data_4S0H
# 
_entry.id   4S0H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
NDB   NA3348       
RCSB  RCSB088024   
PDB   4S0H         
WWPDB D_1000088024 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4S0H 
_pdbx_database_status.recvd_initial_deposition_date   2014-12-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Pradhan, L.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Intermolecular Interactions of Cardiac Transcription Factors NKX2.5 and TBX5.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            55 
_citation.page_first                1702 
_citation.page_last                 1710 
_citation.year                      2016 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26926761 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.6b00171 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pradhan, L.'        1 
primary 'Gopal, S.'          2 
primary 'Li, S.'             3 
primary 'Ashur, S.'          4 
primary 'Suryanarayanan, S.' 5 
primary 'Kasahara, H.'       6 
primary 'Nam, H.J.'          7 
# 
_cell.entry_id           4S0H 
_cell.length_a           70.217 
_cell.length_b           78.459 
_cell.length_c           78.695 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.83 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4S0H 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'T-box transcription factor TBX5'                                   21396.799 2 ? ? 'DB (UNP residues 53-238)'  ? 
2 polymer man 'Homeobox protein Nkx-2.5'                                          6531.528  2 ? ? 'HD (UNP residues 142-194)' ? 
3 polymer syn "5'-D(*TP*CP*TP*CP*AP*CP*AP*CP*CP*TP*TP*TP*GP*AP*AP*GP*TP*GP*G)-3'" 5795.760  2 ? ? ?                           
'ANF DNA strand 1' 
4 polymer syn "5'-D(*CP*CP*AP*CP*TP*TP*CP*AP*AP*AP*GP*GP*TP*GP*TP*GP*AP*GP*A)-3'" 5853.812  2 ? ? ?                           
'ANF DNA strand 2' 
5 water   nat water                                                               18.015    2 ? ? ?                           ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'T-box protein 5'                                                                  
2 'Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMP
GRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFI
AVTSYQNHKITQLKIENNPFAKGFRG
;
;GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMP
GRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFI
AVTSYQNHKITQLKIENNPFAKGFRG
;
A,E ? 
2 'polypeptide(L)'        no no RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK 
RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK B,F ? 
3 polydeoxyribonucleotide no no '(DT)(DC)(DT)(DC)(DA)(DC)(DA)(DC)(DC)(DT)(DT)(DT)(DG)(DA)(DA)(DG)(DT)(DG)(DG)' TCTCACACCTTTGAAGTGG 
C,G ? 
4 polydeoxyribonucleotide no no '(DC)(DC)(DA)(DC)(DT)(DT)(DC)(DA)(DA)(DA)(DG)(DG)(DT)(DG)(DT)(DG)(DA)(DG)(DA)' CCACTTCAAAGGTGTGAGA 
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ILE n 
1 3   LYS n 
1 4   VAL n 
1 5   PHE n 
1 6   LEU n 
1 7   HIS n 
1 8   GLU n 
1 9   ARG n 
1 10  GLU n 
1 11  LEU n 
1 12  TRP n 
1 13  LEU n 
1 14  LYS n 
1 15  PHE n 
1 16  HIS n 
1 17  GLU n 
1 18  VAL n 
1 19  GLY n 
1 20  THR n 
1 21  GLU n 
1 22  MET n 
1 23  ILE n 
1 24  ILE n 
1 25  THR n 
1 26  LYS n 
1 27  ALA n 
1 28  GLY n 
1 29  ARG n 
1 30  ARG n 
1 31  MET n 
1 32  PHE n 
1 33  PRO n 
1 34  SER n 
1 35  TYR n 
1 36  LYS n 
1 37  VAL n 
1 38  LYS n 
1 39  VAL n 
1 40  THR n 
1 41  GLY n 
1 42  LEU n 
1 43  ASN n 
1 44  PRO n 
1 45  LYS n 
1 46  THR n 
1 47  LYS n 
1 48  TYR n 
1 49  ILE n 
1 50  LEU n 
1 51  LEU n 
1 52  MET n 
1 53  ASP n 
1 54  ILE n 
1 55  VAL n 
1 56  PRO n 
1 57  ALA n 
1 58  ASP n 
1 59  ASP n 
1 60  HIS n 
1 61  ARG n 
1 62  TYR n 
1 63  LYS n 
1 64  PHE n 
1 65  ALA n 
1 66  ASP n 
1 67  ASN n 
1 68  LYS n 
1 69  TRP n 
1 70  SER n 
1 71  VAL n 
1 72  THR n 
1 73  GLY n 
1 74  LYS n 
1 75  ALA n 
1 76  GLU n 
1 77  PRO n 
1 78  ALA n 
1 79  MET n 
1 80  PRO n 
1 81  GLY n 
1 82  ARG n 
1 83  LEU n 
1 84  TYR n 
1 85  VAL n 
1 86  HIS n 
1 87  PRO n 
1 88  ASP n 
1 89  SER n 
1 90  PRO n 
1 91  ALA n 
1 92  THR n 
1 93  GLY n 
1 94  ALA n 
1 95  HIS n 
1 96  TRP n 
1 97  MET n 
1 98  ARG n 
1 99  GLN n 
1 100 LEU n 
1 101 VAL n 
1 102 SER n 
1 103 PHE n 
1 104 GLN n 
1 105 LYS n 
1 106 LEU n 
1 107 LYS n 
1 108 LEU n 
1 109 THR n 
1 110 ASN n 
1 111 ASN n 
1 112 HIS n 
1 113 LEU n 
1 114 ASP n 
1 115 PRO n 
1 116 PHE n 
1 117 GLY n 
1 118 HIS n 
1 119 ILE n 
1 120 ILE n 
1 121 LEU n 
1 122 ASN n 
1 123 SER n 
1 124 MET n 
1 125 HIS n 
1 126 LYS n 
1 127 TYR n 
1 128 GLN n 
1 129 PRO n 
1 130 ARG n 
1 131 LEU n 
1 132 HIS n 
1 133 ILE n 
1 134 VAL n 
1 135 LYS n 
1 136 ALA n 
1 137 ASP n 
1 138 GLU n 
1 139 ASN n 
1 140 ASN n 
1 141 GLY n 
1 142 PHE n 
1 143 GLY n 
1 144 SER n 
1 145 LYS n 
1 146 ASN n 
1 147 THR n 
1 148 ALA n 
1 149 PHE n 
1 150 CYS n 
1 151 THR n 
1 152 HIS n 
1 153 VAL n 
1 154 PHE n 
1 155 PRO n 
1 156 GLU n 
1 157 THR n 
1 158 ALA n 
1 159 PHE n 
1 160 ILE n 
1 161 ALA n 
1 162 VAL n 
1 163 THR n 
1 164 SER n 
1 165 TYR n 
1 166 GLN n 
1 167 ASN n 
1 168 HIS n 
1 169 LYS n 
1 170 ILE n 
1 171 THR n 
1 172 GLN n 
1 173 LEU n 
1 174 LYS n 
1 175 ILE n 
1 176 GLU n 
1 177 ASN n 
1 178 ASN n 
1 179 PRO n 
1 180 PHE n 
1 181 ALA n 
1 182 LYS n 
1 183 GLY n 
1 184 PHE n 
1 185 ARG n 
1 186 GLY n 
2 1   ARG n 
2 2   VAL n 
2 3   LEU n 
2 4   PHE n 
2 5   SER n 
2 6   GLN n 
2 7   ALA n 
2 8   GLN n 
2 9   VAL n 
2 10  TYR n 
2 11  GLU n 
2 12  LEU n 
2 13  GLU n 
2 14  ARG n 
2 15  ARG n 
2 16  PHE n 
2 17  LYS n 
2 18  GLN n 
2 19  GLN n 
2 20  ARG n 
2 21  TYR n 
2 22  LEU n 
2 23  SER n 
2 24  ALA n 
2 25  PRO n 
2 26  GLU n 
2 27  ARG n 
2 28  ASP n 
2 29  GLN n 
2 30  LEU n 
2 31  ALA n 
2 32  SER n 
2 33  VAL n 
2 34  LEU n 
2 35  LYS n 
2 36  LEU n 
2 37  THR n 
2 38  SER n 
2 39  THR n 
2 40  GLN n 
2 41  VAL n 
2 42  LYS n 
2 43  ILE n 
2 44  TRP n 
2 45  PHE n 
2 46  GLN n 
2 47  ASN n 
2 48  ARG n 
2 49  ARG n 
2 50  TYR n 
2 51  LYS n 
2 52  SER n 
2 53  LYS n 
3 1   DT  n 
3 2   DC  n 
3 3   DT  n 
3 4   DC  n 
3 5   DA  n 
3 6   DC  n 
3 7   DA  n 
3 8   DC  n 
3 9   DC  n 
3 10  DT  n 
3 11  DT  n 
3 12  DT  n 
3 13  DG  n 
3 14  DA  n 
3 15  DA  n 
3 16  DG  n 
3 17  DT  n 
3 18  DG  n 
3 19  DG  n 
4 1   DC  n 
4 2   DC  n 
4 3   DA  n 
4 4   DC  n 
4 5   DT  n 
4 6   DT  n 
4 7   DC  n 
4 8   DA  n 
4 9   DA  n 
4 10  DA  n 
4 11  DG  n 
4 12  DG  n 
4 13  DT  n 
4 14  DG  n 
4 15  DT  n 
4 16  DG  n 
4 17  DA  n 
4 18  DG  n 
4 19  DA  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? TBX5                         ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? unidentified 32644 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human ? 'NKX2-5, CSX, NKX2.5, NKX2E' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? unidentified 32644 ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
4 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TBX5_HUMAN  Q99593 1 
;GIKVFLHERELWLKFHEVGTEMIITKAGRRMFPSYKVKVTGLNPKTKYILLMDIVPADDHRYKFADNKWSVTGKAEPAMP
GRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFI
AVTSYQNHKITQLKIENNPFAKGFRG
;
53  ? 
2 UNP NKX25_HUMAN P52952 2 RVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCK 142 ? 
3 PDB 4S0H        4S0H   3 TCTCACACCTTTGAAGTGG 1   ? 
4 PDB 4S0H        4S0H   4 CCACTTCAAAGGTGTGAGA 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4S0H A 1 ? 186 ? Q99593 53  ? 238 ? 53  238 
2 2 4S0H B 1 ? 53  ? P52952 142 ? 194 ? 142 194 
3 1 4S0H E 1 ? 186 ? Q99593 53  ? 238 ? 53  238 
4 2 4S0H F 1 ? 53  ? P52952 142 ? 194 ? 105 157 
5 3 4S0H C 1 ? 19  ? 4S0H   1   ? 19  ? 1   19  
6 3 4S0H G 1 ? 19  ? 4S0H   1   ? 19  ? 1   19  
7 4 4S0H D 1 ? 19  ? 4S0H   1   ? 19  ? 1   19  
8 4 4S0H H 1 ? 19  ? 4S0H   1   ? 19  ? 1   19  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 4S0H SER B 52 ? UNP P52952 CYS 193 CONFLICT 193 1 
4 4S0H SER F 52 ? UNP P52952 CYS 193 CONFLICT 156 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4S0H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.59 
_exptl_crystal.density_percent_sol   52.55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    diamond 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97670 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE A1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   A1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97670 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4S0H 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             74.481 
_reflns.d_resolution_high            2.817 
_reflns.number_obs                   18168 
_reflns.number_all                   19742 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.817 
_reflns_shell.d_res_low              ? 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4S0H 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     18072 
_refine.ls_number_reflns_all                     18168 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.12 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             38.164 
_refine.ls_d_res_high                            2.817 
_refine.ls_percent_reflns_obs                    91.58 
_refine.ls_R_factor_obs                          0.1946 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1888 
_refine.ls_R_factor_R_free                       0.2475 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.00 
_refine.ls_number_reflns_R_free                  1807 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -9.3562 
_refine.aniso_B[2][2]                            27.0418 
_refine.aniso_B[3][3]                            -17.6856 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -8.6444 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.38 
_refine.pdbx_overall_phase_error                 28.93 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3802 
_refine_hist.pdbx_number_atoms_nucleic_acid   1546 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               5350 
_refine_hist.d_res_high                       2.817 
_refine_hist.d_res_low                        38.164 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 5636 'X-RAY DIFFRACTION' ? 
f_angle_d          1.387  ? ? 7931 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 25.265 ? ? 2213 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.063  ? ? 861  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.008  ? ? 740  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.8166 2.8927  835  0.3160 61.00 0.4249 . . 92  . . . . 
'X-RAY DIFFRACTION' . 2.8927 2.9778  1035 0.2921 77.00 0.4157 . . 115 . . . . 
'X-RAY DIFFRACTION' . 2.9778 3.0739  1080 0.2889 80.00 0.3549 . . 119 . . . . 
'X-RAY DIFFRACTION' . 3.0739 3.1837  1247 0.2500 91.00 0.3669 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.1837 3.3111  1288 0.2095 96.00 0.3241 . . 144 . . . . 
'X-RAY DIFFRACTION' . 3.3111 3.4617  1331 0.1937 98.00 0.2369 . . 149 . . . . 
'X-RAY DIFFRACTION' . 3.4617 3.6440  1342 0.2070 98.00 0.2514 . . 149 . . . . 
'X-RAY DIFFRACTION' . 3.6440 3.8722  1346 0.1891 99.00 0.2429 . . 149 . . . . 
'X-RAY DIFFRACTION' . 3.8722 4.1708  1335 0.1817 97.00 0.2466 . . 149 . . . . 
'X-RAY DIFFRACTION' . 4.1708 4.5899  1344 0.1628 98.00 0.2265 . . 149 . . . . 
'X-RAY DIFFRACTION' . 4.5899 5.2526  1351 0.1550 99.00 0.2301 . . 150 . . . . 
'X-RAY DIFFRACTION' . 5.2526 6.6121  1374 0.1702 99.00 0.2143 . . 152 . . . . 
'X-RAY DIFFRACTION' . 6.6121 38.1675 1357 0.1623 96.00 0.1840 . . 151 . . . . 
# 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.entry_id                                    4S0H 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_error_no_cutoff                      ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
# 
_struct.entry_id                  4S0H 
_struct.title                     'TBX5 DB, NKX2.5 HD, ANF DNA Complex' 
_struct.pdbx_descriptor           'T-box transcription factor TBX5, Homeobox protein Nkx-2.5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4S0H 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'Transcription Factor, TRANSCRIPTION-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 8   ? GLU A 17  ? GLU A 60  GLU A 69  1 ? 10 
HELX_P HELX_P2  2  GLY A 93  ? GLN A 99  ? GLY A 145 GLN A 151 1 ? 7  
HELX_P HELX_P3  3  PRO A 155 ? ALA A 158 ? PRO A 207 ALA A 210 5 ? 4  
HELX_P HELX_P4  4  ASN A 167 ? ASN A 178 ? ASN A 219 ASN A 230 1 ? 12 
HELX_P HELX_P5  5  PRO A 179 ? ARG A 185 ? PRO A 231 ARG A 237 5 ? 7  
HELX_P HELX_P6  6  SER B 5   ? GLN B 19  ? SER B 146 GLN B 160 1 ? 15 
HELX_P HELX_P7  7  PRO B 25  ? LYS B 35  ? PRO B 166 LYS B 176 1 ? 11 
HELX_P HELX_P8  8  THR B 37  ? SER B 52  ? THR B 178 SER B 193 1 ? 16 
HELX_P HELX_P9  9  GLU C 8   ? GLY C 19  ? GLU E 60  GLY E 71  1 ? 12 
HELX_P HELX_P10 10 GLY C 93  ? ARG C 98  ? GLY E 145 ARG E 150 1 ? 6  
HELX_P HELX_P11 11 PHE C 154 ? ALA C 158 ? PHE E 206 ALA E 210 5 ? 5  
HELX_P HELX_P12 12 ASN C 167 ? ASN C 178 ? ASN E 219 ASN E 230 1 ? 12 
HELX_P HELX_P13 13 PRO C 179 ? ARG C 185 ? PRO E 231 ARG E 237 5 ? 7  
HELX_P HELX_P14 14 SER D 5   ? LYS D 17  ? SER F 109 LYS F 121 1 ? 13 
HELX_P HELX_P15 15 SER D 23  ? LYS D 35  ? SER F 127 LYS F 139 1 ? 13 
HELX_P HELX_P16 16 THR D 37  ? SER D 52  ? THR F 141 SER F 156 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? E DT 1  N3 ? ? ? 1_555 F DA 19 N1 ? ? C DT 1  D DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2  hydrog ? ? E DT 1  O4 ? ? ? 1_555 F DA 19 N6 ? ? C DT 1  D DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3  hydrog ? ? E DC 2  N3 ? ? ? 1_555 F DG 18 N1 ? ? C DC 2  D DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? E DC 2  N4 ? ? ? 1_555 F DG 18 O6 ? ? C DC 2  D DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5  hydrog ? ? E DC 2  O2 ? ? ? 1_555 F DG 18 N2 ? ? C DC 2  D DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? E DT 3  N3 ? ? ? 1_555 F DA 17 N1 ? ? C DT 3  D DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7  hydrog ? ? E DT 3  O4 ? ? ? 1_555 F DA 17 N6 ? ? C DT 3  D DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? E DC 4  N4 ? ? ? 1_555 F DT 15 O4 ? ? C DC 4  D DT 15 1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? 
hydrog9  hydrog ? ? E DC 4  N3 ? ? ? 1_555 F DG 16 N1 ? ? C DC 4  D DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? E DC 4  N4 ? ? ? 1_555 F DG 16 O6 ? ? C DC 4  D DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? E DC 4  O2 ? ? ? 1_555 F DG 16 N2 ? ? C DC 4  D DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12 hydrog ? ? E DA 5  N1 ? ? ? 1_555 F DT 15 N3 ? ? C DA 5  D DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13 hydrog ? ? E DA 5  N6 ? ? ? 1_555 F DT 15 O4 ? ? C DA 5  D DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14 hydrog ? ? E DC 6  N4 ? ? ? 1_555 F DG 14 O6 ? ? C DC 6  D DG 14 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog15 hydrog ? ? E DA 7  N1 ? ? ? 1_555 F DT 13 N3 ? ? C DA 7  D DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16 hydrog ? ? E DA 7  N6 ? ? ? 1_555 F DT 13 O4 ? ? C DA 7  D DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? E DC 8  N3 ? ? ? 1_555 F DG 12 N1 ? ? C DC 8  D DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18 hydrog ? ? E DC 8  N4 ? ? ? 1_555 F DG 12 O6 ? ? C DC 8  D DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19 hydrog ? ? E DC 8  O2 ? ? ? 1_555 F DG 12 N2 ? ? C DC 8  D DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20 hydrog ? ? E DC 9  N3 ? ? ? 1_555 F DG 11 N1 ? ? C DC 9  D DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21 hydrog ? ? E DC 9  N4 ? ? ? 1_555 F DG 11 O6 ? ? C DC 9  D DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22 hydrog ? ? E DC 9  O2 ? ? ? 1_555 F DG 11 N2 ? ? C DC 9  D DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? E DT 10 N3 ? ? ? 1_555 F DA 10 N1 ? ? C DT 10 D DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? E DT 10 O4 ? ? ? 1_555 F DA 10 N6 ? ? C DT 10 D DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25 hydrog ? ? E DT 11 N3 ? ? ? 1_555 F DA 9  N1 ? ? C DT 11 D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? E DT 11 O4 ? ? ? 1_555 F DA 9  N6 ? ? C DT 11 D DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27 hydrog ? ? E DT 12 N3 ? ? ? 1_555 F DA 8  N1 ? ? C DT 12 D DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? E DT 12 O4 ? ? ? 1_555 F DA 8  N6 ? ? C DT 12 D DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? E DG 13 N1 ? ? ? 1_555 F DC 7  N3 ? ? C DG 13 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? E DG 13 N2 ? ? ? 1_555 F DC 7  O2 ? ? C DG 13 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31 hydrog ? ? E DG 13 O6 ? ? ? 1_555 F DC 7  N4 ? ? C DG 13 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32 hydrog ? ? E DA 14 N1 ? ? ? 1_555 F DT 6  N3 ? ? C DA 14 D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33 hydrog ? ? E DA 14 N6 ? ? ? 1_555 F DT 6  O4 ? ? C DA 14 D DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34 hydrog ? ? E DA 15 N1 ? ? ? 1_555 F DT 5  N3 ? ? C DA 15 D DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35 hydrog ? ? E DA 15 N6 ? ? ? 1_555 F DT 5  O4 ? ? C DA 15 D DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36 hydrog ? ? E DG 16 N1 ? ? ? 1_555 F DC 4  N3 ? ? C DG 16 D DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37 hydrog ? ? E DG 16 N2 ? ? ? 1_555 F DC 4  O2 ? ? C DG 16 D DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38 hydrog ? ? E DG 16 O6 ? ? ? 1_555 F DC 4  N4 ? ? C DG 16 D DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39 hydrog ? ? E DT 17 N3 ? ? ? 1_555 F DA 3  N1 ? ? C DT 17 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40 hydrog ? ? E DT 17 O4 ? ? ? 1_555 F DA 3  N6 ? ? C DT 17 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41 hydrog ? ? E DG 18 N1 ? ? ? 1_555 F DC 2  N3 ? ? C DG 18 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42 hydrog ? ? E DG 18 N2 ? ? ? 1_555 F DC 2  O2 ? ? C DG 18 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43 hydrog ? ? E DG 18 O6 ? ? ? 1_555 F DC 2  N4 ? ? C DG 18 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44 hydrog ? ? E DG 19 N1 ? ? ? 1_555 F DC 1  N3 ? ? C DG 19 D DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45 hydrog ? ? E DG 19 N2 ? ? ? 1_555 F DC 1  O2 ? ? C DG 19 D DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46 hydrog ? ? E DG 19 O6 ? ? ? 1_555 F DC 1  N4 ? ? C DG 19 D DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47 hydrog ? ? G DT 1  N3 ? ? ? 1_555 H DA 19 N1 ? ? G DT 1  H DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48 hydrog ? ? G DT 1  O4 ? ? ? 1_555 H DA 19 N6 ? ? G DT 1  H DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49 hydrog ? ? G DC 2  N3 ? ? ? 1_555 H DG 18 N1 ? ? G DC 2  H DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50 hydrog ? ? G DC 2  N4 ? ? ? 1_555 H DG 18 O6 ? ? G DC 2  H DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51 hydrog ? ? G DC 2  O2 ? ? ? 1_555 H DG 18 N2 ? ? G DC 2  H DG 18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52 hydrog ? ? G DT 3  N3 ? ? ? 1_555 H DA 17 N1 ? ? G DT 3  H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53 hydrog ? ? G DT 3  O4 ? ? ? 1_555 H DA 17 N6 ? ? G DT 3  H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54 hydrog ? ? G DC 4  N3 ? ? ? 1_555 H DG 16 N1 ? ? G DC 4  H DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55 hydrog ? ? G DC 4  N4 ? ? ? 1_555 H DG 16 O6 ? ? G DC 4  H DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56 hydrog ? ? G DC 4  O2 ? ? ? 1_555 H DG 16 N2 ? ? G DC 4  H DG 16 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57 hydrog ? ? G DA 5  N1 ? ? ? 1_555 H DT 15 N3 ? ? G DA 5  H DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58 hydrog ? ? G DA 5  N6 ? ? ? 1_555 H DT 15 O4 ? ? G DA 5  H DT 15 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59 hydrog ? ? G DC 6  N3 ? ? ? 1_555 H DG 14 N1 ? ? G DC 6  H DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60 hydrog ? ? G DC 6  N4 ? ? ? 1_555 H DG 14 O6 ? ? G DC 6  H DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61 hydrog ? ? G DC 6  O2 ? ? ? 1_555 H DG 14 N2 ? ? G DC 6  H DG 14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62 hydrog ? ? G DA 7  N1 ? ? ? 1_555 H DT 13 N3 ? ? G DA 7  H DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63 hydrog ? ? G DA 7  N6 ? ? ? 1_555 H DT 13 O4 ? ? G DA 7  H DT 13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64 hydrog ? ? G DC 8  N3 ? ? ? 1_555 H DG 12 N1 ? ? G DC 8  H DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65 hydrog ? ? G DC 8  N4 ? ? ? 1_555 H DG 12 O6 ? ? G DC 8  H DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66 hydrog ? ? G DC 8  O2 ? ? ? 1_555 H DG 12 N2 ? ? G DC 8  H DG 12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67 hydrog ? ? G DC 9  N3 ? ? ? 1_555 H DG 11 N1 ? ? G DC 9  H DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68 hydrog ? ? G DC 9  N4 ? ? ? 1_555 H DG 11 O6 ? ? G DC 9  H DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69 hydrog ? ? G DC 9  O2 ? ? ? 1_555 H DG 11 N2 ? ? G DC 9  H DG 11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70 hydrog ? ? G DT 10 N3 ? ? ? 1_555 H DA 10 N1 ? ? G DT 10 H DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71 hydrog ? ? G DT 10 O4 ? ? ? 1_555 H DA 10 N6 ? ? G DT 10 H DA 10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72 hydrog ? ? G DT 11 N3 ? ? ? 1_555 H DA 9  N1 ? ? G DT 11 H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73 hydrog ? ? G DT 11 O4 ? ? ? 1_555 H DA 9  N6 ? ? G DT 11 H DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74 hydrog ? ? G DT 12 N3 ? ? ? 1_555 H DA 8  N1 ? ? G DT 12 H DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75 hydrog ? ? G DT 12 O4 ? ? ? 1_555 H DA 8  N6 ? ? G DT 12 H DA 8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76 hydrog ? ? G DG 13 N1 ? ? ? 1_555 H DC 7  N3 ? ? G DG 13 H DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77 hydrog ? ? G DG 13 N2 ? ? ? 1_555 H DC 7  O2 ? ? G DG 13 H DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78 hydrog ? ? G DG 13 O6 ? ? ? 1_555 H DC 7  N4 ? ? G DG 13 H DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79 hydrog ? ? G DA 14 N1 ? ? ? 1_555 H DT 6  N3 ? ? G DA 14 H DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80 hydrog ? ? G DA 14 N6 ? ? ? 1_555 H DT 6  O4 ? ? G DA 14 H DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81 hydrog ? ? G DA 15 N1 ? ? ? 1_555 H DT 5  N3 ? ? G DA 15 H DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82 hydrog ? ? G DA 15 N6 ? ? ? 1_555 H DT 5  O4 ? ? G DA 15 H DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83 hydrog ? ? G DG 16 N1 ? ? ? 1_555 H DC 4  N3 ? ? G DG 16 H DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84 hydrog ? ? G DG 16 N2 ? ? ? 1_555 H DC 4  O2 ? ? G DG 16 H DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85 hydrog ? ? G DG 16 O6 ? ? ? 1_555 H DC 4  N4 ? ? G DG 16 H DC 4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86 hydrog ? ? G DT 17 N3 ? ? ? 1_555 H DA 3  N1 ? ? G DT 17 H DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87 hydrog ? ? G DT 17 O4 ? ? ? 1_555 H DA 3  N6 ? ? G DT 17 H DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88 hydrog ? ? G DG 18 N1 ? ? ? 1_555 H DC 2  N3 ? ? G DG 18 H DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89 hydrog ? ? G DG 18 N2 ? ? ? 1_555 H DC 2  O2 ? ? G DG 18 H DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90 hydrog ? ? G DG 18 O6 ? ? ? 1_555 H DC 2  N4 ? ? G DG 18 H DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91 hydrog ? ? G DG 19 N1 ? ? ? 1_555 H DC 1  N3 ? ? G DG 19 H DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92 hydrog ? ? G DG 19 N2 ? ? ? 1_555 H DC 1  O2 ? ? G DG 19 H DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93 hydrog ? ? G DG 19 O6 ? ? ? 1_555 H DC 1  N4 ? ? G DG 19 H DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 32 A . ? PHE 84  A PRO 33 A ? PRO 85  A 1 4.08   
2 ALA 78 A . ? ALA 130 A MET 79 A ? MET 131 A 1 -26.47 
3 SER 89 A . ? SER 141 A PRO 90 A ? PRO 142 A 1 -13.86 
4 PHE 32 C . ? PHE 84  E PRO 33 C ? PRO 85  E 1 0.53   
5 SER 89 C . ? SER 141 E PRO 90 C ? PRO 142 E 1 -2.19  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 4 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 4 ? 
H ? 4 ? 
I ? 3 ? 
J ? 3 ? 
K ? 5 ? 
L ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? parallel      
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 3   ? LEU A 6   ? LYS A 55  LEU A 58  
A 2 TYR A 35  ? THR A 40  ? TYR A 87  THR A 92  
A 3 VAL A 101 ? PHE A 103 ? VAL A 153 PHE A 155 
B 1 GLU A 21  ? ILE A 23  ? GLU A 73  ILE A 75  
B 2 PHE A 159 ? VAL A 162 ? PHE A 211 VAL A 214 
B 3 LYS A 126 ? LYS A 135 ? LYS A 178 LYS A 187 
B 4 LYS A 47  ? PRO A 56  ? LYS A 99  PRO A 108 
B 5 ALA A 91  ? THR A 92  ? ALA A 143 THR A 144 
C 1 TYR A 84  ? VAL A 85  ? TYR A 136 VAL A 137 
C 2 LYS A 47  ? PRO A 56  ? LYS A 99  PRO A 108 
C 3 LYS A 126 ? LYS A 135 ? LYS A 178 LYS A 187 
C 4 CYS A 150 ? VAL A 153 ? CYS A 202 VAL A 205 
D 1 ARG A 29  ? ARG A 30  ? ARG A 81  ARG A 82  
D 2 LYS A 107 ? THR A 109 ? LYS A 159 THR A 161 
D 3 ILE A 119 ? ILE A 120 ? ILE A 171 ILE A 172 
E 1 HIS A 60  ? PHE A 64  ? HIS A 112 PHE A 116 
E 2 TRP A 69  ? LYS A 74  ? TRP A 121 LYS A 126 
F 1 LYS C 3   ? LEU C 6   ? LYS E 55  LEU E 58  
F 2 LYS C 36  ? THR C 40  ? LYS E 88  THR E 92  
F 3 VAL C 101 ? SER C 102 ? VAL E 153 SER E 154 
G 1 GLU C 21  ? ILE C 23  ? GLU E 73  ILE E 75  
G 2 PHE C 159 ? VAL C 162 ? PHE E 211 VAL E 214 
G 3 HIS C 125 ? VAL C 134 ? HIS E 177 VAL E 186 
G 4 CYS C 150 ? HIS C 152 ? CYS E 202 HIS E 204 
H 1 CYS C 150 ? HIS C 152 ? CYS E 202 HIS E 204 
H 2 HIS C 125 ? VAL C 134 ? HIS E 177 VAL E 186 
H 3 LYS C 47  ? PHE C 64  ? LYS E 99  PHE E 116 
H 4 TRP C 69  ? GLY C 73  ? TRP E 121 GLY E 125 
I 1 TRP C 69  ? GLY C 73  ? TRP E 121 GLY E 125 
I 2 LYS C 47  ? PHE C 64  ? LYS E 99  PHE E 116 
I 3 TYR C 84  ? VAL C 85  ? TYR E 136 VAL E 137 
J 1 TYR C 84  ? VAL C 85  ? TYR E 136 VAL E 137 
J 2 LYS C 47  ? PHE C 64  ? LYS E 99  PHE E 116 
J 3 ALA C 91  ? THR C 92  ? ALA E 143 THR E 144 
K 1 ALA C 91  ? THR C 92  ? ALA E 143 THR E 144 
K 2 LYS C 47  ? PHE C 64  ? LYS E 99  PHE E 116 
K 3 HIS C 125 ? VAL C 134 ? HIS E 177 VAL E 186 
K 4 PHE C 159 ? VAL C 162 ? PHE E 211 VAL E 214 
K 5 GLU C 21  ? ILE C 23  ? GLU E 73  ILE E 75  
L 1 ARG C 29  ? ARG C 30  ? ARG E 81  ARG E 82  
L 2 LYS C 107 ? THR C 109 ? LYS E 159 THR E 161 
L 3 ILE C 119 ? ILE C 120 ? ILE E 171 ILE E 172 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 3   ? N LYS A 55  O THR A 40  ? O THR A 92  
A 2 3 N TYR A 35  ? N TYR A 87  O PHE A 103 ? O PHE A 155 
B 1 2 N MET A 22  ? N MET A 74  O VAL A 162 ? O VAL A 214 
B 2 3 O PHE A 159 ? O PHE A 211 N TYR A 127 ? N TYR A 179 
B 3 4 O VAL A 134 ? O VAL A 186 N ILE A 49  ? N ILE A 101 
B 4 5 N TYR A 48  ? N TYR A 100 O ALA A 91  ? O ALA A 143 
C 1 2 O TYR A 84  ? O TYR A 136 N MET A 52  ? N MET A 104 
C 2 3 N ILE A 49  ? N ILE A 101 O VAL A 134 ? O VAL A 186 
C 3 4 N ILE A 133 ? N ILE A 185 O CYS A 150 ? O CYS A 202 
D 1 2 N ARG A 29  ? N ARG A 81  O LEU A 108 ? O LEU A 160 
D 2 3 N THR A 109 ? N THR A 161 O ILE A 119 ? O ILE A 171 
E 1 2 N ARG A 61  ? N ARG A 113 O GLY A 73  ? O GLY A 125 
F 1 2 N LYS C 3   ? N LYS E 55  O THR C 40  ? O THR E 92  
F 2 3 N VAL C 37  ? N VAL E 89  O VAL C 101 ? O VAL E 153 
G 1 2 N MET C 22  ? N MET E 74  O VAL C 162 ? O VAL E 214 
G 2 3 O PHE C 159 ? O PHE E 211 N TYR C 127 ? N TYR E 179 
G 3 4 N LEU C 131 ? N LEU E 183 O HIS C 152 ? O HIS E 204 
H 1 2 O HIS C 152 ? O HIS E 204 N LEU C 131 ? N LEU E 183 
H 2 3 O GLN C 128 ? O GLN E 180 N VAL C 55  ? N VAL E 107 
H 3 4 N ARG C 61  ? N ARG E 113 O THR C 72  ? O THR E 124 
I 1 2 O THR C 72  ? O THR E 124 N ARG C 61  ? N ARG E 113 
I 2 3 N MET C 52  ? N MET E 104 O TYR C 84  ? O TYR E 136 
J 1 2 O TYR C 84  ? O TYR E 136 N MET C 52  ? N MET E 104 
J 2 3 N TYR C 48  ? N TYR E 100 O ALA C 91  ? O ALA E 143 
K 1 2 O ALA C 91  ? O ALA E 143 N TYR C 48  ? N TYR E 100 
K 2 3 N VAL C 55  ? N VAL E 107 O GLN C 128 ? O GLN E 180 
K 3 4 N TYR C 127 ? N TYR E 179 O PHE C 159 ? O PHE E 211 
K 4 5 O VAL C 162 ? O VAL E 214 N MET C 22  ? N MET E 74  
L 1 2 N ARG C 29  ? N ARG E 81  O LEU C 108 ? O LEU E 160 
L 2 3 N THR C 109 ? N THR E 161 O ILE C 119 ? O ILE E 171 
# 
_database_PDB_matrix.entry_id          4S0H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4S0H 
_atom_sites.fract_transf_matrix[1][1]   0.014242 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004857 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012746 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013426 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . GLY A 1 1   ? 6.578   44.051  -8.821  1.00 66.39  ? 53  GLY A N     1 
ATOM   2    C CA    . GLY A 1 1   ? 6.012   42.715  -8.756  1.00 69.88  ? 53  GLY A CA    1 
ATOM   3    C C     . GLY A 1 1   ? 7.016   41.643  -9.141  1.00 70.94  ? 53  GLY A C     1 
ATOM   4    O O     . GLY A 1 1   ? 8.224   41.867  -9.082  1.00 76.57  ? 53  GLY A O     1 
ATOM   5    N N     . ILE A 1 2   ? 6.515   40.473  -9.526  1.00 67.62  ? 54  ILE A N     1 
ATOM   6    C CA    . ILE A 1 2   ? 7.363   39.344  -9.890  1.00 66.51  ? 54  ILE A CA    1 
ATOM   7    C C     . ILE A 1 2   ? 8.308   39.721  -11.021 1.00 69.23  ? 54  ILE A C     1 
ATOM   8    O O     . ILE A 1 2   ? 7.908   40.400  -11.961 1.00 73.86  ? 54  ILE A O     1 
ATOM   9    C CB    . ILE A 1 2   ? 6.518   38.126  -10.310 1.00 66.41  ? 54  ILE A CB    1 
ATOM   10   C CG1   . ILE A 1 2   ? 5.648   37.663  -9.140  1.00 64.42  ? 54  ILE A CG1   1 
ATOM   11   C CG2   . ILE A 1 2   ? 7.406   36.986  -10.791 1.00 66.29  ? 54  ILE A CG2   1 
ATOM   12   C CD1   . ILE A 1 2   ? 4.496   36.789  -9.557  1.00 64.23  ? 54  ILE A CD1   1 
ATOM   13   N N     . LYS A 1 3   ? 9.565   39.305  -10.915 1.00 61.31  ? 55  LYS A N     1 
ATOM   14   C CA    . LYS A 1 3   ? 10.520  39.538  -11.979 1.00 65.81  ? 55  LYS A CA    1 
ATOM   15   C C     . LYS A 1 3   ? 11.542  38.399  -12.047 1.00 62.66  ? 55  LYS A C     1 
ATOM   16   O O     . LYS A 1 3   ? 11.811  37.733  -11.048 1.00 58.86  ? 55  LYS A O     1 
ATOM   17   C CB    . LYS A 1 3   ? 11.200  40.899  -11.800 1.00 69.55  ? 55  LYS A CB    1 
ATOM   18   C CG    . LYS A 1 3   ? 10.454  42.045  -12.505 1.00 72.62  ? 55  LYS A CG    1 
ATOM   19   C CD    . LYS A 1 3   ? 11.265  43.337  -12.585 1.00 71.65  ? 55  LYS A CD    1 
ATOM   20   C CE    . LYS A 1 3   ? 12.671  43.093  -13.135 1.00 67.37  ? 55  LYS A CE    1 
ATOM   21   N NZ    . LYS A 1 3   ? 12.703  42.200  -14.321 1.00 65.04  ? 55  LYS A NZ    1 
ATOM   22   N N     . VAL A 1 4   ? 12.087  38.182  -13.242 1.00 56.13  ? 56  VAL A N     1 
ATOM   23   C CA    . VAL A 1 4   ? 12.881  37.000  -13.543 1.00 49.86  ? 56  VAL A CA    1 
ATOM   24   C C     . VAL A 1 4   ? 14.211  37.402  -14.175 1.00 50.12  ? 56  VAL A C     1 
ATOM   25   O O     . VAL A 1 4   ? 14.275  38.351  -14.950 1.00 52.62  ? 56  VAL A O     1 
ATOM   26   C CB    . VAL A 1 4   ? 12.091  36.050  -14.477 1.00 56.62  ? 56  VAL A CB    1 
ATOM   27   C CG1   . VAL A 1 4   ? 12.984  34.957  -15.077 1.00 50.62  ? 56  VAL A CG1   1 
ATOM   28   C CG2   . VAL A 1 4   ? 10.923  35.444  -13.728 1.00 54.14  ? 56  VAL A CG2   1 
ATOM   29   N N     . PHE A 1 5   ? 15.283  36.706  -13.825 1.00 46.68  ? 57  PHE A N     1 
ATOM   30   C CA    . PHE A 1 5   ? 16.597  37.073  -14.333 1.00 50.04  ? 57  PHE A CA    1 
ATOM   31   C C     . PHE A 1 5   ? 17.263  35.877  -14.939 1.00 48.13  ? 57  PHE A C     1 
ATOM   32   O O     . PHE A 1 5   ? 17.351  34.829  -14.301 1.00 50.36  ? 57  PHE A O     1 
ATOM   33   C CB    . PHE A 1 5   ? 17.486  37.631  -13.227 1.00 52.41  ? 57  PHE A CB    1 
ATOM   34   C CG    . PHE A 1 5   ? 16.824  38.660  -12.395 1.00 52.95  ? 57  PHE A CG    1 
ATOM   35   C CD1   . PHE A 1 5   ? 16.731  39.966  -12.840 1.00 54.58  ? 57  PHE A CD1   1 
ATOM   36   C CD2   . PHE A 1 5   ? 16.276  38.323  -11.166 1.00 55.09  ? 57  PHE A CD2   1 
ATOM   37   C CE1   . PHE A 1 5   ? 16.103  40.924  -12.063 1.00 63.80  ? 57  PHE A CE1   1 
ATOM   38   C CE2   . PHE A 1 5   ? 15.643  39.271  -10.382 1.00 57.31  ? 57  PHE A CE2   1 
ATOM   39   C CZ    . PHE A 1 5   ? 15.555  40.573  -10.828 1.00 61.77  ? 57  PHE A CZ    1 
ATOM   40   N N     . LEU A 1 6   ? 17.754  36.035  -16.160 1.00 47.38  ? 58  LEU A N     1 
ATOM   41   C CA    . LEU A 1 6   ? 18.338  34.907  -16.861 1.00 50.98  ? 58  LEU A CA    1 
ATOM   42   C C     . LEU A 1 6   ? 19.721  34.619  -16.298 1.00 50.45  ? 58  LEU A C     1 
ATOM   43   O O     . LEU A 1 6   ? 20.636  35.439  -16.390 1.00 53.74  ? 58  LEU A O     1 
ATOM   44   C CB    . LEU A 1 6   ? 18.407  35.160  -18.373 1.00 48.37  ? 58  LEU A CB    1 
ATOM   45   C CG    . LEU A 1 6   ? 19.041  33.981  -19.102 1.00 46.36  ? 58  LEU A CG    1 
ATOM   46   C CD1   . LEU A 1 6   ? 18.144  32.764  -18.999 1.00 46.35  ? 58  LEU A CD1   1 
ATOM   47   C CD2   . LEU A 1 6   ? 19.329  34.308  -20.535 1.00 49.74  ? 58  LEU A CD2   1 
ATOM   48   N N     . HIS A 1 7   ? 19.859  33.450  -15.697 1.00 45.49  ? 59  HIS A N     1 
ATOM   49   C CA    . HIS A 1 7   ? 21.146  33.024  -15.213 1.00 49.87  ? 59  HIS A CA    1 
ATOM   50   C C     . HIS A 1 7   ? 22.076  32.759  -16.381 1.00 52.58  ? 59  HIS A C     1 
ATOM   51   O O     . HIS A 1 7   ? 21.653  32.272  -17.436 1.00 53.38  ? 59  HIS A O     1 
ATOM   52   C CB    . HIS A 1 7   ? 21.007  31.776  -14.354 1.00 56.96  ? 59  HIS A CB    1 
ATOM   53   C CG    . HIS A 1 7   ? 22.313  31.191  -13.919 1.00 54.20  ? 59  HIS A CG    1 
ATOM   54   N ND1   . HIS A 1 7   ? 22.937  31.557  -12.743 1.00 50.06  ? 59  HIS A ND1   1 
ATOM   55   C CD2   . HIS A 1 7   ? 23.106  30.257  -14.493 1.00 48.61  ? 59  HIS A CD2   1 
ATOM   56   C CE1   . HIS A 1 7   ? 24.055  30.869  -12.615 1.00 53.93  ? 59  HIS A CE1   1 
ATOM   57   N NE2   . HIS A 1 7   ? 24.182  30.074  -13.665 1.00 51.71  ? 59  HIS A NE2   1 
ATOM   58   N N     . GLU A 1 8   ? 23.344  33.095  -16.169 1.00 54.63  ? 60  GLU A N     1 
ATOM   59   C CA    . GLU A 1 8   ? 24.394  32.903  -17.155 1.00 55.57  ? 60  GLU A CA    1 
ATOM   60   C C     . GLU A 1 8   ? 24.069  33.645  -18.443 1.00 54.40  ? 60  GLU A C     1 
ATOM   61   O O     . GLU A 1 8   ? 24.248  33.108  -19.531 1.00 56.04  ? 60  GLU A O     1 
ATOM   62   C CB    . GLU A 1 8   ? 24.593  31.414  -17.421 1.00 57.36  ? 60  GLU A CB    1 
ATOM   63   C CG    . GLU A 1 8   ? 26.023  30.985  -17.673 1.00 60.87  ? 60  GLU A CG    1 
ATOM   64   C CD    . GLU A 1 8   ? 26.196  29.484  -17.487 1.00 69.00  ? 60  GLU A CD    1 
ATOM   65   O OE1   . GLU A 1 8   ? 25.238  28.841  -17.001 1.00 75.33  ? 60  GLU A OE1   1 
ATOM   66   O OE2   . GLU A 1 8   ? 27.276  28.946  -17.816 1.00 70.35  ? 60  GLU A OE2   1 
ATOM   67   N N     . ARG A 1 9   ? 23.596  34.882  -18.317 1.00 52.94  ? 61  ARG A N     1 
ATOM   68   C CA    . ARG A 1 9   ? 23.181  35.655  -19.484 1.00 56.51  ? 61  ARG A CA    1 
ATOM   69   C C     . ARG A 1 9   ? 24.320  35.899  -20.453 1.00 56.87  ? 61  ARG A C     1 
ATOM   70   O O     . ARG A 1 9   ? 24.131  35.880  -21.677 1.00 53.45  ? 61  ARG A O     1 
ATOM   71   C CB    . ARG A 1 9   ? 22.586  36.998  -19.069 1.00 59.83  ? 61  ARG A CB    1 
ATOM   72   C CG    . ARG A 1 9   ? 22.381  37.937  -20.253 1.00 60.83  ? 61  ARG A CG    1 
ATOM   73   C CD    . ARG A 1 9   ? 21.813  39.276  -19.828 1.00 65.00  ? 61  ARG A CD    1 
ATOM   74   N NE    . ARG A 1 9   ? 22.163  40.321  -20.784 1.00 62.50  ? 61  ARG A NE    1 
ATOM   75   C CZ    . ARG A 1 9   ? 22.127  41.616  -20.499 1.00 64.40  ? 61  ARG A CZ    1 
ATOM   76   N NH1   . ARG A 1 9   ? 21.758  42.011  -19.281 1.00 70.39  ? 61  ARG A NH1   1 
ATOM   77   N NH2   . ARG A 1 9   ? 22.470  42.511  -21.419 1.00 53.95  ? 61  ARG A NH2   1 
ATOM   78   N N     . GLU A 1 10  ? 25.498  36.137  -19.886 1.00 61.18  ? 62  GLU A N     1 
ATOM   79   C CA    . GLU A 1 10  ? 26.695  36.436  -20.655 1.00 57.24  ? 62  GLU A CA    1 
ATOM   80   C C     . GLU A 1 10  ? 27.013  35.317  -21.627 1.00 57.67  ? 62  GLU A C     1 
ATOM   81   O O     . GLU A 1 10  ? 27.228  35.568  -22.807 1.00 60.57  ? 62  GLU A O     1 
ATOM   82   C CB    . GLU A 1 10  ? 27.848  36.672  -19.710 1.00 60.26  ? 62  GLU A CB    1 
ATOM   83   C CG    . GLU A 1 10  ? 27.379  37.331  -18.423 1.00 71.10  ? 62  GLU A CG    1 
ATOM   84   C CD    . GLU A 1 10  ? 28.505  37.505  -17.421 1.00 87.78  ? 62  GLU A CD    1 
ATOM   85   O OE1   . GLU A 1 10  ? 28.750  36.569  -16.618 1.00 84.22  ? 62  GLU A OE1   1 
ATOM   86   O OE2   . GLU A 1 10  ? 29.157  38.574  -17.455 1.00 88.32  ? 62  GLU A OE2   1 
ATOM   87   N N     . LEU A 1 11  ? 27.018  34.081  -21.138 1.00 55.01  ? 63  LEU A N     1 
ATOM   88   C CA    . LEU A 1 11  ? 27.178  32.920  -22.010 1.00 54.47  ? 63  LEU A CA    1 
ATOM   89   C C     . LEU A 1 11  ? 26.118  32.853  -23.132 1.00 57.11  ? 63  LEU A C     1 
ATOM   90   O O     . LEU A 1 11  ? 26.437  32.576  -24.305 1.00 53.94  ? 63  LEU A O     1 
ATOM   91   C CB    . LEU A 1 11  ? 27.132  31.642  -21.182 1.00 52.33  ? 63  LEU A CB    1 
ATOM   92   C CG    . LEU A 1 11  ? 27.405  30.367  -21.975 1.00 53.73  ? 63  LEU A CG    1 
ATOM   93   C CD1   . LEU A 1 11  ? 28.709  30.492  -22.770 1.00 53.36  ? 63  LEU A CD1   1 
ATOM   94   C CD2   . LEU A 1 11  ? 27.446  29.161  -21.057 1.00 54.64  ? 63  LEU A CD2   1 
ATOM   95   N N     . TRP A 1 12  ? 24.861  33.096  -22.770 1.00 54.16  ? 64  TRP A N     1 
ATOM   96   C CA    . TRP A 1 12  ? 23.795  33.147  -23.764 1.00 56.27  ? 64  TRP A CA    1 
ATOM   97   C C     . TRP A 1 12  ? 24.136  34.165  -24.847 1.00 54.54  ? 64  TRP A C     1 
ATOM   98   O O     . TRP A 1 12  ? 24.002  33.876  -26.027 1.00 56.92  ? 64  TRP A O     1 
ATOM   99   C CB    . TRP A 1 12  ? 22.436  33.483  -23.120 1.00 56.23  ? 64  TRP A CB    1 
ATOM   100  C CG    . TRP A 1 12  ? 21.689  32.276  -22.575 1.00 54.52  ? 64  TRP A CG    1 
ATOM   101  C CD1   . TRP A 1 12  ? 21.563  31.911  -21.266 1.00 54.35  ? 64  TRP A CD1   1 
ATOM   102  C CD2   . TRP A 1 12  ? 20.988  31.280  -23.331 1.00 55.03  ? 64  TRP A CD2   1 
ATOM   103  N NE1   . TRP A 1 12  ? 20.830  30.761  -21.158 1.00 52.84  ? 64  TRP A NE1   1 
ATOM   104  C CE2   . TRP A 1 12  ? 20.461  30.351  -22.416 1.00 55.82  ? 64  TRP A CE2   1 
ATOM   105  C CE3   . TRP A 1 12  ? 20.753  31.081  -24.694 1.00 51.43  ? 64  TRP A CE3   1 
ATOM   106  C CZ2   . TRP A 1 12  ? 19.706  29.244  -22.818 1.00 50.65  ? 64  TRP A CZ2   1 
ATOM   107  C CZ3   . TRP A 1 12  ? 20.008  29.985  -25.087 1.00 49.37  ? 64  TRP A CZ3   1 
ATOM   108  C CH2   . TRP A 1 12  ? 19.497  29.080  -24.155 1.00 44.96  ? 64  TRP A CH2   1 
ATOM   109  N N     . LEU A 1 13  ? 24.598  35.342  -24.440 1.00 51.60  ? 65  LEU A N     1 
ATOM   110  C CA    . LEU A 1 13  ? 24.926  36.396  -25.384 1.00 51.34  ? 65  LEU A CA    1 
ATOM   111  C C     . LEU A 1 13  ? 26.090  36.031  -26.302 1.00 53.63  ? 65  LEU A C     1 
ATOM   112  O O     . LEU A 1 13  ? 26.144  36.486  -27.439 1.00 57.36  ? 65  LEU A O     1 
ATOM   113  C CB    . LEU A 1 13  ? 25.240  37.688  -24.643 1.00 50.79  ? 65  LEU A CB    1 
ATOM   114  C CG    . LEU A 1 13  ? 24.025  38.385  -24.064 1.00 50.88  ? 65  LEU A CG    1 
ATOM   115  C CD1   . LEU A 1 13  ? 24.412  39.707  -23.460 1.00 50.41  ? 65  LEU A CD1   1 
ATOM   116  C CD2   . LEU A 1 13  ? 23.025  38.586  -25.177 1.00 57.59  ? 65  LEU A CD2   1 
ATOM   117  N N     . LYS A 1 14  ? 27.022  35.212  -25.838 1.00 52.05  ? 66  LYS A N     1 
ATOM   118  C CA    . LYS A 1 14  ? 28.073  34.786  -26.748 1.00 54.49  ? 66  LYS A CA    1 
ATOM   119  C C     . LYS A 1 14  ? 27.451  33.940  -27.844 1.00 59.62  ? 66  LYS A C     1 
ATOM   120  O O     . LYS A 1 14  ? 28.011  33.823  -28.926 1.00 65.89  ? 66  LYS A O     1 
ATOM   121  C CB    . LYS A 1 14  ? 29.179  33.994  -26.045 1.00 60.71  ? 66  LYS A CB    1 
ATOM   122  C CG    . LYS A 1 14  ? 29.334  34.245  -24.551 1.00 63.58  ? 66  LYS A CG    1 
ATOM   123  C CD    . LYS A 1 14  ? 30.601  33.570  -23.977 1.00 67.38  ? 66  LYS A CD    1 
ATOM   124  C CE    . LYS A 1 14  ? 31.879  34.332  -24.332 1.00 64.00  ? 66  LYS A CE    1 
ATOM   125  N NZ    . LYS A 1 14  ? 31.876  35.702  -23.738 1.00 67.41  ? 66  LYS A NZ    1 
ATOM   126  N N     . PHE A 1 15  ? 26.290  33.350  -27.566 1.00 60.34  ? 67  PHE A N     1 
ATOM   127  C CA    . PHE A 1 15  ? 25.604  32.510  -28.551 1.00 55.46  ? 67  PHE A CA    1 
ATOM   128  C C     . PHE A 1 15  ? 24.648  33.321  -29.410 1.00 56.98  ? 67  PHE A C     1 
ATOM   129  O O     . PHE A 1 15  ? 24.541  33.098  -30.622 1.00 60.44  ? 67  PHE A O     1 
ATOM   130  C CB    . PHE A 1 15  ? 24.842  31.381  -27.863 1.00 48.66  ? 67  PHE A CB    1 
ATOM   131  C CG    . PHE A 1 15  ? 25.663  30.157  -27.624 1.00 48.21  ? 67  PHE A CG    1 
ATOM   132  C CD1   . PHE A 1 15  ? 25.685  29.134  -28.561 1.00 45.80  ? 67  PHE A CD1   1 
ATOM   133  C CD2   . PHE A 1 15  ? 26.415  30.024  -26.458 1.00 48.66  ? 67  PHE A CD2   1 
ATOM   134  C CE1   . PHE A 1 15  ? 26.443  27.994  -28.355 1.00 48.26  ? 67  PHE A CE1   1 
ATOM   135  C CE2   . PHE A 1 15  ? 27.174  28.891  -26.237 1.00 47.63  ? 67  PHE A CE2   1 
ATOM   136  C CZ    . PHE A 1 15  ? 27.190  27.868  -27.191 1.00 50.53  ? 67  PHE A CZ    1 
ATOM   137  N N     . HIS A 1 16  ? 23.962  34.272  -28.784 1.00 55.00  ? 68  HIS A N     1 
ATOM   138  C CA    . HIS A 1 16  ? 22.976  35.073  -29.489 1.00 58.86  ? 68  HIS A CA    1 
ATOM   139  C C     . HIS A 1 16  ? 23.599  35.931  -30.575 1.00 63.44  ? 68  HIS A C     1 
ATOM   140  O O     . HIS A 1 16  ? 22.898  36.485  -31.413 1.00 68.58  ? 68  HIS A O     1 
ATOM   141  C CB    . HIS A 1 16  ? 22.204  35.971  -28.529 1.00 59.45  ? 68  HIS A CB    1 
ATOM   142  C CG    . HIS A 1 16  ? 21.116  36.753  -29.197 1.00 63.88  ? 68  HIS A CG    1 
ATOM   143  N ND1   . HIS A 1 16  ? 20.308  36.213  -30.177 1.00 64.31  ? 68  HIS A ND1   1 
ATOM   144  C CD2   . HIS A 1 16  ? 20.720  38.040  -29.051 1.00 61.94  ? 68  HIS A CD2   1 
ATOM   145  C CE1   . HIS A 1 16  ? 19.453  37.129  -30.592 1.00 70.00  ? 68  HIS A CE1   1 
ATOM   146  N NE2   . HIS A 1 16  ? 19.681  38.248  -29.924 1.00 66.62  ? 68  HIS A NE2   1 
ATOM   147  N N     . GLU A 1 17  ? 24.919  36.048  -30.562 1.00 68.13  ? 69  GLU A N     1 
ATOM   148  C CA    . GLU A 1 17  ? 25.593  36.888  -31.532 1.00 63.17  ? 69  GLU A CA    1 
ATOM   149  C C     . GLU A 1 17  ? 26.353  36.062  -32.536 1.00 64.35  ? 69  GLU A C     1 
ATOM   150  O O     . GLU A 1 17  ? 27.396  36.483  -33.014 1.00 73.60  ? 69  GLU A O     1 
ATOM   151  C CB    . GLU A 1 17  ? 26.543  37.846  -30.835 1.00 63.16  ? 69  GLU A CB    1 
ATOM   152  C CG    . GLU A 1 17  ? 25.864  38.665  -29.772 1.00 66.23  ? 69  GLU A CG    1 
ATOM   153  C CD    . GLU A 1 17  ? 26.710  39.834  -29.348 1.00 72.13  ? 69  GLU A CD    1 
ATOM   154  O OE1   . GLU A 1 17  ? 27.000  40.679  -30.236 1.00 71.24  ? 69  GLU A OE1   1 
ATOM   155  O OE2   . GLU A 1 17  ? 27.089  39.902  -28.149 1.00 68.36  ? 69  GLU A OE2   1 
ATOM   156  N N     . VAL A 1 18  ? 25.851  34.871  -32.833 1.00 61.43  ? 70  VAL A N     1 
ATOM   157  C CA    . VAL A 1 18  ? 26.406  34.054  -33.908 1.00 61.97  ? 70  VAL A CA    1 
ATOM   158  C C     . VAL A 1 18  ? 25.237  33.379  -34.622 1.00 65.49  ? 70  VAL A C     1 
ATOM   159  O O     . VAL A 1 18  ? 25.338  32.963  -35.788 1.00 63.54  ? 70  VAL A O     1 
ATOM   160  C CB    . VAL A 1 18  ? 27.411  32.989  -33.390 1.00 64.52  ? 70  VAL A CB    1 
ATOM   161  C CG1   . VAL A 1 18  ? 28.014  32.200  -34.552 1.00 62.34  ? 70  VAL A CG1   1 
ATOM   162  C CG2   . VAL A 1 18  ? 28.524  33.623  -32.555 1.00 57.78  ? 70  VAL A CG2   1 
ATOM   163  N N     . GLY A 1 19  ? 24.113  33.307  -33.910 1.00 61.58  ? 71  GLY A N     1 
ATOM   164  C CA    . GLY A 1 19  ? 22.934  32.626  -34.401 1.00 54.35  ? 71  GLY A CA    1 
ATOM   165  C C     . GLY A 1 19  ? 22.812  31.288  -33.711 1.00 49.98  ? 71  GLY A C     1 
ATOM   166  O O     . GLY A 1 19  ? 23.249  30.264  -34.251 1.00 47.59  ? 71  GLY A O     1 
ATOM   167  N N     . THR A 1 20  ? 22.230  31.308  -32.512 1.00 45.67  ? 72  THR A N     1 
ATOM   168  C CA    . THR A 1 20  ? 22.115  30.115  -31.682 1.00 46.77  ? 72  THR A CA    1 
ATOM   169  C C     . THR A 1 20  ? 21.433  28.989  -32.421 1.00 45.98  ? 72  THR A C     1 
ATOM   170  O O     . THR A 1 20  ? 20.291  29.123  -32.828 1.00 49.12  ? 72  THR A O     1 
ATOM   171  C CB    . THR A 1 20  ? 21.306  30.362  -30.403 1.00 46.78  ? 72  THR A CB    1 
ATOM   172  O OG1   . THR A 1 20  ? 21.548  31.681  -29.914 1.00 53.98  ? 72  THR A OG1   1 
ATOM   173  C CG2   . THR A 1 20  ? 21.690  29.361  -29.344 1.00 43.33  ? 72  THR A CG2   1 
ATOM   174  N N     . GLU A 1 21  ? 22.133  27.880  -32.592 1.00 44.12  ? 73  GLU A N     1 
ATOM   175  C CA    . GLU A 1 21  ? 21.521  26.690  -33.134 1.00 41.86  ? 73  GLU A CA    1 
ATOM   176  C C     . GLU A 1 21  ? 21.323  25.710  -32.004 1.00 40.70  ? 73  GLU A C     1 
ATOM   177  O O     . GLU A 1 21  ? 22.191  25.575  -31.164 1.00 43.75  ? 73  GLU A O     1 
ATOM   178  C CB    . GLU A 1 21  ? 22.386  26.074  -34.226 1.00 41.90  ? 73  GLU A CB    1 
ATOM   179  C CG    . GLU A 1 21  ? 22.957  27.086  -35.187 1.00 45.43  ? 73  GLU A CG    1 
ATOM   180  C CD    . GLU A 1 21  ? 23.719  26.437  -36.317 1.00 49.39  ? 73  GLU A CD    1 
ATOM   181  O OE1   . GLU A 1 21  ? 23.555  25.215  -36.517 1.00 46.98  ? 73  GLU A OE1   1 
ATOM   182  O OE2   . GLU A 1 21  ? 24.482  27.148  -37.006 1.00 54.79  ? 73  GLU A OE2   1 
ATOM   183  N N     . MET A 1 22  ? 20.174  25.043  -31.972 1.00 45.01  ? 74  MET A N     1 
ATOM   184  C CA    . MET A 1 22  ? 19.969  23.904  -31.079 1.00 39.30  ? 74  MET A CA    1 
ATOM   185  C C     . MET A 1 22  ? 19.738  22.647  -31.905 1.00 39.46  ? 74  MET A C     1 
ATOM   186  O O     . MET A 1 22  ? 18.997  22.666  -32.878 1.00 40.83  ? 74  MET A O     1 
ATOM   187  C CB    . MET A 1 22  ? 18.792  24.141  -30.141 1.00 38.54  ? 74  MET A CB    1 
ATOM   188  C CG    . MET A 1 22  ? 18.968  25.320  -29.194 1.00 40.33  ? 74  MET A CG    1 
ATOM   189  S SD    . MET A 1 22  ? 20.025  25.046  -27.766 1.00 42.50  ? 74  MET A SD    1 
ATOM   190  C CE    . MET A 1 22  ? 20.074  26.712  -27.112 1.00 40.17  ? 74  MET A CE    1 
ATOM   191  N N     . ILE A 1 23  ? 20.409  21.566  -31.534 1.00 39.45  ? 75  ILE A N     1 
ATOM   192  C CA    . ILE A 1 23  ? 20.168  20.276  -32.153 1.00 36.68  ? 75  ILE A CA    1 
ATOM   193  C C     . ILE A 1 23  ? 18.845  19.706  -31.628 1.00 39.00  ? 75  ILE A C     1 
ATOM   194  O O     . ILE A 1 23  ? 18.550  19.756  -30.418 1.00 39.90  ? 75  ILE A O     1 
ATOM   195  C CB    . ILE A 1 23  ? 21.329  19.284  -31.883 1.00 35.53  ? 75  ILE A CB    1 
ATOM   196  C CG1   . ILE A 1 23  ? 22.326  19.313  -33.022 1.00 38.98  ? 75  ILE A CG1   1 
ATOM   197  C CG2   . ILE A 1 23  ? 20.841  17.865  -31.789 1.00 35.30  ? 75  ILE A CG2   1 
ATOM   198  C CD1   . ILE A 1 23  ? 22.828  20.650  -33.312 1.00 40.69  ? 75  ILE A CD1   1 
ATOM   199  N N     . ILE A 1 24  ? 18.030  19.207  -32.548 1.00 35.18  ? 76  ILE A N     1 
ATOM   200  C CA    . ILE A 1 24  ? 16.910  18.366  -32.181 1.00 35.46  ? 76  ILE A CA    1 
ATOM   201  C C     . ILE A 1 24  ? 17.196  16.970  -32.697 1.00 34.53  ? 76  ILE A C     1 
ATOM   202  O O     . ILE A 1 24  ? 17.899  16.803  -33.688 1.00 39.34  ? 76  ILE A O     1 
ATOM   203  C CB    . ILE A 1 24  ? 15.587  18.898  -32.732 1.00 33.21  ? 76  ILE A CB    1 
ATOM   204  C CG1   . ILE A 1 24  ? 15.623  18.968  -34.262 1.00 37.53  ? 76  ILE A CG1   1 
ATOM   205  C CG2   . ILE A 1 24  ? 15.307  20.273  -32.144 1.00 32.26  ? 76  ILE A CG2   1 
ATOM   206  C CD1   . ILE A 1 24  ? 14.363  19.570  -34.887 1.00 35.79  ? 76  ILE A CD1   1 
ATOM   207  N N     . THR A 1 25  ? 16.731  15.962  -31.976 1.00 35.55  ? 77  THR A N     1 
ATOM   208  C CA    . THR A 1 25  ? 16.798  14.593  -32.467 1.00 37.96  ? 77  THR A CA    1 
ATOM   209  C C     . THR A 1 25  ? 15.502  13.891  -32.113 1.00 42.64  ? 77  THR A C     1 
ATOM   210  O O     . THR A 1 25  ? 14.637  14.469  -31.458 1.00 42.99  ? 77  THR A O     1 
ATOM   211  C CB    . THR A 1 25  ? 17.950  13.781  -31.872 1.00 34.87  ? 77  THR A CB    1 
ATOM   212  O OG1   . THR A 1 25  ? 17.567  13.333  -30.571 1.00 43.38  ? 77  THR A OG1   1 
ATOM   213  C CG2   . THR A 1 25  ? 19.227  14.578  -31.792 1.00 32.26  ? 77  THR A CG2   1 
ATOM   214  N N     . LYS A 1 26  ? 15.384  12.634  -32.525 1.00 43.78  ? 78  LYS A N     1 
ATOM   215  C CA    . LYS A 1 26  ? 14.152  11.876  -32.350 1.00 43.36  ? 78  LYS A CA    1 
ATOM   216  C C     . LYS A 1 26  ? 13.987  11.437  -30.901 1.00 40.88  ? 78  LYS A C     1 
ATOM   217  O O     . LYS A 1 26  ? 12.863  11.395  -30.379 1.00 41.43  ? 78  LYS A O     1 
ATOM   218  C CB    . LYS A 1 26  ? 14.147  10.681  -33.308 1.00 43.38  ? 78  LYS A CB    1 
ATOM   219  C CG    . LYS A 1 26  ? 13.390  9.457   -32.853 1.00 42.32  ? 78  LYS A CG    1 
ATOM   220  C CD    . LYS A 1 26  ? 13.732  8.294   -33.773 1.00 49.38  ? 78  LYS A CD    1 
ATOM   221  C CE    . LYS A 1 26  ? 12.905  7.065   -33.453 1.00 56.13  ? 78  LYS A CE    1 
ATOM   222  N NZ    . LYS A 1 26  ? 11.449  7.316   -33.651 1.00 60.98  ? 78  LYS A NZ    1 
ATOM   223  N N     . ALA A 1 27  ? 15.108  11.135  -30.251 1.00 38.95  ? 79  ALA A N     1 
ATOM   224  C CA    . ALA A 1 27  ? 15.097  10.723  -28.846 1.00 39.08  ? 79  ALA A CA    1 
ATOM   225  C C     . ALA A 1 27  ? 14.832  11.911  -27.942 1.00 38.74  ? 79  ALA A C     1 
ATOM   226  O O     . ALA A 1 27  ? 14.300  11.777  -26.846 1.00 39.29  ? 79  ALA A O     1 
ATOM   227  C CB    . ALA A 1 27  ? 16.404  10.078  -28.477 1.00 40.31  ? 79  ALA A CB    1 
ATOM   228  N N     . GLY A 1 28  ? 15.204  13.086  -28.424 1.00 37.96  ? 80  GLY A N     1 
ATOM   229  C CA    . GLY A 1 28  ? 15.118  14.283  -27.627 1.00 37.53  ? 80  GLY A CA    1 
ATOM   230  C C     . GLY A 1 28  ? 16.522  14.687  -27.257 1.00 36.42  ? 80  GLY A C     1 
ATOM   231  O O     . GLY A 1 28  ? 17.323  13.848  -26.886 1.00 40.40  ? 80  GLY A O     1 
ATOM   232  N N     . ARG A 1 29  ? 16.817  15.971  -27.374 1.00 33.26  ? 81  ARG A N     1 
ATOM   233  C CA    . ARG A 1 29  ? 18.143  16.483  -27.103 1.00 32.37  ? 81  ARG A CA    1 
ATOM   234  C C     . ARG A 1 29  ? 18.035  17.682  -26.179 1.00 34.89  ? 81  ARG A C     1 
ATOM   235  O O     . ARG A 1 29  ? 17.071  18.425  -26.234 1.00 37.42  ? 81  ARG A O     1 
ATOM   236  C CB    . ARG A 1 29  ? 18.826  16.868  -28.395 1.00 33.08  ? 81  ARG A CB    1 
ATOM   237  C CG    . ARG A 1 29  ? 20.267  17.174  -28.277 1.00 32.17  ? 81  ARG A CG    1 
ATOM   238  C CD    . ARG A 1 29  ? 21.097  15.964  -28.639 1.00 33.14  ? 81  ARG A CD    1 
ATOM   239  N NE    . ARG A 1 29  ? 22.496  16.325  -28.845 1.00 31.62  ? 81  ARG A NE    1 
ATOM   240  C CZ    . ARG A 1 29  ? 23.467  15.444  -29.063 1.00 39.07  ? 81  ARG A CZ    1 
ATOM   241  N NH1   . ARG A 1 29  ? 23.208  14.139  -29.095 1.00 34.48  ? 81  ARG A NH1   1 
ATOM   242  N NH2   . ARG A 1 29  ? 24.712  15.869  -29.242 1.00 46.16  ? 81  ARG A NH2   1 
ATOM   243  N N     . ARG A 1 30  ? 19.011  17.861  -25.309 1.00 34.44  ? 82  ARG A N     1 
ATOM   244  C CA    . ARG A 1 30  ? 18.943  18.916  -24.321 1.00 33.49  ? 82  ARG A CA    1 
ATOM   245  C C     . ARG A 1 30  ? 19.206  20.224  -24.982 1.00 33.53  ? 82  ARG A C     1 
ATOM   246  O O     . ARG A 1 30  ? 19.627  20.254  -26.119 1.00 43.09  ? 82  ARG A O     1 
ATOM   247  C CB    . ARG A 1 30  ? 19.972  18.693  -23.226 1.00 38.03  ? 82  ARG A CB    1 
ATOM   248  C CG    . ARG A 1 30  ? 19.757  17.470  -22.416 1.00 31.94  ? 82  ARG A CG    1 
ATOM   249  C CD    . ARG A 1 30  ? 19.838  17.844  -20.998 1.00 32.97  ? 82  ARG A CD    1 
ATOM   250  N NE    . ARG A 1 30  ? 19.756  16.673  -20.150 1.00 42.07  ? 82  ARG A NE    1 
ATOM   251  C CZ    . ARG A 1 30  ? 20.485  16.503  -19.056 1.00 37.83  ? 82  ARG A CZ    1 
ATOM   252  N NH1   . ARG A 1 30  ? 21.352  17.436  -18.684 1.00 35.17  ? 82  ARG A NH1   1 
ATOM   253  N NH2   . ARG A 1 30  ? 20.341  15.396  -18.343 1.00 41.93  ? 82  ARG A NH2   1 
ATOM   254  N N     . MET A 1 31  ? 18.976  21.312  -24.277 1.00 35.07  ? 83  MET A N     1 
ATOM   255  C CA    . MET A 1 31  ? 19.443  22.589  -24.770 1.00 38.87  ? 83  MET A CA    1 
ATOM   256  C C     . MET A 1 31  ? 20.799  22.897  -24.198 1.00 41.07  ? 83  MET A C     1 
ATOM   257  O O     . MET A 1 31  ? 20.992  22.796  -22.994 1.00 49.23  ? 83  MET A O     1 
ATOM   258  C CB    . MET A 1 31  ? 18.498  23.714  -24.384 1.00 44.33  ? 83  MET A CB    1 
ATOM   259  C CG    . MET A 1 31  ? 17.272  23.858  -25.234 1.00 44.66  ? 83  MET A CG    1 
ATOM   260  S SD    . MET A 1 31  ? 16.467  25.430  -24.866 1.00 53.97  ? 83  MET A SD    1 
ATOM   261  C CE    . MET A 1 31  ? 15.962  25.195  -23.149 1.00 45.23  ? 83  MET A CE    1 
ATOM   262  N N     . PHE A 1 32  ? 21.740  23.285  -25.042 1.00 41.45  ? 84  PHE A N     1 
ATOM   263  C CA    . PHE A 1 32  ? 22.863  24.055  -24.541 1.00 45.07  ? 84  PHE A CA    1 
ATOM   264  C C     . PHE A 1 32  ? 22.903  25.442  -25.162 1.00 46.64  ? 84  PHE A C     1 
ATOM   265  O O     . PHE A 1 32  ? 22.933  25.571  -26.382 1.00 51.27  ? 84  PHE A O     1 
ATOM   266  C CB    . PHE A 1 32  ? 24.193  23.376  -24.780 1.00 44.61  ? 84  PHE A CB    1 
ATOM   267  C CG    . PHE A 1 32  ? 25.257  23.922  -23.910 1.00 44.32  ? 84  PHE A CG    1 
ATOM   268  C CD1   . PHE A 1 32  ? 26.016  25.003  -24.318 1.00 46.10  ? 84  PHE A CD1   1 
ATOM   269  C CD2   . PHE A 1 32  ? 25.448  23.412  -22.652 1.00 41.53  ? 84  PHE A CD2   1 
ATOM   270  C CE1   . PHE A 1 32  ? 26.988  25.536  -23.494 1.00 46.33  ? 84  PHE A CE1   1 
ATOM   271  C CE2   . PHE A 1 32  ? 26.423  23.941  -21.823 1.00 44.50  ? 84  PHE A CE2   1 
ATOM   272  C CZ    . PHE A 1 32  ? 27.191  25.003  -22.246 1.00 42.69  ? 84  PHE A CZ    1 
ATOM   273  N N     . PRO A 1 33  ? 22.964  26.489  -24.332 1.00 41.95  ? 85  PRO A N     1 
ATOM   274  C CA    . PRO A 1 33  ? 23.080  26.446  -22.878 1.00 44.47  ? 85  PRO A CA    1 
ATOM   275  C C     . PRO A 1 33  ? 21.831  25.929  -22.221 1.00 46.92  ? 85  PRO A C     1 
ATOM   276  O O     . PRO A 1 33  ? 20.817  25.703  -22.889 1.00 48.63  ? 85  PRO A O     1 
ATOM   277  C CB    . PRO A 1 33  ? 23.298  27.913  -22.499 1.00 47.10  ? 85  PRO A CB    1 
ATOM   278  C CG    . PRO A 1 33  ? 23.796  28.542  -23.744 1.00 49.94  ? 85  PRO A CG    1 
ATOM   279  C CD    . PRO A 1 33  ? 23.048  27.865  -24.830 1.00 42.87  ? 85  PRO A CD    1 
ATOM   280  N N     . SER A 1 34  ? 21.921  25.733  -20.917 1.00 46.81  ? 86  SER A N     1 
ATOM   281  C CA    . SER A 1 34  ? 20.787  25.319  -20.123 1.00 48.44  ? 86  SER A CA    1 
ATOM   282  C C     . SER A 1 34  ? 19.982  26.561  -19.782 1.00 48.37  ? 86  SER A C     1 
ATOM   283  O O     . SER A 1 34  ? 20.546  27.626  -19.568 1.00 53.56  ? 86  SER A O     1 
ATOM   284  C CB    . SER A 1 34  ? 21.256  24.582  -18.863 1.00 51.96  ? 86  SER A CB    1 
ATOM   285  O OG    . SER A 1 34  ? 22.056  23.454  -19.204 1.00 49.44  ? 86  SER A OG    1 
ATOM   286  N N     . TYR A 1 35  ? 18.664  26.440  -19.765 1.00 45.41  ? 87  TYR A N     1 
ATOM   287  C CA    . TYR A 1 35  ? 17.822  27.570  -19.407 1.00 45.37  ? 87  TYR A CA    1 
ATOM   288  C C     . TYR A 1 35  ? 17.643  27.577  -17.888 1.00 46.14  ? 87  TYR A C     1 
ATOM   289  O O     . TYR A 1 35  ? 16.947  26.730  -17.334 1.00 50.02  ? 87  TYR A O     1 
ATOM   290  C CB    . TYR A 1 35  ? 16.477  27.474  -20.145 1.00 43.65  ? 87  TYR A CB    1 
ATOM   291  C CG    . TYR A 1 35  ? 15.565  28.689  -20.076 1.00 42.03  ? 87  TYR A CG    1 
ATOM   292  C CD1   . TYR A 1 35  ? 14.788  28.937  -18.951 1.00 49.65  ? 87  TYR A CD1   1 
ATOM   293  C CD2   . TYR A 1 35  ? 15.445  29.557  -21.149 1.00 41.03  ? 87  TYR A CD2   1 
ATOM   294  C CE1   . TYR A 1 35  ? 13.930  30.041  -18.877 1.00 48.69  ? 87  TYR A CE1   1 
ATOM   295  C CE2   . TYR A 1 35  ? 14.598  30.659  -21.088 1.00 47.47  ? 87  TYR A CE2   1 
ATOM   296  C CZ    . TYR A 1 35  ? 13.844  30.900  -19.943 1.00 48.24  ? 87  TYR A CZ    1 
ATOM   297  O OH    . TYR A 1 35  ? 12.997  31.988  -19.863 1.00 47.34  ? 87  TYR A OH    1 
ATOM   298  N N     . LYS A 1 36  ? 18.294  28.504  -17.199 1.00 44.20  ? 88  LYS A N     1 
ATOM   299  C CA    . LYS A 1 36  ? 18.089  28.623  -15.757 1.00 42.53  ? 88  LYS A CA    1 
ATOM   300  C C     . LYS A 1 36  ? 17.756  30.052  -15.399 1.00 44.98  ? 88  LYS A C     1 
ATOM   301  O O     . LYS A 1 36  ? 18.219  30.982  -16.062 1.00 47.78  ? 88  LYS A O     1 
ATOM   302  C CB    . LYS A 1 36  ? 19.323  28.159  -14.994 1.00 45.32  ? 88  LYS A CB    1 
ATOM   303  C CG    . LYS A 1 36  ? 19.831  26.809  -15.458 1.00 47.15  ? 88  LYS A CG    1 
ATOM   304  C CD    . LYS A 1 36  ? 20.916  26.269  -14.555 1.00 43.54  ? 88  LYS A CD    1 
ATOM   305  C CE    . LYS A 1 36  ? 21.619  25.089  -15.209 1.00 50.30  ? 88  LYS A CE    1 
ATOM   306  N NZ    . LYS A 1 36  ? 22.339  24.286  -14.186 1.00 61.45  ? 88  LYS A NZ    1 
ATOM   307  N N     . VAL A 1 37  ? 16.954  30.238  -14.355 1.00 44.24  ? 89  VAL A N     1 
ATOM   308  C CA    . VAL A 1 37  ? 16.513  31.582  -13.984 1.00 43.03  ? 89  VAL A CA    1 
ATOM   309  C C     . VAL A 1 37  ? 16.468  31.806  -12.476 1.00 40.33  ? 89  VAL A C     1 
ATOM   310  O O     . VAL A 1 37  ? 16.307  30.851  -11.727 1.00 42.90  ? 89  VAL A O     1 
ATOM   311  C CB    . VAL A 1 37  ? 15.115  31.881  -14.581 1.00 41.81  ? 89  VAL A CB    1 
ATOM   312  C CG1   . VAL A 1 37  ? 15.239  32.219  -16.034 1.00 44.27  ? 89  VAL A CG1   1 
ATOM   313  C CG2   . VAL A 1 37  ? 14.191  30.708  -14.396 1.00 38.81  ? 89  VAL A CG2   1 
ATOM   314  N N     . LYS A 1 38  ? 16.620  33.052  -12.024 1.00 37.06  ? 90  LYS A N     1 
ATOM   315  C CA    . LYS A 1 38  ? 16.303  33.360  -10.627 1.00 42.23  ? 90  LYS A CA    1 
ATOM   316  C C     . LYS A 1 38  ? 14.975  34.065  -10.602 1.00 45.51  ? 90  LYS A C     1 
ATOM   317  O O     . LYS A 1 38  ? 14.751  34.962  -11.394 1.00 52.33  ? 90  LYS A O     1 
ATOM   318  C CB    . LYS A 1 38  ? 17.369  34.234  -9.946  1.00 49.09  ? 90  LYS A CB    1 
ATOM   319  C CG    . LYS A 1 38  ? 17.271  34.249  -8.391  1.00 48.82  ? 90  LYS A CG    1 
ATOM   320  C CD    . LYS A 1 38  ? 18.206  35.275  -7.721  1.00 48.77  ? 90  LYS A CD    1 
ATOM   321  C CE    . LYS A 1 38  ? 17.740  36.714  -7.986  1.00 53.19  ? 90  LYS A CE    1 
ATOM   322  N NZ    . LYS A 1 38  ? 18.683  37.802  -7.560  1.00 40.39  ? 90  LYS A NZ    1 
ATOM   323  N N     . VAL A 1 39  ? 14.093  33.660  -9.700  1.00 43.85  ? 91  VAL A N     1 
ATOM   324  C CA    . VAL A 1 39  ? 12.777  34.267  -9.607  1.00 49.95  ? 91  VAL A CA    1 
ATOM   325  C C     . VAL A 1 39  ? 12.634  35.034  -8.294  1.00 61.50  ? 91  VAL A C     1 
ATOM   326  O O     . VAL A 1 39  ? 13.173  34.614  -7.260  1.00 63.61  ? 91  VAL A O     1 
ATOM   327  C CB    . VAL A 1 39  ? 11.662  33.195  -9.728  1.00 55.72  ? 91  VAL A CB    1 
ATOM   328  C CG1   . VAL A 1 39  ? 10.278  33.830  -9.693  1.00 57.52  ? 91  VAL A CG1   1 
ATOM   329  C CG2   . VAL A 1 39  ? 11.840  32.383  -11.018 1.00 51.68  ? 91  VAL A CG2   1 
ATOM   330  N N     . THR A 1 40  ? 11.924  36.164  -8.338  1.00 65.30  ? 92  THR A N     1 
ATOM   331  C CA    . THR A 1 40  ? 11.710  37.018  -7.161  1.00 66.03  ? 92  THR A CA    1 
ATOM   332  C C     . THR A 1 40  ? 10.373  37.744  -7.233  1.00 63.12  ? 92  THR A C     1 
ATOM   333  O O     . THR A 1 40  ? 10.040  38.325  -8.255  1.00 71.05  ? 92  THR A O     1 
ATOM   334  C CB    . THR A 1 40  ? 12.826  38.082  -7.012  1.00 67.41  ? 92  THR A CB    1 
ATOM   335  O OG1   . THR A 1 40  ? 13.216  38.548  -8.314  1.00 64.22  ? 92  THR A OG1   1 
ATOM   336  C CG2   . THR A 1 40  ? 14.049  37.515  -6.282  1.00 62.24  ? 92  THR A CG2   1 
ATOM   337  N N     . GLY A 1 41  ? 9.611   37.727  -6.149  1.00 62.49  ? 93  GLY A N     1 
ATOM   338  C CA    . GLY A 1 41  ? 8.353   38.450  -6.122  1.00 58.96  ? 93  GLY A CA    1 
ATOM   339  C C     . GLY A 1 41  ? 7.178   37.570  -5.741  1.00 59.75  ? 93  GLY A C     1 
ATOM   340  O O     . GLY A 1 41  ? 6.151   38.060  -5.286  1.00 56.71  ? 93  GLY A O     1 
ATOM   341  N N     . LEU A 1 42  ? 7.323   36.264  -5.934  1.00 63.18  ? 94  LEU A N     1 
ATOM   342  C CA    . LEU A 1 42  ? 6.260   35.330  -5.586  1.00 61.01  ? 94  LEU A CA    1 
ATOM   343  C C     . LEU A 1 42  ? 5.930   35.422  -4.106  1.00 58.34  ? 94  LEU A C     1 
ATOM   344  O O     . LEU A 1 42  ? 6.818   35.571  -3.268  1.00 60.05  ? 94  LEU A O     1 
ATOM   345  C CB    . LEU A 1 42  ? 6.658   33.896  -5.927  1.00 56.92  ? 94  LEU A CB    1 
ATOM   346  C CG    . LEU A 1 42  ? 7.498   33.735  -7.185  1.00 54.70  ? 94  LEU A CG    1 
ATOM   347  C CD1   . LEU A 1 42  ? 7.937   32.290  -7.335  1.00 54.23  ? 94  LEU A CD1   1 
ATOM   348  C CD2   . LEU A 1 42  ? 6.692   34.183  -8.376  1.00 57.05  ? 94  LEU A CD2   1 
ATOM   349  N N     . ASN A 1 43  ? 4.642   35.362  -3.804  1.00 59.87  ? 95  ASN A N     1 
ATOM   350  C CA    . ASN A 1 43  ? 4.165   35.155  -2.443  1.00 61.98  ? 95  ASN A CA    1 
ATOM   351  C C     . ASN A 1 43  ? 4.679   33.817  -1.966  1.00 59.95  ? 95  ASN A C     1 
ATOM   352  O O     . ASN A 1 43  ? 4.349   32.789  -2.552  1.00 63.10  ? 95  ASN A O     1 
ATOM   353  C CB    . ASN A 1 43  ? 2.631   35.190  -2.394  1.00 63.44  ? 95  ASN A CB    1 
ATOM   354  C CG    . ASN A 1 43  ? 2.083   35.112  -0.990  1.00 65.80  ? 95  ASN A CG    1 
ATOM   355  O OD1   . ASN A 1 43  ? 2.714   34.565  -0.079  1.00 67.43  ? 95  ASN A OD1   1 
ATOM   356  N ND2   . ASN A 1 43  ? 0.896   35.668  -0.802  1.00 69.14  ? 95  ASN A ND2   1 
ATOM   357  N N     . PRO A 1 44  ? 5.488   33.819  -0.907  1.00 54.59  ? 96  PRO A N     1 
ATOM   358  C CA    . PRO A 1 44  ? 6.170   32.597  -0.479  1.00 55.41  ? 96  PRO A CA    1 
ATOM   359  C C     . PRO A 1 44  ? 5.241   31.486  0.001   1.00 56.92  ? 96  PRO A C     1 
ATOM   360  O O     . PRO A 1 44  ? 5.640   30.330  -0.056  1.00 58.17  ? 96  PRO A O     1 
ATOM   361  C CB    . PRO A 1 44  ? 7.063   33.092  0.654   1.00 57.10  ? 96  PRO A CB    1 
ATOM   362  C CG    . PRO A 1 44  ? 7.343   34.496  0.273   1.00 56.34  ? 96  PRO A CG    1 
ATOM   363  C CD    . PRO A 1 44  ? 6.037   35.004  -0.241  1.00 56.86  ? 96  PRO A CD    1 
ATOM   364  N N     . LYS A 1 45  ? 4.030   31.803  0.440   1.00 54.34  ? 97  LYS A N     1 
ATOM   365  C CA    . LYS A 1 45  ? 3.129   30.746  0.895   1.00 60.02  ? 97  LYS A CA    1 
ATOM   366  C C     . LYS A 1 45  ? 2.184   30.235  -0.219  1.00 59.32  ? 97  LYS A C     1 
ATOM   367  O O     . LYS A 1 45  ? 1.486   29.228  -0.044  1.00 51.75  ? 97  LYS A O     1 
ATOM   368  C CB    . LYS A 1 45  ? 2.324   31.224  2.111   1.00 63.96  ? 97  LYS A CB    1 
ATOM   369  C CG    . LYS A 1 45  ? 3.171   31.436  3.373   1.00 70.63  ? 97  LYS A CG    1 
ATOM   370  C CD    . LYS A 1 45  ? 2.313   31.609  4.627   1.00 71.57  ? 97  LYS A CD    1 
ATOM   371  C CE    . LYS A 1 45  ? 1.488   32.882  4.578   1.00 66.70  ? 97  LYS A CE    1 
ATOM   372  N NZ    . LYS A 1 45  ? 0.464   32.886  5.656   1.00 71.33  ? 97  LYS A NZ    1 
ATOM   373  N N     . THR A 1 46  ? 2.189   30.915  -1.365  1.00 59.24  ? 98  THR A N     1 
ATOM   374  C CA    . THR A 1 46  ? 1.378   30.531  -2.530  1.00 55.61  ? 98  THR A CA    1 
ATOM   375  C C     . THR A 1 46  ? 2.023   29.382  -3.306  1.00 51.99  ? 98  THR A C     1 
ATOM   376  O O     . THR A 1 46  ? 3.243   29.356  -3.470  1.00 50.56  ? 98  THR A O     1 
ATOM   377  C CB    . THR A 1 46  ? 1.180   31.743  -3.488  1.00 58.96  ? 98  THR A CB    1 
ATOM   378  O OG1   . THR A 1 46  ? 0.484   32.800  -2.810  1.00 63.23  ? 98  THR A OG1   1 
ATOM   379  C CG2   . THR A 1 46  ? 0.413   31.357  -4.747  1.00 53.48  ? 98  THR A CG2   1 
ATOM   380  N N     . LYS A 1 47  ? 1.220   28.435  -3.785  1.00 49.09  ? 99  LYS A N     1 
ATOM   381  C CA    . LYS A 1 47  ? 1.758   27.383  -4.645  1.00 47.36  ? 99  LYS A CA    1 
ATOM   382  C C     . LYS A 1 47  ? 1.666   27.750  -6.139  1.00 45.71  ? 99  LYS A C     1 
ATOM   383  O O     . LYS A 1 47  ? 0.651   28.261  -6.613  1.00 46.25  ? 99  LYS A O     1 
ATOM   384  C CB    . LYS A 1 47  ? 1.058   26.054  -4.372  1.00 42.66  ? 99  LYS A CB    1 
ATOM   385  C CG    . LYS A 1 47  ? 1.152   25.608  -2.936  1.00 49.77  ? 99  LYS A CG    1 
ATOM   386  C CD    . LYS A 1 47  ? 0.858   24.120  -2.769  1.00 59.80  ? 99  LYS A CD    1 
ATOM   387  C CE    . LYS A 1 47  ? 2.059   23.245  -3.177  1.00 63.16  ? 99  LYS A CE    1 
ATOM   388  N NZ    . LYS A 1 47  ? 1.937   21.827  -2.680  1.00 60.65  ? 99  LYS A NZ    1 
ATOM   389  N N     . TYR A 1 48  ? 2.754   27.492  -6.861  1.00 46.29  ? 100 TYR A N     1 
ATOM   390  C CA    . TYR A 1 48  ? 2.843   27.795  -8.277  1.00 41.67  ? 100 TYR A CA    1 
ATOM   391  C C     . TYR A 1 48  ? 3.320   26.617  -9.118  1.00 43.62  ? 100 TYR A C     1 
ATOM   392  O O     . TYR A 1 48  ? 3.971   25.692  -8.620  1.00 42.47  ? 100 TYR A O     1 
ATOM   393  C CB    . TYR A 1 48  ? 3.802   28.940  -8.526  1.00 41.07  ? 100 TYR A CB    1 
ATOM   394  C CG    . TYR A 1 48  ? 3.480   30.231  -7.856  1.00 45.37  ? 100 TYR A CG    1 
ATOM   395  C CD1   . TYR A 1 48  ? 3.984   30.522  -6.600  1.00 52.86  ? 100 TYR A CD1   1 
ATOM   396  C CD2   . TYR A 1 48  ? 2.733   31.191  -8.493  1.00 50.09  ? 100 TYR A CD2   1 
ATOM   397  C CE1   . TYR A 1 48  ? 3.725   31.725  -5.980  1.00 51.12  ? 100 TYR A CE1   1 
ATOM   398  C CE2   . TYR A 1 48  ? 2.466   32.397  -7.880  1.00 59.41  ? 100 TYR A CE2   1 
ATOM   399  C CZ    . TYR A 1 48  ? 2.969   32.654  -6.623  1.00 51.44  ? 100 TYR A CZ    1 
ATOM   400  O OH    . TYR A 1 48  ? 2.708   33.847  -6.016  1.00 51.75  ? 100 TYR A OH    1 
ATOM   401  N N     . ILE A 1 49  ? 3.008   26.699  -10.410 1.00 42.43  ? 101 ILE A N     1 
ATOM   402  C CA    . ILE A 1 49  ? 3.525   25.805  -11.430 1.00 38.18  ? 101 ILE A CA    1 
ATOM   403  C C     . ILE A 1 49  ? 4.408   26.648  -12.317 1.00 41.52  ? 101 ILE A C     1 
ATOM   404  O O     . ILE A 1 49  ? 4.070   27.787  -12.626 1.00 44.85  ? 101 ILE A O     1 
ATOM   405  C CB    . ILE A 1 49  ? 2.404   25.152  -12.261 1.00 36.62  ? 101 ILE A CB    1 
ATOM   406  C CG1   . ILE A 1 49  ? 1.216   24.790  -11.363 1.00 39.77  ? 101 ILE A CG1   1 
ATOM   407  C CG2   . ILE A 1 49  ? 2.914   23.936  -12.966 1.00 33.70  ? 101 ILE A CG2   1 
ATOM   408  C CD1   . ILE A 1 49  ? 0.131   23.984  -12.031 1.00 33.56  ? 101 ILE A CD1   1 
ATOM   409  N N     . LEU A 1 50  ? 5.555   26.114  -12.703 1.00 37.34  ? 102 LEU A N     1 
ATOM   410  C CA    . LEU A 1 50  ? 6.401   26.809  -13.643 1.00 36.15  ? 102 LEU A CA    1 
ATOM   411  C C     . LEU A 1 50  ? 6.513   25.962  -14.889 1.00 41.53  ? 102 LEU A C     1 
ATOM   412  O O     . LEU A 1 50  ? 7.112   24.887  -14.869 1.00 43.56  ? 102 LEU A O     1 
ATOM   413  C CB    . LEU A 1 50  ? 7.788   27.096  -13.058 1.00 42.29  ? 102 LEU A CB    1 
ATOM   414  C CG    . LEU A 1 50  ? 7.994   28.464  -12.393 1.00 41.75  ? 102 LEU A CG    1 
ATOM   415  C CD1   . LEU A 1 50  ? 7.217   28.580  -11.089 1.00 41.48  ? 102 LEU A CD1   1 
ATOM   416  C CD2   . LEU A 1 50  ? 9.460   28.716  -12.164 1.00 38.88  ? 102 LEU A CD2   1 
ATOM   417  N N     . LEU A 1 51  ? 5.917   26.449  -15.970 1.00 40.43  ? 103 LEU A N     1 
ATOM   418  C CA    . LEU A 1 51  ? 5.975   25.780  -17.252 1.00 37.44  ? 103 LEU A CA    1 
ATOM   419  C C     . LEU A 1 51  ? 6.958   26.475  -18.142 1.00 42.02  ? 103 LEU A C     1 
ATOM   420  O O     . LEU A 1 51  ? 7.192   27.665  -18.009 1.00 45.30  ? 103 LEU A O     1 
ATOM   421  C CB    . LEU A 1 51  ? 4.623   25.791  -17.930 1.00 38.78  ? 103 LEU A CB    1 
ATOM   422  C CG    . LEU A 1 51  ? 3.514   25.732  -16.915 1.00 42.64  ? 103 LEU A CG    1 
ATOM   423  C CD1   . LEU A 1 51  ? 2.222   26.168  -17.560 1.00 46.45  ? 103 LEU A CD1   1 
ATOM   424  C CD2   . LEU A 1 51  ? 3.442   24.317  -16.461 1.00 42.80  ? 103 LEU A CD2   1 
ATOM   425  N N     . MET A 1 52  ? 7.522   25.727  -19.070 1.00 41.29  ? 104 MET A N     1 
ATOM   426  C CA    . MET A 1 52  ? 8.281   26.333  -20.128 1.00 41.37  ? 104 MET A CA    1 
ATOM   427  C C     . MET A 1 52  ? 7.515   26.064  -21.402 1.00 42.47  ? 104 MET A C     1 
ATOM   428  O O     . MET A 1 52  ? 6.775   25.096  -21.516 1.00 37.68  ? 104 MET A O     1 
ATOM   429  C CB    . MET A 1 52  ? 9.710   25.785  -20.181 1.00 40.83  ? 104 MET A CB    1 
ATOM   430  C CG    . MET A 1 52  ? 10.455  26.085  -21.484 1.00 46.24  ? 104 MET A CG    1 
ATOM   431  S SD    . MET A 1 52  ? 12.178  26.610  -21.300 1.00 51.85  ? 104 MET A SD    1 
ATOM   432  C CE    . MET A 1 52  ? 11.886  28.358  -21.100 1.00 52.94  ? 104 MET A CE    1 
ATOM   433  N N     . ASP A 1 53  ? 7.691   26.955  -22.355 1.00 48.64  ? 105 ASP A N     1 
ATOM   434  C CA    . ASP A 1 53  ? 6.967   26.912  -23.591 1.00 46.75  ? 105 ASP A CA    1 
ATOM   435  C C     . ASP A 1 53  ? 7.898   27.415  -24.686 1.00 48.26  ? 105 ASP A C     1 
ATOM   436  O O     . ASP A 1 53  ? 8.679   28.331  -24.464 1.00 49.83  ? 105 ASP A O     1 
ATOM   437  C CB    . ASP A 1 53  ? 5.709   27.760  -23.458 1.00 48.52  ? 105 ASP A CB    1 
ATOM   438  C CG    . ASP A 1 53  ? 4.937   27.884  -24.745 1.00 60.77  ? 105 ASP A CG    1 
ATOM   439  O OD1   . ASP A 1 53  ? 4.334   28.967  -24.932 1.00 66.98  ? 105 ASP A OD1   1 
ATOM   440  O OD2   . ASP A 1 53  ? 4.920   26.921  -25.556 1.00 58.86  ? 105 ASP A OD2   1 
ATOM   441  N N     . ILE A 1 54  ? 7.860   26.792  -25.854 1.00 48.51  ? 106 ILE A N     1 
ATOM   442  C CA    . ILE A 1 54  ? 8.637   27.305  -26.975 1.00 53.39  ? 106 ILE A CA    1 
ATOM   443  C C     . ILE A 1 54  ? 7.720   27.718  -28.146 1.00 55.53  ? 106 ILE A C     1 
ATOM   444  O O     . ILE A 1 54  ? 6.842   26.964  -28.576 1.00 57.64  ? 106 ILE A O     1 
ATOM   445  C CB    . ILE A 1 54  ? 9.673   26.281  -27.434 1.00 46.54  ? 106 ILE A CB    1 
ATOM   446  C CG1   . ILE A 1 54  ? 10.502  25.834  -26.241 1.00 39.18  ? 106 ILE A CG1   1 
ATOM   447  C CG2   . ILE A 1 54  ? 10.575  26.874  -28.487 1.00 41.73  ? 106 ILE A CG2   1 
ATOM   448  C CD1   . ILE A 1 54  ? 11.633  24.957  -26.630 1.00 37.19  ? 106 ILE A CD1   1 
ATOM   449  N N     . VAL A 1 55  ? 7.915   28.933  -28.643 1.00 48.36  ? 107 VAL A N     1 
ATOM   450  C CA    . VAL A 1 55  ? 7.012   29.482  -29.636 1.00 52.84  ? 107 VAL A CA    1 
ATOM   451  C C     . VAL A 1 55  ? 7.794   30.086  -30.796 1.00 55.18  ? 107 VAL A C     1 
ATOM   452  O O     . VAL A 1 55  ? 8.890   30.611  -30.587 1.00 54.85  ? 107 VAL A O     1 
ATOM   453  C CB    . VAL A 1 55  ? 6.076   30.548  -29.002 1.00 55.15  ? 107 VAL A CB    1 
ATOM   454  C CG1   . VAL A 1 55  ? 5.239   29.926  -27.882 1.00 55.58  ? 107 VAL A CG1   1 
ATOM   455  C CG2   . VAL A 1 55  ? 6.875   31.721  -28.479 1.00 53.23  ? 107 VAL A CG2   1 
ATOM   456  N N     . PRO A 1 56  ? 7.232   30.020  -32.019 1.00 55.07  ? 108 PRO A N     1 
ATOM   457  C CA    . PRO A 1 56  ? 7.816   30.582  -33.244 1.00 56.96  ? 108 PRO A CA    1 
ATOM   458  C C     . PRO A 1 56  ? 8.378   32.009  -33.104 1.00 57.31  ? 108 PRO A C     1 
ATOM   459  O O     . PRO A 1 56  ? 7.668   32.920  -32.684 1.00 61.66  ? 108 PRO A O     1 
ATOM   460  C CB    . PRO A 1 56  ? 6.628   30.591  -34.207 1.00 55.97  ? 108 PRO A CB    1 
ATOM   461  C CG    . PRO A 1 56  ? 5.741   29.528  -33.737 1.00 43.74  ? 108 PRO A CG    1 
ATOM   462  C CD    . PRO A 1 56  ? 5.866   29.523  -32.258 1.00 54.39  ? 108 PRO A CD    1 
ATOM   463  N N     . ALA A 1 57  ? 9.639   32.205  -33.468 1.00 56.40  ? 109 ALA A N     1 
ATOM   464  C CA    . ALA A 1 57  ? 10.227  33.545  -33.450 1.00 57.08  ? 109 ALA A CA    1 
ATOM   465  C C     . ALA A 1 57  ? 9.713   34.375  -34.647 1.00 64.91  ? 109 ALA A C     1 
ATOM   466  O O     . ALA A 1 57  ? 9.426   35.571  -34.504 1.00 63.71  ? 109 ALA A O     1 
ATOM   467  C CB    . ALA A 1 57  ? 11.758  33.455  -33.452 1.00 46.15  ? 109 ALA A CB    1 
ATOM   468  N N     . ASP A 1 58  ? 9.596   33.729  -35.812 1.00 60.51  ? 110 ASP A N     1 
ATOM   469  C CA    . ASP A 1 58  ? 8.963   34.316  -37.000 1.00 61.57  ? 110 ASP A CA    1 
ATOM   470  C C     . ASP A 1 58  ? 8.145   33.283  -37.780 1.00 62.46  ? 110 ASP A C     1 
ATOM   471  O O     . ASP A 1 58  ? 7.898   32.180  -37.296 1.00 61.10  ? 110 ASP A O     1 
ATOM   472  C CB    . ASP A 1 58  ? 10.016  34.939  -37.915 1.00 71.14  ? 110 ASP A CB    1 
ATOM   473  C CG    . ASP A 1 58  ? 11.073  33.935  -38.384 1.00 71.52  ? 110 ASP A CG    1 
ATOM   474  O OD1   . ASP A 1 58  ? 10.700  32.874  -38.947 1.00 66.57  ? 110 ASP A OD1   1 
ATOM   475  O OD2   . ASP A 1 58  ? 12.283  34.216  -38.188 1.00 67.13  ? 110 ASP A OD2   1 
ATOM   476  N N     . ASP A 1 59  ? 7.730   33.629  -38.994 1.00 69.04  ? 111 ASP A N     1 
ATOM   477  C CA    . ASP A 1 59  ? 7.065   32.646  -39.853 1.00 69.74  ? 111 ASP A CA    1 
ATOM   478  C C     . ASP A 1 59  ? 7.824   32.430  -41.166 1.00 63.95  ? 111 ASP A C     1 
ATOM   479  O O     . ASP A 1 59  ? 7.312   32.677  -42.253 1.00 64.94  ? 111 ASP A O     1 
ATOM   480  C CB    . ASP A 1 59  ? 5.618   33.057  -40.133 1.00 73.54  ? 111 ASP A CB    1 
ATOM   481  C CG    . ASP A 1 59  ? 5.509   34.461  -40.666 1.00 80.43  ? 111 ASP A CG    1 
ATOM   482  O OD1   . ASP A 1 59  ? 5.756   35.401  -39.877 1.00 76.64  ? 111 ASP A OD1   1 
ATOM   483  O OD2   . ASP A 1 59  ? 5.175   34.619  -41.867 1.00 85.39  ? 111 ASP A OD2   1 
ATOM   484  N N     . HIS A 1 60  ? 9.051   31.941  -41.040 1.00 67.55  ? 112 HIS A N     1 
ATOM   485  C CA    . HIS A 1 60  ? 9.919   31.687  -42.181 1.00 66.31  ? 112 HIS A CA    1 
ATOM   486  C C     . HIS A 1 60  ? 10.650  30.355  -42.049 1.00 62.03  ? 112 HIS A C     1 
ATOM   487  O O     . HIS A 1 60  ? 10.997  29.936  -40.948 1.00 61.50  ? 112 HIS A O     1 
ATOM   488  C CB    . HIS A 1 60  ? 10.957  32.806  -42.329 1.00 67.51  ? 112 HIS A CB    1 
ATOM   489  C CG    . HIS A 1 60  ? 10.370  34.178  -42.485 1.00 75.19  ? 112 HIS A CG    1 
ATOM   490  N ND1   . HIS A 1 60  ? 9.725   34.589  -43.635 1.00 77.39  ? 112 HIS A ND1   1 
ATOM   491  C CD2   . HIS A 1 60  ? 10.354  35.242  -41.644 1.00 71.08  ? 112 HIS A CD2   1 
ATOM   492  C CE1   . HIS A 1 60  ? 9.322   35.840  -43.487 1.00 76.68  ? 112 HIS A CE1   1 
ATOM   493  N NE2   . HIS A 1 60  ? 9.693   36.260  -42.289 1.00 74.14  ? 112 HIS A NE2   1 
ATOM   494  N N     . ARG A 1 61  ? 10.875  29.689  -43.173 1.00 61.80  ? 113 ARG A N     1 
ATOM   495  C CA    . ARG A 1 61  ? 11.869  28.634  -43.234 1.00 59.39  ? 113 ARG A CA    1 
ATOM   496  C C     . ARG A 1 61  ? 13.197  29.339  -43.439 1.00 58.35  ? 113 ARG A C     1 
ATOM   497  O O     . ARG A 1 61  ? 13.221  30.522  -43.767 1.00 59.18  ? 113 ARG A O     1 
ATOM   498  C CB    . ARG A 1 61  ? 11.580  27.649  -44.369 1.00 65.69  ? 113 ARG A CB    1 
ATOM   499  C CG    . ARG A 1 61  ? 12.528  26.461  -44.434 1.00 69.26  ? 113 ARG A CG    1 
ATOM   500  C CD    . ARG A 1 61  ? 12.310  25.641  -45.687 1.00 75.95  ? 113 ARG A CD    1 
ATOM   501  N NE    . ARG A 1 61  ? 10.959  25.103  -45.707 1.00 85.15  ? 113 ARG A NE    1 
ATOM   502  C CZ    . ARG A 1 61  ? 10.569  24.057  -44.985 1.00 91.08  ? 113 ARG A CZ    1 
ATOM   503  N NH1   . ARG A 1 61  ? 11.435  23.440  -44.185 1.00 82.84  ? 113 ARG A NH1   1 
ATOM   504  N NH2   . ARG A 1 61  ? 9.310   23.632  -45.058 1.00 91.12  ? 113 ARG A NH2   1 
ATOM   505  N N     . TYR A 1 62  ? 14.298  28.632  -43.234 1.00 54.58  ? 114 TYR A N     1 
ATOM   506  C CA    . TYR A 1 62  ? 15.607  29.211  -43.456 1.00 53.99  ? 114 TYR A CA    1 
ATOM   507  C C     . TYR A 1 62  ? 16.530  28.222  -44.130 1.00 57.45  ? 114 TYR A C     1 
ATOM   508  O O     . TYR A 1 62  ? 16.208  27.044  -44.260 1.00 56.49  ? 114 TYR A O     1 
ATOM   509  C CB    . TYR A 1 62  ? 16.220  29.668  -42.143 1.00 49.67  ? 114 TYR A CB    1 
ATOM   510  C CG    . TYR A 1 62  ? 15.671  30.965  -41.628 1.00 51.77  ? 114 TYR A CG    1 
ATOM   511  C CD1   . TYR A 1 62  ? 14.560  30.989  -40.804 1.00 53.68  ? 114 TYR A CD1   1 
ATOM   512  C CD2   . TYR A 1 62  ? 16.270  32.171  -41.952 1.00 56.54  ? 114 TYR A CD2   1 
ATOM   513  C CE1   . TYR A 1 62  ? 14.053  32.179  -40.322 1.00 56.11  ? 114 TYR A CE1   1 
ATOM   514  C CE2   . TYR A 1 62  ? 15.771  33.369  -41.475 1.00 55.93  ? 114 TYR A CE2   1 
ATOM   515  C CZ    . TYR A 1 62  ? 14.660  33.366  -40.664 1.00 58.23  ? 114 TYR A CZ    1 
ATOM   516  O OH    . TYR A 1 62  ? 14.150  34.552  -40.188 1.00 66.29  ? 114 TYR A OH    1 
ATOM   517  N N     . LYS A 1 63  ? 17.680  28.716  -44.566 1.00 61.29  ? 115 LYS A N     1 
ATOM   518  C CA    . LYS A 1 63  ? 18.730  27.860  -45.081 1.00 61.11  ? 115 LYS A CA    1 
ATOM   519  C C     . LYS A 1 63  ? 20.059  28.503  -44.753 1.00 66.46  ? 115 LYS A C     1 
ATOM   520  O O     . LYS A 1 63  ? 20.167  29.730  -44.643 1.00 65.35  ? 115 LYS A O     1 
ATOM   521  C CB    . LYS A 1 63  ? 18.593  27.623  -46.596 1.00 68.24  ? 115 LYS A CB    1 
ATOM   522  C CG    . LYS A 1 63  ? 19.221  28.692  -47.507 1.00 73.69  ? 115 LYS A CG    1 
ATOM   523  C CD    . LYS A 1 63  ? 19.154  28.275  -48.989 1.00 76.73  ? 115 LYS A CD    1 
ATOM   524  C CE    . LYS A 1 63  ? 20.027  29.164  -49.878 1.00 76.66  ? 115 LYS A CE    1 
ATOM   525  N NZ    . LYS A 1 63  ? 19.410  30.493  -50.118 1.00 74.08  ? 115 LYS A NZ    1 
ATOM   526  N N     . PHE A 1 64  ? 21.061  27.657  -44.556 1.00 69.35  ? 116 PHE A N     1 
ATOM   527  C CA    . PHE A 1 64  ? 22.405  28.121  -44.310 1.00 67.83  ? 116 PHE A CA    1 
ATOM   528  C C     . PHE A 1 64  ? 23.202  27.743  -45.533 1.00 74.94  ? 116 PHE A C     1 
ATOM   529  O O     . PHE A 1 64  ? 23.366  26.562  -45.833 1.00 80.46  ? 116 PHE A O     1 
ATOM   530  C CB    . PHE A 1 64  ? 22.988  27.500  -43.037 1.00 67.56  ? 116 PHE A CB    1 
ATOM   531  C CG    . PHE A 1 64  ? 24.224  28.199  -42.523 1.00 67.91  ? 116 PHE A CG    1 
ATOM   532  C CD1   . PHE A 1 64  ? 24.119  29.279  -41.665 1.00 66.89  ? 116 PHE A CD1   1 
ATOM   533  C CD2   . PHE A 1 64  ? 25.485  27.769  -42.896 1.00 64.28  ? 116 PHE A CD2   1 
ATOM   534  C CE1   . PHE A 1 64  ? 25.247  29.922  -41.197 1.00 65.86  ? 116 PHE A CE1   1 
ATOM   535  C CE2   . PHE A 1 64  ? 26.613  28.406  -42.431 1.00 64.40  ? 116 PHE A CE2   1 
ATOM   536  C CZ    . PHE A 1 64  ? 26.495  29.486  -41.581 1.00 65.34  ? 116 PHE A CZ    1 
ATOM   537  N N     . ALA A 1 65  ? 23.649  28.750  -46.270 1.00 77.39  ? 117 ALA A N     1 
ATOM   538  C CA    . ALA A 1 65  ? 24.502  28.537  -47.429 1.00 80.63  ? 117 ALA A CA    1 
ATOM   539  C C     . ALA A 1 65  ? 25.431  29.732  -47.534 1.00 80.37  ? 117 ALA A C     1 
ATOM   540  O O     . ALA A 1 65  ? 25.053  30.842  -47.160 1.00 79.79  ? 117 ALA A O     1 
ATOM   541  C CB    . ALA A 1 65  ? 23.676  28.362  -48.702 1.00 79.92  ? 117 ALA A CB    1 
ATOM   542  N N     . ASP A 1 66  ? 26.648  29.500  -48.011 1.00 79.62  ? 118 ASP A N     1 
ATOM   543  C CA    . ASP A 1 66  ? 27.634  30.566  -48.150 1.00 81.16  ? 118 ASP A CA    1 
ATOM   544  C C     . ASP A 1 66  ? 27.887  31.296  -46.827 1.00 80.95  ? 118 ASP A C     1 
ATOM   545  O O     . ASP A 1 66  ? 28.005  32.521  -46.828 1.00 82.02  ? 118 ASP A O     1 
ATOM   546  C CB    . ASP A 1 66  ? 27.198  31.593  -49.217 1.00 82.14  ? 118 ASP A CB    1 
ATOM   547  C CG    . ASP A 1 66  ? 26.881  30.955  -50.578 1.00 85.35  ? 118 ASP A CG    1 
ATOM   548  O OD1   . ASP A 1 66  ? 27.038  29.720  -50.728 1.00 82.36  ? 118 ASP A OD1   1 
ATOM   549  O OD2   . ASP A 1 66  ? 26.463  31.704  -51.496 1.00 77.46  ? 118 ASP A OD2   1 
ATOM   550  N N     . ASN A 1 67  ? 27.943  30.560  -45.711 1.00 74.36  ? 119 ASN A N     1 
ATOM   551  C CA    . ASN A 1 67  ? 28.335  31.141  -44.421 1.00 72.66  ? 119 ASN A CA    1 
ATOM   552  C C     . ASN A 1 67  ? 27.392  32.279  -43.981 1.00 74.11  ? 119 ASN A C     1 
ATOM   553  O O     . ASN A 1 67  ? 27.819  33.328  -43.495 1.00 76.21  ? 119 ASN A O     1 
ATOM   554  C CB    . ASN A 1 67  ? 29.790  31.624  -44.519 1.00 76.87  ? 119 ASN A CB    1 
ATOM   555  C CG    . ASN A 1 67  ? 30.365  32.079  -43.194 1.00 75.15  ? 119 ASN A CG    1 
ATOM   556  O OD1   . ASN A 1 67  ? 29.899  31.689  -42.123 1.00 77.19  ? 119 ASN A OD1   1 
ATOM   557  N ND2   . ASN A 1 67  ? 31.398  32.913  -43.266 1.00 71.35  ? 119 ASN A ND2   1 
ATOM   558  N N     . LYS A 1 68  ? 26.097  32.048  -44.159 1.00 72.11  ? 120 LYS A N     1 
ATOM   559  C CA    . LYS A 1 68  ? 25.073  33.057  -43.926 1.00 73.43  ? 120 LYS A CA    1 
ATOM   560  C C     . LYS A 1 68  ? 23.732  32.340  -43.716 1.00 75.79  ? 120 LYS A C     1 
ATOM   561  O O     . LYS A 1 68  ? 23.534  31.240  -44.246 1.00 76.16  ? 120 LYS A O     1 
ATOM   562  C CB    . LYS A 1 68  ? 24.987  34.016  -45.119 1.00 71.92  ? 120 LYS A CB    1 
ATOM   563  C CG    . LYS A 1 68  ? 23.841  33.660  -46.072 1.00 79.38  ? 120 LYS A CG    1 
ATOM   564  C CD    . LYS A 1 68  ? 24.153  33.811  -47.562 1.00 80.82  ? 120 LYS A CD    1 
ATOM   565  C CE    . LYS A 1 68  ? 23.006  33.217  -48.401 1.00 82.32  ? 120 LYS A CE    1 
ATOM   566  N NZ    . LYS A 1 68  ? 23.395  32.948  -49.818 1.00 86.91  ? 120 LYS A NZ    1 
ATOM   567  N N     . TRP A 1 69  ? 22.816  32.925  -42.944 1.00 71.69  ? 121 TRP A N     1 
ATOM   568  C CA    . TRP A 1 69  ? 21.437  32.428  -42.952 1.00 70.61  ? 121 TRP A CA    1 
ATOM   569  C C     . TRP A 1 69  ? 20.695  33.235  -44.012 1.00 71.98  ? 121 TRP A C     1 
ATOM   570  O O     . TRP A 1 69  ? 21.142  34.323  -44.379 1.00 77.14  ? 121 TRP A O     1 
ATOM   571  C CB    . TRP A 1 69  ? 20.746  32.555  -41.575 1.00 69.02  ? 121 TRP A CB    1 
ATOM   572  C CG    . TRP A 1 69  ? 21.159  31.517  -40.527 1.00 65.83  ? 121 TRP A CG    1 
ATOM   573  C CD1   . TRP A 1 69  ? 21.981  31.721  -39.453 1.00 64.19  ? 121 TRP A CD1   1 
ATOM   574  C CD2   . TRP A 1 69  ? 20.763  30.135  -40.464 1.00 64.49  ? 121 TRP A CD2   1 
ATOM   575  N NE1   . TRP A 1 69  ? 22.119  30.559  -38.728 1.00 60.88  ? 121 TRP A NE1   1 
ATOM   576  C CE2   . TRP A 1 69  ? 21.390  29.569  -39.332 1.00 61.61  ? 121 TRP A CE2   1 
ATOM   577  C CE3   . TRP A 1 69  ? 19.943  29.320  -41.254 1.00 62.43  ? 121 TRP A CE3   1 
ATOM   578  C CZ2   . TRP A 1 69  ? 21.225  28.227  -38.975 1.00 60.29  ? 121 TRP A CZ2   1 
ATOM   579  C CZ3   . TRP A 1 69  ? 19.774  27.983  -40.891 1.00 57.25  ? 121 TRP A CZ3   1 
ATOM   580  C CH2   . TRP A 1 69  ? 20.413  27.454  -39.769 1.00 57.39  ? 121 TRP A CH2   1 
ATOM   581  N N     . SER A 1 70  ? 19.585  32.707  -44.519 1.00 65.31  ? 122 SER A N     1 
ATOM   582  C CA    . SER A 1 70  ? 18.711  33.486  -45.395 1.00 66.67  ? 122 SER A CA    1 
ATOM   583  C C     . SER A 1 70  ? 17.328  32.837  -45.501 1.00 67.99  ? 122 SER A C     1 
ATOM   584  O O     . SER A 1 70  ? 17.209  31.614  -45.619 1.00 65.97  ? 122 SER A O     1 
ATOM   585  C CB    . SER A 1 70  ? 19.334  33.673  -46.801 1.00 76.17  ? 122 SER A CB    1 
ATOM   586  O OG    . SER A 1 70  ? 19.808  32.461  -47.380 1.00 77.26  ? 122 SER A OG    1 
ATOM   587  N N     . VAL A 1 71  ? 16.289  33.670  -45.438 1.00 68.45  ? 123 VAL A N     1 
ATOM   588  C CA    . VAL A 1 71  ? 14.907  33.221  -45.565 1.00 61.62  ? 123 VAL A CA    1 
ATOM   589  C C     . VAL A 1 71  ? 14.684  32.585  -46.924 1.00 64.29  ? 123 VAL A C     1 
ATOM   590  O O     . VAL A 1 71  ? 15.107  33.134  -47.943 1.00 68.54  ? 123 VAL A O     1 
ATOM   591  C CB    . VAL A 1 71  ? 13.922  34.379  -45.394 1.00 62.21  ? 123 VAL A CB    1 
ATOM   592  C CG1   . VAL A 1 71  ? 12.503  33.852  -45.310 1.00 62.58  ? 123 VAL A CG1   1 
ATOM   593  C CG2   . VAL A 1 71  ? 14.274  35.200  -44.166 1.00 61.02  ? 123 VAL A CG2   1 
ATOM   594  N N     . THR A 1 72  ? 14.050  31.417  -46.945 1.00 59.52  ? 124 THR A N     1 
ATOM   595  C CA    . THR A 1 72  ? 13.751  30.746  -48.203 1.00 60.61  ? 124 THR A CA    1 
ATOM   596  C C     . THR A 1 72  ? 12.353  30.132  -48.180 1.00 65.63  ? 124 THR A C     1 
ATOM   597  O O     . THR A 1 72  ? 12.155  28.986  -48.600 1.00 67.11  ? 124 THR A O     1 
ATOM   598  C CB    . THR A 1 72  ? 14.778  29.645  -48.538 1.00 61.25  ? 124 THR A CB    1 
ATOM   599  O OG1   . THR A 1 72  ? 14.667  28.574  -47.597 1.00 63.28  ? 124 THR A OG1   1 
ATOM   600  C CG2   . THR A 1 72  ? 16.189  30.194  -48.523 1.00 64.12  ? 124 THR A CG2   1 
ATOM   601  N N     . GLY A 1 73  ? 11.383  30.906  -47.701 1.00 64.21  ? 125 GLY A N     1 
ATOM   602  C CA    . GLY A 1 73  ? 9.999   30.472  -47.702 1.00 63.56  ? 125 GLY A CA    1 
ATOM   603  C C     . GLY A 1 73  ? 9.275   30.821  -46.418 1.00 70.93  ? 125 GLY A C     1 
ATOM   604  O O     . GLY A 1 73  ? 9.841   31.431  -45.506 1.00 68.85  ? 125 GLY A O     1 
ATOM   605  N N     . LYS A 1 74  ? 8.007   30.434  -46.351 1.00 73.23  ? 126 LYS A N     1 
ATOM   606  C CA    . LYS A 1 74  ? 7.202   30.651  -45.160 1.00 67.06  ? 126 LYS A CA    1 
ATOM   607  C C     . LYS A 1 74  ? 7.333   29.438  -44.246 1.00 65.28  ? 126 LYS A C     1 
ATOM   608  O O     . LYS A 1 74  ? 7.466   28.307  -44.720 1.00 65.76  ? 126 LYS A O     1 
ATOM   609  C CB    . LYS A 1 74  ? 5.744   30.902  -45.545 1.00 66.28  ? 126 LYS A CB    1 
ATOM   610  C CG    . LYS A 1 74  ? 4.843   31.430  -44.429 1.00 73.45  ? 126 LYS A CG    1 
ATOM   611  C CD    . LYS A 1 74  ? 3.401   31.636  -44.932 1.00 76.46  ? 126 LYS A CD    1 
ATOM   612  C CE    . LYS A 1 74  ? 2.508   32.277  -43.876 1.00 82.31  ? 126 LYS A CE    1 
ATOM   613  N NZ    . LYS A 1 74  ? 3.094   33.548  -43.340 1.00 87.32  ? 126 LYS A NZ    1 
ATOM   614  N N     . ALA A 1 75  ? 7.325   29.680  -42.940 1.00 65.60  ? 127 ALA A N     1 
ATOM   615  C CA    . ALA A 1 75  ? 7.401   28.604  -41.956 1.00 65.59  ? 127 ALA A CA    1 
ATOM   616  C C     . ALA A 1 75  ? 6.265   27.626  -42.160 1.00 62.95  ? 127 ALA A C     1 
ATOM   617  O O     . ALA A 1 75  ? 5.114   28.029  -42.192 1.00 71.60  ? 127 ALA A O     1 
ATOM   618  C CB    . ALA A 1 75  ? 7.363   29.166  -40.540 1.00 63.22  ? 127 ALA A CB    1 
ATOM   619  N N     . GLU A 1 76  ? 6.584   26.345  -42.286 1.00 63.13  ? 128 GLU A N     1 
ATOM   620  C CA    . GLU A 1 76  ? 5.571   25.333  -42.569 1.00 72.76  ? 128 GLU A CA    1 
ATOM   621  C C     . GLU A 1 76  ? 4.633   25.068  -41.368 1.00 73.51  ? 128 GLU A C     1 
ATOM   622  O O     . GLU A 1 76  ? 4.917   25.529  -40.260 1.00 68.95  ? 128 GLU A O     1 
ATOM   623  C CB    . GLU A 1 76  ? 6.266   24.058  -43.026 1.00 75.49  ? 128 GLU A CB    1 
ATOM   624  C CG    . GLU A 1 76  ? 7.582   23.806  -42.390 1.00 75.66  ? 128 GLU A CG    1 
ATOM   625  C CD    . GLU A 1 76  ? 8.045   22.388  -42.621 1.00 86.95  ? 128 GLU A CD    1 
ATOM   626  O OE1   . GLU A 1 76  ? 7.181   21.504  -42.812 1.00 93.33  ? 128 GLU A OE1   1 
ATOM   627  O OE2   . GLU A 1 76  ? 9.272   22.161  -42.638 1.00 87.15  ? 128 GLU A OE2   1 
ATOM   628  N N     . PRO A 1 77  ? 3.509   24.334  -41.579 1.00 75.48  ? 129 PRO A N     1 
ATOM   629  C CA    . PRO A 1 77  ? 2.536   24.305  -40.482 1.00 73.16  ? 129 PRO A CA    1 
ATOM   630  C C     . PRO A 1 77  ? 3.024   23.495  -39.308 1.00 73.68  ? 129 PRO A C     1 
ATOM   631  O O     . PRO A 1 77  ? 2.744   22.307  -39.168 1.00 77.47  ? 129 PRO A O     1 
ATOM   632  C CB    . PRO A 1 77  ? 1.304   23.656  -41.110 1.00 75.86  ? 129 PRO A CB    1 
ATOM   633  C CG    . PRO A 1 77  ? 1.799   22.888  -42.281 1.00 73.43  ? 129 PRO A CG    1 
ATOM   634  C CD    . PRO A 1 77  ? 3.199   23.307  -42.594 1.00 76.30  ? 129 PRO A CD    1 
ATOM   635  N N     . ALA A 1 78  ? 3.781   24.167  -38.466 1.00 68.66  ? 130 ALA A N     1 
ATOM   636  C CA    . ALA A 1 78  ? 4.347   23.556  -37.293 1.00 75.13  ? 130 ALA A CA    1 
ATOM   637  C C     . ALA A 1 78  ? 3.327   23.758  -36.200 1.00 72.70  ? 130 ALA A C     1 
ATOM   638  O O     . ALA A 1 78  ? 2.456   24.603  -36.404 1.00 68.30  ? 130 ALA A O     1 
ATOM   639  C CB    . ALA A 1 78  ? 5.692   24.222  -36.954 1.00 80.00  ? 130 ALA A CB    1 
ATOM   640  N N     . MET A 1 79  ? 3.330   23.028  -35.071 1.00 77.81  ? 131 MET A N     1 
ATOM   641  C CA    . MET A 1 79  ? 3.821   21.665  -34.747 1.00 65.39  ? 131 MET A CA    1 
ATOM   642  C C     . MET A 1 79  ? 3.038   21.382  -33.465 1.00 60.92  ? 131 MET A C     1 
ATOM   643  O O     . MET A 1 79  ? 2.688   22.333  -32.767 1.00 62.86  ? 131 MET A O     1 
ATOM   644  C CB    . MET A 1 79  ? 5.436   21.538  -34.687 1.00 60.53  ? 131 MET A CB    1 
ATOM   645  C CG    . MET A 1 79  ? 6.095   22.229  -33.611 1.00 67.20  ? 131 MET A CG    1 
ATOM   646  S SD    . MET A 1 79  ? 7.819   22.434  -33.515 1.00 95.32  ? 131 MET A SD    1 
ATOM   647  C CE    . MET A 1 79  ? 8.454   23.817  -34.298 1.00 74.97  ? 131 MET A CE    1 
ATOM   648  N N     . PRO A 1 80  ? 2.749   20.106  -33.142 1.00 57.39  ? 132 PRO A N     1 
ATOM   649  C CA    . PRO A 1 80  ? 1.821   19.813  -32.030 1.00 54.01  ? 132 PRO A CA    1 
ATOM   650  C C     . PRO A 1 80  ? 2.146   20.529  -30.718 1.00 51.04  ? 132 PRO A C     1 
ATOM   651  O O     . PRO A 1 80  ? 3.117   20.155  -30.071 1.00 56.49  ? 132 PRO A O     1 
ATOM   652  C CB    . PRO A 1 80  ? 1.970   18.300  -31.835 1.00 51.57  ? 132 PRO A CB    1 
ATOM   653  C CG    . PRO A 1 80  ? 2.475   17.780  -33.112 1.00 51.58  ? 132 PRO A CG    1 
ATOM   654  C CD    . PRO A 1 80  ? 3.299   18.874  -33.734 1.00 58.60  ? 132 PRO A CD    1 
ATOM   655  N N     . GLY A 1 81  ? 1.362   21.533  -30.338 1.00 47.33  ? 133 GLY A N     1 
ATOM   656  C CA    . GLY A 1 81  ? 1.668   22.320  -29.153 1.00 52.39  ? 133 GLY A CA    1 
ATOM   657  C C     . GLY A 1 81  ? 2.034   21.459  -27.951 1.00 47.31  ? 133 GLY A C     1 
ATOM   658  O O     . GLY A 1 81  ? 1.414   20.420  -27.729 1.00 43.30  ? 133 GLY A O     1 
ATOM   659  N N     . ARG A 1 82  ? 3.058   21.860  -27.200 1.00 43.01  ? 134 ARG A N     1 
ATOM   660  C CA    . ARG A 1 82  ? 3.498   21.074  -26.049 1.00 41.22  ? 134 ARG A CA    1 
ATOM   661  C C     . ARG A 1 82  ? 4.119   21.958  -24.987 1.00 36.97  ? 134 ARG A C     1 
ATOM   662  O O     . ARG A 1 82  ? 4.717   22.986  -25.292 1.00 42.60  ? 134 ARG A O     1 
ATOM   663  C CB    . ARG A 1 82  ? 4.479   19.976  -26.486 1.00 36.93  ? 134 ARG A CB    1 
ATOM   664  C CG    . ARG A 1 82  ? 3.771   18.744  -27.011 1.00 38.80  ? 134 ARG A CG    1 
ATOM   665  C CD    . ARG A 1 82  ? 4.662   17.584  -27.124 1.00 40.35  ? 134 ARG A CD    1 
ATOM   666  N NE    . ARG A 1 82  ? 3.915   16.347  -27.329 1.00 45.35  ? 134 ARG A NE    1 
ATOM   667  C CZ    . ARG A 1 82  ? 4.504   15.154  -27.404 1.00 55.07  ? 134 ARG A CZ    1 
ATOM   668  N NH1   . ARG A 1 82  ? 5.829   15.072  -27.285 1.00 53.53  ? 134 ARG A NH1   1 
ATOM   669  N NH2   . ARG A 1 82  ? 3.790   14.048  -27.593 1.00 52.10  ? 134 ARG A NH2   1 
ATOM   670  N N     . LEU A 1 83  ? 3.955   21.579  -23.730 1.00 38.44  ? 135 LEU A N     1 
ATOM   671  C CA    . LEU A 1 83  ? 4.520   22.381  -22.644 1.00 42.14  ? 135 LEU A CA    1 
ATOM   672  C C     . LEU A 1 83  ? 5.534   21.584  -21.820 1.00 37.32  ? 135 LEU A C     1 
ATOM   673  O O     . LEU A 1 83  ? 5.582   20.360  -21.909 1.00 39.68  ? 135 LEU A O     1 
ATOM   674  C CB    . LEU A 1 83  ? 3.397   22.937  -21.765 1.00 40.09  ? 135 LEU A CB    1 
ATOM   675  C CG    . LEU A 1 83  ? 3.028   24.392  -22.120 1.00 40.32  ? 135 LEU A CG    1 
ATOM   676  C CD1   . LEU A 1 83  ? 2.417   24.514  -23.489 1.00 34.60  ? 135 LEU A CD1   1 
ATOM   677  C CD2   . LEU A 1 83  ? 2.142   25.061  -21.055 1.00 39.94  ? 135 LEU A CD2   1 
ATOM   678  N N     . TYR A 1 84  ? 6.392   22.273  -21.071 1.00 41.60  ? 136 TYR A N     1 
ATOM   679  C CA    . TYR A 1 84  ? 7.331   21.574  -20.166 1.00 36.29  ? 136 TYR A CA    1 
ATOM   680  C C     . TYR A 1 84  ? 7.024   21.989  -18.751 1.00 34.72  ? 136 TYR A C     1 
ATOM   681  O O     . TYR A 1 84  ? 7.370   23.080  -18.324 1.00 41.42  ? 136 TYR A O     1 
ATOM   682  C CB    . TYR A 1 84  ? 8.805   21.857  -20.497 1.00 29.40  ? 136 TYR A CB    1 
ATOM   683  C CG    . TYR A 1 84  ? 9.752   21.094  -19.608 1.00 31.56  ? 136 TYR A CG    1 
ATOM   684  C CD1   . TYR A 1 84  ? 9.927   19.730  -19.759 1.00 30.45  ? 136 TYR A CD1   1 
ATOM   685  C CD2   . TYR A 1 84  ? 10.454  21.732  -18.598 1.00 31.48  ? 136 TYR A CD2   1 
ATOM   686  C CE1   . TYR A 1 84  ? 10.777  19.014  -18.935 1.00 26.93  ? 136 TYR A CE1   1 
ATOM   687  C CE2   . TYR A 1 84  ? 11.303  21.030  -17.768 1.00 33.62  ? 136 TYR A CE2   1 
ATOM   688  C CZ    . TYR A 1 84  ? 11.465  19.663  -17.937 1.00 33.54  ? 136 TYR A CZ    1 
ATOM   689  O OH    . TYR A 1 84  ? 12.316  18.951  -17.096 1.00 32.83  ? 136 TYR A OH    1 
ATOM   690  N N     . VAL A 1 85  ? 6.330   21.129  -18.034 1.00 29.89  ? 137 VAL A N     1 
ATOM   691  C CA    . VAL A 1 85  ? 6.009   21.416  -16.651 1.00 35.08  ? 137 VAL A CA    1 
ATOM   692  C C     . VAL A 1 85  ? 7.240   21.132  -15.799 1.00 35.30  ? 137 VAL A C     1 
ATOM   693  O O     . VAL A 1 85  ? 7.672   19.985  -15.716 1.00 37.20  ? 137 VAL A O     1 
ATOM   694  C CB    . VAL A 1 85  ? 4.804   20.573  -16.188 1.00 31.61  ? 137 VAL A CB    1 
ATOM   695  C CG1   . VAL A 1 85  ? 4.453   20.872  -14.796 1.00 30.11  ? 137 VAL A CG1   1 
ATOM   696  C CG2   . VAL A 1 85  ? 3.614   20.830  -17.107 1.00 34.63  ? 137 VAL A CG2   1 
ATOM   697  N N     . HIS A 1 86  ? 7.830   22.163  -15.203 1.00 34.59  ? 138 HIS A N     1 
ATOM   698  C CA    . HIS A 1 86  ? 9.013   21.956  -14.362 1.00 38.49  ? 138 HIS A CA    1 
ATOM   699  C C     . HIS A 1 86  ? 8.752   20.915  -13.266 1.00 38.40  ? 138 HIS A C     1 
ATOM   700  O O     . HIS A 1 86  ? 7.789   21.031  -12.523 1.00 39.83  ? 138 HIS A O     1 
ATOM   701  C CB    . HIS A 1 86  ? 9.467   23.271  -13.725 1.00 39.91  ? 138 HIS A CB    1 
ATOM   702  C CG    . HIS A 1 86  ? 10.809  23.188  -13.063 1.00 46.25  ? 138 HIS A CG    1 
ATOM   703  N ND1   . HIS A 1 86  ? 11.021  22.510  -11.880 1.00 44.59  ? 138 HIS A ND1   1 
ATOM   704  C CD2   . HIS A 1 86  ? 12.013  23.699  -13.421 1.00 45.75  ? 138 HIS A CD2   1 
ATOM   705  C CE1   . HIS A 1 86  ? 12.294  22.602  -11.545 1.00 44.09  ? 138 HIS A CE1   1 
ATOM   706  N NE2   . HIS A 1 86  ? 12.919  23.319  -12.464 1.00 38.70  ? 138 HIS A NE2   1 
ATOM   707  N N     . PRO A 1 87  ? 9.619   19.899  -13.164 1.00 39.08  ? 139 PRO A N     1 
ATOM   708  C CA    . PRO A 1 87  ? 9.401   18.725  -12.307 1.00 40.57  ? 139 PRO A CA    1 
ATOM   709  C C     . PRO A 1 87  ? 9.269   19.027  -10.794 1.00 48.39  ? 139 PRO A C     1 
ATOM   710  O O     . PRO A 1 87  ? 8.846   18.148  -10.031 1.00 51.22  ? 139 PRO A O     1 
ATOM   711  C CB    . PRO A 1 87  ? 10.646  17.873  -12.569 1.00 38.24  ? 139 PRO A CB    1 
ATOM   712  C CG    . PRO A 1 87  ? 11.232  18.390  -13.818 1.00 36.46  ? 139 PRO A CG    1 
ATOM   713  C CD    . PRO A 1 87  ? 10.921  19.838  -13.842 1.00 38.83  ? 139 PRO A CD    1 
ATOM   714  N N     . ASP A 1 88  ? 9.623   20.235  -10.364 1.00 45.48  ? 140 ASP A N     1 
ATOM   715  C CA    . ASP A 1 88  ? 9.395   20.621  -8.979  1.00 45.27  ? 140 ASP A CA    1 
ATOM   716  C C     . ASP A 1 88  ? 7.965   21.138  -8.756  1.00 45.13  ? 140 ASP A C     1 
ATOM   717  O O     . ASP A 1 88  ? 7.561   21.350  -7.623  1.00 51.01  ? 140 ASP A O     1 
ATOM   718  C CB    . ASP A 1 88  ? 10.433  21.670  -8.536  1.00 47.34  ? 140 ASP A CB    1 
ATOM   719  C CG    . ASP A 1 88  ? 11.747  21.036  -8.059  1.00 54.71  ? 140 ASP A CG    1 
ATOM   720  O OD1   . ASP A 1 88  ? 11.686  19.929  -7.479  1.00 60.67  ? 140 ASP A OD1   1 
ATOM   721  O OD2   . ASP A 1 88  ? 12.840  21.621  -8.261  1.00 46.36  ? 140 ASP A OD2   1 
ATOM   722  N N     . SER A 1 89  ? 7.196   21.327  -9.825  1.00 42.09  ? 141 SER A N     1 
ATOM   723  C CA    . SER A 1 89  ? 5.808   21.811  -9.719  1.00 42.78  ? 141 SER A CA    1 
ATOM   724  C C     . SER A 1 89  ? 4.866   20.783  -9.093  1.00 44.22  ? 141 SER A C     1 
ATOM   725  O O     . SER A 1 89  ? 5.092   19.590  -9.215  1.00 50.48  ? 141 SER A O     1 
ATOM   726  C CB    . SER A 1 89  ? 5.252   22.192  -11.103 1.00 43.74  ? 141 SER A CB    1 
ATOM   727  O OG    . SER A 1 89  ? 6.085   23.100  -11.818 1.00 44.52  ? 141 SER A OG    1 
ATOM   728  N N     . PRO A 1 90  ? 3.819   21.239  -8.391  1.00 42.70  ? 142 PRO A N     1 
ATOM   729  C CA    . PRO A 1 90  ? 3.636   22.610  -7.922  1.00 44.11  ? 142 PRO A CA    1 
ATOM   730  C C     . PRO A 1 90  ? 4.406   22.808  -6.615  1.00 49.50  ? 142 PRO A C     1 
ATOM   731  O O     . PRO A 1 90  ? 4.700   21.834  -5.916  1.00 47.94  ? 142 PRO A O     1 
ATOM   732  C CB    . PRO A 1 90  ? 2.129   22.707  -7.715  1.00 38.71  ? 142 PRO A CB    1 
ATOM   733  C CG    . PRO A 1 90  ? 1.751   21.352  -7.336  1.00 43.25  ? 142 PRO A CG    1 
ATOM   734  C CD    . PRO A 1 90  ? 2.631   20.417  -8.113  1.00 42.45  ? 142 PRO A CD    1 
ATOM   735  N N     . ALA A 1 91  ? 4.740   24.051  -6.293  1.00 48.33  ? 143 ALA A N     1 
ATOM   736  C CA    . ALA A 1 91  ? 5.620   24.313  -5.166  1.00 48.96  ? 143 ALA A CA    1 
ATOM   737  C C     . ALA A 1 91  ? 5.417   25.717  -4.651  1.00 50.75  ? 143 ALA A C     1 
ATOM   738  O O     . ALA A 1 91  ? 5.070   26.617  -5.426  1.00 50.13  ? 143 ALA A O     1 
ATOM   739  C CB    . ALA A 1 91  ? 7.071   24.111  -5.569  1.00 47.29  ? 143 ALA A CB    1 
ATOM   740  N N     . THR A 1 92  ? 5.646   25.904  -3.354  1.00 47.34  ? 144 THR A N     1 
ATOM   741  C CA    . THR A 1 92  ? 5.540   27.219  -2.740  1.00 46.88  ? 144 THR A CA    1 
ATOM   742  C C     . THR A 1 92  ? 6.503   28.183  -3.391  1.00 47.66  ? 144 THR A C     1 
ATOM   743  O O     . THR A 1 92  ? 7.620   27.799  -3.719  1.00 47.61  ? 144 THR A O     1 
ATOM   744  C CB    . THR A 1 92  ? 5.860   27.179  -1.256  1.00 46.93  ? 144 THR A CB    1 
ATOM   745  O OG1   . THR A 1 92  ? 7.275   27.015  -1.093  1.00 47.66  ? 144 THR A OG1   1 
ATOM   746  C CG2   . THR A 1 92  ? 5.119   26.036  -0.584  1.00 43.68  ? 144 THR A CG2   1 
ATOM   747  N N     . GLY A 1 93  ? 6.083   29.433  -3.565  1.00 48.29  ? 145 GLY A N     1 
ATOM   748  C CA    . GLY A 1 93  ? 6.965   30.456  -4.098  1.00 49.95  ? 145 GLY A CA    1 
ATOM   749  C C     . GLY A 1 93  ? 8.333   30.427  -3.428  1.00 52.08  ? 145 GLY A C     1 
ATOM   750  O O     . GLY A 1 93  ? 9.355   30.660  -4.081  1.00 47.80  ? 145 GLY A O     1 
ATOM   751  N N     . ALA A 1 94  ? 8.337   30.117  -2.128  1.00 50.90  ? 146 ALA A N     1 
ATOM   752  C CA    . ALA A 1 94  ? 9.555   30.031  -1.326  1.00 53.41  ? 146 ALA A CA    1 
ATOM   753  C C     . ALA A 1 94  ? 10.570  29.039  -1.893  1.00 52.69  ? 146 ALA A C     1 
ATOM   754  O O     . ALA A 1 94  ? 11.764  29.331  -2.011  1.00 47.57  ? 146 ALA A O     1 
ATOM   755  C CB    . ALA A 1 94  ? 9.202   29.653  0.076   1.00 55.24  ? 146 ALA A CB    1 
ATOM   756  N N     . HIS A 1 95  ? 10.065  27.860  -2.223  1.00 51.02  ? 147 HIS A N     1 
ATOM   757  C CA    . HIS A 1 95  ? 10.811  26.829  -2.922  1.00 48.57  ? 147 HIS A CA    1 
ATOM   758  C C     . HIS A 1 95  ? 11.378  27.324  -4.257  1.00 52.96  ? 147 HIS A C     1 
ATOM   759  O O     . HIS A 1 95  ? 12.528  27.016  -4.597  1.00 56.40  ? 147 HIS A O     1 
ATOM   760  C CB    . HIS A 1 95  ? 9.894   25.629  -3.148  1.00 50.54  ? 147 HIS A CB    1 
ATOM   761  C CG    . HIS A 1 95  ? 10.600  24.389  -3.583  1.00 52.43  ? 147 HIS A CG    1 
ATOM   762  N ND1   . HIS A 1 95  ? 11.313  24.310  -4.758  1.00 57.45  ? 147 HIS A ND1   1 
ATOM   763  C CD2   . HIS A 1 95  ? 10.676  23.163  -3.014  1.00 56.33  ? 147 HIS A CD2   1 
ATOM   764  C CE1   . HIS A 1 95  ? 11.813  23.094  -4.886  1.00 62.38  ? 147 HIS A CE1   1 
ATOM   765  N NE2   . HIS A 1 95  ? 11.437  22.376  -3.842  1.00 60.03  ? 147 HIS A NE2   1 
ATOM   766  N N     . TRP A 1 96  ? 10.574  28.081  -5.014  1.00 50.49  ? 148 TRP A N     1 
ATOM   767  C CA    . TRP A 1 96  ? 10.977  28.568  -6.343  1.00 46.64  ? 148 TRP A CA    1 
ATOM   768  C C     . TRP A 1 96  ? 12.077  29.618  -6.272  1.00 49.77  ? 148 TRP A C     1 
ATOM   769  O O     . TRP A 1 96  ? 13.037  29.567  -7.040  1.00 49.69  ? 148 TRP A O     1 
ATOM   770  C CB    . TRP A 1 96  ? 9.786   29.149  -7.104  1.00 43.57  ? 148 TRP A CB    1 
ATOM   771  C CG    . TRP A 1 96  ? 8.774   28.125  -7.531  1.00 44.11  ? 148 TRP A CG    1 
ATOM   772  C CD1   . TRP A 1 96  ? 7.446   28.105  -7.218  1.00 43.41  ? 148 TRP A CD1   1 
ATOM   773  C CD2   . TRP A 1 96  ? 9.011   26.972  -8.343  1.00 41.69  ? 148 TRP A CD2   1 
ATOM   774  N NE1   . TRP A 1 96  ? 6.846   27.009  -7.776  1.00 43.56  ? 148 TRP A NE1   1 
ATOM   775  C CE2   . TRP A 1 96  ? 7.784   26.299  -8.479  1.00 42.05  ? 148 TRP A CE2   1 
ATOM   776  C CE3   . TRP A 1 96  ? 10.144  26.444  -8.972  1.00 41.75  ? 148 TRP A CE3   1 
ATOM   777  C CZ2   . TRP A 1 96  ? 7.653   25.126  -9.210  1.00 43.15  ? 148 TRP A CZ2   1 
ATOM   778  C CZ3   . TRP A 1 96  ? 10.022  25.286  -9.695  1.00 41.31  ? 148 TRP A CZ3   1 
ATOM   779  C CH2   . TRP A 1 96  ? 8.780   24.635  -9.812  1.00 46.83  ? 148 TRP A CH2   1 
ATOM   780  N N     . MET A 1 97  ? 11.938  30.563  -5.344  1.00 54.24  ? 149 MET A N     1 
ATOM   781  C CA    . MET A 1 97  ? 12.932  31.625  -5.158  1.00 54.97  ? 149 MET A CA    1 
ATOM   782  C C     . MET A 1 97  ? 14.210  31.182  -4.434  1.00 57.67  ? 149 MET A C     1 
ATOM   783  O O     . MET A 1 97  ? 15.249  31.817  -4.623  1.00 55.80  ? 149 MET A O     1 
ATOM   784  C CB    . MET A 1 97  ? 12.316  32.800  -4.396  1.00 50.53  ? 149 MET A CB    1 
ATOM   785  C CG    . MET A 1 97  ? 11.276  33.574  -5.169  1.00 57.05  ? 149 MET A CG    1 
ATOM   786  S SD    . MET A 1 97  ? 10.483  34.907  -4.244  1.00 65.56  ? 149 MET A SD    1 
ATOM   787  C CE    . MET A 1 97  ? 9.592   33.974  -2.997  1.00 49.81  ? 149 MET A CE    1 
ATOM   788  N N     . ARG A 1 98  ? 14.117  30.116  -3.620  1.00 58.35  ? 150 ARG A N     1 
ATOM   789  C CA    . ARG A 1 98  ? 15.220  29.613  -2.780  1.00 56.28  ? 150 ARG A CA    1 
ATOM   790  C C     . ARG A 1 98  ? 16.559  29.661  -3.531  1.00 63.64  ? 150 ARG A C     1 
ATOM   791  O O     . ARG A 1 98  ? 17.435  30.444  -3.144  1.00 69.90  ? 150 ARG A O     1 
ATOM   792  C CB    . ARG A 1 98  ? 14.914  28.191  -2.247  1.00 55.11  ? 150 ARG A CB    1 
ATOM   793  C CG    . ARG A 1 98  ? 15.998  27.594  -1.341  1.00 73.94  ? 150 ARG A CG    1 
ATOM   794  C CD    . ARG A 1 98  ? 15.646  26.206  -0.759  1.00 87.13  ? 150 ARG A CD    1 
ATOM   795  N NE    . ARG A 1 98  ? 16.726  25.712  0.119   1.00 104.13 ? 150 ARG A NE    1 
ATOM   796  C CZ    . ARG A 1 98  ? 16.659  24.643  0.920   1.00 106.69 ? 150 ARG A CZ    1 
ATOM   797  N NH1   . ARG A 1 98  ? 15.570  23.879  0.967   1.00 110.68 ? 150 ARG A NH1   1 
ATOM   798  N NH2   . ARG A 1 98  ? 17.705  24.325  1.676   1.00 97.33  ? 150 ARG A NH2   1 
ATOM   799  N N     . GLN A 1 99  ? 16.719  28.869  -4.594  1.00 62.55  ? 151 GLN A N     1 
ATOM   800  C CA    . GLN A 1 99  ? 17.805  29.092  -5.550  1.00 66.63  ? 151 GLN A CA    1 
ATOM   801  C C     . GLN A 1 99  ? 17.375  28.725  -6.950  1.00 52.80  ? 151 GLN A C     1 
ATOM   802  O O     . GLN A 1 99  ? 16.269  28.255  -7.139  1.00 58.95  ? 151 GLN A O     1 
ATOM   803  C CB    . GLN A 1 99  ? 19.082  28.333  -5.166  1.00 77.19  ? 151 GLN A CB    1 
ATOM   804  C CG    . GLN A 1 99  ? 19.878  29.008  -4.035  1.00 83.18  ? 151 GLN A CG    1 
ATOM   805  C CD    . GLN A 1 99  ? 21.168  28.304  -3.689  1.00 94.22  ? 151 GLN A CD    1 
ATOM   806  O OE1   . GLN A 1 99  ? 21.345  27.116  -3.988  1.00 90.43  ? 151 GLN A OE1   1 
ATOM   807  N NE2   . GLN A 1 99  ? 22.087  29.036  -3.046  1.00 99.56  ? 151 GLN A NE2   1 
ATOM   808  N N     . LEU A 1 100 ? 18.248  28.974  -7.920  1.00 49.40  ? 152 LEU A N     1 
ATOM   809  C CA    . LEU A 1 100 ? 17.908  28.894  -9.341  1.00 49.21  ? 152 LEU A CA    1 
ATOM   810  C C     . LEU A 1 100 ? 16.911  27.810  -9.712  1.00 50.14  ? 152 LEU A C     1 
ATOM   811  O O     . LEU A 1 100 ? 17.037  26.666  -9.257  1.00 49.50  ? 152 LEU A O     1 
ATOM   812  C CB    . LEU A 1 100 ? 19.163  28.669  -10.173 1.00 46.57  ? 152 LEU A CB    1 
ATOM   813  C CG    . LEU A 1 100 ? 20.261  29.705  -10.040 1.00 50.08  ? 152 LEU A CG    1 
ATOM   814  C CD1   . LEU A 1 100 ? 21.287  29.453  -11.131 1.00 51.29  ? 152 LEU A CD1   1 
ATOM   815  C CD2   . LEU A 1 100 ? 19.687  31.111  -10.113 1.00 44.12  ? 152 LEU A CD2   1 
ATOM   816  N N     . VAL A 1 101 ? 15.916  28.198  -10.519 1.00 47.68  ? 153 VAL A N     1 
ATOM   817  C CA    . VAL A 1 101 ? 15.056  27.258  -11.223 1.00 39.92  ? 153 VAL A CA    1 
ATOM   818  C C     . VAL A 1 101 ? 15.829  26.802  -12.434 1.00 36.10  ? 153 VAL A C     1 
ATOM   819  O O     . VAL A 1 101 ? 16.198  27.623  -13.266 1.00 34.96  ? 153 VAL A O     1 
ATOM   820  C CB    . VAL A 1 101 ? 13.710  27.874  -11.689 1.00 36.85  ? 153 VAL A CB    1 
ATOM   821  C CG1   . VAL A 1 101 ? 12.668  26.792  -11.820 1.00 39.44  ? 153 VAL A CG1   1 
ATOM   822  C CG2   . VAL A 1 101 ? 13.216  28.929  -10.742 1.00 38.38  ? 153 VAL A CG2   1 
ATOM   823  N N     . SER A 1 102 ? 16.105  25.509  -12.530 1.00 36.38  ? 154 SER A N     1 
ATOM   824  C CA    . SER A 1 102 ? 16.760  25.009  -13.728 1.00 40.76  ? 154 SER A CA    1 
ATOM   825  C C     . SER A 1 102 ? 15.805  24.315  -14.670 1.00 39.58  ? 154 SER A C     1 
ATOM   826  O O     . SER A 1 102 ? 15.011  23.486  -14.230 1.00 40.91  ? 154 SER A O     1 
ATOM   827  C CB    . SER A 1 102 ? 17.863  24.026  -13.396 1.00 41.69  ? 154 SER A CB    1 
ATOM   828  O OG    . SER A 1 102 ? 18.197  23.322  -14.588 1.00 42.98  ? 154 SER A OG    1 
ATOM   829  N N     . PHE A 1 103 ? 15.906  24.629  -15.961 1.00 39.92  ? 155 PHE A N     1 
ATOM   830  C CA    . PHE A 1 103 ? 15.140  23.925  -16.995 1.00 40.48  ? 155 PHE A CA    1 
ATOM   831  C C     . PHE A 1 103 ? 16.098  23.105  -17.842 1.00 40.54  ? 155 PHE A C     1 
ATOM   832  O O     . PHE A 1 103 ? 16.044  23.114  -19.059 1.00 41.62  ? 155 PHE A O     1 
ATOM   833  C CB    . PHE A 1 103 ? 14.331  24.902  -17.862 1.00 35.02  ? 155 PHE A CB    1 
ATOM   834  C CG    . PHE A 1 103 ? 13.122  25.467  -17.169 1.00 38.50  ? 155 PHE A CG    1 
ATOM   835  C CD1   . PHE A 1 103 ? 13.220  26.613  -16.388 1.00 41.35  ? 155 PHE A CD1   1 
ATOM   836  C CD2   . PHE A 1 103 ? 11.895  24.837  -17.273 1.00 37.71  ? 155 PHE A CD2   1 
ATOM   837  C CE1   . PHE A 1 103 ? 12.109  27.120  -15.729 1.00 40.73  ? 155 PHE A CE1   1 
ATOM   838  C CE2   . PHE A 1 103 ? 10.784  25.337  -16.628 1.00 39.36  ? 155 PHE A CE2   1 
ATOM   839  C CZ    . PHE A 1 103 ? 10.885  26.475  -15.851 1.00 42.81  ? 155 PHE A CZ    1 
ATOM   840  N N     . GLN A 1 104 ? 16.983  22.383  -17.180 1.00 42.49  ? 156 GLN A N     1 
ATOM   841  C CA    . GLN A 1 104 ? 18.043  21.694  -17.881 1.00 40.37  ? 156 GLN A CA    1 
ATOM   842  C C     . GLN A 1 104 ? 17.626  20.311  -18.372 1.00 43.17  ? 156 GLN A C     1 
ATOM   843  O O     . GLN A 1 104 ? 18.220  19.814  -19.327 1.00 49.12  ? 156 GLN A O     1 
ATOM   844  C CB    . GLN A 1 104 ? 19.265  21.590  -16.975 1.00 46.03  ? 156 GLN A CB    1 
ATOM   845  C CG    . GLN A 1 104 ? 20.486  20.940  -17.586 1.00 45.57  ? 156 GLN A CG    1 
ATOM   846  C CD    . GLN A 1 104 ? 21.614  20.823  -16.577 1.00 56.28  ? 156 GLN A CD    1 
ATOM   847  O OE1   . GLN A 1 104 ? 21.385  20.489  -15.401 1.00 62.01  ? 156 GLN A OE1   1 
ATOM   848  N NE2   . GLN A 1 104 ? 22.834  21.119  -17.016 1.00 51.55  ? 156 GLN A NE2   1 
ATOM   849  N N     . LYS A 1 105 ? 16.619  19.690  -17.750 1.00 36.92  ? 157 LYS A N     1 
ATOM   850  C CA    . LYS A 1 105 ? 16.176  18.358  -18.179 1.00 35.15  ? 157 LYS A CA    1 
ATOM   851  C C     . LYS A 1 105 ? 15.146  18.403  -19.324 1.00 39.60  ? 157 LYS A C     1 
ATOM   852  O O     . LYS A 1 105 ? 14.649  17.366  -19.776 1.00 41.10  ? 157 LYS A O     1 
ATOM   853  C CB    . LYS A 1 105 ? 15.598  17.581  -17.008 1.00 35.42  ? 157 LYS A CB    1 
ATOM   854  C CG    . LYS A 1 105 ? 16.624  16.763  -16.252 1.00 44.41  ? 157 LYS A CG    1 
ATOM   855  C CD    . LYS A 1 105 ? 15.967  15.867  -15.199 1.00 47.84  ? 157 LYS A CD    1 
ATOM   856  C CE    . LYS A 1 105 ? 17.000  14.998  -14.485 1.00 50.92  ? 157 LYS A CE    1 
ATOM   857  N NZ    . LYS A 1 105 ? 17.800  14.125  -15.402 1.00 48.50  ? 157 LYS A NZ    1 
ATOM   858  N N     . LEU A 1 106 ? 14.832  19.601  -19.795 1.00 35.57  ? 158 LEU A N     1 
ATOM   859  C CA    . LEU A 1 106 ? 13.950  19.776  -20.951 1.00 38.68  ? 158 LEU A CA    1 
ATOM   860  C C     . LEU A 1 106 ? 14.577  19.277  -22.267 1.00 38.10  ? 158 LEU A C     1 
ATOM   861  O O     . LEU A 1 106 ? 15.723  19.589  -22.569 1.00 43.51  ? 158 LEU A O     1 
ATOM   862  C CB    . LEU A 1 106 ? 13.578  21.252  -21.064 1.00 36.74  ? 158 LEU A CB    1 
ATOM   863  C CG    . LEU A 1 106 ? 12.756  21.801  -22.212 1.00 36.32  ? 158 LEU A CG    1 
ATOM   864  C CD1   . LEU A 1 106 ? 12.421  23.193  -21.807 1.00 38.49  ? 158 LEU A CD1   1 
ATOM   865  C CD2   . LEU A 1 106 ? 13.529  21.830  -23.499 1.00 37.32  ? 158 LEU A CD2   1 
ATOM   866  N N     . LYS A 1 107 ? 13.825  18.554  -23.080 1.00 33.79  ? 159 LYS A N     1 
ATOM   867  C CA    . LYS A 1 107 ? 14.432  17.990  -24.283 1.00 36.70  ? 159 LYS A CA    1 
ATOM   868  C C     . LYS A 1 107 ? 13.649  18.291  -25.557 1.00 38.43  ? 159 LYS A C     1 
ATOM   869  O O     . LYS A 1 107 ? 12.421  18.411  -25.550 1.00 42.99  ? 159 LYS A O     1 
ATOM   870  C CB    . LYS A 1 107 ? 14.620  16.485  -24.118 1.00 40.40  ? 159 LYS A CB    1 
ATOM   871  C CG    . LYS A 1 107 ? 15.908  16.121  -23.376 1.00 35.33  ? 159 LYS A CG    1 
ATOM   872  C CD    . LYS A 1 107 ? 15.824  14.720  -22.798 1.00 36.89  ? 159 LYS A CD    1 
ATOM   873  C CE    . LYS A 1 107 ? 16.729  13.756  -23.522 1.00 37.34  ? 159 LYS A CE    1 
ATOM   874  N NZ    . LYS A 1 107 ? 17.558  13.006  -22.533 1.00 42.38  ? 159 LYS A NZ    1 
ATOM   875  N N     . LEU A 1 108 ? 14.375  18.445  -26.652 1.00 31.12  ? 160 LEU A N     1 
ATOM   876  C CA    . LEU A 1 108 ? 13.772  18.905  -27.876 1.00 29.69  ? 160 LEU A CA    1 
ATOM   877  C C     . LEU A 1 108 ? 13.753  17.758  -28.836 1.00 35.08  ? 160 LEU A C     1 
ATOM   878  O O     . LEU A 1 108 ? 14.750  17.059  -28.986 1.00 36.38  ? 160 LEU A O     1 
ATOM   879  C CB    . LEU A 1 108 ? 14.546  20.061  -28.471 1.00 29.03  ? 160 LEU A CB    1 
ATOM   880  C CG    . LEU A 1 108 ? 14.874  21.224  -27.564 1.00 25.56  ? 160 LEU A CG    1 
ATOM   881  C CD1   . LEU A 1 108 ? 15.734  22.191  -28.313 1.00 30.45  ? 160 LEU A CD1   1 
ATOM   882  C CD2   . LEU A 1 108 ? 13.640  21.875  -27.109 1.00 23.50  ? 160 LEU A CD2   1 
ATOM   883  N N     . THR A 1 109 ? 12.621  17.554  -29.493 1.00 36.79  ? 161 THR A N     1 
ATOM   884  C CA    . THR A 1 109 ? 12.533  16.463  -30.444 1.00 38.64  ? 161 THR A CA    1 
ATOM   885  C C     . THR A 1 109 ? 12.056  16.950  -31.800 1.00 37.81  ? 161 THR A C     1 
ATOM   886  O O     . THR A 1 109 ? 11.415  17.991  -31.911 1.00 36.87  ? 161 THR A O     1 
ATOM   887  C CB    . THR A 1 109 ? 11.609  15.349  -29.933 1.00 42.91  ? 161 THR A CB    1 
ATOM   888  O OG1   . THR A 1 109 ? 11.903  14.131  -30.626 1.00 47.21  ? 161 THR A OG1   1 
ATOM   889  C CG2   . THR A 1 109 ? 10.151  15.717  -30.143 1.00 46.08  ? 161 THR A CG2   1 
ATOM   890  N N     . ASN A 1 110 ? 12.413  16.202  -32.836 1.00 41.66  ? 162 ASN A N     1 
ATOM   891  C CA    . ASN A 1 110 ? 11.947  16.493  -34.191 1.00 43.21  ? 162 ASN A CA    1 
ATOM   892  C C     . ASN A 1 110 ? 10.803  15.572  -34.559 1.00 45.18  ? 162 ASN A C     1 
ATOM   893  O O     . ASN A 1 110 ? 10.170  15.759  -35.587 1.00 49.79  ? 162 ASN A O     1 
ATOM   894  C CB    . ASN A 1 110 ? 13.082  16.372  -35.230 1.00 33.79  ? 162 ASN A CB    1 
ATOM   895  C CG    . ASN A 1 110 ? 13.696  14.977  -35.297 1.00 38.01  ? 162 ASN A CG    1 
ATOM   896  O OD1   . ASN A 1 110 ? 13.458  14.122  -34.443 1.00 39.87  ? 162 ASN A OD1   1 
ATOM   897  N ND2   . ASN A 1 110 ? 14.513  14.753  -36.315 1.00 41.71  ? 162 ASN A ND2   1 
ATOM   898  N N     . ASN A 1 111 ? 10.549  14.587  -33.701 1.00 42.39  ? 163 ASN A N     1 
ATOM   899  C CA    . ASN A 1 111 ? 9.523   13.581  -33.908 1.00 45.09  ? 163 ASN A CA    1 
ATOM   900  C C     . ASN A 1 111 ? 8.117   14.131  -33.616 1.00 54.04  ? 163 ASN A C     1 
ATOM   901  O O     . ASN A 1 111 ? 7.854   14.608  -32.514 1.00 55.88  ? 163 ASN A O     1 
ATOM   902  C CB    . ASN A 1 111 ? 9.841   12.374  -33.031 1.00 44.83  ? 163 ASN A CB    1 
ATOM   903  C CG    . ASN A 1 111 ? 8.788   11.309  -33.101 1.00 52.06  ? 163 ASN A CG    1 
ATOM   904  O OD1   . ASN A 1 111 ? 7.900   11.352  -33.952 1.00 58.90  ? 163 ASN A OD1   1 
ATOM   905  N ND2   . ASN A 1 111 ? 8.875   10.333  -32.206 1.00 54.42  ? 163 ASN A ND2   1 
ATOM   906  N N     . HIS A 1 112 ? 7.214   14.060  -34.592 1.00 52.00  ? 164 HIS A N     1 
ATOM   907  C CA    . HIS A 1 112 ? 5.916   14.721  -34.462 1.00 53.15  ? 164 HIS A CA    1 
ATOM   908  C C     . HIS A 1 112 ? 4.872   13.816  -33.823 1.00 53.55  ? 164 HIS A C     1 
ATOM   909  O O     . HIS A 1 112 ? 3.726   14.215  -33.600 1.00 51.21  ? 164 HIS A O     1 
ATOM   910  C CB    . HIS A 1 112 ? 5.438   15.198  -35.826 1.00 56.16  ? 164 HIS A CB    1 
ATOM   911  C CG    . HIS A 1 112 ? 6.371   16.176  -36.476 1.00 67.42  ? 164 HIS A CG    1 
ATOM   912  N ND1   . HIS A 1 112 ? 6.561   17.456  -36.002 1.00 68.47  ? 164 HIS A ND1   1 
ATOM   913  C CD2   . HIS A 1 112 ? 7.130   16.069  -37.595 1.00 67.93  ? 164 HIS A CD2   1 
ATOM   914  C CE1   . HIS A 1 112 ? 7.424   18.090  -36.786 1.00 69.95  ? 164 HIS A CE1   1 
ATOM   915  N NE2   . HIS A 1 112 ? 7.780   17.268  -37.756 1.00 74.16  ? 164 HIS A NE2   1 
ATOM   916  N N     . LEU A 1 113 ? 5.288   12.597  -33.514 1.00 51.75  ? 165 LEU A N     1 
ATOM   917  C CA    . LEU A 1 113 ? 4.400   11.620  -32.916 1.00 55.38  ? 165 LEU A CA    1 
ATOM   918  C C     . LEU A 1 113 ? 5.015   11.064  -31.627 1.00 63.79  ? 165 LEU A C     1 
ATOM   919  O O     . LEU A 1 113 ? 4.686   9.955   -31.185 1.00 64.36  ? 165 LEU A O     1 
ATOM   920  C CB    . LEU A 1 113 ? 4.114   10.508  -33.917 1.00 59.74  ? 165 LEU A CB    1 
ATOM   921  C CG    . LEU A 1 113 ? 3.383   10.941  -35.196 1.00 57.44  ? 165 LEU A CG    1 
ATOM   922  C CD1   . LEU A 1 113 ? 4.322   11.419  -36.317 1.00 52.55  ? 165 LEU A CD1   1 
ATOM   923  C CD2   . LEU A 1 113 ? 2.501   9.809   -35.673 1.00 57.60  ? 165 LEU A CD2   1 
ATOM   924  N N     . ASP A 1 114 ? 5.889   11.885  -31.037 1.00 60.97  ? 166 ASP A N     1 
ATOM   925  C CA    . ASP A 1 114 ? 6.693   11.583  -29.857 1.00 57.75  ? 166 ASP A CA    1 
ATOM   926  C C     . ASP A 1 114 ? 5.889   11.166  -28.628 1.00 62.77  ? 166 ASP A C     1 
ATOM   927  O O     . ASP A 1 114 ? 4.913   11.834  -28.251 1.00 59.73  ? 166 ASP A O     1 
ATOM   928  C CB    . ASP A 1 114 ? 7.554   12.808  -29.511 1.00 58.45  ? 166 ASP A CB    1 
ATOM   929  C CG    . ASP A 1 114 ? 8.561   12.533  -28.386 1.00 62.80  ? 166 ASP A CG    1 
ATOM   930  O OD1   . ASP A 1 114 ? 9.684   12.037  -28.675 1.00 60.33  ? 166 ASP A OD1   1 
ATOM   931  O OD2   . ASP A 1 114 ? 8.231   12.830  -27.214 1.00 58.28  ? 166 ASP A OD2   1 
ATOM   932  N N     . PRO A 1 115 ? 6.311   10.051  -27.998 1.00 68.51  ? 167 PRO A N     1 
ATOM   933  C CA    . PRO A 1 115 ? 5.731   9.433   -26.799 1.00 69.95  ? 167 PRO A CA    1 
ATOM   934  C C     . PRO A 1 115 ? 6.483   9.734   -25.500 1.00 71.08  ? 167 PRO A C     1 
ATOM   935  O O     . PRO A 1 115 ? 6.553   8.865   -24.625 1.00 73.84  ? 167 PRO A O     1 
ATOM   936  C CB    . PRO A 1 115 ? 5.836   7.943   -27.117 1.00 70.43  ? 167 PRO A CB    1 
ATOM   937  C CG    . PRO A 1 115 ? 7.142   7.852   -27.845 1.00 68.33  ? 167 PRO A CG    1 
ATOM   938  C CD    . PRO A 1 115 ? 7.277   9.142   -28.646 1.00 66.70  ? 167 PRO A CD    1 
ATOM   939  N N     . PHE A 1 116 ? 7.041   10.930  -25.367 1.00 65.91  ? 168 PHE A N     1 
ATOM   940  C CA    . PHE A 1 116 ? 7.830   11.236  -24.185 1.00 63.87  ? 168 PHE A CA    1 
ATOM   941  C C     . PHE A 1 116 ? 7.426   12.574  -23.551 1.00 63.57  ? 168 PHE A C     1 
ATOM   942  O O     . PHE A 1 116 ? 7.929   12.922  -22.469 1.00 71.57  ? 168 PHE A O     1 
ATOM   943  C CB    . PHE A 1 116 ? 9.332   11.245  -24.527 1.00 67.72  ? 168 PHE A CB    1 
ATOM   944  C CG    . PHE A 1 116 ? 9.950   9.863   -24.706 1.00 71.32  ? 168 PHE A CG    1 
ATOM   945  C CD1   . PHE A 1 116 ? 10.437  9.452   -25.950 1.00 70.92  ? 168 PHE A CD1   1 
ATOM   946  C CD2   . PHE A 1 116 ? 10.073  8.989   -23.629 1.00 74.47  ? 168 PHE A CD2   1 
ATOM   947  C CE1   . PHE A 1 116 ? 11.025  8.187   -26.117 1.00 72.27  ? 168 PHE A CE1   1 
ATOM   948  C CE2   . PHE A 1 116 ? 10.658  7.723   -23.789 1.00 77.06  ? 168 PHE A CE2   1 
ATOM   949  C CZ    . PHE A 1 116 ? 11.133  7.324   -25.035 1.00 74.37  ? 168 PHE A CZ    1 
ATOM   950  N N     . GLY A 1 117 ? 6.522   13.312  -24.205 1.00 54.40  ? 169 GLY A N     1 
ATOM   951  C CA    . GLY A 1 117 ? 6.084   14.615  -23.717 1.00 49.15  ? 169 GLY A CA    1 
ATOM   952  C C     . GLY A 1 117 ? 7.198   15.648  -23.795 1.00 56.65  ? 169 GLY A C     1 
ATOM   953  O O     . GLY A 1 117 ? 7.164   16.680  -23.122 1.00 56.03  ? 169 GLY A O     1 
ATOM   954  N N     . HIS A 1 118 ? 8.213   15.333  -24.600 1.00 59.10  ? 170 HIS A N     1 
ATOM   955  C CA    . HIS A 1 118 ? 9.257   16.274  -24.994 1.00 51.67  ? 170 HIS A CA    1 
ATOM   956  C C     . HIS A 1 118 ? 8.676   17.352  -25.904 1.00 52.37  ? 170 HIS A C     1 
ATOM   957  O O     . HIS A 1 118 ? 7.643   17.133  -26.543 1.00 50.04  ? 170 HIS A O     1 
ATOM   958  C CB    . HIS A 1 118 ? 10.385  15.551  -25.731 1.00 49.26  ? 170 HIS A CB    1 
ATOM   959  C CG    . HIS A 1 118 ? 11.089  14.520  -24.909 1.00 51.59  ? 170 HIS A CG    1 
ATOM   960  N ND1   . HIS A 1 118 ? 12.002  13.642  -25.447 1.00 50.09  ? 170 HIS A ND1   1 
ATOM   961  C CD2   . HIS A 1 118 ? 11.030  14.237  -23.587 1.00 56.17  ? 170 HIS A CD2   1 
ATOM   962  C CE1   . HIS A 1 118 ? 12.471  12.855  -24.494 1.00 56.93  ? 170 HIS A CE1   1 
ATOM   963  N NE2   . HIS A 1 118 ? 11.897  13.197  -23.355 1.00 55.34  ? 170 HIS A NE2   1 
ATOM   964  N N     . ILE A 1 119 ? 9.349   18.495  -25.994 1.00 44.42  ? 171 ILE A N     1 
ATOM   965  C CA    . ILE A 1 119 ? 8.887   19.572  -26.854 1.00 38.62  ? 171 ILE A CA    1 
ATOM   966  C C     . ILE A 1 119 ? 9.251   19.332  -28.307 1.00 41.07  ? 171 ILE A C     1 
ATOM   967  O O     . ILE A 1 119 ? 10.432  19.141  -28.619 1.00 42.24  ? 171 ILE A O     1 
ATOM   968  C CB    . ILE A 1 119 ? 9.466   20.906  -26.422 1.00 38.20  ? 171 ILE A CB    1 
ATOM   969  C CG1   . ILE A 1 119 ? 8.717   21.410  -25.200 1.00 35.00  ? 171 ILE A CG1   1 
ATOM   970  C CG2   . ILE A 1 119 ? 9.369   21.918  -27.566 1.00 38.96  ? 171 ILE A CG2   1 
ATOM   971  C CD1   . ILE A 1 119 ? 9.211   22.711  -24.743 1.00 42.19  ? 171 ILE A CD1   1 
ATOM   972  N N     . ILE A 1 120 ? 8.241   19.353  -29.187 1.00 40.90  ? 172 ILE A N     1 
ATOM   973  C CA    . ILE A 1 120 ? 8.421   19.082  -30.620 1.00 40.46  ? 172 ILE A CA    1 
ATOM   974  C C     . ILE A 1 120 ? 8.727   20.337  -31.403 1.00 41.03  ? 172 ILE A C     1 
ATOM   975  O O     . ILE A 1 120 ? 8.047   21.341  -31.245 1.00 43.20  ? 172 ILE A O     1 
ATOM   976  C CB    . ILE A 1 120 ? 7.186   18.455  -31.248 1.00 43.00  ? 172 ILE A CB    1 
ATOM   977  C CG1   . ILE A 1 120 ? 6.830   17.147  -30.560 1.00 42.90  ? 172 ILE A CG1   1 
ATOM   978  C CG2   . ILE A 1 120 ? 7.424   18.214  -32.705 1.00 44.32  ? 172 ILE A CG2   1 
ATOM   979  C CD1   . ILE A 1 120 ? 5.572   16.547  -31.062 1.00 40.94  ? 172 ILE A CD1   1 
ATOM   980  N N     . LEU A 1 121 ? 9.763   20.274  -32.232 1.00 39.78  ? 173 LEU A N     1 
ATOM   981  C CA    . LEU A 1 121 ? 10.180  21.402  -33.053 1.00 41.29  ? 173 LEU A CA    1 
ATOM   982  C C     . LEU A 1 121 ? 10.312  21.025  -34.527 1.00 49.33  ? 173 LEU A C     1 
ATOM   983  O O     . LEU A 1 121 ? 10.328  19.848  -34.910 1.00 51.22  ? 173 LEU A O     1 
ATOM   984  C CB    . LEU A 1 121 ? 11.503  21.971  -32.560 1.00 37.90  ? 173 LEU A CB    1 
ATOM   985  C CG    . LEU A 1 121 ? 11.518  22.443  -31.110 1.00 38.08  ? 173 LEU A CG    1 
ATOM   986  C CD1   . LEU A 1 121 ? 12.933  22.668  -30.669 1.00 36.26  ? 173 LEU A CD1   1 
ATOM   987  C CD2   . LEU A 1 121 ? 10.723  23.709  -30.937 1.00 39.15  ? 173 LEU A CD2   1 
ATOM   988  N N     . ASN A 1 122 ? 10.400  22.047  -35.362 1.00 48.28  ? 174 ASN A N     1 
ATOM   989  C CA    . ASN A 1 122 ? 10.530  21.842  -36.784 1.00 50.16  ? 174 ASN A CA    1 
ATOM   990  C C     . ASN A 1 122 ? 11.924  22.304  -37.185 1.00 49.45  ? 174 ASN A C     1 
ATOM   991  O O     . ASN A 1 122 ? 12.324  23.429  -36.877 1.00 46.74  ? 174 ASN A O     1 
ATOM   992  C CB    . ASN A 1 122 ? 9.426   22.603  -37.520 1.00 53.48  ? 174 ASN A CB    1 
ATOM   993  C CG    . ASN A 1 122 ? 9.128   22.039  -38.886 1.00 61.19  ? 174 ASN A CG    1 
ATOM   994  O OD1   . ASN A 1 122 ? 9.907   21.270  -39.459 1.00 58.66  ? 174 ASN A OD1   1 
ATOM   995  N ND2   . ASN A 1 122 ? 7.966   22.397  -39.406 1.00 70.13  ? 174 ASN A ND2   1 
ATOM   996  N N     . SER A 1 123 ? 12.680  21.424  -37.829 1.00 42.37  ? 175 SER A N     1 
ATOM   997  C CA    . SER A 1 123 ? 14.024  21.768  -38.237 1.00 40.95  ? 175 SER A CA    1 
ATOM   998  C C     . SER A 1 123 ? 14.071  23.036  -39.084 1.00 45.47  ? 175 SER A C     1 
ATOM   999  O O     . SER A 1 123 ? 13.183  23.294  -39.887 1.00 50.10  ? 175 SER A O     1 
ATOM   1000 C CB    . SER A 1 123 ? 14.640  20.616  -39.006 1.00 48.37  ? 175 SER A CB    1 
ATOM   1001 O OG    . SER A 1 123 ? 15.874  21.017  -39.564 1.00 55.09  ? 175 SER A OG    1 
ATOM   1002 N N     . MET A 1 124 ? 15.108  23.834  -38.876 1.00 49.04  ? 176 MET A N     1 
ATOM   1003 C CA    . MET A 1 124 ? 15.340  25.073  -39.628 1.00 49.05  ? 176 MET A CA    1 
ATOM   1004 C C     . MET A 1 124 ? 14.273  26.176  -39.492 1.00 48.07  ? 176 MET A C     1 
ATOM   1005 O O     . MET A 1 124 ? 14.081  26.963  -40.404 1.00 49.74  ? 176 MET A O     1 
ATOM   1006 C CB    . MET A 1 124 ? 15.531  24.731  -41.091 1.00 50.33  ? 176 MET A CB    1 
ATOM   1007 C CG    . MET A 1 124 ? 16.543  23.640  -41.290 1.00 55.12  ? 176 MET A CG    1 
ATOM   1008 S SD    . MET A 1 124 ? 18.209  24.212  -40.940 1.00 67.07  ? 176 MET A SD    1 
ATOM   1009 C CE    . MET A 1 124 ? 18.900  24.004  -42.599 1.00 63.91  ? 176 MET A CE    1 
ATOM   1010 N N     . HIS A 1 125 ? 13.609  26.246  -38.343 1.00 48.20  ? 177 HIS A N     1 
ATOM   1011 C CA    . HIS A 1 125 ? 12.813  27.414  -37.975 1.00 44.58  ? 177 HIS A CA    1 
ATOM   1012 C C     . HIS A 1 125 ? 13.374  28.085  -36.691 1.00 47.20  ? 177 HIS A C     1 
ATOM   1013 O O     . HIS A 1 125 ? 14.006  27.427  -35.850 1.00 49.12  ? 177 HIS A O     1 
ATOM   1014 C CB    . HIS A 1 125 ? 11.357  27.023  -37.760 1.00 45.94  ? 177 HIS A CB    1 
ATOM   1015 C CG    . HIS A 1 125 ? 10.680  26.465  -38.973 1.00 52.81  ? 177 HIS A CG    1 
ATOM   1016 N ND1   . HIS A 1 125 ? 11.197  25.418  -39.706 1.00 51.04  ? 177 HIS A ND1   1 
ATOM   1017 C CD2   . HIS A 1 125 ? 9.500   26.782  -39.557 1.00 50.46  ? 177 HIS A CD2   1 
ATOM   1018 C CE1   . HIS A 1 125 ? 10.377  25.132  -40.697 1.00 52.87  ? 177 HIS A CE1   1 
ATOM   1019 N NE2   . HIS A 1 125 ? 9.341   25.949  -40.630 1.00 51.76  ? 177 HIS A NE2   1 
ATOM   1020 N N     . LYS A 1 126 ? 13.152  29.387  -36.536 1.00 40.87  ? 178 LYS A N     1 
ATOM   1021 C CA    . LYS A 1 126 ? 13.591  30.075  -35.337 1.00 42.86  ? 178 LYS A CA    1 
ATOM   1022 C C     . LYS A 1 126 ? 12.526  29.951  -34.248 1.00 48.54  ? 178 LYS A C     1 
ATOM   1023 O O     . LYS A 1 126 ? 11.331  30.018  -34.540 1.00 50.92  ? 178 LYS A O     1 
ATOM   1024 C CB    . LYS A 1 126 ? 13.901  31.555  -35.621 1.00 53.81  ? 178 LYS A CB    1 
ATOM   1025 C CG    . LYS A 1 126 ? 15.134  31.788  -36.515 1.00 59.28  ? 178 LYS A CG    1 
ATOM   1026 C CD    . LYS A 1 126 ? 15.424  33.289  -36.799 1.00 61.63  ? 178 LYS A CD    1 
ATOM   1027 C CE    . LYS A 1 126 ? 16.196  34.004  -35.698 1.00 60.94  ? 178 LYS A CE    1 
ATOM   1028 N NZ    . LYS A 1 126 ? 17.638  33.562  -35.651 1.00 67.33  ? 178 LYS A NZ    1 
ATOM   1029 N N     . TYR A 1 127 ? 12.963  29.775  -32.997 1.00 45.86  ? 179 TYR A N     1 
ATOM   1030 C CA    . TYR A 1 127 ? 12.046  29.618  -31.867 1.00 42.74  ? 179 TYR A CA    1 
ATOM   1031 C C     . TYR A 1 127 ? 12.398  30.541  -30.712 1.00 43.58  ? 179 TYR A C     1 
ATOM   1032 O O     . TYR A 1 127 ? 13.488  31.103  -30.659 1.00 48.60  ? 179 TYR A O     1 
ATOM   1033 C CB    . TYR A 1 127 ? 12.028  28.171  -31.383 1.00 38.18  ? 179 TYR A CB    1 
ATOM   1034 C CG    . TYR A 1 127 ? 11.410  27.209  -32.370 1.00 38.82  ? 179 TYR A CG    1 
ATOM   1035 C CD1   . TYR A 1 127 ? 10.030  27.003  -32.416 1.00 41.15  ? 179 TYR A CD1   1 
ATOM   1036 C CD2   . TYR A 1 127 ? 12.200  26.512  -33.256 1.00 39.09  ? 179 TYR A CD2   1 
ATOM   1037 C CE1   . TYR A 1 127 ? 9.467   26.124  -33.320 1.00 36.83  ? 179 TYR A CE1   1 
ATOM   1038 C CE2   . TYR A 1 127 ? 11.652  25.640  -34.159 1.00 44.31  ? 179 TYR A CE2   1 
ATOM   1039 C CZ    . TYR A 1 127 ? 10.293  25.448  -34.195 1.00 42.90  ? 179 TYR A CZ    1 
ATOM   1040 O OH    . TYR A 1 127 ? 9.793   24.565  -35.117 1.00 48.66  ? 179 TYR A OH    1 
ATOM   1041 N N     . GLN A 1 128 ? 11.466  30.689  -29.783 1.00 42.47  ? 180 GLN A N     1 
ATOM   1042 C CA    . GLN A 1 128 ? 11.618  31.633  -28.690 1.00 44.46  ? 180 GLN A CA    1 
ATOM   1043 C C     . GLN A 1 128 ? 11.080  31.023  -27.394 1.00 49.90  ? 180 GLN A C     1 
ATOM   1044 O O     . GLN A 1 128 ? 9.889   30.761  -27.277 1.00 53.17  ? 180 GLN A O     1 
ATOM   1045 C CB    . GLN A 1 128 ? 10.898  32.940  -29.023 1.00 41.24  ? 180 GLN A CB    1 
ATOM   1046 C CG    . GLN A 1 128 ? 10.938  33.977  -27.934 1.00 41.29  ? 180 GLN A CG    1 
ATOM   1047 C CD    . GLN A 1 128 ? 12.344  34.281  -27.494 1.00 49.83  ? 180 GLN A CD    1 
ATOM   1048 O OE1   . GLN A 1 128 ? 13.135  34.867  -28.232 1.00 54.06  ? 180 GLN A OE1   1 
ATOM   1049 N NE2   . GLN A 1 128 ? 12.672  33.872  -26.288 1.00 51.02  ? 180 GLN A NE2   1 
ATOM   1050 N N     . PRO A 1 129 ? 11.966  30.762  -26.424 1.00 47.01  ? 181 PRO A N     1 
ATOM   1051 C CA    . PRO A 1 129 ? 11.515  30.130  -25.181 1.00 42.95  ? 181 PRO A CA    1 
ATOM   1052 C C     . PRO A 1 129 ? 10.785  31.094  -24.255 1.00 44.47  ? 181 PRO A C     1 
ATOM   1053 O O     . PRO A 1 129 ? 11.204  32.232  -24.096 1.00 45.94  ? 181 PRO A O     1 
ATOM   1054 C CB    . PRO A 1 129 ? 12.823  29.645  -24.549 1.00 44.27  ? 181 PRO A CB    1 
ATOM   1055 C CG    . PRO A 1 129 ? 13.817  29.602  -25.695 1.00 41.94  ? 181 PRO A CG    1 
ATOM   1056 C CD    . PRO A 1 129 ? 13.434  30.742  -26.556 1.00 44.41  ? 181 PRO A CD    1 
ATOM   1057 N N     . ARG A 1 130 ? 9.694   30.630  -23.652 1.00 49.11  ? 182 ARG A N     1 
ATOM   1058 C CA    . ARG A 1 130 ? 8.923   31.417  -22.693 1.00 43.99  ? 182 ARG A CA    1 
ATOM   1059 C C     . ARG A 1 130 ? 8.766   30.639  -21.408 1.00 48.16  ? 182 ARG A C     1 
ATOM   1060 O O     . ARG A 1 130 ? 8.501   29.441  -21.436 1.00 49.95  ? 182 ARG A O     1 
ATOM   1061 C CB    . ARG A 1 130 ? 7.539   31.764  -23.233 1.00 50.38  ? 182 ARG A CB    1 
ATOM   1062 C CG    . ARG A 1 130 ? 7.526   32.401  -24.610 1.00 56.01  ? 182 ARG A CG    1 
ATOM   1063 C CD    . ARG A 1 130 ? 6.185   33.047  -24.927 1.00 56.30  ? 182 ARG A CD    1 
ATOM   1064 N NE    . ARG A 1 130 ? 5.102   32.082  -25.090 1.00 57.21  ? 182 ARG A NE    1 
ATOM   1065 C CZ    . ARG A 1 130 ? 3.862   32.425  -25.421 1.00 62.74  ? 182 ARG A CZ    1 
ATOM   1066 N NH1   . ARG A 1 130 ? 3.559   33.703  -25.615 1.00 68.20  ? 182 ARG A NH1   1 
ATOM   1067 N NH2   . ARG A 1 130 ? 2.928   31.500  -25.563 1.00 61.47  ? 182 ARG A NH2   1 
ATOM   1068 N N     . LEU A 1 131 ? 8.942   31.319  -20.281 1.00 52.05  ? 183 LEU A N     1 
ATOM   1069 C CA    . LEU A 1 131 ? 8.614   30.748  -18.986 1.00 44.46  ? 183 LEU A CA    1 
ATOM   1070 C C     . LEU A 1 131 ? 7.253   31.258  -18.545 1.00 46.03  ? 183 LEU A C     1 
ATOM   1071 O O     . LEU A 1 131 ? 6.957   32.434  -18.674 1.00 49.95  ? 183 LEU A O     1 
ATOM   1072 C CB    . LEU A 1 131 ? 9.674   31.100  -17.954 1.00 44.42  ? 183 LEU A CB    1 
ATOM   1073 C CG    . LEU A 1 131 ? 9.208   30.997  -16.497 1.00 47.31  ? 183 LEU A CG    1 
ATOM   1074 C CD1   . LEU A 1 131 ? 9.362   29.599  -15.914 1.00 41.98  ? 183 LEU A CD1   1 
ATOM   1075 C CD2   . LEU A 1 131 ? 9.933   32.007  -15.641 1.00 52.19  ? 183 LEU A CD2   1 
ATOM   1076 N N     . HIS A 1 132 ? 6.415   30.368  -18.041 1.00 47.49  ? 184 HIS A N     1 
ATOM   1077 C CA    . HIS A 1 132 ? 5.150   30.782  -17.457 1.00 49.03  ? 184 HIS A CA    1 
ATOM   1078 C C     . HIS A 1 132 ? 5.100   30.448  -15.975 1.00 44.47  ? 184 HIS A C     1 
ATOM   1079 O O     . HIS A 1 132 ? 5.362   29.322  -15.571 1.00 42.61  ? 184 HIS A O     1 
ATOM   1080 C CB    . HIS A 1 132 ? 3.965   30.113  -18.159 1.00 44.30  ? 184 HIS A CB    1 
ATOM   1081 C CG    . HIS A 1 132 ? 3.980   30.251  -19.645 1.00 49.68  ? 184 HIS A CG    1 
ATOM   1082 N ND1   . HIS A 1 132 ? 3.185   31.156  -20.320 1.00 53.44  ? 184 HIS A ND1   1 
ATOM   1083 C CD2   . HIS A 1 132 ? 4.672   29.583  -20.593 1.00 52.76  ? 184 HIS A CD2   1 
ATOM   1084 C CE1   . HIS A 1 132 ? 3.396   31.042  -21.615 1.00 56.38  ? 184 HIS A CE1   1 
ATOM   1085 N NE2   . HIS A 1 132 ? 4.290   30.088  -21.811 1.00 55.92  ? 184 HIS A NE2   1 
ATOM   1086 N N     . ILE A 1 133 ? 4.751   31.427  -15.162 1.00 42.99  ? 185 ILE A N     1 
ATOM   1087 C CA    . ILE A 1 133 ? 4.463   31.132  -13.789 1.00 43.27  ? 185 ILE A CA    1 
ATOM   1088 C C     . ILE A 1 133 ? 2.975   31.156  -13.648 1.00 49.14  ? 185 ILE A C     1 
ATOM   1089 O O     . ILE A 1 133 ? 2.348   32.161  -13.939 1.00 55.59  ? 185 ILE A O     1 
ATOM   1090 C CB    . ILE A 1 133 ? 5.130   32.119  -12.842 1.00 49.57  ? 185 ILE A CB    1 
ATOM   1091 C CG1   . ILE A 1 133 ? 6.626   31.803  -12.757 1.00 50.80  ? 185 ILE A CG1   1 
ATOM   1092 C CG2   . ILE A 1 133 ? 4.524   32.011  -11.464 1.00 50.14  ? 185 ILE A CG2   1 
ATOM   1093 C CD1   . ILE A 1 133 ? 7.478   32.961  -12.307 1.00 56.96  ? 185 ILE A CD1   1 
ATOM   1094 N N     . VAL A 1 134 ? 2.426   30.026  -13.220 1.00 49.48  ? 186 VAL A N     1 
ATOM   1095 C CA    . VAL A 1 134 ? 0.988   29.818  -13.081 1.00 51.17  ? 186 VAL A CA    1 
ATOM   1096 C C     . VAL A 1 134 ? 0.674   29.433  -11.647 1.00 45.95  ? 186 VAL A C     1 
ATOM   1097 O O     . VAL A 1 134 ? 1.396   28.649  -11.071 1.00 46.52  ? 186 VAL A O     1 
ATOM   1098 C CB    . VAL A 1 134 ? 0.482   28.680  -13.999 1.00 44.19  ? 186 VAL A CB    1 
ATOM   1099 C CG1   . VAL A 1 134 ? -1.017  28.563  -13.932 1.00 45.96  ? 186 VAL A CG1   1 
ATOM   1100 C CG2   . VAL A 1 134 ? 0.946   28.875  -15.403 1.00 49.99  ? 186 VAL A CG2   1 
ATOM   1101 N N     . LYS A 1 135 ? -0.410  29.950  -11.087 1.00 46.40  ? 187 LYS A N     1 
ATOM   1102 C CA    . LYS A 1 135 ? -0.884  29.519  -9.776  1.00 46.35  ? 187 LYS A CA    1 
ATOM   1103 C C     . LYS A 1 135 ? -1.536  28.138  -9.774  1.00 46.36  ? 187 LYS A C     1 
ATOM   1104 O O     . LYS A 1 135 ? -2.219  27.791  -10.720 1.00 53.56  ? 187 LYS A O     1 
ATOM   1105 C CB    . LYS A 1 135 ? -1.897  30.529  -9.248  1.00 59.05  ? 187 LYS A CB    1 
ATOM   1106 C CG    . LYS A 1 135 ? -1.327  31.904  -8.918  1.00 70.98  ? 187 LYS A CG    1 
ATOM   1107 C CD    . LYS A 1 135 ? -2.446  32.828  -8.424  1.00 76.46  ? 187 LYS A CD    1 
ATOM   1108 C CE    . LYS A 1 135 ? -1.880  34.200  -8.068  1.00 88.20  ? 187 LYS A CE    1 
ATOM   1109 N NZ    . LYS A 1 135 ? -2.949  35.145  -7.601  1.00 89.42  ? 187 LYS A NZ    1 
ATOM   1110 N N     . ALA A 1 136 ? -1.367  27.364  -8.705  1.00 46.73  ? 188 ALA A N     1 
ATOM   1111 C CA    . ALA A 1 136 ? -2.194  26.171  -8.510  1.00 43.20  ? 188 ALA A CA    1 
ATOM   1112 C C     . ALA A 1 136 ? -3.111  26.343  -7.298  1.00 51.88  ? 188 ALA A C     1 
ATOM   1113 O O     . ALA A 1 136 ? -4.233  25.821  -7.253  1.00 51.17  ? 188 ALA A O     1 
ATOM   1114 C CB    . ALA A 1 136 ? -1.336  24.955  -8.346  1.00 46.15  ? 188 ALA A CB    1 
ATOM   1115 N N     . THR A 1 147 ? -6.478  33.640  -15.937 1.00 88.13  ? 199 THR A N     1 
ATOM   1116 C CA    . THR A 1 147 ? -6.830  34.948  -15.394 1.00 92.86  ? 199 THR A CA    1 
ATOM   1117 C C     . THR A 1 147 ? -5.522  35.759  -15.315 1.00 98.66  ? 199 THR A C     1 
ATOM   1118 O O     . THR A 1 147 ? -5.491  36.961  -15.686 1.00 102.68 ? 199 THR A O     1 
ATOM   1119 C CB    . THR A 1 147 ? -7.475  34.834  -14.007 1.00 89.84  ? 199 THR A CB    1 
ATOM   1120 O OG1   . THR A 1 147 ? -8.882  34.639  -14.137 1.00 94.55  ? 199 THR A OG1   1 
ATOM   1121 C CG2   . THR A 1 147 ? -7.248  36.088  -13.161 1.00 91.27  ? 199 THR A CG2   1 
ATOM   1122 N N     . ALA A 1 148 ? -4.425  35.060  -14.977 1.00 98.68  ? 200 ALA A N     1 
ATOM   1123 C CA    . ALA A 1 148 ? -3.317  35.694  -14.255 1.00 105.36 ? 200 ALA A CA    1 
ATOM   1124 C C     . ALA A 1 148 ? -1.884  35.227  -14.551 1.00 100.22 ? 200 ALA A C     1 
ATOM   1125 O O     . ALA A 1 148 ? -0.944  35.864  -14.086 1.00 96.08  ? 200 ALA A O     1 
ATOM   1126 C CB    . ALA A 1 148 ? -3.577  35.540  -12.745 1.00 97.96  ? 200 ALA A CB    1 
ATOM   1127 N N     . PHE A 1 149 ? -1.667  34.126  -15.268 1.00 91.12  ? 201 PHE A N     1 
ATOM   1128 C CA    . PHE A 1 149 ? -0.282  33.630  -15.270 1.00 88.81  ? 201 PHE A CA    1 
ATOM   1129 C C     . PHE A 1 149 ? 0.605   34.451  -16.216 1.00 89.88  ? 201 PHE A C     1 
ATOM   1130 O O     . PHE A 1 149 ? 0.230   34.742  -17.368 1.00 92.00  ? 201 PHE A O     1 
ATOM   1131 C CB    . PHE A 1 149 ? -0.186  32.105  -15.545 1.00 84.21  ? 201 PHE A CB    1 
ATOM   1132 C CG    . PHE A 1 149 ? -0.718  31.619  -16.881 1.00 85.59  ? 201 PHE A CG    1 
ATOM   1133 C CD1   . PHE A 1 149 ? 0.119   31.505  -17.986 1.00 82.10  ? 201 PHE A CD1   1 
ATOM   1134 C CD2   . PHE A 1 149 ? -2.020  31.164  -16.996 1.00 82.96  ? 201 PHE A CD2   1 
ATOM   1135 C CE1   . PHE A 1 149 ? -0.345  31.005  -19.190 1.00 74.72  ? 201 PHE A CE1   1 
ATOM   1136 C CE2   . PHE A 1 149 ? -2.484  30.672  -18.197 1.00 83.91  ? 201 PHE A CE2   1 
ATOM   1137 C CZ    . PHE A 1 149 ? -1.639  30.599  -19.296 1.00 82.03  ? 201 PHE A CZ    1 
ATOM   1138 N N     . CYS A 1 150 ? 1.734   34.902  -15.657 1.00 83.63  ? 202 CYS A N     1 
ATOM   1139 C CA    . CYS A 1 150 ? 2.634   35.831  -16.329 1.00 81.14  ? 202 CYS A CA    1 
ATOM   1140 C C     . CYS A 1 150 ? 3.748   35.110  -17.069 1.00 68.74  ? 202 CYS A C     1 
ATOM   1141 O O     . CYS A 1 150 ? 4.119   33.984  -16.752 1.00 63.59  ? 202 CYS A O     1 
ATOM   1142 C CB    . CYS A 1 150 ? 3.242   36.790  -15.330 1.00 71.24  ? 202 CYS A CB    1 
ATOM   1143 S SG    . CYS A 1 150 ? 4.210   35.887  -14.180 1.00 79.60  ? 202 CYS A SG    1 
ATOM   1144 N N     . THR A 1 151 ? 4.297   35.801  -18.047 1.00 69.88  ? 203 THR A N     1 
ATOM   1145 C CA    . THR A 1 151 ? 5.171   35.191  -19.017 1.00 63.27  ? 203 THR A CA    1 
ATOM   1146 C C     . THR A 1 151 ? 6.376   36.090  -19.211 1.00 62.01  ? 203 THR A C     1 
ATOM   1147 O O     . THR A 1 151 ? 6.225   37.296  -19.379 1.00 63.97  ? 203 THR A O     1 
ATOM   1148 C CB    . THR A 1 151 ? 4.438   34.988  -20.358 1.00 63.68  ? 203 THR A CB    1 
ATOM   1149 O OG1   . THR A 1 151 ? 3.335   34.084  -20.184 1.00 65.00  ? 203 THR A OG1   1 
ATOM   1150 C CG2   . THR A 1 151 ? 5.379   34.437  -21.390 1.00 65.26  ? 203 THR A CG2   1 
ATOM   1151 N N     . HIS A 1 152 ? 7.572   35.519  -19.174 1.00 58.53  ? 204 HIS A N     1 
ATOM   1152 C CA    . HIS A 1 152 ? 8.760   36.317  -19.424 1.00 61.59  ? 204 HIS A CA    1 
ATOM   1153 C C     . HIS A 1 152 ? 9.540   35.781  -20.613 1.00 59.63  ? 204 HIS A C     1 
ATOM   1154 O O     . HIS A 1 152 ? 9.697   34.575  -20.785 1.00 60.28  ? 204 HIS A O     1 
ATOM   1155 C CB    . HIS A 1 152 ? 9.629   36.382  -18.171 1.00 61.17  ? 204 HIS A CB    1 
ATOM   1156 C CG    . HIS A 1 152 ? 8.866   36.787  -16.949 1.00 71.44  ? 204 HIS A CG    1 
ATOM   1157 N ND1   . HIS A 1 152 ? 8.454   38.083  -16.725 1.00 78.04  ? 204 HIS A ND1   1 
ATOM   1158 C CD2   . HIS A 1 152 ? 8.411   36.060  -15.899 1.00 75.56  ? 204 HIS A CD2   1 
ATOM   1159 C CE1   . HIS A 1 152 ? 7.788   38.141  -15.582 1.00 79.65  ? 204 HIS A CE1   1 
ATOM   1160 N NE2   . HIS A 1 152 ? 7.748   36.927  -15.062 1.00 78.35  ? 204 HIS A NE2   1 
ATOM   1161 N N     . VAL A 1 153 ? 10.001  36.693  -21.454 1.00 53.67  ? 205 VAL A N     1 
ATOM   1162 C CA    . VAL A 1 153 ? 10.769  36.314  -22.619 1.00 52.07  ? 205 VAL A CA    1 
ATOM   1163 C C     . VAL A 1 153 ? 12.143  36.946  -22.535 1.00 59.83  ? 205 VAL A C     1 
ATOM   1164 O O     . VAL A 1 153 ? 12.272  38.126  -22.223 1.00 62.23  ? 205 VAL A O     1 
ATOM   1165 C CB    . VAL A 1 153 ? 10.087  36.753  -23.920 1.00 49.54  ? 205 VAL A CB    1 
ATOM   1166 C CG1   . VAL A 1 153 ? 10.868  36.274  -25.115 1.00 45.57  ? 205 VAL A CG1   1 
ATOM   1167 C CG2   . VAL A 1 153 ? 8.664   36.230  -23.970 1.00 53.96  ? 205 VAL A CG2   1 
ATOM   1168 N N     . PHE A 1 154 ? 13.178  36.156  -22.786 1.00 60.20  ? 206 PHE A N     1 
ATOM   1169 C CA    . PHE A 1 154 ? 14.506  36.721  -22.934 1.00 56.87  ? 206 PHE A CA    1 
ATOM   1170 C C     . PHE A 1 154 ? 14.945  36.528  -24.378 1.00 58.09  ? 206 PHE A C     1 
ATOM   1171 O O     . PHE A 1 154 ? 15.370  35.442  -24.770 1.00 58.41  ? 206 PHE A O     1 
ATOM   1172 C CB    . PHE A 1 154 ? 15.488  36.090  -21.952 1.00 53.10  ? 206 PHE A CB    1 
ATOM   1173 C CG    . PHE A 1 154 ? 15.124  36.327  -20.526 1.00 56.45  ? 206 PHE A CG    1 
ATOM   1174 C CD1   . PHE A 1 154 ? 15.013  37.618  -20.040 1.00 58.75  ? 206 PHE A CD1   1 
ATOM   1175 C CD2   . PHE A 1 154 ? 14.862  35.268  -19.676 1.00 55.90  ? 206 PHE A CD2   1 
ATOM   1176 C CE1   . PHE A 1 154 ? 14.666  37.852  -18.731 1.00 54.79  ? 206 PHE A CE1   1 
ATOM   1177 C CE2   . PHE A 1 154 ? 14.513  35.492  -18.366 1.00 55.46  ? 206 PHE A CE2   1 
ATOM   1178 C CZ    . PHE A 1 154 ? 14.411  36.787  -17.893 1.00 57.22  ? 206 PHE A CZ    1 
ATOM   1179 N N     . PRO A 1 155 ? 14.807  37.592  -25.176 1.00 55.78  ? 207 PRO A N     1 
ATOM   1180 C CA    . PRO A 1 155 ? 15.204  37.692  -26.576 1.00 51.91  ? 207 PRO A CA    1 
ATOM   1181 C C     . PRO A 1 155 ? 16.454  36.907  -26.916 1.00 53.48  ? 207 PRO A C     1 
ATOM   1182 O O     . PRO A 1 155 ? 16.505  36.297  -27.981 1.00 56.67  ? 207 PRO A O     1 
ATOM   1183 C CB    . PRO A 1 155 ? 15.450  39.186  -26.739 1.00 59.83  ? 207 PRO A CB    1 
ATOM   1184 C CG    . PRO A 1 155 ? 14.417  39.813  -25.835 1.00 56.70  ? 207 PRO A CG    1 
ATOM   1185 C CD    . PRO A 1 155 ? 14.192  38.845  -24.696 1.00 55.36  ? 207 PRO A CD    1 
ATOM   1186 N N     . GLU A 1 156 ? 17.442  36.913  -26.028 1.00 53.24  ? 208 GLU A N     1 
ATOM   1187 C CA    . GLU A 1 156 ? 18.738  36.313  -26.342 1.00 55.28  ? 208 GLU A CA    1 
ATOM   1188 C C     . GLU A 1 156 ? 18.710  34.795  -26.264 1.00 56.65  ? 208 GLU A C     1 
ATOM   1189 O O     . GLU A 1 156 ? 19.681  34.130  -26.658 1.00 57.03  ? 208 GLU A O     1 
ATOM   1190 C CB    . GLU A 1 156 ? 19.829  36.856  -25.419 1.00 50.62  ? 208 GLU A CB    1 
ATOM   1191 C CG    . GLU A 1 156 ? 19.515  36.759  -23.957 1.00 51.35  ? 208 GLU A CG    1 
ATOM   1192 C CD    . GLU A 1 156 ? 18.668  37.912  -23.455 1.00 58.18  ? 208 GLU A CD    1 
ATOM   1193 O OE1   . GLU A 1 156 ? 18.980  38.468  -22.369 1.00 61.44  ? 208 GLU A OE1   1 
ATOM   1194 O OE2   . GLU A 1 156 ? 17.680  38.257  -24.142 1.00 58.92  ? 208 GLU A OE2   1 
ATOM   1195 N N     . THR A 1 157 ? 17.598  34.251  -25.772 1.00 52.22  ? 209 THR A N     1 
ATOM   1196 C CA    . THR A 1 157 ? 17.406  32.806  -25.753 1.00 49.06  ? 209 THR A CA    1 
ATOM   1197 C C     . THR A 1 157 ? 16.774  32.265  -27.030 1.00 49.70  ? 209 THR A C     1 
ATOM   1198 O O     . THR A 1 157 ? 16.526  31.068  -27.110 1.00 51.90  ? 209 THR A O     1 
ATOM   1199 C CB    . THR A 1 157 ? 16.524  32.350  -24.571 1.00 49.54  ? 209 THR A CB    1 
ATOM   1200 O OG1   . THR A 1 157 ? 15.349  33.161  -24.501 1.00 53.52  ? 209 THR A OG1   1 
ATOM   1201 C CG2   . THR A 1 157 ? 17.270  32.469  -23.268 1.00 53.58  ? 209 THR A CG2   1 
ATOM   1202 N N     . ALA A 1 158 ? 16.510  33.124  -28.018 1.00 50.61  ? 210 ALA A N     1 
ATOM   1203 C CA    . ALA A 1 158 ? 15.917  32.676  -29.291 1.00 44.60  ? 210 ALA A CA    1 
ATOM   1204 C C     . ALA A 1 158 ? 16.925  31.859  -30.063 1.00 42.23  ? 210 ALA A C     1 
ATOM   1205 O O     . ALA A 1 158 ? 18.118  32.141  -30.019 1.00 49.11  ? 210 ALA A O     1 
ATOM   1206 C CB    . ALA A 1 158 ? 15.444  33.846  -30.124 1.00 38.81  ? 210 ALA A CB    1 
ATOM   1207 N N     . PHE A 1 159 ? 16.466  30.835  -30.762 1.00 39.57  ? 211 PHE A N     1 
ATOM   1208 C CA    . PHE A 1 159 ? 17.408  29.965  -31.450 1.00 41.67  ? 211 PHE A CA    1 
ATOM   1209 C C     . PHE A 1 159 ? 16.799  29.393  -32.703 1.00 42.90  ? 211 PHE A C     1 
ATOM   1210 O O     . PHE A 1 159 ? 15.623  29.601  -32.972 1.00 45.62  ? 211 PHE A O     1 
ATOM   1211 C CB    . PHE A 1 159 ? 17.871  28.829  -30.529 1.00 47.04  ? 211 PHE A CB    1 
ATOM   1212 C CG    . PHE A 1 159 ? 16.782  27.837  -30.168 1.00 44.49  ? 211 PHE A CG    1 
ATOM   1213 C CD1   . PHE A 1 159 ? 16.578  26.693  -30.934 1.00 40.99  ? 211 PHE A CD1   1 
ATOM   1214 C CD2   . PHE A 1 159 ? 15.973  28.045  -29.061 1.00 43.95  ? 211 PHE A CD2   1 
ATOM   1215 C CE1   . PHE A 1 159 ? 15.585  25.777  -30.594 1.00 40.03  ? 211 PHE A CE1   1 
ATOM   1216 C CE2   . PHE A 1 159 ? 14.979  27.139  -28.724 1.00 43.54  ? 211 PHE A CE2   1 
ATOM   1217 C CZ    . PHE A 1 159 ? 14.780  26.006  -29.497 1.00 38.31  ? 211 PHE A CZ    1 
ATOM   1218 N N     . ILE A 1 160 ? 17.609  28.663  -33.456 1.00 38.67  ? 212 ILE A N     1 
ATOM   1219 C CA    . ILE A 1 160 ? 17.174  28.030  -34.685 1.00 40.87  ? 212 ILE A CA    1 
ATOM   1220 C C     . ILE A 1 160 ? 17.305  26.515  -34.515 1.00 45.12  ? 212 ILE A C     1 
ATOM   1221 O O     . ILE A 1 160 ? 18.390  26.015  -34.196 1.00 41.38  ? 212 ILE A O     1 
ATOM   1222 C CB    . ILE A 1 160 ? 18.009  28.532  -35.882 1.00 43.21  ? 212 ILE A CB    1 
ATOM   1223 C CG1   . ILE A 1 160 ? 18.170  30.063  -35.787 1.00 51.69  ? 212 ILE A CG1   1 
ATOM   1224 C CG2   . ILE A 1 160 ? 17.378  28.092  -37.201 1.00 42.60  ? 212 ILE A CG2   1 
ATOM   1225 C CD1   . ILE A 1 160 ? 19.480  30.662  -36.356 1.00 49.44  ? 212 ILE A CD1   1 
ATOM   1226 N N     . ALA A 1 161 ? 16.210  25.777  -34.692 1.00 40.66  ? 213 ALA A N     1 
ATOM   1227 C CA    . ALA A 1 161 ? 16.293  24.332  -34.515 1.00 37.35  ? 213 ALA A CA    1 
ATOM   1228 C C     . ALA A 1 161 ? 17.005  23.698  -35.704 1.00 39.08  ? 213 ALA A C     1 
ATOM   1229 O O     . ALA A 1 161 ? 16.692  24.001  -36.844 1.00 42.76  ? 213 ALA A O     1 
ATOM   1230 C CB    . ALA A 1 161 ? 14.933  23.745  -34.336 1.00 34.66  ? 213 ALA A CB    1 
ATOM   1231 N N     . VAL A 1 162 ? 17.986  22.848  -35.452 1.00 36.05  ? 214 VAL A N     1 
ATOM   1232 C CA    . VAL A 1 162 ? 18.683  22.207  -36.553 1.00 42.00  ? 214 VAL A CA    1 
ATOM   1233 C C     . VAL A 1 162 ? 18.824  20.734  -36.278 1.00 41.82  ? 214 VAL A C     1 
ATOM   1234 O O     . VAL A 1 162 ? 18.668  20.296  -35.153 1.00 43.72  ? 214 VAL A O     1 
ATOM   1235 C CB    . VAL A 1 162 ? 20.097  22.790  -36.792 1.00 43.40  ? 214 VAL A CB    1 
ATOM   1236 C CG1   . VAL A 1 162 ? 20.045  24.268  -37.170 1.00 41.84  ? 214 VAL A CG1   1 
ATOM   1237 C CG2   . VAL A 1 162 ? 20.940  22.593  -35.580 1.00 45.58  ? 214 VAL A CG2   1 
ATOM   1238 N N     . THR A 1 163 ? 19.138  19.966  -37.306 1.00 43.41  ? 215 THR A N     1 
ATOM   1239 C CA    . THR A 1 163 ? 19.280  18.531  -37.140 1.00 46.62  ? 215 THR A CA    1 
ATOM   1240 C C     . THR A 1 163 ? 20.748  18.188  -36.971 1.00 48.85  ? 215 THR A C     1 
ATOM   1241 O O     . THR A 1 163 ? 21.119  17.126  -36.456 1.00 48.20  ? 215 THR A O     1 
ATOM   1242 C CB    . THR A 1 163 ? 18.645  17.800  -38.318 1.00 50.10  ? 215 THR A CB    1 
ATOM   1243 O OG1   . THR A 1 163 ? 17.255  18.127  -38.351 1.00 59.56  ? 215 THR A OG1   1 
ATOM   1244 C CG2   . THR A 1 163 ? 18.776  16.308  -38.209 1.00 53.17  ? 215 THR A CG2   1 
ATOM   1245 N N     . SER A 1 164 ? 21.580  19.140  -37.363 1.00 47.21  ? 216 SER A N     1 
ATOM   1246 C CA    . SER A 1 164 ? 23.011  19.056  -37.162 1.00 45.29  ? 216 SER A CA    1 
ATOM   1247 C C     . SER A 1 164 ? 23.536  20.460  -37.310 1.00 48.11  ? 216 SER A C     1 
ATOM   1248 O O     . SER A 1 164 ? 22.950  21.270  -38.032 1.00 45.69  ? 216 SER A O     1 
ATOM   1249 C CB    . SER A 1 164 ? 23.671  18.143  -38.172 1.00 40.64  ? 216 SER A CB    1 
ATOM   1250 O OG    . SER A 1 164 ? 24.032  18.913  -39.291 1.00 41.96  ? 216 SER A OG    1 
ATOM   1251 N N     . TYR A 1 165 ? 24.632  20.763  -36.629 1.00 50.24  ? 217 TYR A N     1 
ATOM   1252 C CA    . TYR A 1 165 ? 25.135  22.124  -36.672 1.00 50.61  ? 217 TYR A CA    1 
ATOM   1253 C C     . TYR A 1 165 ? 25.523  22.546  -38.097 1.00 50.33  ? 217 TYR A C     1 
ATOM   1254 O O     . TYR A 1 165 ? 26.130  21.780  -38.862 1.00 45.02  ? 217 TYR A O     1 
ATOM   1255 C CB    . TYR A 1 165 ? 26.312  22.288  -35.718 1.00 45.72  ? 217 TYR A CB    1 
ATOM   1256 C CG    . TYR A 1 165 ? 25.928  22.202  -34.264 1.00 46.38  ? 217 TYR A CG    1 
ATOM   1257 C CD1   . TYR A 1 165 ? 25.133  23.182  -33.676 1.00 46.08  ? 217 TYR A CD1   1 
ATOM   1258 C CD2   . TYR A 1 165 ? 26.383  21.155  -33.463 1.00 47.83  ? 217 TYR A CD2   1 
ATOM   1259 C CE1   . TYR A 1 165 ? 24.784  23.113  -32.325 1.00 45.96  ? 217 TYR A CE1   1 
ATOM   1260 C CE2   . TYR A 1 165 ? 26.042  21.079  -32.118 1.00 46.29  ? 217 TYR A CE2   1 
ATOM   1261 C CZ    . TYR A 1 165 ? 25.245  22.060  -31.557 1.00 46.45  ? 217 TYR A CZ    1 
ATOM   1262 O OH    . TYR A 1 165 ? 24.907  21.983  -30.232 1.00 43.52  ? 217 TYR A OH    1 
ATOM   1263 N N     . GLN A 1 166 ? 25.119  23.766  -38.445 1.00 54.33  ? 218 GLN A N     1 
ATOM   1264 C CA    . GLN A 1 166 ? 25.469  24.383  -39.721 1.00 59.81  ? 218 GLN A CA    1 
ATOM   1265 C C     . GLN A 1 166 ? 26.698  25.283  -39.538 1.00 61.73  ? 218 GLN A C     1 
ATOM   1266 O O     . GLN A 1 166 ? 27.811  24.945  -39.969 1.00 62.78  ? 218 GLN A O     1 
ATOM   1267 C CB    . GLN A 1 166 ? 24.281  25.185  -40.276 1.00 53.99  ? 218 GLN A CB    1 
ATOM   1268 C CG    . GLN A 1 166 ? 22.977  24.388  -40.355 1.00 50.73  ? 218 GLN A CG    1 
ATOM   1269 C CD    . GLN A 1 166 ? 22.970  23.353  -41.473 1.00 48.10  ? 218 GLN A CD    1 
ATOM   1270 O OE1   . GLN A 1 166 ? 22.796  23.693  -42.640 1.00 55.53  ? 218 GLN A OE1   1 
ATOM   1271 N NE2   . GLN A 1 166 ? 23.143  22.087  -41.117 1.00 43.70  ? 218 GLN A NE2   1 
ATOM   1272 N N     . ASN A 1 167 ? 26.491  26.421  -38.884 1.00 57.29  ? 219 ASN A N     1 
ATOM   1273 C CA    . ASN A 1 167 ? 27.569  27.366  -38.650 1.00 58.55  ? 219 ASN A CA    1 
ATOM   1274 C C     . ASN A 1 167 ? 28.641  26.756  -37.763 1.00 56.27  ? 219 ASN A C     1 
ATOM   1275 O O     . ASN A 1 167 ? 28.430  26.604  -36.568 1.00 57.06  ? 219 ASN A O     1 
ATOM   1276 C CB    . ASN A 1 167 ? 27.012  28.644  -38.023 1.00 59.03  ? 219 ASN A CB    1 
ATOM   1277 C CG    . ASN A 1 167 ? 28.016  29.770  -38.011 1.00 61.15  ? 219 ASN A CG    1 
ATOM   1278 O OD1   . ASN A 1 167 ? 29.146  29.610  -38.480 1.00 60.77  ? 219 ASN A OD1   1 
ATOM   1279 N ND2   . ASN A 1 167 ? 27.604  30.930  -37.493 1.00 59.29  ? 219 ASN A ND2   1 
ATOM   1280 N N     . HIS A 1 168 ? 29.787  26.403  -38.343 1.00 60.24  ? 220 HIS A N     1 
ATOM   1281 C CA    . HIS A 1 168 ? 30.821  25.691  -37.585 1.00 60.75  ? 220 HIS A CA    1 
ATOM   1282 C C     . HIS A 1 168 ? 31.344  26.527  -36.420 1.00 58.34  ? 220 HIS A C     1 
ATOM   1283 O O     . HIS A 1 168 ? 31.943  25.998  -35.482 1.00 59.62  ? 220 HIS A O     1 
ATOM   1284 C CB    . HIS A 1 168 ? 31.989  25.266  -38.486 1.00 61.57  ? 220 HIS A CB    1 
ATOM   1285 C CG    . HIS A 1 168 ? 32.901  24.257  -37.852 1.00 71.30  ? 220 HIS A CG    1 
ATOM   1286 N ND1   . HIS A 1 168 ? 33.907  24.606  -36.970 1.00 78.83  ? 220 HIS A ND1   1 
ATOM   1287 C CD2   . HIS A 1 168 ? 32.950  22.906  -37.957 1.00 75.54  ? 220 HIS A CD2   1 
ATOM   1288 C CE1   . HIS A 1 168 ? 34.536  23.517  -36.562 1.00 73.96  ? 220 HIS A CE1   1 
ATOM   1289 N NE2   . HIS A 1 168 ? 33.977  22.471  -37.147 1.00 78.45  ? 220 HIS A NE2   1 
ATOM   1290 N N     . LYS A 1 169 ? 31.113  27.830  -36.462 1.00 56.16  ? 221 LYS A N     1 
ATOM   1291 C CA    . LYS A 1 169 ? 31.506  28.648  -35.330 1.00 57.14  ? 221 LYS A CA    1 
ATOM   1292 C C     . LYS A 1 169 ? 30.787  28.134  -34.100 1.00 51.60  ? 221 LYS A C     1 
ATOM   1293 O O     . LYS A 1 169 ? 31.420  27.792  -33.119 1.00 55.80  ? 221 LYS A O     1 
ATOM   1294 C CB    . LYS A 1 169 ? 31.196  30.119  -35.569 1.00 61.48  ? 221 LYS A CB    1 
ATOM   1295 C CG    . LYS A 1 169 ? 32.225  31.041  -34.953 1.00 67.15  ? 221 LYS A CG    1 
ATOM   1296 C CD    . LYS A 1 169 ? 31.980  32.487  -35.345 1.00 75.07  ? 221 LYS A CD    1 
ATOM   1297 C CE    . LYS A 1 169 ? 32.179  32.717  -36.835 1.00 60.87  ? 221 LYS A CE    1 
ATOM   1298 N NZ    . LYS A 1 169 ? 32.458  34.157  -37.046 1.00 63.57  ? 221 LYS A NZ    1 
ATOM   1299 N N     . ILE A 1 170 ? 29.464  28.035  -34.187 1.00 57.17  ? 222 ILE A N     1 
ATOM   1300 C CA    . ILE A 1 170 ? 28.624  27.488  -33.119 1.00 50.98  ? 222 ILE A CA    1 
ATOM   1301 C C     . ILE A 1 170 ? 29.139  26.150  -32.586 1.00 50.69  ? 222 ILE A C     1 
ATOM   1302 O O     . ILE A 1 170 ? 29.338  26.019  -31.378 1.00 50.92  ? 222 ILE A O     1 
ATOM   1303 C CB    . ILE A 1 170 ? 27.168  27.326  -33.593 1.00 45.19  ? 222 ILE A CB    1 
ATOM   1304 C CG1   . ILE A 1 170 ? 26.465  28.674  -33.577 1.00 49.06  ? 222 ILE A CG1   1 
ATOM   1305 C CG2   . ILE A 1 170 ? 26.409  26.410  -32.692 1.00 46.08  ? 222 ILE A CG2   1 
ATOM   1306 C CD1   . ILE A 1 170 ? 26.309  29.248  -32.192 1.00 47.17  ? 222 ILE A CD1   1 
ATOM   1307 N N     . THR A 1 171 ? 29.383  25.175  -33.465 1.00 48.60  ? 223 THR A N     1 
ATOM   1308 C CA    . THR A 1 171 ? 29.897  23.877  -33.017 1.00 49.39  ? 223 THR A CA    1 
ATOM   1309 C C     . THR A 1 171 ? 31.042  24.077  -32.034 1.00 50.93  ? 223 THR A C     1 
ATOM   1310 O O     . THR A 1 171 ? 30.978  23.599  -30.910 1.00 48.55  ? 223 THR A O     1 
ATOM   1311 C CB    . THR A 1 171 ? 30.394  22.993  -34.178 1.00 50.99  ? 223 THR A CB    1 
ATOM   1312 O OG1   . THR A 1 171 ? 29.501  23.097  -35.290 1.00 51.96  ? 223 THR A OG1   1 
ATOM   1313 C CG2   . THR A 1 171 ? 30.489  21.539  -33.736 1.00 42.81  ? 223 THR A CG2   1 
ATOM   1314 N N     . GLN A 1 172 ? 32.057  24.837  -32.440 1.00 54.35  ? 224 GLN A N     1 
ATOM   1315 C CA    . GLN A 1 172 ? 33.186  25.129  -31.558 1.00 56.09  ? 224 GLN A CA    1 
ATOM   1316 C C     . GLN A 1 172 ? 32.781  25.899  -30.296 1.00 57.31  ? 224 GLN A C     1 
ATOM   1317 O O     . GLN A 1 172 ? 33.404  25.741  -29.242 1.00 57.18  ? 224 GLN A O     1 
ATOM   1318 C CB    . GLN A 1 172 ? 34.270  25.913  -32.296 1.00 56.69  ? 224 GLN A CB    1 
ATOM   1319 C CG    . GLN A 1 172 ? 35.659  25.580  -31.785 1.00 63.78  ? 224 GLN A CG    1 
ATOM   1320 C CD    . GLN A 1 172 ? 36.017  24.116  -32.022 1.00 65.01  ? 224 GLN A CD    1 
ATOM   1321 O OE1   . GLN A 1 172 ? 35.638  23.532  -33.044 1.00 65.99  ? 224 GLN A OE1   1 
ATOM   1322 N NE2   . GLN A 1 172 ? 36.748  23.519  -31.081 1.00 57.95  ? 224 GLN A NE2   1 
ATOM   1323 N N     . LEU A 1 173 ? 31.742  26.721  -30.388 1.00 54.48  ? 225 LEU A N     1 
ATOM   1324 C CA    . LEU A 1 173 ? 31.286  27.455  -29.214 1.00 54.62  ? 225 LEU A CA    1 
ATOM   1325 C C     . LEU A 1 173 ? 30.666  26.465  -28.204 1.00 55.11  ? 225 LEU A C     1 
ATOM   1326 O O     . LEU A 1 173 ? 30.875  26.584  -26.984 1.00 48.02  ? 225 LEU A O     1 
ATOM   1327 C CB    . LEU A 1 173 ? 30.306  28.567  -29.626 1.00 50.73  ? 225 LEU A CB    1 
ATOM   1328 C CG    . LEU A 1 173 ? 29.995  29.722  -28.659 1.00 52.53  ? 225 LEU A CG    1 
ATOM   1329 C CD1   . LEU A 1 173 ? 31.165  30.034  -27.756 1.00 54.41  ? 225 LEU A CD1   1 
ATOM   1330 C CD2   . LEU A 1 173 ? 29.638  30.969  -29.444 1.00 51.67  ? 225 LEU A CD2   1 
ATOM   1331 N N     . LYS A 1 174 ? 29.939  25.469  -28.716 1.00 52.80  ? 226 LYS A N     1 
ATOM   1332 C CA    . LYS A 1 174 ? 29.371  24.438  -27.854 1.00 47.11  ? 226 LYS A CA    1 
ATOM   1333 C C     . LYS A 1 174 ? 30.485  23.621  -27.242 1.00 48.59  ? 226 LYS A C     1 
ATOM   1334 O O     . LYS A 1 174 ? 30.435  23.300  -26.063 1.00 51.28  ? 226 LYS A O     1 
ATOM   1335 C CB    . LYS A 1 174 ? 28.424  23.513  -28.609 1.00 42.80  ? 226 LYS A CB    1 
ATOM   1336 C CG    . LYS A 1 174 ? 27.304  24.212  -29.351 1.00 46.16  ? 226 LYS A CG    1 
ATOM   1337 C CD    . LYS A 1 174 ? 26.081  24.433  -28.497 1.00 48.69  ? 226 LYS A CD    1 
ATOM   1338 C CE    . LYS A 1 174 ? 24.897  24.940  -29.335 1.00 47.25  ? 226 LYS A CE    1 
ATOM   1339 N NZ    . LYS A 1 174 ? 23.563  24.641  -28.722 1.00 39.88  ? 226 LYS A NZ    1 
ATOM   1340 N N     . ILE A 1 175 ? 31.497  23.290  -28.037 1.00 47.70  ? 227 ILE A N     1 
ATOM   1341 C CA    . ILE A 1 175 ? 32.522  22.363  -27.582 1.00 47.99  ? 227 ILE A CA    1 
ATOM   1342 C C     . ILE A 1 175 ? 33.384  22.960  -26.476 1.00 54.44  ? 227 ILE A C     1 
ATOM   1343 O O     . ILE A 1 175 ? 33.717  22.281  -25.505 1.00 52.66  ? 227 ILE A O     1 
ATOM   1344 C CB    . ILE A 1 175 ? 33.417  21.906  -28.725 1.00 46.55  ? 227 ILE A CB    1 
ATOM   1345 C CG1   . ILE A 1 175 ? 32.662  20.917  -29.608 1.00 39.32  ? 227 ILE A CG1   1 
ATOM   1346 C CG2   . ILE A 1 175 ? 34.682  21.239  -28.177 1.00 48.58  ? 227 ILE A CG2   1 
ATOM   1347 C CD1   . ILE A 1 175 ? 33.343  20.630  -30.909 1.00 39.05  ? 227 ILE A CD1   1 
ATOM   1348 N N     . GLU A 1 176 ? 33.728  24.235  -26.591 1.00 56.72  ? 228 GLU A N     1 
ATOM   1349 C CA    . GLU A 1 176 ? 34.484  24.865  -25.512 1.00 56.76  ? 228 GLU A CA    1 
ATOM   1350 C C     . GLU A 1 176 ? 33.661  25.045  -24.228 1.00 51.00  ? 228 GLU A C     1 
ATOM   1351 O O     . GLU A 1 176 ? 34.223  25.045  -23.152 1.00 61.45  ? 228 GLU A O     1 
ATOM   1352 C CB    . GLU A 1 176 ? 35.062  26.222  -25.955 1.00 60.91  ? 228 GLU A CB    1 
ATOM   1353 C CG    . GLU A 1 176 ? 36.239  26.117  -26.955 1.00 70.70  ? 228 GLU A CG    1 
ATOM   1354 C CD    . GLU A 1 176 ? 37.510  26.865  -26.491 1.00 90.09  ? 228 GLU A CD    1 
ATOM   1355 O OE1   . GLU A 1 176 ? 37.592  28.107  -26.654 1.00 86.79  ? 228 GLU A OE1   1 
ATOM   1356 O OE2   . GLU A 1 176 ? 38.435  26.203  -25.958 1.00 90.87  ? 228 GLU A OE2   1 
ATOM   1357 N N     . ASN A 1 177 ? 32.342  25.161  -24.312 1.00 51.75  ? 229 ASN A N     1 
ATOM   1358 C CA    . ASN A 1 177 ? 31.551  25.537  -23.135 1.00 50.81  ? 229 ASN A CA    1 
ATOM   1359 C C     . ASN A 1 177 ? 30.640  24.449  -22.541 1.00 46.85  ? 229 ASN A C     1 
ATOM   1360 O O     . ASN A 1 177 ? 30.125  24.612  -21.438 1.00 41.30  ? 229 ASN A O     1 
ATOM   1361 C CB    . ASN A 1 177 ? 30.688  26.761  -23.467 1.00 51.44  ? 229 ASN A CB    1 
ATOM   1362 C CG    . ASN A 1 177 ? 31.475  28.060  -23.460 1.00 52.04  ? 229 ASN A CG    1 
ATOM   1363 O OD1   . ASN A 1 177 ? 32.141  28.406  -24.437 1.00 56.37  ? 229 ASN A OD1   1 
ATOM   1364 N ND2   . ASN A 1 177 ? 31.379  28.800  -22.365 1.00 50.91  ? 229 ASN A ND2   1 
ATOM   1365 N N     . ASN A 1 178 ? 30.416  23.359  -23.267 1.00 47.84  ? 230 ASN A N     1 
ATOM   1366 C CA    . ASN A 1 178 ? 29.534  22.314  -22.762 1.00 45.96  ? 230 ASN A CA    1 
ATOM   1367 C C     . ASN A 1 178 ? 30.346  21.142  -22.285 1.00 46.46  ? 230 ASN A C     1 
ATOM   1368 O O     . ASN A 1 178 ? 30.881  20.384  -23.093 1.00 46.59  ? 230 ASN A O     1 
ATOM   1369 C CB    . ASN A 1 178 ? 28.517  21.857  -23.815 1.00 46.47  ? 230 ASN A CB    1 
ATOM   1370 C CG    . ASN A 1 178 ? 27.533  20.808  -23.272 1.00 47.06  ? 230 ASN A CG    1 
ATOM   1371 O OD1   . ASN A 1 178 ? 27.629  20.393  -22.118 1.00 52.08  ? 230 ASN A OD1   1 
ATOM   1372 N ND2   . ASN A 1 178 ? 26.575  20.399  -24.095 1.00 41.29  ? 230 ASN A ND2   1 
ATOM   1373 N N     . PRO A 1 179 ? 30.405  20.984  -20.954 1.00 48.51  ? 231 PRO A N     1 
ATOM   1374 C CA    . PRO A 1 179 ? 31.221  20.014  -20.220 1.00 45.06  ? 231 PRO A CA    1 
ATOM   1375 C C     . PRO A 1 179 ? 31.083  18.594  -20.754 1.00 45.86  ? 231 PRO A C     1 
ATOM   1376 O O     . PRO A 1 179 ? 32.049  17.842  -20.713 1.00 49.27  ? 231 PRO A O     1 
ATOM   1377 C CB    . PRO A 1 179 ? 30.679  20.121  -18.802 1.00 41.71  ? 231 PRO A CB    1 
ATOM   1378 C CG    . PRO A 1 179 ? 30.161  21.516  -18.704 1.00 37.98  ? 231 PRO A CG    1 
ATOM   1379 C CD    . PRO A 1 179 ? 29.586  21.811  -20.046 1.00 44.88  ? 231 PRO A CD    1 
ATOM   1380 N N     . PHE A 1 180 ? 29.914  18.226  -21.259 1.00 41.56  ? 232 PHE A N     1 
ATOM   1381 C CA    . PHE A 1 180 ? 29.752  16.882  -21.791 1.00 42.81  ? 232 PHE A CA    1 
ATOM   1382 C C     . PHE A 1 180 ? 30.489  16.708  -23.104 1.00 47.24  ? 232 PHE A C     1 
ATOM   1383 O O     . PHE A 1 180 ? 30.714  15.590  -23.556 1.00 49.65  ? 232 PHE A O     1 
ATOM   1384 C CB    . PHE A 1 180 ? 28.289  16.548  -21.996 1.00 39.71  ? 232 PHE A CB    1 
ATOM   1385 C CG    . PHE A 1 180 ? 27.532  16.344  -20.732 1.00 40.10  ? 232 PHE A CG    1 
ATOM   1386 C CD1   . PHE A 1 180 ? 27.436  15.089  -20.168 1.00 45.30  ? 232 PHE A CD1   1 
ATOM   1387 C CD2   . PHE A 1 180 ? 26.887  17.397  -20.116 1.00 41.09  ? 232 PHE A CD2   1 
ATOM   1388 C CE1   . PHE A 1 180 ? 26.709  14.885  -18.998 1.00 44.55  ? 232 PHE A CE1   1 
ATOM   1389 C CE2   . PHE A 1 180 ? 26.164  17.200  -18.948 1.00 44.10  ? 232 PHE A CE2   1 
ATOM   1390 C CZ    . PHE A 1 180 ? 26.073  15.944  -18.394 1.00 41.67  ? 232 PHE A CZ    1 
ATOM   1391 N N     . ALA A 1 181 ? 30.862  17.817  -23.723 1.00 46.83  ? 233 ALA A N     1 
ATOM   1392 C CA    . ALA A 1 181 ? 31.562  17.752  -24.996 1.00 49.73  ? 233 ALA A CA    1 
ATOM   1393 C C     . ALA A 1 181 ? 33.061  17.906  -24.821 1.00 54.68  ? 233 ALA A C     1 
ATOM   1394 O O     . ALA A 1 181 ? 33.726  18.456  -25.703 1.00 58.56  ? 233 ALA A O     1 
ATOM   1395 C CB    . ALA A 1 181 ? 31.054  18.828  -25.939 1.00 47.75  ? 233 ALA A CB    1 
ATOM   1396 N N     . LYS A 1 182 ? 33.621  17.450  -23.712 1.00 52.56  ? 234 LYS A N     1 
ATOM   1397 C CA    . LYS A 1 182 ? 34.967  17.918  -23.416 1.00 55.41  ? 234 LYS A CA    1 
ATOM   1398 C C     . LYS A 1 182 ? 35.992  17.124  -24.217 1.00 51.78  ? 234 LYS A C     1 
ATOM   1399 O O     . LYS A 1 182 ? 37.107  17.605  -24.410 1.00 53.04  ? 234 LYS A O     1 
ATOM   1400 C CB    . LYS A 1 182 ? 35.269  17.821  -21.934 1.00 55.13  ? 234 LYS A CB    1 
ATOM   1401 C CG    . LYS A 1 182 ? 36.543  18.511  -21.488 1.00 60.87  ? 234 LYS A CG    1 
ATOM   1402 C CD    . LYS A 1 182 ? 36.726  18.561  -19.969 1.00 69.66  ? 234 LYS A CD    1 
ATOM   1403 C CE    . LYS A 1 182 ? 35.489  19.110  -19.205 1.00 68.37  ? 234 LYS A CE    1 
ATOM   1404 N NZ    . LYS A 1 182 ? 35.476  18.725  -17.740 1.00 63.13  ? 234 LYS A NZ    1 
ATOM   1405 N N     . GLY A 1 183 ? 35.601  15.956  -24.751 1.00 49.53  ? 235 GLY A N     1 
ATOM   1406 C CA    . GLY A 1 183 ? 36.498  15.111  -25.542 1.00 48.18  ? 235 GLY A CA    1 
ATOM   1407 C C     . GLY A 1 183 ? 36.675  15.646  -26.944 1.00 50.72  ? 235 GLY A C     1 
ATOM   1408 O O     . GLY A 1 183 ? 37.032  14.908  -27.848 1.00 58.91  ? 235 GLY A O     1 
ATOM   1409 N N     . PHE A 1 184 ? 36.433  16.937  -27.125 1.00 48.53  ? 236 PHE A N     1 
ATOM   1410 C CA    . PHE A 1 184 ? 36.508  17.528  -28.444 1.00 52.08  ? 236 PHE A CA    1 
ATOM   1411 C C     . PHE A 1 184 ? 37.292  18.809  -28.395 1.00 57.18  ? 236 PHE A C     1 
ATOM   1412 O O     . PHE A 1 184 ? 37.521  19.450  -29.425 1.00 62.96  ? 236 PHE A O     1 
ATOM   1413 C CB    . PHE A 1 184 ? 35.117  17.806  -29.008 1.00 49.15  ? 236 PHE A CB    1 
ATOM   1414 C CG    . PHE A 1 184 ? 34.362  16.581  -29.361 1.00 45.55  ? 236 PHE A CG    1 
ATOM   1415 C CD1   . PHE A 1 184 ? 34.780  15.784  -30.408 1.00 50.46  ? 236 PHE A CD1   1 
ATOM   1416 C CD2   . PHE A 1 184 ? 33.227  16.225  -28.658 1.00 45.45  ? 236 PHE A CD2   1 
ATOM   1417 C CE1   . PHE A 1 184 ? 34.083  14.637  -30.758 1.00 48.87  ? 236 PHE A CE1   1 
ATOM   1418 C CE2   . PHE A 1 184 ? 32.522  15.078  -28.995 1.00 47.34  ? 236 PHE A CE2   1 
ATOM   1419 C CZ    . PHE A 1 184 ? 32.951  14.280  -30.055 1.00 45.24  ? 236 PHE A CZ    1 
ATOM   1420 N N     . ARG A 1 185 ? 37.685  19.200  -27.192 1.00 54.32  ? 237 ARG A N     1 
ATOM   1421 C CA    . ARG A 1 185 ? 38.441  20.429  -27.019 1.00 60.41  ? 237 ARG A CA    1 
ATOM   1422 C C     . ARG A 1 185 ? 39.886  20.219  -27.455 1.00 69.32  ? 237 ARG A C     1 
ATOM   1423 O O     . ARG A 1 185 ? 40.190  19.266  -28.171 1.00 67.12  ? 237 ARG A O     1 
ATOM   1424 C CB    . ARG A 1 185 ? 38.408  20.889  -25.558 1.00 59.17  ? 237 ARG A CB    1 
ATOM   1425 C CG    . ARG A 1 185 ? 37.188  21.683  -25.132 1.00 53.54  ? 237 ARG A CG    1 
ATOM   1426 C CD    . ARG A 1 185 ? 37.062  21.641  -23.625 1.00 59.67  ? 237 ARG A CD    1 
ATOM   1427 N NE    . ARG A 1 185 ? 36.037  22.511  -23.058 1.00 65.43  ? 237 ARG A NE    1 
ATOM   1428 C CZ    . ARG A 1 185 ? 34.773  22.124  -22.862 1.00 62.71  ? 237 ARG A CZ    1 
ATOM   1429 N NH1   . ARG A 1 185 ? 34.345  20.920  -23.277 1.00 59.33  ? 237 ARG A NH1   1 
ATOM   1430 N NH2   . ARG A 1 185 ? 33.897  22.960  -22.314 1.00 62.50  ? 237 ARG A NH2   1 
ATOM   1431 N N     . GLY A 1 186 ? 40.774  21.106  -27.008 1.00 78.76  ? 238 GLY A N     1 
ATOM   1432 C CA    . GLY A 1 186 ? 42.183  21.049  -27.371 1.00 80.78  ? 238 GLY A CA    1 
ATOM   1433 C C     . GLY A 1 186 ? 42.918  19.787  -26.937 1.00 88.15  ? 238 GLY A C     1 
ATOM   1434 O O     . GLY A 1 186 ? 44.152  19.714  -27.012 1.00 86.26  ? 238 GLY A O     1 
ATOM   1435 O OXT   . GLY A 1 186 ? 42.304  18.805  -26.497 1.00 89.54  ? 238 GLY A OXT   1 
ATOM   1436 N N     . ARG B 2 1   ? 26.844  -1.475  -8.221  1.00 72.71  ? 142 ARG B N     1 
ATOM   1437 C CA    . ARG B 2 1   ? 25.716  -0.821  -7.572  1.00 76.30  ? 142 ARG B CA    1 
ATOM   1438 C C     . ARG B 2 1   ? 24.375  -1.297  -8.120  1.00 77.54  ? 142 ARG B C     1 
ATOM   1439 O O     . ARG B 2 1   ? 24.235  -1.494  -9.327  1.00 69.29  ? 142 ARG B O     1 
ATOM   1440 C CB    . ARG B 2 1   ? 25.801  0.703   -7.726  1.00 66.97  ? 142 ARG B CB    1 
ATOM   1441 C CG    . ARG B 2 1   ? 24.521  1.388   -7.236  1.00 63.82  ? 142 ARG B CG    1 
ATOM   1442 C CD    . ARG B 2 1   ? 24.682  2.854   -6.961  1.00 50.72  ? 142 ARG B CD    1 
ATOM   1443 N NE    . ARG B 2 1   ? 24.688  3.648   -8.177  1.00 49.76  ? 142 ARG B NE    1 
ATOM   1444 C CZ    . ARG B 2 1   ? 25.028  4.929   -8.197  1.00 46.85  ? 142 ARG B CZ    1 
ATOM   1445 N NH1   . ARG B 2 1   ? 25.374  5.509   -7.064  1.00 46.30  ? 142 ARG B NH1   1 
ATOM   1446 N NH2   . ARG B 2 1   ? 25.016  5.636   -9.319  1.00 42.10  ? 142 ARG B NH2   1 
ATOM   1447 N N     . VAL B 2 2   ? 23.391  -1.478  -7.234  1.00 80.39  ? 143 VAL B N     1 
ATOM   1448 C CA    . VAL B 2 2   ? 22.007  -1.660  -7.673  1.00 78.38  ? 143 VAL B CA    1 
ATOM   1449 C C     . VAL B 2 2   ? 21.197  -0.383  -7.381  1.00 71.34  ? 143 VAL B C     1 
ATOM   1450 O O     . VAL B 2 2   ? 21.085  0.058   -6.227  1.00 60.47  ? 143 VAL B O     1 
ATOM   1451 C CB    . VAL B 2 2   ? 21.327  -2.875  -6.996  1.00 76.70  ? 143 VAL B CB    1 
ATOM   1452 C CG1   . VAL B 2 2   ? 19.854  -2.941  -7.397  1.00 78.01  ? 143 VAL B CG1   1 
ATOM   1453 C CG2   . VAL B 2 2   ? 22.038  -4.167  -7.362  1.00 75.37  ? 143 VAL B CG2   1 
ATOM   1454 N N     . LEU B 2 3   ? 20.654  0.219   -8.436  1.00 62.91  ? 144 LEU B N     1 
ATOM   1455 C CA    . LEU B 2 3   ? 19.869  1.432   -8.276  1.00 56.52  ? 144 LEU B CA    1 
ATOM   1456 C C     . LEU B 2 3   ? 18.448  1.093   -7.879  1.00 56.42  ? 144 LEU B C     1 
ATOM   1457 O O     . LEU B 2 3   ? 18.012  -0.054  -7.991  1.00 60.28  ? 144 LEU B O     1 
ATOM   1458 C CB    . LEU B 2 3   ? 19.865  2.251   -9.556  1.00 56.20  ? 144 LEU B CB    1 
ATOM   1459 C CG    . LEU B 2 3   ? 21.141  2.983   -9.959  1.00 56.57  ? 144 LEU B CG    1 
ATOM   1460 C CD1   . LEU B 2 3   ? 20.888  3.676   -11.278 1.00 54.97  ? 144 LEU B CD1   1 
ATOM   1461 C CD2   . LEU B 2 3   ? 21.574  3.995   -8.899  1.00 52.97  ? 144 LEU B CD2   1 
ATOM   1462 N N     . PHE B 2 4   ? 17.721  2.091   -7.408  1.00 50.27  ? 145 PHE B N     1 
ATOM   1463 C CA    . PHE B 2 4   ? 16.355  1.851   -6.994  1.00 50.54  ? 145 PHE B CA    1 
ATOM   1464 C C     . PHE B 2 4   ? 15.425  1.915   -8.206  1.00 55.54  ? 145 PHE B C     1 
ATOM   1465 O O     . PHE B 2 4   ? 15.682  2.636   -9.178  1.00 55.13  ? 145 PHE B O     1 
ATOM   1466 C CB    . PHE B 2 4   ? 15.930  2.857   -5.934  1.00 47.33  ? 145 PHE B CB    1 
ATOM   1467 C CG    . PHE B 2 4   ? 16.696  2.746   -4.663  1.00 47.82  ? 145 PHE B CG    1 
ATOM   1468 C CD1   . PHE B 2 4   ? 17.231  1.536   -4.271  1.00 52.14  ? 145 PHE B CD1   1 
ATOM   1469 C CD2   . PHE B 2 4   ? 16.888  3.853   -3.859  1.00 46.05  ? 145 PHE B CD2   1 
ATOM   1470 C CE1   . PHE B 2 4   ? 17.939  1.424   -3.098  1.00 48.60  ? 145 PHE B CE1   1 
ATOM   1471 C CE2   . PHE B 2 4   ? 17.592  3.751   -2.693  1.00 43.67  ? 145 PHE B CE2   1 
ATOM   1472 C CZ    . PHE B 2 4   ? 18.124  2.533   -2.312  1.00 48.08  ? 145 PHE B CZ    1 
ATOM   1473 N N     . SER B 2 5   ? 14.343  1.152   -8.142  1.00 52.82  ? 146 SER B N     1 
ATOM   1474 C CA    . SER B 2 5   ? 13.443  1.026   -9.267  1.00 47.47  ? 146 SER B CA    1 
ATOM   1475 C C     . SER B 2 5   ? 12.748  2.341   -9.546  1.00 49.34  ? 146 SER B C     1 
ATOM   1476 O O     . SER B 2 5   ? 12.670  3.207   -8.680  1.00 49.22  ? 146 SER B O     1 
ATOM   1477 C CB    . SER B 2 5   ? 12.411  -0.055  -8.992  1.00 50.37  ? 146 SER B CB    1 
ATOM   1478 O OG    . SER B 2 5   ? 11.515  0.376   -7.975  1.00 53.43  ? 146 SER B OG    1 
ATOM   1479 N N     . GLN B 2 6   ? 12.259  2.478   -10.771 1.00 54.37  ? 147 GLN B N     1 
ATOM   1480 C CA    . GLN B 2 6   ? 11.399  3.580   -11.171 1.00 53.85  ? 147 GLN B CA    1 
ATOM   1481 C C     . GLN B 2 6   ? 10.344  3.854   -10.102 1.00 53.18  ? 147 GLN B C     1 
ATOM   1482 O O     . GLN B 2 6   ? 10.210  4.980   -9.618  1.00 50.11  ? 147 GLN B O     1 
ATOM   1483 C CB    . GLN B 2 6   ? 10.751  3.242   -12.516 1.00 57.51  ? 147 GLN B CB    1 
ATOM   1484 C CG    . GLN B 2 6   ? 9.784   4.262   -13.077 1.00 61.16  ? 147 GLN B CG    1 
ATOM   1485 C CD    . GLN B 2 6   ? 10.461  5.501   -13.635 1.00 68.06  ? 147 GLN B CD    1 
ATOM   1486 O OE1   . GLN B 2 6   ? 11.652  5.752   -13.395 1.00 63.67  ? 147 GLN B OE1   1 
ATOM   1487 N NE2   . GLN B 2 6   ? 9.700   6.284   -14.402 1.00 64.44  ? 147 GLN B NE2   1 
ATOM   1488 N N     . ALA B 2 7   ? 9.624   2.794   -9.731  1.00 57.33  ? 148 ALA B N     1 
ATOM   1489 C CA    . ALA B 2 7   ? 8.621   2.812   -8.661  1.00 51.44  ? 148 ALA B CA    1 
ATOM   1490 C C     . ALA B 2 7   ? 9.114   3.507   -7.411  1.00 49.15  ? 148 ALA B C     1 
ATOM   1491 O O     . ALA B 2 7   ? 8.582   4.540   -7.023  1.00 50.03  ? 148 ALA B O     1 
ATOM   1492 C CB    . ALA B 2 7   ? 8.201   1.392   -8.313  1.00 50.06  ? 148 ALA B CB    1 
ATOM   1493 N N     . GLN B 2 8   ? 10.144  2.925   -6.800  1.00 51.94  ? 149 GLN B N     1 
ATOM   1494 C CA    . GLN B 2 8   ? 10.665  3.342   -5.490  1.00 48.21  ? 149 GLN B CA    1 
ATOM   1495 C C     . GLN B 2 8   ? 11.064  4.808   -5.403  1.00 46.78  ? 149 GLN B C     1 
ATOM   1496 O O     . GLN B 2 8   ? 10.631  5.520   -4.500  1.00 48.30  ? 149 GLN B O     1 
ATOM   1497 C CB    . GLN B 2 8   ? 11.864  2.473   -5.125  1.00 43.39  ? 149 GLN B CB    1 
ATOM   1498 C CG    . GLN B 2 8   ? 11.473  1.055   -4.860  1.00 46.83  ? 149 GLN B CG    1 
ATOM   1499 C CD    . GLN B 2 8   ? 12.605  0.090   -5.001  1.00 48.66  ? 149 GLN B CD    1 
ATOM   1500 O OE1   . GLN B 2 8   ? 13.669  0.428   -5.520  1.00 50.09  ? 149 GLN B OE1   1 
ATOM   1501 N NE2   . GLN B 2 8   ? 12.391  -1.130  -4.531  1.00 50.95  ? 149 GLN B NE2   1 
ATOM   1502 N N     . VAL B 2 9   ? 11.893  5.244   -6.343  1.00 43.27  ? 150 VAL B N     1 
ATOM   1503 C CA    . VAL B 2 9   ? 12.423  6.593   -6.339  1.00 41.23  ? 150 VAL B CA    1 
ATOM   1504 C C     . VAL B 2 9   ? 11.299  7.610   -6.373  1.00 42.90  ? 150 VAL B C     1 
ATOM   1505 O O     . VAL B 2 9   ? 11.333  8.609   -5.666  1.00 43.77  ? 150 VAL B O     1 
ATOM   1506 C CB    . VAL B 2 9   ? 13.374  6.819   -7.529  1.00 36.38  ? 150 VAL B CB    1 
ATOM   1507 C CG1   . VAL B 2 9   ? 13.964  8.210   -7.487  1.00 32.64  ? 150 VAL B CG1   1 
ATOM   1508 C CG2   . VAL B 2 9   ? 14.474  5.792   -7.511  1.00 39.10  ? 150 VAL B CG2   1 
ATOM   1509 N N     . TYR B 2 10  ? 10.288  7.336   -7.182  1.00 45.79  ? 151 TYR B N     1 
ATOM   1510 C CA    . TYR B 2 10  ? 9.131   8.215   -7.275  1.00 48.48  ? 151 TYR B CA    1 
ATOM   1511 C C     . TYR B 2 10  ? 8.414   8.327   -5.945  1.00 46.03  ? 151 TYR B C     1 
ATOM   1512 O O     . TYR B 2 10  ? 7.969   9.400   -5.550  1.00 48.16  ? 151 TYR B O     1 
ATOM   1513 C CB    . TYR B 2 10  ? 8.155   7.707   -8.331  1.00 50.02  ? 151 TYR B CB    1 
ATOM   1514 C CG    . TYR B 2 10  ? 6.895   8.526   -8.420  1.00 46.75  ? 151 TYR B CG    1 
ATOM   1515 C CD1   . TYR B 2 10  ? 6.784   9.533   -9.352  1.00 53.32  ? 151 TYR B CD1   1 
ATOM   1516 C CD2   . TYR B 2 10  ? 5.817   8.291   -7.579  1.00 49.19  ? 151 TYR B CD2   1 
ATOM   1517 C CE1   . TYR B 2 10  ? 5.644   10.287  -9.453  1.00 58.72  ? 151 TYR B CE1   1 
ATOM   1518 C CE2   . TYR B 2 10  ? 4.673   9.047   -7.662  1.00 57.47  ? 151 TYR B CE2   1 
ATOM   1519 C CZ    . TYR B 2 10  ? 4.590   10.046  -8.609  1.00 57.56  ? 151 TYR B CZ    1 
ATOM   1520 O OH    . TYR B 2 10  ? 3.456   10.814  -8.738  1.00 59.59  ? 151 TYR B OH    1 
ATOM   1521 N N     . GLU B 2 11  ? 8.280   7.193   -5.276  1.00 46.52  ? 152 GLU B N     1 
ATOM   1522 C CA    . GLU B 2 11  ? 7.561   7.145   -4.018  1.00 51.67  ? 152 GLU B CA    1 
ATOM   1523 C C     . GLU B 2 11  ? 8.354   7.780   -2.866  1.00 51.11  ? 152 GLU B C     1 
ATOM   1524 O O     . GLU B 2 11  ? 7.765   8.442   -2.006  1.00 51.92  ? 152 GLU B O     1 
ATOM   1525 C CB    . GLU B 2 11  ? 7.190   5.708   -3.673  1.00 50.65  ? 152 GLU B CB    1 
ATOM   1526 C CG    . GLU B 2 11  ? 6.230   5.635   -2.508  1.00 60.83  ? 152 GLU B CG    1 
ATOM   1527 C CD    . GLU B 2 11  ? 4.797   5.976   -2.884  1.00 69.05  ? 152 GLU B CD    1 
ATOM   1528 O OE1   . GLU B 2 11  ? 4.532   7.139   -3.268  1.00 68.95  ? 152 GLU B OE1   1 
ATOM   1529 O OE2   . GLU B 2 11  ? 3.931   5.074   -2.777  1.00 70.96  ? 152 GLU B OE2   1 
ATOM   1530 N N     . LEU B 2 12  ? 9.673   7.570   -2.849  1.00 44.06  ? 153 LEU B N     1 
ATOM   1531 C CA    . LEU B 2 12  ? 10.552  8.300   -1.952  1.00 40.24  ? 153 LEU B CA    1 
ATOM   1532 C C     . LEU B 2 12  ? 10.501  9.806   -2.212  1.00 44.42  ? 153 LEU B C     1 
ATOM   1533 O O     . LEU B 2 12  ? 10.471  10.598  -1.279  1.00 43.28  ? 153 LEU B O     1 
ATOM   1534 C CB    . LEU B 2 12  ? 11.979  7.806   -2.091  1.00 41.73  ? 153 LEU B CB    1 
ATOM   1535 C CG    . LEU B 2 12  ? 12.370  6.611   -1.233  1.00 42.21  ? 153 LEU B CG    1 
ATOM   1536 C CD1   . LEU B 2 12  ? 13.477  5.821   -1.886  1.00 42.32  ? 153 LEU B CD1   1 
ATOM   1537 C CD2   . LEU B 2 12  ? 12.831  7.096   0.097   1.00 42.20  ? 153 LEU B CD2   1 
ATOM   1538 N N     . GLU B 2 13  ? 10.479  10.204  -3.480  1.00 46.16  ? 154 GLU B N     1 
ATOM   1539 C CA    . GLU B 2 13  ? 10.559  11.627  -3.819  1.00 48.57  ? 154 GLU B CA    1 
ATOM   1540 C C     . GLU B 2 13  ? 9.314   12.383  -3.391  1.00 52.98  ? 154 GLU B C     1 
ATOM   1541 O O     . GLU B 2 13  ? 9.394   13.526  -2.925  1.00 50.92  ? 154 GLU B O     1 
ATOM   1542 C CB    . GLU B 2 13  ? 10.781  11.819  -5.319  1.00 50.81  ? 154 GLU B CB    1 
ATOM   1543 C CG    . GLU B 2 13  ? 12.221  11.601  -5.795  1.00 54.33  ? 154 GLU B CG    1 
ATOM   1544 C CD    . GLU B 2 13  ? 13.122  12.816  -5.588  1.00 64.05  ? 154 GLU B CD    1 
ATOM   1545 O OE1   . GLU B 2 13  ? 12.669  13.798  -4.943  1.00 63.49  ? 154 GLU B OE1   1 
ATOM   1546 O OE2   . GLU B 2 13  ? 14.284  12.781  -6.073  1.00 61.50  ? 154 GLU B OE2   1 
ATOM   1547 N N     . ARG B 2 14  ? 8.166   11.736  -3.561  1.00 52.31  ? 155 ARG B N     1 
ATOM   1548 C CA    . ARG B 2 14  ? 6.887   12.316  -3.176  1.00 54.69  ? 155 ARG B CA    1 
ATOM   1549 C C     . ARG B 2 14  ? 6.811   12.562  -1.674  1.00 56.13  ? 155 ARG B C     1 
ATOM   1550 O O     . ARG B 2 14  ? 6.314   13.600  -1.222  1.00 58.34  ? 155 ARG B O     1 
ATOM   1551 C CB    . ARG B 2 14  ? 5.740   11.408  -3.608  1.00 56.87  ? 155 ARG B CB    1 
ATOM   1552 C CG    . ARG B 2 14  ? 4.403   12.111  -3.646  1.00 60.21  ? 155 ARG B CG    1 
ATOM   1553 C CD    . ARG B 2 14  ? 3.370   11.323  -2.880  1.00 65.31  ? 155 ARG B CD    1 
ATOM   1554 N NE    . ARG B 2 14  ? 3.033   10.076  -3.553  1.00 67.42  ? 155 ARG B NE    1 
ATOM   1555 C CZ    . ARG B 2 14  ? 1.864   9.852   -4.133  1.00 67.59  ? 155 ARG B CZ    1 
ATOM   1556 N NH1   . ARG B 2 14  ? 0.929   10.793  -4.107  1.00 68.15  ? 155 ARG B NH1   1 
ATOM   1557 N NH2   . ARG B 2 14  ? 1.627   8.690   -4.725  1.00 68.57  ? 155 ARG B NH2   1 
ATOM   1558 N N     . ARG B 2 15  ? 7.310   11.607  -0.898  1.00 54.17  ? 156 ARG B N     1 
ATOM   1559 C CA    . ARG B 2 15  ? 7.293   11.735  0.549   1.00 51.04  ? 156 ARG B CA    1 
ATOM   1560 C C     . ARG B 2 15  ? 8.202   12.870  1.006   1.00 52.35  ? 156 ARG B C     1 
ATOM   1561 O O     . ARG B 2 15  ? 7.884   13.593  1.945   1.00 55.83  ? 156 ARG B O     1 
ATOM   1562 C CB    . ARG B 2 15  ? 7.705   10.422  1.200   1.00 49.69  ? 156 ARG B CB    1 
ATOM   1563 C CG    . ARG B 2 15  ? 7.491   10.407  2.685   1.00 54.00  ? 156 ARG B CG    1 
ATOM   1564 C CD    . ARG B 2 15  ? 6.056   10.703  3.031   1.00 61.76  ? 156 ARG B CD    1 
ATOM   1565 N NE    . ARG B 2 15  ? 5.862   10.699  4.477   1.00 72.85  ? 156 ARG B NE    1 
ATOM   1566 C CZ    . ARG B 2 15  ? 5.689   9.599   5.205   1.00 73.94  ? 156 ARG B CZ    1 
ATOM   1567 N NH1   . ARG B 2 15  ? 5.677   8.405   4.619   1.00 72.34  ? 156 ARG B NH1   1 
ATOM   1568 N NH2   . ARG B 2 15  ? 5.531   9.693   6.520   1.00 68.46  ? 156 ARG B NH2   1 
ATOM   1569 N N     . PHE B 2 16  ? 9.325   13.030  0.320   1.00 49.24  ? 157 PHE B N     1 
ATOM   1570 C CA    . PHE B 2 16  ? 10.294  14.065  0.656   1.00 50.18  ? 157 PHE B CA    1 
ATOM   1571 C C     . PHE B 2 16  ? 9.747   15.452  0.343   1.00 52.75  ? 157 PHE B C     1 
ATOM   1572 O O     . PHE B 2 16  ? 10.105  16.442  0.984   1.00 53.51  ? 157 PHE B O     1 
ATOM   1573 C CB    . PHE B 2 16  ? 11.602  13.827  -0.103  1.00 46.17  ? 157 PHE B CB    1 
ATOM   1574 C CG    . PHE B 2 16  ? 12.680  14.811  0.222   1.00 43.42  ? 157 PHE B CG    1 
ATOM   1575 C CD1   . PHE B 2 16  ? 13.494  14.626  1.315   1.00 43.68  ? 157 PHE B CD1   1 
ATOM   1576 C CD2   . PHE B 2 16  ? 12.877  15.922  -0.564  1.00 49.72  ? 157 PHE B CD2   1 
ATOM   1577 C CE1   . PHE B 2 16  ? 14.484  15.524  1.613   1.00 44.31  ? 157 PHE B CE1   1 
ATOM   1578 C CE2   . PHE B 2 16  ? 13.866  16.829  -0.271  1.00 49.85  ? 157 PHE B CE2   1 
ATOM   1579 C CZ    . PHE B 2 16  ? 14.671  16.628  0.819   1.00 48.63  ? 157 PHE B CZ    1 
ATOM   1580 N N     . LYS B 2 17  ? 8.881   15.521  -0.660  1.00 57.93  ? 158 LYS B N     1 
ATOM   1581 C CA    . LYS B 2 17  ? 8.258   16.780  -1.031  1.00 57.28  ? 158 LYS B CA    1 
ATOM   1582 C C     . LYS B 2 17  ? 7.370   17.241  0.105   1.00 57.03  ? 158 LYS B C     1 
ATOM   1583 O O     . LYS B 2 17  ? 7.081   18.428  0.231   1.00 61.18  ? 158 LYS B O     1 
ATOM   1584 C CB    . LYS B 2 17  ? 7.452   16.633  -2.322  1.00 56.54  ? 158 LYS B CB    1 
ATOM   1585 C CG    . LYS B 2 17  ? 6.999   17.954  -2.913  1.00 54.48  ? 158 LYS B CG    1 
ATOM   1586 C CD    . LYS B 2 17  ? 6.549   17.809  -4.355  1.00 52.81  ? 158 LYS B CD    1 
ATOM   1587 C CE    . LYS B 2 17  ? 6.215   19.170  -4.946  1.00 50.77  ? 158 LYS B CE    1 
ATOM   1588 N NZ    . LYS B 2 17  ? 5.634   19.085  -6.310  1.00 46.02  ? 158 LYS B NZ    1 
ATOM   1589 N N     . GLN B 2 18  ? 6.967   16.289  0.943   1.00 55.24  ? 159 GLN B N     1 
ATOM   1590 C CA    . GLN B 2 18  ? 6.065   16.551  2.063   1.00 62.28  ? 159 GLN B CA    1 
ATOM   1591 C C     . GLN B 2 18  ? 6.809   16.774  3.396   1.00 63.31  ? 159 GLN B C     1 
ATOM   1592 O O     . GLN B 2 18  ? 6.943   17.905  3.867   1.00 64.78  ? 159 GLN B O     1 
ATOM   1593 C CB    . GLN B 2 18  ? 5.077   15.390  2.199   1.00 62.61  ? 159 GLN B CB    1 
ATOM   1594 C CG    . GLN B 2 18  ? 3.696   15.802  2.686   1.00 69.40  ? 159 GLN B CG    1 
ATOM   1595 C CD    . GLN B 2 18  ? 2.851   14.612  3.119   1.00 75.59  ? 159 GLN B CD    1 
ATOM   1596 O OE1   . GLN B 2 18  ? 3.382   13.538  3.423   1.00 78.78  ? 159 GLN B OE1   1 
ATOM   1597 N NE2   . GLN B 2 18  ? 1.533   14.801  3.162   1.00 70.01  ? 159 GLN B NE2   1 
ATOM   1598 N N     . GLN B 2 19  ? 7.266   15.680  3.999   1.00 58.83  ? 160 GLN B N     1 
ATOM   1599 C CA    . GLN B 2 19  ? 8.161   15.710  5.148   1.00 55.07  ? 160 GLN B CA    1 
ATOM   1600 C C     . GLN B 2 19  ? 9.621   15.543  4.712   1.00 55.30  ? 160 GLN B C     1 
ATOM   1601 O O     . GLN B 2 19  ? 9.957   14.519  4.127   1.00 57.10  ? 160 GLN B O     1 
ATOM   1602 C CB    . GLN B 2 19  ? 7.825   14.572  6.106   1.00 59.56  ? 160 GLN B CB    1 
ATOM   1603 C CG    . GLN B 2 19  ? 6.355   14.216  6.214   1.00 68.53  ? 160 GLN B CG    1 
ATOM   1604 C CD    . GLN B 2 19  ? 6.149   12.937  7.017   1.00 76.04  ? 160 GLN B CD    1 
ATOM   1605 O OE1   . GLN B 2 19  ? 7.097   12.181  7.245   1.00 76.14  ? 160 GLN B OE1   1 
ATOM   1606 N NE2   . GLN B 2 19  ? 4.912   12.688  7.445   1.00 78.73  ? 160 GLN B NE2   1 
ATOM   1607 N N     . ARG B 2 20  ? 10.513  16.486  4.994   1.00 50.13  ? 161 ARG B N     1 
ATOM   1608 C CA    . ARG B 2 20  ? 11.912  16.191  4.683   1.00 50.09  ? 161 ARG B CA    1 
ATOM   1609 C C     . ARG B 2 20  ? 12.694  15.536  5.841   1.00 50.98  ? 161 ARG B C     1 
ATOM   1610 O O     . ARG B 2 20  ? 13.906  15.335  5.730   1.00 50.17  ? 161 ARG B O     1 
ATOM   1611 C CB    . ARG B 2 20  ? 12.652  17.442  4.210   1.00 49.92  ? 161 ARG B CB    1 
ATOM   1612 C CG    . ARG B 2 20  ? 12.255  18.719  4.860   1.00 54.37  ? 161 ARG B CG    1 
ATOM   1613 C CD    . ARG B 2 20  ? 13.032  19.854  4.239   1.00 51.64  ? 161 ARG B CD    1 
ATOM   1614 N NE    . ARG B 2 20  ? 14.458  19.743  4.512   1.00 58.11  ? 161 ARG B NE    1 
ATOM   1615 C CZ    . ARG B 2 20  ? 15.400  20.031  3.621   1.00 67.16  ? 161 ARG B CZ    1 
ATOM   1616 N NH1   . ARG B 2 20  ? 15.028  20.429  2.407   1.00 69.20  ? 161 ARG B NH1   1 
ATOM   1617 N NH2   . ARG B 2 20  ? 16.700  19.915  3.933   1.00 58.49  ? 161 ARG B NH2   1 
ATOM   1618 N N     . TYR B 2 21  ? 12.002  15.193  6.928   1.00 51.12  ? 162 TYR B N     1 
ATOM   1619 C CA    . TYR B 2 21  ? 12.570  14.376  8.007   1.00 50.62  ? 162 TYR B CA    1 
ATOM   1620 C C     . TYR B 2 21  ? 11.569  13.328  8.452   1.00 55.68  ? 162 TYR B C     1 
ATOM   1621 O O     . TYR B 2 21  ? 10.398  13.627  8.639   1.00 63.34  ? 162 TYR B O     1 
ATOM   1622 C CB    . TYR B 2 21  ? 12.948  15.216  9.219   1.00 51.15  ? 162 TYR B CB    1 
ATOM   1623 C CG    . TYR B 2 21  ? 14.077  16.192  9.023   1.00 47.75  ? 162 TYR B CG    1 
ATOM   1624 C CD1   . TYR B 2 21  ? 13.842  17.445  8.477   1.00 54.12  ? 162 TYR B CD1   1 
ATOM   1625 C CD2   . TYR B 2 21  ? 15.361  15.876  9.406   1.00 42.01  ? 162 TYR B CD2   1 
ATOM   1626 C CE1   . TYR B 2 21  ? 14.859  18.350  8.302   1.00 54.11  ? 162 TYR B CE1   1 
ATOM   1627 C CE2   . TYR B 2 21  ? 16.383  16.774  9.238   1.00 50.18  ? 162 TYR B CE2   1 
ATOM   1628 C CZ    . TYR B 2 21  ? 16.127  18.012  8.690   1.00 52.40  ? 162 TYR B CZ    1 
ATOM   1629 O OH    . TYR B 2 21  ? 17.145  18.916  8.514   1.00 57.82  ? 162 TYR B OH    1 
ATOM   1630 N N     . LEU B 2 22  ? 12.029  12.103  8.648   1.00 58.64  ? 163 LEU B N     1 
ATOM   1631 C CA    . LEU B 2 22  ? 11.140  11.022  9.043   1.00 60.69  ? 163 LEU B CA    1 
ATOM   1632 C C     . LEU B 2 22  ? 11.441  10.570  10.455  1.00 70.70  ? 163 LEU B C     1 
ATOM   1633 O O     . LEU B 2 22  ? 12.542  10.783  10.963  1.00 76.85  ? 163 LEU B O     1 
ATOM   1634 C CB    . LEU B 2 22  ? 11.267  9.842   8.085   1.00 63.67  ? 163 LEU B CB    1 
ATOM   1635 C CG    . LEU B 2 22  ? 10.217  9.716   6.985   1.00 63.66  ? 163 LEU B CG    1 
ATOM   1636 C CD1   . LEU B 2 22  ? 9.992   11.045  6.275   1.00 59.17  ? 163 LEU B CD1   1 
ATOM   1637 C CD2   . LEU B 2 22  ? 10.643  8.632   6.009   1.00 58.78  ? 163 LEU B CD2   1 
ATOM   1638 N N     . SER B 2 23  ? 10.462  9.941   11.094  1.00 76.82  ? 164 SER B N     1 
ATOM   1639 C CA    . SER B 2 23  ? 10.663  9.405   12.431  1.00 74.35  ? 164 SER B CA    1 
ATOM   1640 C C     . SER B 2 23  ? 11.145  7.965   12.348  1.00 74.54  ? 164 SER B C     1 
ATOM   1641 O O     . SER B 2 23  ? 11.312  7.415   11.262  1.00 73.93  ? 164 SER B O     1 
ATOM   1642 C CB    . SER B 2 23  ? 9.379   9.475   13.238  1.00 73.19  ? 164 SER B CB    1 
ATOM   1643 O OG    . SER B 2 23  ? 8.477   8.484   12.791  1.00 76.28  ? 164 SER B OG    1 
ATOM   1644 N N     . ALA B 2 24  ? 11.351  7.354   13.505  1.00 77.37  ? 165 ALA B N     1 
ATOM   1645 C CA    . ALA B 2 24  ? 11.870  5.997   13.571  1.00 77.14  ? 165 ALA B CA    1 
ATOM   1646 C C     . ALA B 2 24  ? 10.910  4.978   12.955  1.00 76.96  ? 165 ALA B C     1 
ATOM   1647 O O     . ALA B 2 24  ? 11.335  4.184   12.125  1.00 78.42  ? 165 ALA B O     1 
ATOM   1648 C CB    . ALA B 2 24  ? 12.209  5.625   15.033  1.00 83.00  ? 165 ALA B CB    1 
ATOM   1649 N N     . PRO B 2 25  ? 9.614   4.993   13.338  1.00 82.17  ? 166 PRO B N     1 
ATOM   1650 C CA    . PRO B 2 25  ? 8.731   4.012   12.690  1.00 81.47  ? 166 PRO B CA    1 
ATOM   1651 C C     . PRO B 2 25  ? 8.229   4.465   11.310  1.00 78.68  ? 166 PRO B C     1 
ATOM   1652 O O     . PRO B 2 25  ? 7.908   3.620   10.466  1.00 77.50  ? 166 PRO B O     1 
ATOM   1653 C CB    . PRO B 2 25  ? 7.572   3.887   13.679  1.00 84.56  ? 166 PRO B CB    1 
ATOM   1654 C CG    . PRO B 2 25  ? 7.476   5.247   14.284  1.00 84.92  ? 166 PRO B CG    1 
ATOM   1655 C CD    . PRO B 2 25  ? 8.897   5.753   14.385  1.00 83.23  ? 166 PRO B CD    1 
ATOM   1656 N N     . GLU B 2 26  ? 8.162   5.776   11.088  1.00 75.88  ? 167 GLU B N     1 
ATOM   1657 C CA    . GLU B 2 26  ? 7.851   6.305   9.767   1.00 74.63  ? 167 GLU B CA    1 
ATOM   1658 C C     . GLU B 2 26  ? 8.785   5.749   8.705   1.00 73.78  ? 167 GLU B C     1 
ATOM   1659 O O     . GLU B 2 26  ? 8.364   5.471   7.591   1.00 74.36  ? 167 GLU B O     1 
ATOM   1660 C CB    . GLU B 2 26  ? 7.931   7.821   9.765   1.00 72.12  ? 167 GLU B CB    1 
ATOM   1661 C CG    . GLU B 2 26  ? 6.674   8.477   10.241  1.00 73.30  ? 167 GLU B CG    1 
ATOM   1662 C CD    . GLU B 2 26  ? 6.715   9.973   10.061  1.00 77.11  ? 167 GLU B CD    1 
ATOM   1663 O OE1   . GLU B 2 26  ? 7.750   10.589  10.403  1.00 76.38  ? 167 GLU B OE1   1 
ATOM   1664 O OE2   . GLU B 2 26  ? 5.719   10.531  9.554   1.00 79.98  ? 167 GLU B OE2   1 
ATOM   1665 N N     . ARG B 2 27  ? 10.056  5.591   9.050   1.00 70.83  ? 168 ARG B N     1 
ATOM   1666 C CA    . ARG B 2 27  ? 10.997  4.973   8.132   1.00 70.64  ? 168 ARG B CA    1 
ATOM   1667 C C     . ARG B 2 27  ? 10.686  3.504   7.869   1.00 75.46  ? 168 ARG B C     1 
ATOM   1668 O O     . ARG B 2 27  ? 11.129  2.951   6.865   1.00 73.42  ? 168 ARG B O     1 
ATOM   1669 C CB    . ARG B 2 27  ? 12.429  5.095   8.651   1.00 68.99  ? 168 ARG B CB    1 
ATOM   1670 C CG    . ARG B 2 27  ? 13.068  6.430   8.328   1.00 65.43  ? 168 ARG B CG    1 
ATOM   1671 C CD    . ARG B 2 27  ? 14.554  6.398   8.538   1.00 55.94  ? 168 ARG B CD    1 
ATOM   1672 N NE    . ARG B 2 27  ? 14.944  6.212   9.930   1.00 52.26  ? 168 ARG B NE    1 
ATOM   1673 C CZ    . ARG B 2 27  ? 15.192  7.216   10.765  1.00 62.79  ? 168 ARG B CZ    1 
ATOM   1674 N NH1   . ARG B 2 27  ? 15.084  8.473   10.358  1.00 64.86  ? 168 ARG B NH1   1 
ATOM   1675 N NH2   . ARG B 2 27  ? 15.547  6.967   12.010  1.00 71.12  ? 168 ARG B NH2   1 
ATOM   1676 N N     . ASP B 2 28  ? 9.932   2.864   8.756   1.00 78.70  ? 169 ASP B N     1 
ATOM   1677 C CA    . ASP B 2 28  ? 9.701   1.431   8.611   1.00 74.83  ? 169 ASP B CA    1 
ATOM   1678 C C     . ASP B 2 28  ? 8.488   1.155   7.760   1.00 70.42  ? 169 ASP B C     1 
ATOM   1679 O O     . ASP B 2 28  ? 8.523   0.277   6.896   1.00 69.51  ? 169 ASP B O     1 
ATOM   1680 C CB    . ASP B 2 28  ? 9.555   0.771   9.974   1.00 73.75  ? 169 ASP B CB    1 
ATOM   1681 C CG    . ASP B 2 28  ? 10.799  0.918   10.808  1.00 81.13  ? 169 ASP B CG    1 
ATOM   1682 O OD1   . ASP B 2 28  ? 11.878  1.142   10.214  1.00 75.97  ? 169 ASP B OD1   1 
ATOM   1683 O OD2   . ASP B 2 28  ? 10.701  0.822   12.052  1.00 91.90  ? 169 ASP B OD2   1 
ATOM   1684 N N     . GLN B 2 29  ? 7.420   1.903   8.014   1.00 72.29  ? 170 GLN B N     1 
ATOM   1685 C CA    . GLN B 2 29  ? 6.208   1.795   7.218   1.00 73.29  ? 170 GLN B CA    1 
ATOM   1686 C C     . GLN B 2 29  ? 6.590   1.997   5.758   1.00 71.66  ? 170 GLN B C     1 
ATOM   1687 O O     . GLN B 2 29  ? 6.201   1.219   4.896   1.00 71.44  ? 170 GLN B O     1 
ATOM   1688 C CB    . GLN B 2 29  ? 5.153   2.820   7.661   1.00 75.95  ? 170 GLN B CB    1 
ATOM   1689 C CG    . GLN B 2 29  ? 5.612   4.277   7.522   1.00 81.64  ? 170 GLN B CG    1 
ATOM   1690 C CD    . GLN B 2 29  ? 4.586   5.286   7.973   1.00 87.76  ? 170 GLN B CD    1 
ATOM   1691 O OE1   . GLN B 2 29  ? 3.623   4.944   8.659   1.00 92.62  ? 170 GLN B OE1   1 
ATOM   1692 N NE2   . GLN B 2 29  ? 4.786   6.545   7.587   1.00 86.64  ? 170 GLN B NE2   1 
ATOM   1693 N N     . LEU B 2 30  ? 7.406   3.017   5.506   1.00 70.19  ? 171 LEU B N     1 
ATOM   1694 C CA    . LEU B 2 30  ? 7.808   3.383   4.162   1.00 66.32  ? 171 LEU B CA    1 
ATOM   1695 C C     . LEU B 2 30  ? 8.766   2.345   3.569   1.00 65.79  ? 171 LEU B C     1 
ATOM   1696 O O     . LEU B 2 30  ? 8.652   2.000   2.394   1.00 68.12  ? 171 LEU B O     1 
ATOM   1697 C CB    . LEU B 2 30  ? 8.436   4.777   4.176   1.00 60.78  ? 171 LEU B CB    1 
ATOM   1698 C CG    . LEU B 2 30  ? 8.760   5.433   2.839   1.00 60.20  ? 171 LEU B CG    1 
ATOM   1699 C CD1   . LEU B 2 30  ? 7.710   5.093   1.799   1.00 54.53  ? 171 LEU B CD1   1 
ATOM   1700 C CD2   . LEU B 2 30  ? 8.856   6.935   3.027   1.00 60.68  ? 171 LEU B CD2   1 
ATOM   1701 N N     . ALA B 2 31  ? 9.686   1.836   4.388   1.00 61.19  ? 172 ALA B N     1 
ATOM   1702 C CA    . ALA B 2 31  ? 10.632  0.804   3.964   1.00 59.02  ? 172 ALA B CA    1 
ATOM   1703 C C     . ALA B 2 31  ? 9.947   -0.413  3.374   1.00 63.55  ? 172 ALA B C     1 
ATOM   1704 O O     . ALA B 2 31  ? 10.200  -0.795  2.233   1.00 61.68  ? 172 ALA B O     1 
ATOM   1705 C CB    . ALA B 2 31  ? 11.483  0.377   5.121   1.00 63.79  ? 172 ALA B CB    1 
ATOM   1706 N N     . SER B 2 32  ? 9.093   -1.032  4.178   1.00 67.13  ? 173 SER B N     1 
ATOM   1707 C CA    . SER B 2 32  ? 8.351   -2.209  3.754   1.00 66.11  ? 173 SER B CA    1 
ATOM   1708 C C     . SER B 2 32  ? 7.600   -1.940  2.459   1.00 69.47  ? 173 SER B C     1 
ATOM   1709 O O     . SER B 2 32  ? 7.763   -2.682  1.484   1.00 72.26  ? 173 SER B O     1 
ATOM   1710 C CB    . SER B 2 32  ? 7.371   -2.642  4.838   1.00 63.56  ? 173 SER B CB    1 
ATOM   1711 O OG    . SER B 2 32  ? 6.428   -1.613  5.066   1.00 67.34  ? 173 SER B OG    1 
ATOM   1712 N N     . VAL B 2 33  ? 6.791   -0.879  2.453   1.00 65.27  ? 174 VAL B N     1 
ATOM   1713 C CA    . VAL B 2 33  ? 5.967   -0.539  1.295   1.00 63.45  ? 174 VAL B CA    1 
ATOM   1714 C C     . VAL B 2 33  ? 6.755   -0.606  -0.009  1.00 63.90  ? 174 VAL B C     1 
ATOM   1715 O O     . VAL B 2 33  ? 6.309   -1.218  -0.973  1.00 67.37  ? 174 VAL B O     1 
ATOM   1716 C CB    . VAL B 2 33  ? 5.353   0.872   1.412   1.00 63.41  ? 174 VAL B CB    1 
ATOM   1717 C CG1   . VAL B 2 33  ? 4.745   1.288   0.074   1.00 66.70  ? 174 VAL B CG1   1 
ATOM   1718 C CG2   . VAL B 2 33  ? 4.311   0.922   2.509   1.00 57.76  ? 174 VAL B CG2   1 
ATOM   1719 N N     . LEU B 2 34  ? 7.940   -0.000  -0.016  1.00 63.55  ? 175 LEU B N     1 
ATOM   1720 C CA    . LEU B 2 34  ? 8.782   0.055   -1.210  1.00 59.67  ? 175 LEU B CA    1 
ATOM   1721 C C     . LEU B 2 34  ? 9.712   -1.149  -1.308  1.00 63.46  ? 175 LEU B C     1 
ATOM   1722 O O     . LEU B 2 34  ? 10.395  -1.332  -2.321  1.00 60.82  ? 175 LEU B O     1 
ATOM   1723 C CB    . LEU B 2 34  ? 9.600   1.339   -1.214  1.00 53.47  ? 175 LEU B CB    1 
ATOM   1724 C CG    . LEU B 2 34  ? 8.770   2.562   -0.866  1.00 53.24  ? 175 LEU B CG    1 
ATOM   1725 C CD1   . LEU B 2 34  ? 9.586   3.831   -0.991  1.00 51.19  ? 175 LEU B CD1   1 
ATOM   1726 C CD2   . LEU B 2 34  ? 7.594   2.590   -1.784  1.00 54.72  ? 175 LEU B CD2   1 
ATOM   1727 N N     . LYS B 2 35  ? 9.731   -1.951  -0.240  1.00 65.26  ? 176 LYS B N     1 
ATOM   1728 C CA    . LYS B 2 35  ? 10.538  -3.172  -0.144  1.00 63.47  ? 176 LYS B CA    1 
ATOM   1729 C C     . LYS B 2 35  ? 12.038  -2.866  -0.227  1.00 62.76  ? 176 LYS B C     1 
ATOM   1730 O O     . LYS B 2 35  ? 12.758  -3.343  -1.111  1.00 60.46  ? 176 LYS B O     1 
ATOM   1731 C CB    . LYS B 2 35  ? 10.108  -4.177  -1.214  1.00 67.36  ? 176 LYS B CB    1 
ATOM   1732 C CG    . LYS B 2 35  ? 8.680   -4.704  -1.003  1.00 69.62  ? 176 LYS B CG    1 
ATOM   1733 C CD    . LYS B 2 35  ? 8.027   -5.164  -2.315  1.00 76.06  ? 176 LYS B CD    1 
ATOM   1734 C CE    . LYS B 2 35  ? 6.539   -4.750  -2.381  1.00 76.22  ? 176 LYS B CE    1 
ATOM   1735 N NZ    . LYS B 2 35  ? 6.100   -4.058  -3.645  1.00 70.77  ? 176 LYS B NZ    1 
ATOM   1736 N N     . LEU B 2 36  ? 12.474  -2.046  0.724   1.00 60.74  ? 177 LEU B N     1 
ATOM   1737 C CA    . LEU B 2 36  ? 13.870  -1.731  0.968   1.00 55.14  ? 177 LEU B CA    1 
ATOM   1738 C C     . LEU B 2 36  ? 14.133  -1.770  2.476   1.00 59.11  ? 177 LEU B C     1 
ATOM   1739 O O     . LEU B 2 36  ? 13.231  -1.486  3.280   1.00 58.89  ? 177 LEU B O     1 
ATOM   1740 C CB    . LEU B 2 36  ? 14.212  -0.349  0.431   1.00 53.59  ? 177 LEU B CB    1 
ATOM   1741 C CG    . LEU B 2 36  ? 13.998  -0.057  -1.043  1.00 59.07  ? 177 LEU B CG    1 
ATOM   1742 C CD1   . LEU B 2 36  ? 14.067  1.446   -1.247  1.00 53.48  ? 177 LEU B CD1   1 
ATOM   1743 C CD2   . LEU B 2 36  ? 15.049  -0.775  -1.905  1.00 60.43  ? 177 LEU B CD2   1 
ATOM   1744 N N     . THR B 2 37  ? 15.358  -2.104  2.867   1.00 54.14  ? 178 THR B N     1 
ATOM   1745 C CA    . THR B 2 37  ? 15.744  -1.986  4.267   1.00 49.65  ? 178 THR B CA    1 
ATOM   1746 C C     . THR B 2 37  ? 15.488  -0.560  4.737   1.00 54.00  ? 178 THR B C     1 
ATOM   1747 O O     . THR B 2 37  ? 15.689  0.384   3.976   1.00 57.22  ? 178 THR B O     1 
ATOM   1748 C CB    . THR B 2 37  ? 17.208  -2.321  4.473   1.00 52.11  ? 178 THR B CB    1 
ATOM   1749 O OG1   . THR B 2 37  ? 18.000  -1.211  4.053   1.00 58.90  ? 178 THR B OG1   1 
ATOM   1750 C CG2   . THR B 2 37  ? 17.585  -3.519  3.639   1.00 53.60  ? 178 THR B CG2   1 
ATOM   1751 N N     . SER B 2 38  ? 15.037  -0.402  5.980   1.00 54.83  ? 179 SER B N     1 
ATOM   1752 C CA    . SER B 2 38  ? 14.767  0.918   6.553   1.00 51.24  ? 179 SER B CA    1 
ATOM   1753 C C     . SER B 2 38  ? 16.049  1.735   6.689   1.00 53.18  ? 179 SER B C     1 
ATOM   1754 O O     . SER B 2 38  ? 16.018  2.953   6.870   1.00 53.16  ? 179 SER B O     1 
ATOM   1755 C CB    . SER B 2 38  ? 14.121  0.773   7.910   1.00 57.30  ? 179 SER B CB    1 
ATOM   1756 O OG    . SER B 2 38  ? 15.054  0.165   8.783   1.00 60.00  ? 179 SER B OG    1 
ATOM   1757 N N     . THR B 2 39  ? 17.178  1.040   6.627   1.00 52.84  ? 180 THR B N     1 
ATOM   1758 C CA    . THR B 2 39  ? 18.478  1.672   6.526   1.00 49.12  ? 180 THR B CA    1 
ATOM   1759 C C     . THR B 2 39  ? 18.555  2.520   5.271   1.00 48.47  ? 180 THR B C     1 
ATOM   1760 O O     . THR B 2 39  ? 18.882  3.710   5.323   1.00 49.69  ? 180 THR B O     1 
ATOM   1761 C CB    . THR B 2 39  ? 19.558  0.620   6.486   1.00 49.32  ? 180 THR B CB    1 
ATOM   1762 O OG1   . THR B 2 39  ? 19.167  -0.447  7.355   1.00 59.53  ? 180 THR B OG1   1 
ATOM   1763 C CG2   . THR B 2 39  ? 20.881  1.192   6.930   1.00 49.06  ? 180 THR B CG2   1 
ATOM   1764 N N     . GLN B 2 40  ? 18.229  1.881   4.149   1.00 46.75  ? 181 GLN B N     1 
ATOM   1765 C CA    . GLN B 2 40  ? 18.293  2.477   2.823   1.00 45.83  ? 181 GLN B CA    1 
ATOM   1766 C C     . GLN B 2 40  ? 17.423  3.718   2.675   1.00 46.51  ? 181 GLN B C     1 
ATOM   1767 O O     . GLN B 2 40  ? 17.798  4.677   1.994   1.00 44.16  ? 181 GLN B O     1 
ATOM   1768 C CB    . GLN B 2 40  ? 17.898  1.436   1.792   1.00 44.79  ? 181 GLN B CB    1 
ATOM   1769 C CG    . GLN B 2 40  ? 19.004  0.444   1.538   1.00 46.62  ? 181 GLN B CG    1 
ATOM   1770 C CD    . GLN B 2 40  ? 18.558  -0.691  0.663   1.00 53.49  ? 181 GLN B CD    1 
ATOM   1771 O OE1   . GLN B 2 40  ? 17.472  -1.243  0.855   1.00 54.51  ? 181 GLN B OE1   1 
ATOM   1772 N NE2   . GLN B 2 40  ? 19.378  -1.033  -0.332  1.00 48.67  ? 181 GLN B NE2   1 
ATOM   1773 N N     . VAL B 2 41  ? 16.265  3.690   3.322   1.00 44.30  ? 182 VAL B N     1 
ATOM   1774 C CA    . VAL B 2 41  ? 15.375  4.836   3.365   1.00 43.54  ? 182 VAL B CA    1 
ATOM   1775 C C     . VAL B 2 41  ? 15.960  5.976   4.199   1.00 45.22  ? 182 VAL B C     1 
ATOM   1776 O O     . VAL B 2 41  ? 15.861  7.141   3.809   1.00 44.72  ? 182 VAL B O     1 
ATOM   1777 C CB    . VAL B 2 41  ? 14.018  4.451   3.943   1.00 41.00  ? 182 VAL B CB    1 
ATOM   1778 C CG1   . VAL B 2 41  ? 12.992  5.476   3.566   1.00 43.14  ? 182 VAL B CG1   1 
ATOM   1779 C CG2   . VAL B 2 41  ? 13.625  3.093   3.447   1.00 43.26  ? 182 VAL B CG2   1 
ATOM   1780 N N     . LYS B 2 42  ? 16.543  5.641   5.352   1.00 42.43  ? 183 LYS B N     1 
ATOM   1781 C CA    . LYS B 2 42  ? 17.187  6.633   6.203   1.00 41.44  ? 183 LYS B CA    1 
ATOM   1782 C C     . LYS B 2 42  ? 18.291  7.337   5.458   1.00 41.66  ? 183 LYS B C     1 
ATOM   1783 O O     . LYS B 2 42  ? 18.408  8.554   5.500   1.00 40.35  ? 183 LYS B O     1 
ATOM   1784 C CB    . LYS B 2 42  ? 17.780  5.997   7.454   1.00 44.85  ? 183 LYS B CB    1 
ATOM   1785 C CG    . LYS B 2 42  ? 18.449  7.019   8.374   1.00 48.20  ? 183 LYS B CG    1 
ATOM   1786 C CD    . LYS B 2 42  ? 19.035  6.383   9.624   1.00 51.30  ? 183 LYS B CD    1 
ATOM   1787 C CE    . LYS B 2 42  ? 19.993  5.265   9.274   1.00 48.00  ? 183 LYS B CE    1 
ATOM   1788 N NZ    . LYS B 2 42  ? 20.468  4.580   10.496  1.00 55.20  ? 183 LYS B NZ    1 
ATOM   1789 N N     . ILE B 2 43  ? 19.108  6.535   4.793   1.00 38.10  ? 184 ILE B N     1 
ATOM   1790 C CA    . ILE B 2 43  ? 20.235  7.012   4.023   1.00 40.22  ? 184 ILE B CA    1 
ATOM   1791 C C     . ILE B 2 43  ? 19.801  7.787   2.773   1.00 43.43  ? 184 ILE B C     1 
ATOM   1792 O O     . ILE B 2 43  ? 20.467  8.739   2.322   1.00 39.52  ? 184 ILE B O     1 
ATOM   1793 C CB    . ILE B 2 43  ? 21.120  5.832   3.629   1.00 36.89  ? 184 ILE B CB    1 
ATOM   1794 C CG1   . ILE B 2 43  ? 21.741  5.235   4.895   1.00 40.72  ? 184 ILE B CG1   1 
ATOM   1795 C CG2   . ILE B 2 43  ? 22.180  6.265   2.650   1.00 33.13  ? 184 ILE B CG2   1 
ATOM   1796 C CD1   . ILE B 2 43  ? 22.467  6.259   5.755   1.00 31.97  ? 184 ILE B CD1   1 
ATOM   1797 N N     . TRP B 2 44  ? 18.679  7.375   2.204   1.00 41.94  ? 185 TRP B N     1 
ATOM   1798 C CA    . TRP B 2 44  ? 18.172  8.090   1.060   1.00 42.75  ? 185 TRP B CA    1 
ATOM   1799 C C     . TRP B 2 44  ? 17.797  9.495   1.510   1.00 41.44  ? 185 TRP B C     1 
ATOM   1800 O O     . TRP B 2 44  ? 18.170  10.482  0.882   1.00 42.83  ? 185 TRP B O     1 
ATOM   1801 C CB    . TRP B 2 44  ? 16.975  7.371   0.434   1.00 43.09  ? 185 TRP B CB    1 
ATOM   1802 C CG    . TRP B 2 44  ? 16.604  7.952   -0.870  1.00 39.91  ? 185 TRP B CG    1 
ATOM   1803 C CD1   . TRP B 2 44  ? 17.064  7.571   -2.094  1.00 44.61  ? 185 TRP B CD1   1 
ATOM   1804 C CD2   . TRP B 2 44  ? 15.739  9.058   -1.088  1.00 39.29  ? 185 TRP B CD2   1 
ATOM   1805 N NE1   . TRP B 2 44  ? 16.523  8.370   -3.069  1.00 45.95  ? 185 TRP B NE1   1 
ATOM   1806 C CE2   . TRP B 2 44  ? 15.699  9.290   -2.474  1.00 41.72  ? 185 TRP B CE2   1 
ATOM   1807 C CE3   . TRP B 2 44  ? 14.990  9.877   -0.249  1.00 43.52  ? 185 TRP B CE3   1 
ATOM   1808 C CZ2   . TRP B 2 44  ? 14.935  10.306  -3.037  1.00 41.74  ? 185 TRP B CZ2   1 
ATOM   1809 C CZ3   . TRP B 2 44  ? 14.226  10.880  -0.816  1.00 47.05  ? 185 TRP B CZ3   1 
ATOM   1810 C CH2   . TRP B 2 44  ? 14.210  11.088  -2.195  1.00 42.67  ? 185 TRP B CH2   1 
ATOM   1811 N N     . PHE B 2 45  ? 17.075  9.590   2.614   1.00 39.99  ? 186 PHE B N     1 
ATOM   1812 C CA    . PHE B 2 45  ? 16.618  10.892  3.038   1.00 40.78  ? 186 PHE B CA    1 
ATOM   1813 C C     . PHE B 2 45  ? 17.835  11.742  3.361   1.00 41.24  ? 186 PHE B C     1 
ATOM   1814 O O     . PHE B 2 45  ? 17.921  12.887  2.935   1.00 42.51  ? 186 PHE B O     1 
ATOM   1815 C CB    . PHE B 2 45  ? 15.641  10.780  4.209   1.00 37.64  ? 186 PHE B CB    1 
ATOM   1816 C CG    . PHE B 2 45  ? 14.200  10.686  3.774   1.00 41.41  ? 186 PHE B CG    1 
ATOM   1817 C CD1   . PHE B 2 45  ? 13.360  11.793  3.839   1.00 44.31  ? 186 PHE B CD1   1 
ATOM   1818 C CD2   . PHE B 2 45  ? 13.695  9.507   3.254   1.00 41.31  ? 186 PHE B CD2   1 
ATOM   1819 C CE1   . PHE B 2 45  ? 12.046  11.717  3.414   1.00 42.60  ? 186 PHE B CE1   1 
ATOM   1820 C CE2   . PHE B 2 45  ? 12.375  9.432   2.825   1.00 41.50  ? 186 PHE B CE2   1 
ATOM   1821 C CZ    . PHE B 2 45  ? 11.558  10.538  2.907   1.00 39.98  ? 186 PHE B CZ    1 
ATOM   1822 N N     . GLN B 2 46  ? 18.810  11.152  4.042   1.00 44.13  ? 187 GLN B N     1 
ATOM   1823 C CA    . GLN B 2 46  ? 20.041  11.862  4.385   1.00 42.11  ? 187 GLN B CA    1 
ATOM   1824 C C     . GLN B 2 46  ? 20.767  12.352  3.133   1.00 40.18  ? 187 GLN B C     1 
ATOM   1825 O O     . GLN B 2 46  ? 21.184  13.501  3.067   1.00 39.38  ? 187 GLN B O     1 
ATOM   1826 C CB    . GLN B 2 46  ? 20.961  10.970  5.214   1.00 39.10  ? 187 GLN B CB    1 
ATOM   1827 C CG    . GLN B 2 46  ? 22.238  11.649  5.670   1.00 43.59  ? 187 GLN B CG    1 
ATOM   1828 C CD    . GLN B 2 46  ? 23.236  10.666  6.236   1.00 43.52  ? 187 GLN B CD    1 
ATOM   1829 O OE1   . GLN B 2 46  ? 23.099  10.214  7.377   1.00 45.00  ? 187 GLN B OE1   1 
ATOM   1830 N NE2   . GLN B 2 46  ? 24.240  10.315  5.437   1.00 41.39  ? 187 GLN B NE2   1 
ATOM   1831 N N     . ASN B 2 47  ? 20.899  11.486  2.135   1.00 42.22  ? 188 ASN B N     1 
ATOM   1832 C CA    . ASN B 2 47  ? 21.545  11.876  0.885   1.00 40.23  ? 188 ASN B CA    1 
ATOM   1833 C C     . ASN B 2 47  ? 20.733  12.929  0.108   1.00 42.84  ? 188 ASN B C     1 
ATOM   1834 O O     . ASN B 2 47  ? 21.303  13.852  -0.480  1.00 43.35  ? 188 ASN B O     1 
ATOM   1835 C CB    . ASN B 2 47  ? 21.801  10.640  0.020   1.00 33.61  ? 188 ASN B CB    1 
ATOM   1836 C CG    . ASN B 2 47  ? 23.080  9.901   0.401   1.00 37.62  ? 188 ASN B CG    1 
ATOM   1837 O OD1   . ASN B 2 47  ? 24.086  10.515  0.777   1.00 42.37  ? 188 ASN B OD1   1 
ATOM   1838 N ND2   . ASN B 2 47  ? 23.048  8.576   0.300   1.00 35.17  ? 188 ASN B ND2   1 
ATOM   1839 N N     . ARG B 2 48  ? 19.407  12.810  0.129   1.00 44.02  ? 189 ARG B N     1 
ATOM   1840 C CA    . ARG B 2 48  ? 18.535  13.754  -0.579  1.00 44.68  ? 189 ARG B CA    1 
ATOM   1841 C C     . ARG B 2 48  ? 18.535  15.122  0.086   1.00 46.18  ? 189 ARG B C     1 
ATOM   1842 O O     . ARG B 2 48  ? 18.525  16.152  -0.584  1.00 47.23  ? 189 ARG B O     1 
ATOM   1843 C CB    . ARG B 2 48  ? 17.106  13.214  -0.641  1.00 48.70  ? 189 ARG B CB    1 
ATOM   1844 C CG    . ARG B 2 48  ? 16.154  14.005  -1.520  1.00 50.39  ? 189 ARG B CG    1 
ATOM   1845 C CD    . ARG B 2 48  ? 16.343  13.646  -2.981  1.00 57.47  ? 189 ARG B CD    1 
ATOM   1846 N NE    . ARG B 2 48  ? 15.457  14.431  -3.826  1.00 60.98  ? 189 ARG B NE    1 
ATOM   1847 C CZ    . ARG B 2 48  ? 15.647  15.715  -4.104  1.00 64.37  ? 189 ARG B CZ    1 
ATOM   1848 N NH1   . ARG B 2 48  ? 16.698  16.365  -3.610  1.00 63.89  ? 189 ARG B NH1   1 
ATOM   1849 N NH2   . ARG B 2 48  ? 14.786  16.349  -4.880  1.00 63.86  ? 189 ARG B NH2   1 
ATOM   1850 N N     . ARG B 2 49  ? 18.529  15.101  1.417   1.00 44.56  ? 190 ARG B N     1 
ATOM   1851 C CA    . ARG B 2 49  ? 18.595  16.290  2.262   1.00 43.02  ? 190 ARG B CA    1 
ATOM   1852 C C     . ARG B 2 49  ? 19.889  17.077  2.016   1.00 45.66  ? 190 ARG B C     1 
ATOM   1853 O O     . ARG B 2 49  ? 19.889  18.310  1.970   1.00 49.53  ? 190 ARG B O     1 
ATOM   1854 C CB    . ARG B 2 49  ? 18.497  15.854  3.719   1.00 45.98  ? 190 ARG B CB    1 
ATOM   1855 C CG    . ARG B 2 49  ? 17.708  16.716  4.673   1.00 48.43  ? 190 ARG B CG    1 
ATOM   1856 C CD    . ARG B 2 49  ? 17.827  16.095  6.072   1.00 47.13  ? 190 ARG B CD    1 
ATOM   1857 N NE    . ARG B 2 49  ? 16.858  15.022  6.291   1.00 51.37  ? 190 ARG B NE    1 
ATOM   1858 C CZ    . ARG B 2 49  ? 17.148  13.791  6.718   1.00 48.56  ? 190 ARG B CZ    1 
ATOM   1859 N NH1   . ARG B 2 49  ? 18.400  13.456  6.967   1.00 45.20  ? 190 ARG B NH1   1 
ATOM   1860 N NH2   . ARG B 2 49  ? 16.176  12.885  6.893   1.00 47.76  ? 190 ARG B NH2   1 
ATOM   1861 N N     . TYR B 2 50  ? 20.991  16.347  1.859   1.00 44.99  ? 191 TYR B N     1 
ATOM   1862 C CA    . TYR B 2 50  ? 22.274  16.947  1.549   1.00 44.09  ? 191 TYR B CA    1 
ATOM   1863 C C     . TYR B 2 50  ? 22.240  17.544  0.181   1.00 51.31  ? 191 TYR B C     1 
ATOM   1864 O O     . TYR B 2 50  ? 22.377  18.755  0.015   1.00 56.27  ? 191 TYR B O     1 
ATOM   1865 C CB    . TYR B 2 50  ? 23.405  15.925  1.607   1.00 47.45  ? 191 TYR B CB    1 
ATOM   1866 C CG    . TYR B 2 50  ? 24.769  16.528  1.328   1.00 51.53  ? 191 TYR B CG    1 
ATOM   1867 C CD1   . TYR B 2 50  ? 25.337  17.451  2.206   1.00 53.48  ? 191 TYR B CD1   1 
ATOM   1868 C CD2   . TYR B 2 50  ? 25.490  16.178  0.200   1.00 49.90  ? 191 TYR B CD2   1 
ATOM   1869 C CE1   . TYR B 2 50  ? 26.584  18.009  1.963   1.00 53.30  ? 191 TYR B CE1   1 
ATOM   1870 C CE2   . TYR B 2 50  ? 26.749  16.730  -0.048  1.00 51.67  ? 191 TYR B CE2   1 
ATOM   1871 C CZ    . TYR B 2 50  ? 27.286  17.646  0.834   1.00 52.98  ? 191 TYR B CZ    1 
ATOM   1872 O OH    . TYR B 2 50  ? 28.523  18.205  0.590   1.00 52.29  ? 191 TYR B OH    1 
ATOM   1873 N N     . LYS B 2 51  ? 22.028  16.677  -0.804  1.00 54.21  ? 192 LYS B N     1 
ATOM   1874 C CA    . LYS B 2 51  ? 22.222  17.043  -2.202  1.00 53.67  ? 192 LYS B CA    1 
ATOM   1875 C C     . LYS B 2 51  ? 21.349  18.245  -2.578  1.00 53.78  ? 192 LYS B C     1 
ATOM   1876 O O     . LYS B 2 51  ? 21.741  19.063  -3.412  1.00 53.15  ? 192 LYS B O     1 
ATOM   1877 C CB    . LYS B 2 51  ? 21.971  15.825  -3.110  1.00 50.67  ? 192 LYS B CB    1 
ATOM   1878 C CG    . LYS B 2 51  ? 21.103  16.075  -4.345  1.00 70.81  ? 192 LYS B CG    1 
ATOM   1879 C CD    . LYS B 2 51  ? 20.873  14.778  -5.156  1.00 75.32  ? 192 LYS B CD    1 
ATOM   1880 C CE    . LYS B 2 51  ? 19.973  13.778  -4.406  1.00 74.58  ? 192 LYS B CE    1 
ATOM   1881 N NZ    . LYS B 2 51  ? 19.513  12.620  -5.246  1.00 74.96  ? 192 LYS B NZ    1 
ATOM   1882 N N     . SER B 2 52  ? 20.205  18.386  -1.909  1.00 55.91  ? 193 SER B N     1 
ATOM   1883 C CA    . SER B 2 52  ? 19.315  19.527  -2.128  1.00 58.65  ? 193 SER B CA    1 
ATOM   1884 C C     . SER B 2 52  ? 19.825  20.766  -1.394  1.00 59.42  ? 193 SER B C     1 
ATOM   1885 O O     . SER B 2 52  ? 19.108  21.381  -0.606  1.00 63.59  ? 193 SER B O     1 
ATOM   1886 C CB    . SER B 2 52  ? 17.894  19.194  -1.672  1.00 54.27  ? 193 SER B CB    1 
ATOM   1887 O OG    . SER B 2 52  ? 17.781  19.261  -0.252  1.00 56.03  ? 193 SER B OG    1 
ATOM   1888 N N     . LYS B 2 53  ? 21.071  21.125  -1.669  1.00 64.13  ? 194 LYS B N     1 
ATOM   1889 C CA    . LYS B 2 53  ? 21.720  22.237  -0.994  1.00 65.62  ? 194 LYS B CA    1 
ATOM   1890 C C     . LYS B 2 53  ? 23.112  22.482  -1.594  1.00 69.10  ? 194 LYS B C     1 
ATOM   1891 O O     . LYS B 2 53  ? 23.603  23.608  -1.579  1.00 74.11  ? 194 LYS B O     1 
ATOM   1892 C CB    . LYS B 2 53  ? 21.817  21.954  0.499   1.00 62.60  ? 194 LYS B CB    1 
ATOM   1893 C CG    . LYS B 2 53  ? 22.113  23.155  1.356   1.00 71.62  ? 194 LYS B CG    1 
ATOM   1894 C CD    . LYS B 2 53  ? 22.287  22.716  2.807   1.00 74.67  ? 194 LYS B CD    1 
ATOM   1895 C CE    . LYS B 2 53  ? 23.305  21.573  2.931   1.00 67.30  ? 194 LYS B CE    1 
ATOM   1896 N NZ    . LYS B 2 53  ? 24.684  21.922  2.448   1.00 62.79  ? 194 LYS B NZ    1 
ATOM   1897 O OXT   . LYS B 2 53  ? 23.780  21.584  -2.124  1.00 58.16  ? 194 LYS B OXT   1 
ATOM   1898 N N     . GLY C 1 1   ? -10.089 40.184  -21.813 1.00 76.74  ? 53  GLY E N     1 
ATOM   1899 C CA    . GLY C 1 1   ? -11.459 40.501  -22.189 1.00 76.68  ? 53  GLY E CA    1 
ATOM   1900 C C     . GLY C 1 1   ? -12.196 39.315  -22.793 1.00 73.42  ? 53  GLY E C     1 
ATOM   1901 O O     . GLY C 1 1   ? -13.240 39.467  -23.431 1.00 63.30  ? 53  GLY E O     1 
ATOM   1902 N N     . ILE C 1 2   ? -11.639 38.127  -22.581 1.00 74.85  ? 54  ILE E N     1 
ATOM   1903 C CA    . ILE C 1 2   ? -12.172 36.881  -23.124 1.00 69.68  ? 54  ILE E CA    1 
ATOM   1904 C C     . ILE C 1 2   ? -13.266 36.333  -22.228 1.00 67.36  ? 54  ILE E C     1 
ATOM   1905 O O     . ILE C 1 2   ? -13.332 36.701  -21.058 1.00 72.20  ? 54  ILE E O     1 
ATOM   1906 C CB    . ILE C 1 2   ? -11.060 35.815  -23.246 1.00 71.54  ? 54  ILE E CB    1 
ATOM   1907 C CG1   . ILE C 1 2   ? -9.766  36.438  -23.759 1.00 71.57  ? 54  ILE E CG1   1 
ATOM   1908 C CG2   . ILE C 1 2   ? -11.480 34.676  -24.149 1.00 72.00  ? 54  ILE E CG2   1 
ATOM   1909 C CD1   . ILE C 1 2   ? -8.594  35.507  -23.660 1.00 77.75  ? 54  ILE E CD1   1 
ATOM   1910 N N     . LYS C 1 3   ? -14.111 35.447  -22.752 1.00 59.94  ? 55  LYS E N     1 
ATOM   1911 C CA    . LYS C 1 3   ? -14.986 34.666  -21.881 1.00 58.46  ? 55  LYS E CA    1 
ATOM   1912 C C     . LYS C 1 3   ? -15.234 33.225  -22.380 1.00 56.96  ? 55  LYS E C     1 
ATOM   1913 O O     . LYS C 1 3   ? -15.086 32.919  -23.559 1.00 56.94  ? 55  LYS E O     1 
ATOM   1914 C CB    . LYS C 1 3   ? -16.317 35.403  -21.664 1.00 60.98  ? 55  LYS E CB    1 
ATOM   1915 C CG    . LYS C 1 3   ? -16.823 35.238  -20.212 1.00 73.97  ? 55  LYS E CG    1 
ATOM   1916 C CD    . LYS C 1 3   ? -18.091 36.030  -19.878 1.00 74.30  ? 55  LYS E CD    1 
ATOM   1917 C CE    . LYS C 1 3   ? -18.741 35.514  -18.588 1.00 75.87  ? 55  LYS E CE    1 
ATOM   1918 N NZ    . LYS C 1 3   ? -17.818 34.699  -17.732 1.00 71.71  ? 55  LYS E NZ    1 
ATOM   1919 N N     . VAL C 1 4   ? -15.580 32.344  -21.446 1.00 54.96  ? 56  VAL E N     1 
ATOM   1920 C CA    . VAL C 1 4   ? -15.822 30.931  -21.710 1.00 47.84  ? 56  VAL E CA    1 
ATOM   1921 C C     . VAL C 1 4   ? -17.162 30.565  -21.134 1.00 47.42  ? 56  VAL E C     1 
ATOM   1922 O O     . VAL C 1 4   ? -17.617 31.207  -20.199 1.00 53.15  ? 56  VAL E O     1 
ATOM   1923 C CB    . VAL C 1 4   ? -14.772 30.022  -21.048 1.00 52.06  ? 56  VAL E CB    1 
ATOM   1924 C CG1   . VAL C 1 4   ? -14.843 28.611  -21.620 1.00 51.22  ? 56  VAL E CG1   1 
ATOM   1925 C CG2   . VAL C 1 4   ? -13.383 30.597  -21.195 1.00 50.14  ? 56  VAL E CG2   1 
ATOM   1926 N N     . PHE C 1 5   ? -17.780 29.515  -21.647 1.00 45.31  ? 57  PHE E N     1 
ATOM   1927 C CA    . PHE C 1 5   ? -19.077 29.090  -21.139 1.00 50.85  ? 57  PHE E CA    1 
ATOM   1928 C C     . PHE C 1 5   ? -19.157 27.574  -21.098 1.00 51.24  ? 57  PHE E C     1 
ATOM   1929 O O     . PHE C 1 5   ? -18.828 26.913  -22.074 1.00 54.23  ? 57  PHE E O     1 
ATOM   1930 C CB    . PHE C 1 5   ? -20.206 29.673  -22.002 1.00 53.00  ? 57  PHE E CB    1 
ATOM   1931 C CG    . PHE C 1 5   ? -20.264 31.173  -21.971 1.00 52.64  ? 57  PHE E CG    1 
ATOM   1932 C CD1   . PHE C 1 5   ? -20.851 31.833  -20.904 1.00 53.39  ? 57  PHE E CD1   1 
ATOM   1933 C CD2   . PHE C 1 5   ? -19.693 31.924  -22.985 1.00 53.07  ? 57  PHE E CD2   1 
ATOM   1934 C CE1   . PHE C 1 5   ? -20.886 33.215  -20.850 1.00 58.37  ? 57  PHE E CE1   1 
ATOM   1935 C CE2   . PHE C 1 5   ? -19.722 33.304  -22.937 1.00 58.31  ? 57  PHE E CE2   1 
ATOM   1936 C CZ    . PHE C 1 5   ? -20.323 33.951  -21.863 1.00 59.68  ? 57  PHE E CZ    1 
ATOM   1937 N N     . LEU C 1 6   ? -19.587 27.012  -19.973 1.00 52.66  ? 58  LEU E N     1 
ATOM   1938 C CA    . LEU C 1 6   ? -19.600 25.559  -19.840 1.00 49.93  ? 58  LEU E CA    1 
ATOM   1939 C C     . LEU C 1 6   ? -20.807 24.961  -20.577 1.00 51.98  ? 58  LEU E C     1 
ATOM   1940 O O     . LEU C 1 6   ? -21.953 25.216  -20.217 1.00 56.26  ? 58  LEU E O     1 
ATOM   1941 C CB    . LEU C 1 6   ? -19.595 25.150  -18.363 1.00 46.11  ? 58  LEU E CB    1 
ATOM   1942 C CG    . LEU C 1 6   ? -19.744 23.653  -18.123 1.00 42.57  ? 58  LEU E CG    1 
ATOM   1943 C CD1   . LEU C 1 6   ? -18.653 22.906  -18.840 1.00 40.46  ? 58  LEU E CD1   1 
ATOM   1944 C CD2   . LEU C 1 6   ? -19.751 23.343  -16.640 1.00 44.30  ? 58  LEU E CD2   1 
ATOM   1945 N N     . HIS C 1 7   ? -20.536 24.180  -21.621 1.00 48.23  ? 59  HIS E N     1 
ATOM   1946 C CA    . HIS C 1 7   ? -21.573 23.505  -22.389 1.00 46.31  ? 59  HIS E CA    1 
ATOM   1947 C C     . HIS C 1 7   ? -22.212 22.409  -21.570 1.00 49.65  ? 59  HIS E C     1 
ATOM   1948 O O     . HIS C 1 7   ? -21.514 21.695  -20.864 1.00 58.12  ? 59  HIS E O     1 
ATOM   1949 C CB    . HIS C 1 7   ? -20.984 22.928  -23.669 1.00 50.63  ? 59  HIS E CB    1 
ATOM   1950 C CG    . HIS C 1 7   ? -21.883 21.963  -24.376 1.00 58.18  ? 59  HIS E CG    1 
ATOM   1951 N ND1   . HIS C 1 7   ? -22.957 22.369  -25.141 1.00 64.29  ? 59  HIS E ND1   1 
ATOM   1952 C CD2   . HIS C 1 7   ? -21.876 20.610  -24.430 1.00 60.60  ? 59  HIS E CD2   1 
ATOM   1953 C CE1   . HIS C 1 7   ? -23.573 21.309  -25.634 1.00 68.37  ? 59  HIS E CE1   1 
ATOM   1954 N NE2   . HIS C 1 7   ? -22.937 20.227  -25.218 1.00 63.84  ? 59  HIS E NE2   1 
ATOM   1955 N N     . GLU C 1 8   ? -23.531 22.280  -21.664 1.00 49.61  ? 60  GLU E N     1 
ATOM   1956 C CA    . GLU C 1 8   ? -24.307 21.313  -20.877 1.00 51.67  ? 60  GLU E CA    1 
ATOM   1957 C C     . GLU C 1 8   ? -24.136 21.506  -19.379 1.00 49.31  ? 60  GLU E C     1 
ATOM   1958 O O     . GLU C 1 8   ? -23.827 20.572  -18.636 1.00 45.06  ? 60  GLU E O     1 
ATOM   1959 C CB    . GLU C 1 8   ? -23.974 19.865  -21.270 1.00 55.60  ? 60  GLU E CB    1 
ATOM   1960 C CG    . GLU C 1 8   ? -24.986 19.336  -22.292 1.00 71.22  ? 60  GLU E CG    1 
ATOM   1961 C CD    . GLU C 1 8   ? -24.688 17.937  -22.850 1.00 82.00  ? 60  GLU E CD    1 
ATOM   1962 O OE1   . GLU C 1 8   ? -23.751 17.232  -22.365 1.00 72.03  ? 60  GLU E OE1   1 
ATOM   1963 O OE2   . GLU C 1 8   ? -25.448 17.546  -23.778 1.00 80.95  ? 60  GLU E OE2   1 
ATOM   1964 N N     . ARG C 1 9   ? -24.392 22.733  -18.948 1.00 49.30  ? 61  ARG E N     1 
ATOM   1965 C CA    . ARG C 1 9   ? -24.190 23.126  -17.568 1.00 42.64  ? 61  ARG E CA    1 
ATOM   1966 C C     . ARG C 1 9   ? -25.198 22.503  -16.629 1.00 45.37  ? 61  ARG E C     1 
ATOM   1967 O O     . ARG C 1 9   ? -24.867 22.184  -15.500 1.00 51.31  ? 61  ARG E O     1 
ATOM   1968 C CB    . ARG C 1 9   ? -24.242 24.642  -17.443 1.00 43.44  ? 61  ARG E CB    1 
ATOM   1969 C CG    . ARG C 1 9   ? -24.120 25.118  -16.033 1.00 52.94  ? 61  ARG E CG    1 
ATOM   1970 C CD    . ARG C 1 9   ? -23.395 26.439  -15.967 1.00 63.59  ? 61  ARG E CD    1 
ATOM   1971 N NE    . ARG C 1 9   ? -24.329 27.555  -15.871 1.00 73.79  ? 61  ARG E NE    1 
ATOM   1972 C CZ    . ARG C 1 9   ? -24.714 28.099  -14.723 1.00 75.22  ? 61  ARG E CZ    1 
ATOM   1973 N NH1   . ARG C 1 9   ? -24.240 27.623  -13.575 1.00 65.53  ? 61  ARG E NH1   1 
ATOM   1974 N NH2   . ARG C 1 9   ? -25.570 29.115  -14.724 1.00 82.95  ? 61  ARG E NH2   1 
ATOM   1975 N N     . GLU C 1 10  ? -26.434 22.316  -17.073 1.00 51.72  ? 62  GLU E N     1 
ATOM   1976 C CA    . GLU C 1 10  ? -27.445 21.821  -16.148 1.00 51.41  ? 62  GLU E CA    1 
ATOM   1977 C C     . GLU C 1 10  ? -27.115 20.388  -15.740 1.00 46.83  ? 62  GLU E C     1 
ATOM   1978 O O     . GLU C 1 10  ? -27.307 20.007  -14.596 1.00 45.68  ? 62  GLU E O     1 
ATOM   1979 C CB    . GLU C 1 10  ? -28.856 21.934  -16.744 1.00 57.73  ? 62  GLU E CB    1 
ATOM   1980 C CG    . GLU C 1 10  ? -29.138 21.174  -18.052 1.00 62.47  ? 62  GLU E CG    1 
ATOM   1981 C CD    . GLU C 1 10  ? -30.636 21.234  -18.455 1.00 76.45  ? 62  GLU E CD    1 
ATOM   1982 O OE1   . GLU C 1 10  ? -31.507 20.796  -17.658 1.00 68.49  ? 62  GLU E OE1   1 
ATOM   1983 O OE2   . GLU C 1 10  ? -30.944 21.727  -19.568 1.00 81.01  ? 62  GLU E OE2   1 
ATOM   1984 N N     . LEU C 1 11  ? -26.570 19.616  -16.669 1.00 47.85  ? 63  LEU E N     1 
ATOM   1985 C CA    . LEU C 1 11  ? -26.116 18.265  -16.371 1.00 44.50  ? 63  LEU E CA    1 
ATOM   1986 C C     . LEU C 1 11  ? -25.022 18.250  -15.307 1.00 45.93  ? 63  LEU E C     1 
ATOM   1987 O O     . LEU C 1 11  ? -25.088 17.464  -14.359 1.00 47.63  ? 63  LEU E O     1 
ATOM   1988 C CB    . LEU C 1 11  ? -25.610 17.586  -17.639 1.00 42.69  ? 63  LEU E CB    1 
ATOM   1989 C CG    . LEU C 1 11  ? -25.244 16.115  -17.464 1.00 42.28  ? 63  LEU E CG    1 
ATOM   1990 C CD1   . LEU C 1 11  ? -26.432 15.341  -16.897 1.00 44.52  ? 63  LEU E CD1   1 
ATOM   1991 C CD2   . LEU C 1 11  ? -24.747 15.489  -18.769 1.00 44.03  ? 63  LEU E CD2   1 
ATOM   1992 N N     . TRP C 1 12  ? -24.014 19.107  -15.467 1.00 44.84  ? 64  TRP E N     1 
ATOM   1993 C CA    . TRP C 1 12  ? -22.937 19.222  -14.473 1.00 46.54  ? 64  TRP E CA    1 
ATOM   1994 C C     . TRP C 1 12  ? -23.492 19.535  -13.098 1.00 45.56  ? 64  TRP E C     1 
ATOM   1995 O O     . TRP C 1 12  ? -23.151 18.892  -12.111 1.00 41.63  ? 64  TRP E O     1 
ATOM   1996 C CB    . TRP C 1 12  ? -21.930 20.300  -14.875 1.00 44.04  ? 64  TRP E CB    1 
ATOM   1997 C CG    . TRP C 1 12  ? -20.906 19.807  -15.835 1.00 43.68  ? 64  TRP E CG    1 
ATOM   1998 C CD1   . TRP C 1 12  ? -20.855 20.054  -17.165 1.00 43.19  ? 64  TRP E CD1   1 
ATOM   1999 C CD2   . TRP C 1 12  ? -19.788 18.960  -15.536 1.00 48.57  ? 64  TRP E CD2   1 
ATOM   2000 N NE1   . TRP C 1 12  ? -19.775 19.421  -17.720 1.00 47.64  ? 64  TRP E NE1   1 
ATOM   2001 C CE2   . TRP C 1 12  ? -19.098 18.743  -16.742 1.00 43.23  ? 64  TRP E CE2   1 
ATOM   2002 C CE3   . TRP C 1 12  ? -19.291 18.375  -14.355 1.00 46.55  ? 64  TRP E CE3   1 
ATOM   2003 C CZ2   . TRP C 1 12  ? -17.946 17.965  -16.817 1.00 45.60  ? 64  TRP E CZ2   1 
ATOM   2004 C CZ3   . TRP C 1 12  ? -18.144 17.597  -14.428 1.00 41.39  ? 64  TRP E CZ3   1 
ATOM   2005 C CH2   . TRP C 1 12  ? -17.482 17.403  -15.648 1.00 45.97  ? 64  TRP E CH2   1 
ATOM   2006 N N     . LEU C 1 13  ? -24.369 20.528  -13.071 1.00 47.28  ? 65  LEU E N     1 
ATOM   2007 C CA    . LEU C 1 13  ? -25.052 20.963  -11.869 1.00 45.07  ? 65  LEU E CA    1 
ATOM   2008 C C     . LEU C 1 13  ? -25.845 19.858  -11.162 1.00 46.64  ? 65  LEU E C     1 
ATOM   2009 O O     . LEU C 1 13  ? -25.875 19.820  -9.930  1.00 50.25  ? 65  LEU E O     1 
ATOM   2010 C CB    . LEU C 1 13  ? -25.967 22.133  -12.217 1.00 46.24  ? 65  LEU E CB    1 
ATOM   2011 C CG    . LEU C 1 13  ? -25.206 23.452  -12.287 1.00 46.16  ? 65  LEU E CG    1 
ATOM   2012 C CD1   . LEU C 1 13  ? -26.125 24.582  -12.645 1.00 49.26  ? 65  LEU E CD1   1 
ATOM   2013 C CD2   . LEU C 1 13  ? -24.565 23.711  -10.944 1.00 50.52  ? 65  LEU E CD2   1 
ATOM   2014 N N     . LYS C 1 14  ? -26.484 18.967  -11.920 1.00 43.27  ? 66  LYS E N     1 
ATOM   2015 C CA    . LYS C 1 14  ? -27.165 17.816  -11.313 1.00 45.15  ? 66  LYS E CA    1 
ATOM   2016 C C     . LYS C 1 14  ? -26.164 16.908  -10.596 1.00 48.50  ? 66  LYS E C     1 
ATOM   2017 O O     . LYS C 1 14  ? -26.414 16.454  -9.488  1.00 48.65  ? 66  LYS E O     1 
ATOM   2018 C CB    . LYS C 1 14  ? -27.931 17.000  -12.356 1.00 46.21  ? 66  LYS E CB    1 
ATOM   2019 C CG    . LYS C 1 14  ? -29.047 17.747  -13.036 1.00 52.53  ? 66  LYS E CG    1 
ATOM   2020 C CD    . LYS C 1 14  ? -29.750 16.878  -14.065 1.00 55.85  ? 66  LYS E CD    1 
ATOM   2021 C CE    . LYS C 1 14  ? -30.458 15.687  -13.417 1.00 63.50  ? 66  LYS E CE    1 
ATOM   2022 N NZ    . LYS C 1 14  ? -31.473 15.064  -14.334 1.00 57.35  ? 66  LYS E NZ    1 
ATOM   2023 N N     . PHE C 1 15  ? -25.038 16.629  -11.248 1.00 51.53  ? 67  PHE E N     1 
ATOM   2024 C CA    . PHE C 1 15  ? -23.966 15.843  -10.644 1.00 48.17  ? 67  PHE E CA    1 
ATOM   2025 C C     . PHE C 1 15  ? -23.370 16.537  -9.420  1.00 49.81  ? 67  PHE E C     1 
ATOM   2026 O O     . PHE C 1 15  ? -22.994 15.906  -8.430  1.00 45.46  ? 67  PHE E O     1 
ATOM   2027 C CB    . PHE C 1 15  ? -22.866 15.601  -11.663 1.00 47.28  ? 67  PHE E CB    1 
ATOM   2028 C CG    . PHE C 1 15  ? -23.155 14.500  -12.608 1.00 45.76  ? 67  PHE E CG    1 
ATOM   2029 C CD1   . PHE C 1 15  ? -22.838 13.199  -12.283 1.00 45.31  ? 67  PHE E CD1   1 
ATOM   2030 C CD2   . PHE C 1 15  ? -23.721 14.762  -13.832 1.00 44.63  ? 67  PHE E CD2   1 
ATOM   2031 C CE1   . PHE C 1 15  ? -23.102 12.174  -13.151 1.00 42.41  ? 67  PHE E CE1   1 
ATOM   2032 C CE2   . PHE C 1 15  ? -23.976 13.741  -14.705 1.00 46.42  ? 67  PHE E CE2   1 
ATOM   2033 C CZ    . PHE C 1 15  ? -23.671 12.446  -14.361 1.00 46.40  ? 67  PHE E CZ    1 
ATOM   2034 N N     . HIS C 1 16  ? -23.259 17.852  -9.528  1.00 50.30  ? 68  HIS E N     1 
ATOM   2035 C CA    . HIS C 1 16  ? -22.695 18.655  -8.473  1.00 49.03  ? 68  HIS E CA    1 
ATOM   2036 C C     . HIS C 1 16  ? -23.416 18.427  -7.195  1.00 49.86  ? 68  HIS E C     1 
ATOM   2037 O O     . HIS C 1 16  ? -22.797 18.074  -6.208  1.00 54.38  ? 68  HIS E O     1 
ATOM   2038 C CB    . HIS C 1 16  ? -22.772 20.128  -8.809  1.00 50.67  ? 68  HIS E CB    1 
ATOM   2039 C CG    . HIS C 1 16  ? -21.846 20.972  -8.001  1.00 49.71  ? 68  HIS E CG    1 
ATOM   2040 N ND1   . HIS C 1 16  ? -20.544 20.604  -7.742  1.00 49.71  ? 68  HIS E ND1   1 
ATOM   2041 C CD2   . HIS C 1 16  ? -22.017 22.187  -7.430  1.00 50.78  ? 68  HIS E CD2   1 
ATOM   2042 C CE1   . HIS C 1 16  ? -19.954 21.551  -7.038  1.00 49.54  ? 68  HIS E CE1   1 
ATOM   2043 N NE2   . HIS C 1 16  ? -20.825 22.524  -6.840  1.00 52.39  ? 68  HIS E NE2   1 
ATOM   2044 N N     . GLU C 1 17  ? -24.731 18.627  -7.214  1.00 54.65  ? 69  GLU E N     1 
ATOM   2045 C CA    . GLU C 1 17  ? -25.479 18.652  -5.965  1.00 60.15  ? 69  GLU E CA    1 
ATOM   2046 C C     . GLU C 1 17  ? -25.462 17.287  -5.278  1.00 58.79  ? 69  GLU E C     1 
ATOM   2047 O O     . GLU C 1 17  ? -25.507 17.213  -4.049  1.00 65.91  ? 69  GLU E O     1 
ATOM   2048 C CB    . GLU C 1 17  ? -26.916 19.137  -6.179  1.00 59.52  ? 69  GLU E CB    1 
ATOM   2049 C CG    . GLU C 1 17  ? -27.186 20.524  -5.538  1.00 73.30  ? 69  GLU E CG    1 
ATOM   2050 C CD    . GLU C 1 17  ? -26.906 20.607  -4.012  1.00 89.37  ? 69  GLU E CD    1 
ATOM   2051 O OE1   . GLU C 1 17  ? -26.823 19.561  -3.323  1.00 87.48  ? 69  GLU E OE1   1 
ATOM   2052 O OE2   . GLU C 1 17  ? -26.759 21.743  -3.498  1.00 90.01  ? 69  GLU E OE2   1 
ATOM   2053 N N     . VAL C 1 18  ? -25.347 16.212  -6.048  1.00 51.38  ? 70  VAL E N     1 
ATOM   2054 C CA    . VAL C 1 18  ? -25.219 14.893  -5.434  1.00 54.95  ? 70  VAL E CA    1 
ATOM   2055 C C     . VAL C 1 18  ? -23.810 14.636  -4.849  1.00 53.00  ? 70  VAL E C     1 
ATOM   2056 O O     . VAL C 1 18  ? -23.669 13.915  -3.866  1.00 58.18  ? 70  VAL E O     1 
ATOM   2057 C CB    . VAL C 1 18  ? -25.574 13.770  -6.441  1.00 54.48  ? 70  VAL E CB    1 
ATOM   2058 C CG1   . VAL C 1 18  ? -25.266 12.394  -5.857  1.00 54.13  ? 70  VAL E CG1   1 
ATOM   2059 C CG2   . VAL C 1 18  ? -27.022 13.848  -6.837  1.00 44.41  ? 70  VAL E CG2   1 
ATOM   2060 N N     . GLY C 1 19  ? -22.774 15.232  -5.429  1.00 53.74  ? 71  GLY E N     1 
ATOM   2061 C CA    . GLY C 1 19  ? -21.407 14.958  -4.999  1.00 51.71  ? 71  GLY E CA    1 
ATOM   2062 C C     . GLY C 1 19  ? -20.599 14.162  -6.021  1.00 48.79  ? 71  GLY E C     1 
ATOM   2063 O O     . GLY C 1 19  ? -20.374 12.958  -5.845  1.00 45.47  ? 71  GLY E O     1 
ATOM   2064 N N     . THR C 1 20  ? -20.144 14.866  -7.062  1.00 48.74  ? 72  THR E N     1 
ATOM   2065 C CA    . THR C 1 20  ? -19.595 14.300  -8.305  1.00 44.51  ? 72  THR E CA    1 
ATOM   2066 C C     . THR C 1 20  ? -18.395 13.369  -8.154  1.00 44.13  ? 72  THR E C     1 
ATOM   2067 O O     . THR C 1 20  ? -17.445 13.683  -7.447  1.00 49.04  ? 72  THR E O     1 
ATOM   2068 C CB    . THR C 1 20  ? -19.166 15.425  -9.255  1.00 44.52  ? 72  THR E CB    1 
ATOM   2069 O OG1   . THR C 1 20  ? -20.089 16.515  -9.160  1.00 47.99  ? 72  THR E OG1   1 
ATOM   2070 C CG2   . THR C 1 20  ? -19.126 14.922  -10.676 1.00 46.14  ? 72  THR E CG2   1 
ATOM   2071 N N     . GLU C 1 21  ? -18.431 12.232  -8.842  1.00 42.49  ? 73  GLU E N     1 
ATOM   2072 C CA    . GLU C 1 21  ? -17.342 11.260  -8.781  1.00 42.02  ? 73  GLU E CA    1 
ATOM   2073 C C     . GLU C 1 21  ? -16.847 10.897  -10.178 1.00 40.90  ? 73  GLU E C     1 
ATOM   2074 O O     . GLU C 1 21  ? -17.624 10.474  -11.018 1.00 48.48  ? 73  GLU E O     1 
ATOM   2075 C CB    . GLU C 1 21  ? -17.794 10.003  -8.025  1.00 44.87  ? 73  GLU E CB    1 
ATOM   2076 C CG    . GLU C 1 21  ? -17.958 10.236  -6.513  1.00 45.59  ? 73  GLU E CG    1 
ATOM   2077 C CD    . GLU C 1 21  ? -18.958 9.289   -5.837  1.00 49.56  ? 73  GLU E CD    1 
ATOM   2078 O OE1   . GLU C 1 21  ? -18.755 8.050   -5.925  1.00 47.72  ? 73  GLU E OE1   1 
ATOM   2079 O OE2   . GLU C 1 21  ? -19.936 9.794   -5.212  1.00 46.83  ? 73  GLU E OE2   1 
ATOM   2080 N N     . MET C 1 22  ? -15.562 11.103  -10.442 1.00 36.76  ? 74  MET E N     1 
ATOM   2081 C CA    . MET C 1 22  ? -14.972 10.639  -11.692 1.00 37.96  ? 74  MET E CA    1 
ATOM   2082 C C     . MET C 1 22  ? -14.166 9.396   -11.403 1.00 38.74  ? 74  MET E C     1 
ATOM   2083 O O     . MET C 1 22  ? -13.280 9.422   -10.565 1.00 40.74  ? 74  MET E O     1 
ATOM   2084 C CB    . MET C 1 22  ? -14.064 11.692  -12.332 1.00 38.11  ? 74  MET E CB    1 
ATOM   2085 C CG    . MET C 1 22  ? -14.749 12.971  -12.758 1.00 36.93  ? 74  MET E CG    1 
ATOM   2086 S SD    . MET C 1 22  ? -16.068 12.739  -13.935 1.00 43.75  ? 74  MET E SD    1 
ATOM   2087 C CE    . MET C 1 22  ? -16.693 14.411  -14.046 1.00 39.93  ? 74  MET E CE    1 
ATOM   2088 N N     . ILE C 1 23  ? -14.481 8.304   -12.080 1.00 36.62  ? 75  ILE E N     1 
ATOM   2089 C CA    . ILE C 1 23  ? -13.688 7.095   -11.972 1.00 35.81  ? 75  ILE E CA    1 
ATOM   2090 C C     . ILE C 1 23  ? -12.277 7.322   -12.550 1.00 38.70  ? 75  ILE E C     1 
ATOM   2091 O O     . ILE C 1 23  ? -12.129 8.047   -13.537 1.00 37.69  ? 75  ILE E O     1 
ATOM   2092 C CB    . ILE C 1 23  ? -14.403 5.940   -12.681 1.00 32.35  ? 75  ILE E CB    1 
ATOM   2093 C CG1   . ILE C 1 23  ? -15.426 5.314   -11.722 1.00 37.91  ? 75  ILE E CG1   1 
ATOM   2094 C CG2   . ILE C 1 23  ? -13.405 4.930   -13.230 1.00 30.27  ? 75  ILE E CG2   1 
ATOM   2095 C CD1   . ILE C 1 23  ? -16.252 4.223   -12.329 1.00 40.75  ? 75  ILE E CD1   1 
ATOM   2096 N N     . ILE C 1 24  ? -11.243 6.768   -11.905 1.00 35.70  ? 76  ILE E N     1 
ATOM   2097 C CA    . ILE C 1 24  ? -9.899  6.728   -12.495 1.00 33.14  ? 76  ILE E CA    1 
ATOM   2098 C C     . ILE C 1 24  ? -9.388  5.299   -12.567 1.00 34.70  ? 76  ILE E C     1 
ATOM   2099 O O     . ILE C 1 24  ? -9.743  4.466   -11.755 1.00 42.14  ? 76  ILE E O     1 
ATOM   2100 C CB    . ILE C 1 24  ? -8.888  7.594   -11.726 1.00 32.91  ? 76  ILE E CB    1 
ATOM   2101 C CG1   . ILE C 1 24  ? -8.613  7.051   -10.326 1.00 35.15  ? 76  ILE E CG1   1 
ATOM   2102 C CG2   . ILE C 1 24  ? -9.370  9.021   -11.636 1.00 32.66  ? 76  ILE E CG2   1 
ATOM   2103 C CD1   . ILE C 1 24  ? -7.787  7.995   -9.486  1.00 33.77  ? 76  ILE E CD1   1 
ATOM   2104 N N     . THR C 1 25  ? -8.603  4.989   -13.579 1.00 34.85  ? 77  THR E N     1 
ATOM   2105 C CA    . THR C 1 25  ? -8.103  3.635   -13.740 1.00 37.45  ? 77  THR E CA    1 
ATOM   2106 C C     . THR C 1 25  ? -6.663  3.673   -14.234 1.00 43.33  ? 77  THR E C     1 
ATOM   2107 O O     . THR C 1 25  ? -6.106  4.744   -14.496 1.00 43.78  ? 77  THR E O     1 
ATOM   2108 C CB    . THR C 1 25  ? -8.926  2.810   -14.742 1.00 35.03  ? 77  THR E CB    1 
ATOM   2109 O OG1   . THR C 1 25  ? -8.611  3.234   -16.069 1.00 41.73  ? 77  THR E OG1   1 
ATOM   2110 C CG2   . THR C 1 25  ? -10.429 2.958   -14.523 1.00 36.64  ? 77  THR E CG2   1 
ATOM   2111 N N     . LYS C 1 26  ? -6.078  2.493   -14.393 1.00 42.85  ? 78  LYS E N     1 
ATOM   2112 C CA    . LYS C 1 26  ? -4.691  2.362   -14.802 1.00 38.23  ? 78  LYS E CA    1 
ATOM   2113 C C     . LYS C 1 26  ? -4.545  2.788   -16.269 1.00 37.09  ? 78  LYS E C     1 
ATOM   2114 O O     . LYS C 1 26  ? -3.744  3.670   -16.606 1.00 36.61  ? 78  LYS E O     1 
ATOM   2115 C CB    . LYS C 1 26  ? -4.230  0.917   -14.574 1.00 39.80  ? 78  LYS E CB    1 
ATOM   2116 C CG    . LYS C 1 26  ? -2.747  0.718   -14.385 1.00 44.27  ? 78  LYS E CG    1 
ATOM   2117 C CD    . LYS C 1 26  ? -2.403  -0.753  -14.567 1.00 52.25  ? 78  LYS E CD    1 
ATOM   2118 C CE    . LYS C 1 26  ? -0.944  -0.954  -14.956 1.00 50.37  ? 78  LYS E CE    1 
ATOM   2119 N NZ    . LYS C 1 26  ? -0.826  -1.916  -16.100 1.00 52.92  ? 78  LYS E NZ    1 
ATOM   2120 N N     . ALA C 1 27  ? -5.346  2.163   -17.127 1.00 39.98  ? 79  ALA E N     1 
ATOM   2121 C CA    . ALA C 1 27  ? -5.416  2.483   -18.558 1.00 31.86  ? 79  ALA E CA    1 
ATOM   2122 C C     . ALA C 1 27  ? -5.830  3.926   -18.848 1.00 32.87  ? 79  ALA E C     1 
ATOM   2123 O O     . ALA C 1 27  ? -5.346  4.535   -19.781 1.00 38.50  ? 79  ALA E O     1 
ATOM   2124 C CB    . ALA C 1 27  ? -6.367  1.546   -19.232 1.00 31.60  ? 79  ALA E CB    1 
ATOM   2125 N N     . GLY C 1 28  ? -6.716  4.487   -18.050 1.00 34.32  ? 80  GLY E N     1 
ATOM   2126 C CA    . GLY C 1 28  ? -7.160  5.842   -18.299 1.00 36.00  ? 80  GLY E CA    1 
ATOM   2127 C C     . GLY C 1 28  ? -8.653  5.840   -18.531 1.00 36.59  ? 80  GLY E C     1 
ATOM   2128 O O     . GLY C 1 28  ? -9.178  4.954   -19.200 1.00 37.82  ? 80  GLY E O     1 
ATOM   2129 N N     . ARG C 1 29  ? -9.344  6.805   -17.938 1.00 33.19  ? 81  ARG E N     1 
ATOM   2130 C CA    . ARG C 1 29  ? -10.788 6.902   -18.057 1.00 32.73  ? 81  ARG E CA    1 
ATOM   2131 C C     . ARG C 1 29  ? -11.160 8.346   -18.357 1.00 36.36  ? 81  ARG E C     1 
ATOM   2132 O O     . ARG C 1 29  ? -10.616 9.247   -17.740 1.00 38.16  ? 81  ARG E O     1 
ATOM   2133 C CB    . ARG C 1 29  ? -11.449 6.451   -16.778 1.00 34.56  ? 81  ARG E CB    1 
ATOM   2134 C CG    . ARG C 1 29  ? -12.885 6.071   -16.919 1.00 32.66  ? 81  ARG E CG    1 
ATOM   2135 C CD    . ARG C 1 29  ? -13.007 4.618   -17.333 1.00 33.25  ? 81  ARG E CD    1 
ATOM   2136 N NE    . ARG C 1 29  ? -14.293 4.077   -16.908 1.00 33.61  ? 81  ARG E NE    1 
ATOM   2137 C CZ    . ARG C 1 29  ? -14.671 2.816   -17.076 1.00 34.23  ? 81  ARG E CZ    1 
ATOM   2138 N NH1   . ARG C 1 29  ? -13.863 1.943   -17.678 1.00 22.87  ? 81  ARG E NH1   1 
ATOM   2139 N NH2   . ARG C 1 29  ? -15.866 2.434   -16.630 1.00 33.18  ? 81  ARG E NH2   1 
ATOM   2140 N N     . ARG C 1 30  ? -12.054 8.587   -19.306 1.00 30.85  ? 82  ARG E N     1 
ATOM   2141 C CA    . ARG C 1 30  ? -12.390 9.965   -19.626 1.00 31.51  ? 82  ARG E CA    1 
ATOM   2142 C C     . ARG C 1 30  ? -13.510 10.437  -18.739 1.00 33.66  ? 82  ARG E C     1 
ATOM   2143 O O     . ARG C 1 30  ? -14.253 9.629   -18.220 1.00 38.85  ? 82  ARG E O     1 
ATOM   2144 C CB    . ARG C 1 30  ? -12.780 10.100  -21.094 1.00 42.50  ? 82  ARG E CB    1 
ATOM   2145 C CG    . ARG C 1 30  ? -13.567 8.922   -21.634 1.00 39.64  ? 82  ARG E CG    1 
ATOM   2146 C CD    . ARG C 1 30  ? -14.300 9.300   -22.885 1.00 35.21  ? 82  ARG E CD    1 
ATOM   2147 N NE    . ARG C 1 30  ? -13.469 9.191   -24.074 1.00 44.09  ? 82  ARG E NE    1 
ATOM   2148 C CZ    . ARG C 1 30  ? -13.956 9.160   -25.313 1.00 46.24  ? 82  ARG E CZ    1 
ATOM   2149 N NH1   . ARG C 1 30  ? -15.274 9.229   -25.524 1.00 38.37  ? 82  ARG E NH1   1 
ATOM   2150 N NH2   . ARG C 1 30  ? -13.124 9.058   -26.335 1.00 41.81  ? 82  ARG E NH2   1 
ATOM   2151 N N     . MET C 1 31  ? -13.635 11.740  -18.543 1.00 34.53  ? 83  MET E N     1 
ATOM   2152 C CA    . MET C 1 31  ? -14.665 12.242  -17.635 1.00 38.68  ? 83  MET E CA    1 
ATOM   2153 C C     . MET C 1 31  ? -16.077 12.213  -18.208 1.00 43.11  ? 83  MET E C     1 
ATOM   2154 O O     . MET C 1 31  ? -16.291 12.547  -19.378 1.00 51.61  ? 83  MET E O     1 
ATOM   2155 C CB    . MET C 1 31  ? -14.388 13.678  -17.227 1.00 36.56  ? 83  MET E CB    1 
ATOM   2156 C CG    . MET C 1 31  ? -13.078 13.950  -16.590 1.00 37.78  ? 83  MET E CG    1 
ATOM   2157 S SD    . MET C 1 31  ? -13.051 15.733  -16.374 1.00 52.79  ? 83  MET E SD    1 
ATOM   2158 C CE    . MET C 1 31  ? -13.698 16.258  -17.963 1.00 43.42  ? 83  MET E CE    1 
ATOM   2159 N N     . PHE C 1 32  ? -17.050 11.859  -17.377 1.00 40.64  ? 84  PHE E N     1 
ATOM   2160 C CA    . PHE C 1 32  ? -18.446 12.119  -17.713 1.00 44.21  ? 84  PHE E CA    1 
ATOM   2161 C C     . PHE C 1 32  ? -19.130 12.863  -16.582 1.00 42.66  ? 84  PHE E C     1 
ATOM   2162 O O     . PHE C 1 32  ? -19.072 12.412  -15.438 1.00 41.02  ? 84  PHE E O     1 
ATOM   2163 C CB    . PHE C 1 32  ? -19.206 10.840  -18.004 1.00 44.33  ? 84  PHE E CB    1 
ATOM   2164 C CG    . PHE C 1 32  ? -20.558 11.087  -18.554 1.00 43.42  ? 84  PHE E CG    1 
ATOM   2165 C CD1   . PHE C 1 32  ? -21.613 11.409  -17.720 1.00 45.45  ? 84  PHE E CD1   1 
ATOM   2166 C CD2   . PHE C 1 32  ? -20.779 11.025  -19.914 1.00 45.39  ? 84  PHE E CD2   1 
ATOM   2167 C CE1   . PHE C 1 32  ? -22.874 11.654  -18.237 1.00 49.83  ? 84  PHE E CE1   1 
ATOM   2168 C CE2   . PHE C 1 32  ? -22.035 11.273  -20.439 1.00 48.76  ? 84  PHE E CE2   1 
ATOM   2169 C CZ    . PHE C 1 32  ? -23.087 11.583  -19.600 1.00 46.16  ? 84  PHE E CZ    1 
ATOM   2170 N N     . PRO C 1 33  ? -19.791 13.997  -16.887 1.00 41.33  ? 85  PRO E N     1 
ATOM   2171 C CA    . PRO C 1 33  ? -19.999 14.684  -18.160 1.00 43.59  ? 85  PRO E CA    1 
ATOM   2172 C C     . PRO C 1 33  ? -18.713 15.049  -18.892 1.00 44.91  ? 85  PRO E C     1 
ATOM   2173 O O     . PRO C 1 33  ? -17.681 15.243  -18.273 1.00 42.39  ? 85  PRO E O     1 
ATOM   2174 C CB    . PRO C 1 33  ? -20.728 15.965  -17.747 1.00 43.90  ? 85  PRO E CB    1 
ATOM   2175 C CG    . PRO C 1 33  ? -21.313 15.672  -16.444 1.00 43.90  ? 85  PRO E CG    1 
ATOM   2176 C CD    . PRO C 1 33  ? -20.338 14.787  -15.775 1.00 43.75  ? 85  PRO E CD    1 
ATOM   2177 N N     . SER C 1 34  ? -18.789 15.130  -20.211 1.00 43.96  ? 86  SER E N     1 
ATOM   2178 C CA    . SER C 1 34  ? -17.655 15.543  -20.995 1.00 41.12  ? 86  SER E CA    1 
ATOM   2179 C C     . SER C 1 34  ? -17.463 17.046  -20.919 1.00 46.48  ? 86  SER E C     1 
ATOM   2180 O O     . SER C 1 34  ? -18.423 17.819  -20.944 1.00 50.79  ? 86  SER E O     1 
ATOM   2181 C CB    . SER C 1 34  ? -17.828 15.089  -22.427 1.00 48.88  ? 86  SER E CB    1 
ATOM   2182 O OG    . SER C 1 34  ? -17.746 13.678  -22.468 1.00 56.71  ? 86  SER E OG    1 
ATOM   2183 N N     . TYR C 1 35  ? -16.209 17.452  -20.791 1.00 44.90  ? 87  TYR E N     1 
ATOM   2184 C CA    . TYR C 1 35  ? -15.875 18.850  -20.637 1.00 42.72  ? 87  TYR E CA    1 
ATOM   2185 C C     . TYR C 1 35  ? -15.860 19.528  -22.017 1.00 48.36  ? 87  TYR E C     1 
ATOM   2186 O O     . TYR C 1 35  ? -14.941 19.335  -22.819 1.00 47.90  ? 87  TYR E O     1 
ATOM   2187 C CB    . TYR C 1 35  ? -14.531 18.972  -19.925 1.00 39.47  ? 87  TYR E CB    1 
ATOM   2188 C CG    . TYR C 1 35  ? -14.216 20.334  -19.375 1.00 37.34  ? 87  TYR E CG    1 
ATOM   2189 C CD1   . TYR C 1 35  ? -13.540 21.268  -20.129 1.00 44.08  ? 87  TYR E CD1   1 
ATOM   2190 C CD2   . TYR C 1 35  ? -14.586 20.682  -18.101 1.00 37.93  ? 87  TYR E CD2   1 
ATOM   2191 C CE1   . TYR C 1 35  ? -13.248 22.512  -19.626 1.00 42.62  ? 87  TYR E CE1   1 
ATOM   2192 C CE2   . TYR C 1 35  ? -14.313 21.923  -17.596 1.00 40.74  ? 87  TYR E CE2   1 
ATOM   2193 C CZ    . TYR C 1 35  ? -13.638 22.840  -18.356 1.00 40.71  ? 87  TYR E CZ    1 
ATOM   2194 O OH    . TYR C 1 35  ? -13.343 24.085  -17.832 1.00 41.76  ? 87  TYR E OH    1 
ATOM   2195 N N     . LYS C 1 36  ? -16.895 20.312  -22.298 1.00 49.94  ? 88  LYS E N     1 
ATOM   2196 C CA    . LYS C 1 36  ? -16.950 21.085  -23.534 1.00 44.45  ? 88  LYS E CA    1 
ATOM   2197 C C     . LYS C 1 36  ? -17.222 22.553  -23.229 1.00 44.85  ? 88  LYS E C     1 
ATOM   2198 O O     . LYS C 1 36  ? -17.943 22.879  -22.294 1.00 46.39  ? 88  LYS E O     1 
ATOM   2199 C CB    . LYS C 1 36  ? -18.021 20.528  -24.465 1.00 46.94  ? 88  LYS E CB    1 
ATOM   2200 C CG    . LYS C 1 36  ? -17.744 19.120  -24.942 1.00 46.43  ? 88  LYS E CG    1 
ATOM   2201 C CD    . LYS C 1 36  ? -18.937 18.548  -25.670 1.00 46.16  ? 88  LYS E CD    1 
ATOM   2202 C CE    . LYS C 1 36  ? -18.838 17.037  -25.800 1.00 48.46  ? 88  LYS E CE    1 
ATOM   2203 N NZ    . LYS C 1 36  ? -17.809 16.608  -26.775 1.00 50.54  ? 88  LYS E NZ    1 
ATOM   2204 N N     . VAL C 1 37  ? -16.636 23.447  -24.009 1.00 44.19  ? 89  VAL E N     1 
ATOM   2205 C CA    . VAL C 1 37  ? -16.863 24.864  -23.783 1.00 45.01  ? 89  VAL E CA    1 
ATOM   2206 C C     . VAL C 1 37  ? -17.123 25.645  -25.069 1.00 45.14  ? 89  VAL E C     1 
ATOM   2207 O O     . VAL C 1 37  ? -16.788 25.195  -26.157 1.00 48.66  ? 89  VAL E O     1 
ATOM   2208 C CB    . VAL C 1 37  ? -15.670 25.503  -23.082 1.00 43.53  ? 89  VAL E CB    1 
ATOM   2209 C CG1   . VAL C 1 37  ? -15.444 24.869  -21.726 1.00 46.04  ? 89  VAL E CG1   1 
ATOM   2210 C CG2   . VAL C 1 37  ? -14.448 25.360  -23.950 1.00 43.35  ? 89  VAL E CG2   1 
ATOM   2211 N N     . LYS C 1 38  ? -17.728 26.817  -24.917 1.00 42.52  ? 90  LYS E N     1 
ATOM   2212 C CA    . LYS C 1 38  ? -17.814 27.807  -25.971 1.00 49.29  ? 90  LYS E CA    1 
ATOM   2213 C C     . LYS C 1 38  ? -16.912 28.987  -25.626 1.00 48.36  ? 90  LYS E C     1 
ATOM   2214 O O     . LYS C 1 38  ? -16.948 29.490  -24.514 1.00 51.03  ? 90  LYS E O     1 
ATOM   2215 C CB    . LYS C 1 38  ? -19.260 28.275  -26.167 1.00 52.27  ? 90  LYS E CB    1 
ATOM   2216 C CG    . LYS C 1 38  ? -19.445 29.364  -27.225 1.00 51.49  ? 90  LYS E CG    1 
ATOM   2217 C CD    . LYS C 1 38  ? -18.965 28.895  -28.601 1.00 63.05  ? 90  LYS E CD    1 
ATOM   2218 C CE    . LYS C 1 38  ? -19.217 29.951  -29.690 1.00 66.77  ? 90  LYS E CE    1 
ATOM   2219 N NZ    . LYS C 1 38  ? -18.232 31.081  -29.638 1.00 60.44  ? 90  LYS E NZ    1 
ATOM   2220 N N     . VAL C 1 39  ? -16.116 29.429  -26.594 1.00 51.17  ? 91  VAL E N     1 
ATOM   2221 C CA    . VAL C 1 39  ? -15.157 30.514  -26.398 1.00 54.69  ? 91  VAL E CA    1 
ATOM   2222 C C     . VAL C 1 39  ? -15.466 31.741  -27.255 1.00 56.54  ? 91  VAL E C     1 
ATOM   2223 O O     . VAL C 1 39  ? -15.617 31.618  -28.468 1.00 64.53  ? 91  VAL E O     1 
ATOM   2224 C CB    . VAL C 1 39  ? -13.718 30.038  -26.724 1.00 57.00  ? 91  VAL E CB    1 
ATOM   2225 C CG1   . VAL C 1 39  ? -12.739 31.201  -26.690 1.00 58.16  ? 91  VAL E CG1   1 
ATOM   2226 C CG2   . VAL C 1 39  ? -13.288 28.960  -25.749 1.00 53.41  ? 91  VAL E CG2   1 
ATOM   2227 N N     . THR C 1 40  ? -15.556 32.921  -26.642 1.00 52.31  ? 92  THR E N     1 
ATOM   2228 C CA    . THR C 1 40  ? -15.754 34.146  -27.418 1.00 59.99  ? 92  THR E CA    1 
ATOM   2229 C C     . THR C 1 40  ? -14.692 35.208  -27.122 1.00 60.75  ? 92  THR E C     1 
ATOM   2230 O O     . THR C 1 40  ? -13.899 35.060  -26.198 1.00 62.62  ? 92  THR E O     1 
ATOM   2231 C CB    . THR C 1 40  ? -17.145 34.766  -27.169 1.00 60.80  ? 92  THR E CB    1 
ATOM   2232 O OG1   . THR C 1 40  ? -17.208 35.281  -25.833 1.00 63.69  ? 92  THR E OG1   1 
ATOM   2233 C CG2   . THR C 1 40  ? -18.248 33.735  -27.380 1.00 54.43  ? 92  THR E CG2   1 
ATOM   2234 N N     . GLY C 1 41  ? -14.676 36.272  -27.919 1.00 58.65  ? 93  GLY E N     1 
ATOM   2235 C CA    . GLY C 1 41  ? -13.855 37.436  -27.628 1.00 59.47  ? 93  GLY E CA    1 
ATOM   2236 C C     . GLY C 1 41  ? -12.360 37.260  -27.812 1.00 66.33  ? 93  GLY E C     1 
ATOM   2237 O O     . GLY C 1 41  ? -11.560 37.741  -27.010 1.00 71.97  ? 93  GLY E O     1 
ATOM   2238 N N     . LEU C 1 42  ? -11.968 36.566  -28.869 1.00 61.82  ? 94  LEU E N     1 
ATOM   2239 C CA    . LEU C 1 42  ? -10.557 36.405  -29.175 1.00 57.42  ? 94  LEU E CA    1 
ATOM   2240 C C     . LEU C 1 42  ? -10.279 37.033  -30.515 1.00 70.23  ? 94  LEU E C     1 
ATOM   2241 O O     . LEU C 1 42  ? -11.149 37.043  -31.387 1.00 83.79  ? 94  LEU E O     1 
ATOM   2242 C CB    . LEU C 1 42  ? -10.157 34.934  -29.231 1.00 58.04  ? 94  LEU E CB    1 
ATOM   2243 C CG    . LEU C 1 42  ? -10.332 33.998  -28.044 1.00 62.71  ? 94  LEU E CG    1 
ATOM   2244 C CD1   . LEU C 1 42  ? -10.052 32.566  -28.487 1.00 51.99  ? 94  LEU E CD1   1 
ATOM   2245 C CD2   . LEU C 1 42  ? -9.410  34.423  -26.929 1.00 65.45  ? 94  LEU E CD2   1 
ATOM   2246 N N     . ASN C 1 43  ? -9.067  37.533  -30.699 1.00 66.10  ? 95  ASN E N     1 
ATOM   2247 C CA    . ASN C 1 43  ? -8.629  37.964  -32.015 1.00 66.70  ? 95  ASN E CA    1 
ATOM   2248 C C     . ASN C 1 43  ? -8.622  36.734  -32.950 1.00 68.05  ? 95  ASN E C     1 
ATOM   2249 O O     . ASN C 1 43  ? -7.971  35.731  -32.659 1.00 66.26  ? 95  ASN E O     1 
ATOM   2250 C CB    . ASN C 1 43  ? -7.255  38.637  -31.889 1.00 68.49  ? 95  ASN E CB    1 
ATOM   2251 C CG    . ASN C 1 43  ? -6.692  39.096  -33.209 1.00 75.02  ? 95  ASN E CG    1 
ATOM   2252 O OD1   . ASN C 1 43  ? -7.132  38.677  -34.285 1.00 75.88  ? 95  ASN E OD1   1 
ATOM   2253 N ND2   . ASN C 1 43  ? -5.698  39.973  -33.137 1.00 76.44  ? 95  ASN E ND2   1 
ATOM   2254 N N     . PRO C 1 44  ? -9.386  36.784  -34.058 1.00 69.63  ? 96  PRO E N     1 
ATOM   2255 C CA    . PRO C 1 44  ? -9.484  35.585  -34.899 1.00 64.87  ? 96  PRO E CA    1 
ATOM   2256 C C     . PRO C 1 44  ? -8.282  35.404  -35.809 1.00 68.94  ? 96  PRO E C     1 
ATOM   2257 O O     . PRO C 1 44  ? -8.147  34.359  -36.447 1.00 72.22  ? 96  PRO E O     1 
ATOM   2258 C CB    . PRO C 1 44  ? -10.744 35.833  -35.731 1.00 62.66  ? 96  PRO E CB    1 
ATOM   2259 C CG    . PRO C 1 44  ? -11.468 36.924  -35.020 1.00 67.94  ? 96  PRO E CG    1 
ATOM   2260 C CD    . PRO C 1 44  ? -10.396 37.783  -34.434 1.00 65.87  ? 96  PRO E CD    1 
ATOM   2261 N N     . LYS C 1 45  ? -7.426  36.413  -35.893 1.00 65.75  ? 97  LYS E N     1 
ATOM   2262 C CA    . LYS C 1 45  ? -6.222  36.272  -36.686 1.00 66.89  ? 97  LYS E CA    1 
ATOM   2263 C C     . LYS C 1 45  ? -5.122  35.641  -35.831 1.00 73.12  ? 97  LYS E C     1 
ATOM   2264 O O     . LYS C 1 45  ? -4.309  34.848  -36.334 1.00 70.84  ? 97  LYS E O     1 
ATOM   2265 C CB    . LYS C 1 45  ? -5.911  37.571  -37.346 1.00 70.62  ? 97  LYS E CB    1 
ATOM   2266 C CG    . LYS C 1 45  ? -6.945  38.098  -38.322 1.00 74.54  ? 97  LYS E CG    1 
ATOM   2267 C CD    . LYS C 1 45  ? -6.470  39.360  -38.952 1.00 86.39  ? 97  LYS E CD    1 
ATOM   2268 C CE    . LYS C 1 45  ? -7.347  39.905  -40.043 1.00 89.86  ? 97  LYS E CE    1 
ATOM   2269 N NZ    . LYS C 1 45  ? -8.914  40.354  -39.544 1.00 85.45  ? 97  LYS E NZ    1 
ATOM   2270 N N     . THR C 1 46  ? -5.129  35.975  -34.538 1.00 69.31  ? 98  THR E N     1 
ATOM   2271 C CA    . THR C 1 46  ? -4.138  35.492  -33.574 1.00 65.45  ? 98  THR E CA    1 
ATOM   2272 C C     . THR C 1 46  ? -4.209  33.971  -33.386 1.00 67.24  ? 98  THR E C     1 
ATOM   2273 O O     . THR C 1 46  ? -5.278  33.361  -33.541 1.00 61.83  ? 98  THR E O     1 
ATOM   2274 C CB    . THR C 1 46  ? -4.316  36.199  -32.217 1.00 61.20  ? 98  THR E CB    1 
ATOM   2275 O OG1   . THR C 1 46  ? -4.171  37.608  -32.402 1.00 61.34  ? 98  THR E OG1   1 
ATOM   2276 C CG2   . THR C 1 46  ? -3.297  35.732  -31.198 1.00 61.54  ? 98  THR E CG2   1 
ATOM   2277 N N     . LYS C 1 47  ? -3.050  33.375  -33.085 1.00 69.19  ? 99  LYS E N     1 
ATOM   2278 C CA    . LYS C 1 47  ? -2.902  31.934  -32.867 1.00 65.06  ? 99  LYS E CA    1 
ATOM   2279 C C     . LYS C 1 47  ? -2.910  31.618  -31.386 1.00 64.15  ? 99  LYS E C     1 
ATOM   2280 O O     . LYS C 1 47  ? -2.282  32.326  -30.612 1.00 69.08  ? 99  LYS E O     1 
ATOM   2281 C CB    . LYS C 1 47  ? -1.607  31.423  -33.484 1.00 67.51  ? 99  LYS E CB    1 
ATOM   2282 C CG    . LYS C 1 47  ? -1.573  31.486  -34.997 1.00 66.58  ? 99  LYS E CG    1 
ATOM   2283 C CD    . LYS C 1 47  ? -0.249  30.983  -35.483 1.00 76.00  ? 99  LYS E CD    1 
ATOM   2284 C CE    . LYS C 1 47  ? -0.227  31.024  -36.996 1.00 93.06  ? 99  LYS E CE    1 
ATOM   2285 N NZ    . LYS C 1 47  ? 1.070   30.559  -37.542 1.00 97.82  ? 99  LYS E NZ    1 
ATOM   2286 N N     . TYR C 1 48  ? -3.609  30.552  -31.001 1.00 61.99  ? 100 TYR E N     1 
ATOM   2287 C CA    . TYR C 1 48  ? -3.809  30.215  -29.592 1.00 56.83  ? 100 TYR E CA    1 
ATOM   2288 C C     . TYR C 1 48  ? -3.575  28.735  -29.300 1.00 53.66  ? 100 TYR E C     1 
ATOM   2289 O O     . TYR C 1 48  ? -3.822  27.886  -30.163 1.00 49.49  ? 100 TYR E O     1 
ATOM   2290 C CB    . TYR C 1 48  ? -5.229  30.569  -29.145 1.00 53.59  ? 100 TYR E CB    1 
ATOM   2291 C CG    . TYR C 1 48  ? -5.531  32.032  -28.896 1.00 55.88  ? 100 TYR E CG    1 
ATOM   2292 C CD1   . TYR C 1 48  ? -6.178  32.802  -29.858 1.00 56.20  ? 100 TYR E CD1   1 
ATOM   2293 C CD2   . TYR C 1 48  ? -5.213  32.631  -27.679 1.00 55.84  ? 100 TYR E CD2   1 
ATOM   2294 C CE1   . TYR C 1 48  ? -6.488  34.139  -29.622 1.00 57.39  ? 100 TYR E CE1   1 
ATOM   2295 C CE2   . TYR C 1 48  ? -5.512  33.963  -27.436 1.00 61.75  ? 100 TYR E CE2   1 
ATOM   2296 C CZ    . TYR C 1 48  ? -6.153  34.714  -28.413 1.00 65.25  ? 100 TYR E CZ    1 
ATOM   2297 O OH    . TYR C 1 48  ? -6.451  36.042  -28.177 1.00 66.28  ? 100 TYR E OH    1 
ATOM   2298 N N     . ILE C 1 49  ? -3.109  28.438  -28.079 1.00 56.95  ? 101 ILE E N     1 
ATOM   2299 C CA    . ILE C 1 49  ? -3.055  27.061  -27.568 1.00 51.40  ? 101 ILE E CA    1 
ATOM   2300 C C     . ILE C 1 49  ? -4.107  26.892  -26.492 1.00 45.25  ? 101 ILE E C     1 
ATOM   2301 O O     . ILE C 1 49  ? -4.253  27.738  -25.616 1.00 44.37  ? 101 ILE E O     1 
ATOM   2302 C CB    . ILE C 1 49  ? -1.675  26.669  -26.974 1.00 45.47  ? 101 ILE E CB    1 
ATOM   2303 C CG1   . ILE C 1 49  ? -0.593  26.708  -28.061 1.00 44.41  ? 101 ILE E CG1   1 
ATOM   2304 C CG2   . ILE C 1 49  ? -1.760  25.276  -26.365 1.00 37.41  ? 101 ILE E CG2   1 
ATOM   2305 C CD1   . ILE C 1 49  ? 0.654   25.902  -27.750 1.00 40.73  ? 101 ILE E CD1   1 
ATOM   2306 N N     . LEU C 1 50  ? -4.866  25.813  -26.580 1.00 44.55  ? 102 LEU E N     1 
ATOM   2307 C CA    . LEU C 1 50  ? -5.825  25.507  -25.540 1.00 46.94  ? 102 LEU E CA    1 
ATOM   2308 C C     . LEU C 1 50  ? -5.515  24.183  -24.886 1.00 45.22  ? 102 LEU E C     1 
ATOM   2309 O O     . LEU C 1 50  ? -5.347  23.161  -25.548 1.00 46.75  ? 102 LEU E O     1 
ATOM   2310 C CB    . LEU C 1 50  ? -7.244  25.487  -26.086 1.00 50.58  ? 102 LEU E CB    1 
ATOM   2311 C CG    . LEU C 1 50  ? -8.008  26.788  -25.891 1.00 48.48  ? 102 LEU E CG    1 
ATOM   2312 C CD1   . LEU C 1 50  ? -7.632  27.775  -26.991 1.00 47.26  ? 102 LEU E CD1   1 
ATOM   2313 C CD2   . LEU C 1 50  ? -9.496  26.486  -25.869 1.00 48.06  ? 102 LEU E CD2   1 
ATOM   2314 N N     . LEU C 1 51  ? -5.474  24.216  -23.569 1.00 43.46  ? 103 LEU E N     1 
ATOM   2315 C CA    . LEU C 1 51  ? -5.090  23.068  -22.799 1.00 43.65  ? 103 LEU E CA    1 
ATOM   2316 C C     . LEU C 1 51  ? -5.941  22.997  -21.547 1.00 45.50  ? 103 LEU E C     1 
ATOM   2317 O O     . LEU C 1 51  ? -6.709  23.912  -21.241 1.00 42.84  ? 103 LEU E O     1 
ATOM   2318 C CB    . LEU C 1 51  ? -3.596  23.151  -22.482 1.00 41.78  ? 103 LEU E CB    1 
ATOM   2319 C CG    . LEU C 1 51  ? -3.157  24.423  -21.753 1.00 40.12  ? 103 LEU E CG    1 
ATOM   2320 C CD1   . LEU C 1 51  ? -3.122  24.185  -20.287 1.00 47.75  ? 103 LEU E CD1   1 
ATOM   2321 C CD2   . LEU C 1 51  ? -1.836  24.975  -22.243 1.00 41.66  ? 103 LEU E CD2   1 
ATOM   2322 N N     . MET C 1 52  ? -5.823  21.882  -20.845 1.00 47.73  ? 104 MET E N     1 
ATOM   2323 C CA    . MET C 1 52  ? -6.493  21.713  -19.569 1.00 48.41  ? 104 MET E CA    1 
ATOM   2324 C C     . MET C 1 52  ? -5.520  21.164  -18.557 1.00 40.57  ? 104 MET E C     1 
ATOM   2325 O O     . MET C 1 52  ? -4.498  20.585  -18.911 1.00 43.69  ? 104 MET E O     1 
ATOM   2326 C CB    . MET C 1 52  ? -7.692  20.783  -19.701 1.00 44.41  ? 104 MET E CB    1 
ATOM   2327 C CG    . MET C 1 52  ? -8.979  21.406  -19.237 1.00 47.91  ? 104 MET E CG    1 
ATOM   2328 S SD    . MET C 1 52  ? -10.356 20.355  -19.688 1.00 59.54  ? 104 MET E SD    1 
ATOM   2329 C CE    . MET C 1 52  ? -10.061 18.981  -18.577 1.00 47.24  ? 104 MET E CE    1 
ATOM   2330 N N     . ASP C 1 53  ? -5.828  21.376  -17.296 1.00 38.32  ? 105 ASP E N     1 
ATOM   2331 C CA    . ASP C 1 53  ? -5.155  20.655  -16.233 1.00 43.44  ? 105 ASP E CA    1 
ATOM   2332 C C     . ASP C 1 53  ? -6.134  20.484  -15.097 1.00 47.64  ? 105 ASP E C     1 
ATOM   2333 O O     . ASP C 1 53  ? -7.120  21.223  -14.979 1.00 47.16  ? 105 ASP E O     1 
ATOM   2334 C CB    . ASP C 1 53  ? -3.892  21.372  -15.758 1.00 43.67  ? 105 ASP E CB    1 
ATOM   2335 C CG    . ASP C 1 53  ? -4.183  22.702  -15.102 1.00 50.51  ? 105 ASP E CG    1 
ATOM   2336 O OD1   . ASP C 1 53  ? -5.225  23.302  -15.434 1.00 53.05  ? 105 ASP E OD1   1 
ATOM   2337 O OD2   . ASP C 1 53  ? -3.373  23.153  -14.253 1.00 54.63  ? 105 ASP E OD2   1 
ATOM   2338 N N     . ILE C 1 54  ? -5.887  19.475  -14.281 1.00 47.15  ? 106 ILE E N     1 
ATOM   2339 C CA    . ILE C 1 54  ? -6.731  19.249  -13.131 1.00 45.36  ? 106 ILE E CA    1 
ATOM   2340 C C     . ILE C 1 54  ? -5.863  19.507  -11.932 1.00 43.92  ? 106 ILE E C     1 
ATOM   2341 O O     . ILE C 1 54  ? -4.735  19.028  -11.871 1.00 46.65  ? 106 ILE E O     1 
ATOM   2342 C CB    . ILE C 1 54  ? -7.324  17.833  -13.116 1.00 43.95  ? 106 ILE E CB    1 
ATOM   2343 C CG1   . ILE C 1 54  ? -8.645  17.811  -13.879 1.00 44.55  ? 106 ILE E CG1   1 
ATOM   2344 C CG2   . ILE C 1 54  ? -7.622  17.417  -11.730 1.00 43.46  ? 106 ILE E CG2   1 
ATOM   2345 C CD1   . ILE C 1 54  ? -8.504  17.854  -15.364 1.00 36.71  ? 106 ILE E CD1   1 
ATOM   2346 N N     . VAL C 1 55  ? -6.376  20.307  -11.007 1.00 45.26  ? 107 VAL E N     1 
ATOM   2347 C CA    . VAL C 1 55  ? -5.642  20.688  -9.812  1.00 43.93  ? 107 VAL E CA    1 
ATOM   2348 C C     . VAL C 1 55  ? -6.469  20.428  -8.544  1.00 45.57  ? 107 VAL E C     1 
ATOM   2349 O O     . VAL C 1 55  ? -7.706  20.444  -8.569  1.00 40.86  ? 107 VAL E O     1 
ATOM   2350 C CB    . VAL C 1 55  ? -5.218  22.175  -9.881  1.00 45.74  ? 107 VAL E CB    1 
ATOM   2351 C CG1   . VAL C 1 55  ? -4.387  22.432  -11.131 1.00 43.94  ? 107 VAL E CG1   1 
ATOM   2352 C CG2   . VAL C 1 55  ? -6.440  23.085  -9.839  1.00 43.74  ? 107 VAL E CG2   1 
ATOM   2353 N N     . PRO C 1 56  ? -5.776  20.170  -7.423  1.00 50.36  ? 108 PRO E N     1 
ATOM   2354 C CA    . PRO C 1 56  ? -6.386  19.851  -6.119  1.00 48.92  ? 108 PRO E CA    1 
ATOM   2355 C C     . PRO C 1 56  ? -7.389  20.887  -5.602  1.00 49.66  ? 108 PRO E C     1 
ATOM   2356 O O     . PRO C 1 56  ? -7.081  22.075  -5.552  1.00 51.54  ? 108 PRO E O     1 
ATOM   2357 C CB    . PRO C 1 56  ? -5.177  19.777  -5.194  1.00 48.19  ? 108 PRO E CB    1 
ATOM   2358 C CG    . PRO C 1 56  ? -4.077  19.336  -6.078  1.00 47.11  ? 108 PRO E CG    1 
ATOM   2359 C CD    . PRO C 1 56  ? -4.317  19.965  -7.412  1.00 42.39  ? 108 PRO E CD    1 
ATOM   2360 N N     . ALA C 1 57  ? -8.577  20.429  -5.219  1.00 53.09  ? 109 ALA E N     1 
ATOM   2361 C CA    . ALA C 1 57  ? -9.623  21.324  -4.698  1.00 61.42  ? 109 ALA E CA    1 
ATOM   2362 C C     . ALA C 1 57  ? -9.319  21.836  -3.284  1.00 67.47  ? 109 ALA E C     1 
ATOM   2363 O O     . ALA C 1 57  ? -9.645  22.978  -2.946  1.00 68.15  ? 109 ALA E O     1 
ATOM   2364 C CB    . ALA C 1 57  ? -10.969 20.625  -4.710  1.00 53.65  ? 109 ALA E CB    1 
ATOM   2365 N N     . ASP C 1 58  ? -8.712  20.970  -2.472  1.00 66.81  ? 110 ASP E N     1 
ATOM   2366 C CA    . ASP C 1 58  ? -8.305  21.280  -1.107  1.00 60.61  ? 110 ASP E CA    1 
ATOM   2367 C C     . ASP C 1 58  ? -7.335  20.207  -0.623  1.00 66.31  ? 110 ASP E C     1 
ATOM   2368 O O     . ASP C 1 58  ? -7.042  19.251  -1.349  1.00 60.69  ? 110 ASP E O     1 
ATOM   2369 C CB    . ASP C 1 58  ? -9.516  21.382  -0.166  1.00 64.72  ? 110 ASP E CB    1 
ATOM   2370 C CG    . ASP C 1 58  ? -10.520 20.246  -0.363  1.00 67.54  ? 110 ASP E CG    1 
ATOM   2371 O OD1   . ASP C 1 58  ? -11.698 20.390  0.053   1.00 67.17  ? 110 ASP E OD1   1 
ATOM   2372 O OD2   . ASP C 1 58  ? -10.132 19.206  -0.939  1.00 65.92  ? 110 ASP E OD2   1 
ATOM   2373 N N     . ASP C 1 59  ? -6.857  20.370  0.609   1.00 73.64  ? 111 ASP E N     1 
ATOM   2374 C CA    . ASP C 1 59  ? -5.847  19.493  1.199   1.00 69.48  ? 111 ASP E CA    1 
ATOM   2375 C C     . ASP C 1 59  ? -6.495  18.469  2.138   1.00 72.18  ? 111 ASP E C     1 
ATOM   2376 O O     . ASP C 1 59  ? -6.261  18.488  3.351   1.00 77.99  ? 111 ASP E O     1 
ATOM   2377 C CB    . ASP C 1 59  ? -4.814  20.341  1.943   1.00 71.66  ? 111 ASP E CB    1 
ATOM   2378 C CG    . ASP C 1 59  ? -3.628  19.534  2.454   1.00 85.63  ? 111 ASP E CG    1 
ATOM   2379 O OD1   . ASP C 1 59  ? -3.785  18.341  2.801   1.00 82.67  ? 111 ASP E OD1   1 
ATOM   2380 O OD2   . ASP C 1 59  ? -2.516  20.110  2.510   1.00 92.17  ? 111 ASP E OD2   1 
ATOM   2381 N N     . HIS C 1 60  ? -7.309  17.575  1.578   1.00 67.30  ? 112 HIS E N     1 
ATOM   2382 C CA    . HIS C 1 60  ? -8.013  16.584  2.384   1.00 61.99  ? 112 HIS E CA    1 
ATOM   2383 C C     . HIS C 1 60  ? -8.161  15.273  1.651   1.00 56.79  ? 112 HIS E C     1 
ATOM   2384 O O     . HIS C 1 60  ? -8.376  15.268  0.450   1.00 64.05  ? 112 HIS E O     1 
ATOM   2385 C CB    . HIS C 1 60  ? -9.406  17.082  2.767   1.00 63.75  ? 112 HIS E CB    1 
ATOM   2386 C CG    . HIS C 1 60  ? -9.422  18.419  3.438   1.00 65.78  ? 112 HIS E CG    1 
ATOM   2387 N ND1   . HIS C 1 60  ? -9.564  19.601  2.742   1.00 69.95  ? 112 HIS E ND1   1 
ATOM   2388 C CD2   . HIS C 1 60  ? -9.338  18.762  4.745   1.00 66.85  ? 112 HIS E CD2   1 
ATOM   2389 C CE1   . HIS C 1 60  ? -9.560  20.614  3.588   1.00 72.71  ? 112 HIS E CE1   1 
ATOM   2390 N NE2   . HIS C 1 60  ? -9.425  20.132  4.810   1.00 74.73  ? 112 HIS E NE2   1 
ATOM   2391 N N     . ARG C 1 61  ? -8.048  14.168  2.375   1.00 55.87  ? 113 ARG E N     1 
ATOM   2392 C CA    . ARG C 1 61  ? -8.435  12.859  1.865   1.00 53.70  ? 113 ARG E CA    1 
ATOM   2393 C C     . ARG C 1 61  ? -9.880  12.645  2.267   1.00 52.37  ? 113 ARG E C     1 
ATOM   2394 O O     . ARG C 1 61  ? -10.345 13.294  3.186   1.00 55.03  ? 113 ARG E O     1 
ATOM   2395 C CB    . ARG C 1 61  ? -7.527  11.765  2.428   1.00 58.13  ? 113 ARG E CB    1 
ATOM   2396 C CG    . ARG C 1 61  ? -7.634  10.427  1.725   1.00 61.70  ? 113 ARG E CG    1 
ATOM   2397 C CD    . ARG C 1 61  ? -6.361  9.617   1.915   1.00 72.29  ? 113 ARG E CD    1 
ATOM   2398 N NE    . ARG C 1 61  ? -6.434  8.300   1.280   1.00 81.14  ? 113 ARG E NE    1 
ATOM   2399 C CZ    . ARG C 1 61  ? -5.610  7.285   1.553   1.00 98.54  ? 113 ARG E CZ    1 
ATOM   2400 N NH1   . ARG C 1 61  ? -4.637  7.425   2.449   1.00 96.06  ? 113 ARG E NH1   1 
ATOM   2401 N NH2   . ARG C 1 61  ? -5.751  6.121   0.930   1.00 105.22 ? 113 ARG E NH2   1 
ATOM   2402 N N     . TYR C 1 62  ? -10.610 11.764  1.593   1.00 54.63  ? 114 TYR E N     1 
ATOM   2403 C CA    . TYR C 1 62  ? -12.018 11.549  1.961   1.00 54.98  ? 114 TYR E CA    1 
ATOM   2404 C C     . TYR C 1 62  ? -12.372 10.081  2.114   1.00 55.11  ? 114 TYR E C     1 
ATOM   2405 O O     . TYR C 1 62  ? -11.637 9.201   1.674   1.00 53.99  ? 114 TYR E O     1 
ATOM   2406 C CB    . TYR C 1 62  ? -12.973 12.188  0.942   1.00 48.55  ? 114 TYR E CB    1 
ATOM   2407 C CG    . TYR C 1 62  ? -12.954 13.694  0.958   1.00 48.89  ? 114 TYR E CG    1 
ATOM   2408 C CD1   . TYR C 1 62  ? -12.098 14.395  0.133   1.00 50.19  ? 114 TYR E CD1   1 
ATOM   2409 C CD2   . TYR C 1 62  ? -13.768 14.415  1.812   1.00 52.16  ? 114 TYR E CD2   1 
ATOM   2410 C CE1   . TYR C 1 62  ? -12.055 15.767  0.144   1.00 51.51  ? 114 TYR E CE1   1 
ATOM   2411 C CE2   . TYR C 1 62  ? -13.732 15.803  1.832   1.00 52.09  ? 114 TYR E CE2   1 
ATOM   2412 C CZ    . TYR C 1 62  ? -12.868 16.468  0.991   1.00 54.03  ? 114 TYR E CZ    1 
ATOM   2413 O OH    . TYR C 1 62  ? -12.805 17.841  0.977   1.00 58.42  ? 114 TYR E OH    1 
ATOM   2414 N N     . LYS C 1 63  ? -13.486 9.816   2.875   1.00 58.61  ? 115 LYS E N     1 
ATOM   2415 C CA    . LYS C 1 63  ? -13.961 8.448   3.002   1.00 59.38  ? 115 LYS E CA    1 
ATOM   2416 C C     . LYS C 1 63  ? -15.456 8.457   2.885   1.00 56.58  ? 115 LYS E C     1 
ATOM   2417 O O     . LYS C 1 63  ? -16.124 9.337   3.423   1.00 57.45  ? 115 LYS E O     1 
ATOM   2418 C CB    . LYS C 1 63  ? -13.540 7.802   4.332   1.00 62.35  ? 115 LYS E CB    1 
ATOM   2419 C CG    . LYS C 1 63  ? -14.182 8.402   5.587   1.00 69.97  ? 115 LYS E CG    1 
ATOM   2420 C CD    . LYS C 1 63  ? -14.031 7.468   6.801   1.00 72.59  ? 115 LYS E CD    1 
ATOM   2421 C CE    . LYS C 1 63  ? -15.194 7.634   7.785   1.00 71.75  ? 115 LYS E CE    1 
ATOM   2422 N NZ    . LYS C 1 63  ? -15.487 6.377   8.535   1.00 65.72  ? 115 LYS E NZ    1 
ATOM   2423 N N     . PHE C 1 64  ? -15.975 7.485   2.153   1.00 60.32  ? 116 PHE E N     1 
ATOM   2424 C CA    . PHE C 1 64  ? -17.414 7.320   2.031   1.00 60.77  ? 116 PHE E CA    1 
ATOM   2425 C C     . PHE C 1 64  ? -17.917 6.187   2.883   1.00 62.77  ? 116 PHE E C     1 
ATOM   2426 O O     . PHE C 1 64  ? -17.879 5.045   2.445   1.00 61.89  ? 116 PHE E O     1 
ATOM   2427 C CB    . PHE C 1 64  ? -17.814 7.067   0.571   1.00 56.65  ? 116 PHE E CB    1 
ATOM   2428 C CG    . PHE C 1 64  ? -19.262 7.377   0.272   1.00 55.68  ? 116 PHE E CG    1 
ATOM   2429 C CD1   . PHE C 1 64  ? -19.701 8.691   0.250   1.00 58.42  ? 116 PHE E CD1   1 
ATOM   2430 C CD2   . PHE C 1 64  ? -20.192 6.362   0.024   1.00 54.43  ? 116 PHE E CD2   1 
ATOM   2431 C CE1   . PHE C 1 64  ? -21.040 9.000   -0.029  1.00 57.02  ? 116 PHE E CE1   1 
ATOM   2432 C CE2   . PHE C 1 64  ? -21.525 6.665   -0.239  1.00 50.79  ? 116 PHE E CE2   1 
ATOM   2433 C CZ    . PHE C 1 64  ? -21.945 7.991   -0.267  1.00 52.19  ? 116 PHE E CZ    1 
ATOM   2434 N N     . ALA C 1 65  ? -18.361 6.489   4.101   1.00 74.27  ? 117 ALA E N     1 
ATOM   2435 C CA    . ALA C 1 65  ? -19.316 5.611   4.780   1.00 78.38  ? 117 ALA E CA    1 
ATOM   2436 C C     . ALA C 1 65  ? -20.711 6.172   4.489   1.00 82.58  ? 117 ALA E C     1 
ATOM   2437 O O     . ALA C 1 65  ? -20.910 6.822   3.452   1.00 90.64  ? 117 ALA E O     1 
ATOM   2438 C CB    . ALA C 1 65  ? -19.052 5.552   6.263   1.00 77.01  ? 117 ALA E CB    1 
ATOM   2439 N N     . ASP C 1 66  ? -21.684 5.801   5.323   1.00 77.79  ? 118 ASP E N     1 
ATOM   2440 C CA    . ASP C 1 66  ? -22.783 6.670   5.756   1.00 76.95  ? 118 ASP E CA    1 
ATOM   2441 C C     . ASP C 1 66  ? -23.529 7.053   4.458   1.00 83.54  ? 118 ASP E C     1 
ATOM   2442 O O     . ASP C 1 66  ? -23.822 6.083   3.712   1.00 85.70  ? 118 ASP E O     1 
ATOM   2443 C CB    . ASP C 1 66  ? -22.262 7.539   6.901   1.00 91.14  ? 118 ASP E CB    1 
ATOM   2444 C CG    . ASP C 1 66  ? -20.974 8.360   6.510   1.00 97.59  ? 118 ASP E CG    1 
ATOM   2445 O OD1   . ASP C 1 66  ? -19.982 8.327   7.269   1.00 97.36  ? 118 ASP E OD1   1 
ATOM   2446 O OD2   . ASP C 1 66  ? -20.874 8.904   5.379   1.00 96.90  ? 118 ASP E OD2   1 
ATOM   2447 N N     . ASN C 1 67  ? -23.910 8.320   4.188   1.00 88.98  ? 119 ASN E N     1 
ATOM   2448 C CA    . ASN C 1 67  ? -24.493 8.635   2.870   1.00 78.53  ? 119 ASN E CA    1 
ATOM   2449 C C     . ASN C 1 67  ? -23.570 9.800   2.585   1.00 76.98  ? 119 ASN E C     1 
ATOM   2450 O O     . ASN C 1 67  ? -23.437 10.195  1.410   1.00 87.75  ? 119 ASN E O     1 
ATOM   2451 C CB    . ASN C 1 67  ? -25.797 8.995   3.685   1.00 96.71  ? 119 ASN E CB    1 
ATOM   2452 C CG    . ASN C 1 67  ? -26.853 9.870   2.934   1.00 97.70  ? 119 ASN E CG    1 
ATOM   2453 O OD1   . ASN C 1 67  ? -27.016 9.822   1.731   1.00 97.26  ? 119 ASN E OD1   1 
ATOM   2454 N ND2   . ASN C 1 67  ? -27.482 10.767  3.683   1.00 90.51  ? 119 ASN E ND2   1 
ATOM   2455 N N     . LYS C 1 68  ? -22.882 10.258  3.628   1.00 74.15  ? 120 LYS E N     1 
ATOM   2456 C CA    . LYS C 1 68  ? -22.081 11.466  3.617   1.00 75.52  ? 120 LYS E CA    1 
ATOM   2457 C C     . LYS C 1 68  ? -20.634 11.309  3.063   1.00 71.72  ? 120 LYS E C     1 
ATOM   2458 O O     . LYS C 1 68  ? -20.052 10.217  3.105   1.00 67.43  ? 120 LYS E O     1 
ATOM   2459 C CB    . LYS C 1 68  ? -21.973 11.941  5.043   1.00 85.50  ? 120 LYS E CB    1 
ATOM   2460 C CG    . LYS C 1 68  ? -23.287 11.861  5.792   1.00 95.13  ? 120 LYS E CG    1 
ATOM   2461 C CD    . LYS C 1 68  ? -22.959 11.959  7.252   1.00 91.86  ? 120 LYS E CD    1 
ATOM   2462 C CE    . LYS C 1 68  ? -23.827 11.007  8.079   1.00 86.30  ? 120 LYS E CE    1 
ATOM   2463 N NZ    . LYS C 1 68  ? -25.308 11.257  8.043   1.00 88.59  ? 120 LYS E NZ    1 
ATOM   2464 N N     . TRP C 1 69  ? -19.996 12.400  2.632   1.00 71.68  ? 121 TRP E N     1 
ATOM   2465 C CA    . TRP C 1 69  ? -18.540 12.368  2.450   1.00 70.38  ? 121 TRP E CA    1 
ATOM   2466 C C     . TRP C 1 69  ? -17.856 12.963  3.697   1.00 64.53  ? 121 TRP E C     1 
ATOM   2467 O O     . TRP C 1 69  ? -18.227 14.037  4.180   1.00 64.77  ? 121 TRP E O     1 
ATOM   2468 C CB    . TRP C 1 69  ? -18.121 13.113  1.165   1.00 61.19  ? 121 TRP E CB    1 
ATOM   2469 C CG    . TRP C 1 69  ? -18.202 12.288  -0.088  1.00 49.13  ? 121 TRP E CG    1 
ATOM   2470 C CD1   . TRP C 1 69  ? -19.196 12.330  -1.003  1.00 55.84  ? 121 TRP E CD1   1 
ATOM   2471 C CD2   . TRP C 1 69  ? -17.252 11.316  -0.579  1.00 54.02  ? 121 TRP E CD2   1 
ATOM   2472 N NE1   . TRP C 1 69  ? -18.953 11.449  -2.029  1.00 50.82  ? 121 TRP E NE1   1 
ATOM   2473 C CE2   . TRP C 1 69  ? -17.762 10.816  -1.798  1.00 54.79  ? 121 TRP E CE2   1 
ATOM   2474 C CE3   . TRP C 1 69  ? -16.030 10.818  -0.116  1.00 51.74  ? 121 TRP E CE3   1 
ATOM   2475 C CZ2   . TRP C 1 69  ? -17.096 9.843   -2.558  1.00 45.63  ? 121 TRP E CZ2   1 
ATOM   2476 C CZ3   . TRP C 1 69  ? -15.370 9.843   -0.885  1.00 49.56  ? 121 TRP E CZ3   1 
ATOM   2477 C CH2   . TRP C 1 69  ? -15.907 9.377   -2.085  1.00 39.80  ? 121 TRP E CH2   1 
ATOM   2478 N N     . SER C 1 70  ? -16.799 12.400  4.066   1.00 62.28  ? 122 SER E N     1 
ATOM   2479 C CA    . SER C 1 70  ? -16.093 12.883  5.262   1.00 67.57  ? 122 SER E CA    1 
ATOM   2480 C C     . SER C 1 70  ? -14.601 13.134  5.056   1.00 61.35  ? 122 SER E C     1 
ATOM   2481 O O     . SER C 1 70  ? -13.936 12.411  4.319   1.00 59.33  ? 122 SER E O     1 
ATOM   2482 C CB    . SER C 1 70  ? -16.241 11.886  6.412   1.00 65.43  ? 122 SER E CB    1 
ATOM   2483 O OG    . SER C 1 70  ? -17.594 11.790  6.821   1.00 82.90  ? 122 SER E OG    1 
ATOM   2484 N N     . VAL C 1 71  ? -14.072 14.145  5.733   1.00 56.76  ? 123 VAL E N     1 
ATOM   2485 C CA    . VAL C 1 71  ? -12.631 14.337  5.772   1.00 56.55  ? 123 VAL E CA    1 
ATOM   2486 C C     . VAL C 1 71  ? -11.970 13.261  6.631   1.00 53.86  ? 123 VAL E C     1 
ATOM   2487 O O     . VAL C 1 71  ? -12.305 13.112  7.798   1.00 45.18  ? 123 VAL E O     1 
ATOM   2488 C CB    . VAL C 1 71  ? -12.259 15.708  6.316   1.00 54.52  ? 123 VAL E CB    1 
ATOM   2489 C CG1   . VAL C 1 71  ? -10.774 15.768  6.584   1.00 53.22  ? 123 VAL E CG1   1 
ATOM   2490 C CG2   . VAL C 1 71  ? -12.692 16.780  5.338   1.00 55.28  ? 123 VAL E CG2   1 
ATOM   2491 N N     . THR C 1 72  ? -11.050 12.510  6.025   1.00 58.35  ? 124 THR E N     1 
ATOM   2492 C CA    . THR C 1 72  ? -10.323 11.435  6.691   1.00 53.94  ? 124 THR E CA    1 
ATOM   2493 C C     . THR C 1 72  ? -9.038  11.939  7.277   1.00 54.14  ? 124 THR E C     1 
ATOM   2494 O O     . THR C 1 72  ? -8.736  11.655  8.432   1.00 64.85  ? 124 THR E O     1 
ATOM   2495 C CB    . THR C 1 72  ? -9.976  10.281  5.740   1.00 58.73  ? 124 THR E CB    1 
ATOM   2496 O OG1   . THR C 1 72  ? -11.124 9.454   5.561   1.00 64.10  ? 124 THR E OG1   1 
ATOM   2497 C CG2   . THR C 1 72  ? -8.857  9.426   6.316   1.00 56.97  ? 124 THR E CG2   1 
ATOM   2498 N N     . GLY C 1 73  ? -8.277  12.678  6.478   1.00 55.19  ? 125 GLY E N     1 
ATOM   2499 C CA    . GLY C 1 73  ? -6.993  13.189  6.919   1.00 61.51  ? 125 GLY E CA    1 
ATOM   2500 C C     . GLY C 1 73  ? -6.408  14.255  6.013   1.00 64.10  ? 125 GLY E C     1 
ATOM   2501 O O     . GLY C 1 73  ? -7.137  15.064  5.444   1.00 65.15  ? 125 GLY E O     1 
ATOM   2502 N N     . LYS C 1 74  ? -5.081  14.271  5.900   1.00 67.83  ? 126 LYS E N     1 
ATOM   2503 C CA    . LYS C 1 74  ? -4.401  15.199  5.001   1.00 69.23  ? 126 LYS E CA    1 
ATOM   2504 C C     . LYS C 1 74  ? -4.207  14.552  3.643   1.00 68.13  ? 126 LYS E C     1 
ATOM   2505 O O     . LYS C 1 74  ? -4.057  13.334  3.532   1.00 61.49  ? 126 LYS E O     1 
ATOM   2506 C CB    . LYS C 1 74  ? -3.051  15.669  5.575   1.00 69.41  ? 126 LYS E CB    1 
ATOM   2507 C CG    . LYS C 1 74  ? -1.960  14.593  5.686   1.00 80.41  ? 126 LYS E CG    1 
ATOM   2508 C CD    . LYS C 1 74  ? -0.533  15.188  5.642   1.00 74.90  ? 126 LYS E CD    1 
ATOM   2509 C CE    . LYS C 1 74  ? -0.519  16.670  6.045   1.00 81.40  ? 126 LYS E CE    1 
ATOM   2510 N NZ    . LYS C 1 74  ? 0.830   17.314  5.986   1.00 81.60  ? 126 LYS E NZ    1 
ATOM   2511 N N     . ALA C 1 75  ? -4.236  15.387  2.609   1.00 73.13  ? 127 ALA E N     1 
ATOM   2512 C CA    . ALA C 1 75  ? -4.059  14.942  1.232   1.00 66.74  ? 127 ALA E CA    1 
ATOM   2513 C C     . ALA C 1 75  ? -2.632  14.487  0.991   1.00 65.10  ? 127 ALA E C     1 
ATOM   2514 O O     . ALA C 1 75  ? -1.745  14.741  1.808   1.00 63.12  ? 127 ALA E O     1 
ATOM   2515 C CB    . ALA C 1 75  ? -4.418  16.054  0.271   1.00 62.05  ? 127 ALA E CB    1 
ATOM   2516 N N     . GLU C 1 76  ? -2.420  13.811  -0.133  1.00 63.44  ? 128 GLU E N     1 
ATOM   2517 C CA    . GLU C 1 76  ? -1.078  13.495  -0.598  1.00 65.25  ? 128 GLU E CA    1 
ATOM   2518 C C     . GLU C 1 76  ? -0.384  14.789  -0.961  1.00 64.73  ? 128 GLU E C     1 
ATOM   2519 O O     . GLU C 1 76  ? -1.028  15.830  -1.077  1.00 64.44  ? 128 GLU E O     1 
ATOM   2520 C CB    . GLU C 1 76  ? -1.108  12.562  -1.814  1.00 66.63  ? 128 GLU E CB    1 
ATOM   2521 C CG    . GLU C 1 76  ? -1.702  11.185  -1.565  1.00 69.67  ? 128 GLU E CG    1 
ATOM   2522 C CD    . GLU C 1 76  ? -0.822  10.314  -0.700  1.00 72.02  ? 128 GLU E CD    1 
ATOM   2523 O OE1   . GLU C 1 76  ? 0.350   10.693  -0.480  1.00 74.18  ? 128 GLU E OE1   1 
ATOM   2524 O OE2   . GLU C 1 76  ? -1.302  9.251   -0.246  1.00 71.57  ? 128 GLU E OE2   1 
ATOM   2525 N N     . PRO C 1 77  ? 0.937   14.742  -1.129  1.00 62.64  ? 129 PRO E N     1 
ATOM   2526 C CA    . PRO C 1 77  ? 1.559   15.920  -1.721  1.00 61.17  ? 129 PRO E CA    1 
ATOM   2527 C C     . PRO C 1 77  ? 1.458   15.821  -3.231  1.00 57.47  ? 129 PRO E C     1 
ATOM   2528 O O     . PRO C 1 77  ? 1.507   14.720  -3.778  1.00 57.31  ? 129 PRO E O     1 
ATOM   2529 C CB    . PRO C 1 77  ? 3.001   15.838  -1.238  1.00 64.00  ? 129 PRO E CB    1 
ATOM   2530 C CG    . PRO C 1 77  ? 3.241   14.371  -1.092  1.00 67.84  ? 129 PRO E CG    1 
ATOM   2531 C CD    . PRO C 1 77  ? 1.927   13.741  -0.705  1.00 66.04  ? 129 PRO E CD    1 
ATOM   2532 N N     . ALA C 1 78  ? 1.289   16.962  -3.886  1.00 57.67  ? 130 ALA E N     1 
ATOM   2533 C CA    . ALA C 1 78  ? 1.158   17.003  -5.333  1.00 60.31  ? 130 ALA E CA    1 
ATOM   2534 C C     . ALA C 1 78  ? 2.509   16.809  -6.046  1.00 63.09  ? 130 ALA E C     1 
ATOM   2535 O O     . ALA C 1 78  ? 3.537   17.359  -5.623  1.00 59.69  ? 130 ALA E O     1 
ATOM   2536 C CB    . ALA C 1 78  ? 0.525   18.308  -5.749  1.00 52.55  ? 130 ALA E CB    1 
ATOM   2537 N N     . MET C 1 79  ? 2.500   16.010  -7.114  1.00 57.96  ? 131 MET E N     1 
ATOM   2538 C CA    . MET C 1 79  ? 3.657   15.872  -7.996  1.00 57.68  ? 131 MET E CA    1 
ATOM   2539 C C     . MET C 1 79  ? 3.336   16.645  -9.275  1.00 54.65  ? 131 MET E C     1 
ATOM   2540 O O     . MET C 1 79  ? 2.196   17.068  -9.437  1.00 52.71  ? 131 MET E O     1 
ATOM   2541 C CB    . MET C 1 79  ? 3.958   14.393  -8.273  1.00 59.84  ? 131 MET E CB    1 
ATOM   2542 C CG    . MET C 1 79  ? 4.484   13.621  -7.070  1.00 60.64  ? 131 MET E CG    1 
ATOM   2543 S SD    . MET C 1 79  ? 6.002   14.326  -6.398  1.00 78.09  ? 131 MET E SD    1 
ATOM   2544 C CE    . MET C 1 79  ? 7.139   14.068  -7.773  1.00 63.94  ? 131 MET E CE    1 
ATOM   2545 N N     . PRO C 1 80  ? 4.323   16.823  -10.146 1.00 59.36  ? 132 PRO E N     1 
ATOM   2546 C CA    . PRO C 1 80  ? 4.131   17.574  -11.391 1.00 57.42  ? 132 PRO E CA    1 
ATOM   2547 C C     . PRO C 1 80  ? 2.875   17.141  -12.140 1.00 56.23  ? 132 PRO E C     1 
ATOM   2548 O O     . PRO C 1 80  ? 2.895   16.131  -12.843 1.00 53.77  ? 132 PRO E O     1 
ATOM   2549 C CB    . PRO C 1 80  ? 5.377   17.218  -12.205 1.00 47.36  ? 132 PRO E CB    1 
ATOM   2550 C CG    . PRO C 1 80  ? 5.768   15.868  -11.711 1.00 57.27  ? 132 PRO E CG    1 
ATOM   2551 C CD    . PRO C 1 80  ? 5.429   15.854  -10.247 1.00 62.95  ? 132 PRO E CD    1 
ATOM   2552 N N     . GLY C 1 81  ? 1.797   17.904  -11.989 1.00 51.28  ? 133 GLY E N     1 
ATOM   2553 C CA    . GLY C 1 81  ? 0.555   17.611  -12.680 1.00 49.74  ? 133 GLY E CA    1 
ATOM   2554 C C     . GLY C 1 81  ? 0.701   17.783  -14.179 1.00 51.30  ? 133 GLY E C     1 
ATOM   2555 O O     . GLY C 1 81  ? 1.292   18.757  -14.645 1.00 51.66  ? 133 GLY E O     1 
ATOM   2556 N N     . ARG C 1 82  ? 0.163   16.833  -14.937 1.00 44.68  ? 134 ARG E N     1 
ATOM   2557 C CA    . ARG C 1 82  ? 0.268   16.870  -16.375 1.00 41.10  ? 134 ARG E CA    1 
ATOM   2558 C C     . ARG C 1 82  ? -0.775  17.796  -17.005 1.00 42.00  ? 134 ARG E C     1 
ATOM   2559 O O     . ARG C 1 82  ? -1.664  18.299  -16.320 1.00 42.83  ? 134 ARG E O     1 
ATOM   2560 C CB    . ARG C 1 82  ? 0.113   15.453  -16.913 1.00 42.52  ? 134 ARG E CB    1 
ATOM   2561 C CG    . ARG C 1 82  ? 1.191   14.510  -16.430 1.00 40.08  ? 134 ARG E CG    1 
ATOM   2562 C CD    . ARG C 1 82  ? 0.982   13.142  -16.990 1.00 40.41  ? 134 ARG E CD    1 
ATOM   2563 N NE    . ARG C 1 82  ? 2.116   12.270  -16.753 1.00 40.77  ? 134 ARG E NE    1 
ATOM   2564 C CZ    . ARG C 1 82  ? 2.093   10.963  -16.976 1.00 45.68  ? 134 ARG E CZ    1 
ATOM   2565 N NH1   . ARG C 1 82  ? 0.991   10.390  -17.433 1.00 47.91  ? 134 ARG E NH1   1 
ATOM   2566 N NH2   . ARG C 1 82  ? 3.164   10.229  -16.734 1.00 45.72  ? 134 ARG E NH2   1 
ATOM   2567 N N     . LEU C 1 83  ? -0.663  18.008  -18.313 1.00 43.44  ? 135 LEU E N     1 
ATOM   2568 C CA    . LEU C 1 83  ? -1.646  18.779  -19.077 1.00 39.08  ? 135 LEU E CA    1 
ATOM   2569 C C     . LEU C 1 83  ? -2.218  17.982  -20.227 1.00 38.69  ? 135 LEU E C     1 
ATOM   2570 O O     . LEU C 1 83  ? -1.555  17.090  -20.768 1.00 34.63  ? 135 LEU E O     1 
ATOM   2571 C CB    . LEU C 1 83  ? -1.025  20.052  -19.634 1.00 40.32  ? 135 LEU E CB    1 
ATOM   2572 C CG    . LEU C 1 83  ? -0.167  20.836  -18.646 1.00 45.80  ? 135 LEU E CG    1 
ATOM   2573 C CD1   . LEU C 1 83  ? 0.883   21.631  -19.415 1.00 41.81  ? 135 LEU E CD1   1 
ATOM   2574 C CD2   . LEU C 1 83  ? -1.051  21.748  -17.788 1.00 39.97  ? 135 LEU E CD2   1 
ATOM   2575 N N     . TYR C 1 84  ? -3.461  18.309  -20.585 1.00 43.71  ? 136 TYR E N     1 
ATOM   2576 C CA    . TYR C 1 84  ? -4.061  17.861  -21.846 1.00 38.27  ? 136 TYR E CA    1 
ATOM   2577 C C     . TYR C 1 84  ? -4.067  19.046  -22.783 1.00 38.56  ? 136 TYR E C     1 
ATOM   2578 O O     . TYR C 1 84  ? -4.797  20.002  -22.558 1.00 39.74  ? 136 TYR E O     1 
ATOM   2579 C CB    . TYR C 1 84  ? -5.478  17.331  -21.659 1.00 33.20  ? 136 TYR E CB    1 
ATOM   2580 C CG    . TYR C 1 84  ? -6.074  16.734  -22.919 1.00 37.59  ? 136 TYR E CG    1 
ATOM   2581 C CD1   . TYR C 1 84  ? -6.012  15.366  -23.164 1.00 35.71  ? 136 TYR E CD1   1 
ATOM   2582 C CD2   . TYR C 1 84  ? -6.700  17.542  -23.867 1.00 42.42  ? 136 TYR E CD2   1 
ATOM   2583 C CE1   . TYR C 1 84  ? -6.554  14.819  -24.306 1.00 39.74  ? 136 TYR E CE1   1 
ATOM   2584 C CE2   . TYR C 1 84  ? -7.242  17.006  -25.022 1.00 44.34  ? 136 TYR E CE2   1 
ATOM   2585 C CZ    . TYR C 1 84  ? -7.167  15.645  -25.242 1.00 44.24  ? 136 TYR E CZ    1 
ATOM   2586 O OH    . TYR C 1 84  ? -7.714  15.123  -26.394 1.00 39.23  ? 136 TYR E OH    1 
ATOM   2587 N N     . VAL C 1 85  ? -3.227  19.001  -23.808 1.00 34.81  ? 137 VAL E N     1 
ATOM   2588 C CA    . VAL C 1 85  ? -3.216  20.052  -24.804 1.00 37.40  ? 137 VAL E CA    1 
ATOM   2589 C C     . VAL C 1 85  ? -4.114  19.606  -25.938 1.00 40.70  ? 137 VAL E C     1 
ATOM   2590 O O     . VAL C 1 85  ? -3.906  18.530  -26.491 1.00 42.08  ? 137 VAL E O     1 
ATOM   2591 C CB    . VAL C 1 85  ? -1.810  20.337  -25.335 1.00 37.92  ? 137 VAL E CB    1 
ATOM   2592 C CG1   . VAL C 1 85  ? -1.890  21.153  -26.623 1.00 38.51  ? 137 VAL E CG1   1 
ATOM   2593 C CG2   . VAL C 1 85  ? -0.962  21.041  -24.281 1.00 31.21  ? 137 VAL E CG2   1 
ATOM   2594 N N     . HIS C 1 86  ? -5.113  20.420  -26.272 1.00 44.28  ? 138 HIS E N     1 
ATOM   2595 C CA    . HIS C 1 86  ? -6.138  20.024  -27.235 1.00 41.75  ? 138 HIS E CA    1 
ATOM   2596 C C     . HIS C 1 86  ? -5.532  19.812  -28.593 1.00 45.05  ? 138 HIS E C     1 
ATOM   2597 O O     . HIS C 1 86  ? -4.767  20.643  -29.069 1.00 49.65  ? 138 HIS E O     1 
ATOM   2598 C CB    . HIS C 1 86  ? -7.244  21.058  -27.331 1.00 42.66  ? 138 HIS E CB    1 
ATOM   2599 C CG    . HIS C 1 86  ? -8.430  20.566  -28.082 1.00 42.64  ? 138 HIS E CG    1 
ATOM   2600 N ND1   . HIS C 1 86  ? -8.423  20.403  -29.451 1.00 48.20  ? 138 HIS E ND1   1 
ATOM   2601 C CD2   . HIS C 1 86  ? -9.647  20.157  -27.656 1.00 39.44  ? 138 HIS E CD2   1 
ATOM   2602 C CE1   . HIS C 1 86  ? -9.592  19.925  -29.836 1.00 49.73  ? 138 HIS E CE1   1 
ATOM   2603 N NE2   . HIS C 1 86  ? -10.351 19.763  -28.764 1.00 45.48  ? 138 HIS E NE2   1 
ATOM   2604 N N     . PRO C 1 87  ? -5.866  18.692  -29.228 1.00 42.79  ? 139 PRO E N     1 
ATOM   2605 C CA    . PRO C 1 87  ? -5.126  18.283  -30.423 1.00 42.46  ? 139 PRO E CA    1 
ATOM   2606 C C     . PRO C 1 87  ? -5.241  19.282  -31.579 1.00 48.34  ? 139 PRO E C     1 
ATOM   2607 O O     . PRO C 1 87  ? -4.476  19.194  -32.532 1.00 48.83  ? 139 PRO E O     1 
ATOM   2608 C CB    . PRO C 1 87  ? -5.774  16.947  -30.788 1.00 43.92  ? 139 PRO E CB    1 
ATOM   2609 C CG    . PRO C 1 87  ? -6.386  16.457  -29.529 1.00 42.18  ? 139 PRO E CG    1 
ATOM   2610 C CD    . PRO C 1 87  ? -6.836  17.678  -28.796 1.00 40.77  ? 139 PRO E CD    1 
ATOM   2611 N N     . ASP C 1 88  ? -6.182  20.218  -31.506 1.00 50.22  ? 140 ASP E N     1 
ATOM   2612 C CA    . ASP C 1 88  ? -6.269  21.244  -32.542 1.00 52.40  ? 140 ASP E CA    1 
ATOM   2613 C C     . ASP C 1 88  ? -5.303  22.403  -32.235 1.00 52.10  ? 140 ASP E C     1 
ATOM   2614 O O     . ASP C 1 88  ? -5.249  23.376  -32.990 1.00 55.58  ? 140 ASP E O     1 
ATOM   2615 C CB    . ASP C 1 88  ? -7.711  21.783  -32.699 1.00 52.27  ? 140 ASP E CB    1 
ATOM   2616 C CG    . ASP C 1 88  ? -8.688  20.753  -33.283 1.00 51.02  ? 140 ASP E CG    1 
ATOM   2617 O OD1   . ASP C 1 88  ? -8.262  19.657  -33.696 1.00 47.03  ? 140 ASP E OD1   1 
ATOM   2618 O OD2   . ASP C 1 88  ? -9.900  21.057  -33.341 1.00 55.45  ? 140 ASP E OD2   1 
ATOM   2619 N N     . SER C 1 89  ? -4.542  22.303  -31.141 1.00 47.33  ? 141 SER E N     1 
ATOM   2620 C CA    . SER C 1 89  ? -3.554  23.333  -30.789 1.00 44.14  ? 141 SER E CA    1 
ATOM   2621 C C     . SER C 1 89  ? -2.241  23.195  -31.570 1.00 46.82  ? 141 SER E C     1 
ATOM   2622 O O     . SER C 1 89  ? -1.689  22.097  -31.680 1.00 51.68  ? 141 SER E O     1 
ATOM   2623 C CB    . SER C 1 89  ? -3.236  23.298  -29.295 1.00 42.41  ? 141 SER E CB    1 
ATOM   2624 O OG    . SER C 1 89  ? -4.371  23.592  -28.507 1.00 49.46  ? 141 SER E OG    1 
ATOM   2625 N N     . PRO C 1 90  ? -1.714  24.318  -32.080 1.00 41.53  ? 142 PRO E N     1 
ATOM   2626 C CA    . PRO C 1 90  ? -2.337  25.635  -31.973 1.00 47.07  ? 142 PRO E CA    1 
ATOM   2627 C C     . PRO C 1 90  ? -3.294  25.918  -33.121 1.00 43.94  ? 142 PRO E C     1 
ATOM   2628 O O     . PRO C 1 90  ? -3.187  25.317  -34.177 1.00 44.94  ? 142 PRO E O     1 
ATOM   2629 C CB    . PRO C 1 90  ? -1.136  26.583  -32.010 1.00 43.81  ? 142 PRO E CB    1 
ATOM   2630 C CG    . PRO C 1 90  ? -0.161  25.886  -32.836 1.00 39.28  ? 142 PRO E CG    1 
ATOM   2631 C CD    . PRO C 1 90  ? -0.321  24.421  -32.536 1.00 43.60  ? 142 PRO E CD    1 
ATOM   2632 N N     . ALA C 1 91  ? -4.229  26.826  -32.908 1.00 48.19  ? 143 ALA E N     1 
ATOM   2633 C CA    . ALA C 1 91  ? -5.184  27.166  -33.950 1.00 54.52  ? 143 ALA E CA    1 
ATOM   2634 C C     . ALA C 1 91  ? -5.582  28.624  -33.850 1.00 55.28  ? 143 ALA E C     1 
ATOM   2635 O O     . ALA C 1 91  ? -5.350  29.279  -32.840 1.00 56.31  ? 143 ALA E O     1 
ATOM   2636 C CB    . ALA C 1 91  ? -6.421  26.269  -33.873 1.00 52.28  ? 143 ALA E CB    1 
ATOM   2637 N N     . THR C 1 92  ? -6.186  29.123  -34.915 1.00 56.73  ? 144 THR E N     1 
ATOM   2638 C CA    . THR C 1 92  ? -6.563  30.513  -34.978 1.00 59.00  ? 144 THR E CA    1 
ATOM   2639 C C     . THR C 1 92  ? -7.757  30.732  -34.076 1.00 58.59  ? 144 THR E C     1 
ATOM   2640 O O     . THR C 1 92  ? -8.631  29.866  -33.981 1.00 54.03  ? 144 THR E O     1 
ATOM   2641 C CB    . THR C 1 92  ? -6.901  30.935  -36.419 1.00 58.01  ? 144 THR E CB    1 
ATOM   2642 O OG1   . THR C 1 92  ? -8.094  30.268  -36.845 1.00 55.18  ? 144 THR E OG1   1 
ATOM   2643 C CG2   . THR C 1 92  ? -5.763  30.559  -37.352 1.00 58.51  ? 144 THR E CG2   1 
ATOM   2644 N N     . GLY C 1 93  ? -7.780  31.885  -33.412 1.00 59.19  ? 145 GLY E N     1 
ATOM   2645 C CA    . GLY C 1 93  ? -8.901  32.267  -32.575 1.00 59.92  ? 145 GLY E CA    1 
ATOM   2646 C C     . GLY C 1 93  ? -10.217 32.000  -33.277 1.00 61.09  ? 145 GLY E C     1 
ATOM   2647 O O     . GLY C 1 93  ? -11.184 31.546  -32.664 1.00 58.94  ? 145 GLY E O     1 
ATOM   2648 N N     . ALA C 1 94  ? -10.241 32.269  -34.577 1.00 59.18  ? 146 ALA E N     1 
ATOM   2649 C CA    . ALA C 1 94  ? -11.397 31.945  -35.390 1.00 64.16  ? 146 ALA E CA    1 
ATOM   2650 C C     . ALA C 1 94  ? -11.790 30.477  -35.195 1.00 64.05  ? 146 ALA E C     1 
ATOM   2651 O O     . ALA C 1 94  ? -12.896 30.189  -34.764 1.00 64.35  ? 146 ALA E O     1 
ATOM   2652 C CB    . ALA C 1 94  ? -11.118 32.243  -36.845 1.00 60.94  ? 146 ALA E CB    1 
ATOM   2653 N N     . HIS C 1 95  ? -10.861 29.560  -35.448 1.00 59.83  ? 147 HIS E N     1 
ATOM   2654 C CA    . HIS C 1 95  ? -11.150 28.128  -35.372 1.00 58.91  ? 147 HIS E CA    1 
ATOM   2655 C C     . HIS C 1 95  ? -11.729 27.655  -34.034 1.00 61.31  ? 147 HIS E C     1 
ATOM   2656 O O     . HIS C 1 95  ? -12.632 26.811  -34.016 1.00 65.69  ? 147 HIS E O     1 
ATOM   2657 C CB    . HIS C 1 95  ? -9.888  27.322  -35.667 1.00 60.80  ? 147 HIS E CB    1 
ATOM   2658 C CG    . HIS C 1 95  ? -10.109 25.840  -35.675 1.00 62.32  ? 147 HIS E CG    1 
ATOM   2659 N ND1   . HIS C 1 95  ? -10.230 25.099  -34.517 1.00 59.58  ? 147 HIS E ND1   1 
ATOM   2660 C CD2   . HIS C 1 95  ? -10.231 24.963  -36.700 1.00 58.56  ? 147 HIS E CD2   1 
ATOM   2661 C CE1   . HIS C 1 95  ? -10.414 23.828  -34.830 1.00 61.90  ? 147 HIS E CE1   1 
ATOM   2662 N NE2   . HIS C 1 95  ? -10.420 23.718  -36.148 1.00 59.98  ? 147 HIS E NE2   1 
ATOM   2663 N N     . TRP C 1 96  ? -11.215 28.184  -32.924 1.00 59.20  ? 148 TRP E N     1 
ATOM   2664 C CA    . TRP C 1 96  ? -11.698 27.786  -31.598 1.00 55.58  ? 148 TRP E CA    1 
ATOM   2665 C C     . TRP C 1 96  ? -13.150 28.183  -31.423 1.00 56.42  ? 148 TRP E C     1 
ATOM   2666 O O     . TRP C 1 96  ? -13.946 27.414  -30.888 1.00 57.69  ? 148 TRP E O     1 
ATOM   2667 C CB    . TRP C 1 96  ? -10.849 28.401  -30.475 1.00 51.57  ? 148 TRP E CB    1 
ATOM   2668 C CG    . TRP C 1 96  ? -9.435  27.904  -30.460 1.00 51.57  ? 148 TRP E CG    1 
ATOM   2669 C CD1   . TRP C 1 96  ? -8.304  28.652  -30.598 1.00 54.74  ? 148 TRP E CD1   1 
ATOM   2670 C CD2   . TRP C 1 96  ? -9.000  26.543  -30.329 1.00 52.51  ? 148 TRP E CD2   1 
ATOM   2671 N NE1   . TRP C 1 96  ? -7.189  27.844  -30.557 1.00 52.54  ? 148 TRP E NE1   1 
ATOM   2672 C CE2   . TRP C 1 96  ? -7.593  26.545  -30.391 1.00 52.34  ? 148 TRP E CE2   1 
ATOM   2673 C CE3   . TRP C 1 96  ? -9.663  25.323  -30.158 1.00 51.58  ? 148 TRP E CE3   1 
ATOM   2674 C CZ2   . TRP C 1 96  ? -6.840  25.380  -30.290 1.00 50.09  ? 148 TRP E CZ2   1 
ATOM   2675 C CZ3   . TRP C 1 96  ? -8.915  24.167  -30.060 1.00 48.52  ? 148 TRP E CZ3   1 
ATOM   2676 C CH2   . TRP C 1 96  ? -7.520  24.202  -30.128 1.00 49.33  ? 148 TRP E CH2   1 
ATOM   2677 N N     . MET C 1 97  ? -13.493 29.373  -31.904 1.00 58.00  ? 149 MET E N     1 
ATOM   2678 C CA    . MET C 1 97  ? -14.856 29.899  -31.782 1.00 62.95  ? 149 MET E CA    1 
ATOM   2679 C C     . MET C 1 97  ? -15.876 29.335  -32.788 1.00 60.14  ? 149 MET E C     1 
ATOM   2680 O O     . MET C 1 97  ? -17.075 29.415  -32.561 1.00 60.92  ? 149 MET E O     1 
ATOM   2681 C CB    . MET C 1 97  ? -14.826 31.424  -31.911 1.00 62.11  ? 149 MET E CB    1 
ATOM   2682 C CG    . MET C 1 97  ? -13.805 32.088  -31.020 1.00 59.91  ? 149 MET E CG    1 
ATOM   2683 S SD    . MET C 1 97  ? -13.532 33.839  -31.350 1.00 56.84  ? 149 MET E SD    1 
ATOM   2684 C CE    . MET C 1 97  ? -15.086 34.553  -30.818 1.00 64.07  ? 149 MET E CE    1 
ATOM   2685 N N     . ARG C 1 98  ? -15.432 28.754  -33.893 1.00 58.59  ? 150 ARG E N     1 
ATOM   2686 C CA    . ARG C 1 98  ? -16.408 28.388  -34.916 1.00 65.73  ? 150 ARG E CA    1 
ATOM   2687 C C     . ARG C 1 98  ? -17.169 27.125  -34.535 1.00 66.18  ? 150 ARG E C     1 
ATOM   2688 O O     . ARG C 1 98  ? -17.950 26.603  -35.327 1.00 72.25  ? 150 ARG E O     1 
ATOM   2689 C CB    . ARG C 1 98  ? -15.751 28.227  -36.310 1.00 70.51  ? 150 ARG E CB    1 
ATOM   2690 C CG    . ARG C 1 98  ? -14.970 29.462  -36.798 1.00 73.14  ? 150 ARG E CG    1 
ATOM   2691 C CD    . ARG C 1 98  ? -15.506 30.778  -36.155 1.00 73.36  ? 150 ARG E CD    1 
ATOM   2692 N NE    . ARG C 1 98  ? -14.904 32.000  -36.692 1.00 81.75  ? 150 ARG E NE    1 
ATOM   2693 C CZ    . ARG C 1 98  ? -14.955 33.189  -36.083 1.00 82.80  ? 150 ARG E CZ    1 
ATOM   2694 N NH1   . ARG C 1 98  ? -15.557 33.303  -34.906 1.00 76.84  ? 150 ARG E NH1   1 
ATOM   2695 N NH2   . ARG C 1 98  ? -14.374 34.260  -36.627 1.00 82.57  ? 150 ARG E NH2   1 
ATOM   2696 N N     . GLN C 1 99  ? -16.971 26.666  -33.309 1.00 61.20  ? 151 GLN E N     1 
ATOM   2697 C CA    . GLN C 1 99  ? -17.577 25.429  -32.843 1.00 62.57  ? 151 GLN E CA    1 
ATOM   2698 C C     . GLN C 1 99  ? -17.194 25.168  -31.392 1.00 62.61  ? 151 GLN E C     1 
ATOM   2699 O O     . GLN C 1 99  ? -16.331 25.842  -30.821 1.00 64.88  ? 151 GLN E O     1 
ATOM   2700 C CB    . GLN C 1 99  ? -17.145 24.247  -33.716 1.00 65.14  ? 151 GLN E CB    1 
ATOM   2701 C CG    . GLN C 1 99  ? -15.636 24.088  -33.800 1.00 72.71  ? 151 GLN E CG    1 
ATOM   2702 C CD    . GLN C 1 99  ? -15.200 23.469  -35.105 1.00 82.01  ? 151 GLN E CD    1 
ATOM   2703 O OE1   . GLN C 1 99  ? -16.009 22.851  -35.809 1.00 88.37  ? 151 GLN E OE1   1 
ATOM   2704 N NE2   . GLN C 1 99  ? -13.921 23.642  -35.450 1.00 72.48  ? 151 GLN E NE2   1 
ATOM   2705 N N     . LEU C 1 100 ? -17.836 24.172  -30.803 1.00 59.84  ? 152 LEU E N     1 
ATOM   2706 C CA    . LEU C 1 100 ? -17.631 23.845  -29.404 1.00 56.50  ? 152 LEU E CA    1 
ATOM   2707 C C     . LEU C 1 100 ? -16.281 23.191  -29.178 1.00 51.56  ? 152 LEU E C     1 
ATOM   2708 O O     . LEU C 1 100 ? -16.021 22.116  -29.712 1.00 53.91  ? 152 LEU E O     1 
ATOM   2709 C CB    . LEU C 1 100 ? -18.748 22.923  -28.922 1.00 52.49  ? 152 LEU E CB    1 
ATOM   2710 C CG    . LEU C 1 100 ? -19.546 23.428  -27.735 1.00 52.19  ? 152 LEU E CG    1 
ATOM   2711 C CD1   . LEU C 1 100 ? -19.967 24.877  -27.962 1.00 53.13  ? 152 LEU E CD1   1 
ATOM   2712 C CD2   . LEU C 1 100 ? -20.732 22.522  -27.566 1.00 50.11  ? 152 LEU E CD2   1 
ATOM   2713 N N     . VAL C 1 101 ? -15.420 23.838  -28.396 1.00 47.49  ? 153 VAL E N     1 
ATOM   2714 C CA    . VAL C 1 101 ? -14.145 23.229  -28.041 1.00 45.76  ? 153 VAL E CA    1 
ATOM   2715 C C     . VAL C 1 101 ? -14.420 22.126  -27.022 1.00 46.93  ? 153 VAL E C     1 
ATOM   2716 O O     . VAL C 1 101 ? -15.001 22.367  -25.965 1.00 47.44  ? 153 VAL E O     1 
ATOM   2717 C CB    . VAL C 1 101 ? -13.141 24.248  -27.482 1.00 42.09  ? 153 VAL E CB    1 
ATOM   2718 C CG1   . VAL C 1 101 ? -11.914 23.541  -26.975 1.00 44.65  ? 153 VAL E CG1   1 
ATOM   2719 C CG2   . VAL C 1 101 ? -12.742 25.214  -28.549 1.00 44.90  ? 153 VAL E CG2   1 
ATOM   2720 N N     . SER C 1 102 ? -14.021 20.910  -27.368 1.00 46.11  ? 154 SER E N     1 
ATOM   2721 C CA    . SER C 1 102 ? -14.355 19.731  -26.593 1.00 42.68  ? 154 SER E CA    1 
ATOM   2722 C C     . SER C 1 102 ? -13.134 18.972  -26.188 1.00 43.03  ? 154 SER E C     1 
ATOM   2723 O O     . SER C 1 102 ? -12.417 18.464  -27.035 1.00 46.64  ? 154 SER E O     1 
ATOM   2724 C CB    . SER C 1 102 ? -15.254 18.795  -27.388 1.00 47.59  ? 154 SER E CB    1 
ATOM   2725 O OG    . SER C 1 102 ? -15.531 17.628  -26.631 1.00 50.78  ? 154 SER E OG    1 
ATOM   2726 N N     . PHE C 1 103 ? -12.917 18.867  -24.887 1.00 45.95  ? 155 PHE E N     1 
ATOM   2727 C CA    . PHE C 1 103 ? -11.839 18.049  -24.371 1.00 42.77  ? 155 PHE E CA    1 
ATOM   2728 C C     . PHE C 1 103 ? -12.345 16.670  -24.007 1.00 42.13  ? 155 PHE E C     1 
ATOM   2729 O O     . PHE C 1 103 ? -12.087 16.177  -22.928 1.00 48.17  ? 155 PHE E O     1 
ATOM   2730 C CB    . PHE C 1 103 ? -11.227 18.714  -23.161 1.00 44.73  ? 155 PHE E CB    1 
ATOM   2731 C CG    . PHE C 1 103 ? -10.717 20.086  -23.431 1.00 47.55  ? 155 PHE E CG    1 
ATOM   2732 C CD1   . PHE C 1 103 ? -11.561 21.186  -23.326 1.00 44.86  ? 155 PHE E CD1   1 
ATOM   2733 C CD2   . PHE C 1 103 ? -9.383  20.280  -23.789 1.00 45.51  ? 155 PHE E CD2   1 
ATOM   2734 C CE1   . PHE C 1 103 ? -11.084 22.458  -23.559 1.00 46.82  ? 155 PHE E CE1   1 
ATOM   2735 C CE2   . PHE C 1 103 ? -8.895  21.545  -24.034 1.00 45.72  ? 155 PHE E CE2   1 
ATOM   2736 C CZ    . PHE C 1 103 ? -9.745  22.641  -23.922 1.00 51.17  ? 155 PHE E CZ    1 
ATOM   2737 N N     . GLN C 1 104 ? -13.074 16.041  -24.905 1.00 44.56  ? 156 GLN E N     1 
ATOM   2738 C CA    . GLN C 1 104 ? -13.817 14.858  -24.523 1.00 44.93  ? 156 GLN E CA    1 
ATOM   2739 C C     . GLN C 1 104 ? -12.922 13.643  -24.405 1.00 43.70  ? 156 GLN E C     1 
ATOM   2740 O O     . GLN C 1 104 ? -13.252 12.693  -23.689 1.00 46.83  ? 156 GLN E O     1 
ATOM   2741 C CB    . GLN C 1 104 ? -14.933 14.581  -25.523 1.00 47.60  ? 156 GLN E CB    1 
ATOM   2742 C CG    . GLN C 1 104 ? -15.831 13.436  -25.119 1.00 48.48  ? 156 GLN E CG    1 
ATOM   2743 C CD    . GLN C 1 104 ? -16.528 12.820  -26.298 1.00 57.13  ? 156 GLN E CD    1 
ATOM   2744 O OE1   . GLN C 1 104 ? -15.885 12.460  -27.291 1.00 59.98  ? 156 GLN E OE1   1 
ATOM   2745 N NE2   . GLN C 1 104 ? -17.852 12.701  -26.209 1.00 57.05  ? 156 GLN E NE2   1 
ATOM   2746 N N     . LYS C 1 105 ? -11.785 13.668  -25.089 1.00 36.98  ? 157 LYS E N     1 
ATOM   2747 C CA    . LYS C 1 105 ? -10.937 12.482  -25.094 1.00 41.51  ? 157 LYS E CA    1 
ATOM   2748 C C     . LYS C 1 105 ? -9.843  12.483  -24.013 1.00 43.65  ? 157 LYS E C     1 
ATOM   2749 O O     . LYS C 1 105 ? -9.024  11.569  -23.972 1.00 40.62  ? 157 LYS E O     1 
ATOM   2750 C CB    . LYS C 1 105 ? -10.294 12.293  -26.458 1.00 42.77  ? 157 LYS E CB    1 
ATOM   2751 C CG    . LYS C 1 105 ? -11.268 11.952  -27.567 1.00 50.88  ? 157 LYS E CG    1 
ATOM   2752 C CD    . LYS C 1 105 ? -10.546 11.804  -28.903 1.00 53.94  ? 157 LYS E CD    1 
ATOM   2753 C CE    . LYS C 1 105 ? -11.517 11.434  -30.038 1.00 77.54  ? 157 LYS E CE    1 
ATOM   2754 N NZ    . LYS C 1 105 ? -10.872 11.293  -31.404 1.00 86.80  ? 157 LYS E NZ    1 
ATOM   2755 N N     . LEU C 1 106 ? -9.848  13.499  -23.148 1.00 44.13  ? 158 LEU E N     1 
ATOM   2756 C CA    . LEU C 1 106 ? -8.947  13.583  -21.994 1.00 43.78  ? 158 LEU E CA    1 
ATOM   2757 C C     . LEU C 1 106 ? -9.158  12.421  -21.023 1.00 38.44  ? 158 LEU E C     1 
ATOM   2758 O O     . LEU C 1 106 ? -10.286 12.136  -20.657 1.00 42.93  ? 158 LEU E O     1 
ATOM   2759 C CB    . LEU C 1 106 ? -9.153  14.915  -21.269 1.00 37.91  ? 158 LEU E CB    1 
ATOM   2760 C CG    . LEU C 1 106 ? -8.155  15.228  -20.161 1.00 42.53  ? 158 LEU E CG    1 
ATOM   2761 C CD1   . LEU C 1 106 ? -7.928  16.706  -20.108 1.00 49.90  ? 158 LEU E CD1   1 
ATOM   2762 C CD2   . LEU C 1 106 ? -8.676  14.769  -18.816 1.00 37.29  ? 158 LEU E CD2   1 
ATOM   2763 N N     . LYS C 1 107 ? -8.096  11.763  -20.576 1.00 33.67  ? 159 LYS E N     1 
ATOM   2764 C CA    . LYS C 1 107 ? -8.319  10.599  -19.727 1.00 34.29  ? 159 LYS E CA    1 
ATOM   2765 C C     . LYS C 1 107 ? -7.618  10.696  -18.367 1.00 33.56  ? 159 LYS E C     1 
ATOM   2766 O O     . LYS C 1 107 ? -6.564  11.291  -18.228 1.00 39.00  ? 159 LYS E O     1 
ATOM   2767 C CB    . LYS C 1 107 ? -7.913  9.329   -20.474 1.00 32.69  ? 159 LYS E CB    1 
ATOM   2768 C CG    . LYS C 1 107 ? -8.731  9.147   -21.715 1.00 32.76  ? 159 LYS E CG    1 
ATOM   2769 C CD    . LYS C 1 107 ? -8.319  7.965   -22.535 1.00 34.90  ? 159 LYS E CD    1 
ATOM   2770 C CE    . LYS C 1 107 ? -9.130  6.752   -22.197 1.00 33.34  ? 159 LYS E CE    1 
ATOM   2771 N NZ    . LYS C 1 107 ? -8.463  5.567   -22.798 1.00 42.58  ? 159 LYS E NZ    1 
ATOM   2772 N N     . LEU C 1 108 ? -8.246  10.129  -17.354 1.00 33.72  ? 160 LEU E N     1 
ATOM   2773 C CA    . LEU C 1 108 ? -7.768  10.234  -15.993 1.00 30.50  ? 160 LEU E CA    1 
ATOM   2774 C C     . LEU C 1 108 ? -7.124  8.927   -15.590 1.00 32.70  ? 160 LEU E C     1 
ATOM   2775 O O     . LEU C 1 108 ? -7.599  7.857   -15.936 1.00 36.09  ? 160 LEU E O     1 
ATOM   2776 C CB    . LEU C 1 108 ? -8.917  10.581  -15.058 1.00 28.58  ? 160 LEU E CB    1 
ATOM   2777 C CG    . LEU C 1 108 ? -9.611  11.892  -15.407 1.00 26.97  ? 160 LEU E CG    1 
ATOM   2778 C CD1   . LEU C 1 108 ? -10.717 12.163  -14.451 1.00 27.85  ? 160 LEU E CD1   1 
ATOM   2779 C CD2   . LEU C 1 108 ? -8.632  13.051  -15.436 1.00 28.18  ? 160 LEU E CD2   1 
ATOM   2780 N N     . THR C 1 109 ? -6.026  9.005   -14.867 1.00 32.42  ? 161 THR E N     1 
ATOM   2781 C CA    . THR C 1 109 ? -5.313  7.794   -14.533 1.00 37.30  ? 161 THR E CA    1 
ATOM   2782 C C     . THR C 1 109 ? -4.867  7.826   -13.059 1.00 44.82  ? 161 THR E C     1 
ATOM   2783 O O     . THR C 1 109 ? -4.710  8.902   -12.447 1.00 41.81  ? 161 THR E O     1 
ATOM   2784 C CB    . THR C 1 109 ? -4.111  7.599   -15.497 1.00 36.81  ? 161 THR E CB    1 
ATOM   2785 O OG1   . THR C 1 109 ? -3.683  6.233   -15.513 1.00 36.22  ? 161 THR E OG1   1 
ATOM   2786 C CG2   . THR C 1 109 ? -2.979  8.486   -15.121 1.00 37.14  ? 161 THR E CG2   1 
ATOM   2787 N N     . ASN C 1 110 ? -4.697  6.644   -12.476 1.00 45.09  ? 162 ASN E N     1 
ATOM   2788 C CA    . ASN C 1 110 ? -4.279  6.562   -11.092 1.00 43.23  ? 162 ASN E CA    1 
ATOM   2789 C C     . ASN C 1 110 ? -2.835  6.094   -11.017 1.00 44.89  ? 162 ASN E C     1 
ATOM   2790 O O     . ASN C 1 110 ? -2.247  6.014   -9.932  1.00 48.52  ? 162 ASN E O     1 
ATOM   2791 C CB    . ASN C 1 110 ? -5.202  5.630   -10.295 1.00 37.82  ? 162 ASN E CB    1 
ATOM   2792 C CG    . ASN C 1 110 ? -5.074  4.181   -10.714 1.00 47.36  ? 162 ASN E CG    1 
ATOM   2793 O OD1   . ASN C 1 110 ? -4.441  3.856   -11.728 1.00 49.48  ? 162 ASN E OD1   1 
ATOM   2794 N ND2   . ASN C 1 110 ? -5.684  3.295   -9.937  1.00 48.90  ? 162 ASN E ND2   1 
ATOM   2795 N N     . ASN C 1 111 ? -2.264  5.788   -12.175 1.00 42.28  ? 163 ASN E N     1 
ATOM   2796 C CA    . ASN C 1 111 ? -0.915  5.233   -12.203 1.00 49.96  ? 163 ASN E CA    1 
ATOM   2797 C C     . ASN C 1 111 ? 0.165   6.300   -12.312 1.00 48.28  ? 163 ASN E C     1 
ATOM   2798 O O     . ASN C 1 111 ? 0.223   7.047   -13.275 1.00 48.73  ? 163 ASN E O     1 
ATOM   2799 C CB    . ASN C 1 111 ? -0.774  4.240   -13.343 1.00 46.41  ? 163 ASN E CB    1 
ATOM   2800 C CG    . ASN C 1 111 ? 0.648   3.904   -13.622 1.00 47.37  ? 163 ASN E CG    1 
ATOM   2801 O OD1   . ASN C 1 111 ? 1.097   3.990   -14.758 1.00 50.29  ? 163 ASN E OD1   1 
ATOM   2802 N ND2   . ASN C 1 111 ? 1.385   3.538   -12.582 1.00 48.42  ? 163 ASN E ND2   1 
ATOM   2803 N N     . HIS C 1 112 ? 1.038   6.359   -11.320 1.00 52.22  ? 164 HIS E N     1 
ATOM   2804 C CA    . HIS C 1 112 ? 1.971   7.478   -11.226 1.00 56.63  ? 164 HIS E CA    1 
ATOM   2805 C C     . HIS C 1 112 ? 3.150   7.345   -12.177 1.00 55.21  ? 164 HIS E C     1 
ATOM   2806 O O     . HIS C 1 112 ? 4.071   8.152   -12.161 1.00 56.56  ? 164 HIS E O     1 
ATOM   2807 C CB    . HIS C 1 112 ? 2.470   7.628   -9.791  1.00 51.66  ? 164 HIS E CB    1 
ATOM   2808 C CG    . HIS C 1 112 ? 1.400   8.037   -8.830  1.00 56.90  ? 164 HIS E CG    1 
ATOM   2809 N ND1   . HIS C 1 112 ? 0.676   7.125   -8.089  1.00 64.94  ? 164 HIS E ND1   1 
ATOM   2810 C CD2   . HIS C 1 112 ? 0.909   9.258   -8.509  1.00 57.90  ? 164 HIS E CD2   1 
ATOM   2811 C CE1   . HIS C 1 112 ? -0.202  7.770   -7.340  1.00 65.86  ? 164 HIS E CE1   1 
ATOM   2812 N NE2   . HIS C 1 112 ? -0.079  9.066   -7.572  1.00 62.09  ? 164 HIS E NE2   1 
ATOM   2813 N N     . LEU C 1 113 ? 3.111   6.326   -13.016 1.00 53.86  ? 165 LEU E N     1 
ATOM   2814 C CA    . LEU C 1 113 ? 4.184   6.106   -13.959 1.00 53.43  ? 165 LEU E CA    1 
ATOM   2815 C C     . LEU C 1 113 ? 3.591   5.971   -15.330 1.00 55.67  ? 165 LEU E C     1 
ATOM   2816 O O     . LEU C 1 113 ? 4.160   5.296   -16.191 1.00 59.35  ? 165 LEU E O     1 
ATOM   2817 C CB    . LEU C 1 113 ? 4.979   4.847   -13.610 1.00 55.66  ? 165 LEU E CB    1 
ATOM   2818 C CG    . LEU C 1 113 ? 5.754   4.813   -12.302 1.00 49.08  ? 165 LEU E CG    1 
ATOM   2819 C CD1   . LEU C 1 113 ? 6.472   3.490   -12.213 1.00 54.65  ? 165 LEU E CD1   1 
ATOM   2820 C CD2   . LEU C 1 113 ? 6.733   5.960   -12.260 1.00 48.25  ? 165 LEU E CD2   1 
ATOM   2821 N N     . ASP C 1 114 ? 2.433   6.591   -15.535 1.00 54.87  ? 166 ASP E N     1 
ATOM   2822 C CA    . ASP C 1 114 ? 1.730   6.410   -16.793 1.00 54.12  ? 166 ASP E CA    1 
ATOM   2823 C C     . ASP C 1 114 ? 2.546   6.968   -17.950 1.00 55.54  ? 166 ASP E C     1 
ATOM   2824 O O     . ASP C 1 114 ? 2.980   8.119   -17.904 1.00 55.36  ? 166 ASP E O     1 
ATOM   2825 C CB    . ASP C 1 114 ? 0.354   7.064   -16.768 1.00 51.24  ? 166 ASP E CB    1 
ATOM   2826 C CG    . ASP C 1 114 ? -0.421  6.810   -18.059 1.00 56.63  ? 166 ASP E CG    1 
ATOM   2827 O OD1   . ASP C 1 114 ? -0.993  5.695   -18.198 1.00 59.86  ? 166 ASP E OD1   1 
ATOM   2828 O OD2   . ASP C 1 114 ? -0.429  7.709   -18.939 1.00 52.00  ? 166 ASP E OD2   1 
ATOM   2829 N N     . PRO C 1 115 ? 2.772   6.138   -18.978 1.00 54.51  ? 167 PRO E N     1 
ATOM   2830 C CA    . PRO C 1 115 ? 3.508   6.480   -20.203 1.00 55.12  ? 167 PRO E CA    1 
ATOM   2831 C C     . PRO C 1 115 ? 2.639   7.055   -21.321 1.00 57.66  ? 167 PRO E C     1 
ATOM   2832 O O     . PRO C 1 115 ? 3.191   7.570   -22.297 1.00 59.49  ? 167 PRO E O     1 
ATOM   2833 C CB    . PRO C 1 115 ? 4.084   5.140   -20.634 1.00 58.15  ? 167 PRO E CB    1 
ATOM   2834 C CG    . PRO C 1 115 ? 3.067   4.146   -20.151 1.00 59.69  ? 167 PRO E CG    1 
ATOM   2835 C CD    . PRO C 1 115 ? 2.491   4.695   -18.883 1.00 54.53  ? 167 PRO E CD    1 
ATOM   2836 N N     . PHE C 1 116 ? 1.315   6.960   -21.190 1.00 57.56  ? 168 PHE E N     1 
ATOM   2837 C CA    . PHE C 1 116 ? 0.401   7.442   -22.237 1.00 55.35  ? 168 PHE E CA    1 
ATOM   2838 C C     . PHE C 1 116 ? 0.236   8.958   -22.196 1.00 51.22  ? 168 PHE E C     1 
ATOM   2839 O O     . PHE C 1 116 ? -0.049  9.588   -23.214 1.00 49.32  ? 168 PHE E O     1 
ATOM   2840 C CB    . PHE C 1 116 ? -0.961  6.755   -22.117 1.00 48.76  ? 168 PHE E CB    1 
ATOM   2841 C CG    . PHE C 1 116 ? -0.915  5.292   -22.446 1.00 58.27  ? 168 PHE E CG    1 
ATOM   2842 C CD1   . PHE C 1 116 ? -0.782  4.869   -23.771 1.00 58.11  ? 168 PHE E CD1   1 
ATOM   2843 C CD2   . PHE C 1 116 ? -0.986  4.331   -21.438 1.00 56.24  ? 168 PHE E CD2   1 
ATOM   2844 C CE1   . PHE C 1 116 ? -0.730  3.513   -24.087 1.00 53.45  ? 168 PHE E CE1   1 
ATOM   2845 C CE2   . PHE C 1 116 ? -0.937  2.966   -21.749 1.00 53.65  ? 168 PHE E CE2   1 
ATOM   2846 C CZ    . PHE C 1 116 ? -0.809  2.559   -23.072 1.00 50.21  ? 168 PHE E CZ    1 
ATOM   2847 N N     . GLY C 1 117 ? 0.427   9.537   -21.015 1.00 50.43  ? 169 GLY E N     1 
ATOM   2848 C CA    . GLY C 1 117 ? 0.444   10.979  -20.876 1.00 49.30  ? 169 GLY E CA    1 
ATOM   2849 C C     . GLY C 1 117 ? -0.846  11.499  -20.308 1.00 47.63  ? 169 GLY E C     1 
ATOM   2850 O O     . GLY C 1 117 ? -1.031  12.715  -20.178 1.00 45.38  ? 169 GLY E O     1 
ATOM   2851 N N     . HIS C 1 118 ? -1.729  10.552  -19.988 1.00 46.93  ? 170 HIS E N     1 
ATOM   2852 C CA    . HIS C 1 118 ? -2.991  10.796  -19.302 1.00 39.18  ? 170 HIS E CA    1 
ATOM   2853 C C     . HIS C 1 118 ? -2.765  11.582  -18.040 1.00 37.03  ? 170 HIS E C     1 
ATOM   2854 O O     . HIS C 1 118 ? -1.694  11.493  -17.456 1.00 41.07  ? 170 HIS E O     1 
ATOM   2855 C CB    . HIS C 1 118 ? -3.663  9.472   -18.971 1.00 35.62  ? 170 HIS E CB    1 
ATOM   2856 C CG    . HIS C 1 118 ? -3.993  8.659   -20.178 1.00 39.83  ? 170 HIS E CG    1 
ATOM   2857 N ND1   . HIS C 1 118 ? -4.347  9.233   -21.378 1.00 39.37  ? 170 HIS E ND1   1 
ATOM   2858 C CD2   . HIS C 1 118 ? -4.011  7.322   -20.376 1.00 42.28  ? 170 HIS E CD2   1 
ATOM   2859 C CE1   . HIS C 1 118 ? -4.590  8.281   -22.264 1.00 40.76  ? 170 HIS E CE1   1 
ATOM   2860 N NE2   . HIS C 1 118 ? -4.385  7.114   -21.683 1.00 44.06  ? 170 HIS E NE2   1 
ATOM   2861 N N     . ILE C 1 119 ? -3.761  12.346  -17.602 1.00 35.85  ? 171 ILE E N     1 
ATOM   2862 C CA    . ILE C 1 119 ? -3.627  13.059  -16.333 1.00 37.51  ? 171 ILE E CA    1 
ATOM   2863 C C     . ILE C 1 119 ? -3.721  12.094  -15.158 1.00 36.41  ? 171 ILE E C     1 
ATOM   2864 O O     . ILE C 1 119 ? -4.623  11.259  -15.111 1.00 33.68  ? 171 ILE E O     1 
ATOM   2865 C CB    . ILE C 1 119 ? -4.671  14.155  -16.190 1.00 35.51  ? 171 ILE E CB    1 
ATOM   2866 C CG1   . ILE C 1 119 ? -4.395  15.241  -17.230 1.00 42.14  ? 171 ILE E CG1   1 
ATOM   2867 C CG2   . ILE C 1 119 ? -4.602  14.758  -14.815 1.00 32.62  ? 171 ILE E CG2   1 
ATOM   2868 C CD1   . ILE C 1 119 ? -4.967  16.596  -16.897 1.00 44.55  ? 171 ILE E CD1   1 
ATOM   2869 N N     . ILE C 1 120 ? -2.758  12.195  -14.236 1.00 40.03  ? 172 ILE E N     1 
ATOM   2870 C CA    . ILE C 1 120 ? -2.685  11.315  -13.066 1.00 36.44  ? 172 ILE E CA    1 
ATOM   2871 C C     . ILE C 1 120 ? -3.347  11.938  -11.889 1.00 35.39  ? 172 ILE E C     1 
ATOM   2872 O O     . ILE C 1 120 ? -2.991  13.041  -11.517 1.00 36.72  ? 172 ILE E O     1 
ATOM   2873 C CB    . ILE C 1 120 ? -1.249  11.000  -12.639 1.00 36.48  ? 172 ILE E CB    1 
ATOM   2874 C CG1   . ILE C 1 120 ? -0.307  10.959  -13.840 1.00 42.20  ? 172 ILE E CG1   1 
ATOM   2875 C CG2   . ILE C 1 120 ? -1.201  9.692   -11.888 1.00 40.28  ? 172 ILE E CG2   1 
ATOM   2876 C CD1   . ILE C 1 120 ? 1.058   10.427  -13.488 1.00 41.89  ? 172 ILE E CD1   1 
ATOM   2877 N N     . LEU C 1 121 ? -4.292  11.225  -11.287 1.00 40.25  ? 173 LEU E N     1 
ATOM   2878 C CA    . LEU C 1 121 ? -4.931  11.694  -10.053 1.00 41.86  ? 173 LEU E CA    1 
ATOM   2879 C C     . LEU C 1 121 ? -4.710  10.745  -8.886  1.00 41.80  ? 173 LEU E C     1 
ATOM   2880 O O     . LEU C 1 121 ? -4.320  9.594   -9.071  1.00 41.96  ? 173 LEU E O     1 
ATOM   2881 C CB    . LEU C 1 121 ? -6.427  11.889  -10.263 1.00 37.41  ? 173 LEU E CB    1 
ATOM   2882 C CG    . LEU C 1 121 ? -6.794  12.841  -11.400 1.00 38.60  ? 173 LEU E CG    1 
ATOM   2883 C CD1   . LEU C 1 121 ? -8.284  13.043  -11.443 1.00 37.30  ? 173 LEU E CD1   1 
ATOM   2884 C CD2   . LEU C 1 121 ? -6.100  14.167  -11.236 1.00 37.02  ? 173 LEU E CD2   1 
ATOM   2885 N N     . ASN C 1 122 ? -4.945  11.250  -7.681  1.00 42.04  ? 174 ASN E N     1 
ATOM   2886 C CA    . ASN C 1 122 ? -4.929  10.425  -6.477  1.00 42.26  ? 174 ASN E CA    1 
ATOM   2887 C C     . ASN C 1 122 ? -6.336  10.070  -6.076  1.00 41.49  ? 174 ASN E C     1 
ATOM   2888 O O     . ASN C 1 122 ? -7.166  10.960  -5.864  1.00 40.79  ? 174 ASN E O     1 
ATOM   2889 C CB    . ASN C 1 122 ? -4.265  11.138  -5.295  1.00 48.03  ? 174 ASN E CB    1 
ATOM   2890 C CG    . ASN C 1 122 ? -2.778  11.255  -5.442  1.00 53.96  ? 174 ASN E CG    1 
ATOM   2891 O OD1   . ASN C 1 122 ? -2.092  10.290  -5.786  1.00 58.91  ? 174 ASN E OD1   1 
ATOM   2892 N ND2   . ASN C 1 122 ? -2.259  12.446  -5.173  1.00 55.74  ? 174 ASN E ND2   1 
ATOM   2893 N N     . SER C 1 123 ? -6.593  8.776   -5.939  1.00 38.16  ? 175 SER E N     1 
ATOM   2894 C CA    . SER C 1 123 ? -7.888  8.326   -5.491  1.00 37.73  ? 175 SER E CA    1 
ATOM   2895 C C     . SER C 1 123 ? -8.281  8.959   -4.174  1.00 38.84  ? 175 SER E C     1 
ATOM   2896 O O     . SER C 1 123 ? -7.449  9.195   -3.315  1.00 41.02  ? 175 SER E O     1 
ATOM   2897 C CB    . SER C 1 123 ? -7.910  6.821   -5.354  1.00 42.17  ? 175 SER E CB    1 
ATOM   2898 O OG    . SER C 1 123 ? -9.234  6.378   -5.086  1.00 49.82  ? 175 SER E OG    1 
ATOM   2899 N N     . MET C 1 124 ? -9.568  9.249   -4.066  1.00 40.02  ? 176 MET E N     1 
ATOM   2900 C CA    . MET C 1 124 ? -10.206 9.813   -2.883  1.00 43.39  ? 176 MET E CA    1 
ATOM   2901 C C     . MET C 1 124 ? -9.787  11.237  -2.553  1.00 39.86  ? 176 MET E C     1 
ATOM   2902 O O     . MET C 1 124 ? -10.106 11.741  -1.500  1.00 43.51  ? 176 MET E O     1 
ATOM   2903 C CB    . MET C 1 124 ? -9.968  8.914   -1.675  1.00 49.72  ? 176 MET E CB    1 
ATOM   2904 C CG    . MET C 1 124 ? -11.248 8.310   -1.124  1.00 53.67  ? 176 MET E CG    1 
ATOM   2905 S SD    . MET C 1 124 ? -12.070 7.143   -2.216  1.00 63.40  ? 176 MET E SD    1 
ATOM   2906 C CE    . MET C 1 124 ? -11.175 5.623   -1.858  1.00 56.48  ? 176 MET E CE    1 
ATOM   2907 N N     . HIS C 1 125 ? -9.098  11.904  -3.455  1.00 39.96  ? 177 HIS E N     1 
ATOM   2908 C CA    . HIS C 1 125 ? -8.910  13.333  -3.274  1.00 46.72  ? 177 HIS E CA    1 
ATOM   2909 C C     . HIS C 1 125 ? -9.905  14.090  -4.147  1.00 47.03  ? 177 HIS E C     1 
ATOM   2910 O O     . HIS C 1 125 ? -10.495 13.521  -5.051  1.00 46.67  ? 177 HIS E O     1 
ATOM   2911 C CB    . HIS C 1 125 ? -7.481  13.745  -3.604  1.00 49.99  ? 177 HIS E CB    1 
ATOM   2912 C CG    . HIS C 1 125 ? -6.470  13.216  -2.640  1.00 51.08  ? 177 HIS E CG    1 
ATOM   2913 N ND1   . HIS C 1 125 ? -6.304  11.869  -2.400  1.00 53.19  ? 177 HIS E ND1   1 
ATOM   2914 C CD2   . HIS C 1 125 ? -5.578  13.852  -1.849  1.00 53.12  ? 177 HIS E CD2   1 
ATOM   2915 C CE1   . HIS C 1 125 ? -5.351  11.698  -1.502  1.00 55.23  ? 177 HIS E CE1   1 
ATOM   2916 N NE2   . HIS C 1 125 ? -4.896  12.887  -1.151  1.00 57.76  ? 177 HIS E NE2   1 
ATOM   2917 N N     . LYS C 1 126 ? -10.085 15.374  -3.873  1.00 45.30  ? 178 LYS E N     1 
ATOM   2918 C CA    . LYS C 1 126 ? -11.085 16.174  -4.559  1.00 42.60  ? 178 LYS E CA    1 
ATOM   2919 C C     . LYS C 1 126 ? -10.376 17.115  -5.543  1.00 45.42  ? 178 LYS E C     1 
ATOM   2920 O O     . LYS C 1 126 ? -9.370  17.733  -5.203  1.00 45.60  ? 178 LYS E O     1 
ATOM   2921 C CB    . LYS C 1 126 ? -11.932 16.933  -3.523  1.00 44.18  ? 178 LYS E CB    1 
ATOM   2922 C CG    . LYS C 1 126 ? -13.095 17.752  -4.042  1.00 42.76  ? 178 LYS E CG    1 
ATOM   2923 C CD    . LYS C 1 126 ? -13.853 18.380  -2.884  1.00 53.18  ? 178 LYS E CD    1 
ATOM   2924 C CE    . LYS C 1 126 ? -14.173 19.863  -3.114  1.00 63.20  ? 178 LYS E CE    1 
ATOM   2925 N NZ    . LYS C 1 126 ? -15.304 20.103  -4.071  1.00 59.79  ? 178 LYS E NZ    1 
ATOM   2926 N N     . TYR C 1 127 ? -10.888 17.213  -6.769  1.00 44.70  ? 179 TYR E N     1 
ATOM   2927 C CA    . TYR C 1 127 ? -10.178 17.934  -7.822  1.00 41.56  ? 179 TYR E CA    1 
ATOM   2928 C C     . TYR C 1 127 ? -10.993 18.994  -8.549  1.00 42.91  ? 179 TYR E C     1 
ATOM   2929 O O     . TYR C 1 127 ? -12.221 18.956  -8.561  1.00 44.24  ? 179 TYR E O     1 
ATOM   2930 C CB    . TYR C 1 127 ? -9.651  16.950  -8.845  1.00 38.31  ? 179 TYR E CB    1 
ATOM   2931 C CG    . TYR C 1 127 ? -8.572  16.037  -8.339  1.00 39.31  ? 179 TYR E CG    1 
ATOM   2932 C CD1   . TYR C 1 127 ? -7.250  16.450  -8.290  1.00 40.04  ? 179 TYR E CD1   1 
ATOM   2933 C CD2   . TYR C 1 127 ? -8.876  14.752  -7.928  1.00 41.81  ? 179 TYR E CD2   1 
ATOM   2934 C CE1   . TYR C 1 127 ? -6.265  15.602  -7.835  1.00 39.59  ? 179 TYR E CE1   1 
ATOM   2935 C CE2   . TYR C 1 127 ? -7.909  13.908  -7.457  1.00 42.69  ? 179 TYR E CE2   1 
ATOM   2936 C CZ    . TYR C 1 127 ? -6.607  14.332  -7.416  1.00 42.35  ? 179 TYR E CZ    1 
ATOM   2937 O OH    . TYR C 1 127 ? -5.654  13.464  -6.964  1.00 42.36  ? 179 TYR E OH    1 
ATOM   2938 N N     . GLN C 1 128 ? -10.278 19.922  -9.178  1.00 42.83  ? 180 GLN E N     1 
ATOM   2939 C CA    . GLN C 1 128 ? -10.871 21.043  -9.895  1.00 40.52  ? 180 GLN E CA    1 
ATOM   2940 C C     . GLN C 1 128 ? -10.240 21.243  -11.281 1.00 43.36  ? 180 GLN E C     1 
ATOM   2941 O O     . GLN C 1 128 ? -9.072  21.601  -11.366 1.00 42.68  ? 180 GLN E O     1 
ATOM   2942 C CB    . GLN C 1 128 ? -10.705 22.305  -9.066  1.00 43.70  ? 180 GLN E CB    1 
ATOM   2943 C CG    . GLN C 1 128 ? -11.143 23.542  -9.761  1.00 46.11  ? 180 GLN E CG    1 
ATOM   2944 C CD    . GLN C 1 128 ? -12.639 23.569  -9.941  1.00 52.46  ? 180 GLN E CD    1 
ATOM   2945 O OE1   . GLN C 1 128 ? -13.390 23.671  -8.963  1.00 52.79  ? 180 GLN E OE1   1 
ATOM   2946 N NE2   . GLN C 1 128 ? -13.089 23.463  -11.192 1.00 48.03  ? 180 GLN E NE2   1 
ATOM   2947 N N     . PRO C 1 129 ? -11.006 21.003  -12.370 1.00 43.15  ? 181 PRO E N     1 
ATOM   2948 C CA    . PRO C 1 129 ? -10.495 21.145  -13.744 1.00 41.95  ? 181 PRO E CA    1 
ATOM   2949 C C     . PRO C 1 129 ? -10.323 22.602  -14.144 1.00 43.40  ? 181 PRO E C     1 
ATOM   2950 O O     . PRO C 1 129 ? -11.165 23.412  -13.783 1.00 50.93  ? 181 PRO E O     1 
ATOM   2951 C CB    . PRO C 1 129 ? -11.581 20.478  -14.593 1.00 39.91  ? 181 PRO E CB    1 
ATOM   2952 C CG    . PRO C 1 129 ? -12.361 19.637  -13.640 1.00 37.81  ? 181 PRO E CG    1 
ATOM   2953 C CD    . PRO C 1 129 ? -12.345 20.393  -12.362 1.00 40.42  ? 181 PRO E CD    1 
ATOM   2954 N N     . ARG C 1 130 ? -9.254  22.940  -14.854 1.00 38.11  ? 182 ARG E N     1 
ATOM   2955 C CA    . ARG C 1 130 ? -9.040  24.323  -15.261 1.00 40.58  ? 182 ARG E CA    1 
ATOM   2956 C C     . ARG C 1 130 ? -8.741  24.386  -16.752 1.00 48.15  ? 182 ARG E C     1 
ATOM   2957 O O     . ARG C 1 130 ? -8.046  23.523  -17.293 1.00 46.60  ? 182 ARG E O     1 
ATOM   2958 C CB    . ARG C 1 130 ? -7.897  24.970  -14.471 1.00 46.74  ? 182 ARG E CB    1 
ATOM   2959 C CG    . ARG C 1 130 ? -8.001  24.837  -12.947 1.00 47.28  ? 182 ARG E CG    1 
ATOM   2960 C CD    . ARG C 1 130 ? -6.898  25.607  -12.208 1.00 47.66  ? 182 ARG E CD    1 
ATOM   2961 N NE    . ARG C 1 130 ? -5.566  25.126  -12.545 1.00 44.42  ? 182 ARG E NE    1 
ATOM   2962 C CZ    . ARG C 1 130 ? -4.473  25.867  -12.457 1.00 43.43  ? 182 ARG E CZ    1 
ATOM   2963 N NH1   . ARG C 1 130 ? -4.572  27.116  -12.049 1.00 43.95  ? 182 ARG E NH1   1 
ATOM   2964 N NH2   . ARG C 1 130 ? -3.292  25.370  -12.794 1.00 42.68  ? 182 ARG E NH2   1 
ATOM   2965 N N     . LEU C 1 131 ? -9.287  25.400  -17.419 1.00 51.04  ? 183 LEU E N     1 
ATOM   2966 C CA    . LEU C 1 131 ? -9.005  25.620  -18.833 1.00 46.73  ? 183 LEU E CA    1 
ATOM   2967 C C     . LEU C 1 131 ? -8.006  26.755  -18.962 1.00 50.27  ? 183 LEU E C     1 
ATOM   2968 O O     . LEU C 1 131 ? -8.149  27.787  -18.314 1.00 50.75  ? 183 LEU E O     1 
ATOM   2969 C CB    . LEU C 1 131 ? -10.278 25.947  -19.613 1.00 41.59  ? 183 LEU E CB    1 
ATOM   2970 C CG    . LEU C 1 131 ? -10.043 26.494  -21.021 1.00 45.15  ? 183 LEU E CG    1 
ATOM   2971 C CD1   . LEU C 1 131 ? -9.553  25.402  -21.941 1.00 47.86  ? 183 LEU E CD1   1 
ATOM   2972 C CD2   . LEU C 1 131 ? -11.287 27.131  -21.595 1.00 47.84  ? 183 LEU E CD2   1 
ATOM   2973 N N     . HIS C 1 132 ? -6.994  26.559  -19.801 1.00 48.95  ? 184 HIS E N     1 
ATOM   2974 C CA    . HIS C 1 132 ? -5.968  27.572  -20.013 1.00 47.70  ? 184 HIS E CA    1 
ATOM   2975 C C     . HIS C 1 132 ? -5.851  27.941  -21.488 1.00 48.79  ? 184 HIS E C     1 
ATOM   2976 O O     . HIS C 1 132 ? -5.773  27.068  -22.352 1.00 46.06  ? 184 HIS E O     1 
ATOM   2977 C CB    . HIS C 1 132 ? -4.617  27.085  -19.484 1.00 48.58  ? 184 HIS E CB    1 
ATOM   2978 C CG    . HIS C 1 132 ? -4.631  26.727  -18.031 1.00 51.88  ? 184 HIS E CG    1 
ATOM   2979 N ND1   . HIS C 1 132 ? -4.317  27.631  -17.039 1.00 56.20  ? 184 HIS E ND1   1 
ATOM   2980 C CD2   . HIS C 1 132 ? -4.920  25.564  -17.401 1.00 49.68  ? 184 HIS E CD2   1 
ATOM   2981 C CE1   . HIS C 1 132 ? -4.413  27.040  -15.861 1.00 54.02  ? 184 HIS E CE1   1 
ATOM   2982 N NE2   . HIS C 1 132 ? -4.777  25.785  -16.053 1.00 54.53  ? 184 HIS E NE2   1 
ATOM   2983 N N     . ILE C 1 133 ? -5.840  29.240  -21.769 1.00 50.69  ? 185 ILE E N     1 
ATOM   2984 C CA    . ILE C 1 133 ? -5.732  29.727  -23.139 1.00 51.52  ? 185 ILE E CA    1 
ATOM   2985 C C     . ILE C 1 133 ? -4.446  30.521  -23.342 1.00 56.81  ? 185 ILE E C     1 
ATOM   2986 O O     . ILE C 1 133 ? -4.395  31.720  -23.066 1.00 65.72  ? 185 ILE E O     1 
ATOM   2987 C CB    . ILE C 1 133 ? -6.935  30.610  -23.520 1.00 55.59  ? 185 ILE E CB    1 
ATOM   2988 C CG1   . ILE C 1 133 ? -8.234  29.808  -23.433 1.00 47.06  ? 185 ILE E CG1   1 
ATOM   2989 C CG2   . ILE C 1 133 ? -6.751  31.186  -24.916 1.00 52.57  ? 185 ILE E CG2   1 
ATOM   2990 C CD1   . ILE C 1 133 ? -9.477  30.666  -23.341 1.00 43.31  ? 185 ILE E CD1   1 
ATOM   2991 N N     . VAL C 1 134 ? -3.409  29.845  -23.826 1.00 63.37  ? 186 VAL E N     1 
ATOM   2992 C CA    . VAL C 1 134 ? -2.121  30.485  -24.066 1.00 64.64  ? 186 VAL E CA    1 
ATOM   2993 C C     . VAL C 1 134 ? -2.100  31.193  -25.416 1.00 55.87  ? 186 VAL E C     1 
ATOM   2994 O O     . VAL C 1 134 ? -2.916  30.905  -26.292 1.00 56.85  ? 186 VAL E O     1 
ATOM   2995 C CB    . VAL C 1 134 ? -0.966  29.468  -24.012 1.00 59.90  ? 186 VAL E CB    1 
ATOM   2996 C CG1   . VAL C 1 134 ? 0.374   30.182  -24.103 1.00 61.52  ? 186 VAL E CG1   1 
ATOM   2997 C CG2   . VAL C 1 134 ? -1.051  28.636  -22.742 1.00 46.96  ? 186 VAL E CG2   1 
ATOM   2998 N N     . LYS C 1 135 ? -1.163  32.121  -25.578 1.00 65.01  ? 187 LYS E N     1 
ATOM   2999 C CA    . LYS C 1 135 ? -1.033  32.871  -26.821 1.00 63.73  ? 187 LYS E CA    1 
ATOM   3000 C C     . LYS C 1 135 ? -0.010  32.227  -27.750 1.00 65.01  ? 187 LYS E C     1 
ATOM   3001 O O     . LYS C 1 135 ? 0.436   31.104  -27.514 1.00 65.59  ? 187 LYS E O     1 
ATOM   3002 C CB    . LYS C 1 135 ? -0.642  34.322  -26.533 1.00 73.74  ? 187 LYS E CB    1 
ATOM   3003 C CG    . LYS C 1 135 ? -0.555  35.199  -27.772 1.00 87.14  ? 187 LYS E CG    1 
ATOM   3004 C CD    . LYS C 1 135 ? -0.430  36.668  -27.401 1.00 98.49  ? 187 LYS E CD    1 
ATOM   3005 C CE    . LYS C 1 135 ? 0.935   36.973  -26.808 1.00 104.99 ? 187 LYS E CE    1 
ATOM   3006 N NZ    . LYS C 1 135 ? 1.143   38.435  -26.617 1.00 116.09 ? 187 LYS E NZ    1 
ATOM   3007 N N     . ALA C 1 136 ? 0.358   32.945  -28.806 1.00 77.21  ? 188 ALA E N     1 
ATOM   3008 C CA    . ALA C 1 136 ? 1.329   32.444  -29.772 1.00 80.45  ? 188 ALA E CA    1 
ATOM   3009 C C     . ALA C 1 136 ? 1.484   33.611  -30.741 1.00 99.08  ? 188 ALA E C     1 
ATOM   3010 O O     . ALA C 1 136 ? 0.498   34.211  -31.169 1.00 101.51 ? 188 ALA E O     1 
ATOM   3011 C CB    . ALA C 1 136 ? 0.895   31.088  -30.305 1.00 68.90  ? 188 ALA E CB    1 
ATOM   3012 N N     . ASP C 1 137 ? 2.729   33.927  -31.084 1.00 104.53 ? 189 ASP E N     1 
ATOM   3013 C CA    . ASP C 1 137 ? 3.015   35.022  -32.003 1.00 112.52 ? 189 ASP E CA    1 
ATOM   3014 C C     . ASP C 1 137 ? 3.129   34.346  -33.366 1.00 115.43 ? 189 ASP E C     1 
ATOM   3015 O O     . ASP C 1 137 ? 2.165   33.765  -33.863 1.00 109.68 ? 189 ASP E O     1 
ATOM   3016 C CB    . ASP C 1 137 ? 4.313   35.762  -31.673 1.00 108.38 ? 189 ASP E CB    1 
ATOM   3017 C CG    . ASP C 1 137 ? 5.545   34.908  -31.901 1.00 108.43 ? 189 ASP E CG    1 
ATOM   3018 O OD1   . ASP C 1 137 ? 5.410   33.667  -31.943 1.00 107.75 ? 189 ASP E OD1   1 
ATOM   3019 O OD2   . ASP C 1 137 ? 6.648   35.477  -32.038 1.00 108.76 ? 189 ASP E OD2   1 
ATOM   3020 N N     . THR C 1 147 ? -2.834  40.126  -22.848 1.00 128.47 ? 199 THR E N     1 
ATOM   3021 C CA    . THR C 1 147 ? -3.982  40.078  -23.777 1.00 133.85 ? 199 THR E CA    1 
ATOM   3022 C C     . THR C 1 147 ? -4.478  38.611  -24.004 1.00 130.12 ? 199 THR E C     1 
ATOM   3023 O O     . THR C 1 147 ? -5.465  38.347  -24.716 1.00 123.24 ? 199 THR E O     1 
ATOM   3024 C CB    . THR C 1 147 ? -3.655  40.736  -25.135 1.00 125.55 ? 199 THR E CB    1 
ATOM   3025 O OG1   . THR C 1 147 ? -2.545  40.069  -25.737 1.00 120.12 ? 199 THR E OG1   1 
ATOM   3026 C CG2   . THR C 1 147 ? -3.258  42.215  -24.949 1.00 113.18 ? 199 THR E CG2   1 
ATOM   3027 N N     . ALA C 1 148 ? -3.804  37.639  -23.392 1.00 122.68 ? 200 ALA E N     1 
ATOM   3028 C CA    . ALA C 1 148 ? -4.235  36.246  -23.584 1.00 100.49 ? 200 ALA E CA    1 
ATOM   3029 C C     . ALA C 1 148 ? -4.223  35.363  -22.359 1.00 107.40 ? 200 ALA E C     1 
ATOM   3030 O O     . ALA C 1 148 ? -5.283  34.957  -21.924 1.00 106.84 ? 200 ALA E O     1 
ATOM   3031 C CB    . ALA C 1 148 ? -3.402  35.571  -24.648 1.00 95.08  ? 200 ALA E CB    1 
ATOM   3032 N N     . PHE C 1 149 ? -3.282  35.462  -21.414 1.00 108.61 ? 201 PHE E N     1 
ATOM   3033 C CA    . PHE C 1 149 ? -2.974  34.223  -20.640 1.00 91.03  ? 201 PHE E CA    1 
ATOM   3034 C C     . PHE C 1 149 ? -3.839  33.889  -19.424 1.00 89.35  ? 201 PHE E C     1 
ATOM   3035 O O     . PHE C 1 149 ? -3.866  34.590  -18.414 1.00 100.34 ? 201 PHE E O     1 
ATOM   3036 C CB    . PHE C 1 149 ? -1.527  34.259  -20.211 1.00 87.23  ? 201 PHE E CB    1 
ATOM   3037 C CG    . PHE C 1 149 ? -0.598  34.376  -21.360 1.00 89.98  ? 201 PHE E CG    1 
ATOM   3038 C CD1   . PHE C 1 149 ? -0.196  33.254  -22.057 1.00 85.03  ? 201 PHE E CD1   1 
ATOM   3039 C CD2   . PHE C 1 149 ? -0.167  35.619  -21.792 1.00 88.27  ? 201 PHE E CD2   1 
ATOM   3040 C CE1   . PHE C 1 149 ? 0.663   33.374  -23.139 1.00 85.01  ? 201 PHE E CE1   1 
ATOM   3041 C CE2   . PHE C 1 149 ? 0.695   35.736  -22.876 1.00 82.12  ? 201 PHE E CE2   1 
ATOM   3042 C CZ    . PHE C 1 149 ? 1.104   34.623  -23.549 1.00 81.40  ? 201 PHE E CZ    1 
ATOM   3043 N N     . CYS C 1 150 ? -4.544  32.779  -19.544 1.00 79.22  ? 202 CYS E N     1 
ATOM   3044 C CA    . CYS C 1 150 ? -5.831  32.716  -18.905 1.00 75.35  ? 202 CYS E CA    1 
ATOM   3045 C C     . CYS C 1 150 ? -6.149  31.326  -18.455 1.00 68.27  ? 202 CYS E C     1 
ATOM   3046 O O     . CYS C 1 150 ? -5.699  30.343  -19.029 1.00 66.09  ? 202 CYS E O     1 
ATOM   3047 C CB    . CYS C 1 150 ? -6.888  33.215  -19.875 1.00 76.28  ? 202 CYS E CB    1 
ATOM   3048 S SG    . CYS C 1 150 ? -8.511  33.414  -19.203 1.00 98.94  ? 202 CYS E SG    1 
ATOM   3049 N N     . THR C 1 151 ? -7.099  31.514  -17.570 1.00 67.18  ? 203 THR E N     1 
ATOM   3050 C CA    . THR C 1 151 ? -7.429  30.382  -16.756 1.00 61.59  ? 203 THR E CA    1 
ATOM   3051 C C     . THR C 1 151 ? -8.872  30.540  -16.360 1.00 58.42  ? 203 THR E C     1 
ATOM   3052 O O     . THR C 1 151 ? -9.243  31.518  -15.713 1.00 59.91  ? 203 THR E O     1 
ATOM   3053 C CB    . THR C 1 151 ? -6.522  30.297  -15.521 1.00 62.69  ? 203 THR E CB    1 
ATOM   3054 O OG1   . THR C 1 151 ? -5.177  30.005  -15.929 1.00 58.98  ? 203 THR E OG1   1 
ATOM   3055 C CG2   . THR C 1 151 ? -7.015  29.216  -14.595 1.00 56.76  ? 203 THR E CG2   1 
ATOM   3056 N N     . HIS C 1 152 ? -9.707  29.611  -16.795 1.00 55.58  ? 204 HIS E N     1 
ATOM   3057 C CA    . HIS C 1 152 ? -11.094 29.669  -16.387 1.00 49.42  ? 204 HIS E CA    1 
ATOM   3058 C C     . HIS C 1 152 ? -11.454 28.439  -15.612 1.00 48.10  ? 204 HIS E C     1 
ATOM   3059 O O     . HIS C 1 152 ? -11.040 27.327  -15.928 1.00 49.15  ? 204 HIS E O     1 
ATOM   3060 C CB    . HIS C 1 152 ? -12.007 29.858  -17.580 1.00 51.14  ? 204 HIS E CB    1 
ATOM   3061 C CG    . HIS C 1 152 ? -11.854 31.198  -18.215 1.00 61.83  ? 204 HIS E CG    1 
ATOM   3062 N ND1   . HIS C 1 152 ? -12.715 32.250  -17.969 1.00 66.08  ? 204 HIS E ND1   1 
ATOM   3063 C CD2   . HIS C 1 152 ? -10.915 31.671  -19.064 1.00 56.70  ? 204 HIS E CD2   1 
ATOM   3064 C CE1   . HIS C 1 152 ? -12.312 33.310  -18.646 1.00 62.96  ? 204 HIS E CE1   1 
ATOM   3065 N NE2   . HIS C 1 152 ? -11.218 32.986  -19.314 1.00 60.86  ? 204 HIS E NE2   1 
ATOM   3066 N N     . VAL C 1 153 ? -12.208 28.676  -14.554 1.00 43.84  ? 205 VAL E N     1 
ATOM   3067 C CA    . VAL C 1 153 ? -12.510 27.662  -13.583 1.00 46.13  ? 205 VAL E CA    1 
ATOM   3068 C C     . VAL C 1 153 ? -14.014 27.716  -13.274 1.00 51.29  ? 205 VAL E C     1 
ATOM   3069 O O     . VAL C 1 153 ? -14.526 28.737  -12.810 1.00 51.96  ? 205 VAL E O     1 
ATOM   3070 C CB    . VAL C 1 153 ? -11.657 27.876  -12.302 1.00 46.89  ? 205 VAL E CB    1 
ATOM   3071 C CG1   . VAL C 1 153 ? -11.964 26.828  -11.250 1.00 46.47  ? 205 VAL E CG1   1 
ATOM   3072 C CG2   . VAL C 1 153 ? -10.170 27.887  -12.643 1.00 43.30  ? 205 VAL E CG2   1 
ATOM   3073 N N     . PHE C 1 154 ? -14.720 26.630  -13.568 1.00 48.35  ? 206 PHE E N     1 
ATOM   3074 C CA    . PHE C 1 154 ? -16.127 26.508  -13.207 1.00 52.41  ? 206 PHE E CA    1 
ATOM   3075 C C     . PHE C 1 154 ? -16.223 25.682  -11.956 1.00 55.57  ? 206 PHE E C     1 
ATOM   3076 O O     . PHE C 1 154 ? -15.852 24.508  -11.995 1.00 56.26  ? 206 PHE E O     1 
ATOM   3077 C CB    . PHE C 1 154 ? -16.935 25.834  -14.311 1.00 51.48  ? 206 PHE E CB    1 
ATOM   3078 C CG    . PHE C 1 154 ? -16.914 26.564  -15.611 1.00 50.26  ? 206 PHE E CG    1 
ATOM   3079 C CD1   . PHE C 1 154 ? -17.633 27.733  -15.772 1.00 54.09  ? 206 PHE E CD1   1 
ATOM   3080 C CD2   . PHE C 1 154 ? -16.177 26.082  -16.669 1.00 45.83  ? 206 PHE E CD2   1 
ATOM   3081 C CE1   . PHE C 1 154 ? -17.623 28.406  -16.977 1.00 55.41  ? 206 PHE E CE1   1 
ATOM   3082 C CE2   . PHE C 1 154 ? -16.154 26.747  -17.864 1.00 53.70  ? 206 PHE E CE2   1 
ATOM   3083 C CZ    . PHE C 1 154 ? -16.886 27.915  -18.024 1.00 56.90  ? 206 PHE E CZ    1 
ATOM   3084 N N     . PRO C 1 155 ? -16.738 26.261  -10.849 1.00 57.16  ? 207 PRO E N     1 
ATOM   3085 C CA    . PRO C 1 155 ? -16.705 25.489  -9.603  1.00 52.09  ? 207 PRO E CA    1 
ATOM   3086 C C     . PRO C 1 155 ? -17.655 24.295  -9.630  1.00 51.87  ? 207 PRO E C     1 
ATOM   3087 O O     . PRO C 1 155 ? -17.617 23.493  -8.702  1.00 58.50  ? 207 PRO E O     1 
ATOM   3088 C CB    . PRO C 1 155 ? -17.125 26.508  -8.538  1.00 51.12  ? 207 PRO E CB    1 
ATOM   3089 C CG    . PRO C 1 155 ? -16.960 27.841  -9.176  1.00 56.26  ? 207 PRO E CG    1 
ATOM   3090 C CD    . PRO C 1 155 ? -17.259 27.619  -10.629 1.00 56.66  ? 207 PRO E CD    1 
ATOM   3091 N N     . GLU C 1 156 ? -18.462 24.163  -10.676 1.00 44.87  ? 208 GLU E N     1 
ATOM   3092 C CA    . GLU C 1 156 ? -19.378 23.037  -10.791 1.00 45.76  ? 208 GLU E CA    1 
ATOM   3093 C C     . GLU C 1 156 ? -18.754 21.791  -11.433 1.00 47.47  ? 208 GLU E C     1 
ATOM   3094 O O     . GLU C 1 156 ? -19.305 20.695  -11.339 1.00 45.71  ? 208 GLU E O     1 
ATOM   3095 C CB    . GLU C 1 156 ? -20.615 23.454  -11.584 1.00 50.67  ? 208 GLU E CB    1 
ATOM   3096 C CG    . GLU C 1 156 ? -20.325 24.085  -12.948 1.00 53.98  ? 208 GLU E CG    1 
ATOM   3097 C CD    . GLU C 1 156 ? -20.233 25.607  -12.898 1.00 59.66  ? 208 GLU E CD    1 
ATOM   3098 O OE1   . GLU C 1 156 ? -19.643 26.134  -11.919 1.00 54.64  ? 208 GLU E OE1   1 
ATOM   3099 O OE2   . GLU C 1 156 ? -20.754 26.264  -13.843 1.00 59.41  ? 208 GLU E OE2   1 
ATOM   3100 N N     . THR C 1 157 ? -17.609 21.949  -12.087 1.00 49.97  ? 209 THR E N     1 
ATOM   3101 C CA    . THR C 1 157 ? -16.914 20.794  -12.657 1.00 49.23  ? 209 THR E CA    1 
ATOM   3102 C C     . THR C 1 157 ? -15.926 20.143  -11.664 1.00 44.62  ? 209 THR E C     1 
ATOM   3103 O O     . THR C 1 157 ? -15.187 19.230  -12.031 1.00 39.54  ? 209 THR E O     1 
ATOM   3104 C CB    . THR C 1 157 ? -16.153 21.165  -13.959 1.00 46.07  ? 209 THR E CB    1 
ATOM   3105 O OG1   . THR C 1 157 ? -15.340 22.333  -13.753 1.00 47.58  ? 209 THR E OG1   1 
ATOM   3106 C CG2   . THR C 1 157 ? -17.126 21.426  -15.076 1.00 43.15  ? 209 THR E CG2   1 
ATOM   3107 N N     . ALA C 1 158 ? -15.927 20.592  -10.410 1.00 46.20  ? 210 ALA E N     1 
ATOM   3108 C CA    . ALA C 1 158 ? -15.101 19.957  -9.374  1.00 45.19  ? 210 ALA E CA    1 
ATOM   3109 C C     . ALA C 1 158 ? -15.627 18.551  -9.017  1.00 48.03  ? 210 ALA E C     1 
ATOM   3110 O O     . ALA C 1 158 ? -16.823 18.279  -9.192  1.00 53.39  ? 210 ALA E O     1 
ATOM   3111 C CB    . ALA C 1 158 ? -15.037 20.827  -8.150  1.00 43.21  ? 210 ALA E CB    1 
ATOM   3112 N N     . PHE C 1 159 ? -14.749 17.662  -8.536  1.00 39.88  ? 211 PHE E N     1 
ATOM   3113 C CA    . PHE C 1 159 ? -15.120 16.256  -8.315  1.00 39.53  ? 211 PHE E CA    1 
ATOM   3114 C C     . PHE C 1 159 ? -14.145 15.498  -7.428  1.00 42.78  ? 211 PHE E C     1 
ATOM   3115 O O     . PHE C 1 159 ? -13.001 15.910  -7.262  1.00 47.90  ? 211 PHE E O     1 
ATOM   3116 C CB    . PHE C 1 159 ? -15.239 15.508  -9.653  1.00 39.97  ? 211 PHE E CB    1 
ATOM   3117 C CG    . PHE C 1 159 ? -13.963 15.474  -10.462 1.00 39.51  ? 211 PHE E CG    1 
ATOM   3118 C CD1   . PHE C 1 159 ? -13.097 14.398  -10.382 1.00 39.51  ? 211 PHE E CD1   1 
ATOM   3119 C CD2   . PHE C 1 159 ? -13.634 16.518  -11.319 1.00 43.95  ? 211 PHE E CD2   1 
ATOM   3120 C CE1   . PHE C 1 159 ? -11.913 14.362  -11.140 1.00 35.05  ? 211 PHE E CE1   1 
ATOM   3121 C CE2   . PHE C 1 159 ? -12.449 16.489  -12.069 1.00 42.30  ? 211 PHE E CE2   1 
ATOM   3122 C CZ    . PHE C 1 159 ? -11.590 15.409  -11.972 1.00 33.54  ? 211 PHE E CZ    1 
ATOM   3123 N N     . ILE C 1 160 ? -14.591 14.372  -6.884  1.00 37.17  ? 212 ILE E N     1 
ATOM   3124 C CA    . ILE C 1 160 ? -13.717 13.483  -6.143  1.00 38.55  ? 212 ILE E CA    1 
ATOM   3125 C C     . ILE C 1 160 ? -13.299 12.345  -7.049  1.00 39.78  ? 212 ILE E C     1 
ATOM   3126 O O     . ILE C 1 160 ? -14.151 11.663  -7.583  1.00 47.39  ? 212 ILE E O     1 
ATOM   3127 C CB    . ILE C 1 160 ? -14.414 12.914  -4.902  1.00 43.24  ? 212 ILE E CB    1 
ATOM   3128 C CG1   . ILE C 1 160 ? -14.852 14.046  -3.979  1.00 51.67  ? 212 ILE E CG1   1 
ATOM   3129 C CG2   . ILE C 1 160 ? -13.491 12.000  -4.139  1.00 41.59  ? 212 ILE E CG2   1 
ATOM   3130 C CD1   . ILE C 1 160 ? -16.017 13.680  -3.036  1.00 58.92  ? 212 ILE E CD1   1 
ATOM   3131 N N     . ALA C 1 161 ? -12.002 12.136  -7.247  1.00 39.34  ? 213 ALA E N     1 
ATOM   3132 C CA    . ALA C 1 161 ? -11.548 11.003  -8.057  1.00 38.37  ? 213 ALA E CA    1 
ATOM   3133 C C     . ALA C 1 161 ? -11.761 9.717   -7.285  1.00 38.87  ? 213 ALA E C     1 
ATOM   3134 O O     . ALA C 1 161 ? -11.533 9.687   -6.094  1.00 46.87  ? 213 ALA E O     1 
ATOM   3135 C CB    . ALA C 1 161 ? -10.082 11.163  -8.437  1.00 35.13  ? 213 ALA E CB    1 
ATOM   3136 N N     . VAL C 1 162 ? -12.208 8.655   -7.936  1.00 37.56  ? 214 VAL E N     1 
ATOM   3137 C CA    . VAL C 1 162 ? -12.389 7.383   -7.238  1.00 40.41  ? 214 VAL E CA    1 
ATOM   3138 C C     . VAL C 1 162 ? -12.034 6.183   -8.102  1.00 42.02  ? 214 VAL E C     1 
ATOM   3139 O O     . VAL C 1 162 ? -12.031 6.253   -9.320  1.00 43.78  ? 214 VAL E O     1 
ATOM   3140 C CB    . VAL C 1 162 ? -13.830 7.205   -6.744  1.00 43.70  ? 214 VAL E CB    1 
ATOM   3141 C CG1   . VAL C 1 162 ? -14.083 8.042   -5.503  1.00 42.90  ? 214 VAL E CG1   1 
ATOM   3142 C CG2   . VAL C 1 162 ? -14.815 7.549   -7.848  1.00 44.84  ? 214 VAL E CG2   1 
ATOM   3143 N N     . THR C 1 163 ? -11.744 5.068   -7.457  1.00 46.82  ? 215 THR E N     1 
ATOM   3144 C CA    . THR C 1 163 ? -11.278 3.890   -8.160  1.00 44.55  ? 215 THR E CA    1 
ATOM   3145 C C     . THR C 1 163 ? -12.497 3.084   -8.563  1.00 43.19  ? 215 THR E C     1 
ATOM   3146 O O     . THR C 1 163 ? -12.447 2.271   -9.485  1.00 49.88  ? 215 THR E O     1 
ATOM   3147 C CB    . THR C 1 163 ? -10.318 3.059   -7.280  1.00 50.75  ? 215 THR E CB    1 
ATOM   3148 O OG1   . THR C 1 163 ? -9.402  2.340   -8.104  1.00 51.26  ? 215 THR E OG1   1 
ATOM   3149 C CG2   . THR C 1 163 ? -11.083 2.086   -6.401  1.00 55.43  ? 215 THR E CG2   1 
ATOM   3150 N N     . SER C 1 164 ? -13.597 3.346   -7.864  1.00 44.26  ? 216 SER E N     1 
ATOM   3151 C CA    . SER C 1 164 ? -14.912 2.776   -8.169  1.00 47.96  ? 216 SER E CA    1 
ATOM   3152 C C     . SER C 1 164 ? -15.997 3.655   -7.547  1.00 45.33  ? 216 SER E C     1 
ATOM   3153 O O     . SER C 1 164 ? -15.705 4.593   -6.817  1.00 45.38  ? 216 SER E O     1 
ATOM   3154 C CB    . SER C 1 164 ? -15.037 1.356   -7.643  1.00 47.97  ? 216 SER E CB    1 
ATOM   3155 O OG    . SER C 1 164 ? -15.437 1.377   -6.285  1.00 43.50  ? 216 SER E OG    1 
ATOM   3156 N N     . TYR C 1 165 ? -17.254 3.352   -7.812  1.00 45.93  ? 217 TYR E N     1 
ATOM   3157 C CA    . TYR C 1 165 ? -18.307 4.260   -7.388  1.00 47.89  ? 217 TYR E CA    1 
ATOM   3158 C C     . TYR C 1 165 ? -18.713 4.133   -5.932  1.00 49.02  ? 217 TYR E C     1 
ATOM   3159 O O     . TYR C 1 165 ? -18.841 3.030   -5.401  1.00 45.45  ? 217 TYR E O     1 
ATOM   3160 C CB    . TYR C 1 165 ? -19.525 4.063   -8.263  1.00 50.31  ? 217 TYR E CB    1 
ATOM   3161 C CG    . TYR C 1 165 ? -19.409 4.808   -9.553  1.00 50.32  ? 217 TYR E CG    1 
ATOM   3162 C CD1   . TYR C 1 165 ? -18.931 6.115   -9.579  1.00 48.46  ? 217 TYR E CD1   1 
ATOM   3163 C CD2   . TYR C 1 165 ? -19.756 4.205   -10.746 1.00 46.74  ? 217 TYR E CD2   1 
ATOM   3164 C CE1   . TYR C 1 165 ? -18.821 6.799   -10.763 1.00 47.74  ? 217 TYR E CE1   1 
ATOM   3165 C CE2   . TYR C 1 165 ? -19.648 4.874   -11.916 1.00 45.39  ? 217 TYR E CE2   1 
ATOM   3166 C CZ    . TYR C 1 165 ? -19.181 6.167   -11.932 1.00 45.74  ? 217 TYR E CZ    1 
ATOM   3167 O OH    . TYR C 1 165 ? -19.086 6.821   -13.129 1.00 42.92  ? 217 TYR E OH    1 
ATOM   3168 N N     . GLN C 1 166 ? -18.940 5.281   -5.300  1.00 49.88  ? 218 GLN E N     1 
ATOM   3169 C CA    . GLN C 1 166 ? -19.329 5.317   -3.897  1.00 49.94  ? 218 GLN E CA    1 
ATOM   3170 C C     . GLN C 1 166 ? -20.836 5.501   -3.756  1.00 48.05  ? 218 GLN E C     1 
ATOM   3171 O O     . GLN C 1 166 ? -21.576 4.545   -3.555  1.00 49.24  ? 218 GLN E O     1 
ATOM   3172 C CB    . GLN C 1 166 ? -18.584 6.439   -3.157  1.00 49.43  ? 218 GLN E CB    1 
ATOM   3173 C CG    . GLN C 1 166 ? -17.070 6.324   -3.189  1.00 47.59  ? 218 GLN E CG    1 
ATOM   3174 C CD    . GLN C 1 166 ? -16.583 4.990   -2.690  1.00 46.33  ? 218 GLN E CD    1 
ATOM   3175 O OE1   . GLN C 1 166 ? -16.594 4.724   -1.489  1.00 49.32  ? 218 GLN E OE1   1 
ATOM   3176 N NE2   . GLN C 1 166 ? -16.153 4.136   -3.609  1.00 42.82  ? 218 GLN E NE2   1 
ATOM   3177 N N     . ASN C 1 167 ? -21.275 6.747   -3.846  1.00 47.12  ? 219 ASN E N     1 
ATOM   3178 C CA    . ASN C 1 167 ? -22.687 7.077   -3.832  1.00 46.93  ? 219 ASN E CA    1 
ATOM   3179 C C     . ASN C 1 167 ? -23.396 6.414   -5.017  1.00 51.65  ? 219 ASN E C     1 
ATOM   3180 O O     . ASN C 1 167 ? -23.076 6.711   -6.165  1.00 55.68  ? 219 ASN E O     1 
ATOM   3181 C CB    . ASN C 1 167 ? -22.836 8.595   -3.874  1.00 45.54  ? 219 ASN E CB    1 
ATOM   3182 C CG    . ASN C 1 167 ? -24.255 9.046   -3.675  1.00 48.45  ? 219 ASN E CG    1 
ATOM   3183 O OD1   . ASN C 1 167 ? -25.191 8.284   -3.890  1.00 50.68  ? 219 ASN E OD1   1 
ATOM   3184 N ND2   . ASN C 1 167 ? -24.428 10.298  -3.261  1.00 45.46  ? 219 ASN E ND2   1 
ATOM   3185 N N     . HIS C 1 168 ? -24.351 5.521   -4.775  1.00 48.66  ? 220 HIS E N     1 
ATOM   3186 C CA    . HIS C 1 168 ? -24.936 4.808   -5.911  1.00 56.49  ? 220 HIS E CA    1 
ATOM   3187 C C     . HIS C 1 168 ? -25.927 5.700   -6.696  1.00 58.59  ? 220 HIS E C     1 
ATOM   3188 O O     . HIS C 1 168 ? -26.500 5.274   -7.715  1.00 53.31  ? 220 HIS E O     1 
ATOM   3189 C CB    . HIS C 1 168 ? -25.599 3.498   -5.455  1.00 60.42  ? 220 HIS E CB    1 
ATOM   3190 C CG    . HIS C 1 168 ? -27.069 3.608   -5.196  1.00 72.70  ? 220 HIS E CG    1 
ATOM   3191 N ND1   . HIS C 1 168 ? -27.587 3.894   -3.947  1.00 70.52  ? 220 HIS E ND1   1 
ATOM   3192 C CD2   . HIS C 1 168 ? -28.135 3.457   -6.021  1.00 74.29  ? 220 HIS E CD2   1 
ATOM   3193 C CE1   . HIS C 1 168 ? -28.906 3.928   -4.018  1.00 73.24  ? 220 HIS E CE1   1 
ATOM   3194 N NE2   . HIS C 1 168 ? -29.264 3.670   -5.267  1.00 81.14  ? 220 HIS E NE2   1 
ATOM   3195 N N     . LYS C 1 169 ? -26.102 6.939   -6.230  1.00 53.04  ? 221 LYS E N     1 
ATOM   3196 C CA    . LYS C 1 169 ? -26.899 7.927   -6.947  1.00 47.98  ? 221 LYS E CA    1 
ATOM   3197 C C     . LYS C 1 169 ? -26.134 8.433   -8.152  1.00 51.44  ? 221 LYS E C     1 
ATOM   3198 O O     . LYS C 1 169 ? -26.664 8.485   -9.251  1.00 52.62  ? 221 LYS E O     1 
ATOM   3199 C CB    . LYS C 1 169 ? -27.278 9.097   -6.044  1.00 49.21  ? 221 LYS E CB    1 
ATOM   3200 C CG    . LYS C 1 169 ? -28.470 8.827   -5.136  1.00 54.35  ? 221 LYS E CG    1 
ATOM   3201 C CD    . LYS C 1 169 ? -28.922 10.094  -4.424  1.00 53.11  ? 221 LYS E CD    1 
ATOM   3202 C CE    . LYS C 1 169 ? -29.753 10.962  -5.344  1.00 58.30  ? 221 LYS E CE    1 
ATOM   3203 N NZ    . LYS C 1 169 ? -30.246 12.200  -4.683  1.00 59.32  ? 221 LYS E NZ    1 
ATOM   3204 N N     . ILE C 1 170 ? -24.881 8.817   -7.930  1.00 56.15  ? 222 ILE E N     1 
ATOM   3205 C CA    . ILE C 1 170 ? -23.969 9.186   -9.006  1.00 46.15  ? 222 ILE E CA    1 
ATOM   3206 C C     . ILE C 1 170 ? -23.885 8.067   -10.038 1.00 49.12  ? 222 ILE E C     1 
ATOM   3207 O O     . ILE C 1 170 ? -23.958 8.336   -11.239 1.00 48.43  ? 222 ILE E O     1 
ATOM   3208 C CB    . ILE C 1 170 ? -22.564 9.508   -8.455  1.00 47.92  ? 222 ILE E CB    1 
ATOM   3209 C CG1   . ILE C 1 170 ? -22.594 10.814  -7.652  1.00 48.61  ? 222 ILE E CG1   1 
ATOM   3210 C CG2   . ILE C 1 170 ? -21.518 9.584   -9.573  1.00 47.71  ? 222 ILE E CG2   1 
ATOM   3211 C CD1   . ILE C 1 170 ? -22.720 12.063  -8.493  1.00 46.67  ? 222 ILE E CD1   1 
ATOM   3212 N N     . THR C 1 171 ? -23.760 6.817   -9.581  1.00 48.39  ? 223 THR E N     1 
ATOM   3213 C CA    . THR C 1 171 ? -23.740 5.677   -10.503 1.00 49.27  ? 223 THR E CA    1 
ATOM   3214 C C     . THR C 1 171 ? -24.915 5.721   -11.473 1.00 48.65  ? 223 THR E C     1 
ATOM   3215 O O     . THR C 1 171 ? -24.728 5.702   -12.683 1.00 45.21  ? 223 THR E O     1 
ATOM   3216 C CB    . THR C 1 171 ? -23.784 4.328   -9.778  1.00 47.50  ? 223 THR E CB    1 
ATOM   3217 O OG1   . THR C 1 171 ? -22.603 4.169   -8.995  1.00 50.41  ? 223 THR E OG1   1 
ATOM   3218 C CG2   . THR C 1 171 ? -23.856 3.177   -10.789 1.00 42.58  ? 223 THR E CG2   1 
ATOM   3219 N N     . GLN C 1 172 ? -26.123 5.789   -10.926 1.00 50.95  ? 224 GLN E N     1 
ATOM   3220 C CA    . GLN C 1 172 ? -27.325 5.832   -11.741 1.00 51.10  ? 224 GLN E CA    1 
ATOM   3221 C C     . GLN C 1 172 ? -27.451 7.130   -12.550 1.00 54.11  ? 224 GLN E C     1 
ATOM   3222 O O     . GLN C 1 172 ? -27.913 7.101   -13.701 1.00 55.65  ? 224 GLN E O     1 
ATOM   3223 C CB    . GLN C 1 172 ? -28.566 5.631   -10.867 1.00 52.66  ? 224 GLN E CB    1 
ATOM   3224 C CG    . GLN C 1 172 ? -28.907 4.151   -10.652 1.00 61.57  ? 224 GLN E CG    1 
ATOM   3225 C CD    . GLN C 1 172 ? -29.532 3.464   -11.890 1.00 68.23  ? 224 GLN E CD    1 
ATOM   3226 O OE1   . GLN C 1 172 ? -30.271 4.080   -12.690 1.00 55.63  ? 224 GLN E OE1   1 
ATOM   3227 N NE2   . GLN C 1 172 ? -29.217 2.175   -12.052 1.00 66.59  ? 224 GLN E NE2   1 
ATOM   3228 N N     . LEU C 1 173 ? -27.036 8.256   -11.969 1.00 46.83  ? 225 LEU E N     1 
ATOM   3229 C CA    . LEU C 1 173 ? -27.047 9.532   -12.681 1.00 45.03  ? 225 LEU E CA    1 
ATOM   3230 C C     . LEU C 1 173 ? -26.117 9.460   -13.920 1.00 53.03  ? 225 LEU E C     1 
ATOM   3231 O O     . LEU C 1 173 ? -26.311 10.158  -14.934 1.00 48.74  ? 225 LEU E O     1 
ATOM   3232 C CB    . LEU C 1 173 ? -26.635 10.657  -11.738 1.00 41.03  ? 225 LEU E CB    1 
ATOM   3233 C CG    . LEU C 1 173 ? -27.303 12.034  -11.801 1.00 43.10  ? 225 LEU E CG    1 
ATOM   3234 C CD1   . LEU C 1 173 ? -28.795 11.935  -11.828 1.00 46.29  ? 225 LEU E CD1   1 
ATOM   3235 C CD2   . LEU C 1 173 ? -26.883 12.874  -10.597 1.00 51.23  ? 225 LEU E CD2   1 
ATOM   3236 N N     . LYS C 1 174 ? -25.120 8.585   -13.842 1.00 53.14  ? 226 LYS E N     1 
ATOM   3237 C CA    . LYS C 1 174 ? -24.232 8.345   -14.969 1.00 47.44  ? 226 LYS E CA    1 
ATOM   3238 C C     . LYS C 1 174 ? -24.777 7.317   -15.955 1.00 46.85  ? 226 LYS E C     1 
ATOM   3239 O O     . LYS C 1 174 ? -24.414 7.332   -17.119 1.00 49.93  ? 226 LYS E O     1 
ATOM   3240 C CB    . LYS C 1 174 ? -22.866 7.894   -14.467 1.00 44.30  ? 226 LYS E CB    1 
ATOM   3241 C CG    . LYS C 1 174 ? -22.149 8.948   -13.653 1.00 44.14  ? 226 LYS E CG    1 
ATOM   3242 C CD    . LYS C 1 174 ? -20.735 9.190   -14.183 1.00 45.63  ? 226 LYS E CD    1 
ATOM   3243 C CE    . LYS C 1 174 ? -19.912 10.017  -13.218 1.00 40.05  ? 226 LYS E CE    1 
ATOM   3244 N NZ    . LYS C 1 174 ? -18.591 10.316  -13.783 1.00 40.29  ? 226 LYS E NZ    1 
ATOM   3245 N N     . ILE C 1 175 ? -25.626 6.410   -15.498 1.00 45.53  ? 227 ILE E N     1 
ATOM   3246 C CA    . ILE C 1 175 ? -26.163 5.401   -16.388 1.00 45.73  ? 227 ILE E CA    1 
ATOM   3247 C C     . ILE C 1 175 ? -27.284 6.027   -17.207 1.00 51.29  ? 227 ILE E C     1 
ATOM   3248 O O     . ILE C 1 175 ? -27.419 5.776   -18.407 1.00 49.59  ? 227 ILE E O     1 
ATOM   3249 C CB    . ILE C 1 175 ? -26.673 4.190   -15.616 1.00 46.69  ? 227 ILE E CB    1 
ATOM   3250 C CG1   . ILE C 1 175 ? -25.527 3.513   -14.881 1.00 47.93  ? 227 ILE E CG1   1 
ATOM   3251 C CG2   . ILE C 1 175 ? -27.316 3.195   -16.536 1.00 51.08  ? 227 ILE E CG2   1 
ATOM   3252 C CD1   . ILE C 1 175 ? -25.976 2.412   -13.951 1.00 48.07  ? 227 ILE E CD1   1 
ATOM   3253 N N     . GLU C 1 176 ? -28.073 6.867   -16.553 1.00 52.57  ? 228 GLU E N     1 
ATOM   3254 C CA    . GLU C 1 176 ? -29.139 7.574   -17.232 1.00 53.29  ? 228 GLU E CA    1 
ATOM   3255 C C     . GLU C 1 176 ? -28.578 8.405   -18.383 1.00 54.78  ? 228 GLU E C     1 
ATOM   3256 O O     . GLU C 1 176 ? -29.147 8.407   -19.481 1.00 61.39  ? 228 GLU E O     1 
ATOM   3257 C CB    . GLU C 1 176 ? -29.907 8.467   -16.249 1.00 58.21  ? 228 GLU E CB    1 
ATOM   3258 C CG    . GLU C 1 176 ? -31.296 7.944   -15.803 1.00 70.93  ? 228 GLU E CG    1 
ATOM   3259 C CD    . GLU C 1 176 ? -32.453 8.280   -16.776 1.00 83.63  ? 228 GLU E CD    1 
ATOM   3260 O OE1   . GLU C 1 176 ? -32.290 9.177   -17.636 1.00 83.30  ? 228 GLU E OE1   1 
ATOM   3261 O OE2   . GLU C 1 176 ? -33.543 7.660   -16.664 1.00 81.37  ? 228 GLU E OE2   1 
ATOM   3262 N N     . ASN C 1 177 ? -27.454 9.083   -18.157 1.00 49.16  ? 229 ASN E N     1 
ATOM   3263 C CA    . ASN C 1 177 ? -26.986 10.082  -19.129 1.00 49.35  ? 229 ASN E CA    1 
ATOM   3264 C C     . ASN C 1 177 ? -25.840 9.724   -20.084 1.00 47.34  ? 229 ASN E C     1 
ATOM   3265 O O     . ASN C 1 177 ? -25.662 10.405  -21.082 1.00 49.73  ? 229 ASN E O     1 
ATOM   3266 C CB    . ASN C 1 177 ? -26.593 11.357  -18.389 1.00 47.94  ? 229 ASN E CB    1 
ATOM   3267 C CG    . ASN C 1 177 ? -27.791 12.131  -17.904 1.00 49.82  ? 229 ASN E CG    1 
ATOM   3268 O OD1   . ASN C 1 177 ? -27.960 12.349  -16.706 1.00 52.54  ? 229 ASN E OD1   1 
ATOM   3269 N ND2   . ASN C 1 177 ? -28.631 12.562  -18.835 1.00 52.50  ? 229 ASN E ND2   1 
ATOM   3270 N N     . ASN C 1 178 ? -25.067 8.681   -19.802 1.00 47.67  ? 230 ASN E N     1 
ATOM   3271 C CA    . ASN C 1 178 ? -23.925 8.351   -20.657 1.00 45.72  ? 230 ASN E CA    1 
ATOM   3272 C C     . ASN C 1 178 ? -24.224 7.257   -21.667 1.00 46.61  ? 230 ASN E C     1 
ATOM   3273 O O     . ASN C 1 178 ? -24.239 6.084   -21.306 1.00 46.83  ? 230 ASN E O     1 
ATOM   3274 C CB    . ASN C 1 178 ? -22.715 7.931   -19.811 1.00 43.91  ? 230 ASN E CB    1 
ATOM   3275 C CG    . ASN C 1 178 ? -21.427 7.835   -20.627 1.00 41.30  ? 230 ASN E CG    1 
ATOM   3276 O OD1   . ASN C 1 178 ? -21.455 7.788   -21.852 1.00 49.89  ? 230 ASN E OD1   1 
ATOM   3277 N ND2   . ASN C 1 178 ? -20.302 7.790   -19.950 1.00 35.52  ? 230 ASN E ND2   1 
ATOM   3278 N N     . PRO C 1 179 ? -24.378 7.640   -22.951 1.00 50.23  ? 231 PRO E N     1 
ATOM   3279 C CA    . PRO C 1 179 ? -24.753 6.767   -24.076 1.00 50.07  ? 231 PRO E CA    1 
ATOM   3280 C C     . PRO C 1 179 ? -24.052 5.406   -24.057 1.00 51.15  ? 231 PRO E C     1 
ATOM   3281 O O     . PRO C 1 179 ? -24.647 4.383   -24.418 1.00 52.06  ? 231 PRO E O     1 
ATOM   3282 C CB    . PRO C 1 179 ? -24.309 7.569   -25.303 1.00 45.17  ? 231 PRO E CB    1 
ATOM   3283 C CG    . PRO C 1 179 ? -24.339 8.978   -24.863 1.00 48.68  ? 231 PRO E CG    1 
ATOM   3284 C CD    . PRO C 1 179 ? -23.937 8.968   -23.420 1.00 48.96  ? 231 PRO E CD    1 
ATOM   3285 N N     . PHE C 1 180 ? -22.791 5.401   -23.634 1.00 48.35  ? 232 PHE E N     1 
ATOM   3286 C CA    . PHE C 1 180 ? -22.019 4.166   -23.576 1.00 48.64  ? 232 PHE E CA    1 
ATOM   3287 C C     . PHE C 1 180 ? -22.563 3.224   -22.505 1.00 49.07  ? 232 PHE E C     1 
ATOM   3288 O O     . PHE C 1 180 ? -22.505 1.995   -22.639 1.00 50.60  ? 232 PHE E O     1 
ATOM   3289 C CB    . PHE C 1 180 ? -20.556 4.464   -23.300 1.00 43.13  ? 232 PHE E CB    1 
ATOM   3290 C CG    . PHE C 1 180 ? -19.859 5.201   -24.403 1.00 42.60  ? 232 PHE E CG    1 
ATOM   3291 C CD1   . PHE C 1 180 ? -19.402 4.527   -25.518 1.00 42.72  ? 232 PHE E CD1   1 
ATOM   3292 C CD2   . PHE C 1 180 ? -19.621 6.560   -24.300 1.00 40.47  ? 232 PHE E CD2   1 
ATOM   3293 C CE1   . PHE C 1 180 ? -18.730 5.196   -26.514 1.00 42.86  ? 232 PHE E CE1   1 
ATOM   3294 C CE2   . PHE C 1 180 ? -18.959 7.228   -25.283 1.00 40.54  ? 232 PHE E CE2   1 
ATOM   3295 C CZ    . PHE C 1 180 ? -18.513 6.548   -26.399 1.00 41.90  ? 232 PHE E CZ    1 
ATOM   3296 N N     . ALA C 1 181 ? -23.095 3.812   -21.443 1.00 44.71  ? 233 ALA E N     1 
ATOM   3297 C CA    . ALA C 1 181 ? -23.635 3.042   -20.342 1.00 43.43  ? 233 ALA E CA    1 
ATOM   3298 C C     . ALA C 1 181 ? -25.075 2.594   -20.596 1.00 53.35  ? 233 ALA E C     1 
ATOM   3299 O O     . ALA C 1 181 ? -25.728 2.120   -19.679 1.00 54.95  ? 233 ALA E O     1 
ATOM   3300 C CB    . ALA C 1 181 ? -23.569 3.861   -19.071 1.00 43.64  ? 233 ALA E CB    1 
ATOM   3301 N N     . LYS C 1 182 ? -25.574 2.758   -21.824 1.00 57.59  ? 234 LYS E N     1 
ATOM   3302 C CA    . LYS C 1 182 ? -26.992 2.517   -22.115 1.00 54.86  ? 234 LYS E CA    1 
ATOM   3303 C C     . LYS C 1 182 ? -27.458 1.146   -21.628 1.00 56.65  ? 234 LYS E C     1 
ATOM   3304 O O     . LYS C 1 182 ? -28.414 1.074   -20.858 1.00 57.91  ? 234 LYS E O     1 
ATOM   3305 C CB    . LYS C 1 182 ? -27.278 2.670   -23.611 1.00 49.37  ? 234 LYS E CB    1 
ATOM   3306 C CG    . LYS C 1 182 ? -28.469 1.865   -24.103 1.00 52.67  ? 234 LYS E CG    1 
ATOM   3307 C CD    . LYS C 1 182 ? -29.242 2.604   -25.200 1.00 61.54  ? 234 LYS E CD    1 
ATOM   3308 C CE    . LYS C 1 182 ? -30.278 1.698   -25.901 1.00 61.29  ? 234 LYS E CE    1 
ATOM   3309 N NZ    . LYS C 1 182 ? -31.430 2.466   -26.501 1.00 57.37  ? 234 LYS E NZ    1 
ATOM   3310 N N     . GLY C 1 183 ? -26.763 0.080   -22.029 1.00 54.20  ? 235 GLY E N     1 
ATOM   3311 C CA    . GLY C 1 183 ? -27.147 -1.285  -21.687 1.00 56.21  ? 235 GLY E CA    1 
ATOM   3312 C C     . GLY C 1 183 ? -27.540 -1.576  -20.238 1.00 58.42  ? 235 GLY E C     1 
ATOM   3313 O O     . GLY C 1 183 ? -28.239 -2.561  -19.938 1.00 58.69  ? 235 GLY E O     1 
ATOM   3314 N N     . PHE C 1 184 ? -27.095 -0.710  -19.334 1.00 56.76  ? 236 PHE E N     1 
ATOM   3315 C CA    . PHE C 1 184 ? -27.406 -0.843  -17.915 1.00 56.23  ? 236 PHE E CA    1 
ATOM   3316 C C     . PHE C 1 184 ? -28.660 -0.071  -17.483 1.00 50.93  ? 236 PHE E C     1 
ATOM   3317 O O     . PHE C 1 184 ? -29.019 -0.090  -16.307 1.00 49.81  ? 236 PHE E O     1 
ATOM   3318 C CB    . PHE C 1 184 ? -26.215 -0.382  -17.077 1.00 45.48  ? 236 PHE E CB    1 
ATOM   3319 C CG    . PHE C 1 184 ? -25.005 -1.234  -17.233 1.00 46.79  ? 236 PHE E CG    1 
ATOM   3320 C CD1   . PHE C 1 184 ? -24.947 -2.495  -16.652 1.00 49.87  ? 236 PHE E CD1   1 
ATOM   3321 C CD2   . PHE C 1 184 ? -23.899 -0.771  -17.940 1.00 48.81  ? 236 PHE E CD2   1 
ATOM   3322 C CE1   . PHE C 1 184 ? -23.797 -3.298  -16.778 1.00 50.88  ? 236 PHE E CE1   1 
ATOM   3323 C CE2   . PHE C 1 184 ? -22.747 -1.559  -18.073 1.00 45.28  ? 236 PHE E CE2   1 
ATOM   3324 C CZ    . PHE C 1 184 ? -22.698 -2.829  -17.484 1.00 46.37  ? 236 PHE E CZ    1 
ATOM   3325 N N     . ARG C 1 185 ? -29.310 0.613   -18.422 1.00 53.25  ? 237 ARG E N     1 
ATOM   3326 C CA    . ARG C 1 185 ? -30.570 1.310   -18.127 1.00 61.17  ? 237 ARG E CA    1 
ATOM   3327 C C     . ARG C 1 185 ? -31.710 0.292   -17.936 1.00 64.62  ? 237 ARG E C     1 
ATOM   3328 O O     . ARG C 1 185 ? -31.638 -0.830  -18.443 1.00 70.88  ? 237 ARG E O     1 
ATOM   3329 C CB    . ARG C 1 185 ? -30.913 2.316   -19.236 1.00 54.42  ? 237 ARG E CB    1 
ATOM   3330 C CG    . ARG C 1 185 ? -29.891 3.448   -19.401 1.00 51.30  ? 237 ARG E CG    1 
ATOM   3331 C CD    . ARG C 1 185 ? -30.128 4.298   -20.642 1.00 43.44  ? 237 ARG E CD    1 
ATOM   3332 N NE    . ARG C 1 185 ? -29.111 5.339   -20.785 1.00 51.66  ? 237 ARG E NE    1 
ATOM   3333 C CZ    . ARG C 1 185 ? -28.998 6.162   -21.828 1.00 55.34  ? 237 ARG E CZ    1 
ATOM   3334 N NH1   . ARG C 1 185 ? -29.840 6.081   -22.853 1.00 56.28  ? 237 ARG E NH1   1 
ATOM   3335 N NH2   . ARG C 1 185 ? -28.031 7.070   -21.853 1.00 52.44  ? 237 ARG E NH2   1 
ATOM   3336 N N     . GLY C 1 186 ? -32.744 0.664   -17.188 1.00 61.00  ? 238 GLY E N     1 
ATOM   3337 C CA    . GLY C 1 186 ? -33.812 -0.273  -16.878 1.00 72.16  ? 238 GLY E CA    1 
ATOM   3338 C C     . GLY C 1 186 ? -34.838 0.236   -15.874 1.00 91.76  ? 238 GLY E C     1 
ATOM   3339 O O     . GLY C 1 186 ? -35.973 -0.267  -15.814 1.00 84.95  ? 238 GLY E O     1 
ATOM   3340 O OXT   . GLY C 1 186 ? -34.565 1.160   -15.091 1.00 92.95  ? 238 GLY E OXT   1 
ATOM   3341 N N     . ARG D 2 1   ? -11.371 -2.492  -44.078 1.00 75.61  ? 105 ARG F N     1 
ATOM   3342 C CA    . ARG D 2 1   ? -11.392 -3.038  -42.727 1.00 76.24  ? 105 ARG F CA    1 
ATOM   3343 C C     . ARG D 2 1   ? -10.119 -2.667  -41.953 1.00 73.85  ? 105 ARG F C     1 
ATOM   3344 O O     . ARG D 2 1   ? -9.964  -3.069  -40.794 1.00 71.22  ? 105 ARG F O     1 
ATOM   3345 C CB    . ARG D 2 1   ? -11.578 -4.561  -42.780 1.00 72.74  ? 105 ARG F CB    1 
ATOM   3346 C CG    . ARG D 2 1   ? -12.483 -4.984  -43.925 1.00 74.76  ? 105 ARG F CG    1 
ATOM   3347 C CD    . ARG D 2 1   ? -12.679 -6.487  -44.045 1.00 73.34  ? 105 ARG F CD    1 
ATOM   3348 N NE    . ARG D 2 1   ? -12.738 -6.900  -45.450 1.00 81.46  ? 105 ARG F NE    1 
ATOM   3349 C CZ    . ARG D 2 1   ? -13.731 -6.621  -46.304 1.00 82.65  ? 105 ARG F CZ    1 
ATOM   3350 N NH1   . ARG D 2 1   ? -14.791 -5.920  -45.923 1.00 83.56  ? 105 ARG F NH1   1 
ATOM   3351 N NH2   . ARG D 2 1   ? -13.668 -7.047  -47.559 1.00 75.24  ? 105 ARG F NH2   1 
ATOM   3352 N N     . VAL D 2 2   ? -9.218  -1.894  -42.571 1.00 67.25  ? 106 VAL F N     1 
ATOM   3353 C CA    . VAL D 2 2   ? -7.994  -1.480  -41.865 1.00 66.92  ? 106 VAL F CA    1 
ATOM   3354 C C     . VAL D 2 2   ? -7.786  0.045   -41.756 1.00 59.50  ? 106 VAL F C     1 
ATOM   3355 O O     . VAL D 2 2   ? -7.854  0.771   -42.754 1.00 51.30  ? 106 VAL F O     1 
ATOM   3356 C CB    . VAL D 2 2   ? -6.730  -2.079  -42.510 1.00 62.35  ? 106 VAL F CB    1 
ATOM   3357 C CG1   . VAL D 2 2   ? -5.653  -2.226  -41.456 1.00 61.67  ? 106 VAL F CG1   1 
ATOM   3358 C CG2   . VAL D 2 2   ? -7.022  -3.431  -43.105 1.00 70.11  ? 106 VAL F CG2   1 
ATOM   3359 N N     . LEU D 2 3   ? -7.519  0.505   -40.528 1.00 53.82  ? 107 LEU F N     1 
ATOM   3360 C CA    . LEU D 2 3   ? -7.269  1.915   -40.246 1.00 49.14  ? 107 LEU F CA    1 
ATOM   3361 C C     . LEU D 2 3   ? -5.853  2.289   -40.630 1.00 44.51  ? 107 LEU F C     1 
ATOM   3362 O O     . LEU D 2 3   ? -4.971  1.442   -40.701 1.00 41.91  ? 107 LEU F O     1 
ATOM   3363 C CB    . LEU D 2 3   ? -7.475  2.245   -38.764 1.00 45.71  ? 107 LEU F CB    1 
ATOM   3364 C CG    . LEU D 2 3   ? -8.790  2.076   -38.000 1.00 48.31  ? 107 LEU F CG    1 
ATOM   3365 C CD1   . LEU D 2 3   ? -9.967  2.807   -38.662 1.00 47.71  ? 107 LEU F CD1   1 
ATOM   3366 C CD2   . LEU D 2 3   ? -9.083  0.598   -37.811 1.00 56.48  ? 107 LEU F CD2   1 
ATOM   3367 N N     . PHE D 2 4   ? -5.624  3.570   -40.849 1.00 42.72  ? 108 PHE F N     1 
ATOM   3368 C CA    . PHE D 2 4   ? -4.278  4.015   -41.142 1.00 42.31  ? 108 PHE F CA    1 
ATOM   3369 C C     . PHE D 2 4   ? -3.481  4.185   -39.849 1.00 50.40  ? 108 PHE F C     1 
ATOM   3370 O O     . PHE D 2 4   ? -4.036  4.521   -38.798 1.00 48.22  ? 108 PHE F O     1 
ATOM   3371 C CB    . PHE D 2 4   ? -4.306  5.319   -41.932 1.00 42.05  ? 108 PHE F CB    1 
ATOM   3372 C CG    . PHE D 2 4   ? -4.976  5.199   -43.278 1.00 44.04  ? 108 PHE F CG    1 
ATOM   3373 C CD1   . PHE D 2 4   ? -5.120  3.965   -43.889 1.00 44.31  ? 108 PHE F CD1   1 
ATOM   3374 C CD2   . PHE D 2 4   ? -5.458  6.319   -43.930 1.00 43.93  ? 108 PHE F CD2   1 
ATOM   3375 C CE1   . PHE D 2 4   ? -5.727  3.848   -45.112 1.00 42.08  ? 108 PHE F CE1   1 
ATOM   3376 C CE2   . PHE D 2 4   ? -6.059  6.209   -45.155 1.00 43.02  ? 108 PHE F CE2   1 
ATOM   3377 C CZ    . PHE D 2 4   ? -6.197  4.969   -45.748 1.00 42.50  ? 108 PHE F CZ    1 
ATOM   3378 N N     . SER D 2 5   ? -2.178  3.930   -39.932 1.00 51.48  ? 109 SER F N     1 
ATOM   3379 C CA    . SER D 2 5   ? -1.271  4.182   -38.829 1.00 41.84  ? 109 SER F CA    1 
ATOM   3380 C C     . SER D 2 5   ? -1.344  5.645   -38.477 1.00 41.94  ? 109 SER F C     1 
ATOM   3381 O O     . SER D 2 5   ? -1.623  6.481   -39.322 1.00 43.98  ? 109 SER F O     1 
ATOM   3382 C CB    . SER D 2 5   ? 0.160   3.797   -39.200 1.00 46.93  ? 109 SER F CB    1 
ATOM   3383 O OG    . SER D 2 5   ? 0.679   4.665   -40.198 1.00 50.84  ? 109 SER F OG    1 
ATOM   3384 N N     . GLN D 2 6   ? -1.070  5.973   -37.230 1.00 50.85  ? 110 GLN F N     1 
ATOM   3385 C CA    . GLN D 2 6   ? -1.203  7.356   -36.844 1.00 56.21  ? 110 GLN F CA    1 
ATOM   3386 C C     . GLN D 2 6   ? -0.149  8.200   -37.578 1.00 50.79  ? 110 GLN F C     1 
ATOM   3387 O O     . GLN D 2 6   ? -0.354  9.393   -37.809 1.00 51.77  ? 110 GLN F O     1 
ATOM   3388 C CB    . GLN D 2 6   ? -1.101  7.521   -35.328 1.00 57.95  ? 110 GLN F CB    1 
ATOM   3389 C CG    . GLN D 2 6   ? -1.364  8.957   -34.935 1.00 71.75  ? 110 GLN F CG    1 
ATOM   3390 C CD    . GLN D 2 6   ? -1.160  9.237   -33.479 1.00 78.96  ? 110 GLN F CD    1 
ATOM   3391 O OE1   . GLN D 2 6   ? -0.089  9.682   -33.069 1.00 80.48  ? 110 GLN F OE1   1 
ATOM   3392 N NE2   . GLN D 2 6   ? -2.208  9.028   -32.684 1.00 83.96  ? 110 GLN F NE2   1 
ATOM   3393 N N     . ALA D 2 7   ? 0.949   7.572   -37.984 1.00 42.16  ? 111 ALA F N     1 
ATOM   3394 C CA    . ALA D 2 7   ? 1.928   8.260   -38.816 1.00 46.25  ? 111 ALA F CA    1 
ATOM   3395 C C     . ALA D 2 7   ? 1.308   8.720   -40.144 1.00 50.94  ? 111 ALA F C     1 
ATOM   3396 O O     . ALA D 2 7   ? 1.563   9.839   -40.609 1.00 51.42  ? 111 ALA F O     1 
ATOM   3397 C CB    . ALA D 2 7   ? 3.127   7.367   -39.070 1.00 44.75  ? 111 ALA F CB    1 
ATOM   3398 N N     . GLN D 2 8   ? 0.493   7.863   -40.755 1.00 45.52  ? 112 GLN F N     1 
ATOM   3399 C CA    . GLN D 2 8   ? -0.087  8.195   -42.047 1.00 43.13  ? 112 GLN F CA    1 
ATOM   3400 C C     . GLN D 2 8   ? -1.086  9.315   -41.882 1.00 42.42  ? 112 GLN F C     1 
ATOM   3401 O O     . GLN D 2 8   ? -0.924  10.387  -42.443 1.00 42.60  ? 112 GLN F O     1 
ATOM   3402 C CB    . GLN D 2 8   ? -0.737  6.967   -42.683 1.00 42.97  ? 112 GLN F CB    1 
ATOM   3403 C CG    . GLN D 2 8   ? 0.273   6.016   -43.296 1.00 43.14  ? 112 GLN F CG    1 
ATOM   3404 C CD    . GLN D 2 8   ? -0.260  4.617   -43.510 1.00 46.88  ? 112 GLN F CD    1 
ATOM   3405 O OE1   . GLN D 2 8   ? -1.237  4.198   -42.886 1.00 48.79  ? 112 GLN F OE1   1 
ATOM   3406 N NE2   . GLN D 2 8   ? 0.394   3.877   -44.390 1.00 48.04  ? 112 GLN F NE2   1 
ATOM   3407 N N     . VAL D 2 9   ? -2.101  9.062   -41.072 1.00 43.56  ? 113 VAL F N     1 
ATOM   3408 C CA    . VAL D 2 9   ? -3.149  10.032  -40.811 1.00 43.90  ? 113 VAL F CA    1 
ATOM   3409 C C     . VAL D 2 9   ? -2.603  11.400  -40.447 1.00 42.09  ? 113 VAL F C     1 
ATOM   3410 O O     . VAL D 2 9   ? -3.191  12.419  -40.776 1.00 43.64  ? 113 VAL F O     1 
ATOM   3411 C CB    . VAL D 2 9   ? -4.062  9.554   -39.677 1.00 40.47  ? 113 VAL F CB    1 
ATOM   3412 C CG1   . VAL D 2 9   ? -5.179  10.563  -39.434 1.00 35.67  ? 113 VAL F CG1   1 
ATOM   3413 C CG2   . VAL D 2 9   ? -4.618  8.169   -39.997 1.00 39.08  ? 113 VAL F CG2   1 
ATOM   3414 N N     . TYR D 2 10  ? -1.470  11.418  -39.765 1.00 41.57  ? 114 TYR F N     1 
ATOM   3415 C CA    . TYR D 2 10  ? -0.852  12.673  -39.382 1.00 45.27  ? 114 TYR F CA    1 
ATOM   3416 C C     . TYR D 2 10  ? -0.440  13.489  -40.595 1.00 46.15  ? 114 TYR F C     1 
ATOM   3417 O O     . TYR D 2 10  ? -0.812  14.653  -40.730 1.00 43.98  ? 114 TYR F O     1 
ATOM   3418 C CB    . TYR D 2 10  ? 0.368   12.430  -38.493 1.00 50.62  ? 114 TYR F CB    1 
ATOM   3419 C CG    . TYR D 2 10  ? 0.988   13.717  -38.030 1.00 47.62  ? 114 TYR F CG    1 
ATOM   3420 C CD1   . TYR D 2 10  ? 0.314   14.548  -37.159 1.00 48.77  ? 114 TYR F CD1   1 
ATOM   3421 C CD2   . TYR D 2 10  ? 2.229   14.118  -38.493 1.00 54.85  ? 114 TYR F CD2   1 
ATOM   3422 C CE1   . TYR D 2 10  ? 0.852   15.730  -36.748 1.00 49.84  ? 114 TYR F CE1   1 
ATOM   3423 C CE2   . TYR D 2 10  ? 2.790   15.308  -38.080 1.00 56.60  ? 114 TYR F CE2   1 
ATOM   3424 C CZ    . TYR D 2 10  ? 2.086   16.109  -37.210 1.00 53.46  ? 114 TYR F CZ    1 
ATOM   3425 O OH    . TYR D 2 10  ? 2.604   17.299  -36.785 1.00 53.44  ? 114 TYR F OH    1 
ATOM   3426 N N     . GLU D 2 11  ? 0.341   12.876  -41.474 1.00 45.33  ? 115 GLU F N     1 
ATOM   3427 C CA    . GLU D 2 11  ? 0.771   13.550  -42.688 1.00 44.62  ? 115 GLU F CA    1 
ATOM   3428 C C     . GLU D 2 11  ? -0.398  13.920  -43.610 1.00 49.19  ? 115 GLU F C     1 
ATOM   3429 O O     . GLU D 2 11  ? -0.438  15.024  -44.149 1.00 53.58  ? 115 GLU F O     1 
ATOM   3430 C CB    . GLU D 2 11  ? 1.757   12.676  -43.428 1.00 43.59  ? 115 GLU F CB    1 
ATOM   3431 C CG    . GLU D 2 11  ? 2.909   12.280  -42.579 1.00 54.80  ? 115 GLU F CG    1 
ATOM   3432 C CD    . GLU D 2 11  ? 3.761   13.479  -42.226 1.00 70.38  ? 115 GLU F CD    1 
ATOM   3433 O OE1   . GLU D 2 11  ? 3.716   14.461  -43.011 1.00 71.74  ? 115 GLU F OE1   1 
ATOM   3434 O OE2   . GLU D 2 11  ? 4.463   13.443  -41.176 1.00 71.26  ? 115 GLU F OE2   1 
ATOM   3435 N N     . LEU D 2 12  ? -1.343  12.998  -43.791 1.00 45.36  ? 116 LEU F N     1 
ATOM   3436 C CA    . LEU D 2 12  ? -2.519  13.248  -44.615 1.00 43.61  ? 116 LEU F CA    1 
ATOM   3437 C C     . LEU D 2 12  ? -3.223  14.502  -44.134 1.00 44.30  ? 116 LEU F C     1 
ATOM   3438 O O     . LEU D 2 12  ? -3.723  15.292  -44.935 1.00 49.99  ? 116 LEU F O     1 
ATOM   3439 C CB    . LEU D 2 12  ? -3.472  12.045  -44.589 1.00 41.81  ? 116 LEU F CB    1 
ATOM   3440 C CG    . LEU D 2 12  ? -2.982  10.843  -45.399 1.00 34.80  ? 116 LEU F CG    1 
ATOM   3441 C CD1   . LEU D 2 12  ? -3.901  9.685   -45.188 1.00 37.63  ? 116 LEU F CD1   1 
ATOM   3442 C CD2   . LEU D 2 12  ? -2.921  11.196  -46.841 1.00 32.41  ? 116 LEU F CD2   1 
ATOM   3443 N N     . GLU D 2 13  ? -3.222  14.692  -42.822 1.00 42.35  ? 117 GLU F N     1 
ATOM   3444 C CA    . GLU D 2 13  ? -3.787  15.873  -42.191 1.00 44.01  ? 117 GLU F CA    1 
ATOM   3445 C C     . GLU D 2 13  ? -2.944  17.133  -42.385 1.00 51.53  ? 117 GLU F C     1 
ATOM   3446 O O     . GLU D 2 13  ? -3.490  18.221  -42.572 1.00 52.84  ? 117 GLU F O     1 
ATOM   3447 C CB    . GLU D 2 13  ? -3.971  15.621  -40.698 1.00 45.99  ? 117 GLU F CB    1 
ATOM   3448 C CG    . GLU D 2 13  ? -5.196  14.843  -40.347 1.00 44.26  ? 117 GLU F CG    1 
ATOM   3449 C CD    . GLU D 2 13  ? -6.446  15.695  -40.415 1.00 56.71  ? 117 GLU F CD    1 
ATOM   3450 O OE1   . GLU D 2 13  ? -6.350  16.879  -40.817 1.00 54.74  ? 117 GLU F OE1   1 
ATOM   3451 O OE2   . GLU D 2 13  ? -7.531  15.178  -40.061 1.00 64.32  ? 117 GLU F OE2   1 
ATOM   3452 N N     . ARG D 2 14  ? -1.621  16.996  -42.321 1.00 46.46  ? 118 ARG F N     1 
ATOM   3453 C CA    . ARG D 2 14  ? -0.753  18.148  -42.504 1.00 47.75  ? 118 ARG F CA    1 
ATOM   3454 C C     . ARG D 2 14  ? -0.928  18.739  -43.899 1.00 56.43  ? 118 ARG F C     1 
ATOM   3455 O O     . ARG D 2 14  ? -1.034  19.960  -44.032 1.00 62.58  ? 118 ARG F O     1 
ATOM   3456 C CB    . ARG D 2 14  ? 0.709   17.782  -42.257 1.00 55.19  ? 118 ARG F CB    1 
ATOM   3457 C CG    . ARG D 2 14  ? 1.660   18.352  -43.296 1.00 67.41  ? 118 ARG F CG    1 
ATOM   3458 C CD    . ARG D 2 14  ? 3.136   18.160  -42.949 1.00 75.34  ? 118 ARG F CD    1 
ATOM   3459 N NE    . ARG D 2 14  ? 3.980   18.698  -44.019 1.00 87.36  ? 118 ARG F NE    1 
ATOM   3460 C CZ    . ARG D 2 14  ? 5.308   18.774  -43.986 1.00 89.66  ? 118 ARG F CZ    1 
ATOM   3461 N NH1   . ARG D 2 14  ? 5.975   18.352  -42.922 1.00 87.38  ? 118 ARG F NH1   1 
ATOM   3462 N NH2   . ARG D 2 14  ? 5.972   19.279  -45.023 1.00 91.94  ? 118 ARG F NH2   1 
ATOM   3463 N N     . ARG D 2 15  ? -0.973  17.872  -44.920 1.00 55.88  ? 119 ARG F N     1 
ATOM   3464 C CA    . ARG D 2 15  ? -1.207  18.267  -46.316 1.00 53.32  ? 119 ARG F CA    1 
ATOM   3465 C C     . ARG D 2 15  ? -2.529  18.960  -46.489 1.00 55.79  ? 119 ARG F C     1 
ATOM   3466 O O     . ARG D 2 15  ? -2.622  19.991  -47.144 1.00 58.96  ? 119 ARG F O     1 
ATOM   3467 C CB    . ARG D 2 15  ? -1.187  17.058  -47.245 1.00 46.28  ? 119 ARG F CB    1 
ATOM   3468 C CG    . ARG D 2 15  ? 0.044   16.930  -48.119 1.00 50.47  ? 119 ARG F CG    1 
ATOM   3469 C CD    . ARG D 2 15  ? 0.218   18.049  -49.143 1.00 46.49  ? 119 ARG F CD    1 
ATOM   3470 N NE    . ARG D 2 15  ? 1.353   17.744  -50.023 1.00 50.41  ? 119 ARG F NE    1 
ATOM   3471 C CZ    . ARG D 2 15  ? 1.407   18.039  -51.324 1.00 59.88  ? 119 ARG F CZ    1 
ATOM   3472 N NH1   . ARG D 2 15  ? 0.397   18.657  -51.915 1.00 57.59  ? 119 ARG F NH1   1 
ATOM   3473 N NH2   . ARG D 2 15  ? 2.474   17.719  -52.047 1.00 63.05  ? 119 ARG F NH2   1 
ATOM   3474 N N     . PHE D 2 16  ? -3.564  18.360  -45.916 1.00 54.43  ? 120 PHE F N     1 
ATOM   3475 C CA    . PHE D 2 16  ? -4.911  18.874  -46.056 1.00 57.47  ? 120 PHE F CA    1 
ATOM   3476 C C     . PHE D 2 16  ? -5.061  20.285  -45.487 1.00 64.48  ? 120 PHE F C     1 
ATOM   3477 O O     . PHE D 2 16  ? -5.846  21.092  -45.994 1.00 65.39  ? 120 PHE F O     1 
ATOM   3478 C CB    . PHE D 2 16  ? -5.890  17.936  -45.381 1.00 52.54  ? 120 PHE F CB    1 
ATOM   3479 C CG    . PHE D 2 16  ? -7.301  18.354  -45.535 1.00 54.77  ? 120 PHE F CG    1 
ATOM   3480 C CD1   . PHE D 2 16  ? -7.977  18.107  -46.718 1.00 61.27  ? 120 PHE F CD1   1 
ATOM   3481 C CD2   . PHE D 2 16  ? -7.953  19.011  -44.517 1.00 60.91  ? 120 PHE F CD2   1 
ATOM   3482 C CE1   . PHE D 2 16  ? -9.290  18.499  -46.882 1.00 60.54  ? 120 PHE F CE1   1 
ATOM   3483 C CE2   . PHE D 2 16  ? -9.267  19.405  -44.668 1.00 67.70  ? 120 PHE F CE2   1 
ATOM   3484 C CZ    . PHE D 2 16  ? -9.939  19.149  -45.854 1.00 61.91  ? 120 PHE F CZ    1 
ATOM   3485 N N     . LYS D 2 17  ? -4.305  20.574  -44.428 1.00 65.50  ? 121 LYS F N     1 
ATOM   3486 C CA    . LYS D 2 17  ? -4.286  21.909  -43.832 1.00 67.05  ? 121 LYS F CA    1 
ATOM   3487 C C     . LYS D 2 17  ? -3.492  22.889  -44.711 1.00 73.25  ? 121 LYS F C     1 
ATOM   3488 O O     . LYS D 2 17  ? -3.573  24.108  -44.536 1.00 76.57  ? 121 LYS F O     1 
ATOM   3489 C CB    . LYS D 2 17  ? -3.704  21.854  -42.408 1.00 69.77  ? 121 LYS F CB    1 
ATOM   3490 C CG    . LYS D 2 17  ? -4.759  21.660  -41.296 1.00 72.67  ? 121 LYS F CG    1 
ATOM   3491 C CD    . LYS D 2 17  ? -4.186  20.927  -40.072 1.00 68.03  ? 121 LYS F CD    1 
ATOM   3492 C CE    . LYS D 2 17  ? -5.300  20.342  -39.202 1.00 73.20  ? 121 LYS F CE    1 
ATOM   3493 N NZ    . LYS D 2 17  ? -4.768  19.583  -38.020 1.00 74.97  ? 121 LYS F NZ    1 
ATOM   3494 N N     . GLN D 2 18  ? -2.731  22.352  -45.661 1.00 69.55  ? 122 GLN F N     1 
ATOM   3495 C CA    . GLN D 2 18  ? -2.004  23.177  -46.615 1.00 67.00  ? 122 GLN F CA    1 
ATOM   3496 C C     . GLN D 2 18  ? -2.824  23.422  -47.882 1.00 67.78  ? 122 GLN F C     1 
ATOM   3497 O O     . GLN D 2 18  ? -2.824  24.531  -48.424 1.00 71.32  ? 122 GLN F O     1 
ATOM   3498 C CB    . GLN D 2 18  ? -0.674  22.528  -46.994 1.00 63.32  ? 122 GLN F CB    1 
ATOM   3499 C CG    . GLN D 2 18  ? 0.352   22.472  -45.894 1.00 67.83  ? 122 GLN F CG    1 
ATOM   3500 C CD    . GLN D 2 18  ? 1.693   21.978  -46.409 1.00 76.35  ? 122 GLN F CD    1 
ATOM   3501 O OE1   . GLN D 2 18  ? 2.269   22.561  -47.331 1.00 78.50  ? 122 GLN F OE1   1 
ATOM   3502 N NE2   . GLN D 2 18  ? 2.191   20.890  -45.826 1.00 74.40  ? 122 GLN F NE2   1 
ATOM   3503 N N     . GLN D 2 19  ? -3.505  22.380  -48.360 1.00 65.02  ? 123 GLN F N     1 
ATOM   3504 C CA    . GLN D 2 19  ? -4.221  22.438  -49.643 1.00 63.10  ? 123 GLN F CA    1 
ATOM   3505 C C     . GLN D 2 19  ? -5.248  21.315  -49.773 1.00 58.53  ? 123 GLN F C     1 
ATOM   3506 O O     . GLN D 2 19  ? -4.901  20.139  -49.721 1.00 59.36  ? 123 GLN F O     1 
ATOM   3507 C CB    . GLN D 2 19  ? -3.238  22.379  -50.813 1.00 53.33  ? 123 GLN F CB    1 
ATOM   3508 C CG    . GLN D 2 19  ? -2.244  21.250  -50.737 1.00 50.60  ? 123 GLN F CG    1 
ATOM   3509 C CD    . GLN D 2 19  ? -1.569  20.990  -52.062 1.00 55.69  ? 123 GLN F CD    1 
ATOM   3510 O OE1   . GLN D 2 19  ? -0.351  21.078  -52.173 1.00 57.64  ? 123 GLN F OE1   1 
ATOM   3511 N NE2   . GLN D 2 19  ? -2.359  20.662  -53.079 1.00 58.61  ? 123 GLN F NE2   1 
ATOM   3512 N N     . ARG D 2 20  ? -6.513  21.681  -49.944 1.00 53.07  ? 124 ARG F N     1 
ATOM   3513 C CA    . ARG D 2 20  ? -7.591  20.698  -49.913 1.00 55.41  ? 124 ARG F CA    1 
ATOM   3514 C C     . ARG D 2 20  ? -7.673  19.845  -51.186 1.00 53.15  ? 124 ARG F C     1 
ATOM   3515 O O     . ARG D 2 20  ? -8.433  18.874  -51.243 1.00 53.61  ? 124 ARG F O     1 
ATOM   3516 C CB    . ARG D 2 20  ? -8.918  21.411  -49.663 1.00 59.31  ? 124 ARG F CB    1 
ATOM   3517 C CG    . ARG D 2 20  ? -8.741  22.737  -48.924 1.00 68.90  ? 124 ARG F CG    1 
ATOM   3518 C CD    . ARG D 2 20  ? -9.874  22.980  -47.926 1.00 78.56  ? 124 ARG F CD    1 
ATOM   3519 N NE    . ARG D 2 20  ? -11.185 22.801  -48.561 1.00 87.35  ? 124 ARG F NE    1 
ATOM   3520 C CZ    . ARG D 2 20  ? -12.222 22.188  -47.989 1.00 84.00  ? 124 ARG F CZ    1 
ATOM   3521 N NH1   . ARG D 2 20  ? -12.113 21.709  -46.750 1.00 79.76  ? 124 ARG F NH1   1 
ATOM   3522 N NH2   . ARG D 2 20  ? -13.373 22.063  -48.649 1.00 73.44  ? 124 ARG F NH2   1 
ATOM   3523 N N     . TYR D 2 21  ? -6.889  20.199  -52.202 1.00 50.97  ? 125 TYR F N     1 
ATOM   3524 C CA    . TYR D 2 21  ? -6.893  19.458  -53.461 1.00 50.16  ? 125 TYR F CA    1 
ATOM   3525 C C     . TYR D 2 21  ? -5.472  19.166  -53.933 1.00 49.94  ? 125 TYR F C     1 
ATOM   3526 O O     . TYR D 2 21  ? -4.624  20.061  -53.993 1.00 48.24  ? 125 TYR F O     1 
ATOM   3527 C CB    . TYR D 2 21  ? -7.667  20.229  -54.550 1.00 53.27  ? 125 TYR F CB    1 
ATOM   3528 C CG    . TYR D 2 21  ? -9.161  20.359  -54.289 1.00 53.55  ? 125 TYR F CG    1 
ATOM   3529 C CD1   . TYR D 2 21  ? -9.683  21.469  -53.624 1.00 50.56  ? 125 TYR F CD1   1 
ATOM   3530 C CD2   . TYR D 2 21  ? -10.043 19.370  -54.701 1.00 51.66  ? 125 TYR F CD2   1 
ATOM   3531 C CE1   . TYR D 2 21  ? -11.034 21.578  -53.367 1.00 47.21  ? 125 TYR F CE1   1 
ATOM   3532 C CE2   . TYR D 2 21  ? -11.395 19.476  -54.452 1.00 50.27  ? 125 TYR F CE2   1 
ATOM   3533 C CZ    . TYR D 2 21  ? -11.885 20.580  -53.785 1.00 48.66  ? 125 TYR F CZ    1 
ATOM   3534 O OH    . TYR D 2 21  ? -13.238 20.678  -53.544 1.00 51.82  ? 125 TYR F OH    1 
ATOM   3535 N N     . LEU D 2 22  ? -5.225  17.903  -54.261 1.00 44.28  ? 126 LEU F N     1 
ATOM   3536 C CA    . LEU D 2 22  ? -3.954  17.487  -54.821 1.00 46.25  ? 126 LEU F CA    1 
ATOM   3537 C C     . LEU D 2 22  ? -4.130  17.163  -56.290 1.00 52.31  ? 126 LEU F C     1 
ATOM   3538 O O     . LEU D 2 22  ? -5.211  16.775  -56.704 1.00 57.81  ? 126 LEU F O     1 
ATOM   3539 C CB    . LEU D 2 22  ? -3.410  16.263  -54.091 1.00 51.82  ? 126 LEU F CB    1 
ATOM   3540 C CG    . LEU D 2 22  ? -3.227  16.306  -52.574 1.00 43.39  ? 126 LEU F CG    1 
ATOM   3541 C CD1   . LEU D 2 22  ? -2.389  15.139  -52.160 1.00 41.07  ? 126 LEU F CD1   1 
ATOM   3542 C CD2   . LEU D 2 22  ? -2.579  17.586  -52.143 1.00 47.45  ? 126 LEU F CD2   1 
ATOM   3543 N N     . SER D 2 23  ? -3.073  17.310  -57.079 1.00 58.25  ? 127 SER F N     1 
ATOM   3544 C CA    . SER D 2 23  ? -3.114  16.877  -58.468 1.00 53.60  ? 127 SER F CA    1 
ATOM   3545 C C     . SER D 2 23  ? -2.754  15.398  -58.551 1.00 53.14  ? 127 SER F C     1 
ATOM   3546 O O     . SER D 2 23  ? -2.318  14.812  -57.576 1.00 53.02  ? 127 SER F O     1 
ATOM   3547 C CB    . SER D 2 23  ? -2.166  17.707  -59.324 1.00 53.01  ? 127 SER F CB    1 
ATOM   3548 O OG    . SER D 2 23  ? -0.825  17.488  -58.922 1.00 54.56  ? 127 SER F OG    1 
ATOM   3549 N N     . ALA D 2 24  ? -2.943  14.798  -59.718 1.00 57.55  ? 128 ALA F N     1 
ATOM   3550 C CA    . ALA D 2 24  ? -2.617  13.389  -59.910 1.00 58.48  ? 128 ALA F CA    1 
ATOM   3551 C C     . ALA D 2 24  ? -1.151  13.040  -59.580 1.00 60.50  ? 128 ALA F C     1 
ATOM   3552 O O     . ALA D 2 24  ? -0.895  12.019  -58.954 1.00 61.04  ? 128 ALA F O     1 
ATOM   3553 C CB    . ALA D 2 24  ? -2.955  12.967  -61.340 1.00 58.08  ? 128 ALA F CB    1 
ATOM   3554 N N     . PRO D 2 25  ? -0.181  13.881  -59.990 1.00 61.85  ? 129 PRO F N     1 
ATOM   3555 C CA    . PRO D 2 25  ? 1.190   13.508  -59.604 1.00 63.52  ? 129 PRO F CA    1 
ATOM   3556 C C     . PRO D 2 25  ? 1.573   13.776  -58.117 1.00 61.62  ? 129 PRO F C     1 
ATOM   3557 O O     . PRO D 2 25  ? 2.494   13.132  -57.593 1.00 61.31  ? 129 PRO F O     1 
ATOM   3558 C CB    . PRO D 2 25  ? 2.048   14.360  -60.548 1.00 64.14  ? 129 PRO F CB    1 
ATOM   3559 C CG    . PRO D 2 25  ? 1.180   15.545  -60.884 1.00 58.25  ? 129 PRO F CG    1 
ATOM   3560 C CD    . PRO D 2 25  ? -0.197  14.996  -60.963 1.00 60.29  ? 129 PRO F CD    1 
ATOM   3561 N N     . GLU D 2 26  ? 0.903   14.712  -57.451 1.00 56.62  ? 130 GLU F N     1 
ATOM   3562 C CA    . GLU D 2 26  ? 1.177   14.942  -56.038 1.00 55.04  ? 130 GLU F CA    1 
ATOM   3563 C C     . GLU D 2 26  ? 0.741   13.725  -55.242 1.00 52.65  ? 130 GLU F C     1 
ATOM   3564 O O     . GLU D 2 26  ? 1.460   13.262  -54.366 1.00 52.06  ? 130 GLU F O     1 
ATOM   3565 C CB    . GLU D 2 26  ? 0.466   16.195  -55.538 1.00 56.04  ? 130 GLU F CB    1 
ATOM   3566 C CG    . GLU D 2 26  ? 1.080   17.503  -56.023 1.00 54.71  ? 130 GLU F CG    1 
ATOM   3567 C CD    . GLU D 2 26  ? 0.078   18.651  -56.054 1.00 58.01  ? 130 GLU F CD    1 
ATOM   3568 O OE1   . GLU D 2 26  ? -0.100  19.347  -55.034 1.00 61.12  ? 130 GLU F OE1   1 
ATOM   3569 O OE2   . GLU D 2 26  ? -0.545  18.862  -57.108 1.00 62.43  ? 130 GLU F OE2   1 
ATOM   3570 N N     . ARG D 2 27  ? -0.439  13.205  -55.572 1.00 54.04  ? 131 ARG F N     1 
ATOM   3571 C CA    . ARG D 2 27  ? -0.965  11.980  -54.965 1.00 53.05  ? 131 ARG F CA    1 
ATOM   3572 C C     . ARG D 2 27  ? -0.021  10.789  -55.051 1.00 57.57  ? 131 ARG F C     1 
ATOM   3573 O O     . ARG D 2 27  ? 0.274   10.164  -54.031 1.00 55.20  ? 131 ARG F O     1 
ATOM   3574 C CB    . ARG D 2 27  ? -2.279  11.577  -55.614 1.00 51.71  ? 131 ARG F CB    1 
ATOM   3575 C CG    . ARG D 2 27  ? -3.494  12.137  -54.961 1.00 48.13  ? 131 ARG F CG    1 
ATOM   3576 C CD    . ARG D 2 27  ? -4.699  11.305  -55.355 1.00 51.74  ? 131 ARG F CD    1 
ATOM   3577 N NE    . ARG D 2 27  ? -4.992  11.329  -56.788 1.00 52.68  ? 131 ARG F NE    1 
ATOM   3578 C CZ    . ARG D 2 27  ? -5.787  12.220  -57.379 1.00 55.79  ? 131 ARG F CZ    1 
ATOM   3579 N NH1   . ARG D 2 27  ? -6.373  13.172  -56.664 1.00 50.96  ? 131 ARG F NH1   1 
ATOM   3580 N NH2   . ARG D 2 27  ? -5.988  12.166  -58.691 1.00 55.78  ? 131 ARG F NH2   1 
ATOM   3581 N N     . ASP D 2 28  ? 0.417   10.463  -56.270 1.00 58.78  ? 132 ASP F N     1 
ATOM   3582 C CA    . ASP D 2 28  ? 1.333   9.343   -56.507 1.00 55.66  ? 132 ASP F CA    1 
ATOM   3583 C C     . ASP D 2 28  ? 2.551   9.445   -55.626 1.00 57.62  ? 132 ASP F C     1 
ATOM   3584 O O     . ASP D 2 28  ? 3.017   8.440   -55.095 1.00 59.60  ? 132 ASP F O     1 
ATOM   3585 C CB    . ASP D 2 28  ? 1.785   9.296   -57.960 1.00 60.02  ? 132 ASP F CB    1 
ATOM   3586 C CG    . ASP D 2 28  ? 0.632   9.216   -58.920 1.00 69.31  ? 132 ASP F CG    1 
ATOM   3587 O OD1   . ASP D 2 28  ? -0.224  8.321   -58.735 1.00 71.92  ? 132 ASP F OD1   1 
ATOM   3588 O OD2   . ASP D 2 28  ? 0.577   10.058  -59.851 1.00 72.50  ? 132 ASP F OD2   1 
ATOM   3589 N N     . GLN D 2 29  ? 3.065   10.664  -55.478 1.00 54.92  ? 133 GLN F N     1 
ATOM   3590 C CA    . GLN D 2 29  ? 4.212   10.907  -54.616 1.00 59.44  ? 133 GLN F CA    1 
ATOM   3591 C C     . GLN D 2 29  ? 3.842   10.589  -53.160 1.00 56.28  ? 133 GLN F C     1 
ATOM   3592 O O     . GLN D 2 29  ? 4.283   9.575   -52.595 1.00 48.50  ? 133 GLN F O     1 
ATOM   3593 C CB    . GLN D 2 29  ? 4.690   12.355  -54.770 1.00 60.42  ? 133 GLN F CB    1 
ATOM   3594 C CG    . GLN D 2 29  ? 6.093   12.635  -54.242 1.00 63.82  ? 133 GLN F CG    1 
ATOM   3595 C CD    . GLN D 2 29  ? 6.535   14.070  -54.510 1.00 70.08  ? 133 GLN F CD    1 
ATOM   3596 O OE1   . GLN D 2 29  ? 5.728   14.998  -54.456 1.00 70.88  ? 133 GLN F OE1   1 
ATOM   3597 N NE2   . GLN D 2 29  ? 7.823   14.258  -54.782 1.00 69.37  ? 133 GLN F NE2   1 
ATOM   3598 N N     . LEU D 2 30  ? 3.009   11.454  -52.581 1.00 57.53  ? 134 LEU F N     1 
ATOM   3599 C CA    . LEU D 2 30  ? 2.466   11.275  -51.235 1.00 54.87  ? 134 LEU F CA    1 
ATOM   3600 C C     . LEU D 2 30  ? 2.179   9.808   -50.891 1.00 53.36  ? 134 LEU F C     1 
ATOM   3601 O O     . LEU D 2 30  ? 2.515   9.352   -49.800 1.00 52.21  ? 134 LEU F O     1 
ATOM   3602 C CB    . LEU D 2 30  ? 1.186   12.102  -51.072 1.00 47.13  ? 134 LEU F CB    1 
ATOM   3603 C CG    . LEU D 2 30  ? 0.732   12.268  -49.625 1.00 44.34  ? 134 LEU F CG    1 
ATOM   3604 C CD1   . LEU D 2 30  ? 1.849   12.892  -48.816 1.00 47.53  ? 134 LEU F CD1   1 
ATOM   3605 C CD2   . LEU D 2 30  ? -0.488  13.136  -49.558 1.00 39.79  ? 134 LEU F CD2   1 
ATOM   3606 N N     . ALA D 2 31  ? 1.572   9.082   -51.829 1.00 50.82  ? 135 ALA F N     1 
ATOM   3607 C CA    . ALA D 2 31  ? 1.336   7.655   -51.677 1.00 45.73  ? 135 ALA F CA    1 
ATOM   3608 C C     . ALA D 2 31  ? 2.603   6.881   -51.307 1.00 51.81  ? 135 ALA F C     1 
ATOM   3609 O O     . ALA D 2 31  ? 2.710   6.400   -50.175 1.00 52.24  ? 135 ALA F O     1 
ATOM   3610 C CB    . ALA D 2 31  ? 0.746   7.099   -52.928 1.00 51.80  ? 135 ALA F CB    1 
ATOM   3611 N N     . SER D 2 32  ? 3.574   6.763   -52.217 1.00 51.50  ? 136 SER F N     1 
ATOM   3612 C CA    . SER D 2 32  ? 4.715   5.871   -51.932 1.00 55.81  ? 136 SER F CA    1 
ATOM   3613 C C     . SER D 2 32  ? 5.519   6.307   -50.689 1.00 52.31  ? 136 SER F C     1 
ATOM   3614 O O     . SER D 2 32  ? 6.173   5.483   -50.045 1.00 53.11  ? 136 SER F O     1 
ATOM   3615 C CB    . SER D 2 32  ? 5.649   5.734   -53.148 1.00 51.49  ? 136 SER F CB    1 
ATOM   3616 O OG    . SER D 2 32  ? 6.051   6.982   -53.652 1.00 50.74  ? 136 SER F OG    1 
ATOM   3617 N N     . VAL D 2 33  ? 5.449   7.591   -50.352 1.00 48.72  ? 137 VAL F N     1 
ATOM   3618 C CA    . VAL D 2 33  ? 5.993   8.095   -49.098 1.00 45.61  ? 137 VAL F CA    1 
ATOM   3619 C C     . VAL D 2 33  ? 5.265   7.510   -47.891 1.00 46.64  ? 137 VAL F C     1 
ATOM   3620 O O     . VAL D 2 33  ? 5.889   7.020   -46.948 1.00 42.41  ? 137 VAL F O     1 
ATOM   3621 C CB    . VAL D 2 33  ? 5.892   9.620   -49.026 1.00 46.40  ? 137 VAL F CB    1 
ATOM   3622 C CG1   . VAL D 2 33  ? 6.201   10.104  -47.631 1.00 39.40  ? 137 VAL F CG1   1 
ATOM   3623 C CG2   . VAL D 2 33  ? 6.801   10.260  -50.049 1.00 49.28  ? 137 VAL F CG2   1 
ATOM   3624 N N     . LEU D 2 34  ? 3.935   7.572   -47.928 1.00 47.58  ? 138 LEU F N     1 
ATOM   3625 C CA    . LEU D 2 34  ? 3.110   7.106   -46.820 1.00 46.01  ? 138 LEU F CA    1 
ATOM   3626 C C     . LEU D 2 34  ? 2.845   5.611   -46.924 1.00 47.95  ? 138 LEU F C     1 
ATOM   3627 O O     . LEU D 2 34  ? 2.302   5.003   -46.000 1.00 48.66  ? 138 LEU F O     1 
ATOM   3628 C CB    . LEU D 2 34  ? 1.792   7.864   -46.778 1.00 43.25  ? 138 LEU F CB    1 
ATOM   3629 C CG    . LEU D 2 34  ? 1.915   9.372   -46.619 1.00 41.73  ? 138 LEU F CG    1 
ATOM   3630 C CD1   . LEU D 2 34  ? 0.547   10.015  -46.749 1.00 43.10  ? 138 LEU F CD1   1 
ATOM   3631 C CD2   . LEU D 2 34  ? 2.536   9.692   -45.298 1.00 37.15  ? 138 LEU F CD2   1 
ATOM   3632 N N     . LYS D 2 35  ? 3.240   5.032   -48.054 1.00 48.63  ? 139 LYS F N     1 
ATOM   3633 C CA    . LYS D 2 35  ? 3.043   3.610   -48.315 1.00 51.31  ? 139 LYS F CA    1 
ATOM   3634 C C     . LYS D 2 35  ? 1.556   3.268   -48.313 1.00 50.06  ? 139 LYS F C     1 
ATOM   3635 O O     . LYS D 2 35  ? 1.112   2.302   -47.688 1.00 53.72  ? 139 LYS F O     1 
ATOM   3636 C CB    . LYS D 2 35  ? 3.814   2.765   -47.301 1.00 45.64  ? 139 LYS F CB    1 
ATOM   3637 C CG    . LYS D 2 35  ? 5.304   3.082   -47.300 1.00 51.99  ? 139 LYS F CG    1 
ATOM   3638 C CD    . LYS D 2 35  ? 6.069   2.210   -46.324 1.00 62.74  ? 139 LYS F CD    1 
ATOM   3639 C CE    . LYS D 2 35  ? 7.406   2.832   -45.975 1.00 68.53  ? 139 LYS F CE    1 
ATOM   3640 N NZ    . LYS D 2 35  ? 8.059   2.107   -44.847 1.00 72.67  ? 139 LYS F NZ    1 
ATOM   3641 N N     . LEU D 2 36  ? 0.805   4.114   -49.007 1.00 44.19  ? 140 LEU F N     1 
ATOM   3642 C CA    . LEU D 2 36  ? -0.583  3.888   -49.351 1.00 46.77  ? 140 LEU F CA    1 
ATOM   3643 C C     . LEU D 2 36  ? -0.682  3.880   -50.875 1.00 48.03  ? 140 LEU F C     1 
ATOM   3644 O O     . LEU D 2 36  ? 0.242   4.331   -51.554 1.00 47.34  ? 140 LEU F O     1 
ATOM   3645 C CB    . LEU D 2 36  ? -1.474  4.985   -48.772 1.00 42.47  ? 140 LEU F CB    1 
ATOM   3646 C CG    . LEU D 2 36  ? -1.517  5.150   -47.266 1.00 44.52  ? 140 LEU F CG    1 
ATOM   3647 C CD1   . LEU D 2 36  ? -2.261  6.420   -46.921 1.00 43.87  ? 140 LEU F CD1   1 
ATOM   3648 C CD2   . LEU D 2 36  ? -2.193  3.953   -46.636 1.00 44.36  ? 140 LEU F CD2   1 
ATOM   3649 N N     . THR D 2 37  ? -1.797  3.388   -51.410 1.00 44.72  ? 141 THR F N     1 
ATOM   3650 C CA    . THR D 2 37  ? -2.075  3.492   -52.843 1.00 41.73  ? 141 THR F CA    1 
ATOM   3651 C C     . THR D 2 37  ? -2.562  4.889   -53.210 1.00 42.19  ? 141 THR F C     1 
ATOM   3652 O O     . THR D 2 37  ? -2.976  5.642   -52.342 1.00 45.71  ? 141 THR F O     1 
ATOM   3653 C CB    . THR D 2 37  ? -3.116  2.494   -53.248 1.00 43.41  ? 141 THR F CB    1 
ATOM   3654 O OG1   . THR D 2 37  ? -4.359  2.858   -52.636 1.00 45.23  ? 141 THR F OG1   1 
ATOM   3655 C CG2   . THR D 2 37  ? -2.711  1.121   -52.761 1.00 47.51  ? 141 THR F CG2   1 
ATOM   3656 N N     . SER D 2 38  ? -2.506  5.244   -54.485 1.00 45.15  ? 142 SER F N     1 
ATOM   3657 C CA    . SER D 2 38  ? -3.034  6.539   -54.922 1.00 46.00  ? 142 SER F CA    1 
ATOM   3658 C C     . SER D 2 38  ? -4.508  6.645   -54.612 1.00 43.48  ? 142 SER F C     1 
ATOM   3659 O O     . SER D 2 38  ? -4.987  7.699   -54.220 1.00 43.91  ? 142 SER F O     1 
ATOM   3660 C CB    . SER D 2 38  ? -2.831  6.754   -56.424 1.00 53.22  ? 142 SER F CB    1 
ATOM   3661 O OG    . SER D 2 38  ? -1.458  6.844   -56.760 1.00 63.42  ? 142 SER F OG    1 
ATOM   3662 N N     . THR D 2 39  ? -5.231  5.550   -54.812 1.00 46.07  ? 143 THR F N     1 
ATOM   3663 C CA    . THR D 2 39  ? -6.672  5.525   -54.553 1.00 45.76  ? 143 THR F CA    1 
ATOM   3664 C C     . THR D 2 39  ? -7.009  5.868   -53.102 1.00 43.24  ? 143 THR F C     1 
ATOM   3665 O O     . THR D 2 39  ? -8.009  6.526   -52.827 1.00 42.81  ? 143 THR F O     1 
ATOM   3666 C CB    . THR D 2 39  ? -7.280  4.148   -54.855 1.00 42.62  ? 143 THR F CB    1 
ATOM   3667 O OG1   . THR D 2 39  ? -6.819  3.694   -56.125 1.00 53.40  ? 143 THR F OG1   1 
ATOM   3668 C CG2   . THR D 2 39  ? -8.780  4.228   -54.872 1.00 36.29  ? 143 THR F CG2   1 
ATOM   3669 N N     . GLN D 2 40  ? -6.181  5.404   -52.171 1.00 42.43  ? 144 GLN F N     1 
ATOM   3670 C CA    . GLN D 2 40  ? -6.456  5.607   -50.760 1.00 38.66  ? 144 GLN F CA    1 
ATOM   3671 C C     . GLN D 2 40  ? -6.300  7.057   -50.378 1.00 36.72  ? 144 GLN F C     1 
ATOM   3672 O O     . GLN D 2 40  ? -7.053  7.580   -49.558 1.00 41.27  ? 144 GLN F O     1 
ATOM   3673 C CB    . GLN D 2 40  ? -5.547  4.734   -49.921 1.00 37.60  ? 144 GLN F CB    1 
ATOM   3674 C CG    . GLN D 2 40  ? -6.053  3.337   -49.839 1.00 40.11  ? 144 GLN F CG    1 
ATOM   3675 C CD    . GLN D 2 40  ? -5.046  2.404   -49.273 1.00 40.53  ? 144 GLN F CD    1 
ATOM   3676 O OE1   . GLN D 2 40  ? -3.888  2.385   -49.699 1.00 43.28  ? 144 GLN F OE1   1 
ATOM   3677 N NE2   . GLN D 2 40  ? -5.469  1.611   -48.307 1.00 37.47  ? 144 GLN F NE2   1 
ATOM   3678 N N     . VAL D 2 41  ? -5.335  7.708   -51.000 1.00 33.69  ? 145 VAL F N     1 
ATOM   3679 C CA    . VAL D 2 41  ? -5.079  9.110   -50.764 1.00 36.10  ? 145 VAL F CA    1 
ATOM   3680 C C     . VAL D 2 41  ? -6.127  9.987   -51.442 1.00 38.00  ? 145 VAL F C     1 
ATOM   3681 O O     . VAL D 2 41  ? -6.637  10.920  -50.838 1.00 36.74  ? 145 VAL F O     1 
ATOM   3682 C CB    . VAL D 2 41  ? -3.681  9.475   -51.255 1.00 37.97  ? 145 VAL F CB    1 
ATOM   3683 C CG1   . VAL D 2 41  ? -3.403  10.947  -51.046 1.00 40.11  ? 145 VAL F CG1   1 
ATOM   3684 C CG2   . VAL D 2 41  ? -2.665  8.626   -50.536 1.00 36.47  ? 145 VAL F CG2   1 
ATOM   3685 N N     . LYS D 2 42  ? -6.452  9.675   -52.695 1.00 40.28  ? 146 LYS F N     1 
ATOM   3686 C CA    . LYS D 2 42  ? -7.540  10.347  -53.404 1.00 40.16  ? 146 LYS F CA    1 
ATOM   3687 C C     . LYS D 2 42  ? -8.850  10.265  -52.623 1.00 39.21  ? 146 LYS F C     1 
ATOM   3688 O O     . LYS D 2 42  ? -9.609  11.237  -52.569 1.00 42.29  ? 146 LYS F O     1 
ATOM   3689 C CB    . LYS D 2 42  ? -7.729  9.751   -54.813 1.00 47.49  ? 146 LYS F CB    1 
ATOM   3690 C CG    . LYS D 2 42  ? -9.166  9.877   -55.376 1.00 49.54  ? 146 LYS F CG    1 
ATOM   3691 C CD    . LYS D 2 42  ? -9.275  9.583   -56.861 1.00 49.11  ? 146 LYS F CD    1 
ATOM   3692 C CE    . LYS D 2 42  ? -9.346  8.093   -57.184 1.00 51.08  ? 146 LYS F CE    1 
ATOM   3693 N NZ    . LYS D 2 42  ? -9.176  7.884   -58.672 1.00 58.52  ? 146 LYS F NZ    1 
ATOM   3694 N N     . ILE D 2 43  ? -9.105  9.112   -52.014 1.00 36.21  ? 147 ILE F N     1 
ATOM   3695 C CA    . ILE D 2 43  ? -10.318 8.919   -51.237 1.00 38.26  ? 147 ILE F CA    1 
ATOM   3696 C C     . ILE D 2 43  ? -10.226 9.527   -49.832 1.00 39.23  ? 147 ILE F C     1 
ATOM   3697 O O     . ILE D 2 43  ? -11.216 10.037  -49.324 1.00 41.07  ? 147 ILE F O     1 
ATOM   3698 C CB    . ILE D 2 43  ? -10.679 7.416   -51.155 1.00 39.68  ? 147 ILE F CB    1 
ATOM   3699 C CG1   . ILE D 2 43  ? -11.185 6.940   -52.517 1.00 36.84  ? 147 ILE F CG1   1 
ATOM   3700 C CG2   . ILE D 2 43  ? -11.768 7.150   -50.118 1.00 34.14  ? 147 ILE F CG2   1 
ATOM   3701 C CD1   . ILE D 2 43  ? -12.255 7.814   -53.046 1.00 35.65  ? 147 ILE F CD1   1 
ATOM   3702 N N     . TRP D 2 44  ? -9.057  9.496   -49.199 1.00 40.34  ? 148 TRP F N     1 
ATOM   3703 C CA    . TRP D 2 44  ? -8.925  10.177  -47.909 1.00 41.29  ? 148 TRP F CA    1 
ATOM   3704 C C     . TRP D 2 44  ? -9.267  11.675  -48.087 1.00 41.56  ? 148 TRP F C     1 
ATOM   3705 O O     . TRP D 2 44  ? -10.001 12.242  -47.293 1.00 41.58  ? 148 TRP F O     1 
ATOM   3706 C CB    . TRP D 2 44  ? -7.514  9.992   -47.297 1.00 36.15  ? 148 TRP F CB    1 
ATOM   3707 C CG    . TRP D 2 44  ? -7.449  10.458  -45.875 1.00 38.78  ? 148 TRP F CG    1 
ATOM   3708 C CD1   . TRP D 2 44  ? -7.660  9.714   -44.749 1.00 41.80  ? 148 TRP F CD1   1 
ATOM   3709 C CD2   . TRP D 2 44  ? -7.202  11.792  -45.423 1.00 41.69  ? 148 TRP F CD2   1 
ATOM   3710 N NE1   . TRP D 2 44  ? -7.547  10.507  -43.628 1.00 40.04  ? 148 TRP F NE1   1 
ATOM   3711 C CE2   . TRP D 2 44  ? -7.271  11.786  -44.025 1.00 32.29  ? 148 TRP F CE2   1 
ATOM   3712 C CE3   . TRP D 2 44  ? -6.922  12.994  -46.070 1.00 45.75  ? 148 TRP F CE3   1 
ATOM   3713 C CZ2   . TRP D 2 44  ? -7.079  12.911  -43.283 1.00 35.58  ? 148 TRP F CZ2   1 
ATOM   3714 C CZ3   . TRP D 2 44  ? -6.727  14.118  -45.302 1.00 41.60  ? 148 TRP F CZ3   1 
ATOM   3715 C CH2   . TRP D 2 44  ? -6.809  14.066  -43.937 1.00 35.46  ? 148 TRP F CH2   1 
ATOM   3716 N N     . PHE D 2 45  ? -8.779  12.305  -49.150 1.00 40.49  ? 149 PHE F N     1 
ATOM   3717 C CA    . PHE D 2 45  ? -9.076  13.716  -49.365 1.00 39.88  ? 149 PHE F CA    1 
ATOM   3718 C C     . PHE D 2 45  ? -10.541 13.925  -49.704 1.00 45.28  ? 149 PHE F C     1 
ATOM   3719 O O     . PHE D 2 45  ? -11.144 14.906  -49.291 1.00 48.33  ? 149 PHE F O     1 
ATOM   3720 C CB    . PHE D 2 45  ? -8.199  14.300  -50.461 1.00 36.63  ? 149 PHE F CB    1 
ATOM   3721 C CG    . PHE D 2 45  ? -6.895  14.833  -49.958 1.00 41.05  ? 149 PHE F CG    1 
ATOM   3722 C CD1   . PHE D 2 45  ? -6.769  16.164  -49.609 1.00 41.31  ? 149 PHE F CD1   1 
ATOM   3723 C CD2   . PHE D 2 45  ? -5.798  13.993  -49.804 1.00 40.50  ? 149 PHE F CD2   1 
ATOM   3724 C CE1   . PHE D 2 45  ? -5.581  16.649  -49.142 1.00 44.14  ? 149 PHE F CE1   1 
ATOM   3725 C CE2   . PHE D 2 45  ? -4.610  14.468  -49.340 1.00 37.93  ? 149 PHE F CE2   1 
ATOM   3726 C CZ    . PHE D 2 45  ? -4.496  15.798  -49.010 1.00 47.20  ? 149 PHE F CZ    1 
ATOM   3727 N N     . GLN D 2 46  ? -11.120 13.002  -50.456 1.00 45.17  ? 150 GLN F N     1 
ATOM   3728 C CA    . GLN D 2 46  ? -12.545 13.060  -50.710 1.00 44.76  ? 150 GLN F CA    1 
ATOM   3729 C C     . GLN D 2 46  ? -13.313 12.952  -49.410 1.00 44.43  ? 150 GLN F C     1 
ATOM   3730 O O     . GLN D 2 46  ? -14.123 13.815  -49.104 1.00 48.17  ? 150 GLN F O     1 
ATOM   3731 C CB    . GLN D 2 46  ? -12.974 11.955  -51.666 1.00 43.74  ? 150 GLN F CB    1 
ATOM   3732 C CG    . GLN D 2 46  ? -14.459 11.903  -51.950 1.00 39.28  ? 150 GLN F CG    1 
ATOM   3733 C CD    . GLN D 2 46  ? -14.755 10.953  -53.076 1.00 39.30  ? 150 GLN F CD    1 
ATOM   3734 O OE1   . GLN D 2 46  ? -14.139 11.031  -54.130 1.00 40.17  ? 150 GLN F OE1   1 
ATOM   3735 N NE2   . GLN D 2 46  ? -15.682 10.037  -52.859 1.00 43.36  ? 150 GLN F NE2   1 
ATOM   3736 N N     . ASN D 2 47  ? -13.048 11.900  -48.639 1.00 43.71  ? 151 ASN F N     1 
ATOM   3737 C CA    . ASN D 2 47  ? -13.762 11.674  -47.391 1.00 39.86  ? 151 ASN F CA    1 
ATOM   3738 C C     . ASN D 2 47  ? -13.483 12.778  -46.372 1.00 50.01  ? 151 ASN F C     1 
ATOM   3739 O O     . ASN D 2 47  ? -14.283 13.013  -45.465 1.00 52.31  ? 151 ASN F O     1 
ATOM   3740 C CB    . ASN D 2 47  ? -13.402 10.318  -46.813 1.00 34.17  ? 151 ASN F CB    1 
ATOM   3741 C CG    . ASN D 2 47  ? -14.198 9.179   -47.427 1.00 39.91  ? 151 ASN F CG    1 
ATOM   3742 O OD1   . ASN D 2 47  ? -15.344 9.343   -47.833 1.00 47.15  ? 151 ASN F OD1   1 
ATOM   3743 N ND2   . ASN D 2 47  ? -13.594 8.007   -47.479 1.00 41.16  ? 151 ASN F ND2   1 
ATOM   3744 N N     . ARG D 2 48  ? -12.357 13.472  -46.535 1.00 50.31  ? 152 ARG F N     1 
ATOM   3745 C CA    . ARG D 2 48  ? -11.995 14.558  -45.628 1.00 49.06  ? 152 ARG F CA    1 
ATOM   3746 C C     . ARG D 2 48  ? -12.622 15.890  -46.031 1.00 51.65  ? 152 ARG F C     1 
ATOM   3747 O O     . ARG D 2 48  ? -13.024 16.648  -45.163 1.00 58.28  ? 152 ARG F O     1 
ATOM   3748 C CB    . ARG D 2 48  ? -10.471 14.709  -45.543 1.00 48.44  ? 152 ARG F CB    1 
ATOM   3749 C CG    . ARG D 2 48  ? -9.975  15.797  -44.581 1.00 52.35  ? 152 ARG F CG    1 
ATOM   3750 C CD    . ARG D 2 48  ? -10.289 15.483  -43.094 1.00 57.80  ? 152 ARG F CD    1 
ATOM   3751 N NE    . ARG D 2 48  ? -9.698  16.476  -42.191 1.00 60.02  ? 152 ARG F NE    1 
ATOM   3752 C CZ    . ARG D 2 48  ? -10.324 17.572  -41.765 1.00 61.92  ? 152 ARG F CZ    1 
ATOM   3753 N NH1   . ARG D 2 48  ? -11.576 17.807  -42.144 1.00 64.35  ? 152 ARG F NH1   1 
ATOM   3754 N NH2   . ARG D 2 48  ? -9.708  18.431  -40.961 1.00 53.24  ? 152 ARG F NH2   1 
ATOM   3755 N N     . ARG D 2 49  ? -12.693 16.189  -47.330 1.00 50.63  ? 153 ARG F N     1 
ATOM   3756 C CA    . ARG D 2 49  ? -13.279 17.453  -47.793 1.00 50.96  ? 153 ARG F CA    1 
ATOM   3757 C C     . ARG D 2 49  ? -14.754 17.483  -47.458 1.00 51.64  ? 153 ARG F C     1 
ATOM   3758 O O     . ARG D 2 49  ? -15.329 18.543  -47.248 1.00 58.34  ? 153 ARG F O     1 
ATOM   3759 C CB    . ARG D 2 49  ? -13.086 17.649  -49.301 1.00 51.21  ? 153 ARG F CB    1 
ATOM   3760 C CG    . ARG D 2 49  ? -11.754 18.262  -49.704 1.00 52.29  ? 153 ARG F CG    1 
ATOM   3761 C CD    . ARG D 2 49  ? -11.648 18.442  -51.218 1.00 50.00  ? 153 ARG F CD    1 
ATOM   3762 N NE    . ARG D 2 49  ? -10.742 17.482  -51.858 1.00 47.92  ? 153 ARG F NE    1 
ATOM   3763 C CZ    . ARG D 2 49  ? -11.144 16.382  -52.486 1.00 45.50  ? 153 ARG F CZ    1 
ATOM   3764 N NH1   . ARG D 2 49  ? -12.433 16.114  -52.555 1.00 49.04  ? 153 ARG F NH1   1 
ATOM   3765 N NH2   . ARG D 2 49  ? -10.271 15.553  -53.039 1.00 41.85  ? 153 ARG F NH2   1 
ATOM   3766 N N     . TYR D 2 50  ? -15.357 16.303  -47.401 1.00 51.23  ? 154 TYR F N     1 
ATOM   3767 C CA    . TYR D 2 50  ? -16.772 16.169  -47.111 1.00 53.96  ? 154 TYR F CA    1 
ATOM   3768 C C     . TYR D 2 50  ? -17.064 16.372  -45.649 1.00 59.95  ? 154 TYR F C     1 
ATOM   3769 O O     . TYR D 2 50  ? -18.077 16.958  -45.309 1.00 66.21  ? 154 TYR F O     1 
ATOM   3770 C CB    . TYR D 2 50  ? -17.276 14.803  -47.542 1.00 55.61  ? 154 TYR F CB    1 
ATOM   3771 C CG    . TYR D 2 50  ? -18.716 14.539  -47.196 1.00 58.48  ? 154 TYR F CG    1 
ATOM   3772 C CD1   . TYR D 2 50  ? -19.748 15.072  -47.962 1.00 61.46  ? 154 TYR F CD1   1 
ATOM   3773 C CD2   . TYR D 2 50  ? -19.049 13.720  -46.140 1.00 57.80  ? 154 TYR F CD2   1 
ATOM   3774 C CE1   . TYR D 2 50  ? -21.074 14.820  -47.659 1.00 59.32  ? 154 TYR F CE1   1 
ATOM   3775 C CE2   . TYR D 2 50  ? -20.377 13.449  -45.839 1.00 62.64  ? 154 TYR F CE2   1 
ATOM   3776 C CZ    . TYR D 2 50  ? -21.383 14.002  -46.599 1.00 59.54  ? 154 TYR F CZ    1 
ATOM   3777 O OH    . TYR D 2 50  ? -22.695 13.729  -46.279 1.00 64.85  ? 154 TYR F OH    1 
ATOM   3778 N N     . LYS D 2 51  ? -16.176 15.887  -44.788 1.00 62.17  ? 155 LYS F N     1 
ATOM   3779 C CA    . LYS D 2 51  ? -16.353 16.022  -43.347 1.00 59.11  ? 155 LYS F CA    1 
ATOM   3780 C C     . LYS D 2 51  ? -16.113 17.458  -42.893 1.00 60.36  ? 155 LYS F C     1 
ATOM   3781 O O     . LYS D 2 51  ? -16.645 17.893  -41.872 1.00 68.84  ? 155 LYS F O     1 
ATOM   3782 C CB    . LYS D 2 51  ? -15.415 15.071  -42.600 1.00 61.69  ? 155 LYS F CB    1 
ATOM   3783 C CG    . LYS D 2 51  ? -15.861 13.618  -42.618 1.00 59.68  ? 155 LYS F CG    1 
ATOM   3784 C CD    . LYS D 2 51  ? -15.028 12.772  -41.670 1.00 61.62  ? 155 LYS F CD    1 
ATOM   3785 C CE    . LYS D 2 51  ? -13.836 12.155  -42.383 1.00 60.56  ? 155 LYS F CE    1 
ATOM   3786 N NZ    . LYS D 2 51  ? -13.011 11.321  -41.465 1.00 56.40  ? 155 LYS F NZ    1 
ATOM   3787 N N     . SER D 2 52  ? -15.310 18.189  -43.659 1.00 60.07  ? 156 SER F N     1 
ATOM   3788 C CA    . SER D 2 52  ? -14.998 19.576  -43.337 1.00 62.57  ? 156 SER F CA    1 
ATOM   3789 C C     . SER D 2 52  ? -16.258 20.434  -43.316 1.00 75.25  ? 156 SER F C     1 
ATOM   3790 O O     . SER D 2 52  ? -16.188 21.653  -43.161 1.00 86.95  ? 156 SER F O     1 
ATOM   3791 C CB    . SER D 2 52  ? -13.991 20.145  -44.338 1.00 66.38  ? 156 SER F CB    1 
ATOM   3792 O OG    . SER D 2 52  ? -12.743 19.480  -44.241 1.00 71.19  ? 156 SER F OG    1 
ATOM   3793 N N     . LYS D 2 53  ? -17.410 19.789  -43.472 1.00 75.61  ? 157 LYS F N     1 
ATOM   3794 C CA    . LYS D 2 53  ? -18.688 20.492  -43.472 1.00 71.02  ? 157 LYS F CA    1 
ATOM   3795 C C     . LYS D 2 53  ? -19.749 19.706  -42.710 1.00 71.86  ? 157 LYS F C     1 
ATOM   3796 O O     . LYS D 2 53  ? -19.864 19.944  -41.461 1.00 75.48  ? 157 LYS F O     1 
ATOM   3797 C CB    . LYS D 2 53  ? -19.155 20.754  -44.905 1.00 70.04  ? 157 LYS F CB    1 
ATOM   3798 C CG    . LYS D 2 53  ? -19.497 19.496  -45.686 1.00 67.01  ? 157 LYS F CG    1 
ATOM   3799 C CD    . LYS D 2 53  ? -19.661 19.794  -47.168 1.00 68.87  ? 157 LYS F CD    1 
ATOM   3800 C CE    . LYS D 2 53  ? -19.727 18.514  -47.984 1.00 68.92  ? 157 LYS F CE    1 
ATOM   3801 N NZ    . LYS D 2 53  ? -19.426 18.756  -49.422 1.00 75.95  ? 157 LYS F NZ    1 
ATOM   3802 O OXT   . LYS D 2 53  ? -20.444 18.868  -43.378 1.00 65.11  ? 157 LYS F OXT   1 
ATOM   3803 O "O5'" . DT  E 3 1   ? 18.833  20.888  -44.408 1.00 68.30  ? 1   DT  C "O5'" 1 
ATOM   3804 C "C5'" . DT  E 3 1   ? 19.112  19.758  -45.255 1.00 73.52  ? 1   DT  C "C5'" 1 
ATOM   3805 C "C4'" . DT  E 3 1   ? 18.094  18.646  -45.035 1.00 68.57  ? 1   DT  C "C4'" 1 
ATOM   3806 O "O4'" . DT  E 3 1   ? 18.464  17.475  -45.817 1.00 64.09  ? 1   DT  C "O4'" 1 
ATOM   3807 C "C3'" . DT  E 3 1   ? 17.980  18.180  -43.590 1.00 72.56  ? 1   DT  C "C3'" 1 
ATOM   3808 O "O3'" . DT  E 3 1   ? 16.629  17.892  -43.245 1.00 73.61  ? 1   DT  C "O3'" 1 
ATOM   3809 C "C2'" . DT  E 3 1   ? 18.856  16.932  -43.534 1.00 73.79  ? 1   DT  C "C2'" 1 
ATOM   3810 C "C1'" . DT  E 3 1   ? 18.820  16.398  -44.969 1.00 70.35  ? 1   DT  C "C1'" 1 
ATOM   3811 N N1    . DT  E 3 1   ? 20.149  15.867  -45.402 1.00 75.25  ? 1   DT  C N1    1 
ATOM   3812 C C2    . DT  E 3 1   ? 20.350  14.496  -45.480 1.00 71.76  ? 1   DT  C C2    1 
ATOM   3813 O O2    . DT  E 3 1   ? 19.479  13.668  -45.238 1.00 69.49  ? 1   DT  C O2    1 
ATOM   3814 N N3    . DT  E 3 1   ? 21.618  14.130  -45.865 1.00 67.58  ? 1   DT  C N3    1 
ATOM   3815 C C4    . DT  E 3 1   ? 22.677  14.973  -46.170 1.00 64.57  ? 1   DT  C C4    1 
ATOM   3816 O O4    . DT  E 3 1   ? 23.768  14.547  -46.517 1.00 64.68  ? 1   DT  C O4    1 
ATOM   3817 C C5    . DT  E 3 1   ? 22.403  16.386  -46.057 1.00 65.52  ? 1   DT  C C5    1 
ATOM   3818 C C7    . DT  E 3 1   ? 23.472  17.388  -46.358 1.00 61.44  ? 1   DT  C C7    1 
ATOM   3819 C C6    . DT  E 3 1   ? 21.173  16.762  -45.677 1.00 72.29  ? 1   DT  C C6    1 
ATOM   3820 P P     . DC  E 3 2   ? 16.203  17.842  -41.695 1.00 65.81  ? 2   DC  C P     1 
ATOM   3821 O OP1   . DC  E 3 2   ? 14.738  18.052  -41.678 1.00 67.11  ? 2   DC  C OP1   1 
ATOM   3822 O OP2   . DC  E 3 2   ? 17.090  18.781  -40.965 1.00 54.52  ? 2   DC  C OP2   1 
ATOM   3823 O "O5'" . DC  E 3 2   ? 16.549  16.335  -41.246 1.00 61.58  ? 2   DC  C "O5'" 1 
ATOM   3824 C "C5'" . DC  E 3 2   ? 15.743  15.259  -41.720 1.00 60.93  ? 2   DC  C "C5'" 1 
ATOM   3825 C "C4'" . DC  E 3 2   ? 16.383  13.905  -41.447 1.00 61.73  ? 2   DC  C "C4'" 1 
ATOM   3826 O "O4'" . DC  E 3 2   ? 17.691  13.831  -42.051 1.00 65.39  ? 2   DC  C "O4'" 1 
ATOM   3827 C "C3'" . DC  E 3 2   ? 16.572  13.529  -39.973 1.00 56.76  ? 2   DC  C "C3'" 1 
ATOM   3828 O "O3'" . DC  E 3 2   ? 15.852  12.338  -39.720 1.00 60.60  ? 2   DC  C "O3'" 1 
ATOM   3829 C "C2'" . DC  E 3 2   ? 18.082  13.308  -39.837 1.00 56.38  ? 2   DC  C "C2'" 1 
ATOM   3830 C "C1'" . DC  E 3 2   ? 18.485  12.992  -41.264 1.00 59.73  ? 2   DC  C "C1'" 1 
ATOM   3831 N N1    . DC  E 3 2   ? 19.918  13.283  -41.579 1.00 60.29  ? 2   DC  C N1    1 
ATOM   3832 C C2    . DC  E 3 2   ? 20.772  12.237  -41.953 1.00 60.32  ? 2   DC  C C2    1 
ATOM   3833 O O2    . DC  E 3 2   ? 20.325  11.081  -42.002 1.00 61.57  ? 2   DC  C O2    1 
ATOM   3834 N N3    . DC  E 3 2   ? 22.073  12.521  -42.250 1.00 61.76  ? 2   DC  C N3    1 
ATOM   3835 C C4    . DC  E 3 2   ? 22.519  13.788  -42.190 1.00 66.24  ? 2   DC  C C4    1 
ATOM   3836 N N4    . DC  E 3 2   ? 23.813  14.027  -42.498 1.00 59.26  ? 2   DC  C N4    1 
ATOM   3837 C C5    . DC  E 3 2   ? 21.655  14.865  -41.810 1.00 65.82  ? 2   DC  C C5    1 
ATOM   3838 C C6    . DC  E 3 2   ? 20.378  14.567  -41.521 1.00 63.02  ? 2   DC  C C6    1 
ATOM   3839 P P     . DT  E 3 3   ? 15.770  11.687  -38.249 1.00 59.23  ? 3   DT  C P     1 
ATOM   3840 O OP1   . DT  E 3 3   ? 14.529  10.890  -38.226 1.00 60.84  ? 3   DT  C OP1   1 
ATOM   3841 O OP2   . DT  E 3 3   ? 15.986  12.724  -37.213 1.00 56.72  ? 3   DT  C OP2   1 
ATOM   3842 O "O5'" . DT  E 3 3   ? 16.948  10.613  -38.255 1.00 60.27  ? 3   DT  C "O5'" 1 
ATOM   3843 C "C5'" . DT  E 3 3   ? 16.879  9.528   -39.154 1.00 60.58  ? 3   DT  C "C5'" 1 
ATOM   3844 C "C4'" . DT  E 3 3   ? 17.903  8.465   -38.815 1.00 61.88  ? 3   DT  C "C4'" 1 
ATOM   3845 O "O4'" . DT  E 3 3   ? 19.212  8.882   -39.287 1.00 62.46  ? 3   DT  C "O4'" 1 
ATOM   3846 C "C3'" . DT  E 3 3   ? 18.046  8.159   -37.328 1.00 62.39  ? 3   DT  C "C3'" 1 
ATOM   3847 O "O3'" . DT  E 3 3   ? 18.099  6.742   -37.121 1.00 62.74  ? 3   DT  C "O3'" 1 
ATOM   3848 C "C2'" . DT  E 3 3   ? 19.359  8.859   -36.941 1.00 64.78  ? 3   DT  C "C2'" 1 
ATOM   3849 C "C1'" . DT  E 3 3   ? 20.155  8.793   -38.236 1.00 64.02  ? 3   DT  C "C1'" 1 
ATOM   3850 N N1    . DT  E 3 3   ? 21.130  9.898   -38.416 1.00 54.41  ? 3   DT  C N1    1 
ATOM   3851 C C2    . DT  E 3 3   ? 22.362  9.602   -38.907 1.00 56.00  ? 3   DT  C C2    1 
ATOM   3852 O O2    . DT  E 3 3   ? 22.712  8.467   -39.178 1.00 58.61  ? 3   DT  C O2    1 
ATOM   3853 N N3    . DT  E 3 3   ? 23.184  10.678  -39.071 1.00 53.83  ? 3   DT  C N3    1 
ATOM   3854 C C4    . DT  E 3 3   ? 22.890  11.991  -38.803 1.00 50.58  ? 3   DT  C C4    1 
ATOM   3855 O O4    . DT  E 3 3   ? 23.694  12.891  -38.983 1.00 53.00  ? 3   DT  C O4    1 
ATOM   3856 C C5    . DT  E 3 3   ? 21.577  12.234  -38.295 1.00 51.16  ? 3   DT  C C5    1 
ATOM   3857 C C7    . DT  E 3 3   ? 21.156  13.625  -37.963 1.00 55.54  ? 3   DT  C C7    1 
ATOM   3858 C C6    . DT  E 3 3   ? 20.763  11.191  -38.132 1.00 53.96  ? 3   DT  C C6    1 
ATOM   3859 P P     . DC  E 3 4   ? 17.983  6.118   -35.639 1.00 82.10  ? 4   DC  C P     1 
ATOM   3860 O OP1   . DC  E 3 4   ? 16.677  5.437   -35.539 1.00 76.29  ? 4   DC  C OP1   1 
ATOM   3861 O OP2   . DC  E 3 4   ? 18.332  7.143   -34.619 1.00 76.36  ? 4   DC  C OP2   1 
ATOM   3862 O "O5'" . DC  E 3 4   ? 19.134  5.014   -35.611 1.00 72.06  ? 4   DC  C "O5'" 1 
ATOM   3863 C "C5'" . DC  E 3 4   ? 19.896  4.752   -36.780 1.00 72.46  ? 4   DC  C "C5'" 1 
ATOM   3864 C "C4'" . DC  E 3 4   ? 21.364  4.619   -36.430 1.00 69.47  ? 4   DC  C "C4'" 1 
ATOM   3865 O "O4'" . DC  E 3 4   ? 22.032  5.862   -36.722 1.00 69.32  ? 4   DC  C "O4'" 1 
ATOM   3866 C "C3'" . DC  E 3 4   ? 21.635  4.320   -34.958 1.00 66.95  ? 4   DC  C "C3'" 1 
ATOM   3867 O "O3'" . DC  E 3 4   ? 22.253  3.051   -34.824 1.00 69.63  ? 4   DC  C "O3'" 1 
ATOM   3868 C "C2'" . DC  E 3 4   ? 22.547  5.460   -34.484 1.00 61.96  ? 4   DC  C "C2'" 1 
ATOM   3869 C "C1'" . DC  E 3 4   ? 23.037  6.090   -35.776 1.00 63.83  ? 4   DC  C "C1'" 1 
ATOM   3870 N N1    . DC  E 3 4   ? 23.207  7.550   -35.666 1.00 59.16  ? 4   DC  C N1    1 
ATOM   3871 C C2    . DC  E 3 4   ? 24.414  8.151   -36.051 1.00 56.25  ? 4   DC  C C2    1 
ATOM   3872 O O2    . DC  E 3 4   ? 25.338  7.438   -36.484 1.00 54.45  ? 4   DC  C O2    1 
ATOM   3873 N N3    . DC  E 3 4   ? 24.532  9.501   -35.944 1.00 51.46  ? 4   DC  C N3    1 
ATOM   3874 C C4    . DC  E 3 4   ? 23.506  10.226  -35.481 1.00 52.61  ? 4   DC  C C4    1 
ATOM   3875 N N4    . DC  E 3 4   ? 23.661  11.549  -35.390 1.00 51.11  ? 4   DC  C N4    1 
ATOM   3876 C C5    . DC  E 3 4   ? 22.276  9.626   -35.093 1.00 56.55  ? 4   DC  C C5    1 
ATOM   3877 C C6    . DC  E 3 4   ? 22.171  8.301   -35.205 1.00 59.44  ? 4   DC  C C6    1 
ATOM   3878 P P     . DA  E 3 5   ? 22.440  2.394   -33.364 1.00 79.24  ? 5   DA  C P     1 
ATOM   3879 O OP1   . DA  E 3 5   ? 21.804  1.056   -33.335 1.00 74.73  ? 5   DA  C OP1   1 
ATOM   3880 O OP2   . DA  E 3 5   ? 22.049  3.395   -32.351 1.00 75.02  ? 5   DA  C OP2   1 
ATOM   3881 O "O5'" . DA  E 3 5   ? 24.017  2.196   -33.236 1.00 71.72  ? 5   DA  C "O5'" 1 
ATOM   3882 C "C5'" . DA  E 3 5   ? 24.706  1.277   -34.081 1.00 72.03  ? 5   DA  C "C5'" 1 
ATOM   3883 C "C4'" . DA  E 3 5   ? 26.193  1.520   -33.972 1.00 74.08  ? 5   DA  C "C4'" 1 
ATOM   3884 O "O4'" . DA  E 3 5   ? 26.462  2.836   -34.523 1.00 68.80  ? 5   DA  C "O4'" 1 
ATOM   3885 C "C3'" . DA  E 3 5   ? 26.705  1.522   -32.526 1.00 74.89  ? 5   DA  C "C3'" 1 
ATOM   3886 O "O3'" . DA  E 3 5   ? 27.470  0.295   -32.191 1.00 77.45  ? 5   DA  C "O3'" 1 
ATOM   3887 C "C2'" . DA  E 3 5   ? 27.538  2.784   -32.393 1.00 71.48  ? 5   DA  C "C2'" 1 
ATOM   3888 C "C1'" . DA  E 3 5   ? 27.231  3.617   -33.632 1.00 68.06  ? 5   DA  C "C1'" 1 
ATOM   3889 N N9    . DA  E 3 5   ? 26.532  4.867   -33.310 1.00 63.93  ? 5   DA  C N9    1 
ATOM   3890 C C8    . DA  E 3 5   ? 25.301  5.005   -32.715 1.00 64.39  ? 5   DA  C C8    1 
ATOM   3891 N N7    . DA  E 3 5   ? 24.942  6.257   -32.520 1.00 57.47  ? 5   DA  C N7    1 
ATOM   3892 C C5    . DA  E 3 5   ? 26.018  6.987   -32.997 1.00 54.46  ? 5   DA  C C5    1 
ATOM   3893 C C6    . DA  E 3 5   ? 26.265  8.373   -33.077 1.00 53.76  ? 5   DA  C C6    1 
ATOM   3894 N N6    . DA  E 3 5   ? 25.401  9.304   -32.656 1.00 52.06  ? 5   DA  C N6    1 
ATOM   3895 N N1    . DA  E 3 5   ? 27.441  8.768   -33.616 1.00 55.84  ? 5   DA  C N1    1 
ATOM   3896 C C2    . DA  E 3 5   ? 28.310  7.833   -34.042 1.00 55.74  ? 5   DA  C C2    1 
ATOM   3897 N N3    . DA  E 3 5   ? 28.190  6.505   -34.016 1.00 55.50  ? 5   DA  C N3    1 
ATOM   3898 C C4    . DA  E 3 5   ? 27.011  6.144   -33.479 1.00 56.85  ? 5   DA  C C4    1 
ATOM   3899 P P     . DC  E 3 6   ? 29.000  0.034   -32.675 1.00 84.67  ? 6   DC  C P     1 
ATOM   3900 O OP1   . DC  E 3 6   ? 29.506  1.020   -33.654 1.00 82.77  ? 6   DC  C OP1   1 
ATOM   3901 O OP2   . DC  E 3 6   ? 29.027  -1.402  -33.035 1.00 86.47  ? 6   DC  C OP2   1 
ATOM   3902 O "O5'" . DC  E 3 6   ? 29.896  0.193   -31.360 1.00 74.25  ? 6   DC  C "O5'" 1 
ATOM   3903 C "C5'" . DC  E 3 6   ? 29.988  1.443   -30.680 1.00 78.58  ? 6   DC  C "C5'" 1 
ATOM   3904 C "C4'" . DC  E 3 6   ? 31.146  2.301   -31.193 1.00 77.82  ? 6   DC  C "C4'" 1 
ATOM   3905 O "O4'" . DC  E 3 6   ? 30.652  3.283   -32.161 1.00 69.45  ? 6   DC  C "O4'" 1 
ATOM   3906 C "C3'" . DC  E 3 6   ? 31.810  3.150   -30.113 1.00 80.32  ? 6   DC  C "C3'" 1 
ATOM   3907 O "O3'" . DC  E 3 6   ? 32.801  2.385   -29.349 1.00 82.00  ? 6   DC  C "O3'" 1 
ATOM   3908 C "C2'" . DC  E 3 6   ? 32.379  4.306   -30.930 1.00 70.73  ? 6   DC  C "C2'" 1 
ATOM   3909 C "C1'" . DC  E 3 6   ? 31.204  4.569   -31.862 1.00 67.69  ? 6   DC  C "C1'" 1 
ATOM   3910 N N1    . DC  E 3 6   ? 30.109  5.524   -31.268 1.00 59.07  ? 6   DC  C N1    1 
ATOM   3911 C C2    . DC  E 3 6   ? 30.307  6.911   -31.309 1.00 58.60  ? 6   DC  C C2    1 
ATOM   3912 O O2    . DC  E 3 6   ? 31.345  7.351   -31.811 1.00 67.16  ? 6   DC  C O2    1 
ATOM   3913 N N3    . DC  E 3 6   ? 29.353  7.741   -30.798 1.00 53.66  ? 6   DC  C N3    1 
ATOM   3914 C C4    . DC  E 3 6   ? 28.243  7.237   -30.267 1.00 51.22  ? 6   DC  C C4    1 
ATOM   3915 N N4    . DC  E 3 6   ? 27.338  8.094   -29.786 1.00 43.21  ? 6   DC  C N4    1 
ATOM   3916 C C5    . DC  E 3 6   ? 28.015  5.830   -30.212 1.00 54.80  ? 6   DC  C C5    1 
ATOM   3917 C C6    . DC  E 3 6   ? 28.968  5.023   -30.709 1.00 58.26  ? 6   DC  C C6    1 
ATOM   3918 P P     . DA  E 3 7   ? 34.368  2.397   -29.702 1.00 82.53  ? 7   DA  C P     1 
ATOM   3919 O OP1   . DA  E 3 7   ? 34.512  2.148   -31.160 1.00 79.12  ? 7   DA  C OP1   1 
ATOM   3920 O OP2   . DA  E 3 7   ? 34.964  1.462   -28.723 1.00 85.61  ? 7   DA  C OP2   1 
ATOM   3921 O "O5'" . DA  E 3 7   ? 34.880  3.884   -29.330 1.00 69.87  ? 7   DA  C "O5'" 1 
ATOM   3922 C "C5'" . DA  E 3 7   ? 35.792  4.558   -30.214 1.00 73.36  ? 7   DA  C "C5'" 1 
ATOM   3923 C "C4'" . DA  E 3 7   ? 36.017  5.997   -29.795 1.00 64.76  ? 7   DA  C "C4'" 1 
ATOM   3924 O "O4'" . DA  E 3 7   ? 34.744  6.681   -29.719 1.00 65.63  ? 7   DA  C "O4'" 1 
ATOM   3925 C "C3'" . DA  E 3 7   ? 36.685  6.163   -28.438 1.00 67.20  ? 7   DA  C "C3'" 1 
ATOM   3926 O "O3'" . DA  E 3 7   ? 37.680  7.181   -28.490 1.00 68.48  ? 7   DA  C "O3'" 1 
ATOM   3927 C "C2'" . DA  E 3 7   ? 35.536  6.535   -27.506 1.00 62.41  ? 7   DA  C "C2'" 1 
ATOM   3928 C "C1'" . DA  E 3 7   ? 34.551  7.232   -28.432 1.00 61.85  ? 7   DA  C "C1'" 1 
ATOM   3929 N N9    . DA  E 3 7   ? 33.157  7.008   -28.027 1.00 61.14  ? 7   DA  C N9    1 
ATOM   3930 C C8    . DA  E 3 7   ? 32.586  5.808   -27.716 1.00 61.24  ? 7   DA  C C8    1 
ATOM   3931 N N7    . DA  E 3 7   ? 31.321  5.891   -27.362 1.00 59.52  ? 7   DA  C N7    1 
ATOM   3932 C C5    . DA  E 3 7   ? 31.039  7.244   -27.434 1.00 54.46  ? 7   DA  C C5    1 
ATOM   3933 C C6    . DA  E 3 7   ? 29.856  7.987   -27.174 1.00 50.74  ? 7   DA  C C6    1 
ATOM   3934 N N6    . DA  E 3 7   ? 28.698  7.428   -26.778 1.00 43.42  ? 7   DA  C N6    1 
ATOM   3935 N N1    . DA  E 3 7   ? 29.916  9.326   -27.335 1.00 49.06  ? 7   DA  C N1    1 
ATOM   3936 C C2    . DA  E 3 7   ? 31.078  9.875   -27.734 1.00 51.85  ? 7   DA  C C2    1 
ATOM   3937 N N3    . DA  E 3 7   ? 32.247  9.280   -28.014 1.00 53.21  ? 7   DA  C N3    1 
ATOM   3938 C C4    . DA  E 3 7   ? 32.160  7.954   -27.841 1.00 54.28  ? 7   DA  C C4    1 
ATOM   3939 P P     . DC  E 3 8   ? 38.678  7.388   -27.246 1.00 65.90  ? 8   DC  C P     1 
ATOM   3940 O OP1   . DC  E 3 8   ? 39.867  8.117   -27.734 1.00 65.91  ? 8   DC  C OP1   1 
ATOM   3941 O OP2   . DC  E 3 8   ? 38.761  6.112   -26.487 1.00 59.41  ? 8   DC  C OP2   1 
ATOM   3942 O "O5'" . DC  E 3 8   ? 37.940  8.466   -26.357 1.00 61.61  ? 8   DC  C "O5'" 1 
ATOM   3943 C "C5'" . DC  E 3 8   ? 37.702  9.728   -26.896 1.00 58.41  ? 8   DC  C "C5'" 1 
ATOM   3944 C "C4'" . DC  E 3 8   ? 36.820  10.530  -25.971 1.00 62.11  ? 8   DC  C "C4'" 1 
ATOM   3945 O "O4'" . DC  E 3 8   ? 35.471  9.981   -25.966 1.00 58.83  ? 8   DC  C "O4'" 1 
ATOM   3946 C "C3'" . DC  E 3 8   ? 37.273  10.559  -24.501 1.00 61.81  ? 8   DC  C "C3'" 1 
ATOM   3947 O "O3'" . DC  E 3 8   ? 37.287  11.900  -24.062 1.00 61.79  ? 8   DC  C "O3'" 1 
ATOM   3948 C "C2'" . DC  E 3 8   ? 36.177  9.759   -23.785 1.00 61.00  ? 8   DC  C "C2'" 1 
ATOM   3949 C "C1'" . DC  E 3 8   ? 34.979  10.101  -24.662 1.00 57.27  ? 8   DC  C "C1'" 1 
ATOM   3950 N N1    . DC  E 3 8   ? 33.773  9.218   -24.486 1.00 49.68  ? 8   DC  C N1    1 
ATOM   3951 C C2    . DC  E 3 8   ? 32.515  9.811   -24.333 1.00 50.23  ? 8   DC  C C2    1 
ATOM   3952 O O2    . DC  E 3 8   ? 32.431  11.045  -24.353 1.00 51.97  ? 8   DC  C O2    1 
ATOM   3953 N N3    . DC  E 3 8   ? 31.420  9.016   -24.173 1.00 49.42  ? 8   DC  C N3    1 
ATOM   3954 C C4    . DC  E 3 8   ? 31.557  7.686   -24.157 1.00 48.74  ? 8   DC  C C4    1 
ATOM   3955 N N4    . DC  E 3 8   ? 30.453  6.942   -23.985 1.00 42.52  ? 8   DC  C N4    1 
ATOM   3956 C C5    . DC  E 3 8   ? 32.838  7.062   -24.309 1.00 48.20  ? 8   DC  C C5    1 
ATOM   3957 C C6    . DC  E 3 8   ? 33.905  7.860   -24.471 1.00 49.00  ? 8   DC  C C6    1 
ATOM   3958 P P     . DC  E 3 9   ? 38.527  12.485  -23.233 1.00 60.97  ? 9   DC  C P     1 
ATOM   3959 O OP1   . DC  E 3 9   ? 39.354  13.320  -24.136 1.00 66.60  ? 9   DC  C OP1   1 
ATOM   3960 O OP2   . DC  E 3 9   ? 39.129  11.340  -22.517 1.00 61.67  ? 9   DC  C OP2   1 
ATOM   3961 O "O5'" . DC  E 3 9   ? 37.827  13.470  -22.178 1.00 63.00  ? 9   DC  C "O5'" 1 
ATOM   3962 C "C5'" . DC  E 3 9   ? 37.131  12.916  -21.048 1.00 65.22  ? 9   DC  C "C5'" 1 
ATOM   3963 C "C4'" . DC  E 3 9   ? 35.753  13.531  -20.878 1.00 52.46  ? 9   DC  C "C4'" 1 
ATOM   3964 O "O4'" . DC  E 3 9   ? 34.844  12.958  -21.862 1.00 53.04  ? 9   DC  C "O4'" 1 
ATOM   3965 C "C3'" . DC  E 3 9   ? 35.057  13.214  -19.562 1.00 51.63  ? 9   DC  C "C3'" 1 
ATOM   3966 O "O3'" . DC  E 3 9   ? 35.592  13.943  -18.403 1.00 54.46  ? 9   DC  C "O3'" 1 
ATOM   3967 C "C2'" . DC  E 3 9   ? 33.626  13.560  -19.932 1.00 52.90  ? 9   DC  C "C2'" 1 
ATOM   3968 C "C1'" . DC  E 3 9   ? 33.548  12.822  -21.272 1.00 53.78  ? 9   DC  C "C1'" 1 
ATOM   3969 N N1    . DC  E 3 9   ? 33.214  11.350  -21.110 1.00 48.16  ? 9   DC  C N1    1 
ATOM   3970 C C2    . DC  E 3 9   ? 31.884  10.965  -20.892 1.00 48.15  ? 9   DC  C C2    1 
ATOM   3971 O O2    . DC  E 3 9   ? 31.006  11.838  -20.860 1.00 46.43  ? 9   DC  C O2    1 
ATOM   3972 N N3    . DC  E 3 9   ? 31.593  9.635   -20.736 1.00 46.87  ? 9   DC  C N3    1 
ATOM   3973 C C4    . DC  E 3 9   ? 32.580  8.726   -20.770 1.00 47.41  ? 9   DC  C C4    1 
ATOM   3974 N N4    . DC  E 3 9   ? 32.258  7.439   -20.615 1.00 42.17  ? 9   DC  C N4    1 
ATOM   3975 C C5    . DC  E 3 9   ? 33.941  9.103   -20.978 1.00 50.49  ? 9   DC  C C5    1 
ATOM   3976 C C6    . DC  E 3 9   ? 34.209  10.409  -21.140 1.00 52.74  ? 9   DC  C C6    1 
ATOM   3977 P P     . DT  E 3 10  ? 35.235  15.485  -18.123 1.00 60.51  ? 10  DT  C P     1 
ATOM   3978 O OP1   . DT  E 3 10  ? 35.115  16.076  -19.467 1.00 61.87  ? 10  DT  C OP1   1 
ATOM   3979 O OP2   . DT  E 3 10  ? 36.136  16.073  -17.113 1.00 49.71  ? 10  DT  C OP2   1 
ATOM   3980 O "O5'" . DT  E 3 10  ? 33.784  15.459  -17.470 1.00 58.94  ? 10  DT  C "O5'" 1 
ATOM   3981 C "C5'" . DT  E 3 10  ? 32.955  16.630  -17.515 1.00 53.08  ? 10  DT  C "C5'" 1 
ATOM   3982 C "C4'" . DT  E 3 10  ? 31.529  16.249  -17.234 1.00 41.04  ? 10  DT  C "C4'" 1 
ATOM   3983 O "O4'" . DT  E 3 10  ? 31.270  15.005  -17.910 1.00 46.44  ? 10  DT  C "O4'" 1 
ATOM   3984 C "C3'" . DT  E 3 10  ? 31.265  15.921  -15.790 1.00 41.61  ? 10  DT  C "C3'" 1 
ATOM   3985 O "O3'" . DT  E 3 10  ? 31.034  17.117  -14.993 1.00 47.45  ? 10  DT  C "O3'" 1 
ATOM   3986 C "C2'" . DT  E 3 10  ? 30.077  14.994  -15.868 1.00 46.92  ? 10  DT  C "C2'" 1 
ATOM   3987 C "C1'" . DT  E 3 10  ? 30.305  14.271  -17.187 1.00 46.42  ? 10  DT  C "C1'" 1 
ATOM   3988 N N1    . DT  E 3 10  ? 30.732  12.807  -17.084 1.00 45.11  ? 10  DT  C N1    1 
ATOM   3989 C C2    . DT  E 3 10  ? 29.759  11.851  -16.927 1.00 42.43  ? 10  DT  C C2    1 
ATOM   3990 O O2    . DT  E 3 10  ? 28.582  12.124  -16.821 1.00 42.31  ? 10  DT  C O2    1 
ATOM   3991 N N3    . DT  E 3 10  ? 30.212  10.558  -16.895 1.00 40.88  ? 10  DT  C N3    1 
ATOM   3992 C C4    . DT  E 3 10  ? 31.520  10.132  -17.010 1.00 43.52  ? 10  DT  C C4    1 
ATOM   3993 O O4    . DT  E 3 10  ? 31.828  8.947   -16.985 1.00 43.49  ? 10  DT  C O4    1 
ATOM   3994 C C5    . DT  E 3 10  ? 32.498  11.176  -17.171 1.00 44.07  ? 10  DT  C C5    1 
ATOM   3995 C C7    . DT  E 3 10  ? 33.949  10.821  -17.295 1.00 46.11  ? 10  DT  C C7    1 
ATOM   3996 C C6    . DT  E 3 10  ? 32.065  12.454  -17.204 1.00 44.28  ? 10  DT  C C6    1 
ATOM   3997 P P     . DT  E 3 11  ? 29.675  17.977  -15.029 1.00 49.37  ? 11  DT  C P     1 
ATOM   3998 O OP1   . DT  E 3 11  ? 29.241  18.200  -16.414 1.00 57.11  ? 11  DT  C OP1   1 
ATOM   3999 O OP2   . DT  E 3 11  ? 29.912  19.167  -14.188 1.00 51.30  ? 11  DT  C OP2   1 
ATOM   4000 O "O5'" . DT  E 3 11  ? 28.574  17.039  -14.356 1.00 46.82  ? 11  DT  C "O5'" 1 
ATOM   4001 C "C5'" . DT  E 3 11  ? 27.337  16.899  -15.002 1.00 43.69  ? 11  DT  C "C5'" 1 
ATOM   4002 C "C4'" . DT  E 3 11  ? 26.588  15.659  -14.555 1.00 42.81  ? 11  DT  C "C4'" 1 
ATOM   4003 O "O4'" . DT  E 3 11  ? 27.379  14.462  -14.710 1.00 37.94  ? 11  DT  C "O4'" 1 
ATOM   4004 C "C3'" . DT  E 3 11  ? 26.059  15.661  -13.124 1.00 39.82  ? 11  DT  C "C3'" 1 
ATOM   4005 O "O3'" . DT  E 3 11  ? 24.653  15.470  -13.222 1.00 39.70  ? 11  DT  C "O3'" 1 
ATOM   4006 C "C2'" . DT  E 3 11  ? 26.782  14.460  -12.478 1.00 40.83  ? 11  DT  C "C2'" 1 
ATOM   4007 C "C1'" . DT  E 3 11  ? 27.035  13.572  -13.682 1.00 40.18  ? 11  DT  C "C1'" 1 
ATOM   4008 N N1    . DT  E 3 11  ? 28.159  12.587  -13.555 1.00 42.21  ? 11  DT  C N1    1 
ATOM   4009 C C2    . DT  E 3 11  ? 27.894  11.241  -13.698 1.00 42.23  ? 11  DT  C C2    1 
ATOM   4010 O O2    . DT  E 3 11  ? 26.777  10.803  -13.858 1.00 44.13  ? 11  DT  C O2    1 
ATOM   4011 N N3    . DT  E 3 11  ? 28.994  10.418  -13.626 1.00 41.35  ? 11  DT  C N3    1 
ATOM   4012 C C4    . DT  E 3 11  ? 30.316  10.804  -13.450 1.00 42.24  ? 11  DT  C C4    1 
ATOM   4013 O O4    . DT  E 3 11  ? 31.234  9.990   -13.404 1.00 40.50  ? 11  DT  C O4    1 
ATOM   4014 C C5    . DT  E 3 11  ? 30.530  12.237  -13.325 1.00 39.87  ? 11  DT  C C5    1 
ATOM   4015 C C7    . DT  E 3 11  ? 31.909  12.786  -13.130 1.00 31.60  ? 11  DT  C C7    1 
ATOM   4016 C C6    . DT  E 3 11  ? 29.453  13.043  -13.382 1.00 41.88  ? 11  DT  C C6    1 
ATOM   4017 P P     . DT  E 3 12  ? 23.669  15.535  -11.962 1.00 50.05  ? 12  DT  C P     1 
ATOM   4018 O OP1   . DT  E 3 12  ? 22.347  15.831  -12.539 1.00 48.73  ? 12  DT  C OP1   1 
ATOM   4019 O OP2   . DT  E 3 12  ? 24.233  16.401  -10.900 1.00 48.58  ? 12  DT  C OP2   1 
ATOM   4020 O "O5'" . DT  E 3 12  ? 23.590  14.014  -11.500 1.00 49.30  ? 12  DT  C "O5'" 1 
ATOM   4021 C "C5'" . DT  E 3 12  ? 23.671  13.004  -12.495 1.00 46.12  ? 12  DT  C "C5'" 1 
ATOM   4022 C "C4'" . DT  E 3 12  ? 23.109  11.696  -11.996 1.00 46.67  ? 12  DT  C "C4'" 1 
ATOM   4023 O "O4'" . DT  E 3 12  ? 24.175  10.723  -11.834 1.00 40.72  ? 12  DT  C "O4'" 1 
ATOM   4024 C "C3'" . DT  E 3 12  ? 22.408  11.764  -10.663 1.00 44.01  ? 12  DT  C "C3'" 1 
ATOM   4025 O "O3'" . DT  E 3 12  ? 21.368  10.754  -10.648 1.00 48.07  ? 12  DT  C "O3'" 1 
ATOM   4026 C "C2'" . DT  E 3 12  ? 23.562  11.488  -9.681  1.00 39.00  ? 12  DT  C "C2'" 1 
ATOM   4027 C "C1'" . DT  E 3 12  ? 24.455  10.521  -10.472 1.00 39.74  ? 12  DT  C "C1'" 1 
ATOM   4028 N N1    . DT  E 3 12  ? 25.965  10.694  -10.278 1.00 39.85  ? 12  DT  C N1    1 
ATOM   4029 C C2    . DT  E 3 12  ? 26.788  9.595   -10.418 1.00 38.82  ? 12  DT  C C2    1 
ATOM   4030 O O2    . DT  E 3 12  ? 26.374  8.484   -10.670 1.00 42.51  ? 12  DT  C O2    1 
ATOM   4031 N N3    . DT  E 3 12  ? 28.120  9.839   -10.252 1.00 36.94  ? 12  DT  C N3    1 
ATOM   4032 C C4    . DT  E 3 12  ? 28.717  11.046  -9.983  1.00 37.82  ? 12  DT  C C4    1 
ATOM   4033 O O4    . DT  E 3 12  ? 29.932  11.160  -9.852  1.00 41.48  ? 12  DT  C O4    1 
ATOM   4034 C C5    . DT  E 3 12  ? 27.816  12.160  -9.849  1.00 37.59  ? 12  DT  C C5    1 
ATOM   4035 C C7    . DT  E 3 12  ? 28.358  13.520  -9.540  1.00 35.61  ? 12  DT  C C7    1 
ATOM   4036 C C6    . DT  E 3 12  ? 26.493  11.937  -10.006 1.00 41.46  ? 12  DT  C C6    1 
ATOM   4037 P P     . DG  E 3 13  ? 20.264  10.683  -9.480  1.00 48.68  ? 13  DG  C P     1 
ATOM   4038 O OP1   . DG  E 3 13  ? 19.116  9.881   -9.970  1.00 36.80  ? 13  DG  C OP1   1 
ATOM   4039 O OP2   . DG  E 3 13  ? 20.116  12.017  -8.858  1.00 45.00  ? 13  DG  C OP2   1 
ATOM   4040 O "O5'" . DG  E 3 13  ? 20.955  9.744   -8.401  1.00 44.30  ? 13  DG  C "O5'" 1 
ATOM   4041 C "C5'" . DG  E 3 13  ? 21.257  8.392   -8.730  1.00 35.49  ? 13  DG  C "C5'" 1 
ATOM   4042 C "C4'" . DG  E 3 13  ? 21.852  7.717   -7.543  1.00 36.65  ? 13  DG  C "C4'" 1 
ATOM   4043 O "O4'" . DG  E 3 13  ? 23.290  7.953   -7.537  1.00 40.77  ? 13  DG  C "O4'" 1 
ATOM   4044 C "C3'" . DG  E 3 13  ? 21.343  8.274   -6.207  1.00 35.81  ? 13  DG  C "C3'" 1 
ATOM   4045 O "O3'" . DG  E 3 13  ? 21.361  7.260   -5.240  1.00 35.01  ? 13  DG  C "O3'" 1 
ATOM   4046 C "C2'" . DG  E 3 13  ? 22.393  9.323   -5.889  1.00 36.49  ? 13  DG  C "C2'" 1 
ATOM   4047 C "C1'" . DG  E 3 13  ? 23.631  8.559   -6.307  1.00 35.20  ? 13  DG  C "C1'" 1 
ATOM   4048 N N9    . DG  E 3 13  ? 24.803  9.403   -6.452  1.00 35.87  ? 13  DG  C N9    1 
ATOM   4049 C C8    . DG  E 3 13  ? 24.842  10.769  -6.340  1.00 37.80  ? 13  DG  C C8    1 
ATOM   4050 N N7    . DG  E 3 13  ? 26.047  11.263  -6.468  1.00 39.69  ? 13  DG  C N7    1 
ATOM   4051 C C5    . DG  E 3 13  ? 26.852  10.154  -6.672  1.00 34.02  ? 13  DG  C C5    1 
ATOM   4052 C C6    . DG  E 3 13  ? 28.236  10.074  -6.879  1.00 37.13  ? 13  DG  C C6    1 
ATOM   4053 O O6    . DG  E 3 13  ? 29.063  11.000  -6.924  1.00 42.18  ? 13  DG  C O6    1 
ATOM   4054 N N1    . DG  E 3 13  ? 28.655  8.761   -7.034  1.00 38.31  ? 13  DG  C N1    1 
ATOM   4055 C C2    . DG  E 3 13  ? 27.841  7.670   -6.990  1.00 36.72  ? 13  DG  C C2    1 
ATOM   4056 N N2    . DG  E 3 13  ? 28.434  6.480   -7.163  1.00 36.63  ? 13  DG  C N2    1 
ATOM   4057 N N3    . DG  E 3 13  ? 26.537  7.732   -6.797  1.00 37.44  ? 13  DG  C N3    1 
ATOM   4058 C C4    . DG  E 3 13  ? 26.111  9.001   -6.648  1.00 35.79  ? 13  DG  C C4    1 
ATOM   4059 P P     . DA  E 3 14  ? 20.078  6.964   -4.334  1.00 43.57  ? 14  DA  C P     1 
ATOM   4060 O OP1   . DA  E 3 14  ? 18.862  6.819   -5.185  1.00 36.34  ? 14  DA  C OP1   1 
ATOM   4061 O OP2   . DA  E 3 14  ? 20.060  7.939   -3.198  1.00 38.21  ? 14  DA  C OP2   1 
ATOM   4062 O "O5'" . DA  E 3 14  ? 20.433  5.529   -3.762  1.00 43.02  ? 14  DA  C "O5'" 1 
ATOM   4063 C "C5'" . DA  E 3 14  ? 20.755  4.473   -4.630  1.00 40.35  ? 14  DA  C "C5'" 1 
ATOM   4064 C "C4'" . DA  E 3 14  ? 21.858  3.619   -4.043  1.00 40.58  ? 14  DA  C "C4'" 1 
ATOM   4065 O "O4'" . DA  E 3 14  ? 23.126  4.287   -4.237  1.00 40.82  ? 14  DA  C "O4'" 1 
ATOM   4066 C "C3'" . DA  E 3 14  ? 21.757  3.340   -2.547  1.00 43.82  ? 14  DA  C "C3'" 1 
ATOM   4067 O "O3'" . DA  E 3 14  ? 22.262  2.030   -2.269  1.00 45.99  ? 14  DA  C "O3'" 1 
ATOM   4068 C "C2'" . DA  E 3 14  ? 22.643  4.430   -1.939  1.00 40.08  ? 14  DA  C "C2'" 1 
ATOM   4069 C "C1'" . DA  E 3 14  ? 23.735  4.551   -2.992  1.00 37.92  ? 14  DA  C "C1'" 1 
ATOM   4070 N N9    . DA  E 3 14  ? 24.342  5.873   -3.063  1.00 35.54  ? 14  DA  C N9    1 
ATOM   4071 C C8    . DA  E 3 14  ? 23.713  7.085   -2.974  1.00 35.32  ? 14  DA  C C8    1 
ATOM   4072 N N7    . DA  E 3 14  ? 24.523  8.109   -3.089  1.00 32.12  ? 14  DA  C N7    1 
ATOM   4073 C C5    . DA  E 3 14  ? 25.761  7.522   -3.278  1.00 32.25  ? 14  DA  C C5    1 
ATOM   4074 C C6    . DA  E 3 14  ? 27.053  8.062   -3.458  1.00 36.98  ? 14  DA  C C6    1 
ATOM   4075 N N6    . DA  E 3 14  ? 27.307  9.375   -3.482  1.00 37.01  ? 14  DA  C N6    1 
ATOM   4076 N N1    . DA  E 3 14  ? 28.083  7.197   -3.604  1.00 37.96  ? 14  DA  C N1    1 
ATOM   4077 C C2    . DA  E 3 14  ? 27.825  5.882   -3.578  1.00 38.76  ? 14  DA  C C2    1 
ATOM   4078 N N3    . DA  E 3 14  ? 26.654  5.261   -3.414  1.00 36.69  ? 14  DA  C N3    1 
ATOM   4079 C C4    . DA  E 3 14  ? 25.659  6.148   -3.264  1.00 32.42  ? 14  DA  C C4    1 
ATOM   4080 P P     . DA  E 3 15  ? 22.376  1.477   -0.758  1.00 54.98  ? 15  DA  C P     1 
ATOM   4081 O OP1   . DA  E 3 15  ? 22.098  0.026   -0.914  1.00 49.29  ? 15  DA  C OP1   1 
ATOM   4082 O OP2   . DA  E 3 15  ? 21.620  2.298   0.216   1.00 44.54  ? 15  DA  C OP2   1 
ATOM   4083 O "O5'" . DA  E 3 15  ? 23.910  1.708   -0.378  1.00 43.60  ? 15  DA  C "O5'" 1 
ATOM   4084 C "C5'" . DA  E 3 15  ? 24.921  1.098   -1.147  1.00 40.97  ? 15  DA  C "C5'" 1 
ATOM   4085 C "C4'" . DA  E 3 15  ? 26.289  1.536   -0.679  1.00 38.40  ? 15  DA  C "C4'" 1 
ATOM   4086 O "O4'" . DA  E 3 15  ? 26.465  2.946   -0.939  1.00 34.84  ? 15  DA  C "O4'" 1 
ATOM   4087 C "C3'" . DA  E 3 15  ? 26.567  1.341   0.813   1.00 39.85  ? 15  DA  C "C3'" 1 
ATOM   4088 O "O3'" . DA  E 3 15  ? 27.872  0.779   0.962   1.00 47.06  ? 15  DA  C "O3'" 1 
ATOM   4089 C "C2'" . DA  E 3 15  ? 26.499  2.765   1.363   1.00 37.51  ? 15  DA  C "C2'" 1 
ATOM   4090 C "C1'" . DA  E 3 15  ? 27.040  3.549   0.192   1.00 34.78  ? 15  DA  C "C1'" 1 
ATOM   4091 N N9    . DA  E 3 15  ? 26.672  4.960   0.202   1.00 35.83  ? 15  DA  C N9    1 
ATOM   4092 C C8    . DA  E 3 15  ? 25.414  5.485   0.346   1.00 37.58  ? 15  DA  C C8    1 
ATOM   4093 N N7    . DA  E 3 15  ? 25.379  6.801   0.292   1.00 37.75  ? 15  DA  C N7    1 
ATOM   4094 C C5    . DA  E 3 15  ? 26.710  7.159   0.097   1.00 36.34  ? 15  DA  C C5    1 
ATOM   4095 C C6    . DA  E 3 15  ? 27.352  8.411   -0.035  1.00 35.62  ? 15  DA  C C6    1 
ATOM   4096 N N6    . DA  E 3 15  ? 26.707  9.580   0.006   1.00 36.16  ? 15  DA  C N6    1 
ATOM   4097 N N1    . DA  E 3 15  ? 28.681  8.412   -0.224  1.00 35.14  ? 15  DA  C N1    1 
ATOM   4098 C C2    . DA  E 3 15  ? 29.318  7.243   -0.276  1.00 37.27  ? 15  DA  C C2    1 
ATOM   4099 N N3    . DA  E 3 15  ? 28.829  6.012   -0.157  1.00 34.62  ? 15  DA  C N3    1 
ATOM   4100 C C4    . DA  E 3 15  ? 27.512  6.038   0.035   1.00 32.69  ? 15  DA  C C4    1 
ATOM   4101 P P     . DG  E 3 16  ? 28.495  0.428   2.406   1.00 54.60  ? 16  DG  C P     1 
ATOM   4102 O OP1   . DG  E 3 16  ? 29.200  -0.867  2.234   1.00 51.99  ? 16  DG  C OP1   1 
ATOM   4103 O OP2   . DG  E 3 16  ? 27.455  0.588   3.457   1.00 48.95  ? 16  DG  C OP2   1 
ATOM   4104 O "O5'" . DG  E 3 16  ? 29.620  1.549   2.620   1.00 48.29  ? 16  DG  C "O5'" 1 
ATOM   4105 C "C5'" . DG  E 3 16  ? 30.682  1.678   1.669   1.00 46.30  ? 16  DG  C "C5'" 1 
ATOM   4106 C "C4'" . DG  E 3 16  ? 31.703  2.705   2.123   1.00 45.67  ? 16  DG  C "C4'" 1 
ATOM   4107 O "O4'" . DG  E 3 16  ? 31.206  4.039   1.845   1.00 42.84  ? 16  DG  C "O4'" 1 
ATOM   4108 C "C3'" . DG  E 3 16  ? 32.039  2.666   3.619   1.00 46.58  ? 16  DG  C "C3'" 1 
ATOM   4109 O "O3'" . DG  E 3 16  ? 33.450  2.716   3.805   1.00 52.54  ? 16  DG  C "O3'" 1 
ATOM   4110 C "C2'" . DG  E 3 16  ? 31.358  3.910   4.170   1.00 45.79  ? 16  DG  C "C2'" 1 
ATOM   4111 C "C1'" . DG  E 3 16  ? 31.397  4.856   2.978   1.00 44.20  ? 16  DG  C "C1'" 1 
ATOM   4112 N N9    . DG  E 3 16  ? 30.342  5.881   3.024   1.00 36.17  ? 16  DG  C N9    1 
ATOM   4113 C C8    . DG  E 3 16  ? 28.998  5.660   3.129   1.00 38.22  ? 16  DG  C C8    1 
ATOM   4114 N N7    . DG  E 3 16  ? 28.291  6.756   3.155   1.00 39.39  ? 16  DG  C N7    1 
ATOM   4115 C C5    . DG  E 3 16  ? 29.229  7.769   3.092   1.00 36.29  ? 16  DG  C C5    1 
ATOM   4116 C C6    . DG  E 3 16  ? 29.049  9.170   3.088   1.00 40.25  ? 16  DG  C C6    1 
ATOM   4117 O O6    . DG  E 3 16  ? 27.986  9.811   3.135   1.00 42.07  ? 16  DG  C O6    1 
ATOM   4118 N N1    . DG  E 3 16  ? 30.265  9.843   3.015   1.00 41.39  ? 16  DG  C N1    1 
ATOM   4119 C C2    . DG  E 3 16  ? 31.488  9.237   2.930   1.00 39.62  ? 16  DG  C C2    1 
ATOM   4120 N N2    . DG  E 3 16  ? 32.543  10.052  2.852   1.00 41.72  ? 16  DG  C N2    1 
ATOM   4121 N N3    . DG  E 3 16  ? 31.666  7.925   2.907   1.00 40.34  ? 16  DG  C N3    1 
ATOM   4122 C C4    . DG  E 3 16  ? 30.497  7.254   3.004   1.00 34.74  ? 16  DG  C C4    1 
ATOM   4123 P P     . DT  E 3 17  ? 34.131  2.226   5.181   1.00 57.58  ? 17  DT  C P     1 
ATOM   4124 O OP1   . DT  E 3 17  ? 35.276  1.403   4.753   1.00 50.81  ? 17  DT  C OP1   1 
ATOM   4125 O OP2   . DT  E 3 17  ? 33.123  1.648   6.099   1.00 53.48  ? 17  DT  C OP2   1 
ATOM   4126 O "O5'" . DT  E 3 17  ? 34.672  3.592   5.797   1.00 49.13  ? 17  DT  C "O5'" 1 
ATOM   4127 C "C5'" . DT  E 3 17  ? 35.012  4.632   4.905   1.00 48.27  ? 17  DT  C "C5'" 1 
ATOM   4128 C "C4'" . DT  E 3 17  ? 35.335  5.907   5.647   1.00 51.55  ? 17  DT  C "C4'" 1 
ATOM   4129 O "O4'" . DT  E 3 17  ? 34.275  6.873   5.421   1.00 48.14  ? 17  DT  C "O4'" 1 
ATOM   4130 C "C3'" . DT  E 3 17  ? 35.460  5.756   7.157   1.00 46.16  ? 17  DT  C "C3'" 1 
ATOM   4131 O "O3'" . DT  E 3 17  ? 36.483  6.594   7.627   1.00 51.90  ? 17  DT  C "O3'" 1 
ATOM   4132 C "C2'" . DT  E 3 17  ? 34.105  6.230   7.642   1.00 49.66  ? 17  DT  C "C2'" 1 
ATOM   4133 C "C1'" . DT  E 3 17  ? 33.828  7.349   6.655   1.00 47.05  ? 17  DT  C "C1'" 1 
ATOM   4134 N N1    . DT  E 3 17  ? 32.363  7.735   6.562   1.00 43.82  ? 17  DT  C N1    1 
ATOM   4135 C C2    . DT  E 3 17  ? 32.042  9.069   6.475   1.00 44.98  ? 17  DT  C C2    1 
ATOM   4136 O O2    . DT  E 3 17  ? 32.890  9.950   6.425   1.00 51.18  ? 17  DT  C O2    1 
ATOM   4137 N N3    . DT  E 3 17  ? 30.696  9.342   6.449   1.00 41.27  ? 17  DT  C N3    1 
ATOM   4138 C C4    . DT  E 3 17  ? 29.654  8.429   6.499   1.00 41.61  ? 17  DT  C C4    1 
ATOM   4139 O O4    . DT  E 3 17  ? 28.468  8.774   6.451   1.00 39.49  ? 17  DT  C O4    1 
ATOM   4140 C C5    . DT  E 3 17  ? 30.056  7.043   6.604   1.00 37.47  ? 17  DT  C C5    1 
ATOM   4141 C C7    . DT  E 3 17  ? 29.012  5.964   6.673   1.00 31.12  ? 17  DT  C C7    1 
ATOM   4142 C C6    . DT  E 3 17  ? 31.380  6.765   6.639   1.00 37.00  ? 17  DT  C C6    1 
ATOM   4143 P P     . DG  E 3 18  ? 37.150  6.355   9.076   1.00 67.88  ? 18  DG  C P     1 
ATOM   4144 O OP1   . DG  E 3 18  ? 38.604  6.219   8.810   1.00 66.88  ? 18  DG  C OP1   1 
ATOM   4145 O OP2   . DG  E 3 18  ? 36.449  5.274   9.809   1.00 62.00  ? 18  DG  C OP2   1 
ATOM   4146 O "O5'" . DG  E 3 18  ? 36.887  7.739   9.838   1.00 47.12  ? 18  DG  C "O5'" 1 
ATOM   4147 C "C5'" . DG  E 3 18  ? 37.267  8.932   9.206   1.00 47.80  ? 18  DG  C "C5'" 1 
ATOM   4148 C "C4'" . DG  E 3 18  ? 36.419  10.101  9.660   1.00 53.91  ? 18  DG  C "C4'" 1 
ATOM   4149 O "O4'" . DG  E 3 18  ? 35.044  9.954   9.220   1.00 58.95  ? 18  DG  C "O4'" 1 
ATOM   4150 C "C3'" . DG  E 3 18  ? 36.363  10.343  11.169  1.00 50.21  ? 18  DG  C "C3'" 1 
ATOM   4151 O "O3'" . DG  E 3 18  ? 36.901  11.639  11.414  1.00 59.37  ? 18  DG  C "O3'" 1 
ATOM   4152 C "C2'" . DG  E 3 18  ? 34.859  10.268  11.493  1.00 50.18  ? 18  DG  C "C2'" 1 
ATOM   4153 C "C1'" . DG  E 3 18  ? 34.245  10.627  10.148  1.00 52.01  ? 18  DG  C "C1'" 1 
ATOM   4154 N N9    . DG  E 3 18  ? 32.839  10.226  9.974   1.00 49.43  ? 18  DG  C N9    1 
ATOM   4155 C C8    . DG  E 3 18  ? 32.317  8.951   9.977   1.00 43.31  ? 18  DG  C C8    1 
ATOM   4156 N N7    . DG  E 3 18  ? 31.022  8.920   9.806   1.00 39.51  ? 18  DG  C N7    1 
ATOM   4157 C C5    . DG  E 3 18  ? 30.662  10.260  9.670   1.00 42.32  ? 18  DG  C C5    1 
ATOM   4158 C C6    . DG  E 3 18  ? 29.389  10.857  9.450   1.00 44.60  ? 18  DG  C C6    1 
ATOM   4159 O O6    . DG  E 3 18  ? 28.280  10.301  9.326   1.00 42.85  ? 18  DG  C O6    1 
ATOM   4160 N N1    . DG  E 3 18  ? 29.478  12.244  9.383   1.00 43.37  ? 18  DG  C N1    1 
ATOM   4161 C C2    . DG  E 3 18  ? 30.643  12.965  9.503   1.00 46.93  ? 18  DG  C C2    1 
ATOM   4162 N N2    . DG  E 3 18  ? 30.534  14.299  9.393   1.00 47.46  ? 18  DG  C N2    1 
ATOM   4163 N N3    . DG  E 3 18  ? 31.836  12.422  9.694   1.00 47.98  ? 18  DG  C N3    1 
ATOM   4164 C C4    . DG  E 3 18  ? 31.769  11.071  9.773   1.00 46.49  ? 18  DG  C C4    1 
ATOM   4165 P P     . DG  E 3 19  ? 36.841  12.323  12.866  1.00 67.61  ? 19  DG  C P     1 
ATOM   4166 O OP1   . DG  E 3 19  ? 38.013  13.233  12.972  1.00 63.71  ? 19  DG  C OP1   1 
ATOM   4167 O OP2   . DG  E 3 19  ? 36.594  11.225  13.836  1.00 57.43  ? 19  DG  C OP2   1 
ATOM   4168 O "O5'" . DG  E 3 19  ? 35.535  13.253  12.818  1.00 61.81  ? 19  DG  C "O5'" 1 
ATOM   4169 C "C5'" . DG  E 3 19  ? 35.518  14.473  12.046  1.00 53.06  ? 19  DG  C "C5'" 1 
ATOM   4170 C "C4'" . DG  E 3 19  ? 34.315  15.329  12.438  1.00 54.78  ? 19  DG  C "C4'" 1 
ATOM   4171 O "O4'" . DG  E 3 19  ? 33.069  14.667  12.045  1.00 56.53  ? 19  DG  C "O4'" 1 
ATOM   4172 C "C3'" . DG  E 3 19  ? 34.177  15.587  13.941  1.00 52.85  ? 19  DG  C "C3'" 1 
ATOM   4173 O "O3'" . DG  E 3 19  ? 33.657  16.885  14.158  1.00 56.93  ? 19  DG  C "O3'" 1 
ATOM   4174 C "C2'" . DG  E 3 19  ? 33.182  14.519  14.374  1.00 47.52  ? 19  DG  C "C2'" 1 
ATOM   4175 C "C1'" . DG  E 3 19  ? 32.234  14.534  13.189  1.00 52.65  ? 19  DG  C "C1'" 1 
ATOM   4176 N N9    . DG  E 3 19  ? 31.423  13.315  13.084  1.00 53.38  ? 19  DG  C N9    1 
ATOM   4177 C C8    . DG  E 3 19  ? 31.868  12.015  13.207  1.00 53.06  ? 19  DG  C C8    1 
ATOM   4178 N N7    . DG  E 3 19  ? 30.913  11.121  13.082  1.00 52.15  ? 19  DG  C N7    1 
ATOM   4179 C C5    . DG  E 3 19  ? 29.755  11.874  12.874  1.00 47.95  ? 19  DG  C C5    1 
ATOM   4180 C C6    . DG  E 3 19  ? 28.409  11.452  12.677  1.00 47.87  ? 19  DG  C C6    1 
ATOM   4181 O O6    . DG  E 3 19  ? 27.950  10.286  12.643  1.00 44.80  ? 19  DG  C O6    1 
ATOM   4182 N N1    . DG  E 3 19  ? 27.558  12.537  12.508  1.00 46.00  ? 19  DG  C N1    1 
ATOM   4183 C C2    . DG  E 3 19  ? 27.951  13.855  12.531  1.00 48.11  ? 19  DG  C C2    1 
ATOM   4184 N N2    . DG  E 3 19  ? 26.976  14.757  12.349  1.00 50.31  ? 19  DG  C N2    1 
ATOM   4185 N N3    . DG  E 3 19  ? 29.204  14.266  12.718  1.00 44.06  ? 19  DG  C N3    1 
ATOM   4186 C C4    . DG  E 3 19  ? 30.048  13.228  12.880  1.00 46.92  ? 19  DG  C C4    1 
ATOM   4187 O "O5'" . DC  F 4 1   ? 19.320  12.499  10.746  1.00 59.35  ? 1   DC  D "O5'" 1 
ATOM   4188 C "C5'" . DC  F 4 1   ? 18.708  13.702  11.204  1.00 53.88  ? 1   DC  D "C5'" 1 
ATOM   4189 C "C4'" . DC  F 4 1   ? 19.761  14.731  11.568  1.00 51.35  ? 1   DC  D "C4'" 1 
ATOM   4190 O "O4'" . DC  F 4 1   ? 20.611  14.188  12.607  1.00 53.31  ? 1   DC  D "O4'" 1 
ATOM   4191 C "C3'" . DC  F 4 1   ? 20.696  15.124  10.441  1.00 49.72  ? 1   DC  D "C3'" 1 
ATOM   4192 O "O3'" . DC  F 4 1   ? 20.164  16.255  9.753   1.00 50.68  ? 1   DC  D "O3'" 1 
ATOM   4193 C "C2'" . DC  F 4 1   ? 21.981  15.484  11.191  1.00 51.25  ? 1   DC  D "C2'" 1 
ATOM   4194 C "C1'" . DC  F 4 1   ? 21.960  14.535  12.392  1.00 47.28  ? 1   DC  D "C1'" 1 
ATOM   4195 N N1    . DC  F 4 1   ? 22.740  13.270  12.194  1.00 43.89  ? 1   DC  D N1    1 
ATOM   4196 C C2    . DC  F 4 1   ? 24.147  13.281  12.283  1.00 47.51  ? 1   DC  D C2    1 
ATOM   4197 O O2    . DC  F 4 1   ? 24.733  14.348  12.528  1.00 45.60  ? 1   DC  D O2    1 
ATOM   4198 N N3    . DC  F 4 1   ? 24.830  12.110  12.088  1.00 47.01  ? 1   DC  D N3    1 
ATOM   4199 C C4    . DC  F 4 1   ? 24.156  10.978  11.823  1.00 47.04  ? 1   DC  D C4    1 
ATOM   4200 N N4    . DC  F 4 1   ? 24.855  9.851   11.642  1.00 45.82  ? 1   DC  D N4    1 
ATOM   4201 C C5    . DC  F 4 1   ? 22.733  10.957  11.739  1.00 45.46  ? 1   DC  D C5    1 
ATOM   4202 C C6    . DC  F 4 1   ? 22.075  12.110  11.928  1.00 45.59  ? 1   DC  D C6    1 
ATOM   4203 P P     . DC  F 4 2   ? 20.652  16.603  8.264   1.00 57.14  ? 2   DC  D P     1 
ATOM   4204 O OP1   . DC  F 4 2   ? 19.852  17.740  7.752   1.00 46.46  ? 2   DC  D OP1   1 
ATOM   4205 O OP2   . DC  F 4 2   ? 20.691  15.336  7.513   1.00 54.22  ? 2   DC  D OP2   1 
ATOM   4206 O "O5'" . DC  F 4 2   ? 22.188  17.007  8.443   1.00 48.08  ? 2   DC  D "O5'" 1 
ATOM   4207 C "C5'" . DC  F 4 2   ? 22.553  18.300  8.881   1.00 47.37  ? 2   DC  D "C5'" 1 
ATOM   4208 C "C4'" . DC  F 4 2   ? 24.064  18.392  8.964   1.00 52.26  ? 2   DC  D "C4'" 1 
ATOM   4209 O "O4'" . DC  F 4 2   ? 24.548  17.213  9.623   1.00 53.54  ? 2   DC  D "O4'" 1 
ATOM   4210 C "C3'" . DC  F 4 2   ? 24.762  18.429  7.618   1.00 52.19  ? 2   DC  D "C3'" 1 
ATOM   4211 O "O3'" . DC  F 4 2   ? 25.120  19.759  7.305   1.00 52.91  ? 2   DC  D "O3'" 1 
ATOM   4212 C "C2'" . DC  F 4 2   ? 26.005  17.558  7.792   1.00 50.92  ? 2   DC  D "C2'" 1 
ATOM   4213 C "C1'" . DC  F 4 2   ? 25.780  16.808  9.096   1.00 49.07  ? 2   DC  D "C1'" 1 
ATOM   4214 N N1    . DC  F 4 2   ? 25.731  15.340  8.941   1.00 44.45  ? 2   DC  D N1    1 
ATOM   4215 C C2    . DC  F 4 2   ? 26.912  14.601  8.949   1.00 45.31  ? 2   DC  D C2    1 
ATOM   4216 O O2    . DC  F 4 2   ? 27.990  15.198  9.065   1.00 44.88  ? 2   DC  D O2    1 
ATOM   4217 N N3    . DC  F 4 2   ? 26.842  13.252  8.817   1.00 44.10  ? 2   DC  D N3    1 
ATOM   4218 C C4    . DC  F 4 2   ? 25.652  12.660  8.697   1.00 42.88  ? 2   DC  D C4    1 
ATOM   4219 N N4    . DC  F 4 2   ? 25.617  11.333  8.576   1.00 42.00  ? 2   DC  D N4    1 
ATOM   4220 C C5    . DC  F 4 2   ? 24.447  13.403  8.689   1.00 42.57  ? 2   DC  D C5    1 
ATOM   4221 C C6    . DC  F 4 2   ? 24.531  14.727  8.810   1.00 42.85  ? 2   DC  D C6    1 
ATOM   4222 P P     . DA  F 4 3   ? 25.584  20.126  5.818   1.00 57.50  ? 3   DA  D P     1 
ATOM   4223 O OP1   . DA  F 4 3   ? 25.446  21.594  5.682   1.00 60.63  ? 3   DA  D OP1   1 
ATOM   4224 O OP2   . DA  F 4 3   ? 24.884  19.241  4.859   1.00 52.89  ? 3   DA  D OP2   1 
ATOM   4225 O "O5'" . DA  F 4 3   ? 27.127  19.701  5.787   1.00 59.12  ? 3   DA  D "O5'" 1 
ATOM   4226 C "C5'" . DA  F 4 3   ? 28.038  20.146  6.795   1.00 50.67  ? 3   DA  D "C5'" 1 
ATOM   4227 C "C4'" . DA  F 4 3   ? 29.362  19.432  6.623   1.00 52.90  ? 3   DA  D "C4'" 1 
ATOM   4228 O "O4'" . DA  F 4 3   ? 29.279  18.114  7.210   1.00 49.60  ? 3   DA  D "O4'" 1 
ATOM   4229 C "C3'" . DA  F 4 3   ? 29.735  19.178  5.181   1.00 55.84  ? 3   DA  D "C3'" 1 
ATOM   4230 O "O3'" . DA  F 4 3   ? 30.416  20.308  4.646   1.00 59.59  ? 3   DA  D "O3'" 1 
ATOM   4231 C "C2'" . DA  F 4 3   ? 30.644  17.953  5.280   1.00 51.74  ? 3   DA  D "C2'" 1 
ATOM   4232 C "C1'" . DA  F 4 3   ? 30.072  17.200  6.470   1.00 48.79  ? 3   DA  D "C1'" 1 
ATOM   4233 N N9    . DA  F 4 3   ? 29.239  16.050  6.130   1.00 49.37  ? 3   DA  D N9    1 
ATOM   4234 C C8    . DA  F 4 3   ? 27.925  16.067  5.767   1.00 49.14  ? 3   DA  D C8    1 
ATOM   4235 N N7    . DA  F 4 3   ? 27.411  14.877  5.574   1.00 46.36  ? 3   DA  D N7    1 
ATOM   4236 C C5    . DA  F 4 3   ? 28.461  14.017  5.817   1.00 45.92  ? 3   DA  D C5    1 
ATOM   4237 C C6    . DA  F 4 3   ? 28.568  12.611  5.774   1.00 44.64  ? 3   DA  D C6    1 
ATOM   4238 N N6    . DA  F 4 3   ? 27.554  11.803  5.459   1.00 43.31  ? 3   DA  D N6    1 
ATOM   4239 N N1    . DA  F 4 3   ? 29.757  12.066  6.073   1.00 43.88  ? 3   DA  D N1    1 
ATOM   4240 C C2    . DA  F 4 3   ? 30.771  12.876  6.397   1.00 47.85  ? 3   DA  D C2    1 
ATOM   4241 N N3    . DA  F 4 3   ? 30.792  14.209  6.479   1.00 51.97  ? 3   DA  D N3    1 
ATOM   4242 C C4    . DA  F 4 3   ? 29.595  14.722  6.168   1.00 49.14  ? 3   DA  D C4    1 
ATOM   4243 P P     . DC  F 4 4   ? 31.131  20.208  3.209   1.00 74.06  ? 4   DC  D P     1 
ATOM   4244 O OP1   . DC  F 4 4   ? 31.518  21.563  2.744   1.00 66.52  ? 4   DC  D OP1   1 
ATOM   4245 O OP2   . DC  F 4 4   ? 30.210  19.442  2.324   1.00 60.15  ? 4   DC  D OP2   1 
ATOM   4246 O "O5'" . DC  F 4 4   ? 32.483  19.402  3.541   1.00 60.09  ? 4   DC  D "O5'" 1 
ATOM   4247 C "C5'" . DC  F 4 4   ? 33.254  18.866  2.495   1.00 59.63  ? 4   DC  D "C5'" 1 
ATOM   4248 C "C4'" . DC  F 4 4   ? 33.379  17.355  2.604   1.00 56.35  ? 4   DC  D "C4'" 1 
ATOM   4249 O "O4'" . DC  F 4 4   ? 32.135  16.753  3.024   1.00 56.53  ? 4   DC  D "O4'" 1 
ATOM   4250 C "C3'" . DC  F 4 4   ? 33.638  16.663  1.286   1.00 57.57  ? 4   DC  D "C3'" 1 
ATOM   4251 O "O3'" . DC  F 4 4   ? 35.001  16.648  0.960   1.00 57.20  ? 4   DC  D "O3'" 1 
ATOM   4252 C "C2'" . DC  F 4 4   ? 33.114  15.242  1.514   1.00 55.59  ? 4   DC  D "C2'" 1 
ATOM   4253 C "C1'" . DC  F 4 4   ? 32.278  15.367  2.780   1.00 56.14  ? 4   DC  D "C1'" 1 
ATOM   4254 N N1    . DC  F 4 4   ? 30.952  14.655  2.658   1.00 51.65  ? 4   DC  D N1    1 
ATOM   4255 C C2    . DC  F 4 4   ? 30.933  13.256  2.799   1.00 49.77  ? 4   DC  D C2    1 
ATOM   4256 O O2    . DC  F 4 4   ? 31.993  12.660  3.041   1.00 51.46  ? 4   DC  D O2    1 
ATOM   4257 N N3    . DC  F 4 4   ? 29.763  12.593  2.682   1.00 44.49  ? 4   DC  D N3    1 
ATOM   4258 C C4    . DC  F 4 4   ? 28.652  13.252  2.418   1.00 45.15  ? 4   DC  D C4    1 
ATOM   4259 N N4    . DC  F 4 4   ? 27.528  12.537  2.307   1.00 42.81  ? 4   DC  D N4    1 
ATOM   4260 C C5    . DC  F 4 4   ? 28.639  14.678  2.259   1.00 48.67  ? 4   DC  D C5    1 
ATOM   4261 C C6    . DC  F 4 4   ? 29.808  15.333  2.378   1.00 50.41  ? 4   DC  D C6    1 
ATOM   4262 P P     . DT  F 4 5   ? 35.394  16.204  -0.531  1.00 65.38  ? 5   DT  D P     1 
ATOM   4263 O OP1   . DT  F 4 5   ? 36.761  16.664  -0.869  1.00 64.28  ? 5   DT  D OP1   1 
ATOM   4264 O OP2   . DT  F 4 5   ? 34.239  16.590  -1.377  1.00 54.02  ? 5   DT  D OP2   1 
ATOM   4265 O "O5'" . DT  F 4 5   ? 35.387  14.618  -0.452  1.00 55.49  ? 5   DT  D "O5'" 1 
ATOM   4266 C "C5'" . DT  F 4 5   ? 36.101  13.981  0.568   1.00 52.85  ? 5   DT  D "C5'" 1 
ATOM   4267 C "C4'" . DT  F 4 5   ? 35.817  12.501  0.553   1.00 54.17  ? 5   DT  D "C4'" 1 
ATOM   4268 O "O4'" . DT  F 4 5   ? 34.394  12.283  0.647   1.00 54.29  ? 5   DT  D "O4'" 1 
ATOM   4269 C "C3'" . DT  F 4 5   ? 36.270  11.772  -0.711  1.00 51.83  ? 5   DT  D "C3'" 1 
ATOM   4270 O "O3'" . DT  F 4 5   ? 37.101  10.717  -0.355  1.00 56.38  ? 5   DT  D "O3'" 1 
ATOM   4271 C "C2'" . DT  F 4 5   ? 34.970  11.263  -1.336  1.00 53.34  ? 5   DT  D "C2'" 1 
ATOM   4272 C "C1'" . DT  F 4 5   ? 34.066  11.168  -0.128  1.00 49.01  ? 5   DT  D "C1'" 1 
ATOM   4273 N N1    . DT  F 4 5   ? 32.631  11.250  -0.426  1.00 44.27  ? 5   DT  D N1    1 
ATOM   4274 C C2    . DT  F 4 5   ? 31.881  10.111  -0.436  1.00 42.49  ? 5   DT  D C2    1 
ATOM   4275 O O2    . DT  F 4 5   ? 32.345  9.011   -0.234  1.00 47.08  ? 5   DT  D O2    1 
ATOM   4276 N N3    . DT  F 4 5   ? 30.554  10.302  -0.682  1.00 40.95  ? 5   DT  D N3    1 
ATOM   4277 C C4    . DT  F 4 5   ? 29.915  11.504  -0.909  1.00 42.44  ? 5   DT  D C4    1 
ATOM   4278 O O4    . DT  F 4 5   ? 28.713  11.575  -1.122  1.00 42.54  ? 5   DT  D O4    1 
ATOM   4279 C C5    . DT  F 4 5   ? 30.762  12.663  -0.886  1.00 44.52  ? 5   DT  D C5    1 
ATOM   4280 C C7    . DT  F 4 5   ? 30.188  14.021  -1.126  1.00 44.34  ? 5   DT  D C7    1 
ATOM   4281 C C6    . DT  F 4 5   ? 32.064  12.482  -0.639  1.00 50.02  ? 5   DT  D C6    1 
ATOM   4282 P P     . DT  F 4 6   ? 37.972  9.976   -1.478  1.00 72.36  ? 6   DT  D P     1 
ATOM   4283 O OP1   . DT  F 4 6   ? 39.155  9.364   -0.805  1.00 62.36  ? 6   DT  D OP1   1 
ATOM   4284 O OP2   . DT  F 4 6   ? 38.148  10.919  -2.616  1.00 60.15  ? 6   DT  D OP2   1 
ATOM   4285 O "O5'" . DT  F 4 6   ? 37.006  8.795   -1.950  1.00 62.97  ? 6   DT  D "O5'" 1 
ATOM   4286 C "C5'" . DT  F 4 6   ? 36.747  7.739   -1.082  1.00 52.39  ? 6   DT  D "C5'" 1 
ATOM   4287 C "C4'" . DT  F 4 6   ? 35.913  6.699   -1.775  1.00 53.72  ? 6   DT  D "C4'" 1 
ATOM   4288 O "O4'" . DT  F 4 6   ? 34.541  7.162   -1.877  1.00 57.12  ? 6   DT  D "O4'" 1 
ATOM   4289 C "C3'" . DT  F 4 6   ? 36.341  6.345   -3.195  1.00 52.02  ? 6   DT  D "C3'" 1 
ATOM   4290 O "O3'" . DT  F 4 6   ? 36.224  4.934   -3.342  1.00 59.14  ? 6   DT  D "O3'" 1 
ATOM   4291 C "C2'" . DT  F 4 6   ? 35.299  7.085   -4.043  1.00 52.86  ? 6   DT  D "C2'" 1 
ATOM   4292 C "C1'" . DT  F 4 6   ? 34.068  6.899   -3.170  1.00 52.31  ? 6   DT  D "C1'" 1 
ATOM   4293 N N1    . DT  F 4 6   ? 32.916  7.835   -3.449  1.00 43.91  ? 6   DT  D N1    1 
ATOM   4294 C C2    . DT  F 4 6   ? 31.619  7.346   -3.457  1.00 43.79  ? 6   DT  D C2    1 
ATOM   4295 O O2    . DT  F 4 6   ? 31.338  6.171   -3.278  1.00 46.93  ? 6   DT  D O2    1 
ATOM   4296 N N3    . DT  F 4 6   ? 30.654  8.289   -3.698  1.00 41.64  ? 6   DT  D N3    1 
ATOM   4297 C C4    . DT  F 4 6   ? 30.848  9.646   -3.916  1.00 43.74  ? 6   DT  D C4    1 
ATOM   4298 O O4    . DT  F 4 6   ? 29.904  10.425  -4.121  1.00 39.82  ? 6   DT  D O4    1 
ATOM   4299 C C5    . DT  F 4 6   ? 32.236  10.082  -3.879  1.00 40.16  ? 6   DT  D C5    1 
ATOM   4300 C C7    . DT  F 4 6   ? 32.592  11.519  -4.092  1.00 38.69  ? 6   DT  D C7    1 
ATOM   4301 C C6    . DT  F 4 6   ? 33.175  9.167   -3.648  1.00 43.41  ? 6   DT  D C6    1 
ATOM   4302 P P     . DC  F 4 7   ? 37.220  4.090   -4.279  1.00 68.08  ? 7   DC  D P     1 
ATOM   4303 O OP1   . DC  F 4 7   ? 37.279  2.706   -3.741  1.00 62.12  ? 7   DC  D OP1   1 
ATOM   4304 O OP2   . DC  F 4 7   ? 38.441  4.893   -4.547  1.00 62.55  ? 7   DC  D OP2   1 
ATOM   4305 O "O5'" . DC  F 4 7   ? 36.393  3.930   -5.617  1.00 62.26  ? 7   DC  D "O5'" 1 
ATOM   4306 C "C5'" . DC  F 4 7   ? 35.223  3.139   -5.609  1.00 60.07  ? 7   DC  D "C5'" 1 
ATOM   4307 C "C4'" . DC  F 4 7   ? 34.501  3.271   -6.928  1.00 59.42  ? 7   DC  D "C4'" 1 
ATOM   4308 O "O4'" . DC  F 4 7   ? 33.569  4.386   -6.875  1.00 60.00  ? 7   DC  D "O4'" 1 
ATOM   4309 C "C3'" . DC  F 4 7   ? 35.419  3.552   -8.115  1.00 55.98  ? 7   DC  D "C3'" 1 
ATOM   4310 O "O3'" . DC  F 4 7   ? 35.002  2.779   -9.221  1.00 57.29  ? 7   DC  D "O3'" 1 
ATOM   4311 C "C2'" . DC  F 4 7   ? 35.209  5.044   -8.351  1.00 52.87  ? 7   DC  D "C2'" 1 
ATOM   4312 C "C1'" . DC  F 4 7   ? 33.738  5.150   -8.033  1.00 49.26  ? 7   DC  D "C1'" 1 
ATOM   4313 N N1    . DC  F 4 7   ? 33.256  6.524   -7.789  1.00 44.34  ? 7   DC  D N1    1 
ATOM   4314 C C2    . DC  F 4 7   ? 31.894  6.728   -7.605  1.00 43.76  ? 7   DC  D C2    1 
ATOM   4315 O O2    . DC  F 4 7   ? 31.141  5.743   -7.614  1.00 44.28  ? 7   DC  D O2    1 
ATOM   4316 N N3    . DC  F 4 7   ? 31.436  7.992   -7.406  1.00 40.58  ? 7   DC  D N3    1 
ATOM   4317 C C4    . DC  F 4 7   ? 32.291  9.017   -7.402  1.00 41.34  ? 7   DC  D C4    1 
ATOM   4318 N N4    . DC  F 4 7   ? 31.796  10.249  -7.201  1.00 39.48  ? 7   DC  D N4    1 
ATOM   4319 C C5    . DC  F 4 7   ? 33.691  8.823   -7.599  1.00 40.87  ? 7   DC  D C5    1 
ATOM   4320 C C6    . DC  F 4 7   ? 34.125  7.571   -7.788  1.00 42.03  ? 7   DC  D C6    1 
ATOM   4321 P P     . DA  F 4 8   ? 35.427  1.233   -9.308  1.00 70.70  ? 8   DA  D P     1 
ATOM   4322 O OP1   . DA  F 4 8   ? 35.675  0.703   -7.948  1.00 62.35  ? 8   DA  D OP1   1 
ATOM   4323 O OP2   . DA  F 4 8   ? 36.405  1.111   -10.418 1.00 69.96  ? 8   DA  D OP2   1 
ATOM   4324 O "O5'" . DA  F 4 8   ? 34.102  0.491   -9.734  1.00 61.43  ? 8   DA  D "O5'" 1 
ATOM   4325 C "C5'" . DA  F 4 8   ? 33.561  0.763   -10.948 1.00 57.68  ? 8   DA  D "C5'" 1 
ATOM   4326 C "C4'" . DA  F 4 8   ? 32.077  0.557   -10.910 1.00 55.19  ? 8   DA  D "C4'" 1 
ATOM   4327 O "O4'" . DA  F 4 8   ? 31.439  1.748   -10.373 1.00 52.77  ? 8   DA  D "O4'" 1 
ATOM   4328 C "C3'" . DA  F 4 8   ? 31.491  0.368   -12.284 1.00 59.15  ? 8   DA  D "C3'" 1 
ATOM   4329 O "O3'" . DA  F 4 8   ? 30.298  -0.382  -12.207 1.00 60.74  ? 8   DA  D "O3'" 1 
ATOM   4330 C "C2'" . DA  F 4 8   ? 31.268  1.811   -12.743 1.00 51.45  ? 8   DA  D "C2'" 1 
ATOM   4331 C "C1'" . DA  F 4 8   ? 30.871  2.504   -11.437 1.00 52.73  ? 8   DA  D "C1'" 1 
ATOM   4332 N N9    . DA  F 4 8   ? 31.310  3.911   -11.337 1.00 46.84  ? 8   DA  D N9    1 
ATOM   4333 C C8    . DA  F 4 8   ? 32.575  4.405   -11.508 1.00 49.09  ? 8   DA  D C8    1 
ATOM   4334 N N7    . DA  F 4 8   ? 32.664  5.712   -11.353 1.00 46.33  ? 8   DA  D N7    1 
ATOM   4335 C C5    . DA  F 4 8   ? 31.361  6.105   -11.063 1.00 42.24  ? 8   DA  D C5    1 
ATOM   4336 C C6    . DA  F 4 8   ? 30.777  7.370   -10.781 1.00 40.16  ? 8   DA  D C6    1 
ATOM   4337 N N6    . DA  F 4 8   ? 31.466  8.518   -10.753 1.00 40.71  ? 8   DA  D N6    1 
ATOM   4338 N N1    . DA  F 4 8   ? 29.456  7.404   -10.515 1.00 37.22  ? 8   DA  D N1    1 
ATOM   4339 C C2    . DA  F 4 8   ? 28.762  6.259   -10.540 1.00 39.88  ? 8   DA  D C2    1 
ATOM   4340 N N3    . DA  F 4 8   ? 29.187  5.021   -10.802 1.00 42.14  ? 8   DA  D N3    1 
ATOM   4341 C C4    . DA  F 4 8   ? 30.515  5.010   -11.050 1.00 43.50  ? 8   DA  D C4    1 
ATOM   4342 P P     . DA  F 4 9   ? 29.615  -0.910  -13.558 1.00 64.87  ? 9   DA  D P     1 
ATOM   4343 O OP1   . DA  F 4 9   ? 29.091  -2.296  -13.411 1.00 53.19  ? 9   DA  D OP1   1 
ATOM   4344 O OP2   . DA  F 4 9   ? 30.514  -0.475  -14.661 1.00 63.83  ? 9   DA  D OP2   1 
ATOM   4345 O "O5'" . DA  F 4 9   ? 28.314  -0.030  -13.661 1.00 60.55  ? 9   DA  D "O5'" 1 
ATOM   4346 C "C5'" . DA  F 4 9   ? 27.271  -0.228  -12.745 1.00 54.38  ? 9   DA  D "C5'" 1 
ATOM   4347 C "C4'" . DA  F 4 9   ? 26.255  0.861   -12.925 1.00 53.06  ? 9   DA  D "C4'" 1 
ATOM   4348 O "O4'" . DA  F 4 9   ? 26.910  2.154   -12.776 1.00 53.22  ? 9   DA  D "O4'" 1 
ATOM   4349 C "C3'" . DA  F 4 9   ? 25.601  0.873   -14.299 1.00 53.77  ? 9   DA  D "C3'" 1 
ATOM   4350 O "O3'" . DA  F 4 9   ? 24.236  1.134   -14.128 1.00 54.87  ? 9   DA  D "O3'" 1 
ATOM   4351 C "C2'" . DA  F 4 9   ? 26.343  2.001   -15.050 1.00 48.03  ? 9   DA  D "C2'" 1 
ATOM   4352 C "C1'" . DA  F 4 9   ? 26.661  2.962   -13.912 1.00 51.13  ? 9   DA  D "C1'" 1 
ATOM   4353 N N9    . DA  F 4 9   ? 27.834  3.828   -14.108 1.00 44.67  ? 9   DA  D N9    1 
ATOM   4354 C C8    . DA  F 4 9   ? 29.095  3.447   -14.461 1.00 43.60  ? 9   DA  D C8    1 
ATOM   4355 N N7    . DA  F 4 9   ? 29.960  4.445   -14.510 1.00 44.45  ? 9   DA  D N7    1 
ATOM   4356 C C5    . DA  F 4 9   ? 29.211  5.559   -14.154 1.00 40.90  ? 9   DA  D C5    1 
ATOM   4357 C C6    . DA  F 4 9   ? 29.538  6.932   -14.017 1.00 39.43  ? 9   DA  D C6    1 
ATOM   4358 N N6    . DA  F 4 9   ? 30.756  7.425   -14.221 1.00 34.73  ? 9   DA  D N6    1 
ATOM   4359 N N1    . DA  F 4 9   ? 28.548  7.778   -13.656 1.00 40.86  ? 9   DA  D N1    1 
ATOM   4360 C C2    . DA  F 4 9   ? 27.319  7.279   -13.432 1.00 39.31  ? 9   DA  D C2    1 
ATOM   4361 N N3    . DA  F 4 9   ? 26.894  6.018   -13.523 1.00 38.43  ? 9   DA  D N3    1 
ATOM   4362 C C4    . DA  F 4 9   ? 27.899  5.197   -13.894 1.00 41.41  ? 9   DA  D C4    1 
ATOM   4363 P P     . DA  F 4 10  ? 23.222  1.026   -15.358 1.00 56.88  ? 10  DA  D P     1 
ATOM   4364 O OP1   . DA  F 4 10  ? 22.031  0.322   -14.835 1.00 59.46  ? 10  DA  D OP1   1 
ATOM   4365 O OP2   . DA  F 4 10  ? 23.915  0.500   -16.551 1.00 56.36  ? 10  DA  D OP2   1 
ATOM   4366 O "O5'" . DA  F 4 10  ? 22.837  2.548   -15.597 1.00 52.66  ? 10  DA  D "O5'" 1 
ATOM   4367 C "C5'" . DA  F 4 10  ? 22.734  3.418   -14.477 1.00 48.98  ? 10  DA  D "C5'" 1 
ATOM   4368 C "C4'" . DA  F 4 10  ? 22.436  4.830   -14.928 1.00 48.24  ? 10  DA  D "C4'" 1 
ATOM   4369 O "O4'" . DA  F 4 10  ? 23.679  5.578   -15.046 1.00 47.43  ? 10  DA  D "O4'" 1 
ATOM   4370 C "C3'" . DA  F 4 10  ? 21.747  4.923   -16.285 1.00 47.01  ? 10  DA  D "C3'" 1 
ATOM   4371 O "O3'" . DA  F 4 10  ? 20.810  5.975   -16.251 1.00 51.48  ? 10  DA  D "O3'" 1 
ATOM   4372 C "C2'" . DA  F 4 10  ? 22.907  5.208   -17.240 1.00 47.21  ? 10  DA  D "C2'" 1 
ATOM   4373 C "C1'" . DA  F 4 10  ? 23.840  6.049   -16.365 1.00 46.39  ? 10  DA  D "C1'" 1 
ATOM   4374 N N9    . DA  F 4 10  ? 25.253  5.951   -16.743 1.00 40.55  ? 10  DA  D N9    1 
ATOM   4375 C C8    . DA  F 4 10  ? 25.915  4.840   -17.162 1.00 40.85  ? 10  DA  D C8    1 
ATOM   4376 N N7    . DA  F 4 10  ? 27.186  5.051   -17.437 1.00 40.38  ? 10  DA  D N7    1 
ATOM   4377 C C5    . DA  F 4 10  ? 27.366  6.398   -17.194 1.00 39.54  ? 10  DA  D C5    1 
ATOM   4378 C C6    . DA  F 4 10  ? 28.504  7.251   -17.293 1.00 38.70  ? 10  DA  D C6    1 
ATOM   4379 N N6    . DA  F 4 10  ? 29.714  6.842   -17.691 1.00 32.96  ? 10  DA  D N6    1 
ATOM   4380 N N1    . DA  F 4 10  ? 28.336  8.548   -16.971 1.00 38.97  ? 10  DA  D N1    1 
ATOM   4381 C C2    . DA  F 4 10  ? 27.121  8.956   -16.561 1.00 41.75  ? 10  DA  D C2    1 
ATOM   4382 N N3    . DA  F 4 10  ? 25.992  8.251   -16.418 1.00 41.42  ? 10  DA  D N3    1 
ATOM   4383 C C4    . DA  F 4 10  ? 26.183  6.971   -16.761 1.00 40.75  ? 10  DA  D C4    1 
ATOM   4384 P P     . DG  F 4 11  ? 19.875  6.290   -17.513 1.00 58.31  ? 11  DG  D P     1 
ATOM   4385 O OP1   . DG  F 4 11  ? 18.592  6.819   -16.991 1.00 59.23  ? 11  DG  D OP1   1 
ATOM   4386 O OP2   . DG  F 4 11  ? 19.879  5.120   -18.416 1.00 61.94  ? 11  DG  D OP2   1 
ATOM   4387 O "O5'" . DG  F 4 11  ? 20.640  7.478   -18.249 1.00 49.28  ? 11  DG  D "O5'" 1 
ATOM   4388 C "C5'" . DG  F 4 11  ? 21.023  8.647   -17.535 1.00 45.96  ? 11  DG  D "C5'" 1 
ATOM   4389 C "C4'" . DG  F 4 11  ? 21.881  9.529   -18.412 1.00 42.71  ? 11  DG  D "C4'" 1 
ATOM   4390 O "O4'" . DG  F 4 11  ? 23.274  9.053   -18.390 1.00 40.55  ? 11  DG  D "O4'" 1 
ATOM   4391 C "C3'" . DG  F 4 11  ? 21.480  9.528   -19.907 1.00 43.91  ? 11  DG  D "C3'" 1 
ATOM   4392 O "O3'" . DG  F 4 11  ? 21.777  10.781  -20.473 1.00 46.46  ? 11  DG  D "O3'" 1 
ATOM   4393 C "C2'" . DG  F 4 11  ? 22.452  8.505   -20.466 1.00 45.56  ? 11  DG  D "C2'" 1 
ATOM   4394 C "C1'" . DG  F 4 11  ? 23.689  8.977   -19.731 1.00 42.83  ? 11  DG  D "C1'" 1 
ATOM   4395 N N9    . DG  F 4 11  ? 24.858  8.135   -19.916 1.00 42.83  ? 11  DG  D N9    1 
ATOM   4396 C C8    . DG  F 4 11  ? 24.883  6.781   -20.116 1.00 43.51  ? 11  DG  D C8    1 
ATOM   4397 N N7    . DG  F 4 11  ? 26.087  6.311   -20.316 1.00 43.12  ? 11  DG  D N7    1 
ATOM   4398 C C5    . DG  F 4 11  ? 26.903  7.433   -20.282 1.00 36.21  ? 11  DG  D C5    1 
ATOM   4399 C C6    . DG  F 4 11  ? 28.301  7.546   -20.448 1.00 41.07  ? 11  DG  D C6    1 
ATOM   4400 O O6    . DG  F 4 11  ? 29.130  6.640   -20.651 1.00 48.15  ? 11  DG  D O6    1 
ATOM   4401 N N1    . DG  F 4 11  ? 28.731  8.865   -20.331 1.00 41.04  ? 11  DG  D N1    1 
ATOM   4402 C C2    . DG  F 4 11  ? 27.912  9.934   -20.087 1.00 40.88  ? 11  DG  D C2    1 
ATOM   4403 N N2    . DG  F 4 11  ? 28.512  11.129  -20.012 1.00 40.39  ? 11  DG  D N2    1 
ATOM   4404 N N3    . DG  F 4 11  ? 26.593  9.844   -19.935 1.00 40.84  ? 11  DG  D N3    1 
ATOM   4405 C C4    . DG  F 4 11  ? 26.163  8.563   -20.046 1.00 40.50  ? 11  DG  D C4    1 
ATOM   4406 P P     . DG  F 4 12  ? 20.636  11.788  -20.943 1.00 48.16  ? 12  DG  D P     1 
ATOM   4407 O OP1   . DG  F 4 12  ? 19.899  12.214  -19.733 1.00 45.97  ? 12  DG  D OP1   1 
ATOM   4408 O OP2   . DG  F 4 12  ? 19.938  11.133  -22.068 1.00 39.34  ? 12  DG  D OP2   1 
ATOM   4409 O "O5'" . DG  F 4 12  ? 21.472  13.027  -21.533 1.00 40.15  ? 12  DG  D "O5'" 1 
ATOM   4410 C "C5'" . DG  F 4 12  ? 22.071  14.013  -20.685 1.00 33.33  ? 12  DG  D "C5'" 1 
ATOM   4411 C "C4'" . DG  F 4 12  ? 23.219  14.708  -21.409 1.00 36.57  ? 12  DG  D "C4'" 1 
ATOM   4412 O "O4'" . DG  F 4 12  ? 24.349  13.820  -21.381 1.00 39.34  ? 12  DG  D "O4'" 1 
ATOM   4413 C "C3'" . DG  F 4 12  ? 22.945  15.007  -22.894 1.00 45.50  ? 12  DG  D "C3'" 1 
ATOM   4414 O "O3'" . DG  F 4 12  ? 22.843  16.462  -23.207 1.00 48.36  ? 12  DG  D "O3'" 1 
ATOM   4415 C "C2'" . DG  F 4 12  ? 24.007  14.251  -23.704 1.00 35.03  ? 12  DG  D "C2'" 1 
ATOM   4416 C "C1'" . DG  F 4 12  ? 24.966  13.721  -22.652 1.00 40.31  ? 12  DG  D "C1'" 1 
ATOM   4417 N N9    . DG  F 4 12  ? 25.379  12.332  -22.870 1.00 40.11  ? 12  DG  D N9    1 
ATOM   4418 C C8    . DG  F 4 12  ? 24.588  11.201  -22.830 1.00 38.57  ? 12  DG  D C8    1 
ATOM   4419 N N7    . DG  F 4 12  ? 25.253  10.095  -23.052 1.00 38.14  ? 12  DG  D N7    1 
ATOM   4420 C C5    . DG  F 4 12  ? 26.568  10.525  -23.254 1.00 37.68  ? 12  DG  D C5    1 
ATOM   4421 C C6    . DG  F 4 12  ? 27.750  9.784   -23.526 1.00 39.68  ? 12  DG  D C6    1 
ATOM   4422 O O6    . DG  F 4 12  ? 27.878  8.554   -23.659 1.00 41.58  ? 12  DG  D O6    1 
ATOM   4423 N N1    . DG  F 4 12  ? 28.865  10.617  -23.642 1.00 38.88  ? 12  DG  D N1    1 
ATOM   4424 C C2    . DG  F 4 12  ? 28.842  11.986  -23.504 1.00 39.19  ? 12  DG  D C2    1 
ATOM   4425 N N2    . DG  F 4 12  ? 30.014  12.619  -23.643 1.00 40.32  ? 12  DG  D N2    1 
ATOM   4426 N N3    . DG  F 4 12  ? 27.749  12.687  -23.253 1.00 36.91  ? 12  DG  D N3    1 
ATOM   4427 C C4    . DG  F 4 12  ? 26.655  11.897  -23.143 1.00 37.49  ? 12  DG  D C4    1 
ATOM   4428 P P     . DT  F 4 13  ? 24.092  17.466  -23.232 1.00 40.31  ? 13  DT  D P     1 
ATOM   4429 O OP1   . DT  F 4 13  ? 25.204  16.749  -22.624 1.00 52.07  ? 13  DT  D OP1   1 
ATOM   4430 O OP2   . DT  F 4 13  ? 23.727  18.777  -22.647 1.00 41.41  ? 13  DT  D OP2   1 
ATOM   4431 O "O5'" . DT  F 4 13  ? 24.402  17.687  -24.773 1.00 39.73  ? 13  DT  D "O5'" 1 
ATOM   4432 C "C5'" . DT  F 4 13  ? 25.124  16.704  -25.519 1.00 40.92  ? 13  DT  D "C5'" 1 
ATOM   4433 C "C4'" . DT  F 4 13  ? 26.578  17.083  -25.735 1.00 37.08  ? 13  DT  D "C4'" 1 
ATOM   4434 O "O4'" . DT  F 4 13  ? 27.373  16.044  -25.165 1.00 41.30  ? 13  DT  D "O4'" 1 
ATOM   4435 C "C3'" . DT  F 4 13  ? 26.993  17.174  -27.212 1.00 42.16  ? 13  DT  D "C3'" 1 
ATOM   4436 O "O3'" . DT  F 4 13  ? 27.164  18.523  -27.608 1.00 45.00  ? 13  DT  D "O3'" 1 
ATOM   4437 C "C2'" . DT  F 4 13  ? 28.308  16.414  -27.312 1.00 43.33  ? 13  DT  D "C2'" 1 
ATOM   4438 C "C1'" . DT  F 4 13  ? 28.241  15.477  -26.129 1.00 43.22  ? 13  DT  D "C1'" 1 
ATOM   4439 N N1    . DT  F 4 13  ? 27.813  14.061  -26.440 1.00 39.45  ? 13  DT  D N1    1 
ATOM   4440 C C2    . DT  F 4 13  ? 28.767  13.169  -26.868 1.00 41.82  ? 13  DT  D C2    1 
ATOM   4441 O O2    . DT  F 4 13  ? 29.931  13.475  -27.045 1.00 45.09  ? 13  DT  D O2    1 
ATOM   4442 N N3    . DT  F 4 13  ? 28.312  11.896  -27.088 1.00 39.95  ? 13  DT  D N3    1 
ATOM   4443 C C4    . DT  F 4 13  ? 27.024  11.434  -26.922 1.00 39.38  ? 13  DT  D C4    1 
ATOM   4444 O O4    . DT  F 4 13  ? 26.707  10.275  -27.134 1.00 39.95  ? 13  DT  D O4    1 
ATOM   4445 C C5    . DT  F 4 13  ? 26.071  12.405  -26.477 1.00 40.42  ? 13  DT  D C5    1 
ATOM   4446 C C7    . DT  F 4 13  ? 24.638  11.987  -26.283 1.00 39.67  ? 13  DT  D C7    1 
ATOM   4447 C C6    . DT  F 4 13  ? 26.503  13.666  -26.249 1.00 38.83  ? 13  DT  D C6    1 
ATOM   4448 P P     . DG  F 4 14  ? 26.912  18.923  -29.144 1.00 43.79  ? 14  DG  D P     1 
ATOM   4449 O OP1   . DG  F 4 14  ? 26.947  20.403  -29.264 1.00 42.49  ? 14  DG  D OP1   1 
ATOM   4450 O OP2   . DG  F 4 14  ? 25.727  18.158  -29.590 1.00 43.92  ? 14  DG  D OP2   1 
ATOM   4451 O "O5'" . DG  F 4 14  ? 28.154  18.301  -29.901 1.00 40.76  ? 14  DG  D "O5'" 1 
ATOM   4452 C "C5'" . DG  F 4 14  ? 29.352  19.020  -29.986 1.00 39.32  ? 14  DG  D "C5'" 1 
ATOM   4453 C "C4'" . DG  F 4 14  ? 30.372  18.231  -30.770 1.00 40.29  ? 14  DG  D "C4'" 1 
ATOM   4454 O "O4'" . DG  F 4 14  ? 30.259  16.833  -30.413 1.00 39.38  ? 14  DG  D "O4'" 1 
ATOM   4455 C "C3'" . DG  F 4 14  ? 30.227  18.301  -32.285 1.00 38.99  ? 14  DG  D "C3'" 1 
ATOM   4456 O "O3'" . DG  F 4 14  ? 31.536  18.332  -32.903 1.00 43.57  ? 14  DG  D "O3'" 1 
ATOM   4457 C "C2'" . DG  F 4 14  ? 29.442  17.030  -32.611 1.00 42.29  ? 14  DG  D "C2'" 1 
ATOM   4458 C "C1'" . DG  F 4 14  ? 29.891  16.059  -31.529 1.00 40.01  ? 14  DG  D "C1'" 1 
ATOM   4459 N N9    . DG  F 4 14  ? 28.848  15.122  -31.104 1.00 41.50  ? 14  DG  D N9    1 
ATOM   4460 C C8    . DG  F 4 14  ? 27.585  15.435  -30.659 1.00 43.73  ? 14  DG  D C8    1 
ATOM   4461 N N7    . DG  F 4 14  ? 26.877  14.389  -30.321 1.00 42.79  ? 14  DG  D N7    1 
ATOM   4462 C C5    . DG  F 4 14  ? 27.723  13.316  -30.547 1.00 40.12  ? 14  DG  D C5    1 
ATOM   4463 C C6    . DG  F 4 14  ? 27.501  11.933  -30.367 1.00 41.66  ? 14  DG  D C6    1 
ATOM   4464 O O6    . DG  F 4 14  ? 26.482  11.372  -29.970 1.00 39.41  ? 14  DG  D O6    1 
ATOM   4465 N N1    . DG  F 4 14  ? 28.621  11.177  -30.715 1.00 48.30  ? 14  DG  D N1    1 
ATOM   4466 C C2    . DG  F 4 14  ? 29.810  11.698  -31.177 1.00 45.35  ? 14  DG  D C2    1 
ATOM   4467 N N2    . DG  F 4 14  ? 30.770  10.816  -31.467 1.00 43.27  ? 14  DG  D N2    1 
ATOM   4468 N N3    . DG  F 4 14  ? 30.032  12.996  -31.351 1.00 44.87  ? 14  DG  D N3    1 
ATOM   4469 C C4    . DG  F 4 14  ? 28.944  13.746  -31.023 1.00 42.14  ? 14  DG  D C4    1 
ATOM   4470 P P     . DT  F 4 15  ? 31.738  18.121  -34.486 1.00 56.11  ? 15  DT  D P     1 
ATOM   4471 O OP1   . DT  F 4 15  ? 33.000  18.781  -34.887 1.00 46.13  ? 15  DT  D OP1   1 
ATOM   4472 O OP2   . DT  F 4 15  ? 30.477  18.509  -35.176 1.00 52.25  ? 15  DT  D OP2   1 
ATOM   4473 O "O5'" . DT  F 4 15  ? 31.941  16.535  -34.645 1.00 47.13  ? 15  DT  D "O5'" 1 
ATOM   4474 C "C5'" . DT  F 4 15  ? 33.078  15.892  -34.089 1.00 47.38  ? 15  DT  D "C5'" 1 
ATOM   4475 C "C4'" . DT  F 4 15  ? 33.172  14.446  -34.576 1.00 50.27  ? 15  DT  D "C4'" 1 
ATOM   4476 O "O4'" . DT  F 4 15  ? 32.039  13.708  -34.094 1.00 44.38  ? 15  DT  D "O4'" 1 
ATOM   4477 C "C3'" . DT  F 4 15  ? 33.162  14.285  -36.083 1.00 59.68  ? 15  DT  D "C3'" 1 
ATOM   4478 O "O3'" . DT  F 4 15  ? 34.384  13.704  -36.546 1.00 58.76  ? 15  DT  D "O3'" 1 
ATOM   4479 C "C2'" . DT  F 4 15  ? 31.933  13.404  -36.391 1.00 56.25  ? 15  DT  D "C2'" 1 
ATOM   4480 C "C1'" . DT  F 4 15  ? 31.601  12.790  -35.053 1.00 47.01  ? 15  DT  D "C1'" 1 
ATOM   4481 N N1    . DT  F 4 15  ? 30.127  12.592  -34.812 1.00 49.25  ? 15  DT  D N1    1 
ATOM   4482 C C2    . DT  F 4 15  ? 29.602  11.318  -34.733 1.00 51.80  ? 15  DT  D C2    1 
ATOM   4483 O O2    . DT  F 4 15  ? 30.265  10.307  -34.899 1.00 58.84  ? 15  DT  D O2    1 
ATOM   4484 N N3    . DT  F 4 15  ? 28.260  11.266  -34.463 1.00 45.16  ? 15  DT  D N3    1 
ATOM   4485 C C4    . DT  F 4 15  ? 27.413  12.328  -34.261 1.00 45.99  ? 15  DT  D C4    1 
ATOM   4486 O O4    . DT  F 4 15  ? 26.216  12.176  -34.022 1.00 48.03  ? 15  DT  D O4    1 
ATOM   4487 C C5    . DT  F 4 15  ? 28.027  13.628  -34.350 1.00 43.50  ? 15  DT  D C5    1 
ATOM   4488 C C7    . DT  F 4 15  ? 27.214  14.860  -34.140 1.00 45.31  ? 15  DT  D C7    1 
ATOM   4489 C C6    . DT  F 4 15  ? 29.333  13.694  -34.608 1.00 46.52  ? 15  DT  D C6    1 
ATOM   4490 P P     . DG  F 4 16  ? 34.867  14.020  -38.051 1.00 67.95  ? 16  DG  D P     1 
ATOM   4491 O OP1   . DG  F 4 16  ? 36.301  14.381  -37.983 1.00 61.23  ? 16  DG  D OP1   1 
ATOM   4492 O OP2   . DG  F 4 16  ? 33.871  14.934  -38.681 1.00 55.70  ? 16  DG  D OP2   1 
ATOM   4493 O "O5'" . DG  F 4 16  ? 34.710  12.627  -38.820 1.00 66.56  ? 16  DG  D "O5'" 1 
ATOM   4494 C "C5'" . DG  F 4 16  ? 34.423  11.440  -38.107 1.00 62.15  ? 16  DG  D "C5'" 1 
ATOM   4495 C "C4'" . DG  F 4 16  ? 33.543  10.536  -38.939 1.00 62.54  ? 16  DG  D "C4'" 1 
ATOM   4496 O "O4'" . DG  F 4 16  ? 32.179  10.586  -38.439 1.00 67.71  ? 16  DG  D "O4'" 1 
ATOM   4497 C "C3'" . DG  F 4 16  ? 33.432  10.918  -40.417 1.00 66.28  ? 16  DG  D "C3'" 1 
ATOM   4498 O "O3'" . DG  F 4 16  ? 33.212  9.742   -41.172 1.00 75.89  ? 16  DG  D "O3'" 1 
ATOM   4499 C "C2'" . DG  F 4 16  ? 32.183  11.786  -40.422 1.00 62.18  ? 16  DG  D "C2'" 1 
ATOM   4500 C "C1'" . DG  F 4 16  ? 31.322  10.941  -39.511 1.00 62.14  ? 16  DG  D "C1'" 1 
ATOM   4501 N N9    . DG  F 4 16  ? 30.138  11.605  -38.980 1.00 53.13  ? 16  DG  D N9    1 
ATOM   4502 C C8    . DG  F 4 16  ? 29.874  12.955  -38.953 1.00 49.63  ? 16  DG  D C8    1 
ATOM   4503 N N7    . DG  F 4 16  ? 28.723  13.245  -38.412 1.00 48.68  ? 16  DG  D N7    1 
ATOM   4504 C C5    . DG  F 4 16  ? 28.187  12.002  -38.057 1.00 50.76  ? 16  DG  D C5    1 
ATOM   4505 C C6    . DG  F 4 16  ? 26.951  11.672  -37.422 1.00 48.20  ? 16  DG  D C6    1 
ATOM   4506 O O6    . DG  F 4 16  ? 26.049  12.441  -37.033 1.00 43.44  ? 16  DG  D O6    1 
ATOM   4507 N N1    . DG  F 4 16  ? 26.813  10.290  -37.252 1.00 49.74  ? 16  DG  D N1    1 
ATOM   4508 C C2    . DG  F 4 16  ? 27.744  9.347   -37.642 1.00 53.54  ? 16  DG  D C2    1 
ATOM   4509 N N2    . DG  F 4 16  ? 27.429  8.066   -37.399 1.00 52.94  ? 16  DG  D N2    1 
ATOM   4510 N N3    . DG  F 4 16  ? 28.902  9.641   -38.230 1.00 50.84  ? 16  DG  D N3    1 
ATOM   4511 C C4    . DG  F 4 16  ? 29.052  10.984  -38.405 1.00 51.76  ? 16  DG  D C4    1 
ATOM   4512 P P     . DA  F 4 17  ? 33.821  9.590   -42.648 1.00 87.16  ? 17  DA  D P     1 
ATOM   4513 O OP1   . DA  F 4 17  ? 35.215  9.100   -42.465 1.00 79.69  ? 17  DA  D OP1   1 
ATOM   4514 O OP2   . DA  F 4 17  ? 33.554  10.864  -43.371 1.00 78.52  ? 17  DA  D OP2   1 
ATOM   4515 O "O5'" . DA  F 4 17  ? 32.921  8.438   -43.317 1.00 69.34  ? 17  DA  D "O5'" 1 
ATOM   4516 C "C5'" . DA  F 4 17  ? 32.934  7.118   -42.771 1.00 78.28  ? 17  DA  D "C5'" 1 
ATOM   4517 C "C4'" . DA  F 4 17  ? 31.528  6.547   -42.683 1.00 76.60  ? 17  DA  D "C4'" 1 
ATOM   4518 O "O4'" . DA  F 4 17  ? 30.783  7.232   -41.646 1.00 75.78  ? 17  DA  D "O4'" 1 
ATOM   4519 C "C3'" . DA  F 4 17  ? 30.683  6.737   -43.921 1.00 81.18  ? 17  DA  D "C3'" 1 
ATOM   4520 O "O3'" . DA  F 4 17  ? 30.983  5.728   -44.937 1.00 91.25  ? 17  DA  D "O3'" 1 
ATOM   4521 C "C2'" . DA  F 4 17  ? 29.271  6.622   -43.362 1.00 78.69  ? 17  DA  D "C2'" 1 
ATOM   4522 C "C1'" . DA  F 4 17  ? 29.401  7.244   -41.978 1.00 68.12  ? 17  DA  D "C1'" 1 
ATOM   4523 N N9    . DA  F 4 17  ? 28.887  8.620   -41.890 1.00 62.88  ? 17  DA  D N9    1 
ATOM   4524 C C8    . DA  F 4 17  ? 29.504  9.771   -42.315 1.00 61.70  ? 17  DA  D C8    1 
ATOM   4525 N N7    . DA  F 4 17  ? 28.803  10.866  -42.090 1.00 56.50  ? 17  DA  D N7    1 
ATOM   4526 C C5    . DA  F 4 17  ? 27.652  10.402  -41.467 1.00 55.67  ? 17  DA  D C5    1 
ATOM   4527 C C6    . DA  F 4 17  ? 26.502  11.060  -40.969 1.00 54.47  ? 17  DA  D C6    1 
ATOM   4528 N N6    . DA  F 4 17  ? 26.323  12.381  -41.031 1.00 54.28  ? 17  DA  D N6    1 
ATOM   4529 N N1    . DA  F 4 17  ? 25.531  10.301  -40.421 1.00 52.27  ? 17  DA  D N1    1 
ATOM   4530 C C2    . DA  F 4 17  ? 25.707  8.977   -40.365 1.00 56.66  ? 17  DA  D C2    1 
ATOM   4531 N N3    . DA  F 4 17  ? 26.741  8.244   -40.792 1.00 61.08  ? 17  DA  D N3    1 
ATOM   4532 C C4    . DA  F 4 17  ? 27.687  9.023   -41.339 1.00 59.55  ? 17  DA  D C4    1 
ATOM   4533 P P     . DG  F 4 18  ? 30.511  4.189   -44.811 1.00 92.73  ? 18  DG  D P     1 
ATOM   4534 O OP1   . DG  F 4 18  ? 30.762  3.688   -43.435 1.00 82.95  ? 18  DG  D OP1   1 
ATOM   4535 O OP2   . DG  F 4 18  ? 31.111  3.520   -45.989 1.00 90.37  ? 18  DG  D OP2   1 
ATOM   4536 O "O5'" . DG  F 4 18  ? 28.943  4.212   -45.126 1.00 89.38  ? 18  DG  D "O5'" 1 
ATOM   4537 C "C5'" . DG  F 4 18  ? 28.023  3.525   -44.279 1.00 83.08  ? 18  DG  D "C5'" 1 
ATOM   4538 C "C4'" . DG  F 4 18  ? 26.638  4.100   -44.471 1.00 82.09  ? 18  DG  D "C4'" 1 
ATOM   4539 O "O4'" . DG  F 4 18  ? 26.612  5.447   -43.959 1.00 77.39  ? 18  DG  D "O4'" 1 
ATOM   4540 C "C3'" . DG  F 4 18  ? 26.216  4.218   -45.935 1.00 92.04  ? 18  DG  D "C3'" 1 
ATOM   4541 O "O3'" . DG  F 4 18  ? 25.271  3.166   -46.292 1.00 102.99 ? 18  DG  D "O3'" 1 
ATOM   4542 C "C2'" . DG  F 4 18  ? 25.638  5.638   -46.075 1.00 83.37  ? 18  DG  D "C2'" 1 
ATOM   4543 C "C1'" . DG  F 4 18  ? 25.625  6.162   -44.643 1.00 77.04  ? 18  DG  D "C1'" 1 
ATOM   4544 N N9    . DG  F 4 18  ? 25.892  7.603   -44.561 1.00 71.27  ? 18  DG  D N9    1 
ATOM   4545 C C8    . DG  F 4 18  ? 26.973  8.287   -45.074 1.00 67.23  ? 18  DG  D C8    1 
ATOM   4546 N N7    . DG  F 4 18  ? 26.913  9.579   -44.882 1.00 61.23  ? 18  DG  D N7    1 
ATOM   4547 C C5    . DG  F 4 18  ? 25.704  9.767   -44.220 1.00 61.54  ? 18  DG  D C5    1 
ATOM   4548 C C6    . DG  F 4 18  ? 25.090  10.956  -43.758 1.00 58.67  ? 18  DG  D C6    1 
ATOM   4549 O O6    . DG  F 4 18  ? 25.508  12.125  -43.838 1.00 54.81  ? 18  DG  D O6    1 
ATOM   4550 N N1    . DG  F 4 18  ? 23.873  10.691  -43.135 1.00 59.00  ? 18  DG  D N1    1 
ATOM   4551 C C2    . DG  F 4 18  ? 23.315  9.443   -42.988 1.00 60.32  ? 18  DG  D C2    1 
ATOM   4552 N N2    . DG  F 4 18  ? 22.133  9.392   -42.375 1.00 61.14  ? 18  DG  D N2    1 
ATOM   4553 N N3    . DG  F 4 18  ? 23.871  8.327   -43.417 1.00 62.75  ? 18  DG  D N3    1 
ATOM   4554 C C4    . DG  F 4 18  ? 25.062  8.561   -44.020 1.00 65.68  ? 18  DG  D C4    1 
ATOM   4555 P P     . DA  F 4 19  ? 23.676  3.328   -46.095 1.00 109.48 ? 19  DA  D P     1 
ATOM   4556 O OP1   . DA  F 4 19  ? 23.396  3.880   -44.747 1.00 96.99  ? 19  DA  D OP1   1 
ATOM   4557 O OP2   . DA  F 4 19  ? 23.106  2.009   -46.461 1.00 109.45 ? 19  DA  D OP2   1 
ATOM   4558 O "O5'" . DA  F 4 19  ? 23.228  4.391   -47.220 1.00 96.57  ? 19  DA  D "O5'" 1 
ATOM   4559 C "C5'" . DA  F 4 19  ? 21.990  4.223   -47.940 1.00 100.33 ? 19  DA  D "C5'" 1 
ATOM   4560 C "C4'" . DA  F 4 19  ? 20.807  4.805   -47.173 1.00 94.98  ? 19  DA  D "C4'" 1 
ATOM   4561 O "O4'" . DA  F 4 19  ? 21.281  5.476   -45.973 1.00 85.12  ? 19  DA  D "O4'" 1 
ATOM   4562 C "C3'" . DA  F 4 19  ? 19.993  5.846   -47.942 1.00 95.22  ? 19  DA  D "C3'" 1 
ATOM   4563 O "O3'" . DA  F 4 19  ? 18.889  5.218   -48.619 1.00 98.23  ? 19  DA  D "O3'" 1 
ATOM   4564 C "C2'" . DA  F 4 19  ? 19.518  6.778   -46.830 1.00 90.74  ? 19  DA  D "C2'" 1 
ATOM   4565 C "C1'" . DA  F 4 19  ? 20.724  6.773   -45.895 1.00 83.12  ? 19  DA  D "C1'" 1 
ATOM   4566 N N9    . DA  F 4 19  ? 21.749  7.740   -46.273 1.00 77.54  ? 19  DA  D N9    1 
ATOM   4567 C C8    . DA  F 4 19  ? 22.932  7.485   -46.910 1.00 77.82  ? 19  DA  D C8    1 
ATOM   4568 N N7    . DA  F 4 19  ? 23.660  8.554   -47.128 1.00 72.21  ? 19  DA  D N7    1 
ATOM   4569 C C5    . DA  F 4 19  ? 22.900  9.586   -46.602 1.00 68.74  ? 19  DA  D C5    1 
ATOM   4570 C C6    . DA  F 4 19  ? 23.116  10.980  -46.516 1.00 64.03  ? 19  DA  D C6    1 
ATOM   4571 N N6    . DA  F 4 19  ? 24.213  11.588  -46.991 1.00 56.40  ? 19  DA  D N6    1 
ATOM   4572 N N1    . DA  F 4 19  ? 22.151  11.726  -45.925 1.00 64.25  ? 19  DA  D N1    1 
ATOM   4573 C C2    . DA  F 4 19  ? 21.052  11.110  -45.456 1.00 67.67  ? 19  DA  D C2    1 
ATOM   4574 N N3    . DA  F 4 19  ? 20.742  9.812   -45.477 1.00 71.96  ? 19  DA  D N3    1 
ATOM   4575 C C4    . DA  F 4 19  ? 21.717  9.099   -46.071 1.00 73.08  ? 19  DA  D C4    1 
ATOM   4576 O "O5'" . DT  G 3 1   ? -11.080 1.891   0.528   1.00 61.63  ? 1   DT  G "O5'" 1 
ATOM   4577 C "C5'" . DT  G 3 1   ? -10.951 1.955   -0.898  1.00 71.02  ? 1   DT  G "C5'" 1 
ATOM   4578 C "C4'" . DT  G 3 1   ? -9.574  1.477   -1.352  1.00 69.78  ? 1   DT  G "C4'" 1 
ATOM   4579 O "O4'" . DT  G 3 1   ? -9.278  0.195   -0.735  1.00 68.60  ? 1   DT  G "O4'" 1 
ATOM   4580 C "C3'" . DT  G 3 1   ? -9.433  1.211   -2.850  1.00 69.55  ? 1   DT  G "C3'" 1 
ATOM   4581 O "O3'" . DT  G 3 1   ? -9.160  2.441   -3.573  1.00 65.44  ? 1   DT  G "O3'" 1 
ATOM   4582 C "C2'" . DT  G 3 1   ? -8.268  0.227   -2.869  1.00 68.58  ? 1   DT  G "C2'" 1 
ATOM   4583 C "C1'" . DT  G 3 1   ? -8.587  -0.636  -1.663  1.00 64.64  ? 1   DT  G "C1'" 1 
ATOM   4584 N N1    . DT  G 3 1   ? -9.438  -1.842  -1.985  1.00 63.62  ? 1   DT  G N1    1 
ATOM   4585 C C2    . DT  G 3 1   ? -8.835  -2.958  -2.530  1.00 64.07  ? 1   DT  G C2    1 
ATOM   4586 O O2    . DT  G 3 1   ? -7.646  -3.016  -2.777  1.00 65.90  ? 1   DT  G O2    1 
ATOM   4587 N N3    . DT  G 3 1   ? -9.676  -4.014  -2.769  1.00 60.02  ? 1   DT  G N3    1 
ATOM   4588 C C4    . DT  G 3 1   ? -11.039 -4.067  -2.526  1.00 62.19  ? 1   DT  G C4    1 
ATOM   4589 O O4    . DT  G 3 1   ? -11.706 -5.071  -2.775  1.00 62.06  ? 1   DT  G O4    1 
ATOM   4590 C C5    . DT  G 3 1   ? -11.622 -2.855  -1.961  1.00 61.97  ? 1   DT  G C5    1 
ATOM   4591 C C7    . DT  G 3 1   ? -13.097 -2.784  -1.657  1.00 57.55  ? 1   DT  G C7    1 
ATOM   4592 C C6    . DT  G 3 1   ? -10.800 -1.815  -1.721  1.00 60.08  ? 1   DT  G C6    1 
ATOM   4593 P P     . DC  G 3 2   ? -7.748  2.727   -4.296  1.00 62.75  ? 2   DC  G P     1 
ATOM   4594 O OP1   . DC  G 3 2   ? -6.647  2.820   -3.326  1.00 58.64  ? 2   DC  G OP1   1 
ATOM   4595 O OP2   . DC  G 3 2   ? -8.050  3.862   -5.175  1.00 65.24  ? 2   DC  G OP2   1 
ATOM   4596 O "O5'" . DC  G 3 2   ? -7.490  1.496   -5.269  1.00 56.84  ? 2   DC  G "O5'" 1 
ATOM   4597 C "C5'" . DC  G 3 2   ? -6.176  1.061   -5.494  1.00 53.20  ? 2   DC  G "C5'" 1 
ATOM   4598 C "C4'" . DC  G 3 2   ? -6.191  -0.254  -6.234  1.00 59.63  ? 2   DC  G "C4'" 1 
ATOM   4599 O "O4'" . DC  G 3 2   ? -7.279  -1.076  -5.749  1.00 58.53  ? 2   DC  G "O4'" 1 
ATOM   4600 C "C3'" . DC  G 3 2   ? -6.416  -0.136  -7.748  1.00 55.18  ? 2   DC  G "C3'" 1 
ATOM   4601 O "O3'" . DC  G 3 2   ? -5.278  -0.561  -8.428  1.00 50.38  ? 2   DC  G "O3'" 1 
ATOM   4602 C "C2'" . DC  G 3 2   ? -7.609  -1.060  -8.034  1.00 55.08  ? 2   DC  G "C2'" 1 
ATOM   4603 C "C1'" . DC  G 3 2   ? -7.634  -1.933  -6.793  1.00 57.08  ? 2   DC  G "C1'" 1 
ATOM   4604 N N1    . DC  G 3 2   ? -8.955  -2.530  -6.506  1.00 56.59  ? 2   DC  G N1    1 
ATOM   4605 C C2    . DC  G 3 2   ? -9.135  -3.903  -6.705  1.00 57.09  ? 2   DC  G C2    1 
ATOM   4606 O O2    . DC  G 3 2   ? -8.174  -4.582  -7.115  1.00 58.58  ? 2   DC  G O2    1 
ATOM   4607 N N3    . DC  G 3 2   ? -10.353 -4.456  -6.438  1.00 51.09  ? 2   DC  G N3    1 
ATOM   4608 C C4    . DC  G 3 2   ? -11.350 -3.687  -5.988  1.00 52.26  ? 2   DC  G C4    1 
ATOM   4609 N N4    . DC  G 3 2   ? -12.532 -4.273  -5.733  1.00 51.22  ? 2   DC  G N4    1 
ATOM   4610 C C5    . DC  G 3 2   ? -11.181 -2.281  -5.785  1.00 54.92  ? 2   DC  G C5    1 
ATOM   4611 C C6    . DC  G 3 2   ? -9.978  -1.751  -6.056  1.00 56.41  ? 2   DC  G C6    1 
ATOM   4612 P P     . DT  G 3 3   ? -5.241  -0.424  -10.016 1.00 63.25  ? 3   DT  G P     1 
ATOM   4613 O OP1   . DT  G 3 3   ? -3.842  -0.311  -10.521 1.00 52.71  ? 3   DT  G OP1   1 
ATOM   4614 O OP2   . DT  G 3 3   ? -6.222  0.648   -10.307 1.00 58.28  ? 3   DT  G OP2   1 
ATOM   4615 O "O5'" . DT  G 3 3   ? -5.825  -1.823  -10.506 1.00 61.24  ? 3   DT  G "O5'" 1 
ATOM   4616 C "C5'" . DT  G 3 3   ? -5.213  -3.025  -10.082 1.00 56.79  ? 3   DT  G "C5'" 1 
ATOM   4617 C "C4'" . DT  G 3 3   ? -5.728  -4.204  -10.885 1.00 55.11  ? 3   DT  G "C4'" 1 
ATOM   4618 O "O4'" . DT  G 3 3   ? -7.012  -4.634  -10.359 1.00 50.93  ? 3   DT  G "O4'" 1 
ATOM   4619 C "C3'" . DT  G 3 3   ? -5.965  -3.928  -12.362 1.00 62.36  ? 3   DT  G "C3'" 1 
ATOM   4620 O "O3'" . DT  G 3 3   ? -5.693  -5.109  -13.100 1.00 67.79  ? 3   DT  G "O3'" 1 
ATOM   4621 C "C2'" . DT  G 3 3   ? -7.456  -3.583  -12.392 1.00 58.21  ? 3   DT  G "C2'" 1 
ATOM   4622 C "C1'" . DT  G 3 3   ? -7.982  -4.583  -11.381 1.00 52.99  ? 3   DT  G "C1'" 1 
ATOM   4623 N N1    . DT  G 3 3   ? -9.311  -4.242  -10.769 1.00 47.92  ? 3   DT  G N1    1 
ATOM   4624 C C2    . DT  G 3 3   ? -10.186 -5.263  -10.531 1.00 46.66  ? 3   DT  G C2    1 
ATOM   4625 O O2    . DT  G 3 3   ? -9.936  -6.424  -10.808 1.00 44.94  ? 3   DT  G O2    1 
ATOM   4626 N N3    . DT  G 3 3   ? -11.376 -4.884  -9.962  1.00 47.71  ? 3   DT  G N3    1 
ATOM   4627 C C4    . DT  G 3 3   ? -11.774 -3.603  -9.603  1.00 46.42  ? 3   DT  G C4    1 
ATOM   4628 O O4    . DT  G 3 3   ? -12.878 -3.369  -9.084  1.00 41.08  ? 3   DT  G O4    1 
ATOM   4629 C C5    . DT  G 3 3   ? -10.804 -2.567  -9.876  1.00 46.45  ? 3   DT  G C5    1 
ATOM   4630 C C7    . DT  G 3 3   ? -11.121 -1.141  -9.532  1.00 47.38  ? 3   DT  G C7    1 
ATOM   4631 C C6    . DT  G 3 3   ? -9.627  -2.930  -10.442 1.00 48.00  ? 3   DT  G C6    1 
ATOM   4632 P P     . DC  G 3 4   ? -5.153  -5.035  -14.614 1.00 76.87  ? 4   DC  G P     1 
ATOM   4633 O OP1   . DC  G 3 4   ? -3.690  -5.270  -14.536 1.00 68.65  ? 4   DC  G OP1   1 
ATOM   4634 O OP2   . DC  G 3 4   ? -5.699  -3.822  -15.278 1.00 67.49  ? 4   DC  G OP2   1 
ATOM   4635 O "O5'" . DC  G 3 4   ? -5.871  -6.284  -15.315 1.00 68.19  ? 4   DC  G "O5'" 1 
ATOM   4636 C "C5'" . DC  G 3 4   ? -6.048  -7.501  -14.593 1.00 65.12  ? 4   DC  G "C5'" 1 
ATOM   4637 C "C4'" . DC  G 3 4   ? -7.268  -8.249  -15.088 1.00 57.41  ? 4   DC  G "C4'" 1 
ATOM   4638 O "O4'" . DC  G 3 4   ? -8.444  -7.837  -14.338 1.00 56.15  ? 4   DC  G "O4'" 1 
ATOM   4639 C "C3'" . DC  G 3 4   ? -7.609  -8.029  -16.561 1.00 60.11  ? 4   DC  G "C3'" 1 
ATOM   4640 O "O3'" . DC  G 3 4   ? -8.018  -9.256  -17.112 1.00 63.86  ? 4   DC  G "O3'" 1 
ATOM   4641 C "C2'" . DC  G 3 4   ? -8.772  -7.036  -16.495 1.00 57.66  ? 4   DC  G "C2'" 1 
ATOM   4642 C "C1'" . DC  G 3 4   ? -9.477  -7.502  -15.237 1.00 54.57  ? 4   DC  G "C1'" 1 
ATOM   4643 N N1    . DC  G 3 4   ? -10.330 -6.466  -14.611 1.00 51.15  ? 4   DC  G N1    1 
ATOM   4644 C C2    . DC  G 3 4   ? -11.464 -6.852  -13.880 1.00 50.58  ? 4   DC  G C2    1 
ATOM   4645 O O2    . DC  G 3 4   ? -11.736 -8.061  -13.773 1.00 49.53  ? 4   DC  G O2    1 
ATOM   4646 N N3    . DC  G 3 4   ? -12.235 -5.889  -13.309 1.00 45.53  ? 4   DC  G N3    1 
ATOM   4647 C C4    . DC  G 3 4   ? -11.901 -4.602  -13.446 1.00 45.04  ? 4   DC  G C4    1 
ATOM   4648 N N4    . DC  G 3 4   ? -12.686 -3.691  -12.866 1.00 44.33  ? 4   DC  G N4    1 
ATOM   4649 C C5    . DC  G 3 4   ? -10.750 -4.195  -14.183 1.00 44.66  ? 4   DC  G C5    1 
ATOM   4650 C C6    . DC  G 3 4   ? -10.002 -5.150  -14.743 1.00 51.29  ? 4   DC  G C6    1 
ATOM   4651 P P     . DA  G 3 5   ? -8.048  -9.505  -18.698 1.00 71.61  ? 5   DA  G P     1 
ATOM   4652 O OP1   . DA  G 3 5   ? -6.823  -10.288 -19.008 1.00 78.96  ? 5   DA  G OP1   1 
ATOM   4653 O OP2   . DA  G 3 5   ? -8.326  -8.239  -19.421 1.00 59.77  ? 5   DA  G OP2   1 
ATOM   4654 O "O5'" . DA  G 3 5   ? -9.293  -10.489 -18.853 1.00 65.90  ? 5   DA  G "O5'" 1 
ATOM   4655 C "C5'" . DA  G 3 5   ? -9.586  -11.418 -17.801 1.00 64.02  ? 5   DA  G "C5'" 1 
ATOM   4656 C "C4'" . DA  G 3 5   ? -11.070 -11.734 -17.754 1.00 63.73  ? 5   DA  G "C4'" 1 
ATOM   4657 O "O4'" . DA  G 3 5   ? -11.785 -10.680 -17.052 1.00 56.46  ? 5   DA  G "O4'" 1 
ATOM   4658 C "C3'" . DA  G 3 5   ? -11.735 -11.853 -19.118 1.00 69.30  ? 5   DA  G "C3'" 1 
ATOM   4659 O "O3'" . DA  G 3 5   ? -12.698 -12.867 -19.089 1.00 73.56  ? 5   DA  G "O3'" 1 
ATOM   4660 C "C2'" . DA  G 3 5   ? -12.382 -10.485 -19.316 1.00 66.14  ? 5   DA  G "C2'" 1 
ATOM   4661 C "C1'" . DA  G 3 5   ? -12.766 -10.112 -17.894 1.00 57.99  ? 5   DA  G "C1'" 1 
ATOM   4662 N N9    . DA  G 3 5   ? -12.777 -8.677  -17.668 1.00 53.78  ? 5   DA  G N9    1 
ATOM   4663 C C8    . DA  G 3 5   ? -11.846 -7.767  -18.085 1.00 52.36  ? 5   DA  G C8    1 
ATOM   4664 N N7    . DA  G 3 5   ? -12.120 -6.532  -17.728 1.00 52.64  ? 5   DA  G N7    1 
ATOM   4665 C C5    . DA  G 3 5   ? -13.312 -6.648  -17.030 1.00 49.55  ? 5   DA  G C5    1 
ATOM   4666 C C6    . DA  G 3 5   ? -14.132 -5.704  -16.384 1.00 46.97  ? 5   DA  G C6    1 
ATOM   4667 N N6    . DA  G 3 5   ? -13.858 -4.401  -16.339 1.00 46.83  ? 5   DA  G N6    1 
ATOM   4668 N N1    . DA  G 3 5   ? -15.251 -6.156  -15.782 1.00 45.15  ? 5   DA  G N1    1 
ATOM   4669 C C2    . DA  G 3 5   ? -15.521 -7.461  -15.827 1.00 44.82  ? 5   DA  G C2    1 
ATOM   4670 N N3    . DA  G 3 5   ? -14.829 -8.440  -16.400 1.00 44.17  ? 5   DA  G N3    1 
ATOM   4671 C C4    . DA  G 3 5   ? -13.728 -7.963  -16.987 1.00 48.71  ? 5   DA  G C4    1 
ATOM   4672 P P     . DC  G 3 6   ? -13.298 -13.409 -20.465 1.00 79.82  ? 6   DC  G P     1 
ATOM   4673 O OP1   . DC  G 3 6   ? -13.382 -14.881 -20.303 1.00 76.27  ? 6   DC  G OP1   1 
ATOM   4674 O OP2   . DC  G 3 6   ? -12.491 -12.787 -21.540 1.00 76.67  ? 6   DC  G OP2   1 
ATOM   4675 O "O5'" . DC  G 3 6   ? -14.757 -12.751 -20.536 1.00 70.38  ? 6   DC  G "O5'" 1 
ATOM   4676 C "C5'" . DC  G 3 6   ? -15.665 -12.987 -19.485 1.00 67.04  ? 6   DC  G "C5'" 1 
ATOM   4677 C "C4'" . DC  G 3 6   ? -16.759 -11.942 -19.458 1.00 62.54  ? 6   DC  G "C4'" 1 
ATOM   4678 O "O4'" . DC  G 3 6   ? -16.217 -10.673 -19.072 1.00 60.28  ? 6   DC  G "O4'" 1 
ATOM   4679 C "C3'" . DC  G 3 6   ? -17.424 -11.653 -20.789 1.00 62.28  ? 6   DC  G "C3'" 1 
ATOM   4680 O "O3'" . DC  G 3 6   ? -18.523 -12.534 -21.002 1.00 70.92  ? 6   DC  G "O3'" 1 
ATOM   4681 C "C2'" . DC  G 3 6   ? -17.900 -10.197 -20.637 1.00 59.51  ? 6   DC  G "C2'" 1 
ATOM   4682 C "C1'" . DC  G 3 6   ? -17.194 -9.714  -19.369 1.00 55.22  ? 6   DC  G "C1'" 1 
ATOM   4683 N N1    . DC  G 3 6   ? -16.549 -8.405  -19.518 1.00 49.92  ? 6   DC  G N1    1 
ATOM   4684 C C2    . DC  G 3 6   ? -17.146 -7.286  -18.933 1.00 50.72  ? 6   DC  G C2    1 
ATOM   4685 O O2    . DC  G 3 6   ? -18.199 -7.428  -18.303 1.00 52.55  ? 6   DC  G O2    1 
ATOM   4686 N N3    . DC  G 3 6   ? -16.550 -6.076  -19.066 1.00 51.72  ? 6   DC  G N3    1 
ATOM   4687 C C4    . DC  G 3 6   ? -15.407 -5.970  -19.752 1.00 49.49  ? 6   DC  G C4    1 
ATOM   4688 N N4    . DC  G 3 6   ? -14.859 -4.760  -19.851 1.00 43.71  ? 6   DC  G N4    1 
ATOM   4689 C C5    . DC  G 3 6   ? -14.782 -7.104  -20.367 1.00 48.13  ? 6   DC  G C5    1 
ATOM   4690 C C6    . DC  G 3 6   ? -15.384 -8.291  -20.226 1.00 51.12  ? 6   DC  G C6    1 
ATOM   4691 P P     . DA  G 3 7   ? -19.366 -12.454 -22.379 1.00 81.63  ? 7   DA  G P     1 
ATOM   4692 O OP1   . DA  G 3 7   ? -20.049 -13.753 -22.585 1.00 71.64  ? 7   DA  G OP1   1 
ATOM   4693 O OP2   . DA  G 3 7   ? -18.476 -11.928 -23.454 1.00 66.70  ? 7   DA  G OP2   1 
ATOM   4694 O "O5'" . DA  G 3 7   ? -20.500 -11.373 -22.052 1.00 70.77  ? 7   DA  G "O5'" 1 
ATOM   4695 C "C5'" . DA  G 3 7   ? -21.197 -11.411 -20.798 1.00 65.76  ? 7   DA  G "C5'" 1 
ATOM   4696 C "C4'" . DA  G 3 7   ? -22.312 -10.377 -20.775 1.00 65.99  ? 7   DA  G "C4'" 1 
ATOM   4697 O "O4'" . DA  G 3 7   ? -21.757 -9.056  -20.541 1.00 67.71  ? 7   DA  G "O4'" 1 
ATOM   4698 C "C3'" . DA  G 3 7   ? -23.112 -10.275 -22.067 1.00 68.93  ? 7   DA  G "C3'" 1 
ATOM   4699 O "O3'" . DA  G 3 7   ? -24.458 -9.980  -21.774 1.00 75.68  ? 7   DA  G "O3'" 1 
ATOM   4700 C "C2'" . DA  G 3 7   ? -22.431 -9.134  -22.827 1.00 66.13  ? 7   DA  G "C2'" 1 
ATOM   4701 C "C1'" . DA  G 3 7   ? -21.879 -8.249  -21.705 1.00 64.84  ? 7   DA  G "C1'" 1 
ATOM   4702 N N9    . DA  G 3 7   ? -20.568 -7.677  -22.032 1.00 53.01  ? 7   DA  G N9    1 
ATOM   4703 C C8    . DA  G 3 7   ? -19.599 -8.245  -22.812 1.00 51.78  ? 7   DA  G C8    1 
ATOM   4704 N N7    . DA  G 3 7   ? -18.529 -7.496  -22.961 1.00 51.69  ? 7   DA  G N7    1 
ATOM   4705 C C5    . DA  G 3 7   ? -18.820 -6.351  -22.237 1.00 50.98  ? 7   DA  G C5    1 
ATOM   4706 C C6    . DA  G 3 7   ? -18.087 -5.164  -21.994 1.00 48.43  ? 7   DA  G C6    1 
ATOM   4707 N N6    . DA  G 3 7   ? -16.861 -4.943  -22.480 1.00 45.08  ? 7   DA  G N6    1 
ATOM   4708 N N1    . DA  G 3 7   ? -18.667 -4.215  -21.223 1.00 49.47  ? 7   DA  G N1    1 
ATOM   4709 C C2    . DA  G 3 7   ? -19.898 -4.443  -20.738 1.00 50.48  ? 7   DA  G C2    1 
ATOM   4710 N N3    . DA  G 3 7   ? -20.682 -5.517  -20.899 1.00 51.07  ? 7   DA  G N3    1 
ATOM   4711 C C4    . DA  G 3 7   ? -20.078 -6.443  -21.662 1.00 50.65  ? 7   DA  G C4    1 
ATOM   4712 P P     . DC  G 3 8   ? -25.453 -9.540  -22.951 1.00 80.72  ? 8   DC  G P     1 
ATOM   4713 O OP1   . DC  G 3 8   ? -26.839 -9.842  -22.517 1.00 70.46  ? 8   DC  G OP1   1 
ATOM   4714 O OP2   . DC  G 3 8   ? -24.912 -10.111 -24.215 1.00 74.15  ? 8   DC  G OP2   1 
ATOM   4715 O "O5'" . DC  G 3 8   ? -25.308 -7.952  -22.955 1.00 71.18  ? 8   DC  G "O5'" 1 
ATOM   4716 C "C5'" . DC  G 3 8   ? -25.840 -7.198  -24.016 1.00 76.91  ? 8   DC  G "C5'" 1 
ATOM   4717 C "C4'" . DC  G 3 8   ? -25.536 -5.735  -23.808 1.00 69.22  ? 8   DC  G "C4'" 1 
ATOM   4718 O "O4'" . DC  G 3 8   ? -24.219 -5.608  -23.227 1.00 61.76  ? 8   DC  G "O4'" 1 
ATOM   4719 C "C3'" . DC  G 3 8   ? -25.440 -4.895  -25.067 1.00 66.64  ? 8   DC  G "C3'" 1 
ATOM   4720 O "O3'" . DC  G 3 8   ? -26.767 -4.574  -25.641 1.00 64.66  ? 8   DC  G "O3'" 1 
ATOM   4721 C "C2'" . DC  G 3 8   ? -24.695 -3.682  -24.527 1.00 64.38  ? 8   DC  G "C2'" 1 
ATOM   4722 C "C1'" . DC  G 3 8   ? -23.692 -4.340  -23.570 1.00 58.74  ? 8   DC  G "C1'" 1 
ATOM   4723 N N1    . DC  G 3 8   ? -22.311 -4.522  -24.134 1.00 52.80  ? 8   DC  G N1    1 
ATOM   4724 C C2    . DC  G 3 8   ? -21.378 -3.476  -24.018 1.00 51.48  ? 8   DC  G C2    1 
ATOM   4725 O O2    . DC  G 3 8   ? -21.721 -2.418  -23.472 1.00 54.25  ? 8   DC  G O2    1 
ATOM   4726 N N3    . DC  G 3 8   ? -20.125 -3.650  -24.510 1.00 50.51  ? 8   DC  G N3    1 
ATOM   4727 C C4    . DC  G 3 8   ? -19.781 -4.806  -25.082 1.00 48.40  ? 8   DC  G C4    1 
ATOM   4728 N N4    . DC  G 3 8   ? -18.520 -4.923  -25.547 1.00 37.17  ? 8   DC  G N4    1 
ATOM   4729 C C5    . DC  G 3 8   ? -20.717 -5.891  -25.204 1.00 46.96  ? 8   DC  G C5    1 
ATOM   4730 C C6    . DC  G 3 8   ? -21.958 -5.705  -24.719 1.00 49.57  ? 8   DC  G C6    1 
ATOM   4731 P P     . DC  G 3 9   ? -27.784 -3.527  -24.959 1.00 69.28  ? 9   DC  G P     1 
ATOM   4732 O OP1   . DC  G 3 9   ? -27.725 -3.709  -23.496 1.00 70.38  ? 9   DC  G OP1   1 
ATOM   4733 O OP2   . DC  G 3 9   ? -29.087 -3.664  -25.643 1.00 76.84  ? 9   DC  G OP2   1 
ATOM   4734 O "O5'" . DC  G 3 9   ? -27.183 -2.067  -25.263 1.00 63.79  ? 9   DC  G "O5'" 1 
ATOM   4735 C "C5'" . DC  G 3 9   ? -26.880 -1.627  -26.599 1.00 58.66  ? 9   DC  G "C5'" 1 
ATOM   4736 C "C4'" . DC  G 3 9   ? -25.988 -0.394  -26.528 1.00 53.83  ? 9   DC  G "C4'" 1 
ATOM   4737 O "O4'" . DC  G 3 9   ? -24.801 -0.751  -25.775 1.00 56.38  ? 9   DC  G "O4'" 1 
ATOM   4738 C "C3'" . DC  G 3 9   ? -25.452 0.154   -27.852 1.00 52.71  ? 9   DC  G "C3'" 1 
ATOM   4739 O "O3'" . DC  G 3 9   ? -26.387 1.080   -28.502 1.00 51.95  ? 9   DC  G "O3'" 1 
ATOM   4740 C "C2'" . DC  G 3 9   ? -24.176 0.850   -27.388 1.00 52.49  ? 9   DC  G "C2'" 1 
ATOM   4741 C "C1'" . DC  G 3 9   ? -23.664 -0.109  -26.315 1.00 54.08  ? 9   DC  G "C1'" 1 
ATOM   4742 N N1    . DC  G 3 9   ? -22.725 -1.154  -26.842 1.00 49.90  ? 9   DC  G N1    1 
ATOM   4743 C C2    . DC  G 3 9   ? -21.395 -0.820  -27.130 1.00 49.02  ? 9   DC  G C2    1 
ATOM   4744 O O2    . DC  G 3 9   ? -21.002 0.343   -26.930 1.00 47.41  ? 9   DC  G O2    1 
ATOM   4745 N N3    . DC  G 3 9   ? -20.569 -1.787  -27.622 1.00 47.76  ? 9   DC  G N3    1 
ATOM   4746 C C4    . DC  G 3 9   ? -21.032 -3.020  -27.820 1.00 43.99  ? 9   DC  G C4    1 
ATOM   4747 N N4    . DC  G 3 9   ? -20.193 -3.935  -28.296 1.00 40.60  ? 9   DC  G N4    1 
ATOM   4748 C C5    . DC  G 3 9   ? -22.373 -3.368  -27.533 1.00 49.27  ? 9   DC  G C5    1 
ATOM   4749 C C6    . DC  G 3 9   ? -23.178 -2.413  -27.061 1.00 50.24  ? 9   DC  G C6    1 
ATOM   4750 P P     . DT  G 3 10  ? -26.530 2.611   -28.015 1.00 57.91  ? 10  DT  G P     1 
ATOM   4751 O OP1   . DT  G 3 10  ? -26.437 2.618   -26.544 1.00 63.74  ? 10  DT  G OP1   1 
ATOM   4752 O OP2   . DT  G 3 10  ? -27.698 3.243   -28.641 1.00 52.33  ? 10  DT  G OP2   1 
ATOM   4753 O "O5'" . DT  G 3 10  ? -25.229 3.360   -28.559 1.00 55.74  ? 10  DT  G "O5'" 1 
ATOM   4754 C "C5'" . DT  G 3 10  ? -24.668 4.466   -27.805 1.00 50.06  ? 10  DT  G "C5'" 1 
ATOM   4755 C "C4'" . DT  G 3 10  ? -23.290 4.825   -28.318 1.00 40.81  ? 10  DT  G "C4'" 1 
ATOM   4756 O "O4'" . DT  G 3 10  ? -22.486 3.641   -28.285 1.00 44.18  ? 10  DT  G "O4'" 1 
ATOM   4757 C "C3'" . DT  G 3 10  ? -23.253 5.239   -29.769 1.00 39.72  ? 10  DT  G "C3'" 1 
ATOM   4758 O "O3'" . DT  G 3 10  ? -23.517 6.664   -29.960 1.00 45.87  ? 10  DT  G "O3'" 1 
ATOM   4759 C "C2'" . DT  G 3 10  ? -21.874 4.821   -30.231 1.00 42.93  ? 10  DT  G "C2'" 1 
ATOM   4760 C "C1'" . DT  G 3 10  ? -21.461 3.750   -29.246 1.00 45.21  ? 10  DT  G "C1'" 1 
ATOM   4761 N N1    . DT  G 3 10  ? -21.223 2.390   -29.852 1.00 46.56  ? 10  DT  G N1    1 
ATOM   4762 C C2    . DT  G 3 10  ? -19.936 2.009   -30.204 1.00 42.64  ? 10  DT  G C2    1 
ATOM   4763 O O2    . DT  G 3 10  ? -18.969 2.733   -30.093 1.00 42.09  ? 10  DT  G O2    1 
ATOM   4764 N N3    . DT  G 3 10  ? -19.828 0.736   -30.698 1.00 41.11  ? 10  DT  G N3    1 
ATOM   4765 C C4    . DT  G 3 10  ? -20.854 -0.178  -30.863 1.00 44.86  ? 10  DT  G C4    1 
ATOM   4766 O O4    . DT  G 3 10  ? -20.664 -1.305  -31.308 1.00 45.94  ? 10  DT  G O4    1 
ATOM   4767 C C5    . DT  G 3 10  ? -22.167 0.286   -30.478 1.00 42.90  ? 10  DT  G C5    1 
ATOM   4768 C C7    . DT  G 3 10  ? -23.351 -0.608  -30.624 1.00 41.56  ? 10  DT  G C7    1 
ATOM   4769 C C6    . DT  G 3 10  ? -22.284 1.530   -30.000 1.00 45.29  ? 10  DT  G C6    1 
ATOM   4770 P P     . DT  G 3 11  ? -22.483 7.829   -29.552 1.00 48.02  ? 11  DT  G P     1 
ATOM   4771 O OP1   . DT  G 3 11  ? -22.199 7.671   -28.122 1.00 48.46  ? 11  DT  G OP1   1 
ATOM   4772 O OP2   . DT  G 3 11  ? -22.906 9.137   -30.111 1.00 40.70  ? 11  DT  G OP2   1 
ATOM   4773 O "O5'" . DT  G 3 11  ? -21.174 7.524   -30.381 1.00 49.86  ? 11  DT  G "O5'" 1 
ATOM   4774 C "C5'" . DT  G 3 11  ? -19.946 7.851   -29.856 1.00 43.80  ? 11  DT  G "C5'" 1 
ATOM   4775 C "C4'" . DT  G 3 11  ? -18.863 7.368   -30.768 1.00 40.36  ? 11  DT  G "C4'" 1 
ATOM   4776 O "O4'" . DT  G 3 11  ? -19.134 6.028   -31.175 1.00 38.50  ? 11  DT  G "O4'" 1 
ATOM   4777 C "C3'" . DT  G 3 11  ? -18.685 8.171   -32.040 1.00 37.81  ? 11  DT  G "C3'" 1 
ATOM   4778 O "O3'" . DT  G 3 11  ? -17.417 8.779   -31.947 1.00 43.16  ? 11  DT  G "O3'" 1 
ATOM   4779 C "C2'" . DT  G 3 11  ? -18.773 7.104   -33.170 1.00 42.82  ? 11  DT  G "C2'" 1 
ATOM   4780 C "C1'" . DT  G 3 11  ? -18.519 5.817   -32.402 1.00 39.52  ? 11  DT  G "C1'" 1 
ATOM   4781 N N1    . DT  G 3 11  ? -19.110 4.560   -32.961 1.00 38.51  ? 11  DT  G N1    1 
ATOM   4782 C C2    . DT  G 3 11  ? -18.279 3.521   -33.271 1.00 42.36  ? 11  DT  G C2    1 
ATOM   4783 O O2    . DT  G 3 11  ? -17.068 3.593   -33.193 1.00 44.44  ? 11  DT  G O2    1 
ATOM   4784 N N3    . DT  G 3 11  ? -18.914 2.386   -33.713 1.00 42.64  ? 11  DT  G N3    1 
ATOM   4785 C C4    . DT  G 3 11  ? -20.275 2.181   -33.830 1.00 40.92  ? 11  DT  G C4    1 
ATOM   4786 O O4    . DT  G 3 11  ? -20.754 1.122   -34.222 1.00 40.75  ? 11  DT  G O4    1 
ATOM   4787 C C5    . DT  G 3 11  ? -21.092 3.297   -33.456 1.00 38.10  ? 11  DT  G C5    1 
ATOM   4788 C C7    . DT  G 3 11  ? -22.578 3.190   -33.550 1.00 33.40  ? 11  DT  G C7    1 
ATOM   4789 C C6    . DT  G 3 11  ? -20.478 4.419   -33.042 1.00 39.51  ? 11  DT  G C6    1 
ATOM   4790 P P     . DT  G 3 12  ? -16.885 9.852   -33.010 1.00 57.67  ? 12  DT  G P     1 
ATOM   4791 O OP1   . DT  G 3 12  ? -16.076 10.827  -32.233 1.00 49.40  ? 12  DT  G OP1   1 
ATOM   4792 O OP2   . DT  G 3 12  ? -18.029 10.303  -33.840 1.00 51.97  ? 12  DT  G OP2   1 
ATOM   4793 O "O5'" . DT  G 3 12  ? -15.891 8.974   -33.913 1.00 46.83  ? 12  DT  G "O5'" 1 
ATOM   4794 C "C5'" . DT  G 3 12  ? -15.387 7.747   -33.383 1.00 41.90  ? 12  DT  G "C5'" 1 
ATOM   4795 C "C4'" . DT  G 3 12  ? -14.428 7.079   -34.345 1.00 43.76  ? 12  DT  G "C4'" 1 
ATOM   4796 O "O4'" . DT  G 3 12  ? -14.995 5.840   -34.843 1.00 42.30  ? 12  DT  G "O4'" 1 
ATOM   4797 C "C3'" . DT  G 3 12  ? -14.045 7.891   -35.567 1.00 42.42  ? 12  DT  G "C3'" 1 
ATOM   4798 O "O3'" . DT  G 3 12  ? -12.677 7.588   -35.906 1.00 46.17  ? 12  DT  G "O3'" 1 
ATOM   4799 C "C2'" . DT  G 3 12  ? -15.037 7.384   -36.611 1.00 41.42  ? 12  DT  G "C2'" 1 
ATOM   4800 C "C1'" . DT  G 3 12  ? -15.179 5.910   -36.233 1.00 42.18  ? 12  DT  G "C1'" 1 
ATOM   4801 N N1    . DT  G 3 12  ? -16.535 5.304   -36.548 1.00 43.83  ? 12  DT  G N1    1 
ATOM   4802 C C2    . DT  G 3 12  ? -16.632 3.945   -36.814 1.00 43.23  ? 12  DT  G C2    1 
ATOM   4803 O O2    . DT  G 3 12  ? -15.663 3.184   -36.826 1.00 40.21  ? 12  DT  G O2    1 
ATOM   4804 N N3    . DT  G 3 12  ? -17.915 3.505   -37.074 1.00 41.56  ? 12  DT  G N3    1 
ATOM   4805 C C4    . DT  G 3 12  ? -19.084 4.258   -37.069 1.00 40.65  ? 12  DT  G C4    1 
ATOM   4806 O O4    . DT  G 3 12  ? -20.196 3.762   -37.302 1.00 37.86  ? 12  DT  G O4    1 
ATOM   4807 C C5    . DT  G 3 12  ? -18.901 5.664   -36.780 1.00 38.25  ? 12  DT  G C5    1 
ATOM   4808 C C7    . DT  G 3 12  ? -20.073 6.583   -36.761 1.00 37.90  ? 12  DT  G C7    1 
ATOM   4809 C C6    . DT  G 3 12  ? -17.659 6.111   -36.539 1.00 41.41  ? 12  DT  G C6    1 
ATOM   4810 P P     . DG  G 3 13  ? -11.777 8.574   -36.808 1.00 54.70  ? 13  DG  G P     1 
ATOM   4811 O OP1   . DG  G 3 13  ? -10.404 8.363   -36.328 1.00 45.70  ? 13  DG  G OP1   1 
ATOM   4812 O OP2   . DG  G 3 13  ? -12.385 9.909   -37.029 1.00 52.13  ? 13  DG  G OP2   1 
ATOM   4813 O "O5'" . DG  G 3 13  ? -11.832 7.906   -38.234 1.00 50.64  ? 13  DG  G "O5'" 1 
ATOM   4814 C "C5'" . DG  G 3 13  ? -11.427 6.570   -38.383 1.00 49.08  ? 13  DG  G "C5'" 1 
ATOM   4815 C "C4'" . DG  G 3 13  ? -11.762 6.095   -39.767 1.00 43.67  ? 13  DG  G "C4'" 1 
ATOM   4816 O "O4'" . DG  G 3 13  ? -13.143 5.651   -39.794 1.00 41.68  ? 13  DG  G "O4'" 1 
ATOM   4817 C "C3'" . DG  G 3 13  ? -11.643 7.170   -40.860 1.00 39.22  ? 13  DG  G "C3'" 1 
ATOM   4818 O "O3'" . DG  G 3 13  ? -11.241 6.541   -42.036 1.00 42.63  ? 13  DG  G "O3'" 1 
ATOM   4819 C "C2'" . DG  G 3 13  ? -13.084 7.640   -40.984 1.00 40.78  ? 13  DG  G "C2'" 1 
ATOM   4820 C "C1'" . DG  G 3 13  ? -13.782 6.296   -40.864 1.00 38.72  ? 13  DG  G "C1'" 1 
ATOM   4821 N N9    . DG  G 3 13  ? -15.206 6.373   -40.591 1.00 40.39  ? 13  DG  G N9    1 
ATOM   4822 C C8    . DG  G 3 13  ? -15.939 7.496   -40.259 1.00 38.83  ? 13  DG  G C8    1 
ATOM   4823 N N7    . DG  G 3 13  ? -17.209 7.247   -40.077 1.00 38.15  ? 13  DG  G N7    1 
ATOM   4824 C C5    . DG  G 3 13  ? -17.327 5.869   -40.314 1.00 38.68  ? 13  DG  G C5    1 
ATOM   4825 C C6    . DG  G 3 13  ? -18.467 5.025   -40.282 1.00 40.99  ? 13  DG  G C6    1 
ATOM   4826 O O6    . DG  G 3 13  ? -19.653 5.329   -40.026 1.00 41.70  ? 13  DG  G O6    1 
ATOM   4827 N N1    . DG  G 3 13  ? -18.142 3.706   -40.588 1.00 37.56  ? 13  DG  G N1    1 
ATOM   4828 C C2    . DG  G 3 13  ? -16.888 3.249   -40.887 1.00 38.55  ? 13  DG  G C2    1 
ATOM   4829 N N2    . DG  G 3 13  ? -16.784 1.931   -41.153 1.00 36.24  ? 13  DG  G N2    1 
ATOM   4830 N N3    . DG  G 3 13  ? -15.806 4.023   -40.918 1.00 40.35  ? 13  DG  G N3    1 
ATOM   4831 C C4    . DG  G 3 13  ? -16.105 5.321   -40.630 1.00 39.37  ? 13  DG  G C4    1 
ATOM   4832 P P     . DA  G 3 14  ? -10.100 7.139   -42.993 1.00 49.40  ? 14  DA  G P     1 
ATOM   4833 O OP1   . DA  G 3 14  ? -8.973  7.560   -42.131 1.00 45.47  ? 14  DA  G OP1   1 
ATOM   4834 O OP2   . DA  G 3 14  ? -10.711 8.051   -44.008 1.00 43.99  ? 14  DA  G OP2   1 
ATOM   4835 O "O5'" . DA  G 3 14  ? -9.648  5.841   -43.793 1.00 42.84  ? 14  DA  G "O5'" 1 
ATOM   4836 C "C5'" . DA  G 3 14  ? -9.719  4.576   -43.158 1.00 41.75  ? 14  DA  G "C5'" 1 
ATOM   4837 C "C4'" . DA  G 3 14  ? -10.239 3.513   -44.102 1.00 40.35  ? 14  DA  G "C4'" 1 
ATOM   4838 O "O4'" . DA  G 3 14  ? -11.681 3.434   -44.007 1.00 41.02  ? 14  DA  G "O4'" 1 
ATOM   4839 C "C3'" . DA  G 3 14  ? -9.949  3.742   -45.568 1.00 42.98  ? 14  DA  G "C3'" 1 
ATOM   4840 O "O3'" . DA  G 3 14  ? -9.857  2.477   -46.222 1.00 42.05  ? 14  DA  G "O3'" 1 
ATOM   4841 C "C2'" . DA  G 3 14  ? -11.184 4.523   -46.014 1.00 42.81  ? 14  DA  G "C2'" 1 
ATOM   4842 C "C1'" . DA  G 3 14  ? -12.275 3.829   -45.223 1.00 37.47  ? 14  DA  G "C1'" 1 
ATOM   4843 N N9    . DA  G 3 14  ? -13.387 4.700   -44.903 1.00 36.90  ? 14  DA  G N9    1 
ATOM   4844 C C8    . DA  G 3 14  ? -13.358 6.063   -44.795 1.00 38.60  ? 14  DA  G C8    1 
ATOM   4845 N N7    . DA  G 3 14  ? -14.521 6.590   -44.474 1.00 38.20  ? 14  DA  G N7    1 
ATOM   4846 C C5    . DA  G 3 14  ? -15.365 5.494   -44.371 1.00 35.37  ? 14  DA  G C5    1 
ATOM   4847 C C6    . DA  G 3 14  ? -16.733 5.375   -44.058 1.00 34.82  ? 14  DA  G C6    1 
ATOM   4848 N N6    . DA  G 3 14  ? -17.524 6.418   -43.777 1.00 33.49  ? 14  DA  G N6    1 
ATOM   4849 N N1    . DA  G 3 14  ? -17.252 4.142   -44.039 1.00 34.53  ? 14  DA  G N1    1 
ATOM   4850 C C2    . DA  G 3 14  ? -16.458 3.101   -44.306 1.00 36.33  ? 14  DA  G C2    1 
ATOM   4851 N N3    . DA  G 3 14  ? -15.165 3.084   -44.604 1.00 34.23  ? 14  DA  G N3    1 
ATOM   4852 C C4    . DA  G 3 14  ? -14.676 4.323   -44.626 1.00 34.53  ? 14  DA  G C4    1 
ATOM   4853 P P     . DA  G 3 15  ? -9.571  2.387   -47.797 1.00 47.72  ? 15  DA  G P     1 
ATOM   4854 O OP1   . DA  G 3 15  ? -8.553  1.337   -48.007 1.00 40.94  ? 15  DA  G OP1   1 
ATOM   4855 O OP2   . DA  G 3 15  ? -9.343  3.770   -48.285 1.00 48.72  ? 15  DA  G OP2   1 
ATOM   4856 O "O5'" . DA  G 3 15  ? -10.959 1.901   -48.426 1.00 41.88  ? 15  DA  G "O5'" 1 
ATOM   4857 C "C5'" . DA  G 3 15  ? -11.545 0.685   -48.010 1.00 42.13  ? 15  DA  G "C5'" 1 
ATOM   4858 C "C4'" . DA  G 3 15  ? -13.041 0.662   -48.319 1.00 48.12  ? 15  DA  G "C4'" 1 
ATOM   4859 O "O4'" . DA  G 3 15  ? -13.715 1.797   -47.698 1.00 45.77  ? 15  DA  G "O4'" 1 
ATOM   4860 C "C3'" . DA  G 3 15  ? -13.429 0.714   -49.809 1.00 48.30  ? 15  DA  G "C3'" 1 
ATOM   4861 O "O3'" . DA  G 3 15  ? -14.426 -0.272  -50.050 1.00 56.46  ? 15  DA  G "O3'" 1 
ATOM   4862 C "C2'" . DA  G 3 15  ? -14.024 2.113   -49.953 1.00 42.43  ? 15  DA  G "C2'" 1 
ATOM   4863 C "C1'" . DA  G 3 15  ? -14.674 2.264   -48.596 1.00 38.23  ? 15  DA  G "C1'" 1 
ATOM   4864 N N9    . DA  G 3 15  ? -15.026 3.628   -48.263 1.00 39.38  ? 15  DA  G N9    1 
ATOM   4865 C C8    . DA  G 3 15  ? -14.232 4.747   -48.331 1.00 36.82  ? 15  DA  G C8    1 
ATOM   4866 N N7    . DA  G 3 15  ? -14.855 5.858   -47.981 1.00 35.69  ? 15  DA  G N7    1 
ATOM   4867 C C5    . DA  G 3 15  ? -16.142 5.427   -47.663 1.00 39.34  ? 15  DA  G C5    1 
ATOM   4868 C C6    . DA  G 3 15  ? -17.305 6.105   -47.224 1.00 39.13  ? 15  DA  G C6    1 
ATOM   4869 N N6    . DA  G 3 15  ? -17.361 7.425   -47.004 1.00 40.75  ? 15  DA  G N6    1 
ATOM   4870 N N1    . DA  G 3 15  ? -18.410 5.370   -47.014 1.00 39.48  ? 15  DA  G N1    1 
ATOM   4871 C C2    . DA  G 3 15  ? -18.361 4.050   -47.230 1.00 39.51  ? 15  DA  G C2    1 
ATOM   4872 N N3    . DA  G 3 15  ? -17.342 3.302   -47.631 1.00 35.36  ? 15  DA  G N3    1 
ATOM   4873 C C4    . DA  G 3 15  ? -16.255 4.057   -47.835 1.00 40.01  ? 15  DA  G C4    1 
ATOM   4874 P P     . DG  G 3 16  ? -14.555 -1.018  -51.468 1.00 58.69  ? 16  DG  G P     1 
ATOM   4875 O OP1   . DG  G 3 16  ? -13.993 -2.385  -51.293 1.00 53.30  ? 16  DG  G OP1   1 
ATOM   4876 O OP2   . DG  G 3 16  ? -14.037 -0.110  -52.525 1.00 50.47  ? 16  DG  G OP2   1 
ATOM   4877 O "O5'" . DG  G 3 16  ? -16.128 -1.145  -51.643 1.00 47.23  ? 16  DG  G "O5'" 1 
ATOM   4878 C "C5'" . DG  G 3 16  ? -16.952 -1.251  -50.493 1.00 45.68  ? 16  DG  G "C5'" 1 
ATOM   4879 C "C4'" . DG  G 3 16  ? -18.294 -0.589  -50.739 1.00 51.82  ? 16  DG  G "C4'" 1 
ATOM   4880 O "O4'" . DG  G 3 16  ? -18.267 0.760   -50.265 1.00 48.58  ? 16  DG  G "O4'" 1 
ATOM   4881 C "C3'" . DG  G 3 16  ? -18.707 -0.502  -52.205 1.00 54.16  ? 16  DG  G "C3'" 1 
ATOM   4882 O "O3'" . DG  G 3 16  ? -19.699 -1.486  -52.454 1.00 58.56  ? 16  DG  G "O3'" 1 
ATOM   4883 C "C2'" . DG  G 3 16  ? -19.247 0.935   -52.379 1.00 51.03  ? 16  DG  G "C2'" 1 
ATOM   4884 C "C1'" . DG  G 3 16  ? -19.212 1.517   -50.970 1.00 46.69  ? 16  DG  G "C1'" 1 
ATOM   4885 N N9    . DG  G 3 16  ? -18.754 2.890   -50.917 1.00 42.69  ? 16  DG  G N9    1 
ATOM   4886 C C8    . DG  G 3 16  ? -17.467 3.310   -51.081 1.00 43.13  ? 16  DG  G C8    1 
ATOM   4887 N N7    . DG  G 3 16  ? -17.322 4.593   -50.944 1.00 44.34  ? 16  DG  G N7    1 
ATOM   4888 C C5    . DG  G 3 16  ? -18.590 5.052   -50.661 1.00 38.93  ? 16  DG  G C5    1 
ATOM   4889 C C6    . DG  G 3 16  ? -19.037 6.360   -50.425 1.00 39.34  ? 16  DG  G C6    1 
ATOM   4890 O O6    . DG  G 3 16  ? -18.382 7.394   -50.418 1.00 39.62  ? 16  DG  G O6    1 
ATOM   4891 N N1    . DG  G 3 16  ? -20.394 6.407   -50.174 1.00 43.07  ? 16  DG  G N1    1 
ATOM   4892 C C2    . DG  G 3 16  ? -21.222 5.319   -50.164 1.00 42.70  ? 16  DG  G C2    1 
ATOM   4893 N N2    . DG  G 3 16  ? -22.506 5.570   -49.897 1.00 43.01  ? 16  DG  G N2    1 
ATOM   4894 N N3    . DG  G 3 16  ? -20.815 4.070   -50.387 1.00 40.69  ? 16  DG  G N3    1 
ATOM   4895 C C4    . DG  G 3 16  ? -19.487 4.017   -50.629 1.00 40.44  ? 16  DG  G C4    1 
ATOM   4896 P P     . DT  G 3 17  ? -20.356 -1.666  -53.905 1.00 69.55  ? 17  DT  G P     1 
ATOM   4897 O OP1   . DT  G 3 17  ? -20.699 -3.105  -53.985 1.00 66.64  ? 17  DT  G OP1   1 
ATOM   4898 O OP2   . DT  G 3 17  ? -19.500 -1.039  -54.951 1.00 56.86  ? 17  DT  G OP2   1 
ATOM   4899 O "O5'" . DT  G 3 17  ? -21.694 -0.806  -53.793 1.00 58.09  ? 17  DT  G "O5'" 1 
ATOM   4900 C "C5'" . DT  G 3 17  ? -21.857 0.308   -54.618 1.00 56.74  ? 17  DT  G "C5'" 1 
ATOM   4901 C "C4'" . DT  G 3 17  ? -22.928 1.212   -54.075 1.00 57.79  ? 17  DT  G "C4'" 1 
ATOM   4902 O "O4'" . DT  G 3 17  ? -22.338 2.130   -53.143 1.00 56.34  ? 17  DT  G "O4'" 1 
ATOM   4903 C "C3'" . DT  G 3 17  ? -23.605 2.056   -55.135 1.00 64.61  ? 17  DT  G "C3'" 1 
ATOM   4904 O "O3'" . DT  G 3 17  ? -24.814 1.418   -55.517 1.00 69.35  ? 17  DT  G "O3'" 1 
ATOM   4905 C "C2'" . DT  G 3 17  ? -23.880 3.390   -54.434 1.00 60.27  ? 17  DT  G "C2'" 1 
ATOM   4906 C "C1'" . DT  G 3 17  ? -22.827 3.442   -53.350 1.00 54.72  ? 17  DT  G "C1'" 1 
ATOM   4907 N N1    . DT  G 3 17  ? -21.660 4.369   -53.620 1.00 50.03  ? 17  DT  G N1    1 
ATOM   4908 C C2    . DT  G 3 17  ? -21.833 5.733   -53.472 1.00 49.70  ? 17  DT  G C2    1 
ATOM   4909 O O2    . DT  G 3 17  ? -22.907 6.243   -53.182 1.00 50.12  ? 17  DT  G O2    1 
ATOM   4910 N N3    . DT  G 3 17  ? -20.698 6.488   -53.689 1.00 46.83  ? 17  DT  G N3    1 
ATOM   4911 C C4    . DT  G 3 17  ? -19.427 6.022   -54.007 1.00 47.21  ? 17  DT  G C4    1 
ATOM   4912 O O4    . DT  G 3 17  ? -18.462 6.776   -54.168 1.00 43.77  ? 17  DT  G O4    1 
ATOM   4913 C C5    . DT  G 3 17  ? -19.314 4.582   -54.132 1.00 48.97  ? 17  DT  G C5    1 
ATOM   4914 C C7    . DT  G 3 17  ? -17.993 3.961   -54.483 1.00 44.01  ? 17  DT  G C7    1 
ATOM   4915 C C6    . DT  G 3 17  ? -20.422 3.834   -53.928 1.00 48.08  ? 17  DT  G C6    1 
ATOM   4916 P P     . DG  G 3 18  ? -25.317 1.450   -57.034 1.00 74.97  ? 18  DG  G P     1 
ATOM   4917 O OP1   . DG  G 3 18  ? -26.658 0.840   -56.924 1.00 72.92  ? 18  DG  G OP1   1 
ATOM   4918 O OP2   . DG  G 3 18  ? -24.296 0.817   -57.917 1.00 67.26  ? 18  DG  G OP2   1 
ATOM   4919 O "O5'" . DG  G 3 18  ? -25.487 3.025   -57.351 1.00 62.08  ? 18  DG  G "O5'" 1 
ATOM   4920 C "C5'" . DG  G 3 18  ? -26.399 3.804   -56.570 1.00 58.96  ? 18  DG  G "C5'" 1 
ATOM   4921 C "C4'" . DG  G 3 18  ? -26.230 5.301   -56.811 1.00 63.88  ? 18  DG  G "C4'" 1 
ATOM   4922 O "O4'" . DG  G 3 18  ? -24.947 5.782   -56.310 1.00 67.71  ? 18  DG  G "O4'" 1 
ATOM   4923 C "C3'" . DG  G 3 18  ? -26.297 5.747   -58.274 1.00 66.77  ? 18  DG  G "C3'" 1 
ATOM   4924 O "O3'" . DG  G 3 18  ? -27.190 6.852   -58.381 1.00 71.48  ? 18  DG  G "O3'" 1 
ATOM   4925 C "C2'" . DG  G 3 18  ? -24.859 6.169   -58.576 1.00 61.59  ? 18  DG  G "C2'" 1 
ATOM   4926 C "C1'" . DG  G 3 18  ? -24.468 6.739   -57.228 1.00 61.46  ? 18  DG  G "C1'" 1 
ATOM   4927 N N9    . DG  G 3 18  ? -23.019 6.973   -57.055 1.00 53.68  ? 18  DG  G N9    1 
ATOM   4928 C C8    . DG  G 3 18  ? -21.982 6.092   -57.294 1.00 51.96  ? 18  DG  G C8    1 
ATOM   4929 N N7    . DG  G 3 18  ? -20.796 6.601   -57.062 1.00 45.47  ? 18  DG  G N7    1 
ATOM   4930 C C5    . DG  G 3 18  ? -21.061 7.904   -56.663 1.00 46.99  ? 18  DG  G C5    1 
ATOM   4931 C C6    . DG  G 3 18  ? -20.170 8.944   -56.290 1.00 47.45  ? 18  DG  G C6    1 
ATOM   4932 O O6    . DG  G 3 18  ? -18.926 8.915   -56.237 1.00 43.26  ? 18  DG  G O6    1 
ATOM   4933 N N1    . DG  G 3 18  ? -20.859 10.113  -55.954 1.00 47.66  ? 18  DG  G N1    1 
ATOM   4934 C C2    . DG  G 3 18  ? -22.235 10.255  -55.977 1.00 50.66  ? 18  DG  G C2    1 
ATOM   4935 N N2    . DG  G 3 18  ? -22.720 11.461  -55.614 1.00 49.97  ? 18  DG  G N2    1 
ATOM   4936 N N3    . DG  G 3 18  ? -23.078 9.290   -56.340 1.00 46.90  ? 18  DG  G N3    1 
ATOM   4937 C C4    . DG  G 3 18  ? -22.425 8.149   -56.659 1.00 48.18  ? 18  DG  G C4    1 
ATOM   4938 P P     . DG  G 3 19  ? -27.808 7.256   -59.807 1.00 78.60  ? 19  DG  G P     1 
ATOM   4939 O OP1   . DG  G 3 19  ? -29.061 8.025   -59.548 1.00 66.89  ? 19  DG  G OP1   1 
ATOM   4940 O OP2   . DG  G 3 19  ? -27.828 6.003   -60.624 1.00 58.22  ? 19  DG  G OP2   1 
ATOM   4941 O "O5'" . DG  G 3 19  ? -26.717 8.271   -60.406 1.00 70.21  ? 19  DG  G "O5'" 1 
ATOM   4942 C "C5'" . DG  G 3 19  ? -27.081 9.614   -60.699 1.00 66.38  ? 19  DG  G "C5'" 1 
ATOM   4943 C "C4'" . DG  G 3 19  ? -26.927 10.499  -59.486 1.00 58.65  ? 19  DG  G "C4'" 1 
ATOM   4944 O "O4'" . DG  G 3 19  ? -25.693 10.147  -58.802 1.00 67.19  ? 19  DG  G "O4'" 1 
ATOM   4945 C "C3'" . DG  G 3 19  ? -26.784 11.974  -59.805 1.00 59.30  ? 19  DG  G "C3'" 1 
ATOM   4946 O "O3'" . DG  G 3 19  ? -27.177 12.757  -58.681 1.00 61.20  ? 19  DG  G "O3'" 1 
ATOM   4947 C "C2'" . DG  G 3 19  ? -25.284 12.081  -60.048 1.00 59.42  ? 19  DG  G "C2'" 1 
ATOM   4948 C "C1'" . DG  G 3 19  ? -24.751 11.205  -58.929 1.00 56.11  ? 19  DG  G "C1'" 1 
ATOM   4949 N N9    . DG  G 3 19  ? -23.425 10.619  -59.186 1.00 54.63  ? 19  DG  G N9    1 
ATOM   4950 C C8    . DG  G 3 19  ? -23.152 9.318   -59.570 1.00 56.46  ? 19  DG  G C8    1 
ATOM   4951 N N7    . DG  G 3 19  ? -21.872 9.065   -59.711 1.00 49.53  ? 19  DG  G N7    1 
ATOM   4952 C C5    . DG  G 3 19  ? -21.257 10.268  -59.402 1.00 44.87  ? 19  DG  G C5    1 
ATOM   4953 C C6    . DG  G 3 19  ? -19.890 10.599  -59.387 1.00 46.39  ? 19  DG  G C6    1 
ATOM   4954 O O6    . DG  G 3 19  ? -18.912 9.866   -59.645 1.00 47.49  ? 19  DG  G O6    1 
ATOM   4955 N N1    . DG  G 3 19  ? -19.692 11.929  -59.025 1.00 48.15  ? 19  DG  G N1    1 
ATOM   4956 C C2    . DG  G 3 19  ? -20.691 12.826  -58.719 1.00 48.41  ? 19  DG  G C2    1 
ATOM   4957 N N2    . DG  G 3 19  ? -20.290 14.070  -58.394 1.00 46.77  ? 19  DG  G N2    1 
ATOM   4958 N N3    . DG  G 3 19  ? -21.986 12.530  -58.736 1.00 45.49  ? 19  DG  G N3    1 
ATOM   4959 C C4    . DG  G 3 19  ? -22.195 11.240  -59.080 1.00 47.33  ? 19  DG  G C4    1 
ATOM   4960 O "O5'" . DC  H 4 1   ? -11.241 17.261  -57.719 1.00 53.09  ? 1   DC  H "O5'" 1 
ATOM   4961 C "C5'" . DC  H 4 1   ? -12.174 16.737  -56.769 1.00 50.17  ? 1   DC  H "C5'" 1 
ATOM   4962 C "C4'" . DC  H 4 1   ? -13.606 17.049  -57.169 1.00 44.55  ? 1   DC  H "C4'" 1 
ATOM   4963 O "O4'" . DC  H 4 1   ? -14.012 16.163  -58.225 1.00 50.02  ? 1   DC  H "O4'" 1 
ATOM   4964 C "C3'" . DC  H 4 1   ? -14.622 16.805  -56.080 1.00 54.66  ? 1   DC  H "C3'" 1 
ATOM   4965 O "O3'" . DC  H 4 1   ? -14.688 17.936  -55.247 1.00 61.18  ? 1   DC  H "O3'" 1 
ATOM   4966 C "C2'" . DC  H 4 1   ? -15.919 16.596  -56.867 1.00 47.04  ? 1   DC  H "C2'" 1 
ATOM   4967 C "C1'" . DC  H 4 1   ? -15.412 15.922  -58.143 1.00 49.82  ? 1   DC  H "C1'" 1 
ATOM   4968 N N1    . DC  H 4 1   ? -15.644 14.437  -58.207 1.00 46.71  ? 1   DC  H N1    1 
ATOM   4969 C C2    . DC  H 4 1   ? -16.930 13.944  -58.419 1.00 50.66  ? 1   DC  H C2    1 
ATOM   4970 O O2    . DC  H 4 1   ? -17.880 14.748  -58.521 1.00 50.56  ? 1   DC  H O2    1 
ATOM   4971 N N3    . DC  H 4 1   ? -17.108 12.591  -58.494 1.00 49.71  ? 1   DC  H N3    1 
ATOM   4972 C C4    . DC  H 4 1   ? -16.060 11.765  -58.379 1.00 46.22  ? 1   DC  H C4    1 
ATOM   4973 N N4    . DC  H 4 1   ? -16.282 10.449  -58.459 1.00 45.79  ? 1   DC  H N4    1 
ATOM   4974 C C5    . DC  H 4 1   ? -14.746 12.255  -58.177 1.00 43.83  ? 1   DC  H C5    1 
ATOM   4975 C C6    . DC  H 4 1   ? -14.585 13.581  -58.098 1.00 47.49  ? 1   DC  H C6    1 
ATOM   4976 P P     . DC  H 4 2   ? -15.100 17.792  -53.704 1.00 49.71  ? 2   DC  H P     1 
ATOM   4977 O OP1   . DC  H 4 2   ? -14.801 19.135  -53.164 1.00 45.55  ? 2   DC  H OP1   1 
ATOM   4978 O OP2   . DC  H 4 2   ? -14.557 16.557  -53.103 1.00 47.60  ? 2   DC  H OP2   1 
ATOM   4979 O "O5'" . DC  H 4 2   ? -16.666 17.523  -53.749 1.00 45.25  ? 2   DC  H "O5'" 1 
ATOM   4980 C "C5'" . DC  H 4 2   ? -17.563 18.528  -54.152 1.00 46.20  ? 2   DC  H "C5'" 1 
ATOM   4981 C "C4'" . DC  H 4 2   ? -18.916 17.903  -54.281 1.00 49.92  ? 2   DC  H "C4'" 1 
ATOM   4982 O "O4'" . DC  H 4 2   ? -18.756 16.724  -55.073 1.00 54.40  ? 2   DC  H "O4'" 1 
ATOM   4983 C "C3'" . DC  H 4 2   ? -19.487 17.400  -52.972 1.00 56.84  ? 2   DC  H "C3'" 1 
ATOM   4984 O "O3'" . DC  H 4 2   ? -20.314 18.409  -52.381 1.00 63.01  ? 2   DC  H "O3'" 1 
ATOM   4985 C "C2'" . DC  H 4 2   ? -20.292 16.145  -53.374 1.00 53.15  ? 2   DC  H "C2'" 1 
ATOM   4986 C "C1'" . DC  H 4 2   ? -19.752 15.791  -54.756 1.00 47.28  ? 2   DC  H "C1'" 1 
ATOM   4987 N N1    . DC  H 4 2   ? -19.151 14.432  -54.858 1.00 45.46  ? 2   DC  H N1    1 
ATOM   4988 C C2    . DC  H 4 2   ? -19.980 13.325  -55.029 1.00 47.98  ? 2   DC  H C2    1 
ATOM   4989 O O2    . DC  H 4 2   ? -21.202 13.489  -55.056 1.00 52.82  ? 2   DC  H O2    1 
ATOM   4990 N N3    . DC  H 4 2   ? -19.424 12.099  -55.155 1.00 47.28  ? 2   DC  H N3    1 
ATOM   4991 C C4    . DC  H 4 2   ? -18.100 11.960  -55.123 1.00 47.84  ? 2   DC  H C4    1 
ATOM   4992 N N4    . DC  H 4 2   ? -17.605 10.724  -55.250 1.00 47.07  ? 2   DC  H N4    1 
ATOM   4993 C C5    . DC  H 4 2   ? -17.231 13.080  -54.969 1.00 45.26  ? 2   DC  H C5    1 
ATOM   4994 C C6    . DC  H 4 2   ? -17.794 14.286  -54.849 1.00 46.89  ? 2   DC  H C6    1 
ATOM   4995 P P     . DA  H 4 3   ? -21.264 18.077  -51.116 1.00 70.65  ? 3   DA  H P     1 
ATOM   4996 O OP1   . DA  H 4 3   ? -21.416 19.386  -50.414 1.00 64.78  ? 3   DA  H OP1   1 
ATOM   4997 O OP2   . DA  H 4 3   ? -20.684 16.956  -50.343 1.00 60.74  ? 3   DA  H OP2   1 
ATOM   4998 O "O5'" . DA  H 4 3   ? -22.652 17.566  -51.736 1.00 65.98  ? 3   DA  H "O5'" 1 
ATOM   4999 C "C5'" . DA  H 4 3   ? -23.571 16.877  -50.900 1.00 66.30  ? 3   DA  H "C5'" 1 
ATOM   5000 C "C4'" . DA  H 4 3   ? -23.897 15.511  -51.449 1.00 63.21  ? 3   DA  H "C4'" 1 
ATOM   5001 O "O4'" . DA  H 4 3   ? -22.703 14.837  -51.809 1.00 61.65  ? 3   DA  H "O4'" 1 
ATOM   5002 C "C3'" . DA  H 4 3   ? -24.498 14.553  -50.448 1.00 65.92  ? 3   DA  H "C3'" 1 
ATOM   5003 O "O3'" . DA  H 4 3   ? -25.843 14.778  -50.327 1.00 76.84  ? 3   DA  H "O3'" 1 
ATOM   5004 C "C2'" . DA  H 4 3   ? -24.194 13.174  -51.052 1.00 59.51  ? 3   DA  H "C2'" 1 
ATOM   5005 C "C1'" . DA  H 4 3   ? -23.083 13.498  -52.026 1.00 58.61  ? 3   DA  H "C1'" 1 
ATOM   5006 N N9    . DA  H 4 3   ? -21.928 12.626  -51.983 1.00 50.43  ? 3   DA  H N9    1 
ATOM   5007 C C8    . DA  H 4 3   ? -20.630 12.990  -51.821 1.00 47.76  ? 3   DA  H C8    1 
ATOM   5008 N N7    . DA  H 4 3   ? -19.790 11.989  -51.940 1.00 52.61  ? 3   DA  H N7    1 
ATOM   5009 C C5    . DA  H 4 3   ? -20.608 10.903  -52.224 1.00 48.38  ? 3   DA  H C5    1 
ATOM   5010 C C6    . DA  H 4 3   ? -20.337 9.543   -52.467 1.00 48.85  ? 3   DA  H C6    1 
ATOM   5011 N N6    . DA  H 4 3   ? -19.102 9.023   -52.451 1.00 46.47  ? 3   DA  H N6    1 
ATOM   5012 N N1    . DA  H 4 3   ? -21.391 8.731   -52.725 1.00 46.94  ? 3   DA  H N1    1 
ATOM   5013 C C2    . DA  H 4 3   ? -22.613 9.255   -52.734 1.00 45.83  ? 3   DA  H C2    1 
ATOM   5014 N N3    . DA  H 4 3   ? -22.983 10.513  -52.524 1.00 48.23  ? 3   DA  H N3    1 
ATOM   5015 C C4    . DA  H 4 3   ? -21.923 11.287  -52.269 1.00 47.55  ? 3   DA  H C4    1 
ATOM   5016 P P     . DC  H 4 4   ? -26.383 15.092  -48.863 1.00 85.07  ? 4   DC  H P     1 
ATOM   5017 O OP1   . DC  H 4 4   ? -27.863 15.065  -48.905 1.00 79.42  ? 4   DC  H OP1   1 
ATOM   5018 O OP2   . DC  H 4 4   ? -25.617 16.306  -48.437 1.00 74.80  ? 4   DC  H OP2   1 
ATOM   5019 O "O5'" . DC  H 4 4   ? -25.860 13.827  -48.014 1.00 77.60  ? 4   DC  H "O5'" 1 
ATOM   5020 C "C5'" . DC  H 4 4   ? -26.732 12.738  -47.769 1.00 68.60  ? 4   DC  H "C5'" 1 
ATOM   5021 C "C4'" . DC  H 4 4   ? -26.187 11.434  -48.334 1.00 68.13  ? 4   DC  H "C4'" 1 
ATOM   5022 O "O4'" . DC  H 4 4   ? -24.795 11.531  -48.682 1.00 65.90  ? 4   DC  H "O4'" 1 
ATOM   5023 C "C3'" . DC  H 4 4   ? -26.177 10.279  -47.365 1.00 66.80  ? 4   DC  H "C3'" 1 
ATOM   5024 O "O3'" . DC  H 4 4   ? -27.458 9.733   -47.267 1.00 62.75  ? 4   DC  H "O3'" 1 
ATOM   5025 C "C2'" . DC  H 4 4   ? -25.158 9.300   -48.009 1.00 58.34  ? 4   DC  H "C2'" 1 
ATOM   5026 C "C1'" . DC  H 4 4   ? -24.377 10.204  -48.969 1.00 58.60  ? 4   DC  H "C1'" 1 
ATOM   5027 N N1    . DC  H 4 4   ? -22.856 10.106  -48.913 1.00 53.13  ? 4   DC  H N1    1 
ATOM   5028 C C2    . DC  H 4 4   ? -22.193 8.890   -49.239 1.00 48.83  ? 4   DC  H C2    1 
ATOM   5029 O O2    . DC  H 4 4   ? -22.856 7.879   -49.510 1.00 46.27  ? 4   DC  H O2    1 
ATOM   5030 N N3    . DC  H 4 4   ? -20.833 8.855   -49.219 1.00 42.72  ? 4   DC  H N3    1 
ATOM   5031 C C4    . DC  H 4 4   ? -20.144 9.961   -48.919 1.00 49.18  ? 4   DC  H C4    1 
ATOM   5032 N N4    . DC  H 4 4   ? -18.801 9.889   -48.911 1.00 46.14  ? 4   DC  H N4    1 
ATOM   5033 C C5    . DC  H 4 4   ? -20.799 11.200  -48.609 1.00 52.86  ? 4   DC  H C5    1 
ATOM   5034 C C6    . DC  H 4 4   ? -22.135 11.227  -48.627 1.00 52.23  ? 4   DC  H C6    1 
ATOM   5035 P P     . DT  H 4 5   ? -27.889 8.948   -45.938 1.00 80.27  ? 5   DT  H P     1 
ATOM   5036 O OP1   . DT  H 4 5   ? -29.363 8.770   -46.026 1.00 82.02  ? 5   DT  H OP1   1 
ATOM   5037 O OP2   . DT  H 4 5   ? -27.236 9.598   -44.763 1.00 72.44  ? 5   DT  H OP2   1 
ATOM   5038 O "O5'" . DT  H 4 5   ? -27.258 7.505   -46.136 1.00 59.74  ? 5   DT  H "O5'" 1 
ATOM   5039 C "C5'" . DT  H 4 5   ? -27.478 6.841   -47.329 1.00 60.18  ? 5   DT  H "C5'" 1 
ATOM   5040 C "C4'" . DT  H 4 5   ? -26.601 5.631   -47.402 1.00 65.78  ? 5   DT  H "C4'" 1 
ATOM   5041 O "O4'" . DT  H 4 5   ? -25.202 6.016   -47.589 1.00 63.25  ? 5   DT  H "O4'" 1 
ATOM   5042 C "C3'" . DT  H 4 5   ? -26.639 4.771   -46.158 1.00 63.00  ? 5   DT  H "C3'" 1 
ATOM   5043 O "O3'" . DT  H 4 5   ? -26.707 3.440   -46.576 1.00 62.17  ? 5   DT  H "O3'" 1 
ATOM   5044 C "C2'" . DT  H 4 5   ? -25.303 5.104   -45.461 1.00 59.41  ? 5   DT  H "C2'" 1 
ATOM   5045 C "C1'" . DT  H 4 5   ? -24.399 5.322   -46.657 1.00 52.34  ? 5   DT  H "C1'" 1 
ATOM   5046 N N1    . DT  H 4 5   ? -23.163 6.149   -46.404 1.00 46.94  ? 5   DT  H N1    1 
ATOM   5047 C C2    . DT  H 4 5   ? -21.922 5.589   -46.623 1.00 43.82  ? 5   DT  H C2    1 
ATOM   5048 O O2    . DT  H 4 5   ? -21.762 4.437   -46.964 1.00 45.46  ? 5   DT  H O2    1 
ATOM   5049 N N3    . DT  H 4 5   ? -20.866 6.425   -46.412 1.00 42.38  ? 5   DT  H N3    1 
ATOM   5050 C C4    . DT  H 4 5   ? -20.913 7.750   -46.019 1.00 47.54  ? 5   DT  H C4    1 
ATOM   5051 O O4    . DT  H 4 5   ? -19.879 8.425   -45.848 1.00 44.41  ? 5   DT  H O4    1 
ATOM   5052 C C5    . DT  H 4 5   ? -22.255 8.283   -45.819 1.00 41.17  ? 5   DT  H C5    1 
ATOM   5053 C C7    . DT  H 4 5   ? -22.449 9.704   -45.398 1.00 43.84  ? 5   DT  H C7    1 
ATOM   5054 C C6    . DT  H 4 5   ? -23.293 7.466   -46.020 1.00 44.58  ? 5   DT  H C6    1 
ATOM   5055 P P     . DT  H 4 6   ? -27.236 2.303   -45.588 1.00 80.83  ? 6   DT  H P     1 
ATOM   5056 O OP1   . DT  H 4 6   ? -28.127 1.382   -46.342 1.00 76.50  ? 6   DT  H OP1   1 
ATOM   5057 O OP2   . DT  H 4 6   ? -27.731 3.013   -44.379 1.00 75.27  ? 6   DT  H OP2   1 
ATOM   5058 O "O5'" . DT  H 4 6   ? -25.901 1.496   -45.297 1.00 66.02  ? 6   DT  H "O5'" 1 
ATOM   5059 C "C5'" . DT  H 4 6   ? -24.803 1.732   -46.137 1.00 59.10  ? 6   DT  H "C5'" 1 
ATOM   5060 C "C4'" . DT  H 4 6   ? -23.851 0.582   -46.098 1.00 59.02  ? 6   DT  H "C4'" 1 
ATOM   5061 O "O4'" . DT  H 4 6   ? -22.517 1.097   -45.891 1.00 60.88  ? 6   DT  H "O4'" 1 
ATOM   5062 C "C3'" . DT  H 4 6   ? -24.054 -0.355  -44.945 1.00 60.79  ? 6   DT  H "C3'" 1 
ATOM   5063 O "O3'" . DT  H 4 6   ? -23.324 -1.529  -45.216 1.00 58.04  ? 6   DT  H "O3'" 1 
ATOM   5064 C "C2'" . DT  H 4 6   ? -23.409 0.456   -43.812 1.00 62.70  ? 6   DT  H "C2'" 1 
ATOM   5065 C "C1'" . DT  H 4 6   ? -22.159 0.968   -44.526 1.00 53.89  ? 6   DT  H "C1'" 1 
ATOM   5066 N N1    . DT  H 4 6   ? -21.635 2.296   -44.077 1.00 48.42  ? 6   DT  H N1    1 
ATOM   5067 C C2    . DT  H 4 6   ? -20.280 2.501   -44.146 1.00 47.97  ? 6   DT  H C2    1 
ATOM   5068 O O2    . DT  H 4 6   ? -19.496 1.637   -44.514 1.00 47.65  ? 6   DT  H O2    1 
ATOM   5069 N N3    . DT  H 4 6   ? -19.863 3.751   -43.761 1.00 45.39  ? 6   DT  H N3    1 
ATOM   5070 C C4    . DT  H 4 6   ? -20.653 4.806   -43.333 1.00 45.30  ? 6   DT  H C4    1 
ATOM   5071 O O4    . DT  H 4 6   ? -20.177 5.897   -43.006 1.00 44.38  ? 6   DT  H O4    1 
ATOM   5072 C C5    . DT  H 4 6   ? -22.073 4.538   -43.292 1.00 43.27  ? 6   DT  H C5    1 
ATOM   5073 C C7    . DT  H 4 6   ? -23.014 5.612   -42.837 1.00 35.10  ? 6   DT  H C7    1 
ATOM   5074 C C6    . DT  H 4 6   ? -22.500 3.309   -43.675 1.00 46.67  ? 6   DT  H C6    1 
ATOM   5075 P P     . DC  H 4 7   ? -23.946 -2.975  -44.909 1.00 75.33  ? 7   DC  H P     1 
ATOM   5076 O OP1   . DC  H 4 7   ? -23.679 -3.788  -46.118 1.00 70.93  ? 7   DC  H OP1   1 
ATOM   5077 O OP2   . DC  H 4 7   ? -25.310 -2.785  -44.340 1.00 76.92  ? 7   DC  H OP2   1 
ATOM   5078 O "O5'" . DC  H 4 7   ? -23.030 -3.577  -43.744 1.00 68.64  ? 7   DC  H "O5'" 1 
ATOM   5079 C "C5'" . DC  H 4 7   ? -21.631 -3.660  -43.918 1.00 65.44  ? 7   DC  H "C5'" 1 
ATOM   5080 C "C4'" . DC  H 4 7   ? -20.929 -3.280  -42.635 1.00 60.70  ? 7   DC  H "C4'" 1 
ATOM   5081 O "O4'" . DC  H 4 7   ? -20.989 -1.855  -42.437 1.00 60.83  ? 7   DC  H "O4'" 1 
ATOM   5082 C "C3'" . DC  H 4 7   ? -21.541 -3.879  -41.370 1.00 57.26  ? 7   DC  H "C3'" 1 
ATOM   5083 O "O3'" . DC  H 4 7   ? -20.576 -4.639  -40.726 1.00 61.82  ? 7   DC  H "O3'" 1 
ATOM   5084 C "C2'" . DC  H 4 7   ? -21.932 -2.659  -40.533 1.00 53.27  ? 7   DC  H "C2'" 1 
ATOM   5085 C "C1'" . DC  H 4 7   ? -20.954 -1.652  -41.060 1.00 51.62  ? 7   DC  H "C1'" 1 
ATOM   5086 N N1    . DC  H 4 7   ? -21.288 -0.256  -40.754 1.00 46.15  ? 7   DC  H N1    1 
ATOM   5087 C C2    . DC  H 4 7   ? -20.271 0.716   -40.800 1.00 47.94  ? 7   DC  H C2    1 
ATOM   5088 O O2    . DC  H 4 7   ? -19.095 0.374   -41.123 1.00 42.70  ? 7   DC  H O2    1 
ATOM   5089 N N3    . DC  H 4 7   ? -20.596 2.005   -40.500 1.00 45.92  ? 7   DC  H N3    1 
ATOM   5090 C C4    . DC  H 4 7   ? -21.854 2.321   -40.161 1.00 47.41  ? 7   DC  H C4    1 
ATOM   5091 N N4    . DC  H 4 7   ? -22.125 3.604   -39.870 1.00 44.17  ? 7   DC  H N4    1 
ATOM   5092 C C5    . DC  H 4 7   ? -22.888 1.338   -40.112 1.00 45.06  ? 7   DC  H C5    1 
ATOM   5093 C C6    . DC  H 4 7   ? -22.559 0.076   -40.407 1.00 44.49  ? 7   DC  H C6    1 
ATOM   5094 P P     . DA  H 4 8   ? -20.552 -6.225  -40.951 1.00 82.92  ? 8   DA  H P     1 
ATOM   5095 O OP1   . DA  H 4 8   ? -21.378 -6.504  -42.147 1.00 77.34  ? 8   DA  H OP1   1 
ATOM   5096 O OP2   . DA  H 4 8   ? -20.855 -6.856  -39.636 1.00 72.08  ? 8   DA  H OP2   1 
ATOM   5097 O "O5'" . DA  H 4 8   ? -19.033 -6.548  -41.313 1.00 65.35  ? 8   DA  H "O5'" 1 
ATOM   5098 C "C5'" . DA  H 4 8   ? -18.174 -6.942  -40.291 1.00 65.93  ? 8   DA  H "C5'" 1 
ATOM   5099 C "C4'" . DA  H 4 8   ? -17.037 -5.954  -40.110 1.00 68.28  ? 8   DA  H "C4'" 1 
ATOM   5100 O "O4'" . DA  H 4 8   ? -17.538 -4.590  -39.994 1.00 65.55  ? 8   DA  H "O4'" 1 
ATOM   5101 C "C3'" . DA  H 4 8   ? -16.220 -6.186  -38.857 1.00 64.36  ? 8   DA  H "C3'" 1 
ATOM   5102 O "O3'" . DA  H 4 8   ? -14.893 -5.907  -39.141 1.00 63.25  ? 8   DA  H "O3'" 1 
ATOM   5103 C "C2'" . DA  H 4 8   ? -16.817 -5.175  -37.881 1.00 60.26  ? 8   DA  H "C2'" 1 
ATOM   5104 C "C1'" . DA  H 4 8   ? -17.026 -4.008  -38.813 1.00 54.42  ? 8   DA  H "C1'" 1 
ATOM   5105 N N9    . DA  H 4 8   ? -17.974 -3.006  -38.344 1.00 47.12  ? 8   DA  H N9    1 
ATOM   5106 C C8    . DA  H 4 8   ? -19.264 -3.200  -37.946 1.00 51.26  ? 8   DA  H C8    1 
ATOM   5107 N N7    . DA  H 4 8   ? -19.893 -2.089  -37.611 1.00 47.26  ? 8   DA  H N7    1 
ATOM   5108 C C5    . DA  H 4 8   ? -18.950 -1.104  -37.820 1.00 41.30  ? 8   DA  H C5    1 
ATOM   5109 C C6    . DA  H 4 8   ? -18.986 0.292   -37.655 1.00 37.31  ? 8   DA  H C6    1 
ATOM   5110 N N6    . DA  H 4 8   ? -20.055 0.963   -37.237 1.00 37.48  ? 8   DA  H N6    1 
ATOM   5111 N N1    . DA  H 4 8   ? -17.872 0.976   -37.955 1.00 41.10  ? 8   DA  H N1    1 
ATOM   5112 C C2    . DA  H 4 8   ? -16.788 0.306   -38.398 1.00 43.83  ? 8   DA  H C2    1 
ATOM   5113 N N3    . DA  H 4 8   ? -16.630 -1.003  -38.588 1.00 43.44  ? 8   DA  H N3    1 
ATOM   5114 C C4    . DA  H 4 8   ? -17.762 -1.656  -38.281 1.00 45.11  ? 8   DA  H C4    1 
ATOM   5115 P P     . DA  H 4 9   ? -13.833 -7.098  -39.058 1.00 83.19  ? 9   DA  H P     1 
ATOM   5116 O OP1   . DA  H 4 9   ? -13.180 -7.196  -40.393 1.00 84.10  ? 9   DA  H OP1   1 
ATOM   5117 O OP2   . DA  H 4 9   ? -14.576 -8.229  -38.452 1.00 70.79  ? 9   DA  H OP2   1 
ATOM   5118 O "O5'" . DA  H 4 9   ? -12.775 -6.584  -37.983 1.00 69.27  ? 9   DA  H "O5'" 1 
ATOM   5119 C "C5'" . DA  H 4 9   ? -13.207 -5.676  -37.009 1.00 61.83  ? 9   DA  H "C5'" 1 
ATOM   5120 C "C4'" . DA  H 4 9   ? -12.404 -4.405  -37.080 1.00 55.65  ? 9   DA  H "C4'" 1 
ATOM   5121 O "O4'" . DA  H 4 9   ? -13.313 -3.281  -37.146 1.00 51.57  ? 9   DA  H "O4'" 1 
ATOM   5122 C "C3'" . DA  H 4 9   ? -11.583 -4.172  -35.842 1.00 58.41  ? 9   DA  H "C3'" 1 
ATOM   5123 O "O3'" . DA  H 4 9   ? -10.480 -3.340  -36.122 1.00 59.24  ? 9   DA  H "O3'" 1 
ATOM   5124 C "C2'" . DA  H 4 9   ? -12.596 -3.514  -34.904 1.00 54.14  ? 9   DA  H "C2'" 1 
ATOM   5125 C "C1'" . DA  H 4 9   ? -13.453 -2.693  -35.867 1.00 49.80  ? 9   DA  H "C1'" 1 
ATOM   5126 N N9    . DA  H 4 9   ? -14.885 -2.636  -35.503 1.00 45.38  ? 9   DA  H N9    1 
ATOM   5127 C C8    . DA  H 4 9   ? -15.721 -3.687  -35.276 1.00 47.79  ? 9   DA  H C8    1 
ATOM   5128 N N7    . DA  H 4 9   ? -16.950 -3.331  -34.954 1.00 43.99  ? 9   DA  H N7    1 
ATOM   5129 C C5    . DA  H 4 9   ? -16.910 -1.949  -34.954 1.00 39.66  ? 9   DA  H C5    1 
ATOM   5130 C C6    . DA  H 4 9   ? -17.892 -0.962  -34.693 1.00 41.08  ? 9   DA  H C6    1 
ATOM   5131 N N6    . DA  H 4 9   ? -19.161 -1.242  -34.373 1.00 39.83  ? 9   DA  H N6    1 
ATOM   5132 N N1    . DA  H 4 9   ? -17.516 0.332   -34.775 1.00 39.69  ? 9   DA  H N1    1 
ATOM   5133 C C2    . DA  H 4 9   ? -16.254 0.611   -35.097 1.00 38.76  ? 9   DA  H C2    1 
ATOM   5134 N N3    . DA  H 4 9   ? -15.257 -0.226  -35.372 1.00 39.15  ? 9   DA  H N3    1 
ATOM   5135 C C4    . DA  H 4 9   ? -15.650 -1.501  -35.281 1.00 39.52  ? 9   DA  H C4    1 
ATOM   5136 P P     . DA  H 4 10  ? -9.276  -3.230  -35.057 1.00 72.05  ? 10  DA  H P     1 
ATOM   5137 O OP1   . DA  H 4 10  ? -8.127  -2.712  -35.840 1.00 67.50  ? 10  DA  H OP1   1 
ATOM   5138 O OP2   . DA  H 4 10  ? -9.172  -4.477  -34.248 1.00 64.36  ? 10  DA  H OP2   1 
ATOM   5139 O "O5'" . DA  H 4 10  ? -9.712  -2.021  -34.120 1.00 50.28  ? 10  DA  H "O5'" 1 
ATOM   5140 C "C5'" . DA  H 4 10  ? -9.723  -0.745  -34.672 1.00 48.58  ? 10  DA  H "C5'" 1 
ATOM   5141 C "C4'" . DA  H 4 10  ? -10.446 0.212   -33.784 1.00 43.70  ? 10  DA  H "C4'" 1 
ATOM   5142 O "O4'" . DA  H 4 10  ? -11.837 -0.160  -33.680 1.00 47.77  ? 10  DA  H "O4'" 1 
ATOM   5143 C "C3'" . DA  H 4 10  ? -9.906  0.269   -32.381 1.00 41.05  ? 10  DA  H "C3'" 1 
ATOM   5144 O "O3'" . DA  H 4 10  ? -9.501  1.580   -32.150 1.00 45.53  ? 10  DA  H "O3'" 1 
ATOM   5145 C "C2'" . DA  H 4 10  ? -11.096 -0.163  -31.494 1.00 44.29  ? 10  DA  H "C2'" 1 
ATOM   5146 C "C1'" . DA  H 4 10  ? -12.291 0.134   -32.398 1.00 44.95  ? 10  DA  H "C1'" 1 
ATOM   5147 N N9    . DA  H 4 10  ? -13.476 -0.684  -32.135 1.00 38.25  ? 10  DA  H N9    1 
ATOM   5148 C C8    . DA  H 4 10  ? -13.537 -2.043  -32.079 1.00 39.64  ? 10  DA  H C8    1 
ATOM   5149 N N7    . DA  H 4 10  ? -14.739 -2.510  -31.839 1.00 38.74  ? 10  DA  H N7    1 
ATOM   5150 C C5    . DA  H 4 10  ? -15.523 -1.375  -31.723 1.00 37.49  ? 10  DA  H C5    1 
ATOM   5151 C C6    . DA  H 4 10  ? -16.905 -1.187  -31.466 1.00 37.78  ? 10  DA  H C6    1 
ATOM   5152 N N6    . DA  H 4 10  ? -17.768 -2.193  -31.283 1.00 35.59  ? 10  DA  H N6    1 
ATOM   5153 N N1    . DA  H 4 10  ? -17.364 0.079   -31.414 1.00 36.71  ? 10  DA  H N1    1 
ATOM   5154 C C2    . DA  H 4 10  ? -16.504 1.081   -31.621 1.00 38.13  ? 10  DA  H C2    1 
ATOM   5155 N N3    . DA  H 4 10  ? -15.191 1.027   -31.883 1.00 40.04  ? 10  DA  H N3    1 
ATOM   5156 C C4    . DA  H 4 10  ? -14.760 -0.241  -31.912 1.00 37.75  ? 10  DA  H C4    1 
ATOM   5157 P P     . DG  H 4 11  ? -8.693  1.966   -30.824 1.00 62.10  ? 11  DG  H P     1 
ATOM   5158 O OP1   . DG  H 4 11  ? -7.666  3.001   -31.131 1.00 52.30  ? 11  DG  H OP1   1 
ATOM   5159 O OP2   . DG  H 4 11  ? -8.270  0.700   -30.151 1.00 46.98  ? 11  DG  H OP2   1 
ATOM   5160 O "O5'" . DG  H 4 11  ? -9.833  2.648   -29.959 1.00 45.11  ? 11  DG  H "O5'" 1 
ATOM   5161 C "C5'" . DG  H 4 11  ? -10.192 2.054   -28.770 1.00 44.25  ? 11  DG  H "C5'" 1 
ATOM   5162 C "C4'" . DG  H 4 11  ? -11.530 2.535   -28.359 1.00 39.21  ? 11  DG  H "C4'" 1 
ATOM   5163 O "O4'" . DG  H 4 11  ? -12.513 1.873   -29.168 1.00 39.19  ? 11  DG  H "O4'" 1 
ATOM   5164 C "C3'" . DG  H 4 11  ? -11.918 2.163   -26.949 1.00 43.42  ? 11  DG  H "C3'" 1 
ATOM   5165 O "O3'" . DG  H 4 11  ? -11.291 3.048   -25.933 1.00 46.54  ? 11  DG  H "O3'" 1 
ATOM   5166 C "C2'" . DG  H 4 11  ? -13.416 2.312   -27.021 1.00 48.30  ? 11  DG  H "C2'" 1 
ATOM   5167 C "C1'" . DG  H 4 11  ? -13.715 1.801   -28.436 1.00 44.87  ? 11  DG  H "C1'" 1 
ATOM   5168 N N9    . DG  H 4 11  ? -14.250 0.441   -28.448 1.00 42.30  ? 11  DG  H N9    1 
ATOM   5169 C C8    . DG  H 4 11  ? -13.576 -0.742  -28.665 1.00 43.44  ? 11  DG  H C8    1 
ATOM   5170 N N7    . DG  H 4 11  ? -14.354 -1.803  -28.586 1.00 42.16  ? 11  DG  H N7    1 
ATOM   5171 C C5    . DG  H 4 11  ? -15.614 -1.275  -28.296 1.00 38.36  ? 11  DG  H C5    1 
ATOM   5172 C C6    . DG  H 4 11  ? -16.867 -1.923  -28.100 1.00 38.52  ? 11  DG  H C6    1 
ATOM   5173 O O6    . DG  H 4 11  ? -17.135 -3.129  -28.152 1.00 38.24  ? 11  DG  H O6    1 
ATOM   5174 N N1    . DG  H 4 11  ? -17.871 -1.012  -27.812 1.00 39.66  ? 11  DG  H N1    1 
ATOM   5175 C C2    . DG  H 4 11  ? -17.698 0.357   -27.727 1.00 41.37  ? 11  DG  H C2    1 
ATOM   5176 N N2    . DG  H 4 11  ? -18.795 1.074   -27.431 1.00 42.86  ? 11  DG  H N2    1 
ATOM   5177 N N3    . DG  H 4 11  ? -16.543 0.977   -27.926 1.00 34.30  ? 11  DG  H N3    1 
ATOM   5178 C C4    . DG  H 4 11  ? -15.553 0.102   -28.201 1.00 37.18  ? 11  DG  H C4    1 
ATOM   5179 P P     . DG  H 4 12  ? -11.727 4.585   -25.707 1.00 44.71  ? 12  DG  H P     1 
ATOM   5180 O OP1   . DG  H 4 12  ? -11.827 5.278   -26.997 1.00 53.16  ? 12  DG  H OP1   1 
ATOM   5181 O OP2   . DG  H 4 12  ? -10.793 5.100   -24.699 1.00 37.47  ? 12  DG  H OP2   1 
ATOM   5182 O "O5'" . DG  H 4 12  ? -13.196 4.542   -25.085 1.00 38.43  ? 12  DG  H "O5'" 1 
ATOM   5183 C "C5'" . DG  H 4 12  ? -13.993 5.682   -25.161 1.00 36.23  ? 12  DG  H "C5'" 1 
ATOM   5184 C "C4'" . DG  H 4 12  ? -15.371 5.409   -24.619 1.00 40.66  ? 12  DG  H "C4'" 1 
ATOM   5185 O "O4'" . DG  H 4 12  ? -15.822 4.088   -25.030 1.00 42.92  ? 12  DG  H "O4'" 1 
ATOM   5186 C "C3'" . DG  H 4 12  ? -15.470 5.428   -23.103 1.00 40.15  ? 12  DG  H "C3'" 1 
ATOM   5187 O "O3'" . DG  H 4 12  ? -16.640 6.104   -22.740 1.00 41.42  ? 12  DG  H "O3'" 1 
ATOM   5188 C "C2'" . DG  H 4 12  ? -15.543 3.946   -22.740 1.00 40.23  ? 12  DG  H "C2'" 1 
ATOM   5189 C "C1'" . DG  H 4 12  ? -16.313 3.388   -23.910 1.00 38.02  ? 12  DG  H "C1'" 1 
ATOM   5190 N N9    . DG  H 4 12  ? -16.091 1.973   -24.140 1.00 36.69  ? 12  DG  H N9    1 
ATOM   5191 C C8    . DG  H 4 12  ? -14.909 1.377   -24.462 1.00 37.36  ? 12  DG  H C8    1 
ATOM   5192 N N7    . DG  H 4 12  ? -15.007 0.091   -24.660 1.00 40.01  ? 12  DG  H N7    1 
ATOM   5193 C C5    . DG  H 4 12  ? -16.345 -0.185  -24.442 1.00 37.05  ? 12  DG  H C5    1 
ATOM   5194 C C6    . DG  H 4 12  ? -17.046 -1.413  -24.509 1.00 38.01  ? 12  DG  H C6    1 
ATOM   5195 O O6    . DG  H 4 12  ? -16.605 -2.535  -24.772 1.00 39.19  ? 12  DG  H O6    1 
ATOM   5196 N N1    . DG  H 4 12  ? -18.397 -1.250  -24.235 1.00 40.53  ? 12  DG  H N1    1 
ATOM   5197 C C2    . DG  H 4 12  ? -18.997 -0.051  -23.940 1.00 42.73  ? 12  DG  H C2    1 
ATOM   5198 N N2    . DG  H 4 12  ? -20.317 -0.090  -23.705 1.00 44.75  ? 12  DG  H N2    1 
ATOM   5199 N N3    . DG  H 4 12  ? -18.348 1.109   -23.874 1.00 42.54  ? 12  DG  H N3    1 
ATOM   5200 C C4    . DG  H 4 12  ? -17.031 0.966   -24.133 1.00 37.45  ? 12  DG  H C4    1 
ATOM   5201 P P     . DT  H 4 13  ? -16.912 6.494   -21.216 1.00 46.76  ? 13  DT  H P     1 
ATOM   5202 O OP1   . DT  H 4 13  ? -17.557 7.837   -21.246 1.00 35.95  ? 13  DT  H OP1   1 
ATOM   5203 O OP2   . DT  H 4 13  ? -15.627 6.322   -20.455 1.00 36.91  ? 13  DT  H OP2   1 
ATOM   5204 O "O5'" . DT  H 4 13  ? -17.986 5.378   -20.746 1.00 41.08  ? 13  DT  H "O5'" 1 
ATOM   5205 C "C5'" . DT  H 4 13  ? -18.080 5.026   -19.347 1.00 44.98  ? 13  DT  H "C5'" 1 
ATOM   5206 C "C4'" . DT  H 4 13  ? -19.136 3.969   -19.099 1.00 37.41  ? 13  DT  H "C4'" 1 
ATOM   5207 O "O4'" . DT  H 4 13  ? -19.214 3.108   -20.258 1.00 39.24  ? 13  DT  H "O4'" 1 
ATOM   5208 C "C3'" . DT  H 4 13  ? -18.814 2.934   -18.036 1.00 45.46  ? 13  DT  H "C3'" 1 
ATOM   5209 O "O3'" . DT  H 4 13  ? -18.694 3.398   -16.612 1.00 41.85  ? 13  DT  H "O3'" 1 
ATOM   5210 C "C2'" . DT  H 4 13  ? -19.918 1.944   -18.328 1.00 38.27  ? 13  DT  H "C2'" 1 
ATOM   5211 C "C1'" . DT  H 4 13  ? -19.676 1.819   -19.829 1.00 38.74  ? 13  DT  H "C1'" 1 
ATOM   5212 N N1    . DT  H 4 13  ? -18.648 0.775   -20.192 1.00 36.92  ? 13  DT  H N1    1 
ATOM   5213 C C2    . DT  H 4 13  ? -19.046 -0.537  -20.302 1.00 41.71  ? 13  DT  H C2    1 
ATOM   5214 O O2    . DT  H 4 13  ? -20.193 -0.904  -20.122 1.00 44.27  ? 13  DT  H O2    1 
ATOM   5215 N N3    . DT  H 4 13  ? -18.047 -1.417  -20.638 1.00 40.84  ? 13  DT  H N3    1 
ATOM   5216 C C4    . DT  H 4 13  ? -16.718 -1.122  -20.873 1.00 37.50  ? 13  DT  H C4    1 
ATOM   5217 O O4    . DT  H 4 13  ? -15.896 -1.978  -21.188 1.00 38.91  ? 13  DT  H O4    1 
ATOM   5218 C C5    . DT  H 4 13  ? -16.363 0.262   -20.737 1.00 34.73  ? 13  DT  H C5    1 
ATOM   5219 C C7    . DT  H 4 13  ? -14.945 0.688   -20.970 1.00 32.51  ? 13  DT  H C7    1 
ATOM   5220 C C6    . DT  H 4 13  ? -17.332 1.139   -20.410 1.00 34.41  ? 13  DT  H C6    1 
ATOM   5221 P P     . DG  H 4 14  ? -19.723 4.394   -15.912 1.00 44.85  ? 14  DG  H P     1 
ATOM   5222 O OP1   . DG  H 4 14  ? -19.977 5.589   -16.756 1.00 44.18  ? 14  DG  H OP1   1 
ATOM   5223 O OP2   . DG  H 4 14  ? -19.034 4.661   -14.651 1.00 38.08  ? 14  DG  H OP2   1 
ATOM   5224 O "O5'" . DG  H 4 14  ? -21.068 3.488   -15.738 1.00 48.84  ? 14  DG  H "O5'" 1 
ATOM   5225 C "C5'" . DG  H 4 14  ? -21.520 3.004   -14.423 1.00 43.15  ? 14  DG  H "C5'" 1 
ATOM   5226 C "C4'" . DG  H 4 14  ? -21.736 1.480   -14.388 1.00 39.52  ? 14  DG  H "C4'" 1 
ATOM   5227 O "O4'" . DG  H 4 14  ? -21.159 0.886   -15.566 1.00 44.52  ? 14  DG  H "O4'" 1 
ATOM   5228 C "C3'" . DG  H 4 14  ? -21.038 0.769   -13.237 1.00 47.08  ? 14  DG  H "C3'" 1 
ATOM   5229 O "O3'" . DG  H 4 14  ? -21.874 0.653   -12.048 1.00 48.25  ? 14  DG  H "O3'" 1 
ATOM   5230 C "C2'" . DG  H 4 14  ? -20.657 -0.594  -13.802 1.00 46.75  ? 14  DG  H "C2'" 1 
ATOM   5231 C "C1'" . DG  H 4 14  ? -20.702 -0.428  -15.295 1.00 40.77  ? 14  DG  H "C1'" 1 
ATOM   5232 N N9    . DG  H 4 14  ? -19.403 -0.618  -15.908 1.00 35.42  ? 14  DG  H N9    1 
ATOM   5233 C C8    . DG  H 4 14  ? -18.419 0.317   -16.031 1.00 36.46  ? 14  DG  H C8    1 
ATOM   5234 N N7    . DG  H 4 14  ? -17.358 -0.125  -16.644 1.00 37.86  ? 14  DG  H N7    1 
ATOM   5235 C C5    . DG  H 4 14  ? -17.648 -1.454  -16.924 1.00 38.28  ? 14  DG  H C5    1 
ATOM   5236 C C6    . DG  H 4 14  ? -16.858 -2.455  -17.568 1.00 39.26  ? 14  DG  H C6    1 
ATOM   5237 O O6    . DG  H 4 14  ? -15.714 -2.360  -18.030 1.00 36.97  ? 14  DG  H O6    1 
ATOM   5238 N N1    . DG  H 4 14  ? -17.527 -3.665  -17.646 1.00 43.37  ? 14  DG  H N1    1 
ATOM   5239 C C2    . DG  H 4 14  ? -18.796 -3.890  -17.162 1.00 46.11  ? 14  DG  H C2    1 
ATOM   5240 N N2    . DG  H 4 14  ? -19.275 -5.134  -17.330 1.00 48.81  ? 14  DG  H N2    1 
ATOM   5241 N N3    . DG  H 4 14  ? -19.546 -2.960  -16.555 1.00 41.31  ? 14  DG  H N3    1 
ATOM   5242 C C4    . DG  H 4 14  ? -18.907 -1.773  -16.473 1.00 37.27  ? 14  DG  H C4    1 
ATOM   5243 P P     . DT  H 4 15  ? -23.089 -0.399  -11.934 1.00 59.67  ? 15  DT  H P     1 
ATOM   5244 O OP1   . DT  H 4 15  ? -23.946 -0.135  -13.099 1.00 56.67  ? 15  DT  H OP1   1 
ATOM   5245 O OP2   . DT  H 4 15  ? -23.630 -0.288  -10.554 1.00 53.35  ? 15  DT  H OP2   1 
ATOM   5246 O "O5'" . DT  H 4 15  ? -22.494 -1.873  -12.155 1.00 40.92  ? 15  DT  H "O5'" 1 
ATOM   5247 C "C5'" . DT  H 4 15  ? -23.166 -2.734  -13.051 1.00 42.22  ? 15  DT  H "C5'" 1 
ATOM   5248 C "C4'" . DT  H 4 15  ? -22.588 -4.136  -13.064 1.00 48.04  ? 15  DT  H "C4'" 1 
ATOM   5249 O "O4'" . DT  H 4 15  ? -21.333 -4.174  -13.781 1.00 52.30  ? 15  DT  H "O4'" 1 
ATOM   5250 C "C3'" . DT  H 4 15  ? -22.345 -4.753  -11.708 1.00 52.91  ? 15  DT  H "C3'" 1 
ATOM   5251 O "O3'" . DT  H 4 15  ? -23.126 -5.940  -11.618 1.00 58.37  ? 15  DT  H "O3'" 1 
ATOM   5252 C "C2'" . DT  H 4 15  ? -20.822 -5.024  -11.666 1.00 49.16  ? 15  DT  H "C2'" 1 
ATOM   5253 C "C1'" . DT  H 4 15  ? -20.420 -5.025  -13.134 1.00 43.62  ? 15  DT  H "C1'" 1 
ATOM   5254 N N1    . DT  H 4 15  ? -19.061 -4.477  -13.425 1.00 40.49  ? 15  DT  H N1    1 
ATOM   5255 C C2    . DT  H 4 15  ? -18.164 -5.237  -14.147 1.00 46.81  ? 15  DT  H C2    1 
ATOM   5256 O O2    . DT  H 4 15  ? -18.399 -6.380  -14.519 1.00 47.79  ? 15  DT  H O2    1 
ATOM   5257 N N3    . DT  H 4 15  ? -16.951 -4.614  -14.402 1.00 46.06  ? 15  DT  H N3    1 
ATOM   5258 C C4    . DT  H 4 15  ? -16.573 -3.321  -14.039 1.00 42.60  ? 15  DT  H C4    1 
ATOM   5259 O O4    . DT  H 4 15  ? -15.474 -2.843  -14.334 1.00 36.45  ? 15  DT  H O4    1 
ATOM   5260 C C5    . DT  H 4 15  ? -17.580 -2.571  -13.306 1.00 40.83  ? 15  DT  H C5    1 
ATOM   5261 C C7    . DT  H 4 15  ? -17.295 -1.163  -12.859 1.00 36.54  ? 15  DT  H C7    1 
ATOM   5262 C C6    . DT  H 4 15  ? -18.758 -3.179  -13.046 1.00 39.09  ? 15  DT  H C6    1 
ATOM   5263 P P     . DG  H 4 16  ? -23.558 -6.533  -10.190 1.00 75.74  ? 16  DG  H P     1 
ATOM   5264 O OP1   . DG  H 4 16  ? -24.889 -7.159  -10.405 1.00 61.21  ? 16  DG  H OP1   1 
ATOM   5265 O OP2   . DG  H 4 16  ? -23.362 -5.502  -9.128  1.00 59.88  ? 16  DG  H OP2   1 
ATOM   5266 O "O5'" . DG  H 4 16  ? -22.481 -7.683  -9.965  1.00 60.78  ? 16  DG  H "O5'" 1 
ATOM   5267 C "C5'" . DG  H 4 16  ? -22.293 -8.643  -10.983 1.00 59.45  ? 16  DG  H "C5'" 1 
ATOM   5268 C "C4'" . DG  H 4 16  ? -21.005 -9.377  -10.757 1.00 60.77  ? 16  DG  H "C4'" 1 
ATOM   5269 O "O4'" . DG  H 4 16  ? -19.889 -8.541  -11.154 1.00 61.90  ? 16  DG  H "O4'" 1 
ATOM   5270 C "C3'" . DG  H 4 16  ? -20.763 -9.769  -9.306  1.00 65.64  ? 16  DG  H "C3'" 1 
ATOM   5271 O "O3'" . DG  H 4 16  ? -20.466 -11.150 -9.272  1.00 68.21  ? 16  DG  H "O3'" 1 
ATOM   5272 C "C2'" . DG  H 4 16  ? -19.580 -8.875  -8.864  1.00 60.79  ? 16  DG  H "C2'" 1 
ATOM   5273 C "C1'" . DG  H 4 16  ? -18.868 -8.607  -10.183 1.00 58.50  ? 16  DG  H "C1'" 1 
ATOM   5274 N N9    . DG  H 4 16  ? -18.120 -7.344  -10.241 1.00 50.60  ? 16  DG  H N9    1 
ATOM   5275 C C8    . DG  H 4 16  ? -18.468 -6.138  -9.675  1.00 51.78  ? 16  DG  H C8    1 
ATOM   5276 N N7    . DG  H 4 16  ? -17.614 -5.172  -9.929  1.00 45.90  ? 16  DG  H N7    1 
ATOM   5277 C C5    . DG  H 4 16  ? -16.649 -5.777  -10.723 1.00 44.95  ? 16  DG  H C5    1 
ATOM   5278 C C6    . DG  H 4 16  ? -15.474 -5.235  -11.304 1.00 46.15  ? 16  DG  H C6    1 
ATOM   5279 O O6    . DG  H 4 16  ? -15.042 -4.073  -11.229 1.00 41.91  ? 16  DG  H O6    1 
ATOM   5280 N N1    . DG  H 4 16  ? -14.767 -6.194  -12.033 1.00 48.70  ? 16  DG  H N1    1 
ATOM   5281 C C2    . DG  H 4 16  ? -15.155 -7.512  -12.182 1.00 50.06  ? 16  DG  H C2    1 
ATOM   5282 N N2    . DG  H 4 16  ? -14.345 -8.294  -12.926 1.00 48.09  ? 16  DG  H N2    1 
ATOM   5283 N N3    . DG  H 4 16  ? -16.252 -8.030  -11.633 1.00 46.59  ? 16  DG  H N3    1 
ATOM   5284 C C4    . DG  H 4 16  ? -16.947 -7.111  -10.925 1.00 45.49  ? 16  DG  H C4    1 
ATOM   5285 P P     . DA  H 4 17  ? -20.285 -11.941 -7.888  1.00 81.68  ? 17  DA  H P     1 
ATOM   5286 O OP1   . DA  H 4 17  ? -21.334 -12.992 -7.889  1.00 70.86  ? 17  DA  H OP1   1 
ATOM   5287 O OP2   . DA  H 4 17  ? -20.208 -11.000 -6.744  1.00 69.06  ? 17  DA  H OP2   1 
ATOM   5288 O "O5'" . DA  H 4 17  ? -18.853 -12.617 -8.099  1.00 72.69  ? 17  DA  H "O5'" 1 
ATOM   5289 C "C5'" . DA  H 4 17  ? -18.490 -13.034 -9.424  1.00 72.89  ? 17  DA  H "C5'" 1 
ATOM   5290 C "C4'" . DA  H 4 17  ? -16.983 -13.160 -9.579  1.00 70.86  ? 17  DA  H "C4'" 1 
ATOM   5291 O "O4'" . DA  H 4 17  ? -16.396 -11.849 -9.796  1.00 67.57  ? 17  DA  H "O4'" 1 
ATOM   5292 C "C3'" . DA  H 4 17  ? -16.264 -13.748 -8.378  1.00 73.55  ? 17  DA  H "C3'" 1 
ATOM   5293 O "O3'" . DA  H 4 17  ? -15.181 -14.557 -8.820  1.00 73.92  ? 17  DA  H "O3'" 1 
ATOM   5294 C "C2'" . DA  H 4 17  ? -15.783 -12.504 -7.629  1.00 70.96  ? 17  DA  H "C2'" 1 
ATOM   5295 C "C1'" . DA  H 4 17  ? -15.454 -11.568 -8.783  1.00 62.42  ? 17  DA  H "C1'" 1 
ATOM   5296 N N9    . DA  H 4 17  ? -15.550 -10.149 -8.447  1.00 55.84  ? 17  DA  H N9    1 
ATOM   5297 C C8    . DA  H 4 17  ? -16.525 -9.530  -7.707  1.00 56.60  ? 17  DA  H C8    1 
ATOM   5298 N N7    . DA  H 4 17  ? -16.352 -8.231  -7.579  1.00 49.14  ? 17  DA  H N7    1 
ATOM   5299 C C5    . DA  H 4 17  ? -15.186 -7.989  -8.291  1.00 52.01  ? 17  DA  H C5    1 
ATOM   5300 C C6    . DA  H 4 17  ? -14.451 -6.810  -8.550  1.00 52.61  ? 17  DA  H C6    1 
ATOM   5301 N N6    . DA  H 4 17  ? -14.803 -5.595  -8.092  1.00 49.22  ? 17  DA  H N6    1 
ATOM   5302 N N1    . DA  H 4 17  ? -13.332 -6.927  -9.307  1.00 51.64  ? 17  DA  H N1    1 
ATOM   5303 C C2    . DA  H 4 17  ? -12.976 -8.135  -9.761  1.00 48.61  ? 17  DA  H C2    1 
ATOM   5304 N N3    . DA  H 4 17  ? -13.578 -9.304  -9.577  1.00 51.31  ? 17  DA  H N3    1 
ATOM   5305 C C4    . DA  H 4 17  ? -14.685 -9.162  -8.830  1.00 51.53  ? 17  DA  H C4    1 
ATOM   5306 P P     . DG  H 4 18  ? -14.610 -15.715 -7.866  1.00 79.19  ? 18  DG  H P     1 
ATOM   5307 O OP1   . DG  H 4 18  ? -14.947 -17.016 -8.484  1.00 76.34  ? 18  DG  H OP1   1 
ATOM   5308 O OP2   . DG  H 4 18  ? -15.050 -15.407 -6.483  1.00 70.42  ? 18  DG  H OP2   1 
ATOM   5309 O "O5'" . DG  H 4 18  ? -13.027 -15.521 -7.941  1.00 78.05  ? 18  DG  H "O5'" 1 
ATOM   5310 C "C5'" . DG  H 4 18  ? -12.353 -14.760 -6.951  1.00 73.20  ? 18  DG  H "C5'" 1 
ATOM   5311 C "C4'" . DG  H 4 18  ? -11.046 -14.235 -7.505  1.00 76.08  ? 18  DG  H "C4'" 1 
ATOM   5312 O "O4'" . DG  H 4 18  ? -11.332 -13.097 -8.360  1.00 72.17  ? 18  DG  H "O4'" 1 
ATOM   5313 C "C3'" . DG  H 4 18  ? -10.039 -13.742 -6.457  1.00 82.85  ? 18  DG  H "C3'" 1 
ATOM   5314 O "O3'" . DG  H 4 18  ? -9.038  -14.783 -6.135  1.00 88.16  ? 18  DG  H "O3'" 1 
ATOM   5315 C "C2'" . DG  H 4 18  ? -9.422  -12.513 -7.123  1.00 77.61  ? 18  DG  H "C2'" 1 
ATOM   5316 C "C1'" . DG  H 4 18  ? -10.589 -11.975 -7.937  1.00 68.58  ? 18  DG  H "C1'" 1 
ATOM   5317 N N9    . DG  H 4 18  ? -11.480 -11.078 -7.197  1.00 63.56  ? 18  DG  H N9    1 
ATOM   5318 C C8    . DG  H 4 18  ? -12.650 -11.413 -6.550  1.00 60.27  ? 18  DG  H C8    1 
ATOM   5319 N N7    . DG  H 4 18  ? -13.244 -10.395 -5.989  1.00 56.99  ? 18  DG  H N7    1 
ATOM   5320 C C5    . DG  H 4 18  ? -12.422 -9.311  -6.288  1.00 56.90  ? 18  DG  H C5    1 
ATOM   5321 C C6    . DG  H 4 18  ? -12.555 -7.936  -5.949  1.00 55.48  ? 18  DG  H C6    1 
ATOM   5322 O O6    . DG  H 4 18  ? -13.458 -7.390  -5.290  1.00 55.93  ? 18  DG  H O6    1 
ATOM   5323 N N1    . DG  H 4 18  ? -11.499 -7.170  -6.458  1.00 49.73  ? 18  DG  H N1    1 
ATOM   5324 C C2    . DG  H 4 18  ? -10.447 -7.674  -7.189  1.00 51.82  ? 18  DG  H C2    1 
ATOM   5325 N N2    . DG  H 4 18  ? -9.525  -6.792  -7.586  1.00 48.31  ? 18  DG  H N2    1 
ATOM   5326 N N3    . DG  H 4 18  ? -10.307 -8.958  -7.508  1.00 55.79  ? 18  DG  H N3    1 
ATOM   5327 C C4    . DG  H 4 18  ? -11.330 -9.715  -7.029  1.00 58.81  ? 18  DG  H C4    1 
ATOM   5328 P P     . DA  H 4 19  ? -7.771  -15.099 -7.096  1.00 100.77 ? 19  DA  H P     1 
ATOM   5329 O OP1   . DA  H 4 19  ? -8.188  -14.989 -8.521  1.00 85.65  ? 19  DA  H OP1   1 
ATOM   5330 O OP2   . DA  H 4 19  ? -7.184  -16.379 -6.640  1.00 87.92  ? 19  DA  H OP2   1 
ATOM   5331 O "O5'" . DA  H 4 19  ? -6.695  -13.960 -6.719  1.00 90.30  ? 19  DA  H "O5'" 1 
ATOM   5332 C "C5'" . DA  H 4 19  ? -5.960  -13.279 -7.750  1.00 82.22  ? 19  DA  H "C5'" 1 
ATOM   5333 C "C4'" . DA  H 4 19  ? -5.447  -11.928 -7.262  1.00 81.95  ? 19  DA  H "C4'" 1 
ATOM   5334 O "O4'" . DA  H 4 19  ? -6.564  -11.084 -6.845  1.00 79.36  ? 19  DA  H "O4'" 1 
ATOM   5335 C "C3'" . DA  H 4 19  ? -4.492  -11.993 -6.069  1.00 81.54  ? 19  DA  H "C3'" 1 
ATOM   5336 O "O3'" . DA  H 4 19  ? -3.336  -11.209 -6.334  1.00 83.02  ? 19  DA  H "O3'" 1 
ATOM   5337 C "C2'" . DA  H 4 19  ? -5.320  -11.415 -4.909  1.00 77.68  ? 19  DA  H "C2'" 1 
ATOM   5338 C "C1'" . DA  H 4 19  ? -6.236  -10.447 -5.634  1.00 70.51  ? 19  DA  H "C1'" 1 
ATOM   5339 N N9    . DA  H 4 19  ? -7.465  -10.162 -4.915  1.00 64.17  ? 19  DA  H N9    1 
ATOM   5340 C C8    . DA  H 4 19  ? -8.363  -11.065 -4.424  1.00 66.59  ? 19  DA  H C8    1 
ATOM   5341 N N7    . DA  H 4 19  ? -9.396  -10.513 -3.821  1.00 64.68  ? 19  DA  H N7    1 
ATOM   5342 C C5    . DA  H 4 19  ? -9.149  -9.152  -3.920  1.00 60.84  ? 19  DA  H C5    1 
ATOM   5343 C C6    . DA  H 4 19  ? -9.864  -8.016  -3.475  1.00 54.80  ? 19  DA  H C6    1 
ATOM   5344 N N6    . DA  H 4 19  ? -11.020 -8.085  -2.819  1.00 52.54  ? 19  DA  H N6    1 
ATOM   5345 N N1    . DA  H 4 19  ? -9.339  -6.804  -3.734  1.00 54.41  ? 19  DA  H N1    1 
ATOM   5346 C C2    . DA  H 4 19  ? -8.180  -6.735  -4.399  1.00 58.73  ? 19  DA  H C2    1 
ATOM   5347 N N3    . DA  H 4 19  ? -7.419  -7.727  -4.873  1.00 62.59  ? 19  DA  H N3    1 
ATOM   5348 C C4    . DA  H 4 19  ? -7.964  -8.920  -4.593  1.00 63.58  ? 19  DA  H C4    1 
HETATM 5349 O O     . HOH I 5 .   ? -7.858  15.591  -54.541 1.00 44.57  ? 201 HOH F O     1 
HETATM 5350 O O     . HOH J 5 .   ? 27.755  7.378   13.454  1.00 40.41  ? 101 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   53  53  GLY GLY A . n 
A 1 2   ILE 2   54  54  ILE ILE A . n 
A 1 3   LYS 3   55  55  LYS LYS A . n 
A 1 4   VAL 4   56  56  VAL VAL A . n 
A 1 5   PHE 5   57  57  PHE PHE A . n 
A 1 6   LEU 6   58  58  LEU LEU A . n 
A 1 7   HIS 7   59  59  HIS HIS A . n 
A 1 8   GLU 8   60  60  GLU GLU A . n 
A 1 9   ARG 9   61  61  ARG ARG A . n 
A 1 10  GLU 10  62  62  GLU GLU A . n 
A 1 11  LEU 11  63  63  LEU LEU A . n 
A 1 12  TRP 12  64  64  TRP TRP A . n 
A 1 13  LEU 13  65  65  LEU LEU A . n 
A 1 14  LYS 14  66  66  LYS LYS A . n 
A 1 15  PHE 15  67  67  PHE PHE A . n 
A 1 16  HIS 16  68  68  HIS HIS A . n 
A 1 17  GLU 17  69  69  GLU GLU A . n 
A 1 18  VAL 18  70  70  VAL VAL A . n 
A 1 19  GLY 19  71  71  GLY GLY A . n 
A 1 20  THR 20  72  72  THR THR A . n 
A 1 21  GLU 21  73  73  GLU GLU A . n 
A 1 22  MET 22  74  74  MET MET A . n 
A 1 23  ILE 23  75  75  ILE ILE A . n 
A 1 24  ILE 24  76  76  ILE ILE A . n 
A 1 25  THR 25  77  77  THR THR A . n 
A 1 26  LYS 26  78  78  LYS LYS A . n 
A 1 27  ALA 27  79  79  ALA ALA A . n 
A 1 28  GLY 28  80  80  GLY GLY A . n 
A 1 29  ARG 29  81  81  ARG ARG A . n 
A 1 30  ARG 30  82  82  ARG ARG A . n 
A 1 31  MET 31  83  83  MET MET A . n 
A 1 32  PHE 32  84  84  PHE PHE A . n 
A 1 33  PRO 33  85  85  PRO PRO A . n 
A 1 34  SER 34  86  86  SER SER A . n 
A 1 35  TYR 35  87  87  TYR TYR A . n 
A 1 36  LYS 36  88  88  LYS LYS A . n 
A 1 37  VAL 37  89  89  VAL VAL A . n 
A 1 38  LYS 38  90  90  LYS LYS A . n 
A 1 39  VAL 39  91  91  VAL VAL A . n 
A 1 40  THR 40  92  92  THR THR A . n 
A 1 41  GLY 41  93  93  GLY GLY A . n 
A 1 42  LEU 42  94  94  LEU LEU A . n 
A 1 43  ASN 43  95  95  ASN ASN A . n 
A 1 44  PRO 44  96  96  PRO PRO A . n 
A 1 45  LYS 45  97  97  LYS LYS A . n 
A 1 46  THR 46  98  98  THR THR A . n 
A 1 47  LYS 47  99  99  LYS LYS A . n 
A 1 48  TYR 48  100 100 TYR TYR A . n 
A 1 49  ILE 49  101 101 ILE ILE A . n 
A 1 50  LEU 50  102 102 LEU LEU A . n 
A 1 51  LEU 51  103 103 LEU LEU A . n 
A 1 52  MET 52  104 104 MET MET A . n 
A 1 53  ASP 53  105 105 ASP ASP A . n 
A 1 54  ILE 54  106 106 ILE ILE A . n 
A 1 55  VAL 55  107 107 VAL VAL A . n 
A 1 56  PRO 56  108 108 PRO PRO A . n 
A 1 57  ALA 57  109 109 ALA ALA A . n 
A 1 58  ASP 58  110 110 ASP ASP A . n 
A 1 59  ASP 59  111 111 ASP ASP A . n 
A 1 60  HIS 60  112 112 HIS HIS A . n 
A 1 61  ARG 61  113 113 ARG ARG A . n 
A 1 62  TYR 62  114 114 TYR TYR A . n 
A 1 63  LYS 63  115 115 LYS LYS A . n 
A 1 64  PHE 64  116 116 PHE PHE A . n 
A 1 65  ALA 65  117 117 ALA ALA A . n 
A 1 66  ASP 66  118 118 ASP ASP A . n 
A 1 67  ASN 67  119 119 ASN ASN A . n 
A 1 68  LYS 68  120 120 LYS LYS A . n 
A 1 69  TRP 69  121 121 TRP TRP A . n 
A 1 70  SER 70  122 122 SER SER A . n 
A 1 71  VAL 71  123 123 VAL VAL A . n 
A 1 72  THR 72  124 124 THR THR A . n 
A 1 73  GLY 73  125 125 GLY GLY A . n 
A 1 74  LYS 74  126 126 LYS LYS A . n 
A 1 75  ALA 75  127 127 ALA ALA A . n 
A 1 76  GLU 76  128 128 GLU GLU A . n 
A 1 77  PRO 77  129 129 PRO PRO A . n 
A 1 78  ALA 78  130 130 ALA ALA A . n 
A 1 79  MET 79  131 131 MET MET A . n 
A 1 80  PRO 80  132 132 PRO PRO A . n 
A 1 81  GLY 81  133 133 GLY GLY A . n 
A 1 82  ARG 82  134 134 ARG ARG A . n 
A 1 83  LEU 83  135 135 LEU LEU A . n 
A 1 84  TYR 84  136 136 TYR TYR A . n 
A 1 85  VAL 85  137 137 VAL VAL A . n 
A 1 86  HIS 86  138 138 HIS HIS A . n 
A 1 87  PRO 87  139 139 PRO PRO A . n 
A 1 88  ASP 88  140 140 ASP ASP A . n 
A 1 89  SER 89  141 141 SER SER A . n 
A 1 90  PRO 90  142 142 PRO PRO A . n 
A 1 91  ALA 91  143 143 ALA ALA A . n 
A 1 92  THR 92  144 144 THR THR A . n 
A 1 93  GLY 93  145 145 GLY GLY A . n 
A 1 94  ALA 94  146 146 ALA ALA A . n 
A 1 95  HIS 95  147 147 HIS HIS A . n 
A 1 96  TRP 96  148 148 TRP TRP A . n 
A 1 97  MET 97  149 149 MET MET A . n 
A 1 98  ARG 98  150 150 ARG ARG A . n 
A 1 99  GLN 99  151 151 GLN GLN A . n 
A 1 100 LEU 100 152 152 LEU LEU A . n 
A 1 101 VAL 101 153 153 VAL VAL A . n 
A 1 102 SER 102 154 154 SER SER A . n 
A 1 103 PHE 103 155 155 PHE PHE A . n 
A 1 104 GLN 104 156 156 GLN GLN A . n 
A 1 105 LYS 105 157 157 LYS LYS A . n 
A 1 106 LEU 106 158 158 LEU LEU A . n 
A 1 107 LYS 107 159 159 LYS LYS A . n 
A 1 108 LEU 108 160 160 LEU LEU A . n 
A 1 109 THR 109 161 161 THR THR A . n 
A 1 110 ASN 110 162 162 ASN ASN A . n 
A 1 111 ASN 111 163 163 ASN ASN A . n 
A 1 112 HIS 112 164 164 HIS HIS A . n 
A 1 113 LEU 113 165 165 LEU LEU A . n 
A 1 114 ASP 114 166 166 ASP ASP A . n 
A 1 115 PRO 115 167 167 PRO PRO A . n 
A 1 116 PHE 116 168 168 PHE PHE A . n 
A 1 117 GLY 117 169 169 GLY GLY A . n 
A 1 118 HIS 118 170 170 HIS HIS A . n 
A 1 119 ILE 119 171 171 ILE ILE A . n 
A 1 120 ILE 120 172 172 ILE ILE A . n 
A 1 121 LEU 121 173 173 LEU LEU A . n 
A 1 122 ASN 122 174 174 ASN ASN A . n 
A 1 123 SER 123 175 175 SER SER A . n 
A 1 124 MET 124 176 176 MET MET A . n 
A 1 125 HIS 125 177 177 HIS HIS A . n 
A 1 126 LYS 126 178 178 LYS LYS A . n 
A 1 127 TYR 127 179 179 TYR TYR A . n 
A 1 128 GLN 128 180 180 GLN GLN A . n 
A 1 129 PRO 129 181 181 PRO PRO A . n 
A 1 130 ARG 130 182 182 ARG ARG A . n 
A 1 131 LEU 131 183 183 LEU LEU A . n 
A 1 132 HIS 132 184 184 HIS HIS A . n 
A 1 133 ILE 133 185 185 ILE ILE A . n 
A 1 134 VAL 134 186 186 VAL VAL A . n 
A 1 135 LYS 135 187 187 LYS LYS A . n 
A 1 136 ALA 136 188 188 ALA ALA A . n 
A 1 137 ASP 137 189 ?   ?   ?   A . n 
A 1 138 GLU 138 190 ?   ?   ?   A . n 
A 1 139 ASN 139 191 ?   ?   ?   A . n 
A 1 140 ASN 140 192 ?   ?   ?   A . n 
A 1 141 GLY 141 193 ?   ?   ?   A . n 
A 1 142 PHE 142 194 ?   ?   ?   A . n 
A 1 143 GLY 143 195 ?   ?   ?   A . n 
A 1 144 SER 144 196 ?   ?   ?   A . n 
A 1 145 LYS 145 197 ?   ?   ?   A . n 
A 1 146 ASN 146 198 ?   ?   ?   A . n 
A 1 147 THR 147 199 199 THR THR A . n 
A 1 148 ALA 148 200 200 ALA ALA A . n 
A 1 149 PHE 149 201 201 PHE PHE A . n 
A 1 150 CYS 150 202 202 CYS CYS A . n 
A 1 151 THR 151 203 203 THR THR A . n 
A 1 152 HIS 152 204 204 HIS HIS A . n 
A 1 153 VAL 153 205 205 VAL VAL A . n 
A 1 154 PHE 154 206 206 PHE PHE A . n 
A 1 155 PRO 155 207 207 PRO PRO A . n 
A 1 156 GLU 156 208 208 GLU GLU A . n 
A 1 157 THR 157 209 209 THR THR A . n 
A 1 158 ALA 158 210 210 ALA ALA A . n 
A 1 159 PHE 159 211 211 PHE PHE A . n 
A 1 160 ILE 160 212 212 ILE ILE A . n 
A 1 161 ALA 161 213 213 ALA ALA A . n 
A 1 162 VAL 162 214 214 VAL VAL A . n 
A 1 163 THR 163 215 215 THR THR A . n 
A 1 164 SER 164 216 216 SER SER A . n 
A 1 165 TYR 165 217 217 TYR TYR A . n 
A 1 166 GLN 166 218 218 GLN GLN A . n 
A 1 167 ASN 167 219 219 ASN ASN A . n 
A 1 168 HIS 168 220 220 HIS HIS A . n 
A 1 169 LYS 169 221 221 LYS LYS A . n 
A 1 170 ILE 170 222 222 ILE ILE A . n 
A 1 171 THR 171 223 223 THR THR A . n 
A 1 172 GLN 172 224 224 GLN GLN A . n 
A 1 173 LEU 173 225 225 LEU LEU A . n 
A 1 174 LYS 174 226 226 LYS LYS A . n 
A 1 175 ILE 175 227 227 ILE ILE A . n 
A 1 176 GLU 176 228 228 GLU GLU A . n 
A 1 177 ASN 177 229 229 ASN ASN A . n 
A 1 178 ASN 178 230 230 ASN ASN A . n 
A 1 179 PRO 179 231 231 PRO PRO A . n 
A 1 180 PHE 180 232 232 PHE PHE A . n 
A 1 181 ALA 181 233 233 ALA ALA A . n 
A 1 182 LYS 182 234 234 LYS LYS A . n 
A 1 183 GLY 183 235 235 GLY GLY A . n 
A 1 184 PHE 184 236 236 PHE PHE A . n 
A 1 185 ARG 185 237 237 ARG ARG A . n 
A 1 186 GLY 186 238 238 GLY GLY A . n 
B 2 1   ARG 1   142 142 ARG ARG B . n 
B 2 2   VAL 2   143 143 VAL VAL B . n 
B 2 3   LEU 3   144 144 LEU LEU B . n 
B 2 4   PHE 4   145 145 PHE PHE B . n 
B 2 5   SER 5   146 146 SER SER B . n 
B 2 6   GLN 6   147 147 GLN GLN B . n 
B 2 7   ALA 7   148 148 ALA ALA B . n 
B 2 8   GLN 8   149 149 GLN GLN B . n 
B 2 9   VAL 9   150 150 VAL VAL B . n 
B 2 10  TYR 10  151 151 TYR TYR B . n 
B 2 11  GLU 11  152 152 GLU GLU B . n 
B 2 12  LEU 12  153 153 LEU LEU B . n 
B 2 13  GLU 13  154 154 GLU GLU B . n 
B 2 14  ARG 14  155 155 ARG ARG B . n 
B 2 15  ARG 15  156 156 ARG ARG B . n 
B 2 16  PHE 16  157 157 PHE PHE B . n 
B 2 17  LYS 17  158 158 LYS LYS B . n 
B 2 18  GLN 18  159 159 GLN GLN B . n 
B 2 19  GLN 19  160 160 GLN GLN B . n 
B 2 20  ARG 20  161 161 ARG ARG B . n 
B 2 21  TYR 21  162 162 TYR TYR B . n 
B 2 22  LEU 22  163 163 LEU LEU B . n 
B 2 23  SER 23  164 164 SER SER B . n 
B 2 24  ALA 24  165 165 ALA ALA B . n 
B 2 25  PRO 25  166 166 PRO PRO B . n 
B 2 26  GLU 26  167 167 GLU GLU B . n 
B 2 27  ARG 27  168 168 ARG ARG B . n 
B 2 28  ASP 28  169 169 ASP ASP B . n 
B 2 29  GLN 29  170 170 GLN GLN B . n 
B 2 30  LEU 30  171 171 LEU LEU B . n 
B 2 31  ALA 31  172 172 ALA ALA B . n 
B 2 32  SER 32  173 173 SER SER B . n 
B 2 33  VAL 33  174 174 VAL VAL B . n 
B 2 34  LEU 34  175 175 LEU LEU B . n 
B 2 35  LYS 35  176 176 LYS LYS B . n 
B 2 36  LEU 36  177 177 LEU LEU B . n 
B 2 37  THR 37  178 178 THR THR B . n 
B 2 38  SER 38  179 179 SER SER B . n 
B 2 39  THR 39  180 180 THR THR B . n 
B 2 40  GLN 40  181 181 GLN GLN B . n 
B 2 41  VAL 41  182 182 VAL VAL B . n 
B 2 42  LYS 42  183 183 LYS LYS B . n 
B 2 43  ILE 43  184 184 ILE ILE B . n 
B 2 44  TRP 44  185 185 TRP TRP B . n 
B 2 45  PHE 45  186 186 PHE PHE B . n 
B 2 46  GLN 46  187 187 GLN GLN B . n 
B 2 47  ASN 47  188 188 ASN ASN B . n 
B 2 48  ARG 48  189 189 ARG ARG B . n 
B 2 49  ARG 49  190 190 ARG ARG B . n 
B 2 50  TYR 50  191 191 TYR TYR B . n 
B 2 51  LYS 51  192 192 LYS LYS B . n 
B 2 52  SER 52  193 193 SER SER B . n 
B 2 53  LYS 53  194 194 LYS LYS B . n 
C 1 1   GLY 1   53  53  GLY GLY E . n 
C 1 2   ILE 2   54  54  ILE ILE E . n 
C 1 3   LYS 3   55  55  LYS LYS E . n 
C 1 4   VAL 4   56  56  VAL VAL E . n 
C 1 5   PHE 5   57  57  PHE PHE E . n 
C 1 6   LEU 6   58  58  LEU LEU E . n 
C 1 7   HIS 7   59  59  HIS HIS E . n 
C 1 8   GLU 8   60  60  GLU GLU E . n 
C 1 9   ARG 9   61  61  ARG ARG E . n 
C 1 10  GLU 10  62  62  GLU GLU E . n 
C 1 11  LEU 11  63  63  LEU LEU E . n 
C 1 12  TRP 12  64  64  TRP TRP E . n 
C 1 13  LEU 13  65  65  LEU LEU E . n 
C 1 14  LYS 14  66  66  LYS LYS E . n 
C 1 15  PHE 15  67  67  PHE PHE E . n 
C 1 16  HIS 16  68  68  HIS HIS E . n 
C 1 17  GLU 17  69  69  GLU GLU E . n 
C 1 18  VAL 18  70  70  VAL VAL E . n 
C 1 19  GLY 19  71  71  GLY GLY E . n 
C 1 20  THR 20  72  72  THR THR E . n 
C 1 21  GLU 21  73  73  GLU GLU E . n 
C 1 22  MET 22  74  74  MET MET E . n 
C 1 23  ILE 23  75  75  ILE ILE E . n 
C 1 24  ILE 24  76  76  ILE ILE E . n 
C 1 25  THR 25  77  77  THR THR E . n 
C 1 26  LYS 26  78  78  LYS LYS E . n 
C 1 27  ALA 27  79  79  ALA ALA E . n 
C 1 28  GLY 28  80  80  GLY GLY E . n 
C 1 29  ARG 29  81  81  ARG ARG E . n 
C 1 30  ARG 30  82  82  ARG ARG E . n 
C 1 31  MET 31  83  83  MET MET E . n 
C 1 32  PHE 32  84  84  PHE PHE E . n 
C 1 33  PRO 33  85  85  PRO PRO E . n 
C 1 34  SER 34  86  86  SER SER E . n 
C 1 35  TYR 35  87  87  TYR TYR E . n 
C 1 36  LYS 36  88  88  LYS LYS E . n 
C 1 37  VAL 37  89  89  VAL VAL E . n 
C 1 38  LYS 38  90  90  LYS LYS E . n 
C 1 39  VAL 39  91  91  VAL VAL E . n 
C 1 40  THR 40  92  92  THR THR E . n 
C 1 41  GLY 41  93  93  GLY GLY E . n 
C 1 42  LEU 42  94  94  LEU LEU E . n 
C 1 43  ASN 43  95  95  ASN ASN E . n 
C 1 44  PRO 44  96  96  PRO PRO E . n 
C 1 45  LYS 45  97  97  LYS LYS E . n 
C 1 46  THR 46  98  98  THR THR E . n 
C 1 47  LYS 47  99  99  LYS LYS E . n 
C 1 48  TYR 48  100 100 TYR TYR E . n 
C 1 49  ILE 49  101 101 ILE ILE E . n 
C 1 50  LEU 50  102 102 LEU LEU E . n 
C 1 51  LEU 51  103 103 LEU LEU E . n 
C 1 52  MET 52  104 104 MET MET E . n 
C 1 53  ASP 53  105 105 ASP ASP E . n 
C 1 54  ILE 54  106 106 ILE ILE E . n 
C 1 55  VAL 55  107 107 VAL VAL E . n 
C 1 56  PRO 56  108 108 PRO PRO E . n 
C 1 57  ALA 57  109 109 ALA ALA E . n 
C 1 58  ASP 58  110 110 ASP ASP E . n 
C 1 59  ASP 59  111 111 ASP ASP E . n 
C 1 60  HIS 60  112 112 HIS HIS E . n 
C 1 61  ARG 61  113 113 ARG ARG E . n 
C 1 62  TYR 62  114 114 TYR TYR E . n 
C 1 63  LYS 63  115 115 LYS LYS E . n 
C 1 64  PHE 64  116 116 PHE PHE E . n 
C 1 65  ALA 65  117 117 ALA ALA E . n 
C 1 66  ASP 66  118 118 ASP ASP E . n 
C 1 67  ASN 67  119 119 ASN ASN E . n 
C 1 68  LYS 68  120 120 LYS LYS E . n 
C 1 69  TRP 69  121 121 TRP TRP E . n 
C 1 70  SER 70  122 122 SER SER E . n 
C 1 71  VAL 71  123 123 VAL VAL E . n 
C 1 72  THR 72  124 124 THR THR E . n 
C 1 73  GLY 73  125 125 GLY GLY E . n 
C 1 74  LYS 74  126 126 LYS LYS E . n 
C 1 75  ALA 75  127 127 ALA ALA E . n 
C 1 76  GLU 76  128 128 GLU GLU E . n 
C 1 77  PRO 77  129 129 PRO PRO E . n 
C 1 78  ALA 78  130 130 ALA ALA E . n 
C 1 79  MET 79  131 131 MET MET E . n 
C 1 80  PRO 80  132 132 PRO PRO E . n 
C 1 81  GLY 81  133 133 GLY GLY E . n 
C 1 82  ARG 82  134 134 ARG ARG E . n 
C 1 83  LEU 83  135 135 LEU LEU E . n 
C 1 84  TYR 84  136 136 TYR TYR E . n 
C 1 85  VAL 85  137 137 VAL VAL E . n 
C 1 86  HIS 86  138 138 HIS HIS E . n 
C 1 87  PRO 87  139 139 PRO PRO E . n 
C 1 88  ASP 88  140 140 ASP ASP E . n 
C 1 89  SER 89  141 141 SER SER E . n 
C 1 90  PRO 90  142 142 PRO PRO E . n 
C 1 91  ALA 91  143 143 ALA ALA E . n 
C 1 92  THR 92  144 144 THR THR E . n 
C 1 93  GLY 93  145 145 GLY GLY E . n 
C 1 94  ALA 94  146 146 ALA ALA E . n 
C 1 95  HIS 95  147 147 HIS HIS E . n 
C 1 96  TRP 96  148 148 TRP TRP E . n 
C 1 97  MET 97  149 149 MET MET E . n 
C 1 98  ARG 98  150 150 ARG ARG E . n 
C 1 99  GLN 99  151 151 GLN GLN E . n 
C 1 100 LEU 100 152 152 LEU LEU E . n 
C 1 101 VAL 101 153 153 VAL VAL E . n 
C 1 102 SER 102 154 154 SER SER E . n 
C 1 103 PHE 103 155 155 PHE PHE E . n 
C 1 104 GLN 104 156 156 GLN GLN E . n 
C 1 105 LYS 105 157 157 LYS LYS E . n 
C 1 106 LEU 106 158 158 LEU LEU E . n 
C 1 107 LYS 107 159 159 LYS LYS E . n 
C 1 108 LEU 108 160 160 LEU LEU E . n 
C 1 109 THR 109 161 161 THR THR E . n 
C 1 110 ASN 110 162 162 ASN ASN E . n 
C 1 111 ASN 111 163 163 ASN ASN E . n 
C 1 112 HIS 112 164 164 HIS HIS E . n 
C 1 113 LEU 113 165 165 LEU LEU E . n 
C 1 114 ASP 114 166 166 ASP ASP E . n 
C 1 115 PRO 115 167 167 PRO PRO E . n 
C 1 116 PHE 116 168 168 PHE PHE E . n 
C 1 117 GLY 117 169 169 GLY GLY E . n 
C 1 118 HIS 118 170 170 HIS HIS E . n 
C 1 119 ILE 119 171 171 ILE ILE E . n 
C 1 120 ILE 120 172 172 ILE ILE E . n 
C 1 121 LEU 121 173 173 LEU LEU E . n 
C 1 122 ASN 122 174 174 ASN ASN E . n 
C 1 123 SER 123 175 175 SER SER E . n 
C 1 124 MET 124 176 176 MET MET E . n 
C 1 125 HIS 125 177 177 HIS HIS E . n 
C 1 126 LYS 126 178 178 LYS LYS E . n 
C 1 127 TYR 127 179 179 TYR TYR E . n 
C 1 128 GLN 128 180 180 GLN GLN E . n 
C 1 129 PRO 129 181 181 PRO PRO E . n 
C 1 130 ARG 130 182 182 ARG ARG E . n 
C 1 131 LEU 131 183 183 LEU LEU E . n 
C 1 132 HIS 132 184 184 HIS HIS E . n 
C 1 133 ILE 133 185 185 ILE ILE E . n 
C 1 134 VAL 134 186 186 VAL VAL E . n 
C 1 135 LYS 135 187 187 LYS LYS E . n 
C 1 136 ALA 136 188 188 ALA ALA E . n 
C 1 137 ASP 137 189 189 ASP ASP E . n 
C 1 138 GLU 138 190 ?   ?   ?   E . n 
C 1 139 ASN 139 191 ?   ?   ?   E . n 
C 1 140 ASN 140 192 ?   ?   ?   E . n 
C 1 141 GLY 141 193 ?   ?   ?   E . n 
C 1 142 PHE 142 194 ?   ?   ?   E . n 
C 1 143 GLY 143 195 ?   ?   ?   E . n 
C 1 144 SER 144 196 ?   ?   ?   E . n 
C 1 145 LYS 145 197 ?   ?   ?   E . n 
C 1 146 ASN 146 198 ?   ?   ?   E . n 
C 1 147 THR 147 199 199 THR THR E . n 
C 1 148 ALA 148 200 200 ALA ALA E . n 
C 1 149 PHE 149 201 201 PHE PHE E . n 
C 1 150 CYS 150 202 202 CYS CYS E . n 
C 1 151 THR 151 203 203 THR THR E . n 
C 1 152 HIS 152 204 204 HIS HIS E . n 
C 1 153 VAL 153 205 205 VAL VAL E . n 
C 1 154 PHE 154 206 206 PHE PHE E . n 
C 1 155 PRO 155 207 207 PRO PRO E . n 
C 1 156 GLU 156 208 208 GLU GLU E . n 
C 1 157 THR 157 209 209 THR THR E . n 
C 1 158 ALA 158 210 210 ALA ALA E . n 
C 1 159 PHE 159 211 211 PHE PHE E . n 
C 1 160 ILE 160 212 212 ILE ILE E . n 
C 1 161 ALA 161 213 213 ALA ALA E . n 
C 1 162 VAL 162 214 214 VAL VAL E . n 
C 1 163 THR 163 215 215 THR THR E . n 
C 1 164 SER 164 216 216 SER SER E . n 
C 1 165 TYR 165 217 217 TYR TYR E . n 
C 1 166 GLN 166 218 218 GLN GLN E . n 
C 1 167 ASN 167 219 219 ASN ASN E . n 
C 1 168 HIS 168 220 220 HIS HIS E . n 
C 1 169 LYS 169 221 221 LYS LYS E . n 
C 1 170 ILE 170 222 222 ILE ILE E . n 
C 1 171 THR 171 223 223 THR THR E . n 
C 1 172 GLN 172 224 224 GLN GLN E . n 
C 1 173 LEU 173 225 225 LEU LEU E . n 
C 1 174 LYS 174 226 226 LYS LYS E . n 
C 1 175 ILE 175 227 227 ILE ILE E . n 
C 1 176 GLU 176 228 228 GLU GLU E . n 
C 1 177 ASN 177 229 229 ASN ASN E . n 
C 1 178 ASN 178 230 230 ASN ASN E . n 
C 1 179 PRO 179 231 231 PRO PRO E . n 
C 1 180 PHE 180 232 232 PHE PHE E . n 
C 1 181 ALA 181 233 233 ALA ALA E . n 
C 1 182 LYS 182 234 234 LYS LYS E . n 
C 1 183 GLY 183 235 235 GLY GLY E . n 
C 1 184 PHE 184 236 236 PHE PHE E . n 
C 1 185 ARG 185 237 237 ARG ARG E . n 
C 1 186 GLY 186 238 238 GLY GLY E . n 
D 2 1   ARG 1   105 105 ARG ARG F . n 
D 2 2   VAL 2   106 106 VAL VAL F . n 
D 2 3   LEU 3   107 107 LEU LEU F . n 
D 2 4   PHE 4   108 108 PHE PHE F . n 
D 2 5   SER 5   109 109 SER SER F . n 
D 2 6   GLN 6   110 110 GLN GLN F . n 
D 2 7   ALA 7   111 111 ALA ALA F . n 
D 2 8   GLN 8   112 112 GLN GLN F . n 
D 2 9   VAL 9   113 113 VAL VAL F . n 
D 2 10  TYR 10  114 114 TYR TYR F . n 
D 2 11  GLU 11  115 115 GLU GLU F . n 
D 2 12  LEU 12  116 116 LEU LEU F . n 
D 2 13  GLU 13  117 117 GLU GLU F . n 
D 2 14  ARG 14  118 118 ARG ARG F . n 
D 2 15  ARG 15  119 119 ARG ARG F . n 
D 2 16  PHE 16  120 120 PHE PHE F . n 
D 2 17  LYS 17  121 121 LYS LYS F . n 
D 2 18  GLN 18  122 122 GLN GLN F . n 
D 2 19  GLN 19  123 123 GLN GLN F . n 
D 2 20  ARG 20  124 124 ARG ARG F . n 
D 2 21  TYR 21  125 125 TYR TYR F . n 
D 2 22  LEU 22  126 126 LEU LEU F . n 
D 2 23  SER 23  127 127 SER SER F . n 
D 2 24  ALA 24  128 128 ALA ALA F . n 
D 2 25  PRO 25  129 129 PRO PRO F . n 
D 2 26  GLU 26  130 130 GLU GLU F . n 
D 2 27  ARG 27  131 131 ARG ARG F . n 
D 2 28  ASP 28  132 132 ASP ASP F . n 
D 2 29  GLN 29  133 133 GLN GLN F . n 
D 2 30  LEU 30  134 134 LEU LEU F . n 
D 2 31  ALA 31  135 135 ALA ALA F . n 
D 2 32  SER 32  136 136 SER SER F . n 
D 2 33  VAL 33  137 137 VAL VAL F . n 
D 2 34  LEU 34  138 138 LEU LEU F . n 
D 2 35  LYS 35  139 139 LYS LYS F . n 
D 2 36  LEU 36  140 140 LEU LEU F . n 
D 2 37  THR 37  141 141 THR THR F . n 
D 2 38  SER 38  142 142 SER SER F . n 
D 2 39  THR 39  143 143 THR THR F . n 
D 2 40  GLN 40  144 144 GLN GLN F . n 
D 2 41  VAL 41  145 145 VAL VAL F . n 
D 2 42  LYS 42  146 146 LYS LYS F . n 
D 2 43  ILE 43  147 147 ILE ILE F . n 
D 2 44  TRP 44  148 148 TRP TRP F . n 
D 2 45  PHE 45  149 149 PHE PHE F . n 
D 2 46  GLN 46  150 150 GLN GLN F . n 
D 2 47  ASN 47  151 151 ASN ASN F . n 
D 2 48  ARG 48  152 152 ARG ARG F . n 
D 2 49  ARG 49  153 153 ARG ARG F . n 
D 2 50  TYR 50  154 154 TYR TYR F . n 
D 2 51  LYS 51  155 155 LYS LYS F . n 
D 2 52  SER 52  156 156 SER SER F . n 
D 2 53  LYS 53  157 157 LYS LYS F . n 
E 3 1   DT  1   1   1   DT  DT  C . n 
E 3 2   DC  2   2   2   DC  DC  C . n 
E 3 3   DT  3   3   3   DT  DT  C . n 
E 3 4   DC  4   4   4   DC  DC  C . n 
E 3 5   DA  5   5   5   DA  DA  C . n 
E 3 6   DC  6   6   6   DC  DC  C . n 
E 3 7   DA  7   7   7   DA  DA  C . n 
E 3 8   DC  8   8   8   DC  DC  C . n 
E 3 9   DC  9   9   9   DC  DC  C . n 
E 3 10  DT  10  10  10  DT  DT  C . n 
E 3 11  DT  11  11  11  DT  DT  C . n 
E 3 12  DT  12  12  12  DT  DT  C . n 
E 3 13  DG  13  13  13  DG  DG  C . n 
E 3 14  DA  14  14  14  DA  DA  C . n 
E 3 15  DA  15  15  15  DA  DA  C . n 
E 3 16  DG  16  16  16  DG  DG  C . n 
E 3 17  DT  17  17  17  DT  DT  C . n 
E 3 18  DG  18  18  18  DG  DG  C . n 
E 3 19  DG  19  19  19  DG  DG  C . n 
F 4 1   DC  1   1   1   DC  DC  D . n 
F 4 2   DC  2   2   2   DC  DC  D . n 
F 4 3   DA  3   3   3   DA  DA  D . n 
F 4 4   DC  4   4   4   DC  DC  D . n 
F 4 5   DT  5   5   5   DT  DT  D . n 
F 4 6   DT  6   6   6   DT  DT  D . n 
F 4 7   DC  7   7   7   DC  DC  D . n 
F 4 8   DA  8   8   8   DA  DA  D . n 
F 4 9   DA  9   9   9   DA  DA  D . n 
F 4 10  DA  10  10  10  DA  DA  D . n 
F 4 11  DG  11  11  11  DG  DG  D . n 
F 4 12  DG  12  12  12  DG  DG  D . n 
F 4 13  DT  13  13  13  DT  DT  D . n 
F 4 14  DG  14  14  14  DG  DG  D . n 
F 4 15  DT  15  15  15  DT  DT  D . n 
F 4 16  DG  16  16  16  DG  DG  D . n 
F 4 17  DA  17  17  17  DA  DA  D . n 
F 4 18  DG  18  18  18  DG  DG  D . n 
F 4 19  DA  19  19  19  DA  DA  D . n 
G 3 1   DT  1   1   1   DT  DT  G . n 
G 3 2   DC  2   2   2   DC  DC  G . n 
G 3 3   DT  3   3   3   DT  DT  G . n 
G 3 4   DC  4   4   4   DC  DC  G . n 
G 3 5   DA  5   5   5   DA  DA  G . n 
G 3 6   DC  6   6   6   DC  DC  G . n 
G 3 7   DA  7   7   7   DA  DA  G . n 
G 3 8   DC  8   8   8   DC  DC  G . n 
G 3 9   DC  9   9   9   DC  DC  G . n 
G 3 10  DT  10  10  10  DT  DT  G . n 
G 3 11  DT  11  11  11  DT  DT  G . n 
G 3 12  DT  12  12  12  DT  DT  G . n 
G 3 13  DG  13  13  13  DG  DG  G . n 
G 3 14  DA  14  14  14  DA  DA  G . n 
G 3 15  DA  15  15  15  DA  DA  G . n 
G 3 16  DG  16  16  16  DG  DG  G . n 
G 3 17  DT  17  17  17  DT  DT  G . n 
G 3 18  DG  18  18  18  DG  DG  G . n 
G 3 19  DG  19  19  19  DG  DG  G . n 
H 4 1   DC  1   1   1   DC  DC  H . n 
H 4 2   DC  2   2   2   DC  DC  H . n 
H 4 3   DA  3   3   3   DA  DA  H . n 
H 4 4   DC  4   4   4   DC  DC  H . n 
H 4 5   DT  5   5   5   DT  DT  H . n 
H 4 6   DT  6   6   6   DT  DT  H . n 
H 4 7   DC  7   7   7   DC  DC  H . n 
H 4 8   DA  8   8   8   DA  DA  H . n 
H 4 9   DA  9   9   9   DA  DA  H . n 
H 4 10  DA  10  10  10  DA  DA  H . n 
H 4 11  DG  11  11  11  DG  DG  H . n 
H 4 12  DG  12  12  12  DG  DG  H . n 
H 4 13  DT  13  13  13  DT  DT  H . n 
H 4 14  DG  14  14  14  DG  DG  H . n 
H 4 15  DT  15  15  15  DT  DT  H . n 
H 4 16  DG  16  16  16  DG  DG  H . n 
H 4 17  DA  17  17  17  DA  DA  H . n 
H 4 18  DG  18  18  18  DG  DG  H . n 
H 4 19  DA  19  19  19  DA  DA  H . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
I 5 HOH 1 201 2 HOH HOH F . 
J 5 HOH 1 101 1 HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,F,J 
2 1 C,D,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-12-16 
2 'Structure model' 1 1 2016-03-16 
3 'Structure model' 1 2 2016-04-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX   refinement       '(phenix.refine: 1.7.2_869)' ? 1 
HKL-2000 'data reduction' .                            ? 2 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   CE 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   MET 
_pdbx_validate_close_contact.auth_seq_id_1    131 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   OH 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   TYR 
_pdbx_validate_close_contact.auth_seq_id_2    179 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.74 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CE    E LYS 97 ? ? NZ    E LYS 97 ? ? 1.705 1.486 0.219  0.025 N 
2 1 "C1'" C DC  6  ? ? N1    C DC  6  ? ? 1.570 1.488 0.082  0.013 N 
3 1 "O3'" H DA  3  ? ? "C3'" H DA  3  ? ? 1.369 1.419 -0.050 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG    A MET 131 ? ? SD    A MET 131 ? ? CE    A MET 131 ? ? 115.97 100.20 15.77  1.60 N 
2  1 CB    E ASP 118 ? ? CA    E ASP 118 ? ? C     E ASP 118 ? ? 130.74 110.40 20.34  2.00 N 
3  1 N     E ASN 119 ? ? CA    E ASN 119 ? ? CB    E ASN 119 ? ? 85.06  110.60 -25.54 1.80 N 
4  1 CB    E ALA 188 ? ? CA    E ALA 188 ? ? C     E ALA 188 ? ? 119.27 110.10 9.17   1.50 N 
5  1 O     E ALA 200 ? ? C     E ALA 200 ? ? N     E PHE 201 ? ? 112.67 122.70 -10.03 1.60 Y 
6  1 CA    E CYS 202 ? ? C     E CYS 202 ? ? N     E THR 203 ? ? 102.93 117.20 -14.27 2.20 Y 
7  1 O     E CYS 202 ? ? C     E CYS 202 ? ? N     E THR 203 ? ? 134.24 122.70 11.54  1.60 Y 
8  1 "O4'" C DA  5   ? ? "C1'" C DA  5   ? ? N9    C DA  5   ? ? 110.48 108.30 2.18   0.30 N 
9  1 "O4'" C DC  6   ? ? "C1'" C DC  6   ? ? N1    C DC  6   ? ? 110.90 108.30 2.60   0.30 N 
10 1 "O4'" C DG  13  ? ? "C1'" C DG  13  ? ? N9    C DG  13  ? ? 110.93 108.30 2.63   0.30 N 
11 1 "O4'" C DG  19  ? ? "C1'" C DG  19  ? ? N9    C DG  19  ? ? 110.15 108.30 1.85   0.30 N 
12 1 "O4'" D DC  4   ? ? "C1'" D DC  4   ? ? N1    D DC  4   ? ? 112.78 108.30 4.48   0.30 N 
13 1 "O4'" D DG  11  ? ? "C1'" D DG  11  ? ? N9    D DG  11  ? ? 112.98 108.30 4.68   0.30 N 
14 1 "O4'" D DG  18  ? ? "C1'" D DG  18  ? ? N9    D DG  18  ? ? 110.27 108.30 1.97   0.30 N 
15 1 "O4'" G DG  18  ? ? "C1'" G DG  18  ? ? N9    G DG  18  ? ? 111.37 108.30 3.07   0.30 N 
16 1 "O4'" H DA  3   ? ? "C4'" H DA  3   ? ? "C3'" H DA  3   ? ? 101.65 104.50 -2.85  0.40 N 
17 1 "O4'" H DA  3   ? ? "C1'" H DA  3   ? ? N9    H DA  3   ? ? 110.65 108.30 2.35   0.30 N 
18 1 "O4'" H DC  4   ? ? "C4'" H DC  4   ? ? "C3'" H DC  4   ? ? 101.58 104.50 -2.92  0.40 N 
19 1 "O4'" H DC  4   ? ? "C1'" H DC  4   ? ? N1    H DC  4   ? ? 110.25 108.30 1.95   0.30 N 
20 1 "O4'" H DG  11  ? ? "C1'" H DG  11  ? ? N9    H DG  11  ? ? 110.83 108.30 2.53   0.30 N 
21 1 "O4'" H DT  13  ? ? "C4'" H DT  13  ? ? "C3'" H DT  13  ? ? 99.60  104.50 -4.90  0.40 N 
22 1 "C3'" H DT  13  ? ? "C2'" H DT  13  ? ? "C1'" H DT  13  ? ? 97.35  102.40 -5.05  0.80 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 70  ? ? -141.29 -20.63  
2  1 PRO A 132 ? ? -50.99  107.26  
3  1 LEU A 152 ? ? -34.87  133.18  
4  1 ALA A 200 ? ? -146.10 -11.31  
5  1 PRO A 207 ? ? -34.13  -39.56  
6  1 GLN A 218 ? ? -95.88  -72.70  
7  1 ALA A 233 ? ? -98.74  31.89   
8  1 ARG A 237 ? ? -76.04  -161.35 
9  1 GLN B 159 ? ? -96.18  -77.20  
10 1 ASP E 111 ? ? -100.18 65.30   
11 1 ALA E 117 ? ? -94.74  -159.69 
12 1 ASP E 118 ? ? 60.69   -134.26 
13 1 PRO E 132 ? ? -47.76  99.28   
14 1 PHE E 155 ? ? -95.17  49.07   
15 1 ALA E 188 ? ? -177.26 134.53  
16 1 ALA E 200 ? ? -138.64 -36.57  
17 1 GLN E 218 ? ? -99.40  -82.59  
18 1 GLN F 133 ? ? -63.85  -71.42  
19 1 SER F 156 ? ? -60.73  5.49    
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ALA E 117 ? ? ASP E 118 ? ? 143.32  
2 1 PHE E 201 ? ? CYS E 202 ? ? -147.09 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             ALA 
_pdbx_validate_main_chain_plane.auth_asym_id             E 
_pdbx_validate_main_chain_plane.auth_seq_id              200 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -16.80 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 189 ? A ASP 137 
2  1 Y 1 A GLU 190 ? A GLU 138 
3  1 Y 1 A ASN 191 ? A ASN 139 
4  1 Y 1 A ASN 192 ? A ASN 140 
5  1 Y 1 A GLY 193 ? A GLY 141 
6  1 Y 1 A PHE 194 ? A PHE 142 
7  1 Y 1 A GLY 195 ? A GLY 143 
8  1 Y 1 A SER 196 ? A SER 144 
9  1 Y 1 A LYS 197 ? A LYS 145 
10 1 Y 1 A ASN 198 ? A ASN 146 
11 1 Y 1 E GLU 190 ? C GLU 138 
12 1 Y 1 E ASN 191 ? C ASN 139 
13 1 Y 1 E ASN 192 ? C ASN 140 
14 1 Y 1 E GLY 193 ? C GLY 141 
15 1 Y 1 E PHE 194 ? C PHE 142 
16 1 Y 1 E GLY 195 ? C GLY 143 
17 1 Y 1 E SER 196 ? C SER 144 
18 1 Y 1 E LYS 197 ? C LYS 145 
19 1 Y 1 E ASN 198 ? C ASN 146 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4S0H 'double helix'        
4S0H 'a-form double helix' 
4S0H 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 E DT 1  1_555 F DA 19 1_555 -0.323 -0.240 -0.138 -8.241  -12.105 18.196 1  C_DT1:DA19_D  C 1  ? D 19 ? 20 1 
1 E DC 2  1_555 F DG 18 1_555 -0.339 -0.263 0.261  -4.396  -12.725 7.423  2  C_DC2:DG18_D  C 2  ? D 18 ? 19 1 
1 E DT 3  1_555 F DA 17 1_555 -0.507 -0.146 0.409  -3.639  -16.325 11.804 3  C_DT3:DA17_D  C 3  ? D 17 ? 20 1 
1 E DC 4  1_555 F DG 16 1_555 0.355  -0.253 0.265  -7.186  -5.975  6.077  4  C_DC4:DG16_D  C 4  ? D 16 ? 19 1 
1 E DA 5  1_555 F DT 15 1_555 0.199  -0.073 0.419  1.010   -12.581 6.786  5  C_DA5:DT15_D  C 5  ? D 15 ? 20 1 
1 E DC 6  1_555 F DG 14 1_555 -0.748 0.222  0.171  -5.214  -5.657  -2.570 6  C_DC6:DG14_D  C 6  ? D 14 ? 19 1 
1 E DA 7  1_555 F DT 13 1_555 0.818  0.017  0.802  11.914  -14.469 1.493  7  C_DA7:DT13_D  C 7  ? D 13 ? 20 1 
1 E DC 8  1_555 F DG 12 1_555 0.503  -0.080 -0.026 3.219   -6.315  -0.034 8  C_DC8:DG12_D  C 8  ? D 12 ? 19 1 
1 E DC 9  1_555 F DG 11 1_555 -0.058 0.043  0.217  -3.793  -12.559 7.573  9  C_DC9:DG11_D  C 9  ? D 11 ? 19 1 
1 E DT 10 1_555 F DA 10 1_555 -0.217 -0.208 0.593  -5.872  -12.866 2.480  10 C_DT10:DA10_D C 10 ? D 10 ? 20 1 
1 E DT 11 1_555 F DA 9  1_555 0.096  -0.338 -0.176 -1.758  -17.615 -0.333 11 C_DT11:DA9_D  C 11 ? D 9  ? 20 1 
1 E DT 12 1_555 F DA 8  1_555 0.290  -0.148 -0.028 -8.440  -16.631 4.666  12 C_DT12:DA8_D  C 12 ? D 8  ? 20 1 
1 E DG 13 1_555 F DC 7  1_555 0.003  0.070  0.124  3.200   -2.079  6.876  13 C_DG13:DC7_D  C 13 ? D 7  ? 19 1 
1 E DA 14 1_555 F DT 6  1_555 -0.023 -0.127 0.184  12.122  -13.075 -1.996 14 C_DA14:DT6_D  C 14 ? D 6  ? 20 1 
1 E DA 15 1_555 F DT 5  1_555 0.439  -0.209 0.527  7.802   -13.723 1.190  15 C_DA15:DT5_D  C 15 ? D 5  ? 20 1 
1 E DG 16 1_555 F DC 4  1_555 -0.572 -0.294 0.332  -1.850  -12.869 0.389  16 C_DG16:DC4_D  C 16 ? D 4  ? 19 1 
1 E DT 17 1_555 F DA 3  1_555 -0.313 -0.005 0.318  4.055   -16.810 6.726  17 C_DT17:DA3_D  C 17 ? D 3  ? 20 1 
1 E DG 18 1_555 F DC 2  1_555 -0.598 -0.316 0.462  9.838   -6.501  0.484  18 C_DG18:DC2_D  C 18 ? D 2  ? 19 1 
1 E DG 19 1_555 F DC 1  1_555 -0.295 -0.212 0.366  5.248   -11.550 7.811  19 C_DG19:DC1_D  C 19 ? D 1  ? 19 1 
1 G DT 1  1_555 H DA 19 1_555 -1.002 0.047  0.251  -11.414 -21.722 -2.020 20 G_DT1:DA19_H  G 1  ? H 19 ? 20 1 
1 G DC 2  1_555 H DG 18 1_555 -0.894 0.009  0.117  -2.105  -14.910 8.862  21 G_DC2:DG18_H  G 2  ? H 18 ? 19 1 
1 G DT 3  1_555 H DA 17 1_555 -0.067 -0.088 0.121  -6.711  -7.105  2.050  22 G_DT3:DA17_H  G 3  ? H 17 ? 20 1 
1 G DC 4  1_555 H DG 16 1_555 -0.332 -0.186 -0.198 2.303   -10.890 0.064  23 G_DC4:DG16_H  G 4  ? H 16 ? 19 1 
1 G DA 5  1_555 H DT 15 1_555 0.069  -0.191 0.164  -4.853  -14.595 7.009  24 G_DA5:DT15_H  G 5  ? H 15 ? 20 1 
1 G DC 6  1_555 H DG 14 1_555 -0.143 0.008  0.299  -0.216  -8.512  2.307  25 G_DC6:DG14_H  G 6  ? H 14 ? 19 1 
1 G DA 7  1_555 H DT 13 1_555 0.401  -0.008 0.339  15.257  -16.528 4.049  26 G_DA7:DT13_H  G 7  ? H 13 ? 20 1 
1 G DC 8  1_555 H DG 12 1_555 0.311  -0.079 0.081  5.142   -14.969 3.739  27 G_DC8:DG12_H  G 8  ? H 12 ? 19 1 
1 G DC 9  1_555 H DG 11 1_555 0.188  -0.144 0.467  -2.980  -12.236 5.751  28 G_DC9:DG11_H  G 9  ? H 11 ? 19 1 
1 G DT 10 1_555 H DA 10 1_555 0.003  -0.278 0.232  -8.866  -21.202 2.896  29 G_DT10:DA10_H G 10 ? H 10 ? 20 1 
1 G DT 11 1_555 H DA 9  1_555 -0.081 -0.331 -0.077 -5.069  -24.180 -3.244 30 G_DT11:DA9_H  G 11 ? H 9  ? 20 1 
1 G DT 12 1_555 H DA 8  1_555 0.316  -0.418 -0.154 -6.321  -24.799 -1.287 31 G_DT12:DA8_H  G 12 ? H 8  ? 20 1 
1 G DG 13 1_555 H DC 7  1_555 -0.392 -0.106 -0.223 -3.252  -3.384  -0.159 32 G_DG13:DC7_H  G 13 ? H 7  ? 19 1 
1 G DA 14 1_555 H DT 6  1_555 -0.110 -0.354 0.176  11.436  -12.326 3.609  33 G_DA14:DT6_H  G 14 ? H 6  ? 20 1 
1 G DA 15 1_555 H DT 5  1_555 -0.022 -0.139 0.207  9.674   -12.080 3.232  34 G_DA15:DT5_H  G 15 ? H 5  ? 20 1 
1 G DG 16 1_555 H DC 4  1_555 -0.855 -0.403 0.573  -0.371  -13.133 3.540  35 G_DG16:DC4_H  G 16 ? H 4  ? 19 1 
1 G DT 17 1_555 H DA 3  1_555 0.354  -0.454 0.832  -7.222  -21.229 -0.376 36 G_DT17:DA3_H  G 17 ? H 3  ? 20 1 
1 G DG 18 1_555 H DC 2  1_555 0.079  -0.383 0.547  9.688   -3.614  -2.181 37 G_DG18:DC2_H  G 18 ? H 2  ? 19 1 
1 G DG 19 1_555 H DC 1  1_555 -0.389 -0.304 0.340  -4.729  -16.141 1.808  38 G_DG19:DC1_H  G 19 ? H 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 E DT 1  1_555 F DA 19 1_555 E DC 2  1_555 F DG 18 1_555 -0.318 -0.238 3.420 -2.144 -0.336 36.320 -0.332 0.196  3.435 -0.538 
3.436   36.383 1  CC_DT1DC2:DG18DA19_DD  C 1  ? D 19 ? C 2  ? D 18 ? 
1 E DC 2  1_555 F DG 18 1_555 E DT 3  1_555 F DA 17 1_555 -0.406 -0.408 3.268 -0.454 5.265  32.611 -1.601 0.639  3.171 9.299  
0.801   33.025 2  CC_DC2DT3:DA17DG18_DD  C 2  ? D 18 ? C 3  ? D 17 ? 
1 E DT 3  1_555 F DA 17 1_555 E DC 4  1_555 F DG 16 1_555 0.021  0.694  3.448 0.975  -0.022 41.526 0.981  0.080  3.447 -0.031 
-1.375  41.537 3  CC_DT3DC4:DG16DA17_DD  C 3  ? D 17 ? C 4  ? D 16 ? 
1 E DC 4  1_555 F DG 16 1_555 E DA 5  1_555 F DT 15 1_555 -0.769 1.313  3.144 -3.033 4.514  34.171 1.515  0.827  3.339 7.622  
5.121   34.588 4  CC_DC4DA5:DT15DG16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 E DA 5  1_555 F DT 15 1_555 E DC 6  1_555 F DG 14 1_555 -0.004 -0.809 3.539 1.332  -3.481 28.089 -0.770 0.347  3.607 -7.133 
-2.730  28.331 5  CC_DA5DC6:DG14DT15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 E DC 6  1_555 F DG 14 1_555 E DA 7  1_555 F DT 13 1_555 0.271  0.522  3.155 -3.209 10.971 40.902 -0.377 -0.696 3.158 15.341 
4.488   42.403 6  CC_DC6DA7:DT13DG14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 E DA 7  1_555 F DT 13 1_555 E DC 8  1_555 F DG 12 1_555 0.423  -0.874 3.571 6.428  -0.199 30.206 -1.600 0.588  3.587 -0.376 
-12.163 30.868 7  CC_DA7DC8:DG12DT13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 E DC 8  1_555 F DG 12 1_555 E DC 9  1_555 F DG 11 1_555 1.139  -0.141 3.355 1.058  0.178  37.402 -0.243 -1.631 3.384 0.277  
-1.650  37.416 8  CC_DC8DC9:DG11DG12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 E DC 9  1_555 F DG 11 1_555 E DT 10 1_555 F DA 10 1_555 -0.887 -0.677 3.431 -1.049 2.733  29.889 -1.893 1.487  3.385 5.283  
2.027   30.029 9  CC_DC9DT10:DA10DG11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 E DT 10 1_555 F DA 10 1_555 E DT 11 1_555 F DA 9  1_555 -0.119 -0.147 3.117 6.373  -5.211 39.408 0.349  0.863  3.056 -7.627 
-9.328  40.226 10 CC_DT10DT11:DA9DA10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 E DT 11 1_555 F DA 9  1_555 E DT 12 1_555 F DA 8  1_555 0.469  0.508  3.385 2.377  -0.504 41.546 0.771  -0.400 3.399 -0.710 
-3.348  41.614 11 CC_DT11DT12:DA8DA9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 E DT 12 1_555 F DA 8  1_555 E DG 13 1_555 F DC 7  1_555 0.766  1.172  3.094 -2.495 8.620  27.536 0.454  -2.081 3.225 17.530 
5.073   28.934 12 CC_DT12DG13:DC7DA8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 E DG 13 1_555 F DC 7  1_555 E DA 14 1_555 F DT 6  1_555 -1.453 1.324  3.258 -4.754 4.959  33.288 1.428  1.683  3.579 8.544  
8.190   33.970 13 CC_DG13DA14:DT6DC7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 E DA 14 1_555 F DT 6  1_555 E DA 15 1_555 F DT 5  1_555 0.512  -0.654 3.332 -2.370 1.522  37.384 -1.219 -1.110 3.267 2.370  
3.692   37.486 14 CC_DA14DA15:DT5DT6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 E DA 15 1_555 F DT 5  1_555 E DG 16 1_555 F DC 4  1_555 -0.148 -1.493 3.476 -1.695 0.040  32.890 -2.641 -0.045 3.477 0.071  
2.991   32.932 15 CC_DA15DG16:DC4DT5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 E DG 16 1_555 F DC 4  1_555 E DT 17 1_555 F DA 3  1_555 -0.325 -0.787 3.140 -0.097 6.702  26.338 -3.246 0.669  2.857 14.412 
0.209   27.163 16 CC_DG16DT17:DA3DC4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 E DT 17 1_555 F DA 3  1_555 E DG 18 1_555 F DC 2  1_555 0.242  -0.538 3.066 -2.598 -0.488 31.972 -0.892 -0.876 3.045 -0.884 
4.707   32.078 17 CC_DT17DG18:DC2DA3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 E DG 18 1_555 F DC 2  1_555 E DG 19 1_555 F DC 1  1_555 0.258  -1.038 3.456 -1.777 4.998  37.267 -2.281 -0.639 3.280 7.773  
2.763   37.629 18 CC_DG18DG19:DC1DC2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
1 G DT 1  1_555 H DA 19 1_555 G DC 2  1_555 H DG 18 1_555 1.028  -0.553 3.160 2.763  3.829  33.441 -1.554 -1.336 3.152 6.613  
-4.772  33.764 19 GG_DT1DC2:DG18DA19_HH  G 1  ? H 19 ? G 2  ? H 18 ? 
1 G DC 2  1_555 H DG 18 1_555 G DT 3  1_555 H DA 17 1_555 0.056  -0.217 3.453 1.887  2.721  40.197 -0.639 0.143  3.431 3.951  
-2.740  40.328 20 GG_DC2DT3:DA17DG18_HH  G 2  ? H 18 ? G 3  ? H 17 ? 
1 G DT 3  1_555 H DA 17 1_555 G DC 4  1_555 H DG 16 1_555 -0.227 0.530  2.924 3.908  3.268  34.798 0.440  0.900  2.918 5.428  
-6.491  35.157 21 GG_DT3DC4:DG16DA17_HH  G 3  ? H 17 ? G 4  ? H 16 ? 
1 G DC 4  1_555 H DG 16 1_555 G DA 5  1_555 H DT 15 1_555 -0.155 1.168  3.618 -5.015 5.919  38.891 0.937  -0.438 3.740 8.784  
7.441   39.628 22 GG_DC4DA5:DT15DG16_HH  G 4  ? H 16 ? G 5  ? H 15 ? 
1 G DA 5  1_555 H DT 15 1_555 G DC 6  1_555 H DG 14 1_555 0.178  -0.792 3.197 -0.319 -1.262 30.243 -1.266 -0.404 3.225 -2.417 
0.610   30.271 23 GG_DA5DC6:DG14DT15_HH  G 5  ? H 15 ? G 6  ? H 14 ? 
1 G DC 6  1_555 H DG 14 1_555 G DA 7  1_555 H DT 13 1_555 -0.123 0.770  3.142 1.762  8.269  35.784 0.108  0.433  3.225 13.231 
-2.820  36.738 24 GG_DC6DA7:DT13DG14_HH  G 6  ? H 14 ? G 7  ? H 13 ? 
1 G DA 7  1_555 H DT 13 1_555 G DC 8  1_555 H DG 12 1_555 0.504  -0.915 3.527 1.500  4.825  33.469 -2.399 -0.609 3.385 8.319  
-2.586  33.838 25 GG_DA7DC8:DG12DT13_HH  G 7  ? H 13 ? G 8  ? H 12 ? 
1 G DC 8  1_555 H DG 12 1_555 G DC 9  1_555 H DG 11 1_555 0.544  -0.550 3.477 -2.247 6.076  35.848 -1.763 -1.197 3.303 9.774  
3.614   36.410 26 GG_DC8DC9:DG11DG12_HH  G 8  ? H 12 ? G 9  ? H 11 ? 
1 G DC 9  1_555 H DG 11 1_555 G DT 10 1_555 H DA 10 1_555 -1.000 -0.963 3.421 2.369  -0.030 31.151 -1.782 2.321  3.339 -0.057 
-4.403  31.238 27 GG_DC9DT10:DA10DG11_HH G 9  ? H 11 ? G 10 ? H 10 ? 
1 G DT 10 1_555 H DA 10 1_555 G DT 11 1_555 H DA 9  1_555 -0.450 -0.156 3.116 0.352  -2.546 36.274 0.089  0.768  3.115 -4.084 
-0.564  36.362 28 GG_DT10DT11:DA9DA10_HH G 10 ? H 10 ? G 11 ? H 9  ? 
1 G DT 11 1_555 H DA 9  1_555 G DT 12 1_555 H DA 8  1_555 -0.059 0.403  3.262 2.048  -1.669 41.232 0.749  0.302  3.238 -2.367 
-2.904  41.313 29 GG_DT11DT12:DA8DA9_HH  G 11 ? H 9  ? G 12 ? H 8  ? 
1 G DT 12 1_555 H DA 8  1_555 G DG 13 1_555 H DC 7  1_555 0.890  1.597  3.356 -0.074 5.770  29.858 1.807  -1.714 3.592 11.068 
0.142   30.398 30 GG_DT12DG13:DC7DA8_HH  G 12 ? H 8  ? G 13 ? H 7  ? 
1 G DG 13 1_555 H DC 7  1_555 G DA 14 1_555 H DT 6  1_555 -0.748 1.794  3.083 -2.566 -0.654 33.698 3.185  0.894  3.095 -1.127 
4.418   33.799 31 GG_DG13DA14:DT6DC7_HH  G 13 ? H 7  ? G 14 ? H 6  ? 
1 G DA 14 1_555 H DT 6  1_555 G DA 15 1_555 H DT 5  1_555 0.617  -0.247 3.314 -0.277 0.242  33.168 -0.474 -1.128 3.307 0.423  
0.485   33.170 32 GG_DA14DA15:DT5DT6_HH  G 14 ? H 6  ? G 15 ? H 5  ? 
1 G DA 15 1_555 H DT 5  1_555 G DG 16 1_555 H DC 4  1_555 -0.004 -0.894 3.396 -4.422 1.702  37.929 -1.588 -0.569 3.333 2.606  
6.771   38.213 33 GG_DA15DG16:DC4DT5_HH  G 15 ? H 5  ? G 16 ? H 4  ? 
1 G DG 16 1_555 H DC 4  1_555 G DT 17 1_555 H DA 3  1_555 -0.396 -0.854 3.535 -3.608 0.086  33.776 -1.477 0.051  3.555 0.147  
6.188   33.963 34 GG_DG16DT17:DA3DC4_HH  G 16 ? H 4  ? G 17 ? H 3  ? 
1 G DT 17 1_555 H DA 3  1_555 G DG 18 1_555 H DC 2  1_555 0.310  -1.202 2.699 5.070  4.592  26.293 -3.490 0.366  2.472 9.884  
-10.913 27.153 35 GG_DT17DG18:DC2DA3_HH  G 17 ? H 3  ? G 18 ? H 2  ? 
1 G DG 18 1_555 H DC 2  1_555 G DG 19 1_555 H DC 1  1_555 0.321  -1.091 3.582 -1.104 2.703  33.939 -2.328 -0.738 3.475 4.620  
1.887   34.061 36 GG_DG18DG19:DC1DC2_HH  G 18 ? H 2  ? G 19 ? H 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#