -0.1344 220 ALA A N     
1735 C CA    . ALA A 220 ? 0.2942 0.4230 0.5017 0.0348  -0.0640 -0.1072 220 ALA A CA    
1736 C C     . ALA A 220 ? 0.2992 0.4330 0.4812 0.0319  -0.0544 -0.0994 220 ALA A C     
1737 O O     . ALA A 220 ? 0.3028 0.4251 0.4867 0.0301  -0.0577 -0.0874 220 ALA A O     
1738 C CB    . ALA A 220 ? 0.2856 0.4034 0.4727 0.0307  -0.0620 -0.0911 220 ALA A CB    
1739 N N     . LYS A 221 ? 0.3155 0.4675 0.4742 0.0304  -0.0436 -0.1047 221 LYS A N     
1740 C CA    . LYS A 221 ? 0.3110 0.4691 0.4487 0.0270  -0.0359 -0.0972 221 LYS A CA    
1741 C C     . LYS A 221 ? 0.2882 0.4587 0.4439 0.0295  -0.0370 -0.1096 221 LYS A C     
1742 O O     . LYS A 221 ? 0.2722 0.4365 0.4203 0.0273  -0.0357 -0.0991 221 LYS A O     
1743 C CB    . LYS A 221 ? 0.3438 0.5208 0.4566 0.0231  -0.0266 -0.0973 221 LYS A CB    
1744 C CG    . LYS A 221 ? 0.3784 0.5403 0.4683 0.0194  -0.0244 -0.0793 221 LYS A CG    
1745 C CD    . LYS A 221 ? 0.4123 0.5828 0.4794 0.0139  -0.0179 -0.0692 221 LYS A CD    
1746 C CE    . LYS A 221 ? 0.4071 0.5659 0.4569 0.0112  -0.0170 -0.0553 221 LYS A CE    
1747 N NZ    . LYS A 221 ? 0.3986 0.5636 0.4504 0.0122  -0.0177 -0.0619 221 LYS A NZ    
1748 N N     . ALA A 222 ? 0.2594 0.4497 0.4397 0.0344  -0.0393 -0.1335 222 ALA A N     
1749 C CA    . ALA A 222 ? 0.2686 0.4755 0.4699 0.0376  -0.0403 -0.1494 222 ALA A CA    
1750 C C     . ALA A 222 ? 0.2717 0.4539 0.4957 0.0399  -0.0510 -0.1409 222 ALA A C     
1751 O O     . ALA A 222 ? 0.2655 0.4481 0.4881 0.0387  -0.0497 -0.1361 222 ALA A O     
1752 C CB    . ALA A 222 ? 0.2711 0.5064 0.4998 0.0434  -0.0420 -0.1809 222 ALA A CB    
1753 N N     . LYS A 223 ? 0.2716 0.4337 0.5172 0.0420  -0.0624 -0.1374 223 LYS A N     
1754 C CA    . LYS A 223 ? 0.2718 0.4113 0.5402 0.0419  -0.0751 -0.1246 223 LYS A CA    
1755 C C     . LYS A 223 ? 0.2505 0.3752 0.4886 0.0351  -0.0712 -0.0980 223 LYS A C     
1756 O O     . LYS A 223 ? 0.2535 0.3714 0.5006 0.0339  -0.0762 -0.0903 223 LYS A O     
1757 C CB    . LYS A 223 ? 0.2916 0.4138 0.5850 0.0425  -0.0887 -0.1200 223 LYS A CB    
1758 C CG    . LYS A 223 ? 0.3115 0.4440 0.6489 0.0504  -0.0982 -0.1479 223 LYS A CG    
1759 C CD    . LYS A 223 ? 0.3334 0.4469 0.6986 0.0501  -0.1136 -0.1410 223 LYS A CD    
1760 C CE    . LYS A 223 ? 0.3560 0.4721 0.7800 0.0581  -0.1301 -0.1652 223 LYS A CE    
1761 N NZ    . LYS A 223 ? 0.3894 0.4845 0.8453 0.0563  -0.1483 -0.1542 223 LYS A NZ    
1762 N N     . TYR A 224 ? 0.2393 0.3599 0.4442 0.0307  -0.0632 -0.0852 224 TYR A N     
1763 C CA    . TYR A 224 ? 0.2344 0.3442 0.4110 0.0248  -0.0590 -0.0637 224 TYR A CA    
1764 C C     . TYR A 224 ? 0.2301 0.3484 0.3964 0.0241  -0.0528 -0.0652 224 TYR A C     
1765 O O     . TYR A 224 ? 0.2286 0.3385 0.3949 0.0216  -0.0563 -0.0541 224 TYR A O     
1766 C CB    . TYR A 224 ? 0.2330 0.3419 0.3802 0.0221  -0.0509 -0.0566 224 TYR A CB    
1767 C CG    . TYR A 224 ? 0.2398 0.3432 0.3584 0.0175  -0.0449 -0.0415 224 TYR A CG    
1768 C CD1   . TYR A 224 ? 0.2444 0.3367 0.3597 0.0136  -0.0496 -0.0261 224 TYR A CD1   
1769 C CD2   . TYR A 224 ? 0.2432 0.3549 0.3400 0.0163  -0.0357 -0.0428 224 TYR A CD2   
1770 C CE1   . TYR A 224 ? 0.2455 0.3358 0.3371 0.0101  -0.0443 -0.0166 224 TYR A CE1   
1771 C CE2   . TYR A 224 ? 0.2442 0.3498 0.3203 0.0129  -0.0320 -0.0313 224 TYR A CE2   
1772 C CZ    . TYR A 224 ? 0.2414 0.3367 0.3153 0.0106  -0.0359 -0.0203 224 TYR A CZ    
1773 O OH    . TYR A 224 ? 0.2221 0.3144 0.2781 0.0081  -0.0326 -0.0133 224 TYR A OH    
1774 N N     . LEU A 225 ? 0.2297 0.3675 0.3886 0.0255  -0.0443 -0.0786 225 LEU A N     
1775 C CA    . LEU A 225 ? 0.2390 0.3887 0.3874 0.0234  -0.0380 -0.0791 225 LEU A CA    
1776 C C     . LEU A 225 ? 0.2436 0.3978 0.4193 0.0267  -0.0438 -0.0883 225 LEU A C     
1777 O O     . LEU A 225 ? 0.2527 0.4045 0.4228 0.0243  -0.0430 -0.0806 225 LEU A O     
1778 C CB    . LEU A 225 ? 0.2330 0.4084 0.3680 0.0219  -0.0285 -0.0891 225 LEU A CB    
1779 C CG    . LEU A 225 ? 0.2211 0.3934 0.3271 0.0170  -0.0228 -0.0763 225 LEU A CG    
1780 C CD1   . LEU A 225 ? 0.2242 0.4263 0.3217 0.0139  -0.0158 -0.0849 225 LEU A CD1   
1781 C CD2   . LEU A 225 ? 0.2176 0.3755 0.3054 0.0127  -0.0215 -0.0585 225 LEU A CD2   
1782 N N     . ILE A 226 ? 0.2470 0.4074 0.4547 0.0324  -0.0506 -0.1056 226 ILE A N     
1783 C CA    . ILE A 226 ? 0.2609 0.4247 0.5024 0.0367  -0.0587 -0.1163 226 ILE A CA    
1784 C C     . ILE A 226 ? 0.2561 0.3944 0.5076 0.0344  -0.0699 -0.0971 226 ILE A C     
1785 O O     . ILE A 226 ? 0.2341 0.3729 0.4961 0.0344  -0.0730 -0.0957 226 ILE A O     
1786 C CB    . ILE A 226 ? 0.2691 0.4467 0.5490 0.0443  -0.0652 -0.1429 226 ILE A CB    
1787 C CG1   . ILE A 226 ? 0.2708 0.4853 0.5430 0.0456  -0.0533 -0.1651 226 ILE A CG1   
1788 C CG2   . ILE A 226 ? 0.2812 0.4534 0.6056 0.0495  -0.0790 -0.1513 226 ILE A CG2   
1789 C CD1   . ILE A 226 ? 0.2793 0.5137 0.5823 0.0526  -0.0571 -0.1946 226 ILE A CD1   
1790 N N     . SER A 227 ? 0.2512 0.3706 0.4991 0.0315  -0.0762 -0.0814 227 SER A N     
1791 C CA    . SER A 227 ? 0.2589 0.3601 0.5155 0.0270  -0.0877 -0.0609 227 SER A CA    
1792 C C     . SER A 227 ? 0.2582 0.3571 0.4828 0.0212  -0.0805 -0.0454 227 SER A C     
1793 O O     . SER A 227 ? 0.2637 0.3569 0.4967 0.0183  -0.0877 -0.0349 227 SER A O     
1794 C CB    . SER A 227 ? 0.2701 0.3577 0.5305 0.0233  -0.0961 -0.0466 227 SER A CB    
1795 O OG    . SER A 227 ? 0.2853 0.3710 0.5075 0.0186  -0.0862 -0.0347 227 SER A OG    
1796 N N     . LEU A 228 ? 0.2424 0.3466 0.4330 0.0195  -0.0675 -0.0446 228 LEU A N     
1797 C CA    . LEU A 228 ? 0.2336 0.3370 0.3984 0.0153  -0.0612 -0.0345 228 LEU A CA    
1798 C C     . LEU A 228 ? 0.2330 0.3463 0.4075 0.0170  -0.0598 -0.0428 228 LEU A C     
1799 O O     . LEU A 228 ? 0.2303 0.3386 0.4032 0.0140  -0.0631 -0.0333 228 LEU A O     
1800 C CB    . LEU A 228 ? 0.2262 0.3334 0.3607 0.0137  -0.0499 -0.0338 228 LEU A CB    
1801 C CG    . LEU A 228 ? 0.2272 0.3246 0.3471 0.0110  -0.0504 -0.0229 228 LEU A CG    
1802 C CD1   . LEU A 228 ? 0.2201 0.3223 0.3192 0.0112  -0.0411 -0.0262 228 LEU A CD1   
1803 C CD2   . LEU A 228 ? 0.2311 0.3216 0.3397 0.0059  -0.0533 -0.0082 228 LEU A CD2   
1804 N N     . ALA A 229 ? 0.2277 0.3584 0.4125 0.0212  -0.0550 -0.0609 229 ALA A N     
1805 C CA    . ALA A 229 ? 0.2320 0.3785 0.4259 0.0225  -0.0521 -0.0709 229 ALA A CA    
1806 C C     . ALA A 229 ? 0.2443 0.3855 0.4711 0.0252  -0.0637 -0.0729 229 ALA A C     
1807 O O     . ALA A 229 ? 0.2297 0.3739 0.4570 0.0237  -0.0635 -0.0700 229 ALA A O     
1808 C CB    . ALA A 229 ? 0.2383 0.4115 0.4379 0.0256  -0.0448 -0.0915 229 ALA A CB    
1809 N N     . ARG A 230 ? 0.2591 0.3918 0.5150 0.0288  -0.0751 -0.0764 230 ARG A N     
1810 C CA    . ARG A 230 ? 0.2756 0.3996 0.5671 0.0302  -0.0900 -0.0739 230 ARG A CA    
1811 C C     . ARG A 230 ? 0.2955 0.4012 0.5746 0.0226  -0.0971 -0.0472 230 ARG A C     
1812 O O     . ARG A 230 ? 0.2976 0.3954 0.6050 0.0217  -0.1115 -0.0398 230 ARG A O     
1813 C CB    . ARG A 230 ? 0.2793 0.3988 0.6112 0.0355  -0.1031 -0.0842 230 ARG A CB    
1814 C CG    . ARG A 230 ? 0.2827 0.4240 0.6388 0.0441  -0.0998 -0.1157 230 ARG A CG    
1815 C CD    . ARG A 230 ? 0.2854 0.4200 0.6819 0.0494  -0.1138 -0.1266 230 ARG A CD    
1816 N NE    . ARG A 230 ? 0.2989 0.4598 0.7216 0.0584  -0.1108 -0.1616 230 ARG A NE    
1817 C CZ    . ARG A 230 ? 0.3069 0.4743 0.7531 0.0641  -0.1151 -0.1816 230 ARG A CZ    
1818 N NH1   . ARG A 230 ? 0.3308 0.4781 0.7784 0.0619  -0.1229 -0.1690 230 ARG A NH1   
1819 N NH2   . ARG A 230 ? 0.2995 0.4978 0.7676 0.0718  -0.1108 -0.2160 230 ARG A NH2   
1820 N N     . ASP A 231 ? 0.3171 0.4183 0.5570 0.0169  -0.0886 -0.0333 231 ASP A N     
1821 C CA    . ASP A 231 ? 0.3445 0.4354 0.5698 0.0091  -0.0938 -0.0109 231 ASP A CA    
1822 C C     . ASP A 231 ? 0.3689 0.4505 0.6153 0.0056  -0.1086 0.0023  231 ASP A C     
1823 O O     . ASP A 231 ? 0.3835 0.4612 0.6359 -0.0010 -0.1191 0.0198  231 ASP A O     
1824 C CB    . ASP A 231 ? 0.3455 0.4383 0.5766 0.0073  -0.0972 -0.0072 231 ASP A CB    
1825 C CG    . ASP A 231 ? 0.3626 0.4522 0.5655 -0.0008 -0.0964 0.0111  231 ASP A CG    
1826 O OD1   . ASP A 231 ? 0.3654 0.4529 0.5462 -0.0052 -0.0938 0.0204  231 ASP A OD1   
1827 O OD2   . ASP A 231 ? 0.3552 0.4467 0.5593 -0.0028 -0.0985 0.0142  231 ASP A OD2   
1828 N N     . GLU A 232 ? 0.3796 0.4594 0.6389 0.0092  -0.1104 -0.0052 232 GLU A N     
1829 C CA    . GLU A 232 ? 0.4099 0.4810 0.6945 0.0055  -0.1261 0.0076  232 GLU A CA    
1830 C C     . GLU A 232 ? 0.3828 0.4522 0.6444 0.0013  -0.1217 0.0169  232 GLU A C     
1831 O O     . GLU A 232 ? 0.3900 0.4541 0.6706 -0.0027 -0.1339 0.0283  232 GLU A O     
1832 C CB    . GLU A 232 ? 0.4415 0.5111 0.7731 0.0135  -0.1368 -0.0101 232 GLU A CB    
1833 C CG    . GLU A 232 ? 0.5092 0.5788 0.8763 0.0161  -0.1482 -0.0142 232 GLU A CG    
1834 C CD    . GLU A 232 ? 0.5658 0.6404 0.9780 0.0270  -0.1543 -0.0420 232 GLU A CD    
1835 O OE1   . GLU A 232 ? 0.5951 0.6718 1.0146 0.0317  -0.1526 -0.0560 232 GLU A OE1   
1836 O OE2   . GLU A 232 ? 0.6620 0.7403 1.1044 0.0312  -0.1614 -0.0515 232 GLU A OE2   
1837 N N     . TYR A 233 ? 0.3585 0.4329 0.5822 0.0018  -0.1054 0.0123  233 TYR A N     
1838 C CA    . TYR A 233 ? 0.3496 0.4237 0.5532 -0.0015 -0.1011 0.0195  233 TYR A CA    
1839 C C     . TYR A 233 ? 0.3679 0.4439 0.5627 -0.0122 -0.1082 0.0434  233 TYR A C     
1840 O O     . TYR A 233 ? 0.3853 0.4661 0.5645 -0.0165 -0.1063 0.0506  233 TYR A O     
1841 C CB    . TYR A 233 ? 0.3290 0.4081 0.4976 0.0013  -0.0840 0.0101  233 TYR A CB    
1842 C CG    . TYR A 233 ? 0.3200 0.3997 0.4677 -0.0018 -0.0791 0.0165  233 TYR A CG    
1843 C CD1   . TYR A 233 ? 0.3199 0.4039 0.4469 -0.0089 -0.0780 0.0307  233 TYR A CD1   
1844 C CD2   . TYR A 233 ? 0.3307 0.4098 0.4798 0.0025  -0.0754 0.0068  233 TYR A CD2   
1845 C CE1   . TYR A 233 ? 0.3260 0.4139 0.4356 -0.0114 -0.0733 0.0346  233 TYR A CE1   
1846 C CE2   . TYR A 233 ? 0.3222 0.4024 0.4532 -0.0002 -0.0710 0.0127  233 TYR A CE2   
1847 C CZ    . TYR A 233 ? 0.3199 0.4046 0.4321 -0.0069 -0.0700 0.0263  233 TYR A CZ    
1848 O OH    . TYR A 233 ? 0.3502 0.4392 0.4467 -0.0094 -0.0657 0.0304  233 TYR A OH    
1849 N N     . ASN A 234 ? 0.4091 0.4845 0.6133 -0.0175 -0.1165 0.0558  234 ASN A N     
1850 C CA    . ASN A 234 ? 0.4477 0.5326 0.6403 -0.0297 -0.1222 0.0793  234 ASN A CA    
1851 C C     . ASN A 234 ? 0.4515 0.5416 0.6402 -0.0357 -0.1243 0.0904  234 ASN A C     
1852 O O     . ASN A 234 ? 0.4963 0.5933 0.6978 -0.0466 -0.1375 0.1123  234 ASN A O     
1853 C CB    . ASN A 234 ? 0.4687 0.5530 0.6903 -0.0365 -0.1401 0.0957  234 ASN A CB    
1854 C CG    . ASN A 234 ? 0.4851 0.5598 0.7503 -0.0372 -0.1580 0.1020  234 ASN A CG    
1855 O OD1   . ASN A 234 ? 0.4916 0.5587 0.7684 -0.0299 -0.1562 0.0881  234 ASN A OD1   
1856 N ND2   . ASN A 234 ? 0.5361 0.6119 0.8278 -0.0467 -0.1769 0.1238  234 ASN A ND2   
1857 N N     . GLU A 235 ? 0.4139 0.5029 0.5852 -0.0297 -0.1120 0.0771  235 GLU A N     
1858 C CA    . GLU A 235 ? 0.4253 0.5197 0.5930 -0.0347 -0.1131 0.0861  235 GLU A CA    
1859 C C     . GLU A 235 ? 0.4043 0.5194 0.5510 -0.0472 -0.1129 0.1052  235 GLU A C     
1860 O O     . GLU A 235 ? 0.3709 0.4963 0.4903 -0.0475 -0.1025 0.1006  235 GLU A O     
1861 C CB    . GLU A 235 ? 0.4435 0.5346 0.5936 -0.0261 -0.0991 0.0681  235 GLU A CB    
1862 C CG    . GLU A 235 ? 0.4799 0.5583 0.6515 -0.0159 -0.1000 0.0499  235 GLU A CG    
1863 C CD    . GLU A 235 ? 0.4934 0.5643 0.7054 -0.0175 -0.1173 0.0557  235 GLU A CD    
1864 O OE1   . GLU A 235 ? 0.5619 0.6335 0.7800 -0.0216 -0.1222 0.0642  235 GLU A OE1   
1865 O OE2   . GLU A 235 ? 0.4603 0.5250 0.7006 -0.0146 -0.1270 0.0516  235 GLU A OE2   
1866 N N     . PRO A 236 ? 0.4087 0.5326 0.5697 -0.0581 -0.1252 0.1261  236 PRO A N     
1867 C CA    . PRO A 236 ? 0.4102 0.5617 0.5509 -0.0717 -0.1248 0.1442  236 PRO A CA    
1868 C C     . PRO A 236 ? 0.3886 0.5542 0.4951 -0.0690 -0.1074 0.1316  236 PRO A C     
1869 O O     . PRO A 236 ? 0.3765 0.5301 0.4789 -0.0593 -0.0987 0.1158  236 PRO A O     
1870 C CB    . PRO A 236 ? 0.4262 0.5836 0.5919 -0.0833 -0.1411 0.1682  236 PRO A CB    
1871 C CG    . PRO A 236 ? 0.4342 0.5649 0.6407 -0.0770 -0.1552 0.1656  236 PRO A CG    
1872 C CD    . PRO A 236 ? 0.4163 0.5286 0.6144 -0.0595 -0.1408 0.1344  236 PRO A CD    
1873 N N     . ILE A 237 ? 0.3870 0.5802 0.4714 -0.0779 -0.1034 0.1381  237 ILE A N     
1874 C CA    . ILE A 237 ? 0.3837 0.5959 0.4405 -0.0765 -0.0890 0.1258  237 ILE A CA    
1875 C C     . ILE A 237 ? 0.4169 0.6476 0.4777 -0.0864 -0.0933 0.1411  237 ILE A C     
1876 O O     . ILE A 237 ? 0.4249 0.6805 0.4901 -0.1018 -0.1033 0.1642  237 ILE A O     
1877 C CB    . ILE A 237 ? 0.3789 0.6180 0.4142 -0.0822 -0.0842 0.1237  237 ILE A CB    
1878 C CG1   . ILE A 237 ? 0.3656 0.5851 0.3961 -0.0713 -0.0786 0.1060  237 ILE A CG1   
1879 C CG2   . ILE A 237 ? 0.3828 0.6506 0.3958 -0.0834 -0.0725 0.1123  237 ILE A CG2   
1880 C CD1   . ILE A 237 ? 0.3553 0.5487 0.4079 -0.0680 -0.0882 0.1114  237 ILE A CD1   
1881 N N     . ARG A 238 ? 0.4306 0.6496 0.4915 -0.0784 -0.0870 0.1301  238 ARG A N     
1882 C CA    . ARG A 238 ? 0.4887 0.7228 0.5547 -0.0865 -0.0905 0.1429  238 ARG A CA    
1883 C C     . ARG A 238 ? 0.4819 0.7078 0.5379 -0.0755 -0.0781 0.1232  238 ARG A C     
1884 O O     . ARG A 238 ? 0.4089 0.6057 0.4698 -0.0625 -0.0743 0.1074  238 ARG A O     
1885 C CB    . ARG A 238 ? 0.5362 0.7540 0.6354 -0.0918 -0.1081 0.1623  238 ARG A CB    
1886 C CG    . ARG A 238 ? 0.6086 0.8398 0.7172 -0.1010 -0.1138 0.1778  238 ARG A CG    
1887 C CD    . ARG A 238 ? 0.6736 0.8901 0.8208 -0.1080 -0.1349 0.1994  238 ARG A CD    
1888 N NE    . ARG A 238 ? 0.7065 0.8861 0.8766 -0.0949 -0.1402 0.1855  238 ARG A NE    
1889 C CZ    . ARG A 238 ? 0.7429 0.9118 0.9354 -0.0969 -0.1534 0.1940  238 ARG A CZ    
1890 N NH1   . ARG A 238 ? 0.7796 0.9698 0.9747 -0.1125 -0.1642 0.2194  238 ARG A NH1   
1891 N NH2   . ARG A 238 ? 0.7372 0.8765 0.9509 -0.0837 -0.1564 0.1765  238 ARG A NH2   
1892 N N     . THR A 239 ? 0.5127 0.7681 0.5548 -0.0814 -0.0719 0.1242  239 THR A N     
1893 C CA    . THR A 239 ? 0.5275 0.7787 0.5629 -0.0727 -0.0620 0.1083  239 THR A CA    
1894 C C     . THR A 239 ? 0.5215 0.7459 0.5780 -0.0690 -0.0693 0.1132  239 THR A C     
1895 O O     . THR A 239 ? 0.4946 0.7212 0.5702 -0.0788 -0.0820 0.1337  239 THR A O     
1896 C CB    . THR A 239 ? 0.5619 0.8553 0.5831 -0.0812 -0.0557 0.1095  239 THR A CB    
1897 O OG1   . THR A 239 ? 0.5601 0.8689 0.5631 -0.0762 -0.0452 0.0898  239 THR A OG1   
1898 C CG2   . THR A 239 ? 0.5687 0.8608 0.5924 -0.0772 -0.0513 0.1039  239 THR A CG2   
1899 N N     . ARG A 240 ? 0.5513 0.7510 0.6064 -0.0554 -0.0625 0.0942  240 ARG A N     
1900 C CA    . ARG A 240 ? 0.5918 0.7656 0.6666 -0.0499 -0.0687 0.0931  240 ARG A CA    
1901 C C     . ARG A 240 ? 0.5418 0.7241 0.6219 -0.0537 -0.0699 0.0990  240 ARG A C     
1902 O O     . ARG A 240 ? 0.5032 0.7049 0.5674 -0.0547 -0.0611 0.0948  240 ARG A O     
1903 C CB    . ARG A 240 ? 0.6676 0.8190 0.7363 -0.0359 -0.0605 0.0714  240 ARG A CB    
1904 C CG    . ARG A 240 ? 0.7535 0.8815 0.8430 -0.0298 -0.0671 0.0661  240 ARG A CG    
1905 C CD    . ARG A 240 ? 0.7972 0.9125 0.8769 -0.0184 -0.0577 0.0463  240 ARG A CD    
1906 N NE    . ARG A 240 ? 0.8581 0.9584 0.9570 -0.0130 -0.0631 0.0382  240 ARG A NE    
1907 C CZ    . ARG A 240 ? 0.9054 0.9965 1.0157 -0.0088 -0.0663 0.0307  240 ARG A CZ    
1908 N NH1   . ARG A 240 ? 0.9114 1.0036 1.0154 -0.0095 -0.0648 0.0322  240 ARG A NH1   
1909 N NH2   . ARG A 240 ? 0.9395 1.0225 1.0692 -0.0038 -0.0710 0.0199  240 ARG A NH2   
1910 N N     . VAL A 241 ? 0.5129 0.6823 0.6178 -0.0560 -0.0818 0.1084  241 VAL A N     
1911 C CA    . VAL A 241 ? 0.4989 0.6741 0.6113 -0.0594 -0.0840 0.1141  241 VAL A CA    
1912 C C     . VAL A 241 ? 0.4653 0.6210 0.5746 -0.0461 -0.0766 0.0929  241 VAL A C     
1913 O O     . VAL A 241 ? 0.4314 0.5651 0.5530 -0.0383 -0.0800 0.0825  241 VAL A O     
1914 C CB    . VAL A 241 ? 0.5180 0.6894 0.6626 -0.0692 -0.1025 0.1350  241 VAL A CB    
1915 C CG1   . VAL A 241 ? 0.5211 0.7185 0.6678 -0.0859 -0.1110 0.1611  241 VAL A CG1   
1916 C CG2   . VAL A 241 ? 0.5364 0.6777 0.7078 -0.0613 -0.1127 0.1269  241 VAL A CG2   
1917 N N     . ARG A 242 ? 0.4587 0.6257 0.5521 -0.0440 -0.0666 0.0861  242 ARG A N     
1918 C CA    . ARG A 242 ? 0.4748 0.6268 0.5638 -0.0329 -0.0600 0.0685  242 ARG A CA    
1919 C C     . ARG A 242 ? 0.4286 0.5661 0.5405 -0.0320 -0.0696 0.0696  242 ARG A C     
1920 O O     . ARG A 242 ? 0.4018 0.5467 0.5286 -0.0405 -0.0783 0.0844  242 ARG A O     
1921 C CB    . ARG A 242 ? 0.4922 0.6604 0.5642 -0.0315 -0.0495 0.0623  242 ARG A CB    
1922 C CG    . ARG A 242 ? 0.5520 0.7298 0.6046 -0.0276 -0.0393 0.0515  242 ARG A CG    
1923 C CD    . ARG A 242 ? 0.6255 0.7848 0.6749 -0.0212 -0.0385 0.0432  242 ARG A CD    
1924 N NE    . ARG A 242 ? 0.7051 0.8677 0.7398 -0.0158 -0.0302 0.0310  242 ARG A NE    
1925 C CZ    . ARG A 242 ? 0.7257 0.8761 0.7565 -0.0115 -0.0291 0.0249  242 ARG A CZ    
1926 N NH1   . ARG A 242 ? 0.7240 0.8601 0.7634 -0.0113 -0.0345 0.0283  242 ARG A NH1   
1927 N NH2   . ARG A 242 ? 0.7539 0.9071 0.7749 -0.0071 -0.0233 0.0145  242 ARG A NH2   
1928 N N     . LYS A 243 ? 0.4122 0.5315 0.5274 -0.0223 -0.0684 0.0535  243 LYS A N     
1929 C CA    . LYS A 243 ? 0.4145 0.5223 0.5495 -0.0192 -0.0755 0.0474  243 LYS A CA    
1930 C C     . LYS A 243 ? 0.3882 0.4981 0.5112 -0.0147 -0.0680 0.0382  243 LYS A C     
1931 O O     . LYS A 243 ? 0.3725 0.4783 0.5103 -0.0144 -0.0739 0.0363  243 LYS A O     
1932 C CB    . LYS A 243 ? 0.4386 0.5322 0.5858 -0.0118 -0.0789 0.0327  243 LYS A CB    
1933 C CG    . LYS A 243 ? 0.4527 0.5416 0.6228 -0.0162 -0.0909 0.0419  243 LYS A CG    
1934 C CD    . LYS A 243 ? 0.4754 0.5585 0.6427 -0.0103 -0.0878 0.0304  243 LYS A CD    
1935 C CE    . LYS A 243 ? 0.4834 0.5575 0.6746 -0.0028 -0.0940 0.0117  243 LYS A CE    
1936 N NZ    . LYS A 243 ? 0.4928 0.5628 0.6962 -0.0010 -0.0982 0.0084  243 LYS A NZ    
1937 N N     . SER A 244 ? 0.3712 0.4870 0.4705 -0.0112 -0.0563 0.0323  244 SER A N     
1938 C CA    . SER A 244 ? 0.3636 0.4838 0.4543 -0.0086 -0.0509 0.0275  244 SER A CA    
1939 C C     . SER A 244 ? 0.3702 0.5048 0.4440 -0.0095 -0.0423 0.0292  244 SER A C     
1940 O O     . SER A 244 ? 0.3923 0.5314 0.4566 -0.0099 -0.0385 0.0291  244 SER A O     
1941 C CB    . SER A 244 ? 0.3411 0.4517 0.4274 -0.0008 -0.0479 0.0126  244 SER A CB    
1942 O OG    . SER A 244 ? 0.3426 0.4516 0.4139 0.0030  -0.0412 0.0065  244 SER A OG    
1943 N N     . ILE A 245 ? 0.3401 0.4833 0.4125 -0.0097 -0.0399 0.0291  245 ILE A N     
1944 C CA    . ILE A 245 ? 0.3293 0.4892 0.3910 -0.0095 -0.0324 0.0266  245 ILE A CA    
1945 C C     . ILE A 245 ? 0.3190 0.4764 0.3793 -0.0038 -0.0295 0.0183  245 ILE A C     
1946 O O     . ILE A 245 ? 0.2967 0.4511 0.3651 -0.0046 -0.0332 0.0205  245 ILE A O     
1947 C CB    . ILE A 245 ? 0.3525 0.5367 0.4177 -0.0190 -0.0335 0.0388  245 ILE A CB    
1948 C CG1   . ILE A 245 ? 0.3683 0.5587 0.4326 -0.0254 -0.0363 0.0479  245 ILE A CG1   
1949 C CG2   . ILE A 245 ? 0.3624 0.5693 0.4204 -0.0179 -0.0257 0.0317  245 ILE A CG2   
1950 C CD1   . ILE A 245 ? 0.3936 0.6133 0.4605 -0.0376 -0.0385 0.0630  245 ILE A CD1   
1951 N N     . GLY A 246 ? 0.3106 0.4691 0.3633 0.0017  -0.0242 0.0090  246 GLY A N     
1952 C CA    . GLY A 246 ? 0.3125 0.4673 0.3668 0.0067  -0.0235 0.0027  246 GLY A CA    
1953 C C     . GLY A 246 ? 0.3164 0.4754 0.3691 0.0119  -0.0200 -0.0065 246 GLY A C     
1954 O O     . GLY A 246 ? 0.3202 0.4884 0.3702 0.0120  -0.0170 -0.0105 246 GLY A O     
1955 N N     . ARG A 247 ? 0.3129 0.4656 0.3698 0.0161  -0.0217 -0.0102 247 ARG A N     
1956 C CA    . ARG A 247 ? 0.3274 0.4828 0.3904 0.0213  -0.0214 -0.0188 247 ARG A CA    
1957 C C     . ARG A 247 ? 0.3167 0.4579 0.3827 0.0239  -0.0264 -0.0172 247 ARG A C     
1958 O O     . ARG A 247 ? 0.3093 0.4477 0.3748 0.0220  -0.0286 -0.0125 247 ARG A O     
1959 C CB    . ARG A 247 ? 0.3500 0.5268 0.4218 0.0216  -0.0188 -0.0241 247 ARG A CB    
1960 C CG    . ARG A 247 ? 0.4107 0.5941 0.4950 0.0280  -0.0193 -0.0372 247 ARG A CG    
1961 C CD    . ARG A 247 ? 0.4416 0.6390 0.5251 0.0287  -0.0155 -0.0465 247 ARG A CD    
1962 N NE    . ARG A 247 ? 0.5105 0.7189 0.6121 0.0356  -0.0168 -0.0632 247 ARG A NE    
1963 C CZ    . ARG A 247 ? 0.5499 0.7415 0.6656 0.0419  -0.0237 -0.0688 247 ARG A CZ    
1964 N NH1   . ARG A 247 ? 0.5288 0.6946 0.6390 0.0410  -0.0288 -0.0575 247 ARG A NH1   
1965 N NH2   . ARG A 247 ? 0.5735 0.7769 0.7117 0.0487  -0.0263 -0.0860 247 ARG A NH2   
1966 N N     . ILE A 248 ? 0.3305 0.4642 0.4007 0.0272  -0.0294 -0.0203 248 ILE A N     
1967 C CA    . ILE A 248 ? 0.3551 0.4789 0.4301 0.0278  -0.0359 -0.0160 248 ILE A CA    
1968 C C     . ILE A 248 ? 0.3826 0.5047 0.4749 0.0325  -0.0412 -0.0216 248 ILE A C     
1969 O O     . ILE A 248 ? 0.3607 0.4827 0.4566 0.0348  -0.0405 -0.0279 248 ILE A O     
1970 C CB    . ILE A 248 ? 0.3565 0.4714 0.4194 0.0240  -0.0373 -0.0086 248 ILE A CB    
1971 C CG1   . ILE A 248 ? 0.3611 0.4714 0.4291 0.0225  -0.0451 -0.0018 248 ILE A CG1   
1972 C CG2   . ILE A 248 ? 0.3849 0.4962 0.4426 0.0240  -0.0351 -0.0102 248 ILE A CG2   
1973 C CD1   . ILE A 248 ? 0.3717 0.4825 0.4270 0.0171  -0.0460 0.0048  248 ILE A CD1   
1974 N N     . VAL A 249 ? 0.3713 0.4922 0.4770 0.0340  -0.0476 -0.0198 249 VAL A N     
1975 C CA    . VAL A 249 ? 0.3860 0.5053 0.5161 0.0392  -0.0552 -0.0264 249 VAL A CA    
1976 C C     . VAL A 249 ? 0.3862 0.4944 0.5272 0.0369  -0.0671 -0.0146 249 VAL A C     
1977 O O     . VAL A 249 ? 0.3967 0.5044 0.5282 0.0321  -0.0688 -0.0038 249 VAL A O     
1978 C CB    . VAL A 249 ? 0.4002 0.5339 0.5463 0.0443  -0.0536 -0.0385 249 VAL A CB    
1979 C CG1   . VAL A 249 ? 0.4295 0.5808 0.5688 0.0454  -0.0433 -0.0503 249 VAL A CG1   
1980 C CG2   . VAL A 249 ? 0.4013 0.5380 0.5436 0.0416  -0.0536 -0.0314 249 VAL A CG2   
1981 N N     . THR A 250 ? 0.3764 0.4775 0.5396 0.0398  -0.0766 -0.0166 250 THR A N     
1982 C CA    . THR A 250 ? 0.3823 0.4739 0.5616 0.0363  -0.0911 -0.0026 250 THR A CA    
1983 C C     . THR A 250 ? 0.3791 0.4733 0.5840 0.0409  -0.0985 -0.0071 250 THR A C     
1984 O O     . THR A 250 ? 0.3760 0.4767 0.5998 0.0491  -0.0969 -0.0252 250 THR A O     
1985 C CB    . THR A 250 ? 0.3914 0.4726 0.5885 0.0366  -0.1008 -0.0009 250 THR A CB    
1986 O OG1   . THR A 250 ? 0.3911 0.4702 0.5640 0.0295  -0.0967 0.0102  250 THR A OG1   
1987 C CG2   . THR A 250 ? 0.3978 0.4702 0.6263 0.0345  -0.1200 0.0113  250 THR A CG2   
1988 N N     . MET A 251 ? 0.3773 0.4696 0.5833 0.0352  -0.1067 0.0088  251 MET A N     
1989 C CA    . MET A 251 ? 0.3942 0.4880 0.6263 0.0388  -0.1156 0.0069  251 MET A CA    
1990 C C     . MET A 251 ? 0.4068 0.4894 0.6768 0.0399  -0.1346 0.0122  251 MET A C     
1991 O O     . MET A 251 ? 0.3882 0.4627 0.6581 0.0333  -0.1428 0.0270  251 MET A O     
1992 C CB    . MET A 251 ? 0.4038 0.5025 0.6200 0.0317  -0.1161 0.0213  251 MET A CB    
1993 C CG    . MET A 251 ? 0.4032 0.5111 0.5871 0.0305  -0.0997 0.0159  251 MET A CG    
1994 S SD    . MET A 251 ? 0.4055 0.5210 0.5773 0.0244  -0.1010 0.0266  251 MET A SD    
1995 C CE    . MET A 251 ? 0.4242 0.5400 0.5804 0.0126  -0.1084 0.0470  251 MET A CE    
1996 N N     . LYS A 252 ? 0.4204 0.5038 0.7256 0.0480  -0.1426 0.0000  252 LYS A N     
1997 C CA    . LYS A 252 ? 0.4574 0.5293 0.8076 0.0507  -0.1630 0.0018  252 LYS A CA    
1998 C C     . LYS A 252 ? 0.4659 0.5299 0.8229 0.0394  -0.1803 0.0320  252 LYS A C     
1999 O O     . LYS A 252 ? 0.4803 0.5328 0.8678 0.0366  -0.1989 0.0433  252 LYS A O     
2000 C CB    . LYS A 252 ? 0.4929 0.5710 0.8823 0.0629  -0.1673 -0.0219 252 LYS A CB    
2001 C CG    . LYS A 252 ? 0.5172 0.6114 0.8983 0.0722  -0.1497 -0.0517 252 LYS A CG    
2002 C CD    . LYS A 252 ? 0.5522 0.6499 0.9805 0.0842  -0.1585 -0.0789 252 LYS A CD    
2003 C CE    . LYS A 252 ? 0.5628 0.6743 1.0231 0.0928  -0.1619 -0.0965 252 LYS A CE    
2004 N NZ    . LYS A 252 ? 0.5902 0.6889 1.0675 0.0881  -0.1779 -0.0743 252 LYS A NZ    
2005 N N     . ARG A 253 ? 0.4585 0.5308 0.7868 0.0317  -0.1746 0.0459  253 ARG A N     
2006 C CA    . ARG A 253 ? 0.4797 0.5520 0.8098 0.0192  -0.1897 0.0749  253 ARG A CA    
2007 C C     . ARG A 253 ? 0.4466 0.5322 0.7282 0.0095  -0.1761 0.0855  253 ARG A C     
2008 O O     . ARG A 253 ? 0.4473 0.5402 0.7062 0.0140  -0.1599 0.0713  253 ARG A O     
2009 C CB    . ARG A 253 ? 0.5173 0.5896 0.8791 0.0228  -0.2019 0.0751  253 ARG A CB    
2010 C CG    . ARG A 253 ? 0.5842 0.6517 0.9742 0.0124  -0.2272 0.1034  253 ARG A CG    
2011 C CD    . ARG A 253 ? 0.6089 0.6802 1.0181 0.0141  -0.2355 0.1056  253 ARG A CD    
2012 N NE    . ARG A 253 ? 0.6412 0.7276 1.0070 0.0090  -0.2199 0.1081  253 ARG A NE    
2013 C CZ    . ARG A 253 ? 0.6362 0.7342 0.9771 -0.0056 -0.2234 0.1323  253 ARG A CZ    
2014 N NH1   . ARG A 253 ? 0.6666 0.7655 1.0185 -0.0187 -0.2419 0.1603  253 ARG A NH1   
2015 N NH2   . ARG A 253 ? 0.6159 0.7274 0.9217 -0.0078 -0.2089 0.1284  253 ARG A NH2   
2016 N N     . ASN A 254 ? 0.4283 0.5198 0.6962 -0.0043 -0.1834 0.1096  254 ASN A N     
2017 C CA    . ASN A 254 ? 0.4125 0.5213 0.6377 -0.0132 -0.1713 0.1160  254 ASN A CA    
2018 C C     . ASN A 254 ? 0.4018 0.5203 0.6228 -0.0147 -0.1718 0.1180  254 ASN A C     
2019 O O     . ASN A 254 ? 0.3984 0.5133 0.6483 -0.0152 -0.1871 0.1270  254 ASN A O     
2020 C CB    . ASN A 254 ? 0.4217 0.5419 0.6354 -0.0286 -0.1796 0.1406  254 ASN A CB    
2021 C CG    . ASN A 254 ? 0.4270 0.5398 0.6389 -0.0280 -0.1765 0.1382  254 ASN A CG    
2022 O OD1   . ASN A 254 ? 0.4034 0.5046 0.6152 -0.0162 -0.1652 0.1166  254 ASN A OD1   
2023 N ND2   . ASN A 254 ? 0.4365 0.5584 0.6475 -0.0416 -0.1871 0.1615  254 ASN A ND2   
2024 N N     . SER A 255 ? 0.3953 0.5255 0.5839 -0.0152 -0.1565 0.1091  255 SER A N     
2025 C CA    . SER A 255 ? 0.3916 0.5296 0.5783 -0.0151 -0.1565 0.1078  255 SER A CA    
2026 C C     . SER A 255 ? 0.3925 0.5467 0.5443 -0.0195 -0.1438 0.1027  255 SER A C     
2027 O O     . SER A 255 ? 0.3855 0.5420 0.5156 -0.0187 -0.1313 0.0931  255 SER A O     
2028 C CB    . SER A 255 ? 0.3723 0.4990 0.5799 -0.0014 -0.1522 0.0887  255 SER A CB    
2029 O OG    . SER A 255 ? 0.3611 0.4948 0.5702 -0.0013 -0.1533 0.0883  255 SER A OG    
2030 N N     . ARG A 256 ? 0.4069 0.5724 0.5570 -0.0241 -0.1487 0.1084  256 ARG A N     
2031 C CA    . ARG A 256 ? 0.4161 0.5958 0.5413 -0.0259 -0.1384 0.0989  256 ARG A CA    
2032 C C     . ARG A 256 ? 0.4092 0.5841 0.5455 -0.0186 -0.1368 0.0892  256 ARG A C     
2033 O O     . ARG A 256 ? 0.4229 0.6086 0.5448 -0.0206 -0.1320 0.0831  256 ARG A O     
2034 C CB    . ARG A 256 ? 0.4489 0.6540 0.5587 -0.0402 -0.1458 0.1138  256 ARG A CB    
2035 C CG    . ARG A 256 ? 0.4814 0.7002 0.5835 -0.0519 -0.1521 0.1308  256 ARG A CG    
2036 C CD    . ARG A 256 ? 0.5172 0.7711 0.5966 -0.0660 -0.1541 0.1383  256 ARG A CD    
2037 N NE    . ARG A 256 ? 0.5639 0.8302 0.6180 -0.0643 -0.1386 0.1186  256 ARG A NE    
2038 C CZ    . ARG A 256 ? 0.5691 0.8490 0.6092 -0.0629 -0.1310 0.1017  256 ARG A CZ    
2039 N NH1   . ARG A 256 ? 0.5520 0.8375 0.5964 -0.0639 -0.1361 0.1022  256 ARG A NH1   
2040 N NH2   . ARG A 256 ? 0.5894 0.8776 0.6135 -0.0603 -0.1189 0.0831  256 ARG A NH2   
2041 N N     . ASN A 257 ? 0.3838 0.5445 0.5478 -0.0105 -0.1416 0.0868  257 ASN A N     
2042 C CA    . ASN A 257 ? 0.3607 0.5197 0.5386 -0.0040 -0.1408 0.0784  257 ASN A CA    
2043 C C     . ASN A 257 ? 0.3711 0.5252 0.5434 0.0053  -0.1252 0.0586  257 ASN A C     
2044 O O     . ASN A 257 ? 0.3624 0.5083 0.5456 0.0123  -0.1214 0.0502  257 ASN A O     
2045 C CB    . ASN A 257 ? 0.3492 0.4997 0.5638 -0.0001 -0.1549 0.0842  257 ASN A CB    
2046 C CG    . ASN A 257 ? 0.3348 0.4865 0.5683 0.0064  -0.1557 0.0760  257 ASN A CG    
2047 O OD1   . ASN A 257 ? 0.3167 0.4728 0.5383 0.0101  -0.1437 0.0635  257 ASN A OD1   
2048 N ND2   . ASN A 257 ? 0.3267 0.4743 0.5933 0.0079  -0.1711 0.0834  257 ASN A ND2   
2049 N N     . LEU A 258 ? 0.3987 0.5598 0.5559 0.0045  -0.1174 0.0517  258 LEU A N     
2050 C CA    . LEU A 258 ? 0.4167 0.5759 0.5694 0.0107  -0.1045 0.0370  258 LEU A CA    
2051 C C     . LEU A 258 ? 0.4243 0.5806 0.5989 0.0191  -0.1023 0.0285  258 LEU A C     
2052 O O     . LEU A 258 ? 0.4321 0.5878 0.6035 0.0231  -0.0929 0.0190  258 LEU A O     
2053 C CB    . LEU A 258 ? 0.4344 0.6008 0.5805 0.0088  -0.1016 0.0333  258 LEU A CB    
2054 C CG    . LEU A 258 ? 0.4533 0.6258 0.5775 0.0026  -0.0994 0.0325  258 LEU A CG    
2055 C CD1   . LEU A 258 ? 0.4540 0.6316 0.5789 0.0022  -0.0980 0.0267  258 LEU A CD1   
2056 C CD2   . LEU A 258 ? 0.4447 0.6125 0.5559 0.0038  -0.0909 0.0263  258 LEU A CD2   
2057 N N     . GLU A 259 ? 0.4544 0.6119 0.6526 0.0215  -0.1114 0.0310  259 GLU A N     
2058 C CA    . GLU A 259 ? 0.4536 0.6143 0.6767 0.0301  -0.1096 0.0191  259 GLU A CA    
2059 C C     . GLU A 259 ? 0.4215 0.5755 0.6602 0.0352  -0.1125 0.0141  259 GLU A C     
2060 O O     . GLU A 259 ? 0.4212 0.5815 0.6764 0.0428  -0.1078 -0.0009 259 GLU A O     
2061 C CB    . GLU A 259 ? 0.4914 0.6567 0.7382 0.0315  -0.1192 0.0215  259 GLU A CB    
2062 C CG    . GLU A 259 ? 0.5285 0.6984 0.7618 0.0246  -0.1217 0.0307  259 GLU A CG    
2063 C CD    . GLU A 259 ? 0.5678 0.7422 0.7751 0.0212  -0.1099 0.0266  259 GLU A CD    
2064 O OE1   . GLU A 259 ? 0.5933 0.7705 0.7966 0.0245  -0.0990 0.0169  259 GLU A OE1   
2065 O OE2   . GLU A 259 ? 0.6179 0.7945 0.8106 0.0147  -0.1127 0.0330  259 GLU A OE2   
2066 N N     . GLU A 260 ? 0.3894 0.5336 0.6241 0.0306  -0.1206 0.0261  260 GLU A N     
2067 C CA    . GLU A 260 ? 0.3727 0.5091 0.6193 0.0345  -0.1230 0.0218  260 GLU A CA    
2068 C C     . GLU A 260 ? 0.3309 0.4675 0.5516 0.0344  -0.1088 0.0147  260 GLU A C     
2069 O O     . GLU A 260 ? 0.3356 0.4715 0.5652 0.0403  -0.1051 0.0029  260 GLU A O     
2070 C CB    . GLU A 260 ? 0.3875 0.5146 0.6415 0.0279  -0.1383 0.0402  260 GLU A CB    
2071 C CG    . GLU A 260 ? 0.4073 0.5279 0.7041 0.0319  -0.1559 0.0427  260 GLU A CG    
2072 C CD    . GLU A 260 ? 0.4197 0.5315 0.7244 0.0237  -0.1716 0.0633  260 GLU A CD    
2073 O OE1   . GLU A 260 ? 0.4178 0.5350 0.7028 0.0121  -0.1761 0.0832  260 GLU A OE1   
2074 O OE2   . GLU A 260 ? 0.4206 0.5226 0.7511 0.0282  -0.1795 0.0594  260 GLU A OE2   
2075 N N     . ILE A 261 ? 0.3012 0.4399 0.4922 0.0280  -0.1019 0.0206  261 ILE A N     
2076 C CA    . ILE A 261 ? 0.2894 0.4266 0.4581 0.0270  -0.0913 0.0164  261 ILE A CA    
2077 C C     . ILE A 261 ? 0.2810 0.4264 0.4449 0.0308  -0.0790 0.0037  261 ILE A C     
2078 O O     . ILE A 261 ? 0.2550 0.4011 0.4156 0.0335  -0.0722 -0.0039 261 ILE A O     
2079 C CB    . ILE A 261 ? 0.2843 0.4223 0.4278 0.0187  -0.0905 0.0261  261 ILE A CB    
2080 C CG1   . ILE A 261 ? 0.2876 0.4242 0.4343 0.0123  -0.1028 0.0411  261 ILE A CG1   
2081 C CG2   . ILE A 261 ? 0.2807 0.4168 0.4053 0.0184  -0.0806 0.0208  261 ILE A CG2   
2082 C CD1   . ILE A 261 ? 0.2906 0.4374 0.4150 0.0031  -0.1033 0.0494  261 ILE A CD1   
2083 N N     . LYS A 262 ? 0.2858 0.4392 0.4511 0.0301  -0.0773 0.0028  262 LYS A N     
2084 C CA    . LYS A 262 ? 0.2883 0.4528 0.4500 0.0310  -0.0674 -0.0048 262 LYS A CA    
2085 C C     . LYS A 262 ? 0.2951 0.4695 0.4667 0.0362  -0.0613 -0.0168 262 LYS A C     
2086 O O     . LYS A 262 ? 0.3143 0.4949 0.4736 0.0343  -0.0530 -0.0193 262 LYS A O     
2087 C CB    . LYS A 262 ? 0.3012 0.4748 0.4723 0.0303  -0.0693 -0.0041 262 LYS A CB    
2088 C CG    . LYS A 262 ? 0.3001 0.4719 0.4560 0.0242  -0.0691 0.0026  262 LYS A CG    
2089 C CD    . LYS A 262 ? 0.3029 0.4775 0.4676 0.0227  -0.0762 0.0069  262 LYS A CD    
2090 C CE    . LYS A 262 ? 0.3075 0.4955 0.4894 0.0253  -0.0742 0.0020  262 LYS A CE    
2091 N NZ    . LYS A 262 ? 0.3127 0.5025 0.5006 0.0228  -0.0810 0.0071  262 LYS A NZ    
2092 N N     . PRO A 263 ? 0.2943 0.4726 0.4904 0.0426  -0.0662 -0.0251 263 PRO A N     
2093 C CA    . PRO A 263 ? 0.2884 0.4819 0.4955 0.0478  -0.0602 -0.0407 263 PRO A CA    
2094 C C     . PRO A 263 ? 0.2769 0.4654 0.4678 0.0465  -0.0549 -0.0417 263 PRO A C     
2095 O O     . PRO A 263 ? 0.2590 0.4641 0.4438 0.0460  -0.0459 -0.0493 263 PRO A O     
2096 C CB    . PRO A 263 ? 0.2949 0.4867 0.5348 0.0555  -0.0704 -0.0499 263 PRO A CB    
2097 C CG    . PRO A 263 ? 0.2995 0.4809 0.5471 0.0535  -0.0807 -0.0377 263 PRO A CG    
2098 C CD    . PRO A 263 ? 0.3026 0.4745 0.5202 0.0449  -0.0784 -0.0216 263 PRO A CD    
2099 N N     . TYR A 264 ? 0.2656 0.4340 0.4498 0.0450  -0.0610 -0.0328 264 TYR A N     
2100 C CA    . TYR A 264 ? 0.2612 0.4235 0.4309 0.0437  -0.0568 -0.0330 264 TYR A CA    
2101 C C     . TYR A 264 ? 0.2476 0.4121 0.3920 0.0376  -0.0484 -0.0267 264 TYR A C     
2102 O O     . TYR A 264 ? 0.2458 0.4177 0.3818 0.0369  -0.0414 -0.0313 264 TYR A O     
2103 C CB    . TYR A 264 ? 0.2732 0.4167 0.4423 0.0421  -0.0657 -0.0232 264 TYR A CB    
2104 C CG    . TYR A 264 ? 0.2845 0.4223 0.4832 0.0471  -0.0775 -0.0263 264 TYR A CG    
2105 C CD1   . TYR A 264 ? 0.2880 0.4259 0.5032 0.0528  -0.0791 -0.0387 264 TYR A CD1   
2106 C CD2   . TYR A 264 ? 0.2874 0.4195 0.5002 0.0457  -0.0889 -0.0166 264 TYR A CD2   
2107 C CE1   . TYR A 264 ? 0.2964 0.4274 0.5449 0.0576  -0.0926 -0.0424 264 TYR A CE1   
2108 C CE2   . TYR A 264 ? 0.3016 0.4269 0.5470 0.0497  -0.1028 -0.0175 264 TYR A CE2   
2109 C CZ    . TYR A 264 ? 0.3050 0.4288 0.5697 0.0559  -0.1049 -0.0308 264 TYR A CZ    
2110 O OH    . TYR A 264 ? 0.3231 0.4390 0.6258 0.0603  -0.1208 -0.0329 264 TYR A OH    
2111 N N     . LEU A 265 ? 0.2334 0.3926 0.3683 0.0331  -0.0503 -0.0169 265 LEU A N     
2112 C CA    . LEU A 265 ? 0.2367 0.3962 0.3541 0.0278  -0.0451 -0.0120 265 LEU A CA    
2113 C C     . LEU A 265 ? 0.2272 0.4043 0.3467 0.0265  -0.0385 -0.0157 265 LEU A C     
2114 O O     . LEU A 265 ? 0.2368 0.4173 0.3468 0.0233  -0.0338 -0.0143 265 LEU A O     
2115 C CB    . LEU A 265 ? 0.2537 0.4077 0.3659 0.0240  -0.0496 -0.0048 265 LEU A CB    
2116 C CG    . LEU A 265 ? 0.2650 0.4181 0.3660 0.0192  -0.0473 -0.0018 265 LEU A CG    
2117 C CD1   . LEU A 265 ? 0.2717 0.4178 0.3609 0.0180  -0.0447 -0.0019 265 LEU A CD1   
2118 C CD2   . LEU A 265 ? 0.2858 0.4361 0.3851 0.0165  -0.0529 0.0014  265 LEU A CD2   
2119 N N     . PHE A 266 ? 0.2186 0.4095 0.3519 0.0281  -0.0386 -0.0196 266 PHE A N     
2120 C CA    . PHE A 266 ? 0.2099 0.4240 0.3459 0.0248  -0.0326 -0.0213 266 PHE A CA    
2121 C C     . PHE A 266 ? 0.2094 0.4414 0.3461 0.0261  -0.0263 -0.0306 266 PHE A C     
2122 O O     . PHE A 266 ? 0.2001 0.4499 0.3305 0.0200  -0.0212 -0.0272 266 PHE A O     
2123 C CB    . PHE A 266 ? 0.2020 0.4298 0.3540 0.0264  -0.0343 -0.0244 266 PHE A CB    
2124 C CG    . PHE A 266 ? 0.1989 0.4159 0.3497 0.0232  -0.0396 -0.0148 266 PHE A CG    
2125 C CD1   . PHE A 266 ? 0.2016 0.4040 0.3390 0.0182  -0.0416 -0.0057 266 PHE A CD1   
2126 C CD2   . PHE A 266 ? 0.1995 0.4235 0.3652 0.0253  -0.0430 -0.0167 266 PHE A CD2   
2127 C CE1   . PHE A 266 ? 0.2034 0.3992 0.3419 0.0156  -0.0469 -0.0001 266 PHE A CE1   
2128 C CE2   . PHE A 266 ? 0.1994 0.4155 0.3644 0.0221  -0.0482 -0.0088 266 PHE A CE2   
2129 C CZ    . PHE A 266 ? 0.2061 0.4087 0.3572 0.0171  -0.0501 -0.0011 266 PHE A CZ    
2130 N N     . ARG A 267 ? 0.2259 0.4556 0.3724 0.0332  -0.0278 -0.0422 267 ARG A N     
2131 C CA    . ARG A 267 ? 0.2496 0.4956 0.3967 0.0348  -0.0225 -0.0535 267 ARG A CA    
2132 C C     . ARG A 267 ? 0.2376 0.4729 0.3645 0.0298  -0.0201 -0.0446 267 ARG A C     
2133 O O     . ARG A 267 ? 0.2213 0.4762 0.3410 0.0252  -0.0143 -0.0452 267 ARG A O     
2134 C CB    . ARG A 267 ? 0.2892 0.5301 0.4551 0.0440  -0.0272 -0.0684 267 ARG A CB    
2135 C CG    . ARG A 267 ? 0.3374 0.5972 0.5055 0.0462  -0.0221 -0.0833 267 ARG A CG    
2136 C CD    . ARG A 267 ? 0.3821 0.6509 0.5795 0.0561  -0.0265 -0.1052 267 ARG A CD    
2137 N NE    . ARG A 267 ? 0.4361 0.6728 0.6466 0.0612  -0.0380 -0.1017 267 ARG A NE    
2138 C CZ    . ARG A 267 ? 0.4946 0.7108 0.6999 0.0615  -0.0419 -0.0978 267 ARG A CZ    
2139 N NH1   . ARG A 267 ? 0.4953 0.7175 0.6823 0.0581  -0.0348 -0.0986 267 ARG A NH1   
2140 N NH2   . ARG A 267 ? 0.5135 0.7042 0.7327 0.0641  -0.0537 -0.0913 267 ARG A NH2   
2141 N N     . ALA A 268 ? 0.2338 0.4409 0.3524 0.0300  -0.0249 -0.0361 268 ALA A N     
2142 C CA    . ALA A 268 ? 0.2380 0.4336 0.3404 0.0262  -0.0235 -0.0291 268 ALA A CA    
2143 C C     . ALA A 268 ? 0.2367 0.4414 0.3306 0.0183  -0.0208 -0.0191 268 ALA A C     
2144 O O     . ALA A 268 ? 0.2204 0.4306 0.3063 0.0143  -0.0180 -0.0162 268 ALA A O     
2145 C CB    . ALA A 268 ? 0.2385 0.4086 0.3350 0.0269  -0.0290 -0.0225 268 ALA A CB    
2146 N N     . ILE A 269 ? 0.2353 0.4418 0.3335 0.0156  -0.0230 -0.0132 269 ILE A N     
2147 C CA    . ILE A 269 ? 0.2514 0.4665 0.3477 0.0073  -0.0232 -0.0022 269 ILE A CA    
2148 C C     . ILE A 269 ? 0.2574 0.5047 0.3558 0.0019  -0.0181 -0.0020 269 ILE A C     
2149 O O     . ILE A 269 ? 0.2519 0.5073 0.3453 -0.0057 -0.0180 0.0076  269 ILE A O     
2150 C CB    . ILE A 269 ? 0.2461 0.4567 0.3496 0.0056  -0.0279 0.0032  269 ILE A CB    
2151 C CG1   . ILE A 269 ? 0.2509 0.4357 0.3499 0.0081  -0.0331 0.0040  269 ILE A CG1   
2152 C CG2   . ILE A 269 ? 0.2467 0.4701 0.3544 -0.0037 -0.0296 0.0151  269 ILE A CG2   
2153 C CD1   . ILE A 269 ? 0.2493 0.4302 0.3552 0.0080  -0.0380 0.0056  269 ILE A CD1   
2154 N N     . GLU A 270 ? 0.2654 0.5341 0.3727 0.0053  -0.0145 -0.0126 270 GLU A N     
2155 C CA    . GLU A 270 ? 0.2756 0.5834 0.3848 -0.0005 -0.0087 -0.0149 270 GLU A CA    
2156 C C     . GLU A 270 ? 0.2663 0.5836 0.3659 -0.0020 -0.0050 -0.0186 270 GLU A C     
2157 O O     . GLU A 270 ? 0.2455 0.5870 0.3394 -0.0120 -0.0029 -0.0094 270 GLU A O     
2158 C CB    . GLU A 270 ? 0.2937 0.6254 0.4172 0.0052  -0.0053 -0.0310 270 GLU A CB    
2159 C CG    . GLU A 270 ? 0.3208 0.7018 0.4460 -0.0014 0.0017  -0.0363 270 GLU A CG    
2160 C CD    . GLU A 270 ? 0.3515 0.7615 0.4906 -0.0025 0.0038  -0.0408 270 GLU A CD    
2161 O OE1   . GLU A 270 ? 0.3802 0.7962 0.5350 0.0075  0.0046  -0.0603 270 GLU A OE1   
2162 O OE2   . GLU A 270 ? 0.3772 0.8039 0.5142 -0.0138 0.0034  -0.0242 270 GLU A OE2   
2163 N N     . GLU A 271 ? 0.2692 0.5685 0.3682 0.0069  -0.0051 -0.0306 271 GLU A N     
2164 C CA    . GLU A 271 ? 0.2846 0.5901 0.3753 0.0061  -0.0023 -0.0350 271 GLU A CA    
2165 C C     . GLU A 271 ? 0.2852 0.5740 0.3632 -0.0013 -0.0053 -0.0171 271 GLU A C     
2166 O O     . GLU A 271 ? 0.2829 0.5881 0.3536 -0.0079 -0.0033 -0.0125 271 GLU A O     
2167 C CB    . GLU A 271 ? 0.3012 0.5887 0.3978 0.0171  -0.0037 -0.0508 271 GLU A CB    
2168 C CG    . GLU A 271 ? 0.3262 0.6360 0.4414 0.0244  -0.0021 -0.0716 271 GLU A CG    
2169 C CD    . GLU A 271 ? 0.3491 0.6369 0.4783 0.0353  -0.0075 -0.0852 271 GLU A CD    
2170 O OE1   . GLU A 271 ? 0.3886 0.6491 0.5100 0.0362  -0.0109 -0.0790 271 GLU A OE1   
2171 O OE2   . GLU A 271 ? 0.3843 0.6830 0.5353 0.0426  -0.0094 -0.1017 271 GLU A OE2   
2172 N N     . SER A 272 ? 0.2820 0.5410 0.3596 -0.0005 -0.0107 -0.0076 272 SER A N     
2173 C CA    . SER A 272 ? 0.2867 0.5311 0.3584 -0.0067 -0.0149 0.0067  272 SER A CA    
2174 C C     . SER A 272 ? 0.2877 0.5553 0.3621 -0.0188 -0.0167 0.0220  272 SER A C     
2175 O O     . SER A 272 ? 0.2794 0.5494 0.3501 -0.0253 -0.0189 0.0319  272 SER A O     
2176 C CB    . SER A 272 ? 0.2763 0.4899 0.3500 -0.0033 -0.0205 0.0100  272 SER A CB    
2177 O OG    . SER A 272 ? 0.2761 0.4711 0.3457 0.0048  -0.0200 0.0005  272 SER A OG    
2178 N N     . TYR A 273 ? 0.3031 0.5895 0.3853 -0.0225 -0.0164 0.0252  273 TYR A N     
2179 C CA    . TYR A 273 ? 0.3165 0.6301 0.4031 -0.0362 -0.0191 0.0425  273 TYR A CA    
2180 C C     . TYR A 273 ? 0.3503 0.7052 0.4303 -0.0434 -0.0131 0.0419  273 TYR A C     
2181 O O     . TYR A 273 ? 0.3674 0.7428 0.4476 -0.0568 -0.0169 0.0601  273 TYR A O     
2182 C CB    . TYR A 273 ? 0.3097 0.6325 0.4075 -0.0393 -0.0214 0.0479  273 TYR A CB    
2183 C CG    . TYR A 273 ? 0.2913 0.5831 0.3984 -0.0404 -0.0314 0.0589  273 TYR A CG    
2184 C CD1   . TYR A 273 ? 0.2850 0.5434 0.3915 -0.0297 -0.0330 0.0483  273 TYR A CD1   
2185 C CD2   . TYR A 273 ? 0.2904 0.5886 0.4089 -0.0529 -0.0403 0.0796  273 TYR A CD2   
2186 C CE1   . TYR A 273 ? 0.2834 0.5176 0.3992 -0.0302 -0.0420 0.0542  273 TYR A CE1   
2187 C CE2   . TYR A 273 ? 0.2897 0.5594 0.4213 -0.0528 -0.0509 0.0860  273 TYR A CE2   
2188 C CZ    . TYR A 273 ? 0.2831 0.5217 0.4127 -0.0408 -0.0510 0.0712  273 TYR A CZ    
2189 O OH    . TYR A 273 ? 0.2824 0.4971 0.4258 -0.0400 -0.0611 0.0730  273 TYR A OH    
2190 N N     . TYR A 274 ? 0.3777 0.7465 0.4538 -0.0353 -0.0052 0.0211  274 TYR A N     
2191 C CA    . TYR A 274 ? 0.4091 0.8178 0.4783 -0.0411 0.0006  0.0162  274 TYR A CA    
2192 C C     . TYR A 274 ? 0.4147 0.8087 0.4742 -0.0442 -0.0025 0.0242  274 TYR A C     
2193 O O     . TYR A 274 ? 0.3994 0.8222 0.4537 -0.0565 -0.0032 0.0367  274 TYR A O     
2194 C CB    . TYR A 274 ? 0.4325 0.8570 0.5052 -0.0299 0.0081  -0.0121 274 TYR A CB    
2195 C CG    . TYR A 274 ? 0.4706 0.9373 0.5370 -0.0344 0.0141  -0.0223 274 TYR A CG    
2196 C CD1   . TYR A 274 ? 0.4955 0.9486 0.5540 -0.0307 0.0141  -0.0287 274 TYR A CD1   
2197 C CD2   . TYR A 274 ? 0.5072 1.0312 0.5755 -0.0433 0.0197  -0.0260 274 TYR A CD2   
2198 C CE1   . TYR A 274 ? 0.5311 1.0254 0.5839 -0.0352 0.0192  -0.0394 274 TYR A CE1   
2199 C CE2   . TYR A 274 ? 0.5241 1.0936 0.5859 -0.0483 0.0254  -0.0374 274 TYR A CE2   
2200 C CZ    . TYR A 274 ? 0.5399 1.0934 0.5940 -0.0440 0.0249  -0.0445 274 TYR A CZ    
2201 O OH    . TYR A 274 ? 0.6240 1.2241 0.6717 -0.0491 0.0302  -0.0570 274 TYR A OH    
2202 N N     . LYS A 275 ? 0.4116 0.7634 0.4691 -0.0339 -0.0048 0.0182  275 LYS A N     
2203 C CA    . LYS A 275 ? 0.4283 0.7636 0.4786 -0.0362 -0.0083 0.0259  275 LYS A CA    
2204 C C     . LYS A 275 ? 0.4335 0.7622 0.4884 -0.0477 -0.0174 0.0509  275 LYS A C     
2205 O O     . LYS A 275 ? 0.4409 0.7772 0.4924 -0.0556 -0.0207 0.0621  275 LYS A O     
2206 C CB    . LYS A 275 ? 0.4208 0.7137 0.4698 -0.0240 -0.0095 0.0162  275 LYS A CB    
2207 C CG    . LYS A 275 ? 0.4517 0.7435 0.4996 -0.0131 -0.0042 -0.0056 275 LYS A CG    
2208 C CD    . LYS A 275 ? 0.4620 0.7187 0.5061 -0.0063 -0.0067 -0.0083 275 LYS A CD    
2209 C CE    . LYS A 275 ? 0.4683 0.7057 0.5181 0.0048  -0.0066 -0.0222 275 LYS A CE    
2210 N NZ    . LYS A 275 ? 0.4970 0.7039 0.5423 0.0085  -0.0097 -0.0200 275 LYS A NZ    
2211 N N     . LEU A 276 ? 0.4402 0.7531 0.5057 -0.0482 -0.0229 0.0591  276 LEU A N     
2212 C CA    . LEU A 276 ? 0.4616 0.7658 0.5389 -0.0583 -0.0342 0.0814  276 LEU A CA    
2213 C C     . LEU A 276 ? 0.4821 0.8270 0.5606 -0.0751 -0.0369 0.1008  276 LEU A C     
2214 O O     . LEU A 276 ? 0.4656 0.8088 0.5508 -0.0850 -0.0465 0.1199  276 LEU A O     
2215 C CB    . LEU A 276 ? 0.4536 0.7407 0.5442 -0.0564 -0.0396 0.0843  276 LEU A CB    
2216 C CG    . LEU A 276 ? 0.4591 0.7053 0.5518 -0.0439 -0.0415 0.0721  276 LEU A CG    
2217 C CD1   . LEU A 276 ? 0.4779 0.7147 0.5812 -0.0415 -0.0448 0.0710  276 LEU A CD1   
2218 C CD2   . LEU A 276 ? 0.4650 0.6883 0.5656 -0.0452 -0.0505 0.0791  276 LEU A CD2   
2219 N N     . ASP A 277 ? 0.5282 0.9122 0.6016 -0.0787 -0.0290 0.0956  277 ASP A N     
2220 C CA    . ASP A 277 ? 0.5552 0.9905 0.6260 -0.0956 -0.0289 0.1110  277 ASP A CA    
2221 C C     . ASP A 277 ? 0.5808 1.0201 0.6684 -0.1106 -0.0417 0.1405  277 ASP A C     
2222 O O     . ASP A 277 ? 0.6287 1.0806 0.7239 -0.1132 -0.0414 0.1431  277 ASP A O     
2223 C CB    . ASP A 277 ? 0.5466 0.9956 0.6059 -0.1002 -0.0280 0.1127  277 ASP A CB    
2224 C CG    . ASP A 277 ? 0.5843 1.0968 0.6363 -0.1170 -0.0248 0.1225  277 ASP A CG    
2225 O OD1   . ASP A 277 ? 0.5963 1.1447 0.6521 -0.1253 -0.0226 0.1277  277 ASP A OD1   
2226 O OD2   . ASP A 277 ? 0.5943 1.1240 0.6365 -0.1226 -0.0244 0.1249  277 ASP A OD2   
2227 N N     . LYS A 278 ? 0.5879 1.0145 0.6847 -0.1199 -0.0544 0.1624  278 LYS A N     
2228 C CA    . LYS A 278 ? 0.6071 1.0332 0.7264 -0.1342 -0.0701 0.1915  278 LYS A CA    
2229 C C     . LYS A 278 ? 0.5771 0.9487 0.7171 -0.1267 -0.0833 0.1940  278 LYS A C     
2230 O O     . LYS A 278 ? 0.6108 0.9751 0.7752 -0.1359 -0.0981 0.2143  278 LYS A O     
2231 C CB    . LYS A 278 ? 0.6509 1.1192 0.7720 -0.1564 -0.0780 0.2209  278 LYS A CB    
2232 C CG    . LYS A 278 ? 0.6802 1.2121 0.7899 -0.1690 -0.0689 0.2248  278 LYS A CG    
2233 C CD    . LYS A 278 ? 0.7193 1.3008 0.8274 -0.1927 -0.0760 0.2540  278 LYS A CD    
2234 C CE    . LYS A 278 ? 0.7418 1.3938 0.8402 -0.2071 -0.0671 0.2583  278 LYS A CE    
2235 N NZ    . LYS A 278 ? 0.7675 1.4760 0.8604 -0.2316 -0.0728 0.2860  278 LYS A NZ    
2236 N N     . ARG A 279 ? 0.5616 0.8974 0.6941 -0.1105 -0.0786 0.1726  279 ARG A N     
2237 C CA    . ARG A 279 ? 0.5575 0.8471 0.7088 -0.1018 -0.0890 0.1688  279 ARG A CA    
2238 C C     . ARG A 279 ? 0.5239 0.7974 0.6813 -0.0930 -0.0872 0.1564  279 ARG A C     
2239 O O     . ARG A 279 ? 0.5350 0.8136 0.6750 -0.0837 -0.0738 0.1379  279 ARG A O     
2240 C CB    . ARG A 279 ? 0.5764 0.8398 0.7162 -0.0883 -0.0833 0.1495  279 ARG A CB    
2241 C CG    . ARG A 279 ? 0.6181 0.8905 0.7557 -0.0961 -0.0875 0.1616  279 ARG A CG    
2242 C CD    . ARG A 279 ? 0.6270 0.8836 0.7462 -0.0830 -0.0773 0.1402  279 ARG A CD    
2243 N NE    . ARG A 279 ? 0.6396 0.9201 0.7341 -0.0789 -0.0614 0.1253  279 ARG A NE    
2244 C CZ    . ARG A 279 ? 0.6619 0.9414 0.7394 -0.0715 -0.0525 0.1102  279 ARG A CZ    
2245 N NH1   . ARG A 279 ? 0.6484 0.9047 0.7274 -0.0674 -0.0561 0.1083  279 ARG A NH1   
2246 N NH2   . ARG A 279 ? 0.6863 0.9889 0.7479 -0.0680 -0.0403 0.0956  279 ARG A NH2   
2247 N N     . ILE A 280 ? 0.4915 0.7464 0.6761 -0.0963 -0.1020 0.1666  280 ILE A N     
2248 C CA    . ILE A 280 ? 0.4760 0.7148 0.6688 -0.0886 -0.1024 0.1551  280 ILE A CA    
2249 C C     . ILE A 280 ? 0.4450 0.6446 0.6466 -0.0750 -0.1065 0.1366  280 ILE A C     
2250 O O     . ILE A 280 ? 0.4612 0.6444 0.6857 -0.0774 -0.1203 0.1432  280 ILE A O     
2251 C CB    . ILE A 280 ? 0.5028 0.7516 0.7223 -0.1021 -0.1168 0.1777  280 ILE A CB    
2252 C CG1   . ILE A 280 ? 0.5210 0.8119 0.7275 -0.1120 -0.1080 0.1876  280 ILE A CG1   
2253 C CG2   . ILE A 280 ? 0.5108 0.7322 0.7487 -0.0938 -0.1235 0.1660  280 ILE A CG2   
2254 C CD1   . ILE A 280 ? 0.5349 0.8630 0.7234 -0.1220 -0.1009 0.1979  280 ILE A CD1   
2255 N N     . PRO A 281 ? 0.3884 0.5759 0.5734 -0.0612 -0.0952 0.1131  281 PRO A N     
2256 C CA    . PRO A 281 ? 0.3800 0.5384 0.5700 -0.0494 -0.0974 0.0943  281 PRO A CA    
2257 C C     . PRO A 281 ? 0.3835 0.5267 0.5984 -0.0474 -0.1087 0.0894  281 PRO A C     
2258 O O     . PRO A 281 ? 0.3753 0.5276 0.5956 -0.0517 -0.1103 0.0958  281 PRO A O     
2259 C CB    . PRO A 281 ? 0.3597 0.5185 0.5211 -0.0386 -0.0813 0.0755  281 PRO A CB    
2260 C CG    . PRO A 281 ? 0.3566 0.5369 0.5098 -0.0422 -0.0749 0.0803  281 PRO A CG    
2261 C CD    . PRO A 281 ? 0.3757 0.5790 0.5383 -0.0566 -0.0807 0.1030  281 PRO A CD    
2262 N N     . LYS A 282 ? 0.3909 0.5134 0.6224 -0.0409 -0.1166 0.0765  282 LYS A N     
2263 C CA    . LYS A 282 ? 0.3955 0.5055 0.6496 -0.0368 -0.1261 0.0648  282 LYS A CA    
2264 C C     . LYS A 282 ? 0.3726 0.4757 0.6102 -0.0243 -0.1166 0.0385  282 LYS A C     
2265 O O     . LYS A 282 ? 0.3826 0.4804 0.6333 -0.0205 -0.1220 0.0258  282 LYS A O     
2266 C CB    . LYS A 282 ? 0.4222 0.5179 0.7162 -0.0392 -0.1453 0.0669  282 LYS A CB    
2267 C CG    . LYS A 282 ? 0.4538 0.5564 0.7711 -0.0538 -0.1592 0.0967  282 LYS A CG    
2268 C CD    . LYS A 282 ? 0.4957 0.5815 0.8628 -0.0561 -0.1828 0.0986  282 LYS A CD    
2269 C CE    . LYS A 282 ? 0.5128 0.5836 0.8914 -0.0472 -0.1864 0.0810  282 LYS A CE    
2270 N NZ    . LYS A 282 ? 0.5257 0.6036 0.8777 -0.0488 -0.1757 0.0890  282 LYS A NZ    
2271 N N     . ALA A 283 ? 0.3422 0.4477 0.5520 -0.0190 -0.1035 0.0310  283 ALA A N     
2272 C CA    . ALA A 283 ? 0.3406 0.4438 0.5337 -0.0096 -0.0952 0.0103  283 ALA A CA    
2273 C C     . ALA A 283 ? 0.3293 0.4416 0.4913 -0.0080 -0.0810 0.0123  283 ALA A C     
2274 O O     . ALA A 283 ? 0.3261 0.4453 0.4769 -0.0115 -0.0756 0.0235  283 ALA A O     
2275 C CB    . ALA A 283 ? 0.3422 0.4386 0.5378 -0.0041 -0.0957 -0.0036 283 ALA A CB    
2276 N N     . ILE A 284 ? 0.3034 0.4172 0.4544 -0.0031 -0.0764 0.0008  284 ILE A N     
2277 C CA    . ILE A 284 ? 0.2826 0.4028 0.4102 -0.0006 -0.0659 0.0008  284 ILE A CA    
2278 C C     . ILE A 284 ? 0.2843 0.4036 0.4004 0.0047  -0.0627 -0.0131 284 ILE A C     
2279 O O     . ILE A 284 ? 0.2950 0.4151 0.4192 0.0060  -0.0676 -0.0235 284 ILE A O     
2280 C CB    . ILE A 284 ? 0.2794 0.4074 0.4074 -0.0029 -0.0651 0.0073  284 ILE A CB    
2281 C CG1   . ILE A 284 ? 0.2665 0.4001 0.3759 0.0007  -0.0561 0.0055  284 ILE A CG1   
2282 C CG2   . ILE A 284 ? 0.2770 0.4028 0.4187 -0.0027 -0.0727 0.0010  284 ILE A CG2   
2283 C CD1   . ILE A 284 ? 0.2604 0.4039 0.3723 -0.0008 -0.0549 0.0107  284 ILE A CD1   
2284 N N     . HIS A 285 ? 0.2818 0.4024 0.3802 0.0068  -0.0553 -0.0131 285 HIS A N     
2285 C CA    . HIS A 285 ? 0.2940 0.4182 0.3801 0.0094  -0.0526 -0.0213 285 HIS A CA    
2286 C C     . HIS A 285 ? 0.2839 0.4106 0.3576 0.0101  -0.0476 -0.0150 285 HIS A C     
2287 O O     . HIS A 285 ? 0.2688 0.3940 0.3389 0.0104  -0.0437 -0.0091 285 HIS A O     
2288 C CB    . HIS A 285 ? 0.3161 0.4398 0.3974 0.0109  -0.0508 -0.0280 285 HIS A CB    
2289 C CG    . HIS A 285 ? 0.3486 0.4706 0.4472 0.0114  -0.0569 -0.0375 285 HIS A CG    
2290 N ND1   . HIS A 285 ? 0.3747 0.5054 0.4759 0.0132  -0.0585 -0.0531 285 HIS A ND1   
2291 C CD2   . HIS A 285 ? 0.3550 0.4696 0.4729 0.0100  -0.0633 -0.0342 285 HIS A CD2   
2292 C CE1   . HIS A 285 ? 0.3768 0.5038 0.5002 0.0144  -0.0656 -0.0617 285 HIS A CE1   
2293 N NE2   . HIS A 285 ? 0.3801 0.4955 0.5149 0.0122  -0.0695 -0.0487 285 HIS A NE2   
2294 N N     . VAL A 286 ? 0.2835 0.4154 0.3530 0.0101  -0.0490 -0.0170 286 VAL A N     
2295 C CA    . VAL A 286 ? 0.2803 0.4140 0.3424 0.0108  -0.0473 -0.0116 286 VAL A CA    
2296 C C     . VAL A 286 ? 0.2881 0.4251 0.3395 0.0099  -0.0467 -0.0125 286 VAL A C     
2297 O O     . VAL A 286 ? 0.2802 0.4262 0.3278 0.0077  -0.0486 -0.0183 286 VAL A O     
2298 C CB    . VAL A 286 ? 0.2806 0.4194 0.3467 0.0099  -0.0512 -0.0103 286 VAL A CB    
2299 C CG1   . VAL A 286 ? 0.2821 0.4220 0.3453 0.0104  -0.0520 -0.0041 286 VAL A CG1   
2300 C CG2   . VAL A 286 ? 0.2867 0.4246 0.3643 0.0098  -0.0519 -0.0081 286 VAL A CG2   
2301 N N     . VAL A 287 ? 0.2924 0.4251 0.3402 0.0110  -0.0446 -0.0073 287 VAL A N     
2302 C CA    . VAL A 287 ? 0.2962 0.4315 0.3356 0.0091  -0.0446 -0.0052 287 VAL A CA    
2303 C C     . VAL A 287 ? 0.2963 0.4324 0.3375 0.0078  -0.0490 0.0035  287 VAL A C     
2304 O O     . VAL A 287 ? 0.3068 0.4363 0.3566 0.0110  -0.0496 0.0058  287 VAL A O     
2305 C CB    . VAL A 287 ? 0.2981 0.4261 0.3358 0.0111  -0.0405 -0.0058 287 VAL A CB    
2306 C CG1   . VAL A 287 ? 0.3052 0.4366 0.3353 0.0084  -0.0409 -0.0028 287 VAL A CG1   
2307 C CG2   . VAL A 287 ? 0.3002 0.4260 0.3406 0.0119  -0.0382 -0.0120 287 VAL A CG2   
2308 N N     . ALA A 288 ? 0.3146 0.4616 0.3500 0.0025  -0.0531 0.0082  288 ALA A N     
2309 C CA    . ALA A 288 ? 0.3283 0.4765 0.3684 -0.0007 -0.0603 0.0202  288 ALA A CA    
2310 C C     . ALA A 288 ? 0.3361 0.4888 0.3706 -0.0055 -0.0620 0.0272  288 ALA A C     
2311 O O     . ALA A 288 ? 0.3525 0.5187 0.3754 -0.0096 -0.0591 0.0240  288 ALA A O     
2312 C CB    . ALA A 288 ? 0.3220 0.4835 0.3608 -0.0057 -0.0660 0.0244  288 ALA A CB    
2313 N N     . VAL A 289 ? 0.3506 0.4933 0.3959 -0.0047 -0.0671 0.0355  289 VAL A N     
2314 C CA    . VAL A 289 ? 0.3664 0.5134 0.4108 -0.0110 -0.0722 0.0467  289 VAL A CA    
2315 C C     . VAL A 289 ? 0.3827 0.5373 0.4356 -0.0181 -0.0842 0.0626  289 VAL A C     
2316 O O     . VAL A 289 ? 0.3736 0.5168 0.4443 -0.0142 -0.0907 0.0653  289 VAL A O     
2317 C CB    . VAL A 289 ? 0.3873 0.5176 0.4432 -0.0060 -0.0729 0.0461  289 VAL A CB    
2318 C CG1   . VAL A 289 ? 0.4062 0.5410 0.4625 -0.0135 -0.0791 0.0590  289 VAL A CG1   
2319 C CG2   . VAL A 289 ? 0.3855 0.5088 0.4345 0.0008  -0.0620 0.0316  289 VAL A CG2   
2320 N N     . THR A 290 ? 0.4014 0.5781 0.4430 -0.0291 -0.0875 0.0729  290 THR A N     
2321 C CA    . THR A 290 ? 0.4338 0.6231 0.4821 -0.0390 -0.1005 0.0920  290 THR A CA    
2322 C C     . THR A 290 ? 0.4594 0.6396 0.5269 -0.0436 -0.1137 0.1108  290 THR A C     
2323 O O     . THR A 290 ? 0.4406 0.6067 0.5145 -0.0393 -0.1120 0.1077  290 THR A O     
2324 C CB    . THR A 290 ? 0.4331 0.6570 0.4616 -0.0511 -0.0998 0.0967  290 THR A CB    
2325 O OG1   . THR A 290 ? 0.4560 0.6929 0.4733 -0.0562 -0.0952 0.0971  290 THR A OG1   
2326 C CG2   . THR A 290 ? 0.4214 0.6537 0.4381 -0.0464 -0.0906 0.0776  290 THR A CG2   
2327 N N     . GLU A 291 ? 0.5094 0.6981 0.5888 -0.0528 -0.1283 0.1308  291 GLU A N     
2328 C CA    . GLU A 291 ? 0.5531 0.7309 0.6595 -0.0574 -0.1452 0.1506  291 GLU A CA    
2329 C C     . GLU A 291 ? 0.5698 0.7587 0.6710 -0.0677 -0.1481 0.1643  291 GLU A C     
2330 O O     . GLU A 291 ? 0.5675 0.7414 0.6927 -0.0687 -0.1600 0.1756  291 GLU A O     
2331 C CB    . GLU A 291 ? 0.5830 0.7699 0.7048 -0.0668 -0.1622 0.1719  291 GLU A CB    
2332 C CG    . GLU A 291 ? 0.6079 0.8328 0.7078 -0.0844 -0.1649 0.1891  291 GLU A CG    
2333 C CD    . GLU A 291 ? 0.6174 0.8531 0.7264 -0.0917 -0.1777 0.2042  291 GLU A CD    
2334 O OE1   . GLU A 291 ? 0.6308 0.8507 0.7722 -0.0930 -0.1958 0.2210  291 GLU A OE1   
2335 O OE2   . GLU A 291 ? 0.6204 0.8803 0.7067 -0.0957 -0.1706 0.1982  291 GLU A OE2   
2336 N N     . ASP A 292 ? 0.5958 0.8123 0.6684 -0.0752 -0.1380 0.1620  292 ASP A N     
2337 C CA    . ASP A 292 ? 0.6256 0.8563 0.6903 -0.0842 -0.1374 0.1712  292 ASP A CA    
2338 C C     . ASP A 292 ? 0.6196 0.8371 0.6733 -0.0726 -0.1213 0.1479  292 ASP A C     
2339 O O     . ASP A 292 ? 0.6527 0.8838 0.6963 -0.0784 -0.1175 0.1504  292 ASP A O     
2340 C CB    . ASP A 292 ? 0.6381 0.9145 0.6810 -0.1014 -0.1374 0.1837  292 ASP A CB    
2341 C CG    . ASP A 292 ? 0.6533 0.9488 0.6730 -0.0977 -0.1237 0.1622  292 ASP A CG    
2342 O OD1   . ASP A 292 ? 0.6793 0.9571 0.6933 -0.0832 -0.1102 0.1364  292 ASP A OD1   
2343 O OD2   . ASP A 292 ? 0.6558 0.9854 0.6647 -0.1099 -0.1277 0.1715  292 ASP A OD2   
2344 N N     . LEU A 293 ? 0.6122 0.8053 0.6691 -0.0572 -0.1129 0.1267  293 LEU A N     
2345 C CA    . LEU A 293 ? 0.6008 0.7797 0.6504 -0.0463 -0.0995 0.1064  293 LEU A CA    
2346 C C     . LEU A 293 ? 0.5826 0.7811 0.6078 -0.0466 -0.0857 0.0917  293 LEU A C     
2347 O O     . LEU A 293 ? 0.5447 0.7353 0.5645 -0.0402 -0.0764 0.0785  293 LEU A O     
2348 C CB    . LEU A 293 ? 0.6282 0.7943 0.6897 -0.0467 -0.1041 0.1129  293 LEU A CB    
2349 C CG    . LEU A 293 ? 0.6390 0.7858 0.7316 -0.0465 -0.1206 0.1261  293 LEU A CG    
2350 C CD1   . LEU A 293 ? 0.6380 0.7741 0.7414 -0.0469 -0.1243 0.1296  293 LEU A CD1   
2351 C CD2   . LEU A 293 ? 0.6178 0.7429 0.7266 -0.0332 -0.1203 0.1113  293 LEU A CD2   
2352 N N     . ASP A 294 ? 0.5620 0.7864 0.5752 -0.0533 -0.0850 0.0922  294 ASP A N     
2353 C CA    . ASP A 294 ? 0.5861 0.8268 0.5829 -0.0505 -0.0730 0.0722  294 ASP A CA    
2354 C C     . ASP A 294 ? 0.5762 0.7919 0.5779 -0.0368 -0.0667 0.0545  294 ASP A C     
2355 O O     . ASP A 294 ? 0.5648 0.7618 0.5784 -0.0322 -0.0714 0.0584  294 ASP A O     
2356 C CB    . ASP A 294 ? 0.6370 0.9145 0.6223 -0.0612 -0.0751 0.0750  294 ASP A CB    
2357 C CG    . ASP A 294 ? 0.6929 1.0000 0.6637 -0.0625 -0.0650 0.0558  294 ASP A CG    
2358 O OD1   . ASP A 294 ? 0.7161 1.0107 0.6875 -0.0534 -0.0565 0.0389  294 ASP A OD1   
2359 O OD2   . ASP A 294 ? 0.7161 1.0619 0.6767 -0.0729 -0.0663 0.0569  294 ASP A OD2   
2360 N N     . ILE A 295 ? 0.5617 0.7785 0.5569 -0.0309 -0.0570 0.0359  295 ILE A N     
2361 C CA    . ILE A 295 ? 0.5368 0.7337 0.5374 -0.0203 -0.0521 0.0218  295 ILE A CA    
2362 C C     . ILE A 295 ? 0.5403 0.7537 0.5370 -0.0202 -0.0497 0.0081  295 ILE A C     
2363 O O     . ILE A 295 ? 0.5549 0.7879 0.5458 -0.0222 -0.0459 -0.0033 295 ILE A O     
2364 C CB    . ILE A 295 ? 0.5264 0.7076 0.5288 -0.0133 -0.0456 0.0125  295 ILE A CB    
2365 C CG1   . ILE A 295 ? 0.5249 0.6905 0.5327 -0.0127 -0.0481 0.0230  295 ILE A CG1   
2366 C CG2   . ILE A 295 ? 0.5281 0.6931 0.5370 -0.0050 -0.0422 0.0020  295 ILE A CG2   
2367 C CD1   . ILE A 295 ? 0.5286 0.7067 0.5310 -0.0197 -0.0490 0.0303  295 ILE A CD1   
2368 N N     . VAL A 296 ? 0.5071 0.7136 0.5092 -0.0177 -0.0525 0.0078  296 VAL A N     
2369 C CA    . VAL A 296 ? 0.4797 0.6968 0.4823 -0.0163 -0.0515 -0.0061 296 VAL A CA    
2370 C C     . VAL A 296 ? 0.4551 0.6488 0.4685 -0.0075 -0.0493 -0.0138 296 VAL A C     
2371 O O     . VAL A 296 ? 0.4413 0.6163 0.4605 -0.0040 -0.0499 -0.0057 296 VAL A O     
2372 C CB    . VAL A 296 ? 0.5254 0.7553 0.5266 -0.0218 -0.0579 0.0016  296 VAL A CB    
2373 C CG1   . VAL A 296 ? 0.5493 0.7930 0.5515 -0.0208 -0.0574 -0.0149 296 VAL A CG1   
2374 C CG2   . VAL A 296 ? 0.5546 0.8092 0.5465 -0.0332 -0.0627 0.0159  296 VAL A CG2   
2375 N N     . SER A 297 ? 0.4146 0.6117 0.4333 -0.0044 -0.0476 -0.0294 297 SER A N     
2376 C CA    . SER A 297 ? 0.3950 0.5731 0.4260 0.0015  -0.0477 -0.0331 297 SER A CA    
2377 C C     . SER A 297 ? 0.3659 0.5519 0.4065 0.0025  -0.0509 -0.0472 297 SER A C     
2378 O O     . SER A 297 ? 0.3505 0.5561 0.3906 0.0008  -0.0515 -0.0607 297 SER A O     
2379 C CB    . SER A 297 ? 0.4007 0.5636 0.4362 0.0055  -0.0442 -0.0342 297 SER A CB    
2380 O OG    . SER A 297 ? 0.4447 0.6119 0.4889 0.0073  -0.0446 -0.0485 297 SER A OG    
2381 N N     . ARG A 298 ? 0.3312 0.5046 0.3823 0.0048  -0.0534 -0.0447 298 ARG A N     
2382 C CA    . ARG A 298 ? 0.3362 0.5125 0.4016 0.0060  -0.0582 -0.0569 298 ARG A CA    
2383 C C     . ARG A 298 ? 0.3178 0.4751 0.3987 0.0088  -0.0600 -0.0529 298 ARG A C     
2384 O O     . ARG A 298 ? 0.3237 0.4705 0.4017 0.0089  -0.0575 -0.0396 298 ARG A O     
2385 C CB    . ARG A 298 ? 0.3486 0.5344 0.4119 0.0034  -0.0619 -0.0552 298 ARG A CB    
2386 C CG    . ARG A 298 ? 0.3699 0.5803 0.4187 -0.0018 -0.0620 -0.0572 298 ARG A CG    
2387 C CD    . ARG A 298 ? 0.3846 0.6170 0.4369 -0.0023 -0.0630 -0.0786 298 ARG A CD    
2388 N NE    . ARG A 298 ? 0.3981 0.6619 0.4346 -0.0094 -0.0627 -0.0797 298 ARG A NE    
2389 C CZ    . ARG A 298 ? 0.4015 0.6791 0.4245 -0.0137 -0.0589 -0.0746 298 ARG A CZ    
2390 N NH1   . ARG A 298 ? 0.3970 0.6578 0.4201 -0.0105 -0.0547 -0.0693 298 ARG A NH1   
2391 N NH2   . ARG A 298 ? 0.4170 0.7282 0.4264 -0.0223 -0.0598 -0.0734 298 ARG A NH2   
2392 N N     . GLY A 299 ? 0.3009 0.4562 0.4005 0.0104  -0.0654 -0.0643 299 GLY A N     
2393 C CA    . GLY A 299 ? 0.3073 0.4469 0.4235 0.0107  -0.0690 -0.0569 299 GLY A CA    
2394 C C     . GLY A 299 ? 0.3131 0.4501 0.4554 0.0109  -0.0789 -0.0656 299 GLY A C     
2395 O O     . GLY A 299 ? 0.3277 0.4754 0.4770 0.0121  -0.0830 -0.0819 299 GLY A O     
2396 N N     . ARG A 300 ? 0.3243 0.4490 0.4826 0.0090  -0.0838 -0.0544 300 ARG A N     
2397 C CA    . ARG A 300 ? 0.3637 0.4834 0.5522 0.0081  -0.0959 -0.0589 300 ARG A CA    
2398 C C     . ARG A 300 ? 0.3692 0.4776 0.5748 0.0046  -0.1016 -0.0445 300 ARG A C     
2399 O O     . ARG A 300 ? 0.3845 0.4920 0.5758 0.0014  -0.0953 -0.0273 300 ARG A O     
2400 C CB    . ARG A 300 ? 0.3879 0.5101 0.5778 0.0055  -0.0981 -0.0527 300 ARG A CB    
2401 C CG    . ARG A 300 ? 0.4191 0.5347 0.6423 0.0030  -0.1119 -0.0527 300 ARG A CG    
2402 C CD    . ARG A 300 ? 0.4551 0.5753 0.6776 0.0008  -0.1133 -0.0487 300 ARG A CD    
2403 N NE    . ARG A 300 ? 0.5120 0.6265 0.7690 -0.0016 -0.1281 -0.0505 300 ARG A NE    
2404 C CZ    . ARG A 300 ? 0.5526 0.6697 0.8168 -0.0042 -0.1324 -0.0476 300 ARG A CZ    
2405 N NH1   . ARG A 300 ? 0.5636 0.6894 0.8032 -0.0043 -0.1233 -0.0428 300 ARG A NH1   
2406 N NH2   . ARG A 300 ? 0.6125 0.7231 0.9117 -0.0067 -0.1475 -0.0489 300 ARG A NH2   
2407 N N     . THR A 301 ? 0.3901 0.4918 0.6284 0.0049  -0.1146 -0.0520 301 THR A N     
2408 C CA    . THR A 301 ? 0.4031 0.4946 0.6647 -0.0003 -0.1243 -0.0357 301 THR A CA    
2409 C C     . THR A 301 ? 0.4241 0.5114 0.7152 -0.0049 -0.1380 -0.0294 301 THR A C     
2410 O O     . THR A 301 ? 0.4253 0.5130 0.7338 -0.0012 -0.1452 -0.0473 301 THR A O     
2411 C CB    . THR A 301 ? 0.4151 0.5005 0.6982 0.0034  -0.1315 -0.0479 301 THR A CB    
2412 O OG1   . THR A 301 ? 0.4069 0.4985 0.6615 0.0078  -0.1183 -0.0560 301 THR A OG1   
2413 C CG2   . THR A 301 ? 0.4169 0.4923 0.7228 -0.0034 -0.1424 -0.0268 301 THR A CG2   
2414 N N     . PHE A 302 ? 0.4391 0.5257 0.7355 -0.0138 -0.1416 -0.0038 302 PHE A N     
2415 C CA    . PHE A 302 ? 0.4479 0.5316 0.7746 -0.0205 -0.1560 0.0075  302 PHE A CA    
2416 C C     . PHE A 302 ? 0.4933 0.5668 0.8589 -0.0261 -0.1739 0.0187  302 PHE A C     
2417 O O     . PHE A 302 ? 0.5043 0.5759 0.8656 -0.0269 -0.1722 0.0248  302 PHE A O     
2418 C CB    . PHE A 302 ? 0.4420 0.5377 0.7510 -0.0288 -0.1491 0.0309  302 PHE A CB    
2419 C CG    . PHE A 302 ? 0.4447 0.5492 0.7241 -0.0241 -0.1353 0.0219  302 PHE A CG    
2420 C CD1   . PHE A 302 ? 0.4335 0.5439 0.6777 -0.0191 -0.1190 0.0170  302 PHE A CD1   
2421 C CD2   . PHE A 302 ? 0.4506 0.5571 0.7402 -0.0248 -0.1402 0.0191  302 PHE A CD2   
2422 C CE1   . PHE A 302 ? 0.4439 0.5616 0.6653 -0.0153 -0.1088 0.0106  302 PHE A CE1   
2423 C CE2   . PHE A 302 ? 0.4704 0.5851 0.7345 -0.0208 -0.1288 0.0121  302 PHE A CE2   
2424 C CZ    . PHE A 302 ? 0.4509 0.5711 0.6820 -0.0162 -0.1137 0.0085  302 PHE A CZ    
2425 N N     . PRO A 303 ? 0.5238 0.5904 0.9295 -0.0306 -0.1926 0.0227  303 PRO A N     
2426 C CA    . PRO A 303 ? 0.5587 0.6154 1.0084 -0.0387 -0.2138 0.0397  303 PRO A CA    
2427 C C     . PRO A 303 ? 0.5642 0.6318 1.0112 -0.0544 -0.2164 0.0782  303 PRO A C     
2428 O O     . PRO A 303 ? 0.6116 0.6744 1.0987 -0.0648 -0.2371 0.0984  303 PRO A O     
2429 C CB    . PRO A 303 ? 0.5583 0.6048 1.0531 -0.0365 -0.2330 0.0255  303 PRO A CB    
2430 C CG    . PRO A 303 ? 0.5465 0.6027 1.0157 -0.0342 -0.2214 0.0179  303 PRO A CG    
2431 C CD    . PRO A 303 ? 0.5294 0.5969 0.9442 -0.0280 -0.1962 0.0100  303 PRO A CD    
2432 N N     . HIS A 304 ? 0.5341 0.6187 0.9367 -0.0568 -0.1967 0.0879  304 HIS A N     
2433 C CA    . HIS A 304 ? 0.5175 0.6210 0.9133 -0.0718 -0.1963 0.1208  304 HIS A CA    
2434 C C     . HIS A 304 ? 0.4802 0.6012 0.8264 -0.0693 -0.1724 0.1197  304 HIS A C     
2435 O O     . HIS A 304 ? 0.4362 0.5514 0.7569 -0.0567 -0.1585 0.0963  304 HIS A O     
2436 C CB    . HIS A 304 ? 0.5484 0.6603 0.9593 -0.0801 -0.2036 0.1338  304 HIS A CB    
2437 C CG    . HIS A 304 ? 0.5956 0.7107 0.9814 -0.0708 -0.1892 0.1141  304 HIS A CG    
2438 N ND1   . HIS A 304 ? 0.6121 0.7114 1.0042 -0.0582 -0.1904 0.0851  304 HIS A ND1   
2439 C CD2   . HIS A 304 ? 0.6051 0.7397 0.9610 -0.0725 -0.1739 0.1189  304 HIS A CD2   
2440 C CE1   . HIS A 304 ? 0.6113 0.7191 0.9777 -0.0536 -0.1773 0.0757  304 HIS A CE1   
2441 N NE2   . HIS A 304 ? 0.6116 0.7392 0.9574 -0.0615 -0.1674 0.0955  304 HIS A NE2   
2442 N N     . GLY A 305 ? 0.4543 0.5993 0.7892 -0.0818 -0.1687 0.1447  305 GLY A N     
2443 C CA    . GLY A 305 ? 0.4332 0.5976 0.7267 -0.0799 -0.1480 0.1425  305 GLY A CA    
2444 C C     . GLY A 305 ? 0.4110 0.5803 0.6817 -0.0713 -0.1336 0.1259  305 GLY A C     
2445 O O     . GLY A 305 ? 0.3787 0.5464 0.6635 -0.0723 -0.1393 0.1257  305 GLY A O     
2446 N N     . ILE A 306 ? 0.3918 0.5664 0.6300 -0.0631 -0.1164 0.1125  306 ILE A N     
2447 C CA    . ILE A 306 ? 0.3872 0.5678 0.6048 -0.0553 -0.1035 0.0985  306 ILE A CA    
2448 C C     . ILE A 306 ? 0.3574 0.5694 0.5578 -0.0614 -0.0924 0.1081  306 ILE A C     
2449 O O     . ILE A 306 ? 0.3619 0.5842 0.5456 -0.0612 -0.0842 0.1075  306 ILE A O     
2450 C CB    . ILE A 306 ? 0.3804 0.5449 0.5782 -0.0415 -0.0940 0.0756  306 ILE A CB    
2451 C CG1   . ILE A 306 ? 0.4014 0.5422 0.6161 -0.0358 -0.1039 0.0631  306 ILE A CG1   
2452 C CG2   . ILE A 306 ? 0.3806 0.5497 0.5624 -0.0346 -0.0841 0.0637  306 ILE A CG2   
2453 C CD1   . ILE A 306 ? 0.3886 0.5190 0.5847 -0.0252 -0.0956 0.0440  306 ILE A CD1   
2454 N N     . SER A 307 ? 0.3388 0.5687 0.5446 -0.0670 -0.0923 0.1153  307 SER A N     
2455 C CA    . SER A 307 ? 0.3265 0.5900 0.5165 -0.0702 -0.0801 0.1173  307 SER A CA    
2456 C C     . SER A 307 ? 0.3206 0.5780 0.4904 -0.0558 -0.0669 0.0939  307 SER A C     
2457 O O     . SER A 307 ? 0.2857 0.5161 0.4539 -0.0456 -0.0680 0.0802  307 SER A O     
2458 C CB    . SER A 307 ? 0.3379 0.6242 0.5415 -0.0800 -0.0838 0.1305  307 SER A CB    
2459 O OG    . SER A 307 ? 0.3465 0.6138 0.5583 -0.0727 -0.0871 0.1203  307 SER A OG    
2460 N N     . LYS A 308 ? 0.3107 0.5955 0.4673 -0.0556 -0.0556 0.0894  308 LYS A N     
2461 C CA    . LYS A 308 ? 0.3131 0.5938 0.4568 -0.0428 -0.0456 0.0690  308 LYS A CA    
2462 C C     . LYS A 308 ? 0.3173 0.5872 0.4677 -0.0368 -0.0473 0.0616  308 LYS A C     
2463 O O     . LYS A 308 ? 0.3178 0.5681 0.4618 -0.0263 -0.0453 0.0480  308 LYS A O     
2464 C CB    . LYS A 308 ? 0.3067 0.6237 0.4426 -0.0441 -0.0350 0.0634  308 LYS A CB    
2465 C CG    . LYS A 308 ? 0.3010 0.6115 0.4287 -0.0306 -0.0271 0.0417  308 LYS A CG    
2466 C CD    . LYS A 308 ? 0.2998 0.6486 0.4251 -0.0309 -0.0178 0.0318  308 LYS A CD    
2467 C CE    . LYS A 308 ? 0.3116 0.6932 0.4479 -0.0351 -0.0154 0.0320  308 LYS A CE    
2468 N NZ    . LYS A 308 ? 0.3071 0.7338 0.4425 -0.0365 -0.0062 0.0202  308 LYS A NZ    
2469 N N     . GLU A 309 ? 0.3215 0.6058 0.4852 -0.0444 -0.0517 0.0721  309 GLU A N     
2470 C CA    . GLU A 309 ? 0.3288 0.6041 0.5003 -0.0397 -0.0545 0.0665  309 GLU A CA    
2471 C C     . GLU A 309 ? 0.3297 0.5699 0.5030 -0.0341 -0.0622 0.0612  309 GLU A C     
2472 O O     . GLU A 309 ? 0.3292 0.5559 0.4973 -0.0252 -0.0608 0.0488  309 GLU A O     
2473 C CB    . GLU A 309 ? 0.3333 0.6296 0.5210 -0.0507 -0.0597 0.0813  309 GLU A CB    
2474 C CG    . GLU A 309 ? 0.3487 0.6316 0.5468 -0.0470 -0.0653 0.0774  309 GLU A CG    
2475 C CD    . GLU A 309 ? 0.3522 0.6614 0.5652 -0.0565 -0.0677 0.0891  309 GLU A CD    
2476 O OE1   . GLU A 309 ? 0.3609 0.7027 0.5765 -0.0672 -0.0651 0.1016  309 GLU A OE1   
2477 O OE2   . GLU A 309 ? 0.3512 0.6514 0.5735 -0.0540 -0.0725 0.0864  309 GLU A OE2   
2478 N N     . THR A 310 ? 0.3174 0.5457 0.5004 -0.0398 -0.0714 0.0704  310 THR A N     
2479 C CA    . THR A 310 ? 0.3112 0.5111 0.4987 -0.0346 -0.0789 0.0620  310 THR A CA    
2480 C C     . THR A 310 ? 0.2958 0.4832 0.4642 -0.0246 -0.0716 0.0472  310 THR A C     
2481 O O     . THR A 310 ? 0.3041 0.4777 0.4691 -0.0181 -0.0730 0.0357  310 THR A O     
2482 C CB    . THR A 310 ? 0.3205 0.5108 0.5265 -0.0417 -0.0910 0.0724  310 THR A CB    
2483 O OG1   . THR A 310 ? 0.3270 0.5281 0.5544 -0.0521 -0.1003 0.0883  310 THR A OG1   
2484 C CG2   . THR A 310 ? 0.3245 0.4899 0.5378 -0.0349 -0.0984 0.0584  310 THR A CG2   
2485 N N     . ALA A 311 ? 0.2703 0.4650 0.4266 -0.0242 -0.0642 0.0481  311 ALA A N     
2486 C CA    . ALA A 311 ? 0.2623 0.4459 0.4022 -0.0158 -0.0581 0.0360  311 ALA A CA    
2487 C C     . ALA A 311 ? 0.2542 0.4376 0.3870 -0.0086 -0.0537 0.0262  311 ALA A C     
2488 O O     . ALA A 311 ? 0.2601 0.4299 0.3853 -0.0031 -0.0541 0.0179  311 ALA A O     
2489 C CB    . ALA A 311 ? 0.2580 0.4516 0.3883 -0.0171 -0.0516 0.0384  311 ALA A CB    
2490 N N     . TYR A 312 ? 0.2441 0.4453 0.3809 -0.0094 -0.0502 0.0278  312 TYR A N     
2491 C CA    . TYR A 312 ? 0.2439 0.4457 0.3800 -0.0032 -0.0484 0.0200  312 TYR A CA    
2492 C C     . TYR A 312 ? 0.2521 0.4398 0.3916 -0.0023 -0.0557 0.0185  312 TYR A C     
2493 O O     . TYR A 312 ? 0.2531 0.4302 0.3856 0.0024  -0.0568 0.0123  312 TYR A O     
2494 C CB    . TYR A 312 ? 0.2412 0.4676 0.3865 -0.0049 -0.0448 0.0210  312 TYR A CB    
2495 C CG    . TYR A 312 ? 0.2365 0.4847 0.3796 -0.0043 -0.0367 0.0167  312 TYR A CG    
2496 C CD1   . TYR A 312 ? 0.2390 0.4799 0.3735 0.0016  -0.0331 0.0082  312 TYR A CD1   
2497 C CD2   . TYR A 312 ? 0.2388 0.5184 0.3896 -0.0101 -0.0330 0.0199  312 TYR A CD2   
2498 C CE1   . TYR A 312 ? 0.2399 0.5026 0.3745 0.0026  -0.0263 0.0012  312 TYR A CE1   
2499 C CE2   . TYR A 312 ? 0.2371 0.5429 0.3865 -0.0097 -0.0253 0.0127  312 TYR A CE2   
2500 C CZ    . TYR A 312 ? 0.2404 0.5370 0.3823 -0.0028 -0.0222 0.0022  312 TYR A CZ    
2501 O OH    . TYR A 312 ? 0.2440 0.5680 0.3862 -0.0020 -0.0152 -0.0079 312 TYR A OH    
2502 N N     . SER A 313 ? 0.2550 0.4449 0.4062 -0.0079 -0.0614 0.0246  313 SER A N     
2503 C CA    . SER A 313 ? 0.2629 0.4437 0.4199 -0.0074 -0.0688 0.0214  313 SER A CA    
2504 C C     . SER A 313 ? 0.2640 0.4296 0.4135 -0.0046 -0.0717 0.0132  313 SER A C     
2505 O O     . SER A 313 ? 0.2405 0.4027 0.3838 -0.0014 -0.0733 0.0064  313 SER A O     
2506 C CB    . SER A 313 ? 0.2706 0.4555 0.4452 -0.0145 -0.0760 0.0296  313 SER A CB    
2507 O OG    . SER A 313 ? 0.3043 0.4809 0.4860 -0.0137 -0.0837 0.0240  313 SER A OG    
2508 N N     . GLU A 314 ? 0.2727 0.4324 0.4231 -0.0062 -0.0725 0.0140  314 GLU A N     
2509 C CA    . GLU A 314 ? 0.2818 0.4309 0.4285 -0.0036 -0.0754 0.0041  314 GLU A CA    
2510 C C     . GLU A 314 ? 0.2732 0.4211 0.4009 0.0010  -0.0689 -0.0010 314 GLU A C     
2511 O O     . GLU A 314 ? 0.2834 0.4299 0.4047 0.0028  -0.0706 -0.0097 314 GLU A O     
2512 C CB    . GLU A 314 ? 0.3127 0.4558 0.4698 -0.0065 -0.0793 0.0066  314 GLU A CB    
2513 C CG    . GLU A 314 ? 0.3490 0.4837 0.5099 -0.0036 -0.0843 -0.0068 314 GLU A CG    
2514 C CD    . GLU A 314 ? 0.3897 0.5251 0.5626 -0.0031 -0.0923 -0.0175 314 GLU A CD    
2515 O OE1   . GLU A 314 ? 0.3968 0.5336 0.5845 -0.0066 -0.0982 -0.0116 314 GLU A OE1   
2516 O OE2   . GLU A 314 ? 0.4166 0.5540 0.5838 0.0003  -0.0926 -0.0324 314 GLU A OE2   
2517 N N     . SER A 315 ? 0.2543 0.4057 0.3746 0.0022  -0.0621 0.0039  315 SER A N     
2518 C CA    . SER A 315 ? 0.2456 0.3946 0.3521 0.0061  -0.0578 0.0006  315 SER A CA    
2519 C C     . SER A 315 ? 0.2452 0.3961 0.3486 0.0074  -0.0607 -0.0014 315 SER A C     
2520 O O     . SER A 315 ? 0.2286 0.3784 0.3223 0.0079  -0.0615 -0.0042 315 SER A O     
2521 C CB    . SER A 315 ? 0.2375 0.3912 0.3414 0.0077  -0.0515 0.0038  315 SER A CB    
2522 O OG    . SER A 315 ? 0.2378 0.4014 0.3491 0.0087  -0.0505 0.0054  315 SER A OG    
2523 N N     . VAL A 316 ? 0.2539 0.4103 0.3662 0.0068  -0.0630 0.0014  316 VAL A N     
2524 C CA    . VAL A 316 ? 0.2660 0.4252 0.3774 0.0074  -0.0672 0.0015  316 VAL A CA    
2525 C C     . VAL A 316 ? 0.2692 0.4299 0.3756 0.0049  -0.0722 -0.0038 316 VAL A C     
2526 O O     . VAL A 316 ? 0.2512 0.4161 0.3493 0.0038  -0.0747 -0.0032 316 VAL A O     
2527 C CB    . VAL A 316 ? 0.2695 0.4352 0.3934 0.0075  -0.0689 0.0049  316 VAL A CB    
2528 C CG1   . VAL A 316 ? 0.2798 0.4482 0.4043 0.0069  -0.0753 0.0061  316 VAL A CG1   
2529 C CG2   . VAL A 316 ? 0.2691 0.4393 0.3984 0.0109  -0.0639 0.0062  316 VAL A CG2   
2530 N N     . LYS A 317 ? 0.2859 0.4454 0.3991 0.0033  -0.0747 -0.0091 317 LYS A N     
2531 C CA    . LYS A 317 ? 0.3189 0.4835 0.4309 0.0016  -0.0798 -0.0193 317 LYS A CA    
2532 C C     . LYS A 317 ? 0.3184 0.4858 0.4177 0.0019  -0.0771 -0.0253 317 LYS A C     
2533 O O     . LYS A 317 ? 0.3283 0.5078 0.4191 -0.0002 -0.0793 -0.0310 317 LYS A O     
2534 C CB    . LYS A 317 ? 0.3490 0.5103 0.4781 0.0006  -0.0850 -0.0253 317 LYS A CB    
2535 C CG    . LYS A 317 ? 0.3756 0.5355 0.5181 -0.0010 -0.0870 -0.0161 317 LYS A CG    
2536 C CD    . LYS A 317 ? 0.4047 0.5654 0.5650 -0.0032 -0.0959 -0.0218 317 LYS A CD    
2537 C CE    . LYS A 317 ? 0.4211 0.5738 0.5992 -0.0046 -0.1009 -0.0236 317 LYS A CE    
2538 N NZ    . LYS A 317 ? 0.4370 0.5886 0.6366 -0.0088 -0.1081 -0.0157 317 LYS A NZ    
2539 N N     . LEU A 318 ? 0.2990 0.4582 0.3964 0.0037  -0.0723 -0.0233 318 LEU A N     
2540 C CA    . LEU A 318 ? 0.2995 0.4612 0.3856 0.0040  -0.0692 -0.0279 318 LEU A CA    
2541 C C     . LEU A 318 ? 0.3010 0.4681 0.3732 0.0027  -0.0675 -0.0202 318 LEU A C     
2542 O O     . LEU A 318 ? 0.3095 0.4880 0.3713 0.0000  -0.0679 -0.0235 318 LEU A O     
2543 C CB    . LEU A 318 ? 0.2914 0.4423 0.3805 0.0060  -0.0653 -0.0263 318 LEU A CB    
2544 C CG    . LEU A 318 ? 0.2899 0.4351 0.3968 0.0058  -0.0697 -0.0308 318 LEU A CG    
2545 C CD1   . LEU A 318 ? 0.2927 0.4293 0.4023 0.0060  -0.0666 -0.0239 318 LEU A CD1   
2546 C CD2   . LEU A 318 ? 0.3007 0.4517 0.4145 0.0064  -0.0744 -0.0470 318 LEU A CD2   
2547 N N     . LEU A 319 ? 0.2969 0.4584 0.3716 0.0040  -0.0669 -0.0100 319 LEU A N     
2548 C CA    . LEU A 319 ? 0.3022 0.4670 0.3712 0.0025  -0.0689 -0.0013 319 LEU A CA    
2549 C C     . LEU A 319 ? 0.3097 0.4883 0.3757 -0.0024 -0.0755 0.0007  319 LEU A C     
2550 O O     . LEU A 319 ? 0.2925 0.4814 0.3498 -0.0072 -0.0786 0.0066  319 LEU A O     
2551 C CB    . LEU A 319 ? 0.3026 0.4593 0.3816 0.0061  -0.0683 0.0054  319 LEU A CB    
2552 C CG    . LEU A 319 ? 0.3114 0.4688 0.3939 0.0054  -0.0737 0.0147  319 LEU A CG    
2553 C CD1   . LEU A 319 ? 0.3117 0.4680 0.3858 0.0034  -0.0736 0.0184  319 LEU A CD1   
2554 C CD2   . LEU A 319 ? 0.3123 0.4641 0.4107 0.0107  -0.0734 0.0154  319 LEU A CD2   
2555 N N     . GLN A 320 ? 0.3136 0.4949 0.3870 -0.0025 -0.0784 -0.0031 320 GLN A N     
2556 C CA    . GLN A 320 ? 0.3439 0.5410 0.4137 -0.0077 -0.0849 -0.0028 320 GLN A CA    
2557 C C     . GLN A 320 ? 0.3602 0.5751 0.4178 -0.0119 -0.0846 -0.0126 320 GLN A C     
2558 O O     . GLN A 320 ? 0.3555 0.5891 0.4031 -0.0185 -0.0884 -0.0077 320 GLN A O     
2559 C CB    . GLN A 320 ? 0.3527 0.5494 0.4338 -0.0067 -0.0881 -0.0072 320 GLN A CB    
2560 C CG    . GLN A 320 ? 0.3696 0.5575 0.4625 -0.0041 -0.0894 0.0027  320 GLN A CG    
2561 C CD    . GLN A 320 ? 0.3832 0.5703 0.4887 -0.0033 -0.0916 -0.0007 320 GLN A CD    
2562 O OE1   . GLN A 320 ? 0.3951 0.5783 0.5064 -0.0023 -0.0900 -0.0083 320 GLN A OE1   
2563 N NE2   . GLN A 320 ? 0.3889 0.5795 0.5015 -0.0041 -0.0966 0.0061  320 GLN A NE2   
2564 N N     . LYS A 321 ? 0.3604 0.5719 0.4209 -0.0087 -0.0808 -0.0262 321 LYS A N     
2565 C CA    . LYS A 321 ? 0.3941 0.6248 0.4472 -0.0114 -0.0801 -0.0402 321 LYS A CA    
2566 C C     . LYS A 321 ? 0.3849 0.6268 0.4226 -0.0158 -0.0777 -0.0323 321 LYS A C     
2567 O O     . LYS A 321 ? 0.3715 0.6407 0.3986 -0.0226 -0.0796 -0.0350 321 LYS A O     
2568 C CB    . LYS A 321 ? 0.4072 0.6278 0.4724 -0.0060 -0.0779 -0.0552 321 LYS A CB    
2569 C CG    . LYS A 321 ? 0.4469 0.6889 0.5135 -0.0069 -0.0792 -0.0766 321 LYS A CG    
2570 C CD    . LYS A 321 ? 0.4615 0.6896 0.5474 -0.0010 -0.0800 -0.0903 321 LYS A CD    
2571 C CE    . LYS A 321 ? 0.4826 0.7307 0.5692 -0.0005 -0.0789 -0.1108 321 LYS A CE    
2572 N NZ    . LYS A 321 ? 0.5093 0.7887 0.5959 -0.0035 -0.0828 -0.1295 321 LYS A NZ    
2573 N N     . ILE A 322 ? 0.3747 0.5984 0.4122 -0.0129 -0.0739 -0.0222 322 ILE A N     
2574 C CA    . ILE A 322 ? 0.3793 0.6093 0.4061 -0.0173 -0.0732 -0.0110 322 ILE A CA    
2575 C C     . ILE A 322 ? 0.4050 0.6495 0.4269 -0.0253 -0.0806 0.0049  322 ILE A C     
2576 O O     . ILE A 322 ? 0.3935 0.6603 0.4043 -0.0337 -0.0826 0.0111  322 ILE A O     
2577 C CB    . ILE A 322 ? 0.3894 0.5948 0.4211 -0.0119 -0.0697 -0.0028 322 ILE A CB    
2578 C CG1   . ILE A 322 ? 0.3824 0.5779 0.4165 -0.0066 -0.0633 -0.0150 322 ILE A CG1   
2579 C CG2   . ILE A 322 ? 0.3973 0.6064 0.4228 -0.0168 -0.0718 0.0113  322 ILE A CG2   
2580 C CD1   . ILE A 322 ? 0.3758 0.5498 0.4156 -0.0013 -0.0597 -0.0093 322 ILE A CD1   
2581 N N     . LEU A 323 ? 0.4262 0.6600 0.4580 -0.0237 -0.0854 0.0129  323 LEU A N     
2582 C CA    . LEU A 323 ? 0.4309 0.6754 0.4632 -0.0311 -0.0947 0.0300  323 LEU A CA    
2583 C C     . LEU A 323 ? 0.4532 0.7298 0.4747 -0.0400 -0.0987 0.0265  323 LEU A C     
2584 O O     . LEU A 323 ? 0.4469 0.7441 0.4620 -0.0504 -0.1059 0.0415  323 LEU A O     
2585 C CB    . LEU A 323 ? 0.4155 0.6409 0.4646 -0.0258 -0.0989 0.0365  323 LEU A CB    
2586 C CG    . LEU A 323 ? 0.4027 0.6053 0.4642 -0.0196 -0.0980 0.0431  323 LEU A CG    
2587 C CD1   . LEU A 323 ? 0.3845 0.5733 0.4645 -0.0133 -0.1005 0.0440  323 LEU A CD1   
2588 C CD2   . LEU A 323 ? 0.4059 0.6126 0.4684 -0.0261 -0.1057 0.0601  323 LEU A CD2   
2589 N N     . GLU A 324 ? 0.4677 0.7503 0.4889 -0.0367 -0.0950 0.0068  324 GLU A N     
2590 C CA    . GLU A 324 ? 0.4998 0.8166 0.5120 -0.0441 -0.0980 -0.0027 324 GLU A CA    
2591 C C     . GLU A 324 ? 0.5012 0.8484 0.4981 -0.0516 -0.0952 -0.0068 324 GLU A C     
2592 O O     . GLU A 324 ? 0.5303 0.9128 0.5159 -0.0629 -0.0999 -0.0016 324 GLU A O     
2593 C CB    . GLU A 324 ? 0.5148 0.8288 0.5358 -0.0375 -0.0958 -0.0261 324 GLU A CB    
2594 C CG    . GLU A 324 ? 0.5367 0.8398 0.5688 -0.0355 -0.1013 -0.0226 324 GLU A CG    
2595 C CD    . GLU A 324 ? 0.5591 0.8480 0.6063 -0.0276 -0.0997 -0.0412 324 GLU A CD    
2596 O OE1   . GLU A 324 ? 0.5512 0.8391 0.6022 -0.0235 -0.0956 -0.0580 324 GLU A OE1   
2597 O OE2   . GLU A 324 ? 0.5640 0.8426 0.6220 -0.0257 -0.1037 -0.0379 324 GLU A OE2   
2598 N N     . GLU A 325 ? 0.4854 0.8216 0.4823 -0.0462 -0.0878 -0.0149 325 GLU A N     
2599 C CA    . GLU A 325 ? 0.4972 0.8640 0.4827 -0.0512 -0.0835 -0.0259 325 GLU A CA    
2600 C C     . GLU A 325 ? 0.5338 0.9071 0.5096 -0.0585 -0.0834 -0.0064 325 GLU A C     
2601 O O     . GLU A 325 ? 0.6040 1.0081 0.5693 -0.0646 -0.0801 -0.0132 325 GLU A O     
2602 C CB    . GLU A 325 ? 0.4594 0.8135 0.4542 -0.0407 -0.0764 -0.0506 325 GLU A CB    
2603 C CG    . GLU A 325 ? 0.4428 0.7955 0.4509 -0.0349 -0.0783 -0.0720 325 GLU A CG    
2604 C CD    . GLU A 325 ? 0.4277 0.7618 0.4518 -0.0246 -0.0747 -0.0920 325 GLU A CD    
2605 O OE1   . GLU A 325 ? 0.4372 0.7625 0.4603 -0.0220 -0.0697 -0.0915 325 GLU A OE1   
2606 O OE2   . GLU A 325 ? 0.4079 0.7358 0.4481 -0.0197 -0.0783 -0.1074 325 GLU A OE2   
2607 N N     . ASP A 326 ? 0.5442 0.8902 0.5261 -0.0578 -0.0876 0.0161  326 ASP A N     
2608 C CA    . ASP A 326 ? 0.5342 0.8840 0.5117 -0.0653 -0.0905 0.0369  326 ASP A CA    
2609 C C     . ASP A 326 ? 0.5581 0.8969 0.5448 -0.0701 -0.1021 0.0625  326 ASP A C     
2610 O O     . ASP A 326 ? 0.5381 0.8460 0.5390 -0.0610 -0.1036 0.0630  326 ASP A O     
2611 C CB    . ASP A 326 ? 0.5392 0.8592 0.5222 -0.0561 -0.0837 0.0333  326 ASP A CB    
2612 C CG    . ASP A 326 ? 0.5515 0.8790 0.5303 -0.0642 -0.0864 0.0513  326 ASP A CG    
2613 O OD1   . ASP A 326 ? 0.5591 0.8823 0.5445 -0.0708 -0.0965 0.0753  326 ASP A OD1   
2614 O OD2   . ASP A 326 ? 0.5702 0.9073 0.5420 -0.0640 -0.0793 0.0417  326 ASP A OD2   
2615 N N     . GLU A 327 ? 0.5839 0.9504 0.5646 -0.0850 -0.1111 0.0840  327 GLU A N     
2616 C CA    . GLU A 327 ? 0.6234 0.9873 0.6153 -0.0923 -0.1255 0.1096  327 GLU A CA    
2617 C C     . GLU A 327 ? 0.6032 0.9375 0.6137 -0.0906 -0.1333 0.1295  327 GLU A C     
2618 O O     . GLU A 327 ? 0.6184 0.9422 0.6463 -0.0935 -0.1465 0.1487  327 GLU A O     
2619 C CB    . GLU A 327 ? 0.6909 1.1038 0.6695 -0.1118 -0.1342 0.1263  327 GLU A CB    
2620 C CG    . GLU A 327 ? 0.7422 1.1928 0.7036 -0.1152 -0.1282 0.1051  327 GLU A CG    
2621 C CD    . GLU A 327 ? 0.7902 1.2602 0.7380 -0.1118 -0.1144 0.0783  327 GLU A CD    
2622 O OE1   . GLU A 327 ? 0.8124 1.2760 0.7590 -0.1112 -0.1101 0.0814  327 GLU A OE1   
2623 O OE2   . GLU A 327 ? 0.8439 1.3355 0.7847 -0.1093 -0.1086 0.0529  327 GLU A OE2   
2624 N N     . ARG A 328 ? 0.5985 0.9198 0.6079 -0.0858 -0.1262 0.1243  328 ARG A N     
2625 C CA    . ARG A 328 ? 0.5650 0.8602 0.5937 -0.0842 -0.1341 0.1407  328 ARG A CA    
2626 C C     . ARG A 328 ? 0.5383 0.7946 0.5890 -0.0694 -0.1350 0.1335  328 ARG A C     
2627 O O     . ARG A 328 ? 0.4922 0.7389 0.5400 -0.0593 -0.1260 0.1142  328 ARG A O     
2628 C CB    . ARG A 328 ? 0.5611 0.8540 0.5824 -0.0827 -0.1259 0.1351  328 ARG A CB    
2629 C CG    . ARG A 328 ? 0.5864 0.9206 0.5914 -0.0996 -0.1282 0.1482  328 ARG A CG    
2630 C CD    . ARG A 328 ? 0.5721 0.9086 0.5668 -0.0970 -0.1171 0.1366  328 ARG A CD    
2631 N NE    . ARG A 328 ? 0.5532 0.8898 0.5358 -0.0860 -0.1016 0.1057  328 ARG A NE    
2632 C CZ    . ARG A 328 ? 0.5537 0.8917 0.5287 -0.0817 -0.0911 0.0907  328 ARG A CZ    
2633 N NH1   . ARG A 328 ? 0.5880 0.9285 0.5636 -0.0874 -0.0930 0.1035  328 ARG A NH1   
2634 N NH2   . ARG A 328 ? 0.5372 0.8737 0.5068 -0.0718 -0.0799 0.0637  328 ARG A NH2   
2635 N N     . LYS A 329 ? 0.5267 0.7639 0.6017 -0.0692 -0.1471 0.1495  329 LYS A N     
2636 C CA    . LYS A 329 ? 0.5060 0.7098 0.6047 -0.0548 -0.1474 0.1397  329 LYS A CA    
2637 C C     . LYS A 329 ? 0.4738 0.6619 0.5649 -0.0435 -0.1323 0.1190  329 LYS A C     
2638 O O     . LYS A 329 ? 0.4717 0.6669 0.5500 -0.0475 -0.1276 0.1198  329 LYS A O     
2639 C CB    . LYS A 329 ? 0.5489 0.7386 0.6794 -0.0574 -0.1654 0.1593  329 LYS A CB    
2640 C CG    . LYS A 329 ? 0.5659 0.7683 0.7114 -0.0696 -0.1847 0.1846  329 LYS A CG    
2641 C CD    . LYS A 329 ? 0.5743 0.7608 0.7429 -0.0600 -0.1898 0.1780  329 LYS A CD    
2642 C CE    . LYS A 329 ? 0.6044 0.8010 0.7926 -0.0717 -0.2110 0.2043  329 LYS A CE    
2643 N NZ    . LYS A 329 ? 0.6250 0.8103 0.8469 -0.0771 -0.2312 0.2261  329 LYS A NZ    
2644 N N     . ILE A 330 ? 0.4296 0.5992 0.5288 -0.0304 -0.1250 0.1016  330 ILE A N     
2645 C CA    . ILE A 330 ? 0.3968 0.5531 0.4909 -0.0206 -0.1122 0.0840  330 ILE A CA    
2646 C C     . ILE A 330 ? 0.4063 0.5431 0.5255 -0.0140 -0.1181 0.0841  330 ILE A C     
2647 O O     . ILE A 330 ? 0.3988 0.5276 0.5434 -0.0109 -0.1284 0.0877  330 ILE A O     
2648 C CB    . ILE A 330 ? 0.3777 0.5309 0.4655 -0.0123 -0.1011 0.0659  330 ILE A CB    
2649 C CG1   . ILE A 330 ? 0.3669 0.5392 0.4340 -0.0183 -0.0968 0.0630  330 ILE A CG1   
2650 C CG2   . ILE A 330 ? 0.3608 0.5022 0.4455 -0.0038 -0.0898 0.0511  330 ILE A CG2   
2651 C CD1   . ILE A 330 ? 0.3476 0.5169 0.4109 -0.0116 -0.0880 0.0470  330 ILE A CD1   
2652 N N     . ARG A 331 ? 0.3974 0.5279 0.5117 -0.0116 -0.1123 0.0787  331 ARG A N     
2653 C CA    . ARG A 331 ? 0.3932 0.5075 0.5313 -0.0057 -0.1180 0.0764  331 ARG A CA    
2654 C C     . ARG A 331 ? 0.3599 0.4658 0.4965 0.0057  -0.1053 0.0549  331 ARG A C     
2655 O O     . ARG A 331 ? 0.3521 0.4495 0.5119 0.0138  -0.1085 0.0454  331 ARG A O     
2656 C CB    . ARG A 331 ? 0.4083 0.5236 0.5454 -0.0135 -0.1240 0.0898  331 ARG A CB    
2657 C CG    . ARG A 331 ? 0.4350 0.5335 0.5967 -0.0072 -0.1297 0.0851  331 ARG A CG    
2658 C CD    . ARG A 331 ? 0.4726 0.5718 0.6439 -0.0175 -0.1430 0.1057  331 ARG A CD    
2659 N NE    . ARG A 331 ? 0.4806 0.5665 0.6639 -0.0122 -0.1432 0.0977  331 ARG A NE    
2660 C CZ    . ARG A 331 ? 0.5026 0.5811 0.7096 -0.0172 -0.1584 0.1113  331 ARG A CZ    
2661 N NH1   . ARG A 331 ? 0.5229 0.6064 0.7459 -0.0288 -0.1762 0.1367  331 ARG A NH1   
2662 N NH2   . ARG A 331 ? 0.5166 0.5836 0.7331 -0.0112 -0.1570 0.1004  331 ARG A NH2   
2663 N N     . ARG A 332 ? 0.3473 0.4584 0.4590 0.0058  -0.0921 0.0470  332 ARG A N     
2664 C CA    . ARG A 332 ? 0.3454 0.4528 0.4534 0.0141  -0.0806 0.0299  332 ARG A CA    
2665 C C     . ARG A 332 ? 0.3126 0.4277 0.4045 0.0137  -0.0720 0.0247  332 ARG A C     
2666 O O     . ARG A 332 ? 0.2812 0.4042 0.3582 0.0079  -0.0711 0.0295  332 ARG A O     
2667 C CB    . ARG A 332 ? 0.3632 0.4670 0.4618 0.0148  -0.0744 0.0255  332 ARG A CB    
2668 C CG    . ARG A 332 ? 0.3925 0.4887 0.5058 0.0135  -0.0836 0.0319  332 ARG A CG    
2669 C CD    . ARG A 332 ? 0.3974 0.4908 0.5004 0.0141  -0.0771 0.0272  332 ARG A CD    
2670 N NE    . ARG A 332 ? 0.4424 0.5291 0.5597 0.0111  -0.0874 0.0360  332 ARG A NE    
2671 C CZ    . ARG A 332 ? 0.4661 0.5525 0.5742 0.0074  -0.0856 0.0398  332 ARG A CZ    
2672 N NH1   . ARG A 332 ? 0.4360 0.5280 0.5210 0.0068  -0.0738 0.0344  332 ARG A NH1   
2673 N NH2   . ARG A 332 ? 0.4764 0.5565 0.6015 0.0039  -0.0971 0.0497  332 ARG A NH2   
2674 N N     . ILE A 333 ? 0.3000 0.4152 0.3969 0.0197  -0.0662 0.0139  333 ILE A N     
2675 C CA    . ILE A 333 ? 0.2937 0.4149 0.3796 0.0191  -0.0596 0.0098  333 ILE A CA    
2676 C C     . ILE A 333 ? 0.2863 0.4087 0.3697 0.0228  -0.0508 0.0005  333 ILE A C     
2677 O O     . ILE A 333 ? 0.2847 0.4074 0.3779 0.0270  -0.0497 -0.0057 333 ILE A O     
2678 C CB    . ILE A 333 ? 0.2849 0.4102 0.3811 0.0197  -0.0640 0.0113  333 ILE A CB    
2679 C CG1   . ILE A 333 ? 0.2891 0.4203 0.3751 0.0176  -0.0594 0.0089  333 ILE A CG1   
2680 C CG2   . ILE A 333 ? 0.2818 0.4079 0.3981 0.0262  -0.0648 0.0040  333 ILE A CG2   
2681 C CD1   . ILE A 333 ? 0.3015 0.4365 0.3727 0.0119  -0.0603 0.0122  333 ILE A CD1   
2682 N N     . GLY A 334 ? 0.2872 0.4123 0.3595 0.0205  -0.0458 -0.0007 334 GLY A N     
2683 C CA    . GLY A 334 ? 0.2868 0.4152 0.3571 0.0214  -0.0395 -0.0053 334 GLY A CA    
2684 C C     . GLY A 334 ? 0.2894 0.4189 0.3536 0.0181  -0.0378 -0.0044 334 GLY A C     
2685 O O     . GLY A 334 ? 0.3002 0.4296 0.3631 0.0161  -0.0411 -0.0032 334 GLY A O     
2686 N N     . VAL A 335 ? 0.2861 0.4181 0.3491 0.0170  -0.0341 -0.0050 335 VAL A N     
2687 C CA    . VAL A 335 ? 0.2932 0.4252 0.3570 0.0136  -0.0349 -0.0030 335 VAL A CA    
2688 C C     . VAL A 335 ? 0.2816 0.4118 0.3424 0.0120  -0.0331 -0.0020 335 VAL A C     
2689 O O     . VAL A 335 ? 0.2672 0.4002 0.3245 0.0129  -0.0296 -0.0025 335 VAL A O     
2690 C CB    . VAL A 335 ? 0.3009 0.4421 0.3735 0.0111  -0.0354 0.0004  335 VAL A CB    
2691 C CG1   . VAL A 335 ? 0.3264 0.4675 0.4039 0.0115  -0.0391 -0.0001 335 VAL A CG1   
2692 C CG2   . VAL A 335 ? 0.2946 0.4489 0.3694 0.0118  -0.0310 -0.0002 335 VAL A CG2   
2693 N N     . ARG A 336 ? 0.2930 0.4191 0.3580 0.0097  -0.0365 -0.0015 336 ARG A N     
2694 C CA    . ARG A 336 ? 0.2975 0.4211 0.3645 0.0075  -0.0373 0.0009  336 ARG A CA    
2695 C C     . ARG A 336 ? 0.2994 0.4236 0.3812 0.0032  -0.0437 0.0060  336 ARG A C     
2696 O O     . ARG A 336 ? 0.3159 0.4364 0.4061 0.0038  -0.0485 0.0017  336 ARG A O     
2697 C CB    . ARG A 336 ? 0.3001 0.4164 0.3630 0.0097  -0.0377 -0.0057 336 ARG A CB    
2698 C CG    . ARG A 336 ? 0.3001 0.4156 0.3508 0.0123  -0.0333 -0.0078 336 ARG A CG    
2699 C CD    . ARG A 336 ? 0.3005 0.4131 0.3474 0.0129  -0.0333 -0.0128 336 ARG A CD    
2700 N NE    . ARG A 336 ? 0.3098 0.4193 0.3602 0.0120  -0.0334 -0.0113 336 ARG A NE    
2701 C CZ    . ARG A 336 ? 0.3019 0.4094 0.3515 0.0126  -0.0333 -0.0155 336 ARG A CZ    
2702 N NH1   . ARG A 336 ? 0.2965 0.4081 0.3408 0.0135  -0.0323 -0.0218 336 ARG A NH1   
2703 N NH2   . ARG A 336 ? 0.3021 0.4065 0.3567 0.0115  -0.0345 -0.0125 336 ARG A NH2   
2704 N N     . PHE A 337 ? 0.3036 0.4346 0.3902 -0.0020 -0.0447 0.0157  337 PHE A N     
2705 C CA    . PHE A 337 ? 0.3166 0.4487 0.4209 -0.0081 -0.0532 0.0249  337 PHE A CA    
2706 C C     . PHE A 337 ? 0.3457 0.4709 0.4591 -0.0105 -0.0589 0.0284  337 PHE A C     
2707 O O     . PHE A 337 ? 0.3357 0.4613 0.4385 -0.0094 -0.0543 0.0276  337 PHE A O     
2708 C CB    . PHE A 337 ? 0.3130 0.4633 0.4184 -0.0150 -0.0520 0.0370  337 PHE A CB    
2709 C CG    . PHE A 337 ? 0.3313 0.4895 0.4330 -0.0127 -0.0478 0.0332  337 PHE A CG    
2710 C CD1   . PHE A 337 ? 0.3362 0.4922 0.4502 -0.0143 -0.0536 0.0350  337 PHE A CD1   
2711 C CD2   . PHE A 337 ? 0.3339 0.5007 0.4226 -0.0085 -0.0391 0.0265  337 PHE A CD2   
2712 C CE1   . PHE A 337 ? 0.3408 0.5041 0.4524 -0.0121 -0.0502 0.0317  337 PHE A CE1   
2713 C CE2   . PHE A 337 ? 0.3327 0.5060 0.4219 -0.0058 -0.0367 0.0224  337 PHE A CE2   
2714 C CZ    . PHE A 337 ? 0.3369 0.5087 0.4365 -0.0078 -0.0418 0.0255  337 PHE A CZ    
2715 N N     . SER A 338 ? 0.3670 0.4860 0.5033 -0.0137 -0.0701 0.0323  338 SER A N     
2716 C CA    . SER A 338 ? 0.3880 0.4982 0.5399 -0.0149 -0.0783 0.0338  338 SER A CA    
2717 C C     . SER A 338 ? 0.4084 0.5145 0.5919 -0.0208 -0.0935 0.0429  338 SER A C     
2718 O O     . SER A 338 ? 0.4145 0.5259 0.6041 -0.0244 -0.0962 0.0489  338 SER A O     
2719 C CB    . SER A 338 ? 0.3778 0.4780 0.5276 -0.0062 -0.0762 0.0147  338 SER A CB    
2720 O OG    . SER A 338 ? 0.3849 0.4829 0.5415 -0.0022 -0.0784 0.0024  338 SER A OG    
2721 N N     . LYS A 339 ? 0.4298 0.5265 0.6360 -0.0218 -0.1044 0.0441  339 LYS A N     
2722 C CA    . LYS A 339 ? 0.4475 0.5370 0.6925 -0.0272 -0.1229 0.0524  339 LYS A CA    
2723 C C     . LYS A 339 ? 0.4472 0.5498 0.6975 -0.0404 -0.1285 0.0794  339 LYS A C     
2724 O O     . LYS A 339 ? 0.4604 0.5642 0.7273 -0.0446 -0.1363 0.0856  339 LYS A O     
2725 C CB    . LYS A 339 ? 0.4724 0.5538 0.7352 -0.0209 -0.1285 0.0347  339 LYS A CB    
2726 C CG    . LYS A 339 ? 0.4944 0.5731 0.7443 -0.0092 -0.1196 0.0071  339 LYS A CG    
2727 C CD    . LYS A 339 ? 0.5227 0.5925 0.8027 -0.0035 -0.1304 -0.0107 339 LYS A CD    
2728 C CE    . LYS A 339 ? 0.5319 0.5978 0.8166 -0.0050 -0.1328 -0.0035 339 LYS A CE    
2729 N NZ    . LYS A 339 ? 0.5574 0.6162 0.8757 0.0015  -0.1438 -0.0232 339 LYS A NZ    
2730 N N     . PHE A 340 ? 0.4573 0.5727 0.6938 -0.0477 -0.1249 0.0955  340 PHE A N     
2731 C CA    . PHE A 340 ? 0.4774 0.6150 0.7126 -0.0617 -0.1272 0.1207  340 PHE A CA    
2732 C C     . PHE A 340 ? 0.5360 0.6713 0.8109 -0.0737 -0.1492 0.1432  340 PHE A C     
2733 O O     . PHE A 340 ? 0.5376 0.6547 0.8409 -0.0718 -0.1630 0.1414  340 PHE A O     
2734 C CB    . PHE A 340 ? 0.4747 0.6316 0.6840 -0.0665 -0.1172 0.1291  340 PHE A CB    
2735 C CG    . PHE A 340 ? 0.4652 0.6235 0.6410 -0.0554 -0.0984 0.1086  340 PHE A CG    
2736 C CD1   . PHE A 340 ? 0.4588 0.6224 0.6196 -0.0501 -0.0880 0.0977  340 PHE A CD1   
2737 C CD2   . PHE A 340 ? 0.4454 0.5998 0.6072 -0.0509 -0.0924 0.1013  340 PHE A CD2   
2738 C CE1   . PHE A 340 ? 0.4322 0.5962 0.5674 -0.0406 -0.0735 0.0808  340 PHE A CE1   
2739 C CE2   . PHE A 340 ? 0.4347 0.5898 0.5697 -0.0416 -0.0773 0.0843  340 PHE A CE2   
2740 C CZ    . PHE A 340 ? 0.4129 0.5723 0.5359 -0.0366 -0.0686 0.0744  340 PHE A CZ    
2741 N N     . ILE A 341 ? 0.5777 0.7329 0.8573 -0.0865 -0.1535 0.1646  341 ILE A N     
2742 C CA    . ILE A 341 ? 0.6341 0.7891 0.9538 -0.1002 -0.1763 0.1902  341 ILE A CA    
2743 C C     . ILE A 341 ? 0.6848 0.8535 1.0082 -0.1129 -0.1838 0.2143  341 ILE A C     
2744 O O     . ILE A 341 ? 0.6868 0.8840 0.9797 -0.1198 -0.1715 0.2235  341 ILE A O     
2745 C CB    . ILE A 341 ? 0.6420 0.8187 0.9651 -0.1120 -0.1786 0.2083  341 ILE A CB    
2746 C CG1   . ILE A 341 ? 0.6432 0.8114 0.9561 -0.1000 -0.1683 0.1851  341 ILE A CG1   
2747 C CG2   . ILE A 341 ? 0.6462 0.8201 1.0164 -0.1269 -0.2052 0.2363  341 ILE A CG2   
2748 C CD1   . ILE A 341 ? 0.6496 0.7932 1.0004 -0.0960 -0.1848 0.1777  341 ILE A CD1   
2749 N N     . GLU A 342 ? 0.7481 0.8977 1.1107 -0.1158 -0.2049 0.2233  342 GLU A N     
2750 C CA    . GLU A 342 ? 0.7707 0.9321 1.1439 -0.1298 -0.2167 0.2503  342 GLU A CA    
2751 C C     . GLU A 342 ? 0.7747 0.9682 1.1571 -0.1528 -0.2274 0.2888  342 GLU A C     
2752 O O     . GLU A 342 ? 0.7623 0.9912 1.1097 -0.1607 -0.2122 0.2971  342 GLU A O     
2753 C CB    . GLU A 342 ? 0.7853 0.9159 1.2060 -0.1261 -0.2392 0.2486  342 GLU A CB    
2754 C CG    . GLU A 342 ? 0.8134 0.9526 1.2557 -0.1418 -0.2572 0.2803  342 GLU A CG    
2755 C CD    . GLU A 342 ? 0.8189 0.9660 1.2282 -0.1382 -0.2430 0.2740  342 GLU A CD    
2756 O OE1   . GLU A 342 ? 0.7674 0.9122 1.1380 -0.1234 -0.2196 0.2452  342 GLU A OE1   
2757 O OE2   . GLU A 342 ? 0.8241 0.9801 1.2481 -0.1512 -0.2569 0.2996  342 GLU A OE2   
2758 C C2    . 2JV B 5   ? 0.7121 0.7479 0.6831 -0.0247 -0.0127 -0.0215 5   2JV B C2    
2759 C C5    . 2JV B 5   ? 0.8981 0.8447 0.7704 -0.0322 -0.0184 -0.0164 5   2JV B C5    
2760 C C6    . 2JV B 5   ? 0.8457 0.8263 0.7439 -0.0439 0.0025  -0.0273 5   2JV B C6    
2761 C C4    . 2JV B 5   ? 0.8573 0.8261 0.7686 -0.0168 -0.0355 -0.0104 5   2JV B C4    
2762 O O6    . 2JV B 5   ? 0.9200 0.8865 0.7949 -0.0584 0.0206  -0.0360 5   2JV B O6    
2763 N N7    . 2JV B 5   ? 0.9677 0.8625 0.7864 -0.0308 -0.0279 -0.0116 5   2JV B N7    
2764 C C8    . 2JV B 5   ? 0.9716 0.8601 0.7995 -0.0139 -0.0530 -0.0041 5   2JV B C8    
2765 N N9    . 2JV B 5   ? 0.9147 0.8498 0.8018 -0.0066 -0.0555 -0.0041 5   2JV B N9    
2766 C CAQ   . 2JV B 5   ? 0.8960 0.8430 0.8192 0.0099  -0.0754 -0.0004 5   2JV B CAQ   
2767 O OAP   . 2JV B 5   ? 0.9194 0.8357 0.8208 0.0143  -0.0788 0.0043  5   2JV B OAP   
2768 C CAR   . 2JV B 5   ? 0.8883 0.8292 0.8177 0.0224  -0.1023 -0.0010 5   2JV B CAR   
2769 C CAT   . 2JV B 5   ? 0.9081 0.8240 0.8347 0.0368  -0.1229 0.0021  5   2JV B CAT   
2770 O OAS   . 2JV B 5   ? 0.8349 0.7896 0.8266 0.0454  -0.1252 -0.0007 5   2JV B OAS   
2771 C CAU   . 2JV B 5   ? 0.9558 0.8385 0.8374 0.0287  -0.1071 0.0068  5   2JV B CAU   
2772 C CAV   . 2JV B 5   ? 1.0291 0.8554 0.8343 0.0212  -0.1060 0.0090  5   2JV B CAV   
2773 O OAB   . 2JV B 5   ? 1.1186 0.8898 0.8782 0.0344  -0.1309 0.0132  5   2JV B OAB   
2774 P PAD   . 2JV B 5   ? 1.2358 0.9415 0.9097 0.0287  -0.1343 0.0147  5   2JV B PAD   
2775 O OAC   . 2JV B 5   ? 1.2977 0.9485 0.9302 0.0489  -0.1717 0.0179  5   2JV B OAC   
2776 O OAA   . 2JV B 5   ? 1.1760 0.9109 0.8664 0.0215  -0.1311 0.0090  5   2JV B OAA   
2777 N N1    . 2JV B 5   ? 0.7692 0.7926 0.7152 -0.0382 0.0016  -0.0292 5   2JV B N1    
2778 N N3    . 2JV B 5   ? 0.7591 0.7708 0.7172 -0.0151 -0.0292 -0.0131 5   2JV B N3    
2779 N N2    . 2JV B 5   ? 0.6188 0.6895 0.6275 -0.0211 -0.0096 -0.0244 5   2JV B N2    
2780 C CBD   . 2JV B 5   ? 0.5502 0.6348 0.5862 -0.0103 -0.0166 -0.0193 5   2JV B CBD   
2781 C CBC   . 2JV B 5   ? 0.4930 0.6004 0.5508 -0.0092 -0.0095 -0.0231 5   2JV B CBC   
2782 C CAX   . 2JV B 5   ? 0.4693 0.5829 0.5475 -0.0002 -0.0119 -0.0185 5   2JV B CAX   
2783 C CBG   . 2JV B 5   ? 0.4705 0.5746 0.5582 0.0071  -0.0204 -0.0123 5   2JV B CBG   
2784 C CBF   . 2JV B 5   ? 0.5016 0.5881 0.5745 0.0079  -0.0317 -0.0099 5   2JV B CBF   
2785 C CBE   . 2JV B 5   ? 0.5292 0.6025 0.5711 -0.0004 -0.0303 -0.0122 5   2JV B CBE   
2786 C CBB   . 2JV B 5   ? 0.4797 0.6013 0.5389 -0.0165 -0.0003 -0.0335 5   2JV B CBB   
2787 C CBA   . 2JV B 5   ? 0.4588 0.5979 0.5346 -0.0126 0.0014  -0.0382 5   2JV B CBA   
2788 C CAZ   . 2JV B 5   ? 0.4419 0.5800 0.5269 -0.0032 -0.0016 -0.0313 5   2JV B CAZ   
2789 C CAY   . 2JV B 5   ? 0.4563 0.5828 0.5448 0.0018  -0.0057 -0.0219 5   2JV B CAY   
2790 C CBM   . 2JV B 5   ? 0.4379 0.5832 0.5281 0.0016  -0.0007 -0.0353 5   2JV B CBM   
2791 N NAW   . 2JV B 5   ? 0.4311 0.5892 0.5235 -0.0006 -0.0012 -0.0473 5   2JV B NAW   
2792 C CBL   . 2JV B 5   ? 0.4422 0.5781 0.5343 0.0093  0.0007  -0.0286 5   2JV B CBL   
2793 C CBK   . 2JV B 5   ? 0.4334 0.5601 0.5335 0.0118  0.0017  -0.0203 5   2JV B CBK   
2794 C CBJ   . 2JV B 5   ? 0.4498 0.5741 0.5511 0.0090  -0.0037 -0.0175 5   2JV B CBJ   
2795 C CBI   . 2JV B 5   ? 0.4614 0.5782 0.5768 0.0140  -0.0074 -0.0122 5   2JV B CBI   
2796 C CBH   . 2JV B 5   ? 0.4570 0.5662 0.5687 0.0140  -0.0179 -0.0103 5   2JV B CBH   
2797 P P     . DG  B 6   ? 0.6609 0.6427 0.7112 0.0580  -0.1424 -0.0073 6   DG  B P     
2798 O OP1   . DG  B 6   ? 0.6597 0.6211 0.7173 0.0731  -0.1630 -0.0085 6   DG  B OP1   
2799 O OP2   . DG  B 6   ? 0.6275 0.6087 0.6686 0.0575  -0.1548 -0.0109 6   DG  B OP2   
2800 O "O5'" . DG  B 6   ? 0.5695 0.5970 0.6774 0.0539  -0.1208 -0.0103 6   DG  B "O5'" 
2801 C "C5'" . DG  B 6   ? 0.5280 0.5741 0.6298 0.0408  -0.0961 -0.0082 6   DG  B "C5'" 
2802 C "C4'" . DG  B 6   ? 0.4729 0.5525 0.6256 0.0413  -0.0836 -0.0123 6   DG  B "C4'" 
2803 O "O4'" . DG  B 6   ? 0.4477 0.5410 0.5902 0.0315  -0.0637 -0.0108 6   DG  B "O4'" 
2804 C "C3'" . DG  B 6   ? 0.4497 0.5459 0.6388 0.0462  -0.0941 -0.0194 6   DG  B "C3'" 
2805 O "O3'" . DG  B 6   ? 0.4131 0.5278 0.6509 0.0487  -0.0825 -0.0244 6   DG  B "O3'" 
2806 C "C2'" . DG  B 6   ? 0.4355 0.5399 0.6053 0.0375  -0.0856 -0.0184 6   DG  B "C2'" 
2807 C "C1'" . DG  B 6   ? 0.4225 0.5311 0.5762 0.0298  -0.0642 -0.0142 6   DG  B "C1'" 
2808 N N9    . DG  B 6   ? 0.4020 0.5086 0.5224 0.0211  -0.0575 -0.0134 6   DG  B N9    
2809 C C8    . DG  B 6   ? 0.4247 0.5130 0.5097 0.0167  -0.0641 -0.0132 6   DG  B C8    
2810 N N7    . DG  B 6   ? 0.4274 0.5207 0.4956 0.0076  -0.0516 -0.0157 6   DG  B N7    
2811 C C5    . DG  B 6   ? 0.3958 0.5113 0.4875 0.0082  -0.0403 -0.0171 6   DG  B C5    
2812 C C6    . DG  B 6   ? 0.3714 0.5014 0.4622 0.0032  -0.0287 -0.0221 6   DG  B C6    
2813 O O6    . DG  B 6   ? 0.3870 0.5181 0.4635 -0.0044 -0.0233 -0.0279 6   DG  B O6    
2814 N N1    . DG  B 6   ? 0.3552 0.4966 0.4644 0.0082  -0.0234 -0.0217 6   DG  B N1    
2815 C C2    . DG  B 6   ? 0.3555 0.4944 0.4826 0.0146  -0.0236 -0.0175 6   DG  B C2    
2816 N N2    . DG  B 6   ? 0.3586 0.5008 0.4923 0.0176  -0.0150 -0.0179 6   DG  B N2    
2817 N N3    . DG  B 6   ? 0.3614 0.4925 0.4989 0.0181  -0.0319 -0.0149 6   DG  B N3    
2818 C C4    . DG  B 6   ? 0.3818 0.5019 0.5005 0.0158  -0.0423 -0.0147 6   DG  B C4    
2819 P P     . DA  B 7   ? 0.4069 0.5424 0.6954 0.0507  -0.0827 -0.0347 7   DA  B P     
2820 O OP1   . DA  B 7   ? 0.3876 0.5314 0.7241 0.0542  -0.0722 -0.0419 7   DA  B OP1   
2821 O OP2   . DA  B 7   ? 0.4122 0.5440 0.6995 0.0559  -0.1088 -0.0394 7   DA  B OP2   
2822 O "O5'" . DA  B 7   ? 0.3618 0.5068 0.6379 0.0414  -0.0605 -0.0314 7   DA  B "O5'" 
2823 C "C5'" . DA  B 7   ? 0.3289 0.4735 0.6027 0.0374  -0.0369 -0.0284 7   DA  B "C5'" 
2824 C "C4'" . DA  B 7   ? 0.3035 0.4518 0.5633 0.0322  -0.0236 -0.0270 7   DA  B "C4'" 
2825 O "O4'" . DA  B 7   ? 0.2894 0.4361 0.5105 0.0292  -0.0302 -0.0220 7   DA  B "O4'" 
2826 C "C3'" . DA  B 7   ? 0.2943 0.4519 0.5820 0.0319  -0.0242 -0.0340 7   DA  B "C3'" 
2827 O "O3'" . DA  B 7   ? 0.3008 0.4530 0.5913 0.0287  -0.0010 -0.0349 7   DA  B "O3'" 
2828 C "C2'" . DA  B 7   ? 0.2850 0.4450 0.5455 0.0305  -0.0376 -0.0316 7   DA  B "C2'" 
2829 C "C1'" . DA  B 7   ? 0.2780 0.4317 0.4991 0.0277  -0.0317 -0.0245 7   DA  B "C1'" 
2830 N N9    . DA  B 7   ? 0.2736 0.4259 0.4650 0.0248  -0.0420 -0.0228 7   DA  B N9    
2831 C C8    . DA  B 7   ? 0.2865 0.4318 0.4675 0.0250  -0.0583 -0.0235 7   DA  B C8    
2832 N N7    . DA  B 7   ? 0.2912 0.4314 0.4406 0.0196  -0.0587 -0.0228 7   DA  B N7    
2833 C C5    . DA  B 7   ? 0.2729 0.4228 0.4190 0.0169  -0.0443 -0.0230 7   DA  B C5    
2834 C C6    . DA  B 7   ? 0.2731 0.4270 0.4003 0.0116  -0.0380 -0.0260 7   DA  B C6    
2835 N N6    . DA  B 7   ? 0.2757 0.4226 0.3809 0.0053  -0.0400 -0.0288 7   DA  B N6    
2836 N N1    . DA  B 7   ? 0.2640 0.4270 0.3954 0.0133  -0.0293 -0.0279 7   DA  B N1    
2837 C C2    . DA  B 7   ? 0.2630 0.4244 0.4073 0.0187  -0.0245 -0.0250 7   DA  B C2    
2838 N N3    . DA  B 7   ? 0.2656 0.4223 0.4281 0.0216  -0.0244 -0.0222 7   DA  B N3    
2839 C C4    . DA  B 7   ? 0.2672 0.4216 0.4342 0.0209  -0.0357 -0.0221 7   DA  B C4    
2840 P P     . DC  B 8   ? 0.3196 0.4746 0.6376 0.0261  0.0088  -0.0429 8   DC  B P     
2841 O OP1   . DC  B 8   ? 0.3437 0.4809 0.6590 0.0226  0.0368  -0.0437 8   DC  B OP1   
2842 O OP2   . DC  B 8   ? 0.3245 0.4944 0.6883 0.0282  -0.0062 -0.0533 8   DC  B OP2   
2843 O "O5'" . DC  B 8   ? 0.3396 0.4974 0.6279 0.0255  -0.0010 -0.0390 8   DC  B "O5'" 
2844 C "C5'" . DC  B 8   ? 0.3262 0.4749 0.6011 0.0236  0.0124  -0.0389 8   DC  B "C5'" 
2845 C "C4'" . DC  B 8   ? 0.3116 0.4536 0.5422 0.0258  0.0104  -0.0316 8   DC  B "C4'" 
2846 O "O4'" . DC  B 8   ? 0.2951 0.4477 0.5127 0.0262  -0.0057 -0.0286 8   DC  B "O4'" 
2847 C "C3'" . DC  B 8   ? 0.3086 0.4499 0.5255 0.0264  0.0087  -0.0325 8   DC  B "C3'" 
2848 O "O3'" . DC  B 8   ? 0.3216 0.4420 0.5358 0.0262  0.0278  -0.0338 8   DC  B "O3'" 
2849 C "C2'" . DC  B 8   ? 0.2947 0.4394 0.4807 0.0291  -0.0004 -0.0291 8   DC  B "C2'" 
2850 C "C1'" . DC  B 8   ? 0.2831 0.4376 0.4737 0.0269  -0.0097 -0.0275 8   DC  B "C1'" 
2851 N N1    . DC  B 8   ? 0.2704 0.4355 0.4586 0.0242  -0.0241 -0.0290 8   DC  B N1    
2852 C C2    . DC  B 8   ? 0.2554 0.4252 0.4231 0.0229  -0.0271 -0.0307 8   DC  B C2    
2853 O O2    . DC  B 8   ? 0.2499 0.4180 0.4067 0.0261  -0.0217 -0.0316 8   DC  B O2    
2854 N N3    . DC  B 8   ? 0.2528 0.4258 0.4123 0.0186  -0.0357 -0.0327 8   DC  B N3    
2855 C C4    . DC  B 8   ? 0.2620 0.4304 0.4271 0.0175  -0.0454 -0.0320 8   DC  B C4    
2856 N N4    . DC  B 8   ? 0.2718 0.4342 0.4178 0.0134  -0.0534 -0.0337 8   DC  B N4    
2857 C C5    . DC  B 8   ? 0.2638 0.4309 0.4543 0.0211  -0.0475 -0.0313 8   DC  B C5    
2858 C C6    . DC  B 8   ? 0.2625 0.4297 0.4666 0.0234  -0.0346 -0.0304 8   DC  B C6    
2859 P P     . DT  B 9   ? 0.3361 0.4518 0.5574 0.0244  0.0330  -0.0384 9   DT  B P     
2860 O OP1   . DT  B 9   ? 0.3615 0.4474 0.5777 0.0220  0.0584  -0.0400 9   DT  B OP1   
2861 O OP2   . DT  B 9   ? 0.3160 0.4555 0.5716 0.0211  0.0191  -0.0444 9   DT  B OP2   
2862 O "O5'" . DT  B 9   ? 0.3340 0.4475 0.5196 0.0302  0.0228  -0.0349 9   DT  B "O5'" 
2863 C "C5'" . DT  B 9   ? 0.3552 0.4517 0.5048 0.0369  0.0238  -0.0306 9   DT  B "C5'" 
2864 C "C4'" . DT  B 9   ? 0.3559 0.4621 0.4890 0.0425  0.0090  -0.0321 9   DT  B "C4'" 
2865 O "O4'" . DT  B 9   ? 0.3253 0.4601 0.4729 0.0385  -0.0041 -0.0338 9   DT  B "O4'" 
2866 C "C3'" . DT  B 9   ? 0.3667 0.4685 0.5000 0.0437  0.0096  -0.0352 9   DT  B "C3'" 
2867 O "O3'" . DT  B 9   ? 0.4224 0.5065 0.5249 0.0540  0.0055  -0.0358 9   DT  B "O3'" 
2868 C "C2'" . DT  B 9   ? 0.3379 0.4697 0.4914 0.0388  -0.0033 -0.0389 9   DT  B "C2'" 
2869 C "C1'" . DT  B 9   ? 0.3157 0.4630 0.4677 0.0377  -0.0117 -0.0381 9   DT  B "C1'" 
2870 N N1    . DT  B 9   ? 0.2944 0.4587 0.4626 0.0303  -0.0193 -0.0391 9   DT  B N1    
2871 C C2    . DT  B 9   ? 0.2863 0.4628 0.4478 0.0276  -0.0272 -0.0428 9   DT  B C2    
2872 O O2    . DT  B 9   ? 0.2870 0.4677 0.4390 0.0307  -0.0281 -0.0472 9   DT  B O2    
2873 N N3    . DT  B 9   ? 0.2785 0.4594 0.4440 0.0213  -0.0340 -0.0429 9   DT  B N3    
2874 C C4    . DT  B 9   ? 0.2762 0.4543 0.4568 0.0199  -0.0382 -0.0410 9   DT  B C4    
2875 O O4    . DT  B 9   ? 0.2782 0.4549 0.4547 0.0166  -0.0485 -0.0417 9   DT  B O4    
2876 C C5    . DT  B 9   ? 0.2791 0.4521 0.4781 0.0227  -0.0294 -0.0397 9   DT  B C5    
2877 C C7    . DT  B 9   ? 0.2790 0.4533 0.5064 0.0216  -0.0332 -0.0419 9   DT  B C7    
2878 C C6    . DT  B 9   ? 0.2902 0.4544 0.4793 0.0266  -0.0183 -0.0383 9   DT  B C6    
2879 P P     . DG  B 10  ? 0.4560 0.5281 0.5492 0.0588  0.0052  -0.0389 10  DG  B P     
2880 O OP1   . DG  B 10  ? 0.5371 0.5681 0.5887 0.0706  0.0079  -0.0368 10  DG  B OP1   
2881 O OP2   . DG  B 10  ? 0.4633 0.5410 0.5819 0.0490  0.0144  -0.0404 10  DG  B OP2   
2882 O "O5'" . DG  B 10  ? 0.4238 0.5258 0.5261 0.0618  -0.0123 -0.0453 10  DG  B "O5'" 
2883 C "C5'" . DG  B 10  ? 0.3994 0.5071 0.4910 0.0703  -0.0243 -0.0493 10  DG  B "C5'" 
2884 C "C4'" . DG  B 10  ? 0.3717 0.5055 0.4789 0.0714  -0.0349 -0.0593 10  DG  B "C4'" 
2885 O "O4'" . DG  B 10  ? 0.3359 0.4960 0.4652 0.0579  -0.0329 -0.0602 10  DG  B "O4'" 
2886 C "C3'" . DG  B 10  ? 0.3747 0.4997 0.4793 0.0762  -0.0352 -0.0626 10  DG  B "C3'" 
2887 O "O3'" . DG  B 10  ? 0.3748 0.5136 0.4856 0.0851  -0.0476 -0.0745 10  DG  B "O3'" 
2888 C "C2'" . DG  B 10  ? 0.3538 0.4947 0.4788 0.0623  -0.0284 -0.0614 10  DG  B "C2'" 
2889 C "C1'" . DG  B 10  ? 0.3250 0.4908 0.4636 0.0534  -0.0314 -0.0629 10  DG  B "C1'" 
2890 N N9    . DG  B 10  ? 0.2985 0.4700 0.4478 0.0418  -0.0277 -0.0582 10  DG  B N9    
2891 C C8    . DG  B 10  ? 0.3092 0.4692 0.4640 0.0388  -0.0216 -0.0521 10  DG  B C8    
2892 N N7    . DG  B 10  ? 0.2906 0.4601 0.4586 0.0305  -0.0246 -0.0518 10  DG  B N7    
2893 C C5    . DG  B 10  ? 0.2867 0.4687 0.4493 0.0268  -0.0309 -0.0559 10  DG  B C5    
2894 C C6    . DG  B 10  ? 0.2813 0.4677 0.4421 0.0187  -0.0368 -0.0570 10  DG  B C6    
2895 O O6    . DG  B 10  ? 0.2798 0.4626 0.4469 0.0154  -0.0425 -0.0548 10  DG  B O6    
2896 N N1    . DG  B 10  ? 0.2772 0.4693 0.4267 0.0150  -0.0360 -0.0628 10  DG  B N1    
2897 C C2    . DG  B 10  ? 0.2760 0.4762 0.4267 0.0193  -0.0322 -0.0694 10  DG  B C2    
2898 N N2    . DG  B 10  ? 0.2716 0.4785 0.4181 0.0128  -0.0286 -0.0781 10  DG  B N2    
2899 N N3    . DG  B 10  ? 0.2769 0.4753 0.4314 0.0295  -0.0321 -0.0690 10  DG  B N3    
2900 C C4    . DG  B 10  ? 0.2837 0.4697 0.4391 0.0325  -0.0307 -0.0610 10  DG  B C4    
2901 P P     . DG  B 11  ? 0.3858 0.5216 0.4990 0.0923  -0.0512 -0.0820 11  DG  B P     
2902 O OP1   . DG  B 11  ? 0.4134 0.5462 0.5224 0.1100  -0.0676 -0.0931 11  DG  B OP1   
2903 O OP2   . DG  B 11  ? 0.4149 0.5224 0.5118 0.0907  -0.0405 -0.0730 11  DG  B OP2   
2904 O "O5'" . DG  B 11  ? 0.3423 0.5124 0.4845 0.0786  -0.0476 -0.0898 11  DG  B "O5'" 
2905 C "C5'" . DG  B 11  ? 0.3128 0.5105 0.4745 0.0746  -0.0510 -0.1009 11  DG  B "C5'" 
2906 C "C4'" . DG  B 11  ? 0.2952 0.5114 0.4723 0.0606  -0.0428 -0.1075 11  DG  B "C4'" 
2907 O "O4'" . DG  B 11  ? 0.2859 0.4970 0.4544 0.0472  -0.0357 -0.0960 11  DG  B "O4'" 
2908 C "C3'" . DG  B 11  ? 0.2999 0.5139 0.4815 0.0638  -0.0418 -0.1141 11  DG  B "C3'" 
2909 O "O3'" . DG  B 11  ? 0.2868 0.5219 0.4877 0.0555  -0.0361 -0.1291 11  DG  B "O3'" 
2910 C "C2'" . DG  B 11  ? 0.2958 0.4958 0.4650 0.0547  -0.0351 -0.1019 11  DG  B "C2'" 
2911 C "C1'" . DG  B 11  ? 0.2820 0.4886 0.4494 0.0418  -0.0318 -0.0960 11  DG  B "C1'" 
2912 N N9    . DG  B 11  ? 0.2833 0.4775 0.4434 0.0366  -0.0305 -0.0839 11  DG  B N9    
2913 C C8    . DG  B 11  ? 0.2849 0.4628 0.4404 0.0426  -0.0294 -0.0756 11  DG  B C8    
2914 N N7    . DG  B 11  ? 0.2869 0.4607 0.4464 0.0352  -0.0274 -0.0696 11  DG  B N7    
2915 C C5    . DG  B 11  ? 0.2757 0.4602 0.4363 0.0256  -0.0309 -0.0725 11  DG  B C5    
2916 C C6    . DG  B 11  ? 0.2799 0.4627 0.4425 0.0175  -0.0355 -0.0699 11  DG  B C6    
2917 O O6    . DG  B 11  ? 0.2810 0.4593 0.4552 0.0167  -0.0371 -0.0664 11  DG  B O6    
2918 N N1    . DG  B 11  ? 0.2831 0.4674 0.4328 0.0101  -0.0384 -0.0737 11  DG  B N1    
2919 C C2    . DG  B 11  ? 0.2793 0.4692 0.4214 0.0082  -0.0328 -0.0810 11  DG  B C2    
2920 N N2    . DG  B 11  ? 0.2935 0.4765 0.4177 -0.0015 -0.0316 -0.0847 11  DG  B N2    
2921 N N3    . DG  B 11  ? 0.2741 0.4730 0.4254 0.0155  -0.0287 -0.0860 11  DG  B N3    
2922 C C4    . DG  B 11  ? 0.2721 0.4665 0.4297 0.0251  -0.0302 -0.0806 11  DG  B C4    
2923 P P     . DT  B 12  ? 0.3056 0.5451 0.5190 0.0572  -0.0328 -0.1420 12  DT  B P     
2924 O OP1   . DT  B 12  ? 0.2996 0.5635 0.5423 0.0553  -0.0292 -0.1633 12  DT  B OP1   
2925 O OP2   . DT  B 12  ? 0.3103 0.5309 0.5139 0.0734  -0.0415 -0.1376 12  DT  B OP2   
2926 O "O5'" . DT  B 12  ? 0.3081 0.5409 0.5076 0.0392  -0.0211 -0.1359 12  DT  B "O5'" 
2927 C "C5'" . DT  B 12  ? 0.3173 0.5559 0.5134 0.0230  -0.0111 -0.1393 12  DT  B "C5'" 
2928 C "C4'" . DT  B 12  ? 0.3355 0.5586 0.5102 0.0102  -0.0050 -0.1344 12  DT  B "C4'" 
2929 O "O4'" . DT  B 12  ? 0.3319 0.5418 0.4916 0.0110  -0.0135 -0.1177 12  DT  B "O4'" 
2930 C "C3'" . DT  B 12  ? 0.3513 0.5704 0.5293 0.0127  -0.0024 -0.1413 12  DT  B "C3'" 
2931 O "O3'" . DT  B 12  ? 0.3870 0.5940 0.5464 -0.0021 0.0075  -0.1452 12  DT  B "O3'" 
2932 C "C2'" . DT  B 12  ? 0.3491 0.5550 0.5184 0.0195  -0.0118 -0.1273 12  DT  B "C2'" 
2933 C "C1'" . DT  B 12  ? 0.3402 0.5393 0.4947 0.0113  -0.0152 -0.1155 12  DT  B "C1'" 
2934 N N1    . DT  B 12  ? 0.3275 0.5186 0.4817 0.0163  -0.0226 -0.1030 12  DT  B N1    
2935 C C2    . DT  B 12  ? 0.3276 0.5104 0.4725 0.0085  -0.0274 -0.0962 12  DT  B C2    
2936 O O2    . DT  B 12  ? 0.3356 0.5120 0.4645 -0.0010 -0.0280 -0.0983 12  DT  B O2    
2937 N N3    . DT  B 12  ? 0.3193 0.4977 0.4731 0.0125  -0.0314 -0.0883 12  DT  B N3    
2938 C C4    . DT  B 12  ? 0.3194 0.4940 0.4813 0.0219  -0.0280 -0.0851 12  DT  B C4    
2939 O O4    . DT  B 12  ? 0.3215 0.4890 0.4907 0.0221  -0.0273 -0.0798 12  DT  B O4    
2940 C C5    . DT  B 12  ? 0.3230 0.4998 0.4837 0.0313  -0.0254 -0.0904 12  DT  B C5    
2941 C C7    . DT  B 12  ? 0.3371 0.4991 0.4940 0.0436  -0.0239 -0.0868 12  DT  B C7    
2942 C C6    . DT  B 12  ? 0.3249 0.5131 0.4863 0.0287  -0.0243 -0.0998 12  DT  B C6    
2943 P P     . DA  B 13  ? 0.4204 0.6324 0.5899 -0.0088 0.0236  -0.1653 13  DA  B P     
2944 O OP1   . DA  B 13  ? 0.4088 0.6390 0.6005 -0.0109 0.0322  -0.1783 13  DA  B OP1   
2945 O OP2   . DA  B 13  ? 0.3997 0.6145 0.5841 0.0023  0.0201  -0.1702 13  DA  B OP2   
2946 O "O5'" . DA  B 13  ? 0.4642 0.6492 0.5939 -0.0272 0.0332  -0.1632 13  DA  B "O5'" 
2947 C "C5'" . DA  B 13  ? 0.4789 0.6503 0.5829 -0.0368 0.0344  -0.1559 13  DA  B "C5'" 
2948 C "C4'" . DA  B 13  ? 0.5167 0.6548 0.5756 -0.0453 0.0284  -0.1462 13  DA  B "C4'" 
2949 O "O4'" . DA  B 13  ? 0.4962 0.6353 0.5581 -0.0357 0.0072  -0.1316 13  DA  B "O4'" 
2950 C "C3'" . DA  B 13  ? 0.5551 0.6726 0.5921 -0.0531 0.0365  -0.1544 13  DA  B "C3'" 
2951 O "O3'" . DA  B 13  ? 0.6221 0.7004 0.6058 -0.0650 0.0367  -0.1502 13  DA  B "O3'" 
2952 C "C2'" . DA  B 13  ? 0.5253 0.6503 0.5773 -0.0420 0.0200  -0.1475 13  DA  B "C2'" 
2953 C "C1'" . DA  B 13  ? 0.4947 0.6249 0.5518 -0.0346 0.0016  -0.1323 13  DA  B "C1'" 
2954 N N9    . DA  B 13  ? 0.4482 0.5972 0.5374 -0.0216 -0.0075 -0.1268 13  DA  B N9    
2955 C C8    . DA  B 13  ? 0.4263 0.5936 0.5439 -0.0117 -0.0026 -0.1319 13  DA  B C8    
2956 N N7    . DA  B 13  ? 0.4023 0.5738 0.5345 -0.0015 -0.0110 -0.1241 13  DA  B N7    
2957 C C5    . DA  B 13  ? 0.4029 0.5645 0.5246 -0.0058 -0.0209 -0.1149 13  DA  B C5    
2958 C C6    . DA  B 13  ? 0.3850 0.5456 0.5187 -0.0014 -0.0290 -0.1068 13  DA  B C6    
2959 N N6    . DA  B 13  ? 0.3740 0.5371 0.5236 0.0078  -0.0259 -0.1043 13  DA  B N6    
2960 N N1    . DA  B 13  ? 0.3858 0.5391 0.5133 -0.0065 -0.0398 -0.1028 13  DA  B N1    
2961 C C2    . DA  B 13  ? 0.4056 0.5468 0.5067 -0.0143 -0.0442 -0.1047 13  DA  B C2    
2962 N N3    . DA  B 13  ? 0.4312 0.5652 0.5100 -0.0205 -0.0346 -0.1105 13  DA  B N3    
2963 C C4    . DA  B 13  ? 0.4276 0.5757 0.5229 -0.0166 -0.0218 -0.1164 13  DA  B C4    
2964 P P     . DT  B 14  ? 0.6879 0.7286 0.6271 -0.0746 0.0402  -0.1551 14  DT  B P     
2965 O OP1   . DT  B 14  ? 0.7446 0.7409 0.6257 -0.0891 0.0521  -0.1565 14  DT  B OP1   
2966 O OP2   . DT  B 14  ? 0.6818 0.7394 0.6492 -0.0738 0.0539  -0.1683 14  DT  B OP2   
2967 O "O5'" . DT  B 14  ? 0.6688 0.7031 0.6012 -0.0655 0.0103  -0.1424 14  DT  B "O5'" 
2968 C "C5'" . DT  B 14  ? 0.6747 0.6970 0.5900 -0.0619 -0.0097 -0.1303 14  DT  B "C5'" 
2969 C "C4'" . DT  B 14  ? 0.6686 0.6948 0.5967 -0.0529 -0.0357 -0.1245 14  DT  B "C4'" 
2970 O "O4'" . DT  B 14  ? 0.6175 0.6832 0.6012 -0.0434 -0.0354 -0.1233 14  DT  B "O4'" 
2971 C "C3'" . DT  B 14  ? 0.7090 0.7081 0.6079 -0.0571 -0.0427 -0.1309 14  DT  B "C3'" 
2972 O "O3'" . DT  B 14  ? 0.7465 0.7237 0.6237 -0.0530 -0.0716 -0.1263 14  DT  B "O3'" 
2973 C "C2'" . DT  B 14  ? 0.6605 0.6912 0.6067 -0.0515 -0.0390 -0.1348 14  DT  B "C2'" 
2974 C "C1'" . DT  B 14  ? 0.6162 0.6806 0.6084 -0.0413 -0.0448 -0.1265 14  DT  B "C1'" 
2975 N N1    . DT  B 14  ? 0.5677 0.6614 0.6038 -0.0340 -0.0358 -0.1277 14  DT  B N1    
2976 C C2    . DT  B 14  ? 0.5352 0.6427 0.6022 -0.0267 -0.0464 -0.1228 14  DT  B C2    
2977 O O2    . DT  B 14  ? 0.5429 0.6454 0.6114 -0.0262 -0.0631 -0.1198 14  DT  B O2    
2978 N N3    . DT  B 14  ? 0.5162 0.6404 0.6121 -0.0197 -0.0363 -0.1232 14  DT  B N3    
2979 C C4    . DT  B 14  ? 0.5050 0.6366 0.6058 -0.0168 -0.0216 -0.1286 14  DT  B C4    
2980 O O4    . DT  B 14  ? 0.4842 0.6245 0.6060 -0.0079 -0.0173 -0.1282 14  DT  B O4    
2981 C C5    . DT  B 14  ? 0.5210 0.6453 0.5996 -0.0247 -0.0117 -0.1361 14  DT  B C5    
2982 C C7    . DT  B 14  ? 0.5074 0.6433 0.6003 -0.0218 0.0040  -0.1465 14  DT  B C7    
2983 C C6    . DT  B 14  ? 0.5482 0.6525 0.5938 -0.0340 -0.0169 -0.1348 14  DT  B C6    
2984 P P     . DT  B 15  ? 0.8162 0.7589 0.6569 -0.0553 -0.0896 -0.1329 15  DT  B P     
2985 O OP1   . DT  B 15  ? 0.8575 0.7601 0.6501 -0.0526 -0.1155 -0.1293 15  DT  B OP1   
2986 O OP2   . DT  B 15  ? 0.8158 0.7424 0.6315 -0.0656 -0.0659 -0.1419 15  DT  B OP2   
2987 O "O5'" . DT  B 15  ? 0.7559 0.7345 0.6566 -0.0469 -0.1041 -0.1348 15  DT  B "O5'" 
2988 C "C5'" . DT  B 15  ? 0.7129 0.7194 0.6591 -0.0377 -0.1188 -0.1294 15  DT  B "C5'" 
2989 C "C4'" . DT  B 15  ? 0.6863 0.7160 0.6808 -0.0340 -0.1269 -0.1354 15  DT  B "C4'" 
2990 O "O4'" . DT  B 15  ? 0.6323 0.6904 0.6633 -0.0337 -0.1028 -0.1342 15  DT  B "O4'" 
2991 C "C3'" . DT  B 15  ? 0.7224 0.7295 0.6953 -0.0381 -0.1385 -0.1461 15  DT  B "C3'" 
2992 O "O3'" . DT  B 15  ? 0.7251 0.7485 0.7423 -0.0335 -0.1582 -0.1533 15  DT  B "O3'" 
2993 C "C2'" . DT  B 15  ? 0.7061 0.7234 0.6871 -0.0431 -0.1113 -0.1489 15  DT  B "C2'" 
2994 C "C1'" . DT  B 15  ? 0.6404 0.6951 0.6746 -0.0372 -0.0979 -0.1427 15  DT  B "C1'" 
2995 N N1    . DT  B 15  ? 0.5930 0.6610 0.6373 -0.0371 -0.0718 -0.1417 15  DT  B N1    
2996 C C2    . DT  B 15  ? 0.5523 0.6428 0.6383 -0.0313 -0.0629 -0.1396 15  DT  B C2    
2997 O O2    . DT  B 15  ? 0.5279 0.6276 0.6437 -0.0288 -0.0711 -0.1394 15  DT  B O2    
2998 N N3    . DT  B 15  ? 0.5328 0.6312 0.6233 -0.0283 -0.0435 -0.1395 15  DT  B N3    
2999 C C4    . DT  B 15  ? 0.5370 0.6297 0.6054 -0.0313 -0.0310 -0.1435 15  DT  B C4    
3000 O O4    . DT  B 15  ? 0.5220 0.6258 0.6049 -0.0260 -0.0171 -0.1458 15  DT  B O4    
3001 C C5    . DT  B 15  ? 0.5737 0.6433 0.6010 -0.0404 -0.0356 -0.1462 15  DT  B C5    
3002 C C7    . DT  B 15  ? 0.5864 0.6454 0.5890 -0.0472 -0.0168 -0.1532 15  DT  B C7    
3003 C C6    . DT  B 15  ? 0.6001 0.6556 0.6127 -0.0422 -0.0564 -0.1440 15  DT  B C6    
3004 P P     . DG  B 16  ? 0.7718 0.7693 0.7691 -0.0305 -0.1955 -0.1634 16  DG  B P     
3005 O OP1   . DG  B 16  ? 0.7797 0.7677 0.7650 -0.0230 -0.2157 -0.1578 16  DG  B OP1   
3006 O OP2   . DG  B 16  ? 0.8126 0.7725 0.7525 -0.0373 -0.1958 -0.1691 16  DG  B OP2   
3007 O "O5'" . DG  B 16  ? 0.7307 0.7603 0.7993 -0.0284 -0.2042 -0.1750 16  DG  B "O5'" 
3008 C "C5'" . DG  B 16  ? 0.6606 0.7279 0.7906 -0.0268 -0.1868 -0.1716 16  DG  B "C5'" 
3009 C "C4'" . DG  B 16  ? 0.6374 0.7210 0.8087 -0.0320 -0.1726 -0.1810 16  DG  B "C4'" 
3010 O "O4'" . DG  B 16  ? 0.6146 0.6969 0.7674 -0.0358 -0.1423 -0.1729 16  DG  B "O4'" 
3011 C "C3'" . DG  B 16  ? 0.6632 0.7322 0.8294 -0.0354 -0.1928 -0.1973 16  DG  B "C3'" 
3012 O "O3'" . DG  B 16  ? 0.6529 0.7446 0.8806 -0.0391 -0.1853 -0.2096 16  DG  B "O3'" 
3013 C "C2'" . DG  B 16  ? 0.6742 0.7204 0.7879 -0.0411 -0.1759 -0.1929 16  DG  B "C2'" 
3014 C "C1'" . DG  B 16  ? 0.6276 0.6941 0.7615 -0.0415 -0.1414 -0.1819 16  DG  B "C1'" 
3015 N N9    . DG  B 16  ? 0.6060 0.6609 0.7002 -0.0437 -0.1199 -0.1741 16  DG  B N9    
3016 C C8    . DG  B 16  ? 0.6339 0.6615 0.6714 -0.0469 -0.1215 -0.1728 16  DG  B C8    
3017 N N7    . DG  B 16  ? 0.6234 0.6515 0.6475 -0.0488 -0.0962 -0.1686 16  DG  B N7    
3018 C C5    . DG  B 16  ? 0.5756 0.6303 0.6452 -0.0443 -0.0809 -0.1656 16  DG  B C5    
3019 C C6    . DG  B 16  ? 0.5497 0.6149 0.6282 -0.0411 -0.0568 -0.1619 16  DG  B C6    
3020 O O6    . DG  B 16  ? 0.5618 0.6214 0.6188 -0.0423 -0.0428 -0.1627 16  DG  B O6    
3021 N N1    . DG  B 16  ? 0.5210 0.6025 0.6384 -0.0358 -0.0494 -0.1590 16  DG  B N1    
3022 C C2    . DG  B 16  ? 0.5134 0.6023 0.6620 -0.0362 -0.0587 -0.1609 16  DG  B C2    
3023 N N2    . DG  B 16  ? 0.4959 0.5922 0.6727 -0.0325 -0.0443 -0.1581 16  DG  B N2    
3024 N N3    . DG  B 16  ? 0.5361 0.6225 0.6876 -0.0396 -0.0806 -0.1668 16  DG  B N3    
3025 C C4    . DG  B 16  ? 0.5666 0.6349 0.6757 -0.0423 -0.0929 -0.1681 16  DG  B C4    
3026 P P     . DG  B 17  ? 0.6466 0.7584 0.9373 -0.0361 -0.2097 -0.2266 17  DG  B P     
3027 O OP1   . DG  B 17  ? 0.6326 0.7574 0.9381 -0.0292 -0.2105 -0.2169 17  DG  B OP1   
3028 O OP2   . DG  B 17  ? 0.6812 0.7744 0.9549 -0.0340 -0.2475 -0.2425 17  DG  B OP2   
3029 O "O5'" . DG  B 17  ? 0.6211 0.7541 0.9723 -0.0446 -0.1822 -0.2367 17  DG  B "O5'" 
3030 C "C5'" . DG  B 17  ? 0.5842 0.7264 0.9480 -0.0467 -0.1452 -0.2238 17  DG  B "C5'" 
3031 C "C4'" . DG  B 17  ? 0.5838 0.7194 0.9510 -0.0547 -0.1175 -0.2267 17  DG  B "C4'" 
3032 O "O4'" . DG  B 17  ? 0.5859 0.7020 0.8942 -0.0536 -0.1106 -0.2151 17  DG  B "O4'" 
3033 C "C3'" . DG  B 17  ? 0.6057 0.7433 1.0086 -0.0627 -0.1267 -0.2498 17  DG  B "C3'" 
3034 O "O3'" . DG  B 17  ? 0.6327 0.7680 1.0582 -0.0707 -0.0918 -0.2521 17  DG  B "O3'" 
3035 C "C2'" . DG  B 17  ? 0.6215 0.7374 0.9696 -0.0625 -0.1427 -0.2496 17  DG  B "C2'" 
3036 C "C1'" . DG  B 17  ? 0.6026 0.7065 0.9027 -0.0596 -0.1173 -0.2281 17  DG  B "C1'" 
3037 N N9    . DG  B 17  ? 0.6068 0.6898 0.8446 -0.0575 -0.1267 -0.2210 17  DG  B N9    
3038 C C8    . DG  B 17  ? 0.6331 0.6997 0.8372 -0.0562 -0.1571 -0.2265 17  DG  B C8    
3039 N N7    . DG  B 17  ? 0.6489 0.6928 0.7942 -0.0564 -0.1521 -0.2181 17  DG  B N7    
3040 C C5    . DG  B 17  ? 0.6172 0.6689 0.7654 -0.0566 -0.1193 -0.2078 17  DG  B C5    
3041 C C6    . DG  B 17  ? 0.6177 0.6571 0.7257 -0.0566 -0.1000 -0.1993 17  DG  B C6    
3042 O O6    . DG  B 17  ? 0.6435 0.6608 0.7027 -0.0590 -0.1034 -0.1989 17  DG  B O6    
3043 N N1    . DG  B 17  ? 0.5830 0.6356 0.7124 -0.0535 -0.0738 -0.1925 17  DG  B N1    
3044 C C2    . DG  B 17  ? 0.5570 0.6246 0.7302 -0.0517 -0.0645 -0.1920 17  DG  B C2    
3045 N N2    . DG  B 17  ? 0.5409 0.6098 0.7177 -0.0469 -0.0411 -0.1845 17  DG  B N2    
3046 N N3    . DG  B 17  ? 0.5553 0.6331 0.7655 -0.0544 -0.0768 -0.2000 17  DG  B N3    
3047 C C4    . DG  B 17  ? 0.5923 0.6648 0.7921 -0.0562 -0.1051 -0.2084 17  DG  B C4    
3048 P P     . DG  B 18  ? 0.6637 0.8137 1.1637 -0.0808 -0.0807 -0.2747 18  DG  B P     
3049 O OP1   . DG  B 18  ? 0.6322 0.7951 1.1634 -0.0789 -0.0669 -0.2698 18  DG  B OP1   
3050 O OP2   . DG  B 18  ? 0.6625 0.8224 1.1923 -0.0833 -0.1146 -0.2988 18  DG  B OP2   
3051 O "O5'" . DG  B 18  ? 0.6616 0.7910 1.1518 -0.0894 -0.0436 -0.2736 18  DG  B "O5'" 
3052 C "C5'" . DG  B 18  ? 0.6501 0.7608 1.1055 -0.0858 -0.0119 -0.2530 18  DG  B "C5'" 
3053 C "C4'" . DG  B 18  ? 0.6715 0.7564 1.1053 -0.0910 0.0120  -0.2535 18  DG  B "C4'" 
3054 O "O4'" . DG  B 18  ? 0.6743 0.7511 1.0603 -0.0854 -0.0033 -0.2467 18  DG  B "O4'" 
3055 C "C3'" . DG  B 18  ? 0.6882 0.7724 1.1682 -0.1056 0.0206  -0.2783 18  DG  B "C3'" 
3056 O "O3'" . DG  B 18  ? 0.7174 0.7706 1.1836 -0.1113 0.0578  -0.2760 18  DG  B "O3'" 
3057 C "C2'" . DG  B 18  ? 0.6936 0.7821 1.1601 -0.1057 -0.0097 -0.2879 18  DG  B "C2'" 
3058 C "C1'" . DG  B 18  ? 0.6886 0.7655 1.0881 -0.0937 -0.0169 -0.2656 18  DG  B "C1'" 
3059 N N9    . DG  B 18  ? 0.6815 0.7666 1.0586 -0.0885 -0.0530 -0.2662 18  DG  B N9    
3060 C C8    . DG  B 18  ? 0.6807 0.7817 1.0857 -0.0893 -0.0857 -0.2814 18  DG  B C8    
3061 N N7    . DG  B 18  ? 0.6805 0.7739 1.0417 -0.0831 -0.1130 -0.2766 18  DG  B N7    
3062 C C5    . DG  B 18  ? 0.6690 0.7454 0.9774 -0.0797 -0.0944 -0.2587 18  DG  B C5    
3063 C C6    . DG  B 18  ? 0.6738 0.7339 0.9222 -0.0750 -0.1045 -0.2485 18  DG  B C6    
3064 O O6    . DG  B 18  ? 0.6852 0.7359 0.9047 -0.0729 -0.1323 -0.2513 18  DG  B O6    
3065 N N1    . DG  B 18  ? 0.6660 0.7166 0.8860 -0.0727 -0.0776 -0.2354 18  DG  B N1    
3066 C C2    . DG  B 18  ? 0.6524 0.7035 0.8911 -0.0724 -0.0488 -0.2310 18  DG  B C2    
3067 N N2    . DG  B 18  ? 0.6428 0.6830 0.8503 -0.0669 -0.0306 -0.2201 18  DG  B N2    
3068 N N3    . DG  B 18  ? 0.6536 0.7118 0.9373 -0.0770 -0.0380 -0.2382 18  DG  B N3    
3069 C C4    . DG  B 18  ? 0.6685 0.7415 0.9882 -0.0816 -0.0601 -0.2525 18  DG  B C4    
3070 P P     . DC  C 1   ? 0.8582 1.1255 0.9460 0.0227  -0.0422 -0.2083 1   DC  C P     
3071 O OP1   . DC  C 1   ? 0.7592 1.0237 0.8461 0.0198  -0.0485 -0.2088 1   DC  C OP1   
3072 O OP2   . DC  C 1   ? 0.8453 1.1096 0.9282 0.0217  -0.0385 -0.1937 1   DC  C OP2   
3073 O "O5'" . DC  C 1   ? 0.6397 0.8968 0.7436 0.0310  -0.0461 -0.2187 1   DC  C "O5'" 
3074 C "C5'" . DC  C 1   ? 0.5450 0.7845 0.6519 0.0368  -0.0487 -0.2118 1   DC  C "C5'" 
3075 C "C4'" . DC  C 1   ? 0.5009 0.7126 0.6108 0.0438  -0.0582 -0.2186 1   DC  C "C4'" 
3076 O "O4'" . DC  C 1   ? 0.4715 0.6712 0.5798 0.0363  -0.0579 -0.2177 1   DC  C "O4'" 
3077 C "C3'" . DC  C 1   ? 0.4756 0.6527 0.5740 0.0475  -0.0632 -0.2075 1   DC  C "C3'" 
3078 O "O3'" . DC  C 1   ? 0.4911 0.6363 0.5847 0.0583  -0.0772 -0.2170 1   DC  C "O3'" 
3079 C "C2'" . DC  C 1   ? 0.4732 0.6329 0.5620 0.0343  -0.0557 -0.1939 1   DC  C "C2'" 
3080 C "C1'" . DC  C 1   ? 0.4691 0.6396 0.5677 0.0293  -0.0551 -0.2044 1   DC  C "C1'" 
3081 N N1    . DC  C 1   ? 0.4275 0.6143 0.5329 0.0184  -0.0477 -0.1996 1   DC  C N1    
3082 C C2    . DC  C 1   ? 0.4353 0.6021 0.5389 0.0071  -0.0407 -0.1937 1   DC  C C2    
3083 O O2    . DC  C 1   ? 0.4661 0.5951 0.5526 0.0043  -0.0397 -0.1895 1   DC  C O2    
3084 N N3    . DC  C 1   ? 0.4286 0.6153 0.5473 -0.0009 -0.0359 -0.1953 1   DC  C N3    
3085 C C4    . DC  C 1   ? 0.4014 0.6184 0.5288 0.0041  -0.0419 -0.1992 1   DC  C C4    
3086 N N4    . DC  C 1   ? 0.3932 0.6263 0.5365 -0.0001 -0.0428 -0.2034 1   DC  C N4    
3087 C C5    . DC  C 1   ? 0.3946 0.6238 0.5125 0.0130  -0.0477 -0.2015 1   DC  C C5    
3088 C C6    . DC  C 1   ? 0.4121 0.6299 0.5232 0.0189  -0.0483 -0.2031 1   DC  C C6    
3089 P P     . DC  C 2   ? 0.5082 0.6564 0.6123 0.0767  -0.0914 -0.2322 2   DC  C P     
3090 O OP1   . DC  C 2   ? 0.5269 0.6465 0.6300 0.0889  -0.1089 -0.2479 2   DC  C OP1   
3091 O OP2   . DC  C 2   ? 0.4907 0.6915 0.6173 0.0753  -0.0810 -0.2426 2   DC  C OP2   
3092 O "O5'" . DC  C 2   ? 0.5183 0.6347 0.6013 0.0788  -0.0959 -0.2159 2   DC  C "O5'" 
3093 C "C5'" . DC  C 2   ? 0.5650 0.6209 0.6128 0.0754  -0.1024 -0.2028 2   DC  C "C5'" 
3094 C "C4'" . DC  C 2   ? 0.5814 0.6243 0.6099 0.0655  -0.0926 -0.1827 2   DC  C "C4'" 
3095 O "O4'" . DC  C 2   ? 0.5322 0.6097 0.5734 0.0491  -0.0719 -0.1737 2   DC  C "O4'" 
3096 C "C3'" . DC  C 2   ? 0.5780 0.6359 0.6140 0.0772  -0.0993 -0.1837 2   DC  C "C3'" 
3097 O "O3'" . DC  C 2   ? 0.6469 0.6606 0.6481 0.0727  -0.1002 -0.1672 2   DC  C "O3'" 
3098 C "C2'" . DC  C 2   ? 0.5221 0.6358 0.5827 0.0674  -0.0806 -0.1803 2   DC  C "C2'" 
3099 C "C1'" . DC  C 2   ? 0.5063 0.6126 0.5568 0.0498  -0.0660 -0.1673 2   DC  C "C1'" 
3100 N N1    . DC  C 2   ? 0.4607 0.6105 0.5305 0.0411  -0.0535 -0.1672 2   DC  C N1    
3101 C C2    . DC  C 2   ? 0.4290 0.5771 0.4974 0.0278  -0.0436 -0.1601 2   DC  C C2    
3102 O O2    . DC  C 2   ? 0.4327 0.5466 0.4854 0.0199  -0.0404 -0.1548 2   DC  C O2    
3103 N N3    . DC  C 2   ? 0.4057 0.5867 0.4881 0.0233  -0.0384 -0.1616 2   DC  C N3    
3104 C C4    . DC  C 2   ? 0.4127 0.6211 0.5009 0.0279  -0.0397 -0.1672 2   DC  C C4    
3105 N N4    . DC  C 2   ? 0.4231 0.6517 0.5132 0.0231  -0.0375 -0.1672 2   DC  C N4    
3106 C C5    . DC  C 2   ? 0.4079 0.6221 0.4990 0.0369  -0.0438 -0.1756 2   DC  C C5    
3107 C C6    . DC  C 2   ? 0.4222 0.6098 0.5086 0.0451  -0.0522 -0.1767 2   DC  C C6    
3108 P P     . DC  C 3   ? 0.7319 0.6947 0.7053 0.0907  -0.1262 -0.1704 3   DC  C P     
3109 O OP1   . DC  C 3   ? 0.7607 0.6757 0.7136 0.0993  -0.1450 -0.1795 3   DC  C OP1   
3110 O OP2   . DC  C 3   ? 0.6775 0.6839 0.6845 0.1060  -0.1342 -0.1835 3   DC  C OP2   
3111 O "O5'" . DC  C 3   ? 0.7719 0.6865 0.6986 0.0750  -0.1163 -0.1479 3   DC  C "O5'" 
3112 C "C5'" . DC  C 3   ? 0.8230 0.6956 0.7162 0.0539  -0.1023 -0.1374 3   DC  C "C5'" 
3113 C "C4'" . DC  C 3   ? 0.8287 0.7134 0.7179 0.0322  -0.0762 -0.1235 3   DC  C "C4'" 
3114 O "O4'" . DC  C 3   ? 0.7346 0.6919 0.6742 0.0283  -0.0610 -0.1268 3   DC  C "O4'" 
3115 C "C3'" . DC  C 3   ? 0.8597 0.7284 0.7274 0.0355  -0.0792 -0.1138 3   DC  C "C3'" 
3116 O "O3'" . DC  C 3   ? 0.9282 0.7754 0.7707 0.0106  -0.0556 -0.1028 3   DC  C "O3'" 
3117 C "C2'" . DC  C 3   ? 0.7741 0.7163 0.6934 0.0443  -0.0755 -0.1180 3   DC  C "C2'" 
3118 C "C1'" . DC  C 3   ? 0.7062 0.6917 0.6575 0.0310  -0.0567 -0.1205 3   DC  C "C1'" 
3119 N N1    . DC  C 3   ? 0.6241 0.6724 0.6191 0.0379  -0.0551 -0.1282 3   DC  C N1    
3120 C C2    . DC  C 3   ? 0.5786 0.6615 0.5953 0.0263  -0.0404 -0.1278 3   DC  C C2    
3121 O O2    . DC  C 3   ? 0.5898 0.6587 0.5990 0.0115  -0.0285 -0.1241 3   DC  C O2    
3122 N N3    . DC  C 3   ? 0.5359 0.6643 0.5793 0.0306  -0.0398 -0.1335 3   DC  C N3    
3123 C C4    . DC  C 3   ? 0.4938 0.6389 0.5469 0.0423  -0.0481 -0.1415 3   DC  C C4    
3124 N N4    . DC  C 3   ? 0.4568 0.6406 0.5278 0.0412  -0.0433 -0.1474 3   DC  C N4    
3125 C C5    . DC  C 3   ? 0.5153 0.6357 0.5586 0.0551  -0.0625 -0.1463 3   DC  C C5    
3126 C C6    . DC  C 3   ? 0.5851 0.6548 0.5972 0.0542  -0.0682 -0.1385 3   DC  C C6    
3127 P P     . DA  C 4   ? 1.0495 0.8368 0.8350 0.0039  -0.0558 -0.0910 4   DA  C P     
3128 O OP1   . DA  C 4   ? 1.1160 0.8149 0.8346 -0.0036 -0.0644 -0.0878 4   DA  C OP1   
3129 O OP2   . DA  C 4   ? 1.0114 0.8207 0.8112 0.0257  -0.0734 -0.0911 4   DA  C OP2   
3130 O "O5'" . DA  C 4   ? 0.9698 0.7816 0.7661 -0.0232 -0.0219 -0.0870 4   DA  C "O5'" 
3131 C "C5'" . DA  C 4   ? 0.9338 0.7396 0.7299 -0.0482 0.0007  -0.0921 4   DA  C "C5'" 
3132 C "C4'" . DA  C 4   ? 0.8440 0.7158 0.6922 -0.0601 0.0238  -0.0983 4   DA  C "C4'" 
3133 O "O4'" . DA  C 4   ? 0.7435 0.6820 0.6470 -0.0401 0.0124  -0.1022 4   DA  C "O4'" 
3134 C "C3'" . DA  C 4   ? 0.8331 0.7067 0.6726 -0.0696 0.0381  -0.0936 4   DA  C "C3'" 
3135 O "O3'" . DA  C 4   ? 0.8289 0.7283 0.6940 -0.0937 0.0658  -0.1055 4   DA  C "O3'" 
3136 C "C2'" . DA  C 4   ? 0.7608 0.6843 0.6366 -0.0452 0.0222  -0.0899 4   DA  C "C2'" 
3137 C "C1'" . DA  C 4   ? 0.7216 0.6931 0.6434 -0.0333 0.0134  -0.0976 4   DA  C "C1'" 
3138 N N9    . DA  C 4   ? 0.6902 0.6859 0.6286 -0.0096 -0.0072 -0.0961 4   DA  C N9    
3139 C C8    . DA  C 4   ? 0.7239 0.6937 0.6399 0.0062  -0.0260 -0.0928 4   DA  C C8    
3140 N N7    . DA  C 4   ? 0.6914 0.6998 0.6378 0.0227  -0.0380 -0.0982 4   DA  C N7    
3141 C C5    . DA  C 4   ? 0.6400 0.6951 0.6217 0.0170  -0.0272 -0.1020 4   DA  C C5    
3142 C C6    . DA  C 4   ? 0.5839 0.6857 0.5976 0.0244  -0.0299 -0.1079 4   DA  C C6    
3143 N N6    . DA  C 4   ? 0.5612 0.6785 0.5846 0.0372  -0.0405 -0.1138 4   DA  C N6    
3144 N N1    . DA  C 4   ? 0.5415 0.6719 0.5754 0.0169  -0.0213 -0.1098 4   DA  C N1    
3145 C C2    . DA  C 4   ? 0.5725 0.6940 0.6057 0.0040  -0.0105 -0.1098 4   DA  C C2    
3146 N N3    . DA  C 4   ? 0.6378 0.7230 0.6481 -0.0071 -0.0021 -0.1072 4   DA  C N3    
3147 C C4    . DA  C 4   ? 0.6495 0.6983 0.6292 -0.0004 -0.0110 -0.1014 4   DA  C C4    
3148 P P     . DA  C 5   ? 0.7998 0.7265 0.6820 -0.1045 0.0847  -0.1094 5   DA  C P     
3149 O OP1   . DA  C 5   ? 0.8534 0.7760 0.7387 -0.1367 0.1158  -0.1259 5   DA  C OP1   
3150 O OP2   . DA  C 5   ? 0.8615 0.7530 0.7014 -0.0956 0.0750  -0.0949 5   DA  C OP2   
3151 O "O5'" . DA  C 5   ? 0.6949 0.6994 0.6466 -0.0856 0.0749  -0.1156 5   DA  C "O5'" 
3152 C "C5'" . DA  C 5   ? 0.6601 0.7003 0.6523 -0.0831 0.0717  -0.1271 5   DA  C "C5'" 
3153 C "C4'" . DA  C 5   ? 0.5857 0.6855 0.6280 -0.0664 0.0609  -0.1313 5   DA  C "C4'" 
3154 O "O4'" . DA  C 5   ? 0.5422 0.6469 0.5784 -0.0442 0.0396  -0.1180 5   DA  C "O4'" 
3155 C "C3'" . DA  C 5   ? 0.5736 0.6952 0.6338 -0.0692 0.0697  -0.1355 5   DA  C "C3'" 
3156 O "O3'" . DA  C 5   ? 0.5523 0.7230 0.6639 -0.0632 0.0645  -0.1509 5   DA  C "O3'" 
3157 C "C2'" . DA  C 5   ? 0.5457 0.6600 0.5864 -0.0518 0.0550  -0.1176 5   DA  C "C2'" 
3158 C "C1'" . DA  C 5   ? 0.5189 0.6416 0.5627 -0.0353 0.0357  -0.1118 5   DA  C "C1'" 
3159 N N9    . DA  C 5   ? 0.4886 0.5929 0.5071 -0.0219 0.0224  -0.0988 5   DA  C N9    
3160 C C8    . DA  C 5   ? 0.5221 0.5822 0.5006 -0.0227 0.0206  -0.0911 5   DA  C C8    
3161 N N7    . DA  C 5   ? 0.5306 0.5891 0.5028 -0.0064 0.0041  -0.0858 5   DA  C N7    
3162 C C5    . DA  C 5   ? 0.4688 0.5716 0.4750 0.0019  -0.0011 -0.0894 5   DA  C C5    
3163 C C6    . DA  C 5   ? 0.4426 0.5668 0.4602 0.0150  -0.0127 -0.0899 5   DA  C C6    
3164 N N6    . DA  C 5   ? 0.4847 0.5958 0.4908 0.0253  -0.0236 -0.0899 5   DA  C N6    
3165 N N1    . DA  C 5   ? 0.3937 0.5518 0.4338 0.0161  -0.0128 -0.0932 5   DA  C N1    
3166 C C2    . DA  C 5   ? 0.4001 0.5706 0.4538 0.0092  -0.0070 -0.0963 5   DA  C C2    
3167 N N3    . DA  C 5   ? 0.4187 0.5796 0.4744 -0.0012 0.0028  -0.0997 5   DA  C N3    
3168 C C4    . DA  C 5   ? 0.4471 0.5737 0.4772 -0.0064 0.0079  -0.0957 5   DA  C C4    
3169 P P     . DT  C 6   ? 0.5641 0.7665 0.7124 -0.0676 0.0734  -0.1679 6   DT  C P     
3170 O OP1   . DT  C 6   ? 0.6052 0.8276 0.7889 -0.0849 0.0888  -0.1953 6   DT  C OP1   
3171 O OP2   . DT  C 6   ? 0.5755 0.7547 0.6949 -0.0733 0.0839  -0.1580 6   DT  C OP2   
3172 O "O5'" . DT  C 6   ? 0.5120 0.7466 0.6858 -0.0428 0.0472  -0.1651 6   DT  C "O5'" 
3173 C "C5'" . DT  C 6   ? 0.4889 0.7177 0.6452 -0.0300 0.0369  -0.1481 6   DT  C "C5'" 
3174 C "C4'" . DT  C 6   ? 0.4438 0.6763 0.5916 -0.0130 0.0155  -0.1358 6   DT  C "C4'" 
3175 O "O4'" . DT  C 6   ? 0.4397 0.6466 0.5520 -0.0116 0.0155  -0.1184 6   DT  C "O4'" 
3176 C "C3'" . DT  C 6   ? 0.4206 0.6650 0.5748 0.0005  0.0006  -0.1321 6   DT  C "C3'" 
3177 O "O3'" . DT  C 6   ? 0.3687 0.6279 0.5379 0.0109  -0.0179 -0.1399 6   DT  C "O3'" 
3178 C "C2'" . DT  C 6   ? 0.4230 0.6486 0.5442 0.0044  -0.0010 -0.1119 6   DT  C "C2'" 
3179 C "C1'" . DT  C 6   ? 0.4282 0.6373 0.5298 -0.0001 0.0042  -0.1064 6   DT  C "C1'" 
3180 N N1    . DT  C 6   ? 0.4115 0.5974 0.4862 -0.0009 0.0085  -0.0950 6   DT  C N1    
3181 C C2    . DT  C 6   ? 0.3908 0.5760 0.4535 0.0077  -0.0006 -0.0868 6   DT  C C2    
3182 O O2    . DT  C 6   ? 0.3976 0.5974 0.4651 0.0126  -0.0084 -0.0870 6   DT  C O2    
3183 N N3    . DT  C 6   ? 0.3919 0.5570 0.4348 0.0092  -0.0001 -0.0807 6   DT  C N3    
3184 C C4    . DT  C 6   ? 0.4137 0.5512 0.4375 0.0029  0.0072  -0.0790 6   DT  C C4    
3185 O O4    . DT  C 6   ? 0.4533 0.5695 0.4559 0.0076  0.0019  -0.0741 6   DT  C O4    
3186 C C5    . DT  C 6   ? 0.4184 0.5538 0.4487 -0.0101 0.0209  -0.0861 6   DT  C C5    
3187 C C7    . DT  C 6   ? 0.4432 0.5434 0.4448 -0.0230 0.0339  -0.0855 6   DT  C C7    
3188 C C6    . DT  C 6   ? 0.4049 0.5684 0.4652 -0.0111 0.0213  -0.0953 6   DT  C C6    
3189 P P     . DA  C 7   ? 0.3251 0.5970 0.5154 0.0231  -0.0353 -0.1503 7   DA  C P     
3190 O OP1   . DA  C 7   ? 0.3439 0.6243 0.5460 0.0329  -0.0559 -0.1619 7   DA  C OP1   
3191 O OP2   . DA  C 7   ? 0.3140 0.5990 0.5324 0.0163  -0.0215 -0.1650 7   DA  C OP2   
3192 O "O5'" . DA  C 7   ? 0.3399 0.5917 0.4944 0.0300  -0.0439 -0.1288 7   DA  C "O5'" 
3193 C "C5'" . DA  C 7   ? 0.3548 0.5921 0.4761 0.0317  -0.0507 -0.1145 7   DA  C "C5'" 
3194 C "C4'" . DA  C 7   ? 0.3613 0.5830 0.4547 0.0316  -0.0495 -0.0982 7   DA  C "C4'" 
3195 O "O4'" . DA  C 7   ? 0.3452 0.5657 0.4356 0.0243  -0.0320 -0.0918 7   DA  C "O4'" 
3196 C "C3'" . DA  C 7   ? 0.3747 0.5911 0.4716 0.0385  -0.0593 -0.0991 7   DA  C "C3'" 
3197 O "O3'" . DA  C 7   ? 0.4006 0.5952 0.4617 0.0392  -0.0671 -0.0856 7   DA  C "O3'" 
3198 C "C2'" . DA  C 7   ? 0.3617 0.5839 0.4703 0.0325  -0.0419 -0.0982 7   DA  C "C2'" 
3199 C "C1'" . DA  C 7   ? 0.3522 0.5679 0.4408 0.0252  -0.0298 -0.0871 7   DA  C "C1'" 
3200 N N9    . DA  C 7   ? 0.3396 0.5526 0.4299 0.0184  -0.0142 -0.0863 7   DA  C N9    
3201 C C8    . DA  C 7   ? 0.3166 0.5328 0.4224 0.0123  -0.0029 -0.0960 7   DA  C C8    
3202 N N7    . DA  C 7   ? 0.3201 0.5202 0.4087 0.0053  0.0089  -0.0907 7   DA  C N7    
3203 C C5    . DA  C 7   ? 0.3178 0.5092 0.3864 0.0104  0.0024  -0.0791 7   DA  C C5    
3204 C C6    . DA  C 7   ? 0.3182 0.4916 0.3652 0.0105  0.0040  -0.0722 7   DA  C C6    
3205 N N6    . DA  C 7   ? 0.3301 0.4808 0.3601 0.0045  0.0121  -0.0718 7   DA  C N6    
3206 N N1    . DA  C 7   ? 0.3110 0.4878 0.3524 0.0164  -0.0039 -0.0683 7   DA  C N1    
3207 C C2    . DA  C 7   ? 0.2911 0.4830 0.3392 0.0182  -0.0093 -0.0685 7   DA  C C2    
3208 N N3    . DA  C 7   ? 0.3048 0.5050 0.3621 0.0184  -0.0132 -0.0710 7   DA  C N3    
3209 C C4    . DA  C 7   ? 0.3198 0.5216 0.3909 0.0163  -0.0088 -0.0773 7   DA  C C4    
3210 P P     . DC  C 8   ? 0.4756 0.6494 0.5231 0.0493  -0.0899 -0.0863 8   DC  C P     
3211 O OP1   . DC  C 8   ? 0.5442 0.7111 0.5873 0.0575  -0.1105 -0.0951 8   DC  C OP1   
3212 O OP2   . DC  C 8   ? 0.4851 0.6696 0.5619 0.0547  -0.0892 -0.0944 8   DC  C OP2   
3213 O "O5'" . DC  C 8   ? 0.5274 0.6733 0.5277 0.0408  -0.0869 -0.0690 8   DC  C "O5'" 
3214 C "C5'" . DC  C 8   ? 0.5203 0.6662 0.5186 0.0348  -0.0735 -0.0611 8   DC  C "C5'" 
3215 C "C4'" . DC  C 8   ? 0.5123 0.6716 0.5093 0.0238  -0.0533 -0.0569 8   DC  C "C4'" 
3216 O "O4'" . DC  C 8   ? 0.4893 0.6711 0.5181 0.0256  -0.0431 -0.0630 8   DC  C "O4'" 
3217 C "C3'" . DC  C 8   ? 0.5193 0.6724 0.5035 0.0163  -0.0435 -0.0497 8   DC  C "C3'" 
3218 O "O3'" . DC  C 8   ? 0.5266 0.6614 0.4752 0.0049  -0.0413 -0.0452 8   DC  C "O3'" 
3219 C "C2'" . DC  C 8   ? 0.4940 0.6687 0.4984 0.0140  -0.0292 -0.0528 8   DC  C "C2'" 
3220 C "C1'" . DC  C 8   ? 0.4723 0.6589 0.5001 0.0201  -0.0300 -0.0591 8   DC  C "C1'" 
3221 N N1    . DC  C 8   ? 0.4502 0.6415 0.4952 0.0223  -0.0239 -0.0613 8   DC  C N1    
3222 C C2    . DC  C 8   ? 0.4109 0.6014 0.4530 0.0201  -0.0156 -0.0590 8   DC  C C2    
3223 O O2    . DC  C 8   ? 0.4506 0.6428 0.4845 0.0179  -0.0144 -0.0580 8   DC  C O2    
3224 N N3    . DC  C 8   ? 0.4092 0.5956 0.4561 0.0200  -0.0097 -0.0604 8   DC  C N3    
3225 C C4    . DC  C 8   ? 0.3938 0.5835 0.4544 0.0197  -0.0076 -0.0664 8   DC  C C4    
3226 N N4    . DC  C 8   ? 0.3740 0.5570 0.4338 0.0156  0.0023  -0.0692 8   DC  C N4    
3227 C C5    . DC  C 8   ? 0.4078 0.6063 0.4826 0.0236  -0.0165 -0.0728 8   DC  C C5    
3228 C C6    . DC  C 8   ? 0.4266 0.6225 0.4900 0.0260  -0.0265 -0.0686 8   DC  C C6    
3229 P P     . DC  C 9   ? 0.5421 0.6546 0.4653 -0.0039 -0.0388 -0.0386 9   DC  C P     
3230 O OP1   . DC  C 9   ? 0.6142 0.7019 0.4930 -0.0201 -0.0344 -0.0363 9   DC  C OP1   
3231 O OP2   . DC  C 9   ? 0.5486 0.6470 0.4761 0.0076  -0.0537 -0.0360 9   DC  C OP2   
3232 O "O5'" . DC  C 9   ? 0.5043 0.6436 0.4532 -0.0080 -0.0223 -0.0427 9   DC  C "O5'" 
3233 C "C5'" . DC  C 9   ? 0.4646 0.6258 0.4242 -0.0142 -0.0103 -0.0510 9   DC  C "C5'" 
3234 C "C4'" . DC  C 9   ? 0.4361 0.6156 0.4178 -0.0143 -0.0022 -0.0569 9   DC  C "C4'" 
3235 O "O4'" . DC  C 9   ? 0.3783 0.5647 0.3816 -0.0007 -0.0077 -0.0555 9   DC  C "O4'" 
3236 C "C3'" . DC  C 9   ? 0.4229 0.5906 0.3929 -0.0228 0.0015  -0.0545 9   DC  C "C3'" 
3237 O "O3'" . DC  C 9   ? 0.4073 0.5962 0.3929 -0.0309 0.0129  -0.0678 9   DC  C "O3'" 
3238 C "C2'" . DC  C 9   ? 0.3980 0.5618 0.3803 -0.0099 -0.0072 -0.0483 9   DC  C "C2'" 
3239 C "C1'" . DC  C 9   ? 0.3793 0.5602 0.3848 0.0011  -0.0085 -0.0524 9   DC  C "C1'" 
3240 N N1    . DC  C 9   ? 0.3804 0.5563 0.3937 0.0108  -0.0141 -0.0484 9   DC  C N1    
3241 C C2    . DC  C 9   ? 0.3769 0.5564 0.4008 0.0163  -0.0123 -0.0506 9   DC  C C2    
3242 O O2    . DC  C 9   ? 0.3651 0.5498 0.3919 0.0168  -0.0110 -0.0553 9   DC  C O2    
3243 N N3    . DC  C 9   ? 0.3705 0.5455 0.3995 0.0203  -0.0122 -0.0501 9   DC  C N3    
3244 C C4    . DC  C 9   ? 0.3505 0.5248 0.3846 0.0219  -0.0163 -0.0506 9   DC  C C4    
3245 N N4    . DC  C 9   ? 0.3378 0.5141 0.3842 0.0239  -0.0134 -0.0559 9   DC  C N4    
3246 C C5    . DC  C 9   ? 0.3630 0.5321 0.3874 0.0209  -0.0242 -0.0483 9   DC  C C5    
3247 C C6    . DC  C 9   ? 0.3852 0.5517 0.3944 0.0139  -0.0216 -0.0456 9   DC  C C6    
3248 P P     . DA  C 10  ? 0.4186 0.6024 0.3965 -0.0456 0.0221  -0.0719 10  DA  C P     
3249 O OP1   . DA  C 10  ? 0.4303 0.6429 0.4285 -0.0570 0.0360  -0.0932 10  DA  C OP1   
3250 O OP2   . DA  C 10  ? 0.4831 0.6284 0.4184 -0.0563 0.0206  -0.0590 10  DA  C OP2   
3251 O "O5'" . DA  C 10  ? 0.3814 0.5699 0.3802 -0.0313 0.0136  -0.0695 10  DA  C "O5'" 
3252 C "C5'" . DA  C 10  ? 0.3536 0.5665 0.3833 -0.0202 0.0105  -0.0815 10  DA  C "C5'" 
3253 C "C4'" . DA  C 10  ? 0.3236 0.5287 0.3583 -0.0077 0.0013  -0.0756 10  DA  C "C4'" 
3254 O "O4'" . DA  C 10  ? 0.3205 0.5104 0.3451 0.0011  -0.0048 -0.0623 10  DA  C "O4'" 
3255 C "C3'" . DA  C 10  ? 0.3249 0.5198 0.3525 -0.0148 0.0035  -0.0731 10  DA  C "C3'" 
3256 O "O3'" . DA  C 10  ? 0.2985 0.5115 0.3477 -0.0144 0.0037  -0.0888 10  DA  C "O3'" 
3257 C "C2'" . DA  C 10  ? 0.3348 0.5118 0.3541 -0.0039 -0.0047 -0.0600 10  DA  C "C2'" 
3258 C "C1'" . DA  C 10  ? 0.3150 0.4944 0.3380 0.0064  -0.0087 -0.0574 10  DA  C "C1'" 
3259 N N9    . DA  C 10  ? 0.3058 0.4729 0.3221 0.0108  -0.0118 -0.0485 10  DA  C N9    
3260 C C8    . DA  C 10  ? 0.3199 0.4768 0.3255 0.0078  -0.0147 -0.0434 10  DA  C C8    
3261 N N7    . DA  C 10  ? 0.3148 0.4677 0.3256 0.0154  -0.0197 -0.0420 10  DA  C N7    
3262 C C5    . DA  C 10  ? 0.3022 0.4612 0.3232 0.0198  -0.0156 -0.0450 10  DA  C C5    
3263 C C6    . DA  C 10  ? 0.2897 0.4488 0.3191 0.0239  -0.0133 -0.0484 10  DA  C C6    
3264 N N6    . DA  C 10  ? 0.2933 0.4547 0.3338 0.0270  -0.0166 -0.0526 10  DA  C N6    
3265 N N1    . DA  C 10  ? 0.2839 0.4388 0.3086 0.0239  -0.0078 -0.0500 10  DA  C N1    
3266 C C2    . DA  C 10  ? 0.3046 0.4570 0.3212 0.0244  -0.0098 -0.0493 10  DA  C C2    
3267 N N3    . DA  C 10  ? 0.2915 0.4516 0.3105 0.0227  -0.0129 -0.0501 10  DA  C N3    
3268 C C4    . DA  C 10  ? 0.3015 0.4647 0.3215 0.0183  -0.0131 -0.0474 10  DA  C C4    
3269 P P     . DG  C 11  ? 0.3168 0.5248 0.3665 -0.0215 0.0058  -0.0916 11  DG  C P     
3270 O OP1   . DG  C 11  ? 0.2962 0.5324 0.3743 -0.0276 0.0102  -0.1159 11  DG  C OP1   
3271 O OP2   . DG  C 11  ? 0.3453 0.5269 0.3662 -0.0342 0.0113  -0.0780 11  DG  C OP2   
3272 O "O5'" . DG  C 11  ? 0.2837 0.4815 0.3335 -0.0036 -0.0072 -0.0848 11  DG  C "O5'" 
3273 C "C5'" . DG  C 11  ? 0.2779 0.4803 0.3361 0.0121  -0.0180 -0.0903 11  DG  C "C5'" 
3274 C "C4'" . DG  C 11  ? 0.2785 0.4622 0.3245 0.0222  -0.0261 -0.0836 11  DG  C "C4'" 
3275 O "O4'" . DG  C 11  ? 0.2768 0.4440 0.3059 0.0234  -0.0229 -0.0687 11  DG  C "O4'" 
3276 C "C3'" . DG  C 11  ? 0.2798 0.4608 0.3271 0.0169  -0.0247 -0.0852 11  DG  C "C3'" 
3277 O "O3'" . DG  C 11  ? 0.2991 0.4754 0.3470 0.0277  -0.0363 -0.0929 11  DG  C "O3'" 
3278 C "C2'" . DG  C 11  ? 0.2856 0.4491 0.3166 0.0135  -0.0197 -0.0697 11  DG  C "C2'" 
3279 C "C1'" . DG  C 11  ? 0.2802 0.4364 0.3025 0.0212  -0.0209 -0.0626 11  DG  C "C1'" 
3280 N N9    . DG  C 11  ? 0.2672 0.4178 0.2848 0.0182  -0.0169 -0.0537 11  DG  C N9    
3281 C C8    . DG  C 11  ? 0.2765 0.4266 0.2912 0.0101  -0.0146 -0.0505 11  DG  C C8    
3282 N N7    . DG  C 11  ? 0.2776 0.4193 0.2878 0.0128  -0.0169 -0.0448 11  DG  C N7    
3283 C C5    . DG  C 11  ? 0.2645 0.4067 0.2802 0.0206  -0.0167 -0.0462 11  DG  C C5    
3284 C C6    . DG  C 11  ? 0.2621 0.4032 0.2840 0.0251  -0.0169 -0.0475 11  DG  C C6    
3285 O O6    . DG  C 11  ? 0.2763 0.4157 0.3022 0.0272  -0.0222 -0.0476 11  DG  C O6    
3286 N N1    . DG  C 11  ? 0.2573 0.3978 0.2795 0.0268  -0.0108 -0.0518 11  DG  C N1    
3287 C C2    . DG  C 11  ? 0.2704 0.4043 0.2806 0.0267  -0.0092 -0.0521 11  DG  C C2    
3288 N N2    . DG  C 11  ? 0.2715 0.3955 0.2713 0.0258  -0.0025 -0.0556 11  DG  C N2    
3289 N N3    . DG  C 11  ? 0.2530 0.3884 0.2605 0.0268  -0.0143 -0.0517 11  DG  C N3    
3290 C C4    . DG  C 11  ? 0.2588 0.4021 0.2732 0.0227  -0.0159 -0.0499 11  DG  C C4    
3291 P P     . DT  C 12  ? 0.3232 0.4928 0.3697 0.0257  -0.0375 -0.0945 12  DT  C P     
3292 O OP1   . DT  C 12  ? 0.3127 0.4864 0.3681 0.0364  -0.0523 -0.1107 12  DT  C OP1   
3293 O OP2   . DT  C 12  ? 0.3201 0.4956 0.3728 0.0095  -0.0257 -0.0933 12  DT  C OP2   
3294 O "O5'" . DT  C 12  ? 0.3356 0.4805 0.3572 0.0311  -0.0369 -0.0799 12  DT  C "O5'" 
3295 C "C5'" . DT  C 12  ? 0.3629 0.4926 0.3660 0.0397  -0.0415 -0.0765 12  DT  C "C5'" 
3296 C "C4'" . DT  C 12  ? 0.3879 0.4965 0.3692 0.0400  -0.0367 -0.0692 12  DT  C "C4'" 
3297 O "O4'" . DT  C 12  ? 0.3703 0.4833 0.3567 0.0341  -0.0254 -0.0618 12  DT  C "O4'" 
3298 C "C3'" . DT  C 12  ? 0.3986 0.5034 0.3799 0.0395  -0.0380 -0.0724 12  DT  C "C3'" 
3299 O "O3'" . DT  C 12  ? 0.4625 0.5423 0.4147 0.0433  -0.0394 -0.0722 12  DT  C "O3'" 
3300 C "C2'" . DT  C 12  ? 0.3840 0.4950 0.3766 0.0329  -0.0285 -0.0668 12  DT  C "C2'" 
3301 C "C1'" . DT  C 12  ? 0.3724 0.4841 0.3632 0.0318  -0.0217 -0.0612 12  DT  C "C1'" 
3302 N N1    . DT  C 12  ? 0.3471 0.4675 0.3516 0.0281  -0.0190 -0.0571 12  DT  C N1    
3303 C C2    . DT  C 12  ? 0.3529 0.4731 0.3613 0.0291  -0.0145 -0.0570 12  DT  C C2    
3304 O O2    . DT  C 12  ? 0.3791 0.4950 0.3819 0.0294  -0.0079 -0.0612 12  DT  C O2    
3305 N N3    . DT  C 12  ? 0.3461 0.4692 0.3635 0.0286  -0.0180 -0.0543 12  DT  C N3    
3306 C C4    . DT  C 12  ? 0.3351 0.4552 0.3489 0.0239  -0.0225 -0.0495 12  DT  C C4    
3307 O O4    . DT  C 12  ? 0.3901 0.5033 0.4019 0.0238  -0.0275 -0.0465 12  DT  C O4    
3308 C C5    . DT  C 12  ? 0.3269 0.4502 0.3379 0.0186  -0.0213 -0.0511 12  DT  C C5    
3309 C C7    . DT  C 12  ? 0.3370 0.4579 0.3431 0.0076  -0.0201 -0.0499 12  DT  C C7    
3310 C C6    . DT  C 12  ? 0.3189 0.4451 0.3297 0.0227  -0.0212 -0.0559 12  DT  C C6    
3311 P P     . DC  C 13  ? 0.4929 0.5605 0.4338 0.0467  -0.0463 -0.0785 13  DC  C P     
3312 O OP1   . DC  C 13  ? 0.5395 0.5754 0.4421 0.0534  -0.0570 -0.0805 13  DC  C OP1   
3313 O OP2   . DC  C 13  ? 0.4853 0.5743 0.4553 0.0461  -0.0522 -0.0856 13  DC  C OP2   
3314 O "O5'" . DC  C 13  ? 0.4934 0.5585 0.4332 0.0403  -0.0320 -0.0756 13  DC  C "O5'" 
3315 C "C5'" . DC  C 13  ? 0.4974 0.5489 0.4177 0.0354  -0.0192 -0.0739 13  DC  C "C5'" 
3316 C "C4'" . DC  C 13  ? 0.4967 0.5604 0.4366 0.0314  -0.0079 -0.0777 13  DC  C "C4'" 
3317 O "O4'" . DC  C 13  ? 0.4609 0.5454 0.4307 0.0317  -0.0084 -0.0742 13  DC  C "O4'" 
3318 C "C3'" . DC  C 13  ? 0.5048 0.5688 0.4516 0.0339  -0.0126 -0.0829 13  DC  C "C3'" 
3319 O "O3'" . DC  C 13  ? 0.5085 0.5688 0.4525 0.0306  -0.0012 -0.0917 13  DC  C "O3'" 
3320 C "C2'" . DC  C 13  ? 0.4765 0.5576 0.4536 0.0350  -0.0181 -0.0798 13  DC  C "C2'" 
3321 C "C1'" . DC  C 13  ? 0.4610 0.5516 0.4493 0.0336  -0.0120 -0.0770 13  DC  C "C1'" 
3322 N N1    . DC  C 13  ? 0.4364 0.5354 0.4403 0.0334  -0.0181 -0.0708 13  DC  C N1    
3323 C C2    . DC  C 13  ? 0.4213 0.5262 0.4390 0.0351  -0.0174 -0.0715 13  DC  C C2    
3324 O O2    . DC  C 13  ? 0.4241 0.5340 0.4489 0.0361  -0.0100 -0.0803 13  DC  C O2    
3325 N N3    . DC  C 13  ? 0.3958 0.4994 0.4173 0.0344  -0.0248 -0.0651 13  DC  C N3    
3326 C C4    . DC  C 13  ? 0.3988 0.4982 0.4123 0.0287  -0.0277 -0.0593 13  DC  C C4    
3327 N N4    . DC  C 13  ? 0.3985 0.4907 0.4072 0.0243  -0.0319 -0.0534 13  DC  C N4    
3328 C C5    . DC  C 13  ? 0.4103 0.5115 0.4195 0.0263  -0.0266 -0.0620 13  DC  C C5    
3329 C C6    . DC  C 13  ? 0.4261 0.5258 0.4300 0.0306  -0.0243 -0.0671 13  DC  C C6    
3330 N N     . MET D 1   ? 0.5222 0.5263 0.5552 -0.0863 -0.0216 0.0721  1   MET D N     
3331 C CA    . MET D 1   ? 0.5051 0.5145 0.5284 -0.0818 -0.0155 0.0638  1   MET D CA    
3332 C C     . MET D 1   ? 0.4582 0.4640 0.4746 -0.0781 -0.0179 0.0610  1   MET D C     
3333 O O     . MET D 1   ? 0.4475 0.4478 0.4722 -0.0760 -0.0236 0.0605  1   MET D O     
3334 C CB    . MET D 1   ? 0.5514 0.5636 0.5850 -0.0774 -0.0138 0.0554  1   MET D CB    
3335 C CG    . MET D 1   ? 0.6181 0.6349 0.6439 -0.0723 -0.0087 0.0472  1   MET D CG    
3336 S SD    . MET D 1   ? 0.7124 0.7317 0.7503 -0.0667 -0.0085 0.0377  1   MET D SD    
3337 C CE    . MET D 1   ? 0.6738 0.7014 0.7028 -0.0653 -0.0005 0.0337  1   MET D CE    
3338 N N     . ILE D 2   ? 0.4262 0.4351 0.4284 -0.0774 -0.0136 0.0592  2   ILE D N     
3339 C CA    . ILE D 2   ? 0.4148 0.4207 0.4104 -0.0742 -0.0155 0.0564  2   ILE D CA    
3340 C C     . ILE D 2   ? 0.3796 0.3896 0.3700 -0.0695 -0.0101 0.0481  2   ILE D C     
3341 O O     . ILE D 2   ? 0.3646 0.3798 0.3471 -0.0703 -0.0044 0.0467  2   ILE D O     
3342 C CB    . ILE D 2   ? 0.4422 0.4466 0.4249 -0.0782 -0.0171 0.0628  2   ILE D CB    
3343 C CG1   . ILE D 2   ? 0.4637 0.4639 0.4514 -0.0832 -0.0230 0.0724  2   ILE D CG1   
3344 C CG2   . ILE D 2   ? 0.4454 0.4467 0.4236 -0.0750 -0.0198 0.0596  2   ILE D CG2   
3345 C CD1   . ILE D 2   ? 0.4881 0.4884 0.4616 -0.0882 -0.0240 0.0799  2   ILE D CD1   
3346 N N     . VAL D 3   ? 0.3509 0.3589 0.3469 -0.0646 -0.0120 0.0426  3   VAL D N     
3347 C CA    . VAL D 3   ? 0.3376 0.3488 0.3308 -0.0598 -0.0078 0.0352  3   VAL D CA    
3348 C C     . VAL D 3   ? 0.3303 0.3388 0.3177 -0.0578 -0.0094 0.0338  3   VAL D C     
3349 O O     . VAL D 3   ? 0.3254 0.3299 0.3178 -0.0573 -0.0144 0.0353  3   VAL D O     
3350 C CB    . VAL D 3   ? 0.3225 0.3348 0.3273 -0.0557 -0.0082 0.0299  3   VAL D CB    
3351 C CG1   . VAL D 3   ? 0.3203 0.3362 0.3218 -0.0511 -0.0041 0.0234  3   VAL D CG1   
3352 C CG2   . VAL D 3   ? 0.3189 0.3335 0.3312 -0.0581 -0.0076 0.0314  3   VAL D CG2   
3353 N N     . LEU D 4   ? 0.3289 0.3396 0.3064 -0.0568 -0.0053 0.0310  4   LEU D N     
3354 C CA    . LEU D 4   ? 0.3242 0.3326 0.2967 -0.0549 -0.0064 0.0290  4   LEU D CA    
3355 C C     . LEU D 4   ? 0.3279 0.3387 0.3017 -0.0502 -0.0028 0.0228  4   LEU D C     
3356 O O     . LEU D 4   ? 0.3297 0.3439 0.2992 -0.0494 0.0018  0.0201  4   LEU D O     
3357 C CB    . LEU D 4   ? 0.3408 0.3488 0.3004 -0.0581 -0.0057 0.0311  4   LEU D CB    
3358 C CG    . LEU D 4   ? 0.3438 0.3486 0.2983 -0.0573 -0.0083 0.0301  4   LEU D CG    
3359 C CD1   . LEU D 4   ? 0.3630 0.3666 0.3061 -0.0616 -0.0100 0.0339  4   LEU D CD1   
3360 C CD2   . LEU D 4   ? 0.3332 0.3393 0.2855 -0.0536 -0.0045 0.0240  4   LEU D CD2   
3361 N N     . PHE D 5   ? 0.3217 0.3312 0.3015 -0.0470 -0.0050 0.0207  5   PHE D N     
3362 C CA    . PHE D 5   ? 0.3110 0.3229 0.2930 -0.0425 -0.0022 0.0158  5   PHE D CA    
3363 C C     . PHE D 5   ? 0.3153 0.3252 0.2925 -0.0416 -0.0024 0.0150  5   PHE D C     
3364 O O     . PHE D 5   ? 0.3068 0.3136 0.2842 -0.0430 -0.0062 0.0174  5   PHE D O     
3365 C CB    . PHE D 5   ? 0.3127 0.3256 0.3052 -0.0396 -0.0041 0.0140  5   PHE D CB    
3366 C CG    . PHE D 5   ? 0.3086 0.3243 0.3029 -0.0352 -0.0017 0.0098  5   PHE D CG    
3367 C CD1   . PHE D 5   ? 0.3107 0.3301 0.3036 -0.0331 0.0019  0.0069  5   PHE D CD1   
3368 C CD2   . PHE D 5   ? 0.3090 0.3244 0.3067 -0.0332 -0.0032 0.0093  5   PHE D CD2   
3369 C CE1   . PHE D 5   ? 0.3088 0.3309 0.3028 -0.0292 0.0036  0.0040  5   PHE D CE1   
3370 C CE2   . PHE D 5   ? 0.3127 0.3313 0.3115 -0.0296 -0.0008 0.0064  5   PHE D CE2   
3371 C CZ    . PHE D 5   ? 0.3051 0.3269 0.3017 -0.0276 0.0024  0.0040  5   PHE D CZ    
3372 N N     . VAL D 6   ? 0.3001 0.3116 0.2738 -0.0393 0.0012  0.0118  6   VAL D N     
3373 C CA    . VAL D 6   ? 0.2965 0.3059 0.2671 -0.0385 0.0010  0.0109  6   VAL D CA    
3374 C C     . VAL D 6   ? 0.2911 0.3026 0.2663 -0.0344 0.0029  0.0084  6   VAL D C     
3375 O O     . VAL D 6   ? 0.3083 0.3228 0.2842 -0.0323 0.0058  0.0063  6   VAL D O     
3376 C CB    . VAL D 6   ? 0.2945 0.3028 0.2560 -0.0398 0.0031  0.0095  6   VAL D CB    
3377 C CG1   . VAL D 6   ? 0.3002 0.3055 0.2599 -0.0390 0.0021  0.0083  6   VAL D CG1   
3378 C CG2   . VAL D 6   ? 0.3014 0.3088 0.2566 -0.0440 0.0018  0.0122  6   VAL D CG2   
3379 N N     . ASP D 7   ? 0.3098 0.3203 0.2884 -0.0336 0.0011  0.0090  7   ASP D N     
3380 C CA    . ASP D 7   ? 0.3089 0.3219 0.2916 -0.0303 0.0028  0.0077  7   ASP D CA    
3381 C C     . ASP D 7   ? 0.3135 0.3237 0.2950 -0.0308 0.0021  0.0085  7   ASP D C     
3382 O O     . ASP D 7   ? 0.3153 0.3233 0.2984 -0.0328 -0.0011 0.0103  7   ASP D O     
3383 C CB    . ASP D 7   ? 0.3252 0.3409 0.3156 -0.0289 0.0014  0.0079  7   ASP D CB    
3384 C CG    . ASP D 7   ? 0.3507 0.3707 0.3444 -0.0254 0.0038  0.0066  7   ASP D CG    
3385 O OD1   . ASP D 7   ? 0.3536 0.3735 0.3449 -0.0245 0.0057  0.0069  7   ASP D OD1   
3386 O OD2   . ASP D 7   ? 0.3804 0.4040 0.3794 -0.0235 0.0036  0.0053  7   ASP D OD2   
3387 N N     . PHE D 8   ? 0.3020 0.3121 0.2817 -0.0292 0.0044  0.0075  8   PHE D N     
3388 C CA    . PHE D 8   ? 0.3221 0.3287 0.3011 -0.0301 0.0034  0.0080  8   PHE D CA    
3389 C C     . PHE D 8   ? 0.3219 0.3305 0.3079 -0.0293 0.0028  0.0101  8   PHE D C     
3390 O O     . PHE D 8   ? 0.3311 0.3442 0.3206 -0.0268 0.0049  0.0103  8   PHE D O     
3391 C CB    . PHE D 8   ? 0.3339 0.3392 0.3100 -0.0285 0.0058  0.0063  8   PHE D CB    
3392 C CG    . PHE D 8   ? 0.3370 0.3421 0.3075 -0.0285 0.0075  0.0037  8   PHE D CG    
3393 C CD1   . PHE D 8   ? 0.3413 0.3462 0.3077 -0.0310 0.0066  0.0035  8   PHE D CD1   
3394 C CD2   . PHE D 8   ? 0.3461 0.3517 0.3161 -0.0261 0.0100  0.0017  8   PHE D CD2   
3395 C CE1   . PHE D 8   ? 0.3589 0.3649 0.3205 -0.0312 0.0089  0.0012  8   PHE D CE1   
3396 C CE2   . PHE D 8   ? 0.3433 0.3497 0.3094 -0.0259 0.0120  -0.0010 8   PHE D CE2   
3397 C CZ    . PHE D 8   ? 0.3526 0.3597 0.3144 -0.0286 0.0118  -0.0013 8   PHE D CZ    
3398 N N     . ASP D 9   ? 0.3254 0.3314 0.3135 -0.0314 0.0000  0.0115  9   ASP D N     
3399 C CA    . ASP D 9   ? 0.3177 0.3265 0.3136 -0.0311 -0.0005 0.0136  9   ASP D CA    
3400 C C     . ASP D 9   ? 0.3188 0.3289 0.3171 -0.0296 0.0021  0.0149  9   ASP D C     
3401 O O     . ASP D 9   ? 0.3203 0.3261 0.3158 -0.0302 0.0019  0.0146  9   ASP D O     
3402 C CB    . ASP D 9   ? 0.3280 0.3336 0.3263 -0.0340 -0.0047 0.0149  9   ASP D CB    
3403 C CG    . ASP D 9   ? 0.3275 0.3317 0.3241 -0.0358 -0.0081 0.0149  9   ASP D CG    
3404 O OD1   . ASP D 9   ? 0.3120 0.3190 0.3105 -0.0347 -0.0077 0.0147  9   ASP D OD1   
3405 O OD2   . ASP D 9   ? 0.3447 0.3449 0.3387 -0.0386 -0.0118 0.0153  9   ASP D OD2   
3406 N N     . TYR D 10  ? 0.3062 0.3222 0.3097 -0.0276 0.0043  0.0163  10  TYR D N     
3407 C CA    . TYR D 10  ? 0.3081 0.3266 0.3141 -0.0264 0.0070  0.0188  10  TYR D CA    
3408 C C     . TYR D 10  ? 0.3074 0.3213 0.3090 -0.0261 0.0075  0.0187  10  TYR D C     
3409 O O     . TYR D 10  ? 0.3010 0.3117 0.3050 -0.0273 0.0069  0.0207  10  TYR D O     
3410 C CB    . TYR D 10  ? 0.3131 0.3330 0.3267 -0.0282 0.0062  0.0218  10  TYR D CB    
3411 C CG    . TYR D 10  ? 0.3215 0.3349 0.3365 -0.0315 0.0023  0.0222  10  TYR D CG    
3412 C CD1   . TYR D 10  ? 0.3311 0.3421 0.3461 -0.0334 -0.0015 0.0207  10  TYR D CD1   
3413 C CD2   . TYR D 10  ? 0.3268 0.3366 0.3437 -0.0328 0.0020  0.0242  10  TYR D CD2   
3414 C CE1   . TYR D 10  ? 0.3235 0.3289 0.3391 -0.0365 -0.0055 0.0207  10  TYR D CE1   
3415 C CE2   . TYR D 10  ? 0.3268 0.3306 0.3453 -0.0358 -0.0020 0.0238  10  TYR D CE2   
3416 C CZ    . TYR D 10  ? 0.3344 0.3363 0.3518 -0.0376 -0.0058 0.0218  10  TYR D CZ    
3417 O OH    . TYR D 10  ? 0.3532 0.3496 0.3714 -0.0405 -0.0102 0.0210  10  TYR D OH    
3418 N N     . PHE D 11  ? 0.3147 0.3284 0.3108 -0.0244 0.0086  0.0162  11  PHE D N     
3419 C CA    . PHE D 11  ? 0.3141 0.3226 0.3058 -0.0243 0.0084  0.0144  11  PHE D CA    
3420 C C     . PHE D 11  ? 0.3132 0.3192 0.3072 -0.0237 0.0089  0.0167  11  PHE D C     
3421 O O     . PHE D 11  ? 0.2934 0.2936 0.2879 -0.0253 0.0069  0.0160  11  PHE D O     
3422 C CB    . PHE D 11  ? 0.3144 0.3248 0.3016 -0.0223 0.0099  0.0116  11  PHE D CB    
3423 C CG    . PHE D 11  ? 0.3208 0.3268 0.3042 -0.0221 0.0100  0.0090  11  PHE D CG    
3424 C CD1   . PHE D 11  ? 0.3296 0.3302 0.3106 -0.0245 0.0080  0.0072  11  PHE D CD1   
3425 C CD2   . PHE D 11  ? 0.3378 0.3453 0.3201 -0.0194 0.0119  0.0079  11  PHE D CD2   
3426 C CE1   . PHE D 11  ? 0.3557 0.3529 0.3334 -0.0241 0.0084  0.0039  11  PHE D CE1   
3427 C CE2   . PHE D 11  ? 0.3475 0.3515 0.3275 -0.0188 0.0122  0.0049  11  PHE D CE2   
3428 C CZ    . PHE D 11  ? 0.3478 0.3468 0.3254 -0.0211 0.0107  0.0027  11  PHE D CZ    
3429 N N     . TYR D 12  ? 0.3347 0.3449 0.3302 -0.0214 0.0111  0.0194  12  TYR D N     
3430 C CA    . TYR D 12  ? 0.3341 0.3413 0.3320 -0.0208 0.0111  0.0222  12  TYR D CA    
3431 C C     . TYR D 12  ? 0.3331 0.3368 0.3366 -0.0238 0.0094  0.0251  12  TYR D C     
3432 O O     . TYR D 12  ? 0.3236 0.3210 0.3292 -0.0246 0.0076  0.0252  12  TYR D O     
3433 C CB    . TYR D 12  ? 0.3460 0.3587 0.3441 -0.0182 0.0134  0.0258  12  TYR D CB    
3434 C CG    . TYR D 12  ? 0.3431 0.3592 0.3365 -0.0151 0.0146  0.0231  12  TYR D CG    
3435 C CD1   . TYR D 12  ? 0.3547 0.3689 0.3448 -0.0149 0.0141  0.0180  12  TYR D CD1   
3436 C CD2   . TYR D 12  ? 0.3377 0.3597 0.3303 -0.0126 0.0161  0.0259  12  TYR D CD2   
3437 C CE1   . TYR D 12  ? 0.3602 0.3781 0.3477 -0.0123 0.0151  0.0157  12  TYR D CE1   
3438 C CE2   . TYR D 12  ? 0.3580 0.3833 0.3471 -0.0099 0.0166  0.0233  12  TYR D CE2   
3439 C CZ    . TYR D 12  ? 0.3684 0.3917 0.3557 -0.0097 0.0161  0.0181  12  TYR D CZ    
3440 O OH    . TYR D 12  ? 0.3635 0.3906 0.3486 -0.0072 0.0164  0.0157  12  TYR D OH    
3441 N N     . ALA D 13  ? 0.3265 0.3346 0.3336 -0.0253 0.0096  0.0272  13  ALA D N     
3442 C CA    . ALA D 13  ? 0.3214 0.3275 0.3355 -0.0283 0.0080  0.0303  13  ALA D CA    
3443 C C     . ALA D 13  ? 0.3265 0.3253 0.3400 -0.0307 0.0042  0.0266  13  ALA D C     
3444 O O     . ALA D 13  ? 0.3274 0.3207 0.3450 -0.0326 0.0019  0.0276  13  ALA D O     
3445 C CB    . ALA D 13  ? 0.3143 0.3279 0.3332 -0.0290 0.0094  0.0328  13  ALA D CB    
3446 N N     . GLN D 14  ? 0.3362 0.3348 0.3443 -0.0307 0.0032  0.0225  14  GLN D N     
3447 C CA    . GLN D 14  ? 0.3439 0.3364 0.3496 -0.0330 -0.0005 0.0190  14  GLN D CA    
3448 C C     . GLN D 14  ? 0.3437 0.3295 0.3464 -0.0325 -0.0013 0.0160  14  GLN D C     
3449 O O     . GLN D 14  ? 0.3323 0.3124 0.3360 -0.0346 -0.0046 0.0141  14  GLN D O     
3450 C CB    . GLN D 14  ? 0.3509 0.3449 0.3509 -0.0332 -0.0012 0.0161  14  GLN D CB    
3451 C CG    . GLN D 14  ? 0.3582 0.3473 0.3565 -0.0364 -0.0057 0.0140  14  GLN D CG    
3452 C CD    . GLN D 14  ? 0.3599 0.3500 0.3522 -0.0371 -0.0069 0.0121  14  GLN D CD    
3453 O OE1   . GLN D 14  ? 0.3524 0.3393 0.3420 -0.0397 -0.0107 0.0108  14  GLN D OE1   
3454 N NE2   . GLN D 14  ? 0.3491 0.3436 0.3392 -0.0351 -0.0040 0.0121  14  GLN D NE2   
3455 N N     . VAL D 15  ? 0.3517 0.3383 0.3512 -0.0295 0.0013  0.0151  15  VAL D N     
3456 C CA    . VAL D 15  ? 0.3753 0.3559 0.3736 -0.0285 0.0006  0.0119  15  VAL D CA    
3457 C C     . VAL D 15  ? 0.3932 0.3694 0.3996 -0.0295 -0.0012 0.0151  15  VAL D C     
3458 O O     . VAL D 15  ? 0.3936 0.3629 0.4014 -0.0305 -0.0039 0.0120  15  VAL D O     
3459 C CB    . VAL D 15  ? 0.3776 0.3607 0.3730 -0.0249 0.0037  0.0109  15  VAL D CB    
3460 C CG1   . VAL D 15  ? 0.3870 0.3640 0.3837 -0.0233 0.0028  0.0079  15  VAL D CG1   
3461 C CG2   . VAL D 15  ? 0.3722 0.3591 0.3606 -0.0243 0.0052  0.0075  15  VAL D CG2   
3462 N N     . GLU D 16  ? 0.4094 0.3896 0.4212 -0.0294 0.0004  0.0213  16  GLU D N     
3463 C CA    . GLU D 16  ? 0.4144 0.3909 0.4348 -0.0309 -0.0012 0.0257  16  GLU D CA    
3464 C C     . GLU D 16  ? 0.4228 0.3950 0.4479 -0.0347 -0.0050 0.0247  16  GLU D C     
3465 O O     . GLU D 16  ? 0.4478 0.4134 0.4789 -0.0362 -0.0079 0.0249  16  GLU D O     
3466 C CB    . GLU D 16  ? 0.3972 0.3806 0.4216 -0.0305 0.0018  0.0331  16  GLU D CB    
3467 C CG    . GLU D 16  ? 0.4103 0.3971 0.4307 -0.0268 0.0047  0.0346  16  GLU D CG    
3468 C CD    . GLU D 16  ? 0.4356 0.4158 0.4585 -0.0251 0.0032  0.0349  16  GLU D CD    
3469 O OE1   . GLU D 16  ? 0.4749 0.4475 0.5031 -0.0269 0.0001  0.0339  16  GLU D OE1   
3470 O OE2   . GLU D 16  ? 0.4139 0.3963 0.4341 -0.0220 0.0048  0.0360  16  GLU D OE2   
3471 N N     . GLU D 17  ? 0.4321 0.4079 0.4550 -0.0364 -0.0057 0.0235  17  GLU D N     
3472 C CA    . GLU D 17  ? 0.4634 0.4357 0.4900 -0.0399 -0.0100 0.0220  17  GLU D CA    
3473 C C     . GLU D 17  ? 0.4698 0.4345 0.4910 -0.0404 -0.0135 0.0150  17  GLU D C     
3474 O O     . GLU D 17  ? 0.4638 0.4228 0.4896 -0.0428 -0.0178 0.0134  17  GLU D O     
3475 C CB    . GLU D 17  ? 0.4864 0.4647 0.5122 -0.0411 -0.0102 0.0226  17  GLU D CB    
3476 C CG    . GLU D 17  ? 0.5116 0.4980 0.5442 -0.0410 -0.0070 0.0286  17  GLU D CG    
3477 C CD    . GLU D 17  ? 0.5461 0.5381 0.5795 -0.0418 -0.0075 0.0284  17  GLU D CD    
3478 O OE1   . GLU D 17  ? 0.5591 0.5479 0.5891 -0.0433 -0.0113 0.0248  17  GLU D OE1   
3479 O OE2   . GLU D 17  ? 0.5808 0.5806 0.6184 -0.0409 -0.0043 0.0318  17  GLU D OE2   
3480 N N     . VAL D 18  ? 0.4709 0.4359 0.4825 -0.0381 -0.0118 0.0105  18  VAL D N     
3481 C CA    . VAL D 18  ? 0.4846 0.4438 0.4900 -0.0381 -0.0142 0.0033  18  VAL D CA    
3482 C C     . VAL D 18  ? 0.4943 0.4466 0.5054 -0.0372 -0.0156 0.0017  18  VAL D C     
3483 O O     . VAL D 18  ? 0.5108 0.4568 0.5230 -0.0388 -0.0196 -0.0029 18  VAL D O     
3484 C CB    . VAL D 18  ? 0.4913 0.4536 0.4864 -0.0356 -0.0109 -0.0004 18  VAL D CB    
3485 C CG1   . VAL D 18  ? 0.5012 0.4584 0.4904 -0.0350 -0.0121 -0.0080 18  VAL D CG1   
3486 C CG2   . VAL D 18  ? 0.4788 0.4463 0.4686 -0.0370 -0.0108 0.0006  18  VAL D CG2   
3487 N N     . LEU D 19  ? 0.4909 0.4444 0.5060 -0.0346 -0.0126 0.0054  19  LEU D N     
3488 C CA    . LEU D 19  ? 0.5006 0.4475 0.5224 -0.0333 -0.0139 0.0049  19  LEU D CA    
3489 C C     . LEU D 19  ? 0.5190 0.4615 0.5520 -0.0364 -0.0174 0.0093  19  LEU D C     
3490 O O     . LEU D 19  ? 0.5871 0.5219 0.6264 -0.0364 -0.0204 0.0072  19  LEU D O     
3491 C CB    . LEU D 19  ? 0.4896 0.4396 0.5122 -0.0297 -0.0101 0.0087  19  LEU D CB    
3492 C CG    . LEU D 19  ? 0.4913 0.4449 0.5048 -0.0264 -0.0069 0.0040  19  LEU D CG    
3493 C CD1   . LEU D 19  ? 0.4848 0.4429 0.4994 -0.0232 -0.0037 0.0087  19  LEU D CD1   
3494 C CD2   . LEU D 19  ? 0.4964 0.4443 0.5076 -0.0248 -0.0082 -0.0045 19  LEU D CD2   
3495 N N     . ASN D 20  ? 0.5042 0.4517 0.5408 -0.0391 -0.0171 0.0150  20  ASN D N     
3496 C CA    . ASN D 20  ? 0.4814 0.4265 0.5298 -0.0427 -0.0200 0.0199  20  ASN D CA    
3497 C C     . ASN D 20  ? 0.4824 0.4316 0.5318 -0.0460 -0.0217 0.0207  20  ASN D C     
3498 O O     . ASN D 20  ? 0.4557 0.4123 0.5089 -0.0469 -0.0191 0.0269  20  ASN D O     
3499 C CB    . ASN D 20  ? 0.4802 0.4290 0.5358 -0.0423 -0.0169 0.0291  20  ASN D CB    
3500 C CG    . ASN D 20  ? 0.4925 0.4388 0.5612 -0.0462 -0.0195 0.0348  20  ASN D CG    
3501 O OD1   . ASN D 20  ? 0.4893 0.4310 0.5627 -0.0492 -0.0241 0.0317  20  ASN D OD1   
3502 N ND2   . ASN D 20  ? 0.5042 0.4539 0.5791 -0.0463 -0.0168 0.0436  20  ASN D ND2   
3503 N N     . PRO D 21  ? 0.4917 0.4365 0.5380 -0.0477 -0.0262 0.0142  21  PRO D N     
3504 C CA    . PRO D 21  ? 0.4902 0.4389 0.5362 -0.0505 -0.0284 0.0144  21  PRO D CA    
3505 C C     . PRO D 21  ? 0.4952 0.4464 0.5546 -0.0540 -0.0300 0.0208  21  PRO D C     
3506 O O     . PRO D 21  ? 0.4800 0.4368 0.5406 -0.0555 -0.0305 0.0224  21  PRO D O     
3507 C CB    . PRO D 21  ? 0.5165 0.4591 0.5558 -0.0515 -0.0336 0.0060  21  PRO D CB    
3508 C CG    . PRO D 21  ? 0.5163 0.4510 0.5561 -0.0499 -0.0345 0.0014  21  PRO D CG    
3509 C CD    . PRO D 21  ? 0.5047 0.4417 0.5458 -0.0466 -0.0292 0.0057  21  PRO D CD    
3510 N N     . SER D 22  ? 0.5103 0.4579 0.5806 -0.0553 -0.0307 0.0248  22  SER D N     
3511 C CA    . SER D 22  ? 0.4923 0.4438 0.5763 -0.0589 -0.0312 0.0318  22  SER D CA    
3512 C C     . SER D 22  ? 0.4945 0.4572 0.5791 -0.0578 -0.0250 0.0386  22  SER D C     
3513 O O     . SER D 22  ? 0.4556 0.4242 0.5505 -0.0605 -0.0245 0.0439  22  SER D O     
3514 C CB    . SER D 22  ? 0.4868 0.4322 0.5826 -0.0607 -0.0327 0.0358  22  SER D CB    
3515 O OG    . SER D 22  ? 0.4918 0.4393 0.5869 -0.0581 -0.0276 0.0413  22  SER D OG    
3516 N N     . LEU D 23  ? 0.4938 0.4601 0.5681 -0.0539 -0.0203 0.0381  23  LEU D N     
3517 C CA    . LEU D 23  ? 0.5045 0.4816 0.5780 -0.0524 -0.0147 0.0429  23  LEU D CA    
3518 C C     . LEU D 23  ? 0.5212 0.5042 0.5929 -0.0528 -0.0152 0.0407  23  LEU D C     
3519 O O     . LEU D 23  ? 0.5480 0.5402 0.6230 -0.0523 -0.0114 0.0446  23  LEU D O     
3520 C CB    . LEU D 23  ? 0.4919 0.4707 0.5552 -0.0481 -0.0103 0.0424  23  LEU D CB    
3521 C CG    . LEU D 23  ? 0.4816 0.4562 0.5466 -0.0469 -0.0092 0.0457  23  LEU D CG    
3522 C CD1   . LEU D 23  ? 0.4908 0.4669 0.5452 -0.0424 -0.0060 0.0435  23  LEU D CD1   
3523 C CD2   . LEU D 23  ? 0.4904 0.4706 0.5650 -0.0486 -0.0063 0.0550  23  LEU D CD2   
3524 N N     . LYS D 24  ? 0.5495 0.5277 0.6159 -0.0534 -0.0198 0.0346  24  LYS D N     
3525 C CA    . LYS D 24  ? 0.5794 0.5626 0.6439 -0.0536 -0.0208 0.0330  24  LYS D CA    
3526 C C     . LYS D 24  ? 0.5570 0.5462 0.6351 -0.0564 -0.0216 0.0375  24  LYS D C     
3527 O O     . LYS D 24  ? 0.5740 0.5601 0.6618 -0.0595 -0.0246 0.0394  24  LYS D O     
3528 C CB    . LYS D 24  ? 0.6560 0.6330 0.7124 -0.0544 -0.0262 0.0266  24  LYS D CB    
3529 C CG    . LYS D 24  ? 0.7228 0.6998 0.7653 -0.0513 -0.0239 0.0228  24  LYS D CG    
3530 C CD    . LYS D 24  ? 0.7593 0.7324 0.7933 -0.0525 -0.0288 0.0176  24  LYS D CD    
3531 C CE    . LYS D 24  ? 0.8088 0.7734 0.8408 -0.0542 -0.0333 0.0130  24  LYS D CE    
3532 N NZ    . LYS D 24  ? 0.8215 0.7819 0.8512 -0.0520 -0.0304 0.0113  24  LYS D NZ    
3533 N N     . GLY D 25  ? 0.5314 0.5294 0.6110 -0.0551 -0.0187 0.0391  25  GLY D N     
3534 C CA    . GLY D 25  ? 0.4892 0.4951 0.5823 -0.0569 -0.0180 0.0433  25  GLY D CA    
3535 C C     . GLY D 25  ? 0.4788 0.4930 0.5764 -0.0557 -0.0109 0.0489  25  GLY D C     
3536 O O     . GLY D 25  ? 0.4916 0.5155 0.5978 -0.0558 -0.0081 0.0516  25  GLY D O     
3537 N N     . LYS D 26  ? 0.4613 0.4725 0.5533 -0.0544 -0.0080 0.0506  26  LYS D N     
3538 C CA    . LYS D 26  ? 0.4583 0.4775 0.5532 -0.0534 -0.0016 0.0566  26  LYS D CA    
3539 C C     . LYS D 26  ? 0.4257 0.4511 0.5107 -0.0490 0.0033  0.0549  26  LYS D C     
3540 O O     . LYS D 26  ? 0.4098 0.4307 0.4845 -0.0467 0.0020  0.0500  26  LYS D O     
3541 C CB    . LYS D 26  ? 0.4876 0.5003 0.5828 -0.0544 -0.0015 0.0603  26  LYS D CB    
3542 C CG    . LYS D 26  ? 0.5148 0.5207 0.6208 -0.0588 -0.0067 0.0617  26  LYS D CG    
3543 C CD    . LYS D 26  ? 0.5339 0.5362 0.6445 -0.0602 -0.0055 0.0679  26  LYS D CD    
3544 C CE    . LYS D 26  ? 0.5368 0.5321 0.6600 -0.0649 -0.0110 0.0692  26  LYS D CE    
3545 N NZ    . LYS D 26  ? 0.5407 0.5241 0.6585 -0.0647 -0.0175 0.0611  26  LYS D NZ    
3546 N N     . PRO D 27  ? 0.4252 0.4613 0.5135 -0.0480 0.0090  0.0591  27  PRO D N     
3547 C CA    . PRO D 27  ? 0.4041 0.4449 0.4821 -0.0437 0.0134  0.0576  27  PRO D CA    
3548 C C     . PRO D 27  ? 0.3867 0.4212 0.4567 -0.0426 0.0137  0.0591  27  PRO D C     
3549 O O     . PRO D 27  ? 0.3947 0.4274 0.4692 -0.0446 0.0142  0.0650  27  PRO D O     
3550 C CB    . PRO D 27  ? 0.4009 0.4550 0.4844 -0.0432 0.0194  0.0617  27  PRO D CB    
3551 C CG    . PRO D 27  ? 0.4187 0.4751 0.5161 -0.0475 0.0189  0.0669  27  PRO D CG    
3552 C CD    . PRO D 27  ? 0.4164 0.4617 0.5176 -0.0504 0.0118  0.0645  27  PRO D CD    
3553 N N     . VAL D 28  ? 0.3573 0.3885 0.4165 -0.0394 0.0133  0.0542  28  VAL D N     
3554 C CA    . VAL D 28  ? 0.3476 0.3729 0.3991 -0.0376 0.0132  0.0543  28  VAL D CA    
3555 C C     . VAL D 28  ? 0.3500 0.3819 0.3930 -0.0336 0.0169  0.0529  28  VAL D C     
3556 O O     . VAL D 28  ? 0.3306 0.3649 0.3695 -0.0318 0.0170  0.0478  28  VAL D O     
3557 C CB    . VAL D 28  ? 0.3455 0.3601 0.3922 -0.0377 0.0085  0.0485  28  VAL D CB    
3558 C CG1   . VAL D 28  ? 0.3434 0.3531 0.3831 -0.0352 0.0088  0.0479  28  VAL D CG1   
3559 C CG2   . VAL D 28  ? 0.3424 0.3498 0.3966 -0.0415 0.0039  0.0486  28  VAL D CG2   
3560 N N     . VAL D 29  ? 0.3499 0.3846 0.3906 -0.0324 0.0197  0.0577  29  VAL D N     
3561 C CA    . VAL D 29  ? 0.3429 0.3844 0.3756 -0.0287 0.0230  0.0567  29  VAL D CA    
3562 C C     . VAL D 29  ? 0.3627 0.3983 0.3898 -0.0270 0.0218  0.0578  29  VAL D C     
3563 O O     . VAL D 29  ? 0.3667 0.3998 0.3968 -0.0282 0.0216  0.0639  29  VAL D O     
3564 C CB    . VAL D 29  ? 0.3449 0.3983 0.3794 -0.0285 0.0279  0.0622  29  VAL D CB    
3565 C CG1   . VAL D 29  ? 0.3583 0.4192 0.3840 -0.0244 0.0307  0.0592  29  VAL D CG1   
3566 C CG2   . VAL D 29  ? 0.3330 0.3923 0.3764 -0.0307 0.0292  0.0624  29  VAL D CG2   
3567 N N     . VAL D 30  ? 0.3555 0.3889 0.3754 -0.0242 0.0208  0.0521  30  VAL D N     
3568 C CA    . VAL D 30  ? 0.3641 0.3930 0.3793 -0.0220 0.0197  0.0522  30  VAL D CA    
3569 C C     . VAL D 30  ? 0.3681 0.4057 0.3773 -0.0189 0.0226  0.0541  30  VAL D C     
3570 O O     . VAL D 30  ? 0.3417 0.3859 0.3471 -0.0171 0.0242  0.0500  30  VAL D O     
3571 C CB    . VAL D 30  ? 0.3704 0.3928 0.3817 -0.0209 0.0171  0.0449  30  VAL D CB    
3572 C CG1   . VAL D 30  ? 0.3822 0.4012 0.3896 -0.0182 0.0163  0.0444  30  VAL D CG1   
3573 C CG2   . VAL D 30  ? 0.3862 0.4004 0.4020 -0.0239 0.0140  0.0429  30  VAL D CG2   
3574 N N     . CYS D 31  ? 0.3872 0.4245 0.3960 -0.0183 0.0227  0.0601  31  CYS D N     
3575 C CA    . CYS D 31  ? 0.4089 0.4551 0.4125 -0.0162 0.0253  0.0641  31  CYS D CA    
3576 C C     . CYS D 31  ? 0.4169 0.4601 0.4160 -0.0133 0.0233  0.0649  31  CYS D C     
3577 O O     . CYS D 31  ? 0.3924 0.4264 0.3949 -0.0136 0.0203  0.0656  31  CYS D O     
3578 C CB    . CYS D 31  ? 0.4132 0.4634 0.4211 -0.0187 0.0274  0.0733  31  CYS D CB    
3579 S SG    . CYS D 31  ? 0.4529 0.5092 0.4677 -0.0221 0.0303  0.0736  31  CYS D SG    
3580 N N     . VAL D 32  ? 0.4389 0.4903 0.4309 -0.0104 0.0247  0.0643  32  VAL D N     
3581 C CA    . VAL D 32  ? 0.4725 0.5238 0.4604 -0.0077 0.0229  0.0672  32  VAL D CA    
3582 C C     . VAL D 32  ? 0.5032 0.5607 0.4896 -0.0086 0.0248  0.0771  32  VAL D C     
3583 O O     . VAL D 32  ? 0.4782 0.5466 0.4590 -0.0077 0.0278  0.0780  32  VAL D O     
3584 C CB    . VAL D 32  ? 0.4723 0.5286 0.4532 -0.0041 0.0226  0.0606  32  VAL D CB    
3585 C CG1   . VAL D 32  ? 0.4711 0.5272 0.4486 -0.0013 0.0201  0.0636  32  VAL D CG1   
3586 C CG2   . VAL D 32  ? 0.4714 0.5220 0.4542 -0.0039 0.0213  0.0519  32  VAL D CG2   
3587 N N     . PHE D 33  ? 0.5616 0.6124 0.5535 -0.0104 0.0229  0.0845  33  PHE D N     
3588 C CA    . PHE D 33  ? 0.6106 0.6662 0.6017 -0.0115 0.0240  0.0956  33  PHE D CA    
3589 C C     . PHE D 33  ? 0.6499 0.7091 0.6333 -0.0080 0.0222  0.0983  33  PHE D C     
3590 O O     . PHE D 33  ? 0.6265 0.6791 0.6105 -0.0054 0.0184  0.0950  33  PHE D O     
3591 C CB    . PHE D 33  ? 0.6115 0.6575 0.6125 -0.0148 0.0218  0.1028  33  PHE D CB    
3592 C CG    . PHE D 33  ? 0.6401 0.6840 0.6490 -0.0188 0.0234  0.1018  33  PHE D CG    
3593 C CD1   . PHE D 33  ? 0.6478 0.7007 0.6581 -0.0217 0.0276  0.1075  33  PHE D CD1   
3594 C CD2   . PHE D 33  ? 0.6444 0.6780 0.6593 -0.0196 0.0206  0.0950  33  PHE D CD2   
3595 C CE1   . PHE D 33  ? 0.6550 0.7064 0.6737 -0.0253 0.0287  0.1065  33  PHE D CE1   
3596 C CE2   . PHE D 33  ? 0.6498 0.6817 0.6719 -0.0232 0.0213  0.0940  33  PHE D CE2   
3597 C CZ    . PHE D 33  ? 0.6622 0.7028 0.6868 -0.0261 0.0252  0.0999  33  PHE D CZ    
3598 N N     . SER D 34  ? 0.7391 0.8094 0.7154 -0.0078 0.0249  0.1041  34  SER D N     
3599 C CA    . SER D 34  ? 0.8318 0.9072 0.7993 -0.0045 0.0230  0.1069  34  SER D CA    
3600 C C     . SER D 34  ? 0.8805 0.9490 0.8517 -0.0048 0.0189  0.1170  34  SER D C     
3601 O O     . SER D 34  ? 0.8500 0.9151 0.8196 -0.0016 0.0146  0.1161  34  SER D O     
3602 C CB    . SER D 34  ? 0.8506 0.9409 0.8083 -0.0043 0.0273  0.1101  34  SER D CB    
3603 O OG    . SER D 34  ? 0.8788 0.9756 0.8353 -0.0043 0.0313  0.1016  34  SER D OG    
3604 N N     . GLY D 35  ? 0.9317 0.9984 0.9088 -0.0087 0.0201  0.1267  35  GLY D N     
3605 C CA    . GLY D 35  ? 0.9731 1.0342 0.9540 -0.0096 0.0165  0.1383  35  GLY D CA    
3606 C C     . GLY D 35  ? 1.0221 1.0944 0.9930 -0.0094 0.0178  0.1484  35  GLY D C     
3607 O O     . GLY D 35  ? 1.0380 1.1078 1.0120 -0.0113 0.0158  0.1607  35  GLY D O     
3608 N N     . ARG D 36  ? 1.0473 1.1323 1.0065 -0.0073 0.0210  0.1434  36  ARG D N     
3609 C CA    . ARG D 36  ? 1.0954 1.1926 1.0424 -0.0065 0.0222  0.1512  36  ARG D CA    
3610 C C     . ARG D 36  ? 1.0984 1.2059 1.0436 -0.0106 0.0286  0.1589  36  ARG D C     
3611 O O     . ARG D 36  ? 1.1258 1.2340 1.0722 -0.0136 0.0286  0.1723  36  ARG D O     
3612 C CB    . ARG D 36  ? 1.1095 1.2155 1.0449 -0.0020 0.0222  0.1410  36  ARG D CB    
3613 C CG    . ARG D 36  ? 1.1206 1.2181 1.0581 0.0020  0.0160  0.1341  36  ARG D CG    
3614 C CD    . ARG D 36  ? 1.1188 1.2223 1.0496 0.0056  0.0164  0.1209  36  ARG D CD    
3615 N NE    . ARG D 36  ? 1.1696 1.2626 1.1084 0.0074  0.0130  0.1117  36  ARG D NE    
3616 C CZ    . ARG D 36  ? 1.1277 1.2147 1.0689 0.0103  0.0074  0.1111  36  ARG D CZ    
3617 N NH1   . ARG D 36  ? 1.1199 1.2097 1.0562 0.0119  0.0036  0.1193  36  ARG D NH1   
3618 N NH2   . ARG D 36  ? 1.1069 1.1856 1.0556 0.0115  0.0055  0.1023  36  ARG D NH2   
3619 N N     . PHE D 37  ? 1.1325 1.2481 1.0758 -0.0109 0.0341  0.1506  37  PHE D N     
3620 C CA    . PHE D 37  ? 1.1328 1.2587 1.0765 -0.0147 0.0410  0.1560  37  PHE D CA    
3621 C C     . PHE D 37  ? 1.1080 1.2233 1.0675 -0.0193 0.0408  0.1602  37  PHE D C     
3622 O O     . PHE D 37  ? 1.0564 1.1574 1.0245 -0.0188 0.0358  0.1563  37  PHE D O     
3623 C CB    . PHE D 37  ? 1.1485 1.2851 1.0875 -0.0129 0.0461  0.1440  37  PHE D CB    
3624 C CG    . PHE D 37  ? 1.1887 1.3434 1.1170 -0.0131 0.0524  0.1476  37  PHE D CG    
3625 C CD1   . PHE D 37  ? 1.2176 1.3817 1.1309 -0.0096 0.0517  0.1471  37  PHE D CD1   
3626 C CD2   . PHE D 37  ? 1.1908 1.3539 1.1242 -0.0167 0.0592  0.1507  37  PHE D CD2   
3627 C CE1   . PHE D 37  ? 1.1939 1.3755 1.0964 -0.0096 0.0577  0.1496  37  PHE D CE1   
3628 C CE2   . PHE D 37  ? 1.1968 1.3778 1.1203 -0.0167 0.0657  0.1534  37  PHE D CE2   
3629 C CZ    . PHE D 37  ? 1.1969 1.3872 1.1044 -0.0131 0.0650  0.1526  37  PHE D CZ    
3630 N N     . GLU D 38  ? 1.0692 1.1917 1.0326 -0.0236 0.0461  0.1676  38  GLU D N     
3631 C CA    . GLU D 38  ? 1.0521 1.1654 1.0312 -0.0283 0.0457  0.1715  38  GLU D CA    
3632 C C     . GLU D 38  ? 0.9966 1.1050 0.9827 -0.0277 0.0460  0.1582  38  GLU D C     
3633 O O     . GLU D 38  ? 0.9587 1.0775 0.9426 -0.0274 0.0511  0.1520  38  GLU D O     
3634 C CB    . GLU D 38  ? 1.0885 1.2120 1.0710 -0.0335 0.0516  0.1836  38  GLU D CB    
3635 C CG    . GLU D 38  ? 1.0879 1.2048 1.0873 -0.0386 0.0522  0.1859  38  GLU D CG    
3636 C CD    . GLU D 38  ? 1.1068 1.2042 1.1179 -0.0395 0.0447  0.1855  38  GLU D CD    
3637 O OE1   . GLU D 38  ? 1.1099 1.1989 1.1179 -0.0370 0.0393  0.1877  38  GLU D OE1   
3638 O OE2   . GLU D 38  ? 1.1140 1.2047 1.1380 -0.0425 0.0441  0.1827  38  GLU D OE2   
3639 N N     . ASP D 39  ? 0.9215 1.0145 0.9161 -0.0276 0.0405  0.1539  39  ASP D N     
3640 C CA    . ASP D 39  ? 0.8858 0.9730 0.8876 -0.0278 0.0401  0.1430  39  ASP D CA    
3641 C C     . ASP D 39  ? 0.8527 0.9495 0.8461 -0.0243 0.0434  0.1318  39  ASP D C     
3642 O O     . ASP D 39  ? 0.8315 0.9328 0.8294 -0.0256 0.0466  0.1268  39  ASP D O     
3643 C CB    . ASP D 39  ? 0.8860 0.9730 0.9003 -0.0332 0.0424  0.1481  39  ASP D CB    
3644 C CG    . ASP D 39  ? 0.8474 0.9275 0.8698 -0.0338 0.0410  0.1379  39  ASP D CG    
3645 O OD1   . ASP D 39  ? 0.8552 0.9224 0.8803 -0.0325 0.0357  0.1323  39  ASP D OD1   
3646 O OD2   . ASP D 39  ? 0.7977 0.8857 0.8239 -0.0355 0.0451  0.1355  39  ASP D OD2   
3647 N N     . SER D 40  ? 0.8081 0.9082 0.7904 -0.0200 0.0421  0.1280  40  SER D N     
3648 C CA    . SER D 40  ? 0.7714 0.8795 0.7461 -0.0165 0.0443  0.1172  40  SER D CA    
3649 C C     . SER D 40  ? 0.7315 0.8292 0.7067 -0.0136 0.0396  0.1070  40  SER D C     
3650 O O     . SER D 40  ? 0.7264 0.8126 0.7052 -0.0135 0.0348  0.1083  40  SER D O     
3651 C CB    . SER D 40  ? 0.8130 0.9333 0.7743 -0.0136 0.0462  0.1192  40  SER D CB    
3652 O OG    . SER D 40  ? 0.8619 0.9763 0.8178 -0.0108 0.0409  0.1199  40  SER D OG    
3653 N N     . GLY D 41  ? 0.6376 0.7402 0.6097 -0.0113 0.0410  0.0966  41  GLY D N     
3654 C CA    . GLY D 41  ? 0.5842 0.6787 0.5565 -0.0090 0.0373  0.0870  41  GLY D CA    
3655 C C     . GLY D 41  ? 0.5296 0.6282 0.5031 -0.0083 0.0394  0.0774  41  GLY D C     
3656 O O     . GLY D 41  ? 0.5173 0.6264 0.4903 -0.0087 0.0439  0.0773  41  GLY D O     
3657 N N     . ALA D 42  ? 0.4657 0.5563 0.4414 -0.0072 0.0363  0.0695  42  ALA D N     
3658 C CA    . ALA D 42  ? 0.4267 0.5192 0.4045 -0.0067 0.0372  0.0607  42  ALA D CA    
3659 C C     . ALA D 42  ? 0.3997 0.4813 0.3855 -0.0091 0.0348  0.0583  42  ALA D C     
3660 O O     . ALA D 42  ? 0.4205 0.4925 0.4083 -0.0100 0.0317  0.0606  42  ALA D O     
3661 C CB    . ALA D 42  ? 0.4071 0.5018 0.3784 -0.0029 0.0356  0.0528  42  ALA D CB    
3662 N N     . VAL D 43  ? 0.3754 0.4587 0.3657 -0.0099 0.0359  0.0534  43  VAL D N     
3663 C CA    . VAL D 43  ? 0.3673 0.4412 0.3639 -0.0121 0.0332  0.0502  43  VAL D CA    
3664 C C     . VAL D 43  ? 0.3653 0.4343 0.3585 -0.0100 0.0303  0.0428  43  VAL D C     
3665 O O     . VAL D 43  ? 0.3522 0.4268 0.3418 -0.0075 0.0310  0.0376  43  VAL D O     
3666 C CB    . VAL D 43  ? 0.3635 0.4419 0.3668 -0.0137 0.0350  0.0482  43  VAL D CB    
3667 C CG1   . VAL D 43  ? 0.3528 0.4217 0.3616 -0.0159 0.0316  0.0449  43  VAL D CG1   
3668 C CG2   . VAL D 43  ? 0.3532 0.4381 0.3610 -0.0159 0.0385  0.0556  43  VAL D CG2   
3669 N N     . ALA D 44  ? 0.3637 0.4224 0.3584 -0.0112 0.0272  0.0420  44  ALA D N     
3670 C CA    . ALA D 44  ? 0.3674 0.4214 0.3597 -0.0100 0.0248  0.0355  44  ALA D CA    
3671 C C     . ALA D 44  ? 0.3623 0.4132 0.3586 -0.0120 0.0237  0.0313  44  ALA D C     
3672 O O     . ALA D 44  ? 0.3733 0.4249 0.3683 -0.0109 0.0229  0.0260  44  ALA D O     
3673 C CB    . ALA D 44  ? 0.3803 0.4262 0.3716 -0.0099 0.0225  0.0362  44  ALA D CB    
3674 N N     . THR D 45  ? 0.3627 0.4097 0.3644 -0.0150 0.0230  0.0341  45  THR D N     
3675 C CA    . THR D 45  ? 0.3777 0.4233 0.3839 -0.0170 0.0218  0.0314  45  THR D CA    
3676 C C     . THR D 45  ? 0.3672 0.4121 0.3803 -0.0200 0.0219  0.0358  45  THR D C     
3677 O O     . THR D 45  ? 0.3653 0.4081 0.3800 -0.0212 0.0221  0.0408  45  THR D O     
3678 C CB    . THR D 45  ? 0.3975 0.4347 0.4018 -0.0180 0.0185  0.0273  45  THR D CB    
3679 O OG1   . THR D 45  ? 0.4402 0.4771 0.4483 -0.0196 0.0170  0.0250  45  THR D OG1   
3680 C CG2   . THR D 45  ? 0.4022 0.4314 0.4072 -0.0199 0.0166  0.0293  45  THR D CG2   
3681 N N     . ALA D 46  ? 0.3540 0.4007 0.3724 -0.0213 0.0212  0.0342  46  ALA D N     
3682 C CA    . ALA D 46  ? 0.3399 0.3859 0.3664 -0.0245 0.0205  0.0376  46  ALA D CA    
3683 C C     . ALA D 46  ? 0.3318 0.3720 0.3609 -0.0264 0.0165  0.0341  46  ALA D C     
3684 O O     . ALA D 46  ? 0.3243 0.3647 0.3509 -0.0251 0.0154  0.0297  46  ALA D O     
3685 C CB    . ALA D 46  ? 0.3445 0.4011 0.3764 -0.0241 0.0243  0.0399  46  ALA D CB    
3686 N N     . ASN D 47  ? 0.3315 0.3663 0.3654 -0.0296 0.0138  0.0361  47  ASN D N     
3687 C CA    . ASN D 47  ? 0.3315 0.3618 0.3681 -0.0317 0.0095  0.0335  47  ASN D CA    
3688 C C     . ASN D 47  ? 0.3196 0.3574 0.3643 -0.0317 0.0100  0.0333  47  ASN D C     
3689 O O     . ASN D 47  ? 0.3080 0.3547 0.3561 -0.0301 0.0142  0.0349  47  ASN D O     
3690 C CB    . ASN D 47  ? 0.3448 0.3671 0.3840 -0.0351 0.0058  0.0348  47  ASN D CB    
3691 C CG    . ASN D 47  ? 0.3589 0.3842 0.4085 -0.0375 0.0064  0.0398  47  ASN D CG    
3692 O OD1   . ASN D 47  ? 0.3661 0.4003 0.4210 -0.0369 0.0101  0.0426  47  ASN D OD1   
3693 N ND2   . ASN D 47  ? 0.3547 0.3728 0.4075 -0.0405 0.0028  0.0407  47  ASN D ND2   
3694 N N     . TYR D 48  ? 0.3270 0.3614 0.3743 -0.0332 0.0057  0.0310  48  TYR D N     
3695 C CA    . TYR D 48  ? 0.3508 0.3917 0.4063 -0.0326 0.0054  0.0300  48  TYR D CA    
3696 C C     . TYR D 48  ? 0.3517 0.3986 0.4189 -0.0343 0.0067  0.0336  48  TYR D C     
3697 O O     . TYR D 48  ? 0.3551 0.4110 0.4295 -0.0327 0.0094  0.0333  48  TYR D O     
3698 C CB    . TYR D 48  ? 0.3513 0.3869 0.4061 -0.0336 -0.0001 0.0271  48  TYR D CB    
3699 C CG    . TYR D 48  ? 0.3601 0.3942 0.4067 -0.0312 0.0001  0.0237  48  TYR D CG    
3700 C CD1   . TYR D 48  ? 0.3722 0.4003 0.4083 -0.0312 0.0001  0.0227  48  TYR D CD1   
3701 C CD2   . TYR D 48  ? 0.3787 0.4175 0.4292 -0.0289 0.0004  0.0212  48  TYR D CD2   
3702 C CE1   . TYR D 48  ? 0.3979 0.4252 0.4277 -0.0295 0.0005  0.0199  48  TYR D CE1   
3703 C CE2   . TYR D 48  ? 0.4030 0.4403 0.4474 -0.0271 0.0003  0.0183  48  TYR D CE2   
3704 C CZ    . TYR D 48  ? 0.4073 0.4389 0.4412 -0.0276 0.0004  0.0179  48  TYR D CZ    
3705 O OH    . TYR D 48  ? 0.4199 0.4504 0.4487 -0.0262 0.0004  0.0153  48  TYR D OH    
3706 N N     . GLU D 49  ? 0.3710 0.4135 0.4408 -0.0375 0.0051  0.0369  49  GLU D N     
3707 C CA    . GLU D 49  ? 0.3777 0.4264 0.4594 -0.0395 0.0068  0.0412  49  GLU D CA    
3708 C C     . GLU D 49  ? 0.3583 0.4169 0.4402 -0.0374 0.0139  0.0439  49  GLU D C     
3709 O O     . GLU D 49  ? 0.3520 0.4206 0.4430 -0.0371 0.0171  0.0453  49  GLU D O     
3710 C CB    . GLU D 49  ? 0.4096 0.4510 0.4942 -0.0434 0.0036  0.0442  49  GLU D CB    
3711 C CG    . GLU D 49  ? 0.4486 0.4958 0.5472 -0.0464 0.0047  0.0492  49  GLU D CG    
3712 C CD    . GLU D 49  ? 0.4774 0.5289 0.5876 -0.0476 0.0017  0.0480  49  GLU D CD    
3713 O OE1   . GLU D 49  ? 0.5137 0.5596 0.6214 -0.0477 -0.0039 0.0441  49  GLU D OE1   
3714 O OE2   . GLU D 49  ? 0.4729 0.5338 0.5951 -0.0486 0.0048  0.0513  49  GLU D OE2   
3715 N N     . ALA D 50  ? 0.3370 0.3935 0.4088 -0.0357 0.0163  0.0444  50  ALA D N     
3716 C CA    . ALA D 50  ? 0.3425 0.4084 0.4123 -0.0335 0.0225  0.0469  50  ALA D CA    
3717 C C     . ALA D 50  ? 0.3488 0.4233 0.4174 -0.0297 0.0252  0.0423  50  ALA D C     
3718 O O     . ALA D 50  ? 0.3527 0.4384 0.4247 -0.0284 0.0304  0.0436  50  ALA D O     
3719 C CB    . ALA D 50  ? 0.3553 0.4162 0.4147 -0.0325 0.0233  0.0486  50  ALA D CB    
3720 N N     . ARG D 51  ? 0.3497 0.4191 0.4137 -0.0280 0.0219  0.0367  51  ARG D N     
3721 C CA    . ARG D 51  ? 0.3533 0.4292 0.4166 -0.0243 0.0236  0.0317  51  ARG D CA    
3722 C C     . ARG D 51  ? 0.3770 0.4611 0.4524 -0.0240 0.0245  0.0304  51  ARG D C     
3723 O O     . ARG D 51  ? 0.3795 0.4730 0.4566 -0.0209 0.0283  0.0275  51  ARG D O     
3724 C CB    . ARG D 51  ? 0.3507 0.4186 0.4081 -0.0233 0.0193  0.0269  51  ARG D CB    
3725 C CG    . ARG D 51  ? 0.3434 0.4069 0.3891 -0.0221 0.0198  0.0264  51  ARG D CG    
3726 C CD    . ARG D 51  ? 0.3418 0.3978 0.3827 -0.0218 0.0157  0.0224  51  ARG D CD    
3727 N NE    . ARG D 51  ? 0.3408 0.3901 0.3724 -0.0221 0.0152  0.0229  51  ARG D NE    
3728 C CZ    . ARG D 51  ? 0.3258 0.3708 0.3513 -0.0213 0.0134  0.0196  51  ARG D CZ    
3729 N NH1   . ARG D 51  ? 0.3298 0.3755 0.3573 -0.0203 0.0117  0.0162  51  ARG D NH1   
3730 N NH2   . ARG D 51  ? 0.3290 0.3690 0.3473 -0.0214 0.0133  0.0200  51  ARG D NH2   
3731 N N     . LYS D 52  ? 0.4030 0.4842 0.4874 -0.0270 0.0211  0.0323  52  LYS D N     
3732 C CA    . LYS D 52  ? 0.4262 0.5153 0.5234 -0.0264 0.0214  0.0307  52  LYS D CA    
3733 C C     . LYS D 52  ? 0.4166 0.5189 0.5205 -0.0260 0.0283  0.0335  52  LYS D C     
3734 O O     . LYS D 52  ? 0.4114 0.5225 0.5259 -0.0246 0.0299  0.0314  52  LYS D O     
3735 C CB    . LYS D 52  ? 0.4652 0.5479 0.5706 -0.0296 0.0150  0.0315  52  LYS D CB    
3736 C CG    . LYS D 52  ? 0.5018 0.5817 0.6117 -0.0340 0.0138  0.0370  52  LYS D CG    
3737 C CD    . LYS D 52  ? 0.5413 0.6153 0.6587 -0.0366 0.0065  0.0365  52  LYS D CD    
3738 C CE    . LYS D 52  ? 0.5846 0.6574 0.7101 -0.0410 0.0049  0.0412  52  LYS D CE    
3739 N NZ    . LYS D 52  ? 0.6354 0.7092 0.7741 -0.0428 -0.0003 0.0408  52  LYS D NZ    
3740 N N     . PHE D 53  ? 0.4128 0.5169 0.5103 -0.0269 0.0324  0.0382  53  PHE D N     
3741 C CA    . PHE D 53  ? 0.4029 0.5206 0.5039 -0.0262 0.0396  0.0412  53  PHE D CA    
3742 C C     . PHE D 53  ? 0.4150 0.5386 0.5047 -0.0221 0.0441  0.0382  53  PHE D C     
3743 O O     . PHE D 53  ? 0.4559 0.5914 0.5454 -0.0211 0.0504  0.0402  53  PHE D O     
3744 C CB    . PHE D 53  ? 0.3848 0.5016 0.4880 -0.0306 0.0411  0.0498  53  PHE D CB    
3745 C CG    . PHE D 53  ? 0.3670 0.4801 0.4833 -0.0347 0.0370  0.0523  53  PHE D CG    
3746 C CD1   . PHE D 53  ? 0.3737 0.4977 0.5045 -0.0359 0.0398  0.0539  53  PHE D CD1   
3747 C CD2   . PHE D 53  ? 0.3538 0.4529 0.4680 -0.0373 0.0301  0.0525  53  PHE D CD2   
3748 C CE1   . PHE D 53  ? 0.3756 0.4963 0.5193 -0.0398 0.0354  0.0560  53  PHE D CE1   
3749 C CE2   . PHE D 53  ? 0.3609 0.4565 0.4867 -0.0411 0.0256  0.0543  53  PHE D CE2   
3750 C CZ    . PHE D 53  ? 0.3636 0.4698 0.5045 -0.0424 0.0279  0