data_4SBV
# 
_entry.id   4SBV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4SBV         
WWPDB D_1000179418 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             1985-07-17 
_pdbx_database_PDB_obs_spr.pdb_id           4SBV 
_pdbx_database_PDB_obs_spr.replace_pdb_id   3SBV 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4SBV 
_pdbx_database_status.recvd_initial_deposition_date   1985-04-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Rossmann, M.G.' 
_audit_author.pdbx_ordinal   1 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The Refinement of Southern Bean Mosaic Virus in Reciprocal Space' 'Acta Crystallogr.,Sect.B' 41  147  ? 1985 ASBSDK DK 
0108-7681 0622 ? -1 ? 
1       'Subunit Interactions in Southern Bean Mosaic Virus' J.Mol.Biol.                166 37   ? 1983 JMOBAK UK 0022-2836 0070 ? 
?  ? 
2       'Structural Comparisons of Small Spherical Plant Viruses' J.Mol.Biol.                165 711  ? 1983 JMOBAK UK 0022-2836 
0070 ? ?  ? 
3       
'Amino Acid Sequence of Southern Bean Mosaic Virus Coat Protein and its Relation to the Three-Dimensional Structure of the Virus' 
Virology                   119 133  ? 1982 VIRLAX US 0042-6822 0922 ? ?  ? 
4       
'A Description of Techniques Used in the Structure Determination of Southern Bean Mosaic Virus at 2.8 Angstroms Resolution'       
'Acta Crystallogr.,Sect.B' 37  2002 ? 1981 ASBSDK DK 0108-7681 0622 ? ?  ? 
5       'Southern Bean Mosaic Virus at 2.8 Angstroms Resolution' Nature                     286 33   ? 1980 NATUAS UK 0028-0836 
0006 ? ?  ? 
6       'Metal-Free Southern Bean Mosaic Virus Crystals' J.Biol.Chem.               254 5243 ? 1979 JBCHA3 US 0021-9258 0071 ? ?  
? 
7       'The Structure of Southern Bean Mosaic Virus at 5 Angstroms Resolution' Virology                   85  187  ? 1978 VIRLAX 
US 0042-6822 0922 ? ?  ? 
8       'An 11 Angstroms-Resolution Electron Density Map of Southern Bean Mosaic Virus' 'Acta Crystallogr.,Sect.B' 34  567  ? 1978 
ASBSDK DK 0108-7681 0622 ? ?  ? 
9       'The Structure of Southern Bean Mosaic Virus at 22.5 Angstroms Resolution' Virology                   75  394  ? 1976 
VIRLAX US 0042-6822 0922 ? ?  ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Silva, A.M.'        1  
primary 'Rossmann, M.G.'     2  
1       'Rossmann, M.G.'     3  
1       'Abad-Zapatero, C.'  4  
1       'Hermodson, M.A.'    5  
1       'Erickson, J.W.'     6  
2       'Rossmann, M.G.'     7  
2       'Abad-Zapatero, C.'  8  
2       'Murthy, M.R.'       9  
2       'Liljas, L.'         10 
2       'Jones, T.A.'        11 
2       'Strandberg, B.'     12 
3       'Hermodson, M.A.'    13 
3       'Abad-Zapatero, C.'  14 
3       'Abdel-Meguid, S.S.' 15 
3       'Pundak, S.'         16 
3       'Rossmann, M.G.'     17 
3       'Tremaine, J.H.'     18 
4       'Abad-Zapatero, C.'  19 
4       'Abdel-Meguid, S.S.' 20 
4       'Johnson, J.E.'      21 
4       'Leslie, A.G.W.'     22 
4       'Rayment, I.'        23 
4       'Rossmann, M.G.'     24 
4       'Suck, D.'           25 
4       'Tsukihara, T.'      26 
5       'Abad-Zapatero, C.'  27 
5       'Abdel-Meguid, S.S.' 28 
5       'Johnson, J.E.'      29 
5       'Leslie, A.G.W.'     30 
5       'Rayment, I.'        31 
5       'Rossmann, M.G.'     32 
5       'Suck, D.'           33 
5       'Tsukihara, T.'      34 
6       'Rayment, I.'        35 
6       'Johnson, J.E.'      36 
6       'Rossmann, M.G.'     37 
7       'Suck, D.'           38 
7       'Rayment, I.'        39 
7       'Johnson, J.E.'      40 
7       'Rossmann, M.G.'     41 
8       'Rayment, I.'        42 
8       'Johnson, J.E.'      43 
8       'Suck, D.'           44 
8       'Akimoto, T.'        45 
8       'Rossmann, M.G.'     46 
8       'Lonberg-Holm, K.'   47 
8       'Korant, B.D.'       48 
9       'Johnson, J.E.'      49 
9       'Akimoto, T.'        50 
9       'Suck, D.'           51 
9       'Rayment, I.'        52 
9       'Rossmann, M.G.'     53 
# 
_cell.entry_id           4SBV 
_cell.length_a           334.300 
_cell.length_b           334.300 
_cell.length_c           757.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              54 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         4SBV 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SOUTHERN BEAN MOSAIC VIRUS COAT PROTEIN' 28261.676 3  ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'                             40.078    3  ? ? ? ? 
3 water       nat water                                     18.015    34 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ATRLTKKQLAQAIQNTLPNPPRRKRRAKRRAAQVPKPTQAGVSMAPIAQGTMVKLRPPMLRSSMDVTILSHCELSTELAV
TVTIVVTSELVMPFTVGTWLRGVAQNWSKYAWVAIRYTYLPSCPTTTSGAIHMGFQYDMADTLPVSVNQLSNLKGYVTGP
VWEGQSGLCFVNNTKCPDTSRAITIALDTNEVSEKRYPFKTATDYATAVGVNANIGNILVPARLVTAMEGGSSKTAVNTG
RLYASYTIRLIEPIAAALNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ATRLTKKQLAQAIQNTLPNPPRRKRRAKRRAAQVPKPTQAGVSMAPIAQGTMVKLRPPMLRSSMDVTILSHCELSTELAV
TVTIVVTSELVMPFTVGTWLRGVAQNWSKYAWVAIRYTYLPSCPTTTSGAIHMGFQYDMADTLPVSVNQLSNLKGYVTGP
VWEGQSGLCFVNNTKCPDTSRAITIALDTNEVSEKRYPFKTATDYATAVGVNANIGNILVPARLVTAMEGGSSKTAVNTG
RLYASYTIRLIEPIAAALNL
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   THR n 
1 3   ARG n 
1 4   LEU n 
1 5   THR n 
1 6   LYS n 
1 7   LYS n 
1 8   GLN n 
1 9   LEU n 
1 10  ALA n 
1 11  GLN n 
1 12  ALA n 
1 13  ILE n 
1 14  GLN n 
1 15  ASN n 
1 16  THR n 
1 17  LEU n 
1 18  PRO n 
1 19  ASN n 
1 20  PRO n 
1 21  PRO n 
1 22  ARG n 
1 23  ARG n 
1 24  LYS n 
1 25  ARG n 
1 26  ARG n 
1 27  ALA n 
1 28  LYS n 
1 29  ARG n 
1 30  ARG n 
1 31  ALA n 
1 32  ALA n 
1 33  GLN n 
1 34  VAL n 
1 35  PRO n 
1 36  LYS n 
1 37  PRO n 
1 38  THR n 
1 39  GLN n 
1 40  ALA n 
1 41  GLY n 
1 42  VAL n 
1 43  SER n 
1 44  MET n 
1 45  ALA n 
1 46  PRO n 
1 47  ILE n 
1 48  ALA n 
1 49  GLN n 
1 50  GLY n 
1 51  THR n 
1 52  MET n 
1 53  VAL n 
1 54  LYS n 
1 55  LEU n 
1 56  ARG n 
1 57  PRO n 
1 58  PRO n 
1 59  MET n 
1 60  LEU n 
1 61  ARG n 
1 62  SER n 
1 63  SER n 
1 64  MET n 
1 65  ASP n 
1 66  VAL n 
1 67  THR n 
1 68  ILE n 
1 69  LEU n 
1 70  SER n 
1 71  HIS n 
1 72  CYS n 
1 73  GLU n 
1 74  LEU n 
1 75  SER n 
1 76  THR n 
1 77  GLU n 
1 78  LEU n 
1 79  ALA n 
1 80  VAL n 
1 81  THR n 
1 82  VAL n 
1 83  THR n 
1 84  ILE n 
1 85  VAL n 
1 86  VAL n 
1 87  THR n 
1 88  SER n 
1 89  GLU n 
1 90  LEU n 
1 91  VAL n 
1 92  MET n 
1 93  PRO n 
1 94  PHE n 
1 95  THR n 
1 96  VAL n 
1 97  GLY n 
1 98  THR n 
1 99  TRP n 
1 100 LEU n 
1 101 ARG n 
1 102 GLY n 
1 103 VAL n 
1 104 ALA n 
1 105 GLN n 
1 106 ASN n 
1 107 TRP n 
1 108 SER n 
1 109 LYS n 
1 110 TYR n 
1 111 ALA n 
1 112 TRP n 
1 113 VAL n 
1 114 ALA n 
1 115 ILE n 
1 116 ARG n 
1 117 TYR n 
1 118 THR n 
1 119 TYR n 
1 120 LEU n 
1 121 PRO n 
1 122 SER n 
1 123 CYS n 
1 124 PRO n 
1 125 THR n 
1 126 THR n 
1 127 THR n 
1 128 SER n 
1 129 GLY n 
1 130 ALA n 
1 131 ILE n 
1 132 HIS n 
1 133 MET n 
1 134 GLY n 
1 135 PHE n 
1 136 GLN n 
1 137 TYR n 
1 138 ASP n 
1 139 MET n 
1 140 ALA n 
1 141 ASP n 
1 142 THR n 
1 143 LEU n 
1 144 PRO n 
1 145 VAL n 
1 146 SER n 
1 147 VAL n 
1 148 ASN n 
1 149 GLN n 
1 150 LEU n 
1 151 SER n 
1 152 ASN n 
1 153 LEU n 
1 154 LYS n 
1 155 GLY n 
1 156 TYR n 
1 157 VAL n 
1 158 THR n 
1 159 GLY n 
1 160 PRO n 
1 161 VAL n 
1 162 TRP n 
1 163 GLU n 
1 164 GLY n 
1 165 GLN n 
1 166 SER n 
1 167 GLY n 
1 168 LEU n 
1 169 CYS n 
1 170 PHE n 
1 171 VAL n 
1 172 ASN n 
1 173 ASN n 
1 174 THR n 
1 175 LYS n 
1 176 CYS n 
1 177 PRO n 
1 178 ASP n 
1 179 THR n 
1 180 SER n 
1 181 ARG n 
1 182 ALA n 
1 183 ILE n 
1 184 THR n 
1 185 ILE n 
1 186 ALA n 
1 187 LEU n 
1 188 ASP n 
1 189 THR n 
1 190 ASN n 
1 191 GLU n 
1 192 VAL n 
1 193 SER n 
1 194 GLU n 
1 195 LYS n 
1 196 ARG n 
1 197 TYR n 
1 198 PRO n 
1 199 PHE n 
1 200 LYS n 
1 201 THR n 
1 202 ALA n 
1 203 THR n 
1 204 ASP n 
1 205 TYR n 
1 206 ALA n 
1 207 THR n 
1 208 ALA n 
1 209 VAL n 
1 210 GLY n 
1 211 VAL n 
1 212 ASN n 
1 213 ALA n 
1 214 ASN n 
1 215 ILE n 
1 216 GLY n 
1 217 ASN n 
1 218 ILE n 
1 219 LEU n 
1 220 VAL n 
1 221 PRO n 
1 222 ALA n 
1 223 ARG n 
1 224 LEU n 
1 225 VAL n 
1 226 THR n 
1 227 ALA n 
1 228 MET n 
1 229 GLU n 
1 230 GLY n 
1 231 GLY n 
1 232 SER n 
1 233 SER n 
1 234 LYS n 
1 235 THR n 
1 236 ALA n 
1 237 VAL n 
1 238 ASN n 
1 239 THR n 
1 240 GLY n 
1 241 ARG n 
1 242 LEU n 
1 243 TYR n 
1 244 ALA n 
1 245 SER n 
1 246 TYR n 
1 247 THR n 
1 248 ILE n 
1 249 ARG n 
1 250 LEU n 
1 251 ILE n 
1 252 GLU n 
1 253 PRO n 
1 254 ILE n 
1 255 ALA n 
1 256 ALA n 
1 257 ALA n 
1 258 LEU n 
1 259 ASN n 
1 260 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Sobemovirus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'COW PEA STRAIN' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Southern bean mosaic virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     12139 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COAT_SBMV 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03607 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSGLFHHRTKPREIRAFVMATRLTKKQLAQAIQNTLPNPPRRKRRAKRRAAQVPKPTQAGVSMAPIAQGTMVKLRPPMLR
SSMDVTILSHCELSTELAVTVTIVVTSELVMPFTVGTWLRGVAQNWSKYAWVAIRYTYLPSCPTTTSGAIHMGFQYDMAD
TLPVSVNQLSNLKGYVTGPVWEGQSGLCFVNNTKCPDTSRAITIALDTNEVSEKRYPFKTATDYATAVGVNANIGNILVP
ARLVTAMEGGSSKTAVNTGRLYASYTIRLIEPIAAALNL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4SBV A 1 ? 260 ? P03607 20 ? 279 ? 1 260 
2 1 4SBV B 1 ? 260 ? P03607 20 ? 279 ? 1 260 
3 1 4SBV C 1 ? 260 ? P03607 20 ? 279 ? 1 260 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4SBV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.14 
_exptl_crystal.density_percent_sol   42.56 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 4SBV 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             . 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.254 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4686 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             34 
_refine_hist.number_atoms_total               4723 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  4SBV 
_struct.title                     'The REFINEMENT OF SOUTHERN BEAN MOSAIC VIRUS IN RECIPROCAL SPACE' 
_struct.pdbx_descriptor           'SOUTHERN BEAN MOSAIC VIRUS COAT PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4SBV 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'COAT PROTEIN (VIRAL), Icosahedral virus, Virus' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 93  ? VAL A 96  ? PRO A 93  VAL A 96  5 ? 4  
HELX_P HELX_P2  2  GLY A 97  ? GLN A 105 ? GLY A 97  GLN A 105 1 ? 9  
HELX_P HELX_P3  3  SER A 146 ? ASN A 152 ? SER A 146 ASN A 152 1 ? 7  
HELX_P HELX_P4  4  THR A 201 ? GLY A 210 ? THR A 201 GLY A 210 1 ? 10 
HELX_P HELX_P5  5  ILE A 215 ? VAL A 220 ? ILE A 215 VAL A 220 1 ? 6  
HELX_P HELX_P6  6  ALA A 255 ? ASN A 259 ? ALA A 255 ASN A 259 5 ? 5  
HELX_P HELX_P7  7  MET B 92  ? GLY B 97  ? MET B 92  GLY B 97  1 ? 6  
HELX_P HELX_P8  8  GLY B 97  ? GLN B 105 ? GLY B 97  GLN B 105 1 ? 9  
HELX_P HELX_P9  9  SER B 146 ? SER B 151 ? SER B 146 SER B 151 1 ? 6  
HELX_P HELX_P10 10 GLY B 167 ? ASN B 173 ? GLY B 167 ASN B 173 1 ? 7  
HELX_P HELX_P11 11 ASP B 178 ? ALA B 182 ? ASP B 178 ALA B 182 5 ? 5  
HELX_P HELX_P12 12 ASP B 188 ? VAL B 192 ? ASP B 188 VAL B 192 5 ? 5  
HELX_P HELX_P13 13 THR B 201 ? GLY B 210 ? THR B 201 GLY B 210 1 ? 10 
HELX_P HELX_P14 14 VAL B 211 ? ASN B 214 ? VAL B 211 ASN B 214 5 ? 4  
HELX_P HELX_P15 15 ILE B 215 ? VAL B 220 ? ILE B 215 VAL B 220 1 ? 6  
HELX_P HELX_P16 16 ALA B 255 ? ASN B 259 ? ALA B 255 ASN B 259 5 ? 5  
HELX_P HELX_P17 17 MET C 92  ? GLY C 97  ? MET C 92  GLY C 97  1 ? 6  
HELX_P HELX_P18 18 TRP C 99  ? GLN C 105 ? TRP C 99  GLN C 105 1 ? 7  
HELX_P HELX_P19 19 SER C 146 ? SER C 151 ? SER C 146 SER C 151 1 ? 6  
HELX_P HELX_P20 20 GLY C 167 ? ASN C 173 ? GLY C 167 ASN C 173 1 ? 7  
HELX_P HELX_P21 21 ASP C 188 ? VAL C 192 ? ASP C 188 VAL C 192 5 ? 5  
HELX_P HELX_P22 22 THR C 201 ? ASN C 212 ? THR C 201 ASN C 212 1 ? 12 
HELX_P HELX_P23 23 ILE C 215 ? VAL C 220 ? ILE C 215 VAL C 220 1 ? 6  
HELX_P HELX_P24 24 ALA C 255 ? ASN C 259 ? ALA C 255 ASN C 259 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 169 SG ? ? ? 1_555 A CYS 176 SG  ? ? A CYS 169 A CYS 176 1_555 ? ? ? ? ? ? ? 2.160 ? 
disulf2  disulf ? ? B CYS 169 SG ? ? ? 1_555 B CYS 176 SG  ? ? B CYS 169 B CYS 176 1_555 ? ? ? ? ? ? ? 2.103 ? 
disulf3  disulf ? ? C CYS 169 SG ? ? ? 1_555 C CYS 176 SG  ? ? C CYS 169 C CYS 176 1_555 ? ? ? ? ? ? ? 1.989 ? 
metalc1  metalc ? ? D CA  .   CA ? ? ? 1_555 B ASN 259 OD1 ? ? A CA  261 B ASN 259 1_555 ? ? ? ? ? ? ? 2.015 ? 
metalc2  metalc ? ? D CA  .   CA ? ? ? 1_555 B PHE 199 O   ? ? A CA  261 B PHE 199 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc3  metalc ? ? D CA  .   CA ? ? ? 1_555 B LEU 260 O   ? ? A CA  261 B LEU 260 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc4  metalc ? ? D CA  .   CA ? ? ? 1_555 A ASP 141 OD1 ? ? A CA  261 A ASP 141 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc5  metalc ? ? D CA  .   CA ? ? ? 1_555 A ASP 138 OD1 ? ? A CA  261 A ASP 138 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc6  metalc ? ? E CA  .   CA ? ? ? 1_555 B ASP 141 OD1 ? ? B CA  261 B ASP 141 1_555 ? ? ? ? ? ? ? 2.841 ? 
metalc7  metalc ? ? E CA  .   CA ? ? ? 1_555 B ASP 141 OD2 ? ? B CA  261 B ASP 141 1_555 ? ? ? ? ? ? ? 2.833 ? 
metalc8  metalc ? ? E CA  .   CA ? ? ? 1_555 B ASP 138 OD1 ? ? B CA  261 B ASP 138 1_555 ? ? ? ? ? ? ? 1.803 ? 
metalc9  metalc ? ? E CA  .   CA ? ? ? 1_555 C PHE 199 O   ? ? B CA  261 C PHE 199 1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc10 metalc ? ? E CA  .   CA ? ? ? 1_555 C ASN 259 OD1 ? ? B CA  261 C ASN 259 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc11 metalc ? ? E CA  .   CA ? ? ? 1_555 C LEU 260 O   ? ? B CA  261 C LEU 260 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc12 metalc ? ? F CA  .   CA ? ? ? 1_555 C ASP 138 OD1 ? ? C CA  261 C ASP 138 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc13 metalc ? ? F CA  .   CA ? ? ? 1_555 A ASN 259 OD1 ? ? C CA  261 A ASN 259 1_555 ? ? ? ? ? ? ? 2.088 ? 
metalc14 metalc ? ? F CA  .   CA ? ? ? 1_555 A LEU 260 O   ? ? C CA  261 A LEU 260 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc15 metalc ? ? F CA  .   CA ? ? ? 1_555 C ASP 141 OD1 ? ? C CA  261 C ASP 141 1_555 ? ? ? ? ? ? ? 3.154 ? 
metalc16 metalc ? ? F CA  .   CA ? ? ? 1_555 C ASP 141 OD2 ? ? C CA  261 C ASP 141 1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc17 metalc ? ? F CA  .   CA ? ? ? 1_555 A PHE 199 O   ? ? C CA  261 A PHE 199 1_555 ? ? ? ? ? ? ? 2.452 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 5 ? 
H ? 5 ? 
I ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 67  ? VAL A 80  ? THR A 67  VAL A 80  
A 2 VAL A 237 ? LEU A 250 ? VAL A 237 LEU A 250 
A 3 LYS A 109 ? PRO A 121 ? LYS A 109 PRO A 121 
A 4 THR A 184 ? ALA A 186 ? THR A 184 ALA A 186 
B 1 THR A 67  ? VAL A 80  ? THR A 67  VAL A 80  
B 2 VAL A 237 ? LEU A 250 ? VAL A 237 LEU A 250 
B 3 LYS A 109 ? PRO A 121 ? LYS A 109 PRO A 121 
B 4 TYR A 197 ? PRO A 198 ? TYR A 197 PRO A 198 
C 1 VAL A 85  ? LEU A 90  ? VAL A 85  LEU A 90  
C 2 ARG A 223 ? GLU A 229 ? ARG A 223 GLU A 229 
C 3 ALA A 130 ? GLN A 136 ? ALA A 130 GLN A 136 
C 4 VAL A 157 ? PRO A 160 ? VAL A 157 PRO A 160 
D 1 THR B 67  ? VAL B 80  ? THR B 67  VAL B 80  
D 2 VAL B 237 ? LEU B 250 ? VAL B 237 LEU B 250 
D 3 LYS B 109 ? PRO B 121 ? LYS B 109 PRO B 121 
D 4 THR B 184 ? ALA B 186 ? THR B 184 ALA B 186 
E 1 THR B 67  ? VAL B 80  ? THR B 67  VAL B 80  
E 2 VAL B 237 ? LEU B 250 ? VAL B 237 LEU B 250 
E 3 LYS B 109 ? PRO B 121 ? LYS B 109 PRO B 121 
E 4 TYR B 197 ? PRO B 198 ? TYR B 197 PRO B 198 
F 1 VAL B 86  ? LEU B 90  ? VAL B 86  LEU B 90  
F 2 ARG B 223 ? GLU B 229 ? ARG B 223 GLU B 229 
F 3 ALA B 130 ? GLN B 136 ? ALA B 130 GLN B 136 
F 4 LYS B 154 ? PRO B 160 ? LYS B 154 PRO B 160 
G 1 MET C 59  ? SER C 62  ? MET C 59  SER C 62  
G 2 THR C 67  ? VAL C 80  ? THR C 67  VAL C 80  
G 3 VAL C 237 ? LEU C 250 ? VAL C 237 LEU C 250 
G 4 LYS C 109 ? PRO C 121 ? LYS C 109 PRO C 121 
G 5 THR C 184 ? ALA C 186 ? THR C 184 ALA C 186 
H 1 MET C 59  ? SER C 62  ? MET C 59  SER C 62  
H 2 THR C 67  ? VAL C 80  ? THR C 67  VAL C 80  
H 3 VAL C 237 ? LEU C 250 ? VAL C 237 LEU C 250 
H 4 LYS C 109 ? PRO C 121 ? LYS C 109 PRO C 121 
H 5 TYR C 197 ? PRO C 198 ? TYR C 197 PRO C 198 
I 1 VAL C 86  ? LEU C 90  ? VAL C 86  LEU C 90  
I 2 ARG C 223 ? MET C 228 ? ARG C 223 MET C 228 
I 3 ALA C 130 ? GLN C 136 ? ALA C 130 GLN C 136 
I 4 VAL C 157 ? PRO C 160 ? VAL C 157 PRO C 160 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 80  ? O VAL A 80  N VAL A 237 ? N VAL A 237 
A 2 3 N ARG A 249 ? N ARG A 249 O ALA A 111 ? O ALA A 111 
A 3 4 O TYR A 117 ? O TYR A 117 N ILE A 185 ? N ILE A 185 
B 1 2 O VAL A 80  ? O VAL A 80  N VAL A 237 ? N VAL A 237 
B 2 3 N ARG A 249 ? N ARG A 249 O ALA A 111 ? O ALA A 111 
B 3 4 N TYR A 110 ? N TYR A 110 O TYR A 197 ? O TYR A 197 
C 1 2 O GLU A 89  ? O GLU A 89  N LEU A 224 ? N LEU A 224 
C 2 3 O GLU A 229 ? O GLU A 229 N ALA A 130 ? N ALA A 130 
C 3 4 O MET A 133 ? O MET A 133 N VAL A 157 ? N VAL A 157 
D 1 2 N VAL B 80  ? N VAL B 80  O VAL B 237 ? O VAL B 237 
D 2 3 N ARG B 249 ? N ARG B 249 O ALA B 111 ? O ALA B 111 
D 3 4 N TYR B 117 ? N TYR B 117 O ILE B 185 ? O ILE B 185 
E 1 2 N VAL B 80  ? N VAL B 80  O VAL B 237 ? O VAL B 237 
E 2 3 N ARG B 249 ? N ARG B 249 O ALA B 111 ? O ALA B 111 
E 3 4 O TYR B 110 ? O TYR B 110 N TYR B 197 ? N TYR B 197 
F 1 2 O GLU B 89  ? O GLU B 89  N LEU B 224 ? N LEU B 224 
F 2 3 O GLU B 229 ? O GLU B 229 N ALA B 130 ? N ALA B 130 
F 3 4 N PHE B 135 ? N PHE B 135 O LYS B 154 ? O LYS B 154 
G 1 2 O ARG C 61  ? O ARG C 61  N ILE C 68  ? N ILE C 68  
G 2 3 N VAL C 80  ? N VAL C 80  O VAL C 237 ? O VAL C 237 
G 3 4 N ARG C 249 ? N ARG C 249 O ALA C 111 ? O ALA C 111 
G 4 5 N TYR C 117 ? N TYR C 117 O ILE C 185 ? O ILE C 185 
H 1 2 O ARG C 61  ? O ARG C 61  N ILE C 68  ? N ILE C 68  
H 2 3 N VAL C 80  ? N VAL C 80  O VAL C 237 ? O VAL C 237 
H 3 4 N ARG C 249 ? N ARG C 249 O ALA C 111 ? O ALA C 111 
H 4 5 O TYR C 110 ? O TYR C 110 N TYR C 197 ? N TYR C 197 
I 1 2 O GLU C 89  ? O GLU C 89  N LEU C 224 ? N LEU C 224 
I 2 3 N ALA C 227 ? N ALA C 227 O HIS C 132 ? O HIS C 132 
I 3 4 N MET C 133 ? N MET C 133 O VAL C 157 ? O VAL C 157 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 261' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 261' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA C 261' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 138 ? ASP A 138 . ? 1_555 ? 
2  AC1 5 ASP A 141 ? ASP A 141 . ? 1_555 ? 
3  AC1 5 PHE B 199 ? PHE B 199 . ? 1_555 ? 
4  AC1 5 ASN B 259 ? ASN B 259 . ? 1_555 ? 
5  AC1 5 LEU B 260 ? LEU B 260 . ? 1_555 ? 
6  AC2 5 ASP B 138 ? ASP B 138 . ? 1_555 ? 
7  AC2 5 ASP B 141 ? ASP B 141 . ? 1_555 ? 
8  AC2 5 PHE C 199 ? PHE C 199 . ? 1_555 ? 
9  AC2 5 ASN C 259 ? ASN C 259 . ? 1_555 ? 
10 AC2 5 LEU C 260 ? LEU C 260 . ? 1_555 ? 
11 AC3 5 PHE A 199 ? PHE A 199 . ? 1_555 ? 
12 AC3 5 ASN A 259 ? ASN A 259 . ? 1_555 ? 
13 AC3 5 LEU A 260 ? LEU A 260 . ? 1_555 ? 
14 AC3 5 ASP C 138 ? ASP C 138 . ? 1_555 ? 
15 AC3 5 ASP C 141 ? ASP C 141 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4SBV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4SBV 
_atom_sites.fract_transf_matrix[1][1]   0.002991 
_atom_sites.fract_transf_matrix[1][2]   0.001727 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003454 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001320 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 62  ? 16.654  -36.397 108.805 1.00 83.28 ? 62  SER A N   1 
ATOM   2    C  CA  . SER A 1 62  ? 16.816  -34.959 109.244 1.00 82.87 ? 62  SER A CA  1 
ATOM   3    C  C   . SER A 1 62  ? 17.820  -34.867 110.376 1.00 82.20 ? 62  SER A C   1 
ATOM   4    O  O   . SER A 1 62  ? 17.648  -35.591 111.398 1.00 82.78 ? 62  SER A O   1 
ATOM   5    C  CB  . SER A 1 62  ? 15.425  -34.437 109.547 1.00 83.15 ? 62  SER A CB  1 
ATOM   6    O  OG  . SER A 1 62  ? 15.216  -33.147 110.051 1.00 83.36 ? 62  SER A OG  1 
ATOM   7    N  N   . SER A 1 63  ? 18.855  -34.040 110.243 1.00 80.80 ? 63  SER A N   1 
ATOM   8    C  CA  . SER A 1 63  ? 19.868  -33.852 111.361 1.00 79.17 ? 63  SER A CA  1 
ATOM   9    C  C   . SER A 1 63  ? 20.581  -32.513 111.041 1.00 77.21 ? 63  SER A C   1 
ATOM   10   O  O   . SER A 1 63  ? 21.331  -32.324 110.078 1.00 77.41 ? 63  SER A O   1 
ATOM   11   C  CB  . SER A 1 63  ? 20.723  -35.062 111.621 1.00 79.67 ? 63  SER A CB  1 
ATOM   12   O  OG  . SER A 1 63  ? 20.081  -36.059 112.490 1.00 79.58 ? 63  SER A OG  1 
ATOM   13   N  N   . MET A 1 64  ? 20.264  -31.544 111.889 1.00 74.48 ? 64  MET A N   1 
ATOM   14   C  CA  . MET A 1 64  ? 20.697  -30.164 111.906 1.00 71.60 ? 64  MET A CA  1 
ATOM   15   C  C   . MET A 1 64  ? 21.193  -29.796 113.326 1.00 67.93 ? 64  MET A C   1 
ATOM   16   O  O   . MET A 1 64  ? 22.317  -29.886 113.777 1.00 67.35 ? 64  MET A O   1 
ATOM   17   C  CB  . MET A 1 64  ? 19.560  -29.227 111.505 1.00 73.58 ? 64  MET A CB  1 
ATOM   18   C  CG  . MET A 1 64  ? 18.515  -29.881 110.640 1.00 75.76 ? 64  MET A CG  1 
ATOM   19   S  SD  . MET A 1 64  ? 18.529  -29.016 108.982 1.00 78.21 ? 64  MET A SD  1 
ATOM   20   C  CE  . MET A 1 64  ? 17.801  -30.390 107.979 1.00 78.14 ? 64  MET A CE  1 
ATOM   21   N  N   . ASP A 1 65  ? 20.216  -29.324 114.061 1.00 63.63 ? 65  ASP A N   1 
ATOM   22   C  CA  . ASP A 1 65  ? 20.136  -28.907 115.430 1.00 59.13 ? 65  ASP A CA  1 
ATOM   23   C  C   . ASP A 1 65  ? 19.054  -29.931 115.993 1.00 54.68 ? 65  ASP A C   1 
ATOM   24   O  O   . ASP A 1 65  ? 18.891  -30.061 117.188 1.00 54.87 ? 65  ASP A O   1 
ATOM   25   C  CB  . ASP A 1 65  ? 19.725  -27.517 115.784 1.00 60.76 ? 65  ASP A CB  1 
ATOM   26   C  CG  . ASP A 1 65  ? 20.047  -26.390 114.835 1.00 61.92 ? 65  ASP A CG  1 
ATOM   27   O  OD1 . ASP A 1 65  ? 21.155  -25.791 114.930 1.00 62.72 ? 65  ASP A OD1 1 
ATOM   28   O  OD2 . ASP A 1 65  ? 19.151  -26.072 113.991 1.00 62.06 ? 65  ASP A OD2 1 
ATOM   29   N  N   . VAL A 1 66  ? 18.411  -30.566 115.024 1.00 48.28 ? 66  VAL A N   1 
ATOM   30   C  CA  . VAL A 1 66  ? 17.441  -31.578 115.307 1.00 42.21 ? 66  VAL A CA  1 
ATOM   31   C  C   . VAL A 1 66  ? 18.110  -32.965 115.099 1.00 37.83 ? 66  VAL A C   1 
ATOM   32   O  O   . VAL A 1 66  ? 18.749  -33.139 114.091 1.00 37.05 ? 66  VAL A O   1 
ATOM   33   C  CB  . VAL A 1 66  ? 16.203  -31.613 114.430 1.00 42.25 ? 66  VAL A CB  1 
ATOM   34   C  CG1 . VAL A 1 66  ? 15.542  -32.999 114.514 1.00 42.03 ? 66  VAL A CG1 1 
ATOM   35   C  CG2 . VAL A 1 66  ? 15.242  -30.521 114.771 1.00 42.29 ? 66  VAL A CG2 1 
ATOM   36   N  N   . THR A 1 67  ? 17.841  -33.830 116.021 1.00 33.13 ? 67  THR A N   1 
ATOM   37   C  CA  . THR A 1 67  ? 18.339  -35.163 116.006 1.00 28.70 ? 67  THR A CA  1 
ATOM   38   C  C   . THR A 1 67  ? 17.216  -36.171 116.065 1.00 26.55 ? 67  THR A C   1 
ATOM   39   O  O   . THR A 1 67  ? 16.381  -36.101 116.954 1.00 26.17 ? 67  THR A O   1 
ATOM   40   C  CB  . THR A 1 67  ? 19.293  -35.512 117.223 1.00 27.68 ? 67  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 67  ? 20.326  -34.542 117.178 1.00 27.10 ? 67  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 67  ? 19.793  -36.961 117.111 1.00 27.02 ? 67  THR A CG2 1 
ATOM   43   N  N   . ILE A 1 68  ? 17.295  -37.097 115.154 1.00 24.58 ? 68  ILE A N   1 
ATOM   44   C  CA  . ILE A 1 68  ? 16.287  -38.151 115.164 1.00 22.79 ? 68  ILE A CA  1 
ATOM   45   C  C   . ILE A 1 68  ? 16.890  -39.497 115.461 1.00 21.71 ? 68  ILE A C   1 
ATOM   46   O  O   . ILE A 1 68  ? 17.969  -39.699 114.873 1.00 22.09 ? 68  ILE A O   1 
ATOM   47   C  CB  . ILE A 1 68  ? 15.632  -38.218 113.772 1.00 22.57 ? 68  ILE A CB  1 
ATOM   48   C  CG1 . ILE A 1 68  ? 14.800  -36.966 113.608 1.00 22.51 ? 68  ILE A CG1 1 
ATOM   49   C  CG2 . ILE A 1 68  ? 14.841  -39.547 113.649 1.00 23.18 ? 68  ILE A CG2 1 
ATOM   50   C  CD1 . ILE A 1 68  ? 13.517  -37.270 112.787 1.00 23.37 ? 68  ILE A CD1 1 
ATOM   51   N  N   . LEU A 1 69  ? 16.258  -40.342 116.228 1.00 20.10 ? 69  LEU A N   1 
ATOM   52   C  CA  . LEU A 1 69  ? 16.844  -41.663 116.457 1.00 18.37 ? 69  LEU A CA  1 
ATOM   53   C  C   . LEU A 1 69  ? 15.626  -42.532 116.808 1.00 17.92 ? 69  LEU A C   1 
ATOM   54   O  O   . LEU A 1 69  ? 14.633  -42.028 117.343 1.00 16.83 ? 69  LEU A O   1 
ATOM   55   C  CB  . LEU A 1 69  ? 17.864  -41.734 117.516 1.00 18.24 ? 69  LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 69  ? 17.418  -41.579 118.967 1.00 17.57 ? 69  LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 69  ? 17.396  -42.920 119.635 1.00 17.49 ? 69  LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 69  ? 18.429  -40.658 119.633 1.00 17.53 ? 69  LEU A CD2 1 
ATOM   59   N  N   . SER A 1 70  ? 15.972  -43.726 116.390 1.00 17.88 ? 70  SER A N   1 
ATOM   60   C  CA  . SER A 1 70  ? 15.005  -44.825 116.546 1.00 18.98 ? 70  SER A CA  1 
ATOM   61   C  C   . SER A 1 70  ? 15.609  -45.981 117.288 1.00 20.33 ? 70  SER A C   1 
ATOM   62   O  O   . SER A 1 70  ? 16.734  -46.350 116.913 1.00 21.34 ? 70  SER A O   1 
ATOM   63   C  CB  . SER A 1 70  ? 14.592  -45.332 115.181 1.00 18.06 ? 70  SER A CB  1 
ATOM   64   O  OG  . SER A 1 70  ? 13.911  -44.290 114.548 1.00 18.08 ? 70  SER A OG  1 
ATOM   65   N  N   . HIS A 1 71  ? 14.864  -46.504 118.249 1.00 21.33 ? 71  HIS A N   1 
ATOM   66   C  CA  . HIS A 1 71  ? 15.388  -47.639 119.017 1.00 21.71 ? 71  HIS A CA  1 
ATOM   67   C  C   . HIS A 1 71  ? 14.296  -48.575 119.476 1.00 21.86 ? 71  HIS A C   1 
ATOM   68   O  O   . HIS A 1 71  ? 13.070  -48.367 119.300 1.00 22.30 ? 71  HIS A O   1 
ATOM   69   C  CB  . HIS A 1 71  ? 16.221  -47.146 120.232 1.00 22.29 ? 71  HIS A CB  1 
ATOM   70   C  CG  . HIS A 1 71  ? 17.080  -48.281 120.723 1.00 22.61 ? 71  HIS A CG  1 
ATOM   71   N  ND1 . HIS A 1 71  ? 17.291  -49.417 119.958 1.00 22.71 ? 71  HIS A ND1 1 
ATOM   72   C  CD2 . HIS A 1 71  ? 17.742  -48.455 121.869 1.00 22.65 ? 71  HIS A CD2 1 
ATOM   73   C  CE1 . HIS A 1 71  ? 18.092  -50.209 120.655 1.00 23.06 ? 71  HIS A CE1 1 
ATOM   74   N  NE2 . HIS A 1 71  ? 18.364  -49.650 121.826 1.00 22.76 ? 71  HIS A NE2 1 
ATOM   75   N  N   . CYS A 1 72  ? 14.795  -49.654 120.082 1.00 21.64 ? 72  CYS A N   1 
ATOM   76   C  CA  . CYS A 1 72  ? 13.863  -50.645 120.579 1.00 21.70 ? 72  CYS A CA  1 
ATOM   77   C  C   . CYS A 1 72  ? 14.445  -51.375 121.750 1.00 21.23 ? 72  CYS A C   1 
ATOM   78   O  O   . CYS A 1 72  ? 15.553  -51.950 121.562 1.00 20.33 ? 72  CYS A O   1 
ATOM   79   C  CB  . CYS A 1 72  ? 13.563  -51.576 119.398 1.00 23.46 ? 72  CYS A CB  1 
ATOM   80   S  SG  . CYS A 1 72  ? 12.264  -52.691 120.072 1.00 25.51 ? 72  CYS A SG  1 
ATOM   81   N  N   . GLU A 1 73  ? 13.668  -51.296 122.835 1.00 20.45 ? 73  GLU A N   1 
ATOM   82   C  CA  . GLU A 1 73  ? 14.133  -51.919 124.088 1.00 20.14 ? 73  GLU A CA  1 
ATOM   83   C  C   . GLU A 1 73  ? 13.054  -52.433 125.003 1.00 19.86 ? 73  GLU A C   1 
ATOM   84   O  O   . GLU A 1 73  ? 11.850  -52.549 124.673 1.00 20.08 ? 73  GLU A O   1 
ATOM   85   C  CB  . GLU A 1 73  ? 15.007  -50.918 124.850 1.00 20.30 ? 73  GLU A CB  1 
ATOM   86   C  CG  . GLU A 1 73  ? 14.557  -49.510 125.006 1.00 21.31 ? 73  GLU A CG  1 
ATOM   87   C  CD  . GLU A 1 73  ? 15.326  -48.516 125.782 1.00 22.15 ? 73  GLU A CD  1 
ATOM   88   O  OE1 . GLU A 1 73  ? 15.280  -47.298 125.645 1.00 22.51 ? 73  GLU A OE1 1 
ATOM   89   O  OE2 . GLU A 1 73  ? 16.090  -49.006 126.669 1.00 23.09 ? 73  GLU A OE2 1 
ATOM   90   N  N   . LEU A 1 74  ? 13.495  -52.823 126.199 1.00 19.37 ? 74  LEU A N   1 
ATOM   91   C  CA  . LEU A 1 74  ? 12.602  -53.437 127.192 1.00 19.21 ? 74  LEU A CA  1 
ATOM   92   C  C   . LEU A 1 74  ? 11.994  -52.406 128.088 1.00 19.23 ? 74  LEU A C   1 
ATOM   93   O  O   . LEU A 1 74  ? 12.792  -51.731 128.740 1.00 19.73 ? 74  LEU A O   1 
ATOM   94   C  CB  . LEU A 1 74  ? 13.437  -54.470 127.954 1.00 19.13 ? 74  LEU A CB  1 
ATOM   95   C  CG  . LEU A 1 74  ? 12.791  -54.900 129.291 1.00 18.71 ? 74  LEU A CG  1 
ATOM   96   C  CD1 . LEU A 1 74  ? 11.839  -56.043 129.052 1.00 18.63 ? 74  LEU A CD1 1 
ATOM   97   C  CD2 . LEU A 1 74  ? 13.930  -55.257 130.212 1.00 18.15 ? 74  LEU A CD2 1 
ATOM   98   N  N   . SER A 1 75  ? 10.704  -52.334 128.096 1.00 19.85 ? 75  SER A N   1 
ATOM   99   C  CA  . SER A 1 75  ? 10.095  -51.279 128.949 1.00 21.17 ? 75  SER A CA  1 
ATOM   100  C  C   . SER A 1 75  ? 9.879   -51.870 130.332 1.00 22.52 ? 75  SER A C   1 
ATOM   101  O  O   . SER A 1 75  ? 10.083  -51.146 131.335 1.00 23.32 ? 75  SER A O   1 
ATOM   102  C  CB  . SER A 1 75  ? 8.856   -50.728 128.312 1.00 20.84 ? 75  SER A CB  1 
ATOM   103  O  OG  . SER A 1 75  ? 8.345   -49.584 129.033 1.00 21.85 ? 75  SER A OG  1 
ATOM   104  N  N   . THR A 1 76  ? 9.510   -53.147 130.369 1.00 23.14 ? 76  THR A N   1 
ATOM   105  C  CA  . THR A 1 76  ? 9.219   -53.756 131.660 1.00 23.51 ? 76  THR A CA  1 
ATOM   106  C  C   . THR A 1 76  ? 8.803   -55.182 131.654 1.00 24.28 ? 76  THR A C   1 
ATOM   107  O  O   . THR A 1 76  ? 8.410   -55.681 130.561 1.00 24.95 ? 76  THR A O   1 
ATOM   108  C  CB  . THR A 1 76  ? 8.010   -52.868 132.200 1.00 23.55 ? 76  THR A CB  1 
ATOM   109  O  OG1 . THR A 1 76  ? 7.841   -53.323 133.543 1.00 24.54 ? 76  THR A OG1 1 
ATOM   110  C  CG2 . THR A 1 76  ? 6.770   -53.015 131.334 1.00 23.07 ? 76  THR A CG2 1 
ATOM   111  N  N   . GLU A 1 77  ? 8.820   -55.849 132.804 1.00 24.57 ? 77  GLU A N   1 
ATOM   112  C  CA  . GLU A 1 77  ? 8.435   -57.291 132.825 1.00 24.69 ? 77  GLU A CA  1 
ATOM   113  C  C   . GLU A 1 77  ? 7.173   -57.576 133.564 1.00 23.32 ? 77  GLU A C   1 
ATOM   114  O  O   . GLU A 1 77  ? 6.791   -56.851 134.502 1.00 23.09 ? 77  GLU A O   1 
ATOM   115  C  CB  . GLU A 1 77  ? 9.594   -58.073 133.421 1.00 26.55 ? 77  GLU A CB  1 
ATOM   116  C  CG  . GLU A 1 77  ? 10.694  -57.242 134.075 1.00 29.16 ? 77  GLU A CG  1 
ATOM   117  C  CD  . GLU A 1 77  ? 12.072  -57.775 133.902 1.00 31.85 ? 77  GLU A CD  1 
ATOM   118  O  OE1 . GLU A 1 77  ? 12.876  -58.144 134.770 1.00 33.76 ? 77  GLU A OE1 1 
ATOM   119  O  OE2 . GLU A 1 77  ? 12.444  -57.855 132.696 1.00 33.27 ? 77  GLU A OE2 1 
ATOM   120  N  N   . LEU A 1 78  ? 6.458   -58.657 133.155 1.00 22.14 ? 78  LEU A N   1 
ATOM   121  C  CA  . LEU A 1 78  ? 5.194   -58.840 133.928 1.00 20.59 ? 78  LEU A CA  1 
ATOM   122  C  C   . LEU A 1 78  ? 5.034   -60.300 134.370 1.00 19.81 ? 78  LEU A C   1 
ATOM   123  O  O   . LEU A 1 78  ? 5.669   -61.178 133.851 1.00 18.81 ? 78  LEU A O   1 
ATOM   124  C  CB  . LEU A 1 78  ? 4.043   -58.287 133.138 1.00 19.71 ? 78  LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 78  ? 4.239   -57.243 132.074 1.00 18.98 ? 78  LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 78  ? 4.445   -57.898 130.726 1.00 18.34 ? 78  LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 78  ? 2.982   -56.375 132.034 1.00 18.92 ? 78  LEU A CD2 1 
ATOM   128  N  N   . ALA A 1 79  ? 4.144   -60.290 135.390 1.00 19.16 ? 79  ALA A N   1 
ATOM   129  C  CA  . ALA A 1 79  ? 3.693   -61.513 136.045 1.00 18.56 ? 79  ALA A CA  1 
ATOM   130  C  C   . ALA A 1 79  ? 2.231   -61.388 136.464 1.00 18.48 ? 79  ALA A C   1 
ATOM   131  O  O   . ALA A 1 79  ? 1.738   -60.278 136.841 1.00 18.61 ? 79  ALA A O   1 
ATOM   132  C  CB  . ALA A 1 79  ? 4.666   -61.761 137.166 1.00 18.64 ? 79  ALA A CB  1 
ATOM   133  N  N   . VAL A 1 80  ? 1.480   -62.451 136.416 1.00 18.67 ? 80  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 80  ? 0.139   -62.688 136.754 1.00 20.06 ? 80  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 80  ? -0.182  -63.317 138.145 1.00 21.81 ? 80  VAL A C   1 
ATOM   136  O  O   . VAL A 1 80  ? 0.535   -64.264 138.499 1.00 21.77 ? 80  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 80  ? -0.507  -63.851 135.885 1.00 19.62 ? 80  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 80  ? -1.483  -63.465 134.853 1.00 18.38 ? 80  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 80  ? 0.602   -64.752 135.302 1.00 19.38 ? 80  VAL A CG2 1 
ATOM   140  N  N   . THR A 1 81  ? -1.275  -62.937 138.764 1.00 23.90 ? 81  THR A N   1 
ATOM   141  C  CA  . THR A 1 81  ? -1.775  -63.529 140.002 1.00 25.95 ? 81  THR A CA  1 
ATOM   142  C  C   . THR A 1 81  ? -3.196  -64.083 139.799 1.00 28.15 ? 81  THR A C   1 
ATOM   143  O  O   . THR A 1 81  ? -3.577  -64.216 138.620 1.00 29.16 ? 81  THR A O   1 
ATOM   144  C  CB  . THR A 1 81  ? -1.773  -62.532 141.195 1.00 25.83 ? 81  THR A CB  1 
ATOM   145  O  OG1 . THR A 1 81  ? -2.670  -61.499 140.680 1.00 26.18 ? 81  THR A OG1 1 
ATOM   146  C  CG2 . THR A 1 81  ? -0.389  -62.059 141.573 1.00 26.12 ? 81  THR A CG2 1 
ATOM   147  N  N   . VAL A 1 82  ? -3.971  -64.395 140.798 1.00 30.20 ? 82  VAL A N   1 
ATOM   148  C  CA  . VAL A 1 82  ? -5.289  -64.943 140.867 1.00 31.84 ? 82  VAL A CA  1 
ATOM   149  C  C   . VAL A 1 82  ? -6.382  -63.880 140.593 1.00 32.93 ? 82  VAL A C   1 
ATOM   150  O  O   . VAL A 1 82  ? -7.494  -64.129 140.104 1.00 33.12 ? 82  VAL A O   1 
ATOM   151  C  CB  . VAL A 1 82  ? -5.690  -65.597 142.251 1.00 32.24 ? 82  VAL A CB  1 
ATOM   152  C  CG1 . VAL A 1 82  ? -4.972  -66.862 142.701 1.00 32.42 ? 82  VAL A CG1 1 
ATOM   153  C  CG2 . VAL A 1 82  ? -5.617  -64.651 143.459 1.00 31.92 ? 82  VAL A CG2 1 
ATOM   154  N  N   . THR A 1 83  ? -6.011  -62.701 141.019 1.00 34.01 ? 83  THR A N   1 
ATOM   155  C  CA  . THR A 1 83  ? -6.729  -61.465 141.015 1.00 35.24 ? 83  THR A CA  1 
ATOM   156  C  C   . THR A 1 83  ? -6.192  -60.532 139.946 1.00 35.83 ? 83  THR A C   1 
ATOM   157  O  O   . THR A 1 83  ? -5.195  -60.945 139.331 1.00 37.37 ? 83  THR A O   1 
ATOM   158  C  CB  . THR A 1 83  ? -6.571  -60.660 142.369 1.00 35.41 ? 83  THR A CB  1 
ATOM   159  O  OG1 . THR A 1 83  ? -5.122  -60.854 142.656 1.00 35.96 ? 83  THR A OG1 1 
ATOM   160  C  CG2 . THR A 1 83  ? -7.518  -61.076 143.464 1.00 35.74 ? 83  THR A CG2 1 
ATOM   161  N  N   . ILE A 1 84  ? -6.778  -59.372 139.847 1.00 34.98 ? 84  ILE A N   1 
ATOM   162  C  CA  . ILE A 1 84  ? -6.444  -58.368 138.881 1.00 33.33 ? 84  ILE A CA  1 
ATOM   163  C  C   . ILE A 1 84  ? -5.614  -57.278 139.445 1.00 32.36 ? 84  ILE A C   1 
ATOM   164  O  O   . ILE A 1 84  ? -6.016  -56.692 140.448 1.00 32.53 ? 84  ILE A O   1 
ATOM   165  C  CB  . ILE A 1 84  ? -7.782  -57.707 138.332 1.00 33.72 ? 84  ILE A CB  1 
ATOM   166  C  CG1 . ILE A 1 84  ? -8.589  -58.928 137.795 1.00 35.18 ? 84  ILE A CG1 1 
ATOM   167  C  CG2 . ILE A 1 84  ? -7.608  -56.581 137.322 1.00 32.46 ? 84  ILE A CG2 1 
ATOM   168  C  CD1 . ILE A 1 84  ? -9.963  -59.156 138.523 1.00 36.65 ? 84  ILE A CD1 1 
ATOM   169  N  N   . VAL A 1 85  ? -4.572  -57.035 138.712 1.00 31.62 ? 85  VAL A N   1 
ATOM   170  C  CA  . VAL A 1 85  ? -3.634  -55.957 139.044 1.00 29.97 ? 85  VAL A CA  1 
ATOM   171  C  C   . VAL A 1 85  ? -3.555  -54.964 137.906 1.00 29.00 ? 85  VAL A C   1 
ATOM   172  O  O   . VAL A 1 85  ? -3.304  -55.441 136.754 1.00 29.25 ? 85  VAL A O   1 
ATOM   173  C  CB  . VAL A 1 85  ? -2.281  -56.624 139.324 1.00 29.67 ? 85  VAL A CB  1 
ATOM   174  C  CG1 . VAL A 1 85  ? -1.446  -55.655 140.095 1.00 30.08 ? 85  VAL A CG1 1 
ATOM   175  C  CG2 . VAL A 1 85  ? -2.489  -57.959 139.973 1.00 29.69 ? 85  VAL A CG2 1 
ATOM   176  N  N   . VAL A 1 86  ? -3.697  -53.704 138.210 1.00 27.58 ? 86  VAL A N   1 
ATOM   177  C  CA  . VAL A 1 86  ? -3.596  -52.676 137.164 1.00 26.82 ? 86  VAL A CA  1 
ATOM   178  C  C   . VAL A 1 86  ? -2.402  -51.761 137.349 1.00 26.86 ? 86  VAL A C   1 
ATOM   179  O  O   . VAL A 1 86  ? -2.302  -51.105 138.394 1.00 26.98 ? 86  VAL A O   1 
ATOM   180  C  CB  . VAL A 1 86  ? -4.917  -51.915 137.179 1.00 26.62 ? 86  VAL A CB  1 
ATOM   181  C  CG1 . VAL A 1 86  ? -4.896  -50.589 136.431 1.00 26.73 ? 86  VAL A CG1 1 
ATOM   182  C  CG2 . VAL A 1 86  ? -6.049  -52.765 136.632 1.00 26.88 ? 86  VAL A CG2 1 
ATOM   183  N  N   . THR A 1 87  ? -1.544  -51.644 136.372 1.00 27.33 ? 87  THR A N   1 
ATOM   184  C  CA  . THR A 1 87  ? -0.396  -50.740 136.444 1.00 28.28 ? 87  THR A CA  1 
ATOM   185  C  C   . THR A 1 87  ? -0.509  -49.641 135.403 1.00 28.35 ? 87  THR A C   1 
ATOM   186  O  O   . THR A 1 87  ? -1.447  -49.643 134.564 1.00 28.89 ? 87  THR A O   1 
ATOM   187  C  CB  . THR A 1 87  ? 0.936   -51.515 136.252 1.00 29.20 ? 87  THR A CB  1 
ATOM   188  O  OG1 . THR A 1 87  ? 0.553   -52.886 136.627 1.00 30.79 ? 87  THR A OG1 1 
ATOM   189  C  CG2 . THR A 1 87  ? 2.091   -50.996 137.073 1.00 29.55 ? 87  THR A CG2 1 
ATOM   190  N  N   . SER A 1 88  ? 0.452   -48.752 135.473 1.00 28.05 ? 88  SER A N   1 
ATOM   191  C  CA  . SER A 1 88  ? 0.534   -47.642 134.527 1.00 27.99 ? 88  SER A CA  1 
ATOM   192  C  C   . SER A 1 88  ? 2.014   -47.241 134.404 1.00 27.39 ? 88  SER A C   1 
ATOM   193  O  O   . SER A 1 88  ? 2.830   -47.257 135.320 1.00 26.79 ? 88  SER A O   1 
ATOM   194  C  CB  . SER A 1 88  ? -0.324  -46.455 134.901 1.00 28.80 ? 88  SER A CB  1 
ATOM   195  O  OG  . SER A 1 88  ? 0.328   -45.798 135.998 1.00 30.26 ? 88  SER A OG  1 
ATOM   196  N  N   . GLU A 1 89  ? 2.301   -46.892 133.172 1.00 27.42 ? 89  GLU A N   1 
ATOM   197  C  CA  . GLU A 1 89  ? 3.622   -46.423 132.773 1.00 27.28 ? 89  GLU A CA  1 
ATOM   198  C  C   . GLU A 1 89  ? 3.389   -45.083 132.072 1.00 25.53 ? 89  GLU A C   1 
ATOM   199  O  O   . GLU A 1 89  ? 2.442   -44.981 131.255 1.00 25.18 ? 89  GLU A O   1 
ATOM   200  C  CB  . GLU A 1 89  ? 4.374   -47.364 131.881 1.00 29.32 ? 89  GLU A CB  1 
ATOM   201  C  CG  . GLU A 1 89  ? 5.157   -48.482 132.563 1.00 32.63 ? 89  GLU A CG  1 
ATOM   202  C  CD  . GLU A 1 89  ? 5.994   -48.092 133.756 1.00 34.70 ? 89  GLU A CD  1 
ATOM   203  O  OE1 . GLU A 1 89  ? 6.414   -48.899 134.602 1.00 35.37 ? 89  GLU A OE1 1 
ATOM   204  O  OE2 . GLU A 1 89  ? 6.252   -46.838 133.815 1.00 35.62 ? 89  GLU A OE2 1 
ATOM   205  N  N   . LEU A 1 90  ? 4.218   -44.145 132.456 1.00 23.26 ? 90  LEU A N   1 
ATOM   206  C  CA  . LEU A 1 90  ? 4.168   -42.807 131.834 1.00 21.12 ? 90  LEU A CA  1 
ATOM   207  C  C   . LEU A 1 90  ? 4.847   -43.052 130.476 1.00 19.70 ? 90  LEU A C   1 
ATOM   208  O  O   . LEU A 1 90  ? 5.749   -43.935 130.515 1.00 19.94 ? 90  LEU A O   1 
ATOM   209  C  CB  . LEU A 1 90  ? 4.906   -41.781 132.583 1.00 20.43 ? 90  LEU A CB  1 
ATOM   210  C  CG  . LEU A 1 90  ? 4.537   -41.400 133.970 1.00 20.01 ? 90  LEU A CG  1 
ATOM   211  C  CD1 . LEU A 1 90  ? 5.668   -40.552 134.588 1.00 20.65 ? 90  LEU A CD1 1 
ATOM   212  C  CD2 . LEU A 1 90  ? 3.287   -40.556 133.964 1.00 19.54 ? 90  LEU A CD2 1 
ATOM   213  N  N   . VAL A 1 91  ? 4.448   -42.335 129.469 1.00 18.03 ? 91  VAL A N   1 
ATOM   214  C  CA  . VAL A 1 91  ? 5.221   -42.686 128.189 1.00 16.38 ? 91  VAL A CA  1 
ATOM   215  C  C   . VAL A 1 91  ? 6.020   -41.448 127.878 1.00 15.33 ? 91  VAL A C   1 
ATOM   216  O  O   . VAL A 1 91  ? 5.670   -40.591 127.108 1.00 15.01 ? 91  VAL A O   1 
ATOM   217  C  CB  . VAL A 1 91  ? 4.284   -43.334 127.167 1.00 15.46 ? 91  VAL A CB  1 
ATOM   218  C  CG1 . VAL A 1 91  ? 2.847   -43.042 127.448 1.00 14.65 ? 91  VAL A CG1 1 
ATOM   219  C  CG2 . VAL A 1 91  ? 4.684   -42.974 125.745 1.00 14.96 ? 91  VAL A CG2 1 
ATOM   220  N  N   . MET A 1 92  ? 7.132   -41.418 128.614 1.00 14.90 ? 92  MET A N   1 
ATOM   221  C  CA  . MET A 1 92  ? 8.089   -40.286 128.452 1.00 14.54 ? 92  MET A CA  1 
ATOM   222  C  C   . MET A 1 92  ? 9.435   -41.010 128.285 1.00 14.48 ? 92  MET A C   1 
ATOM   223  O  O   . MET A 1 92  ? 9.598   -42.177 128.699 1.00 14.19 ? 92  MET A O   1 
ATOM   224  C  CB  . MET A 1 92  ? 8.017   -39.306 129.550 1.00 15.27 ? 92  MET A CB  1 
ATOM   225  C  CG  . MET A 1 92  ? 9.121   -39.289 130.561 1.00 16.54 ? 92  MET A CG  1 
ATOM   226  S  SD  . MET A 1 92  ? 8.354   -38.629 132.135 1.00 17.49 ? 92  MET A SD  1 
ATOM   227  C  CE  . MET A 1 92  ? 6.694   -39.152 131.910 1.00 17.14 ? 92  MET A CE  1 
ATOM   228  N  N   . PRO A 1 93  ? 10.326  -40.277 127.660 1.00 14.60 ? 93  PRO A N   1 
ATOM   229  C  CA  . PRO A 1 93  ? 11.672  -40.811 127.393 1.00 14.91 ? 93  PRO A CA  1 
ATOM   230  C  C   . PRO A 1 93  ? 12.251  -41.347 128.682 1.00 15.78 ? 93  PRO A C   1 
ATOM   231  O  O   . PRO A 1 93  ? 12.709  -42.519 128.634 1.00 16.69 ? 93  PRO A O   1 
ATOM   232  C  CB  . PRO A 1 93  ? 12.468  -39.699 126.784 1.00 13.82 ? 93  PRO A CB  1 
ATOM   233  C  CG  . PRO A 1 93  ? 11.507  -38.575 126.540 1.00 13.67 ? 93  PRO A CG  1 
ATOM   234  C  CD  . PRO A 1 93  ? 10.172  -38.913 127.137 1.00 13.94 ? 93  PRO A CD  1 
ATOM   235  N  N   . PHE A 1 94  ? 12.191  -40.537 129.738 1.00 15.96 ? 94  PHE A N   1 
ATOM   236  C  CA  . PHE A 1 94  ? 12.832  -41.085 131.010 1.00 16.76 ? 94  PHE A CA  1 
ATOM   237  C  C   . PHE A 1 94  ? 12.314  -42.490 131.310 1.00 16.60 ? 94  PHE A C   1 
ATOM   238  O  O   . PHE A 1 94  ? 13.123  -43.402 131.090 1.00 17.61 ? 94  PHE A O   1 
ATOM   239  C  CB  . PHE A 1 94  ? 12.696  -40.154 132.179 1.00 17.62 ? 94  PHE A CB  1 
ATOM   240  C  CG  . PHE A 1 94  ? 13.377  -40.524 133.439 1.00 18.35 ? 94  PHE A CG  1 
ATOM   241  C  CD1 . PHE A 1 94  ? 14.686  -40.082 133.681 1.00 19.30 ? 94  PHE A CD1 1 
ATOM   242  C  CD2 . PHE A 1 94  ? 12.748  -41.295 134.406 1.00 18.56 ? 94  PHE A CD2 1 
ATOM   243  C  CE1 . PHE A 1 94  ? 15.385  -40.398 134.848 1.00 18.21 ? 94  PHE A CE1 1 
ATOM   244  C  CE2 . PHE A 1 94  ? 13.394  -41.629 135.589 1.00 17.94 ? 94  PHE A CE2 1 
ATOM   245  C  CZ  . PHE A 1 94  ? 14.705  -41.172 135.766 1.00 18.16 ? 94  PHE A CZ  1 
ATOM   246  N  N   . THR A 1 95  ? 11.139  -42.715 131.786 1.00 15.77 ? 95  THR A N   1 
ATOM   247  C  CA  . THR A 1 95  ? 10.538  -43.931 132.070 1.00 15.63 ? 95  THR A CA  1 
ATOM   248  C  C   . THR A 1 95  ? 10.303  -44.888 130.920 1.00 15.57 ? 95  THR A C   1 
ATOM   249  O  O   . THR A 1 95  ? 9.524   -45.852 131.276 1.00 15.08 ? 95  THR A O   1 
ATOM   250  C  CB  . THR A 1 95  ? 8.992   -43.727 132.501 1.00 15.92 ? 95  THR A CB  1 
ATOM   251  O  OG1 . THR A 1 95  ? 8.626   -42.480 131.897 1.00 16.28 ? 95  THR A OG1 1 
ATOM   252  C  CG2 . THR A 1 95  ? 8.779   -43.776 133.968 1.00 17.14 ? 95  THR A CG2 1 
ATOM   253  N  N   . VAL A 1 96  ? 10.779  -44.649 129.714 1.00 15.37 ? 96  VAL A N   1 
ATOM   254  C  CA  . VAL A 1 96  ? 10.300  -45.721 128.762 1.00 16.04 ? 96  VAL A CA  1 
ATOM   255  C  C   . VAL A 1 96  ? 11.237  -46.899 128.824 1.00 16.40 ? 96  VAL A C   1 
ATOM   256  O  O   . VAL A 1 96  ? 10.756  -48.026 128.710 1.00 16.15 ? 96  VAL A O   1 
ATOM   257  C  CB  . VAL A 1 96  ? 10.056  -45.202 127.373 1.00 16.48 ? 96  VAL A CB  1 
ATOM   258  C  CG1 . VAL A 1 96  ? 9.979   -46.383 126.421 1.00 16.64 ? 96  VAL A CG1 1 
ATOM   259  C  CG2 . VAL A 1 96  ? 8.796   -44.355 127.208 1.00 17.00 ? 96  VAL A CG2 1 
ATOM   260  N  N   . GLY A 1 97  ? 12.481  -46.606 128.958 1.00 17.63 ? 97  GLY A N   1 
ATOM   261  C  CA  . GLY A 1 97  ? 13.536  -47.665 129.003 1.00 18.98 ? 97  GLY A CA  1 
ATOM   262  C  C   . GLY A 1 97  ? 14.772  -47.013 129.586 1.00 20.04 ? 97  GLY A C   1 
ATOM   263  O  O   . GLY A 1 97  ? 14.804  -45.765 129.689 1.00 21.24 ? 97  GLY A O   1 
ATOM   264  N  N   . THR A 1 98  ? 15.760  -47.773 129.998 1.00 20.76 ? 98  THR A N   1 
ATOM   265  C  CA  . THR A 1 98  ? 16.954  -47.128 130.588 1.00 20.96 ? 98  THR A CA  1 
ATOM   266  C  C   . THR A 1 98  ? 17.902  -46.690 129.491 1.00 20.57 ? 98  THR A C   1 
ATOM   267  O  O   . THR A 1 98  ? 18.871  -45.960 129.849 1.00 22.00 ? 98  THR A O   1 
ATOM   268  C  CB  . THR A 1 98  ? 17.705  -48.024 131.633 1.00 21.16 ? 98  THR A CB  1 
ATOM   269  O  OG1 . THR A 1 98  ? 18.350  -49.164 130.941 1.00 21.29 ? 98  THR A OG1 1 
ATOM   270  C  CG2 . THR A 1 98  ? 16.744  -48.484 132.729 1.00 21.47 ? 98  THR A CG2 1 
ATOM   271  N  N   . TRP A 1 99  ? 17.663  -47.140 128.296 1.00 19.71 ? 99  TRP A N   1 
ATOM   272  C  CA  . TRP A 1 99  ? 18.625  -46.748 127.249 1.00 20.08 ? 99  TRP A CA  1 
ATOM   273  C  C   . TRP A 1 99  ? 18.270  -45.326 126.768 1.00 20.51 ? 99  TRP A C   1 
ATOM   274  O  O   . TRP A 1 99  ? 19.107  -44.409 126.892 1.00 20.65 ? 99  TRP A O   1 
ATOM   275  C  CB  . TRP A 1 99  ? 18.643  -47.745 126.120 1.00 19.66 ? 99  TRP A CB  1 
ATOM   276  C  CG  . TRP A 1 99  ? 19.628  -47.482 125.067 1.00 19.38 ? 99  TRP A CG  1 
ATOM   277  C  CD1 . TRP A 1 99  ? 20.903  -47.968 125.009 1.00 19.93 ? 99  TRP A CD1 1 
ATOM   278  C  CD2 . TRP A 1 99  ? 19.489  -46.674 123.913 1.00 19.98 ? 99  TRP A CD2 1 
ATOM   279  N  NE1 . TRP A 1 99  ? 21.580  -47.543 123.892 1.00 19.89 ? 99  TRP A NE1 1 
ATOM   280  C  CE2 . TRP A 1 99  ? 20.727  -46.739 123.195 1.00 20.22 ? 99  TRP A CE2 1 
ATOM   281  C  CE3 . TRP A 1 99  ? 18.448  -45.903 123.408 1.00 20.15 ? 99  TRP A CE3 1 
ATOM   282  C  CZ2 . TRP A 1 99  ? 20.949  -46.035 122.015 1.00 19.99 ? 99  TRP A CZ2 1 
ATOM   283  C  CZ3 . TRP A 1 99  ? 18.670  -45.242 122.201 1.00 20.32 ? 99  TRP A CZ3 1 
ATOM   284  C  CH2 . TRP A 1 99  ? 19.897  -45.302 121.545 1.00 20.10 ? 99  TRP A CH2 1 
ATOM   285  N  N   . LEU A 1 100 ? 17.051  -45.277 126.245 1.00 19.85 ? 100 LEU A N   1 
ATOM   286  C  CA  . LEU A 1 100 ? 16.547  -44.017 125.694 1.00 20.06 ? 100 LEU A CA  1 
ATOM   287  C  C   . LEU A 1 100 ? 16.818  -42.960 126.763 1.00 20.55 ? 100 LEU A C   1 
ATOM   288  O  O   . LEU A 1 100 ? 17.395  -41.889 126.490 1.00 22.36 ? 100 LEU A O   1 
ATOM   289  C  CB  . LEU A 1 100 ? 15.120  -44.158 125.229 1.00 19.14 ? 100 LEU A CB  1 
ATOM   290  C  CG  . LEU A 1 100 ? 14.512  -43.130 124.318 1.00 17.79 ? 100 LEU A CG  1 
ATOM   291  C  CD1 . LEU A 1 100 ? 13.169  -42.682 124.900 1.00 18.32 ? 100 LEU A CD1 1 
ATOM   292  C  CD2 . LEU A 1 100 ? 15.387  -41.896 124.229 1.00 17.43 ? 100 LEU A CD2 1 
ATOM   293  N  N   . ARG A 1 101 ? 16.439  -43.301 127.910 1.00 21.15 ? 101 ARG A N   1 
ATOM   294  C  CA  . ARG A 1 101 ? 16.615  -42.514 129.099 1.00 22.80 ? 101 ARG A CA  1 
ATOM   295  C  C   . ARG A 1 101 ? 17.972  -41.857 129.258 1.00 22.73 ? 101 ARG A C   1 
ATOM   296  O  O   . ARG A 1 101 ? 18.162  -40.702 129.695 1.00 22.90 ? 101 ARG A O   1 
ATOM   297  C  CB  . ARG A 1 101 ? 16.419  -43.520 130.279 1.00 23.61 ? 101 ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 101 ? 17.376  -43.138 131.417 1.00 25.47 ? 101 ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 101 ? 16.547  -42.408 132.462 1.00 26.51 ? 101 ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 101 ? 16.282  -43.366 133.513 1.00 28.34 ? 101 ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 101 ? 15.297  -44.211 133.748 1.00 29.08 ? 101 ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 101 ? 14.108  -44.222 133.132 1.00 29.46 ? 101 ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 101 ? 15.502  -45.199 134.667 1.00 29.23 ? 101 ARG A NH2 1 
ATOM   304  N  N   . GLY A 1 102 ? 19.008  -42.608 128.983 1.00 22.66 ? 102 GLY A N   1 
ATOM   305  C  CA  . GLY A 1 102 ? 20.384  -42.174 129.091 1.00 22.97 ? 102 GLY A CA  1 
ATOM   306  C  C   . GLY A 1 102 ? 20.790  -41.355 127.864 1.00 23.18 ? 102 GLY A C   1 
ATOM   307  O  O   . GLY A 1 102 ? 21.762  -40.560 128.018 1.00 24.46 ? 102 GLY A O   1 
ATOM   308  N  N   . VAL A 1 103 ? 20.096  -41.577 126.758 1.00 21.92 ? 103 VAL A N   1 
ATOM   309  C  CA  . VAL A 1 103 ? 20.385  -40.871 125.534 1.00 21.01 ? 103 VAL A CA  1 
ATOM   310  C  C   . VAL A 1 103 ? 19.625  -39.545 125.511 1.00 20.55 ? 103 VAL A C   1 
ATOM   311  O  O   . VAL A 1 103 ? 20.283  -38.514 125.185 1.00 20.64 ? 103 VAL A O   1 
ATOM   312  C  CB  . VAL A 1 103 ? 20.069  -41.729 124.297 1.00 21.27 ? 103 VAL A CB  1 
ATOM   313  C  CG1 . VAL A 1 103 ? 20.227  -40.990 122.976 1.00 20.80 ? 103 VAL A CG1 1 
ATOM   314  C  CG2 . VAL A 1 103 ? 20.935  -42.969 124.318 1.00 21.23 ? 103 VAL A CG2 1 
ATOM   315  N  N   . ALA A 1 104 ? 18.352  -39.635 125.805 1.00 19.53 ? 104 ALA A N   1 
ATOM   316  C  CA  . ALA A 1 104 ? 17.506  -38.442 125.770 1.00 19.85 ? 104 ALA A CA  1 
ATOM   317  C  C   . ALA A 1 104 ? 17.873  -37.349 126.762 1.00 20.85 ? 104 ALA A C   1 
ATOM   318  O  O   . ALA A 1 104 ? 17.582  -36.166 126.504 1.00 20.79 ? 104 ALA A O   1 
ATOM   319  C  CB  . ALA A 1 104 ? 16.049  -38.783 126.046 1.00 18.78 ? 104 ALA A CB  1 
ATOM   320  N  N   . GLN A 1 105 ? 18.490  -37.757 127.855 1.00 22.40 ? 105 GLN A N   1 
ATOM   321  C  CA  . GLN A 1 105 ? 18.771  -36.721 128.891 1.00 23.28 ? 105 GLN A CA  1 
ATOM   322  C  C   . GLN A 1 105 ? 19.606  -35.606 128.313 1.00 22.62 ? 105 GLN A C   1 
ATOM   323  O  O   . GLN A 1 105 ? 19.483  -34.528 128.932 1.00 22.37 ? 105 GLN A O   1 
ATOM   324  C  CB  . GLN A 1 105 ? 19.358  -37.284 130.151 1.00 25.43 ? 105 GLN A CB  1 
ATOM   325  C  CG  . GLN A 1 105 ? 20.431  -38.354 130.010 1.00 27.51 ? 105 GLN A CG  1 
ATOM   326  C  CD  . GLN A 1 105 ? 20.842  -38.782 131.446 1.00 28.80 ? 105 GLN A CD  1 
ATOM   327  O  OE1 . GLN A 1 105 ? 20.132  -38.356 132.402 1.00 29.57 ? 105 GLN A OE1 1 
ATOM   328  N  NE2 . GLN A 1 105 ? 21.923  -39.565 131.514 1.00 29.08 ? 105 GLN A NE2 1 
ATOM   329  N  N   . ASN A 1 106 ? 20.308  -35.921 127.251 1.00 21.91 ? 106 ASN A N   1 
ATOM   330  C  CA  . ASN A 1 106 ? 21.190  -34.884 126.668 1.00 21.37 ? 106 ASN A CA  1 
ATOM   331  C  C   . ASN A 1 106 ? 20.505  -33.789 125.900 1.00 21.19 ? 106 ASN A C   1 
ATOM   332  O  O   . ASN A 1 106 ? 21.267  -32.918 125.399 1.00 21.76 ? 106 ASN A O   1 
ATOM   333  C  CB  . ASN A 1 106 ? 22.195  -35.639 125.811 1.00 21.89 ? 106 ASN A CB  1 
ATOM   334  C  CG  . ASN A 1 106 ? 23.015  -36.473 126.821 1.00 22.68 ? 106 ASN A CG  1 
ATOM   335  O  OD1 . ASN A 1 106 ? 22.752  -37.677 127.018 1.00 22.65 ? 106 ASN A OD1 1 
ATOM   336  N  ND2 . ASN A 1 106 ? 23.955  -35.718 127.409 1.00 22.94 ? 106 ASN A ND2 1 
ATOM   337  N  N   . TRP A 1 107 ? 19.202  -33.807 125.842 1.00 20.07 ? 107 TRP A N   1 
ATOM   338  C  CA  . TRP A 1 107 ? 18.440  -32.832 125.088 1.00 19.01 ? 107 TRP A CA  1 
ATOM   339  C  C   . TRP A 1 107 ? 17.292  -32.294 125.905 1.00 18.91 ? 107 TRP A C   1 
ATOM   340  O  O   . TRP A 1 107 ? 16.703  -33.093 126.619 1.00 19.46 ? 107 TRP A O   1 
ATOM   341  C  CB  . TRP A 1 107 ? 17.891  -33.507 123.850 1.00 18.58 ? 107 TRP A CB  1 
ATOM   342  C  CG  . TRP A 1 107 ? 18.714  -33.716 122.664 1.00 17.67 ? 107 TRP A CG  1 
ATOM   343  C  CD1 . TRP A 1 107 ? 18.852  -32.869 121.612 1.00 17.58 ? 107 TRP A CD1 1 
ATOM   344  C  CD2 . TRP A 1 107 ? 19.519  -34.863 122.358 1.00 17.79 ? 107 TRP A CD2 1 
ATOM   345  N  NE1 . TRP A 1 107 ? 19.685  -33.398 120.649 1.00 17.60 ? 107 TRP A NE1 1 
ATOM   346  C  CE2 . TRP A 1 107 ? 20.110  -34.627 121.091 1.00 17.99 ? 107 TRP A CE2 1 
ATOM   347  C  CE3 . TRP A 1 107 ? 19.788  -36.056 123.026 1.00 17.63 ? 107 TRP A CE3 1 
ATOM   348  C  CZ2 . TRP A 1 107 ? 20.971  -35.552 120.493 1.00 17.57 ? 107 TRP A CZ2 1 
ATOM   349  C  CZ3 . TRP A 1 107 ? 20.618  -36.984 122.413 1.00 17.29 ? 107 TRP A CZ3 1 
ATOM   350  C  CH2 . TRP A 1 107 ? 21.205  -36.725 121.169 1.00 16.93 ? 107 TRP A CH2 1 
ATOM   351  N  N   . SER A 1 108 ? 16.974  -31.058 125.726 1.00 19.22 ? 108 SER A N   1 
ATOM   352  C  CA  . SER A 1 108 ? 15.957  -30.338 126.446 1.00 19.60 ? 108 SER A CA  1 
ATOM   353  C  C   . SER A 1 108 ? 14.507  -30.678 126.202 1.00 19.54 ? 108 SER A C   1 
ATOM   354  O  O   . SER A 1 108 ? 13.774  -30.578 127.227 1.00 19.88 ? 108 SER A O   1 
ATOM   355  C  CB  . SER A 1 108 ? 16.131  -28.800 126.151 1.00 19.42 ? 108 SER A CB  1 
ATOM   356  O  OG  . SER A 1 108 ? 16.811  -28.129 127.219 1.00 18.46 ? 108 SER A OG  1 
ATOM   357  N  N   . LYS A 1 109 ? 14.137  -30.962 124.990 1.00 19.26 ? 109 LYS A N   1 
ATOM   358  C  CA  . LYS A 1 109 ? 12.623  -31.252 124.767 1.00 17.99 ? 109 LYS A CA  1 
ATOM   359  C  C   . LYS A 1 109 ? 12.647  -32.140 123.526 1.00 16.91 ? 109 LYS A C   1 
ATOM   360  O  O   . LYS A 1 109 ? 13.697  -32.302 122.864 1.00 17.22 ? 109 LYS A O   1 
ATOM   361  C  CB  . LYS A 1 109 ? 11.870  -30.061 124.754 1.00 18.36 ? 109 LYS A CB  1 
ATOM   362  C  CG  . LYS A 1 109 ? 11.246  -28.802 124.541 1.00 18.69 ? 109 LYS A CG  1 
ATOM   363  C  CD  . LYS A 1 109 ? 12.081  -27.579 124.318 1.00 19.31 ? 109 LYS A CD  1 
ATOM   364  C  CE  . LYS A 1 109 ? 11.592  -26.508 123.418 1.00 19.06 ? 109 LYS A CE  1 
ATOM   365  N  NZ  . LYS A 1 109 ? 10.146  -26.405 123.365 1.00 19.53 ? 109 LYS A NZ  1 
ATOM   366  N  N   . TYR A 1 110 ? 11.555  -32.745 123.210 1.00 16.01 ? 110 TYR A N   1 
ATOM   367  C  CA  . TYR A 1 110 ? 11.431  -33.712 122.131 1.00 15.14 ? 110 TYR A CA  1 
ATOM   368  C  C   . TYR A 1 110 ? 10.005  -33.935 121.794 1.00 14.53 ? 110 TYR A C   1 
ATOM   369  O  O   . TYR A 1 110 ? 9.198   -33.264 122.487 1.00 14.15 ? 110 TYR A O   1 
ATOM   370  C  CB  . TYR A 1 110 ? 12.065  -35.058 122.704 1.00 15.03 ? 110 TYR A CB  1 
ATOM   371  C  CG  . TYR A 1 110 ? 10.995  -35.591 123.690 1.00 14.85 ? 110 TYR A CG  1 
ATOM   372  C  CD1 . TYR A 1 110 ? 10.073  -36.600 123.321 1.00 14.92 ? 110 TYR A CD1 1 
ATOM   373  C  CD2 . TYR A 1 110 ? 10.859  -35.012 124.919 1.00 14.17 ? 110 TYR A CD2 1 
ATOM   374  C  CE1 . TYR A 1 110 ? 9.096   -37.009 124.199 1.00 14.67 ? 110 TYR A CE1 1 
ATOM   375  C  CE2 . TYR A 1 110 ? 9.897   -35.400 125.808 1.00 14.37 ? 110 TYR A CE2 1 
ATOM   376  C  CZ  . TYR A 1 110 ? 9.010   -36.406 125.450 1.00 14.80 ? 110 TYR A CZ  1 
ATOM   377  O  OH  . TYR A 1 110 ? 8.072   -36.739 126.410 1.00 15.33 ? 110 TYR A OH  1 
ATOM   378  N  N   . ALA A 1 111 ? 9.709   -34.831 120.901 1.00 14.44 ? 111 ALA A N   1 
ATOM   379  C  CA  . ALA A 1 111 ? 8.310   -35.170 120.517 1.00 14.51 ? 111 ALA A CA  1 
ATOM   380  C  C   . ALA A 1 111 ? 8.463   -36.591 119.894 1.00 15.10 ? 111 ALA A C   1 
ATOM   381  O  O   . ALA A 1 111 ? 9.508   -36.902 119.275 1.00 15.41 ? 111 ALA A O   1 
ATOM   382  C  CB  . ALA A 1 111 ? 7.570   -34.315 119.586 1.00 13.94 ? 111 ALA A CB  1 
ATOM   383  N  N   . TRP A 1 112 ? 7.393   -37.288 120.181 1.00 15.30 ? 112 TRP A N   1 
ATOM   384  C  CA  . TRP A 1 112 ? 7.379   -38.693 119.784 1.00 15.67 ? 112 TRP A CA  1 
ATOM   385  C  C   . TRP A 1 112 ? 7.060   -38.776 118.332 1.00 15.02 ? 112 TRP A C   1 
ATOM   386  O  O   . TRP A 1 112 ? 6.005   -38.222 118.116 1.00 15.52 ? 112 TRP A O   1 
ATOM   387  C  CB  . TRP A 1 112 ? 6.353   -39.434 120.614 1.00 17.30 ? 112 TRP A CB  1 
ATOM   388  C  CG  . TRP A 1 112 ? 6.685   -39.736 122.024 1.00 18.79 ? 112 TRP A CG  1 
ATOM   389  C  CD1 . TRP A 1 112 ? 5.981   -39.326 123.134 1.00 18.69 ? 112 TRP A CD1 1 
ATOM   390  C  CD2 . TRP A 1 112 ? 7.781   -40.533 122.517 1.00 19.15 ? 112 TRP A CD2 1 
ATOM   391  N  NE1 . TRP A 1 112 ? 6.584   -39.806 124.271 1.00 18.95 ? 112 TRP A NE1 1 
ATOM   392  C  CE2 . TRP A 1 112 ? 7.682   -40.544 123.926 1.00 18.98 ? 112 TRP A CE2 1 
ATOM   393  C  CE3 . TRP A 1 112 ? 8.810   -41.208 121.904 1.00 19.37 ? 112 TRP A CE3 1 
ATOM   394  C  CZ2 . TRP A 1 112 ? 8.589   -41.205 124.740 1.00 18.81 ? 112 TRP A CZ2 1 
ATOM   395  C  CZ3 . TRP A 1 112 ? 9.707   -41.863 122.733 1.00 19.85 ? 112 TRP A CZ3 1 
ATOM   396  C  CH2 . TRP A 1 112 ? 9.613   -41.872 124.138 1.00 19.03 ? 112 TRP A CH2 1 
ATOM   397  N  N   . VAL A 1 113 ? 7.817   -39.384 117.489 1.00 14.60 ? 113 VAL A N   1 
ATOM   398  C  CA  . VAL A 1 113 ? 7.392   -39.477 116.096 1.00 13.88 ? 113 VAL A CA  1 
ATOM   399  C  C   . VAL A 1 113 ? 6.599   -40.802 116.096 1.00 13.31 ? 113 VAL A C   1 
ATOM   400  O  O   . VAL A 1 113 ? 5.716   -40.978 115.312 1.00 13.04 ? 113 VAL A O   1 
ATOM   401  C  CB  . VAL A 1 113 ? 8.481   -39.523 115.045 1.00 13.70 ? 113 VAL A CB  1 
ATOM   402  C  CG1 . VAL A 1 113 ? 7.946   -40.049 113.684 1.00 13.59 ? 113 VAL A CG1 1 
ATOM   403  C  CG2 . VAL A 1 113 ? 9.156   -38.217 114.833 1.00 13.11 ? 113 VAL A CG2 1 
ATOM   404  N  N   . ALA A 1 114 ? 7.057   -41.626 116.988 1.00 14.31 ? 114 ALA A N   1 
ATOM   405  C  CA  . ALA A 1 114 ? 6.451   -42.969 117.124 1.00 16.06 ? 114 ALA A CA  1 
ATOM   406  C  C   . ALA A 1 114 ? 7.019   -43.692 118.339 1.00 16.68 ? 114 ALA A C   1 
ATOM   407  O  O   . ALA A 1 114 ? 8.201   -43.517 118.683 1.00 17.60 ? 114 ALA A O   1 
ATOM   408  C  CB  . ALA A 1 114 ? 6.678   -43.799 115.895 1.00 15.81 ? 114 ALA A CB  1 
ATOM   409  N  N   . ILE A 1 115 ? 6.113   -44.473 118.894 1.00 16.89 ? 115 ILE A N   1 
ATOM   410  C  CA  . ILE A 1 115 ? 6.389   -45.250 120.096 1.00 16.38 ? 115 ILE A CA  1 
ATOM   411  C  C   . ILE A 1 115 ? 5.294   -46.304 120.201 1.00 15.57 ? 115 ILE A C   1 
ATOM   412  O  O   . ILE A 1 115 ? 4.142   -45.985 119.914 1.00 14.56 ? 115 ILE A O   1 
ATOM   413  C  CB  . ILE A 1 115 ? 6.364   -44.405 121.388 1.00 17.09 ? 115 ILE A CB  1 
ATOM   414  C  CG1 . ILE A 1 115 ? 6.676   -45.302 122.614 1.00 17.29 ? 115 ILE A CG1 1 
ATOM   415  C  CG2 . ILE A 1 115 ? 4.988   -43.688 121.513 1.00 17.35 ? 115 ILE A CG2 1 
ATOM   416  C  CD1 . ILE A 1 115 ? 7.473   -44.500 123.684 1.00 17.69 ? 115 ILE A CD1 1 
ATOM   417  N  N   . ARG A 1 116 ? 5.795   -47.435 120.666 1.00 15.58 ? 116 ARG A N   1 
ATOM   418  C  CA  . ARG A 1 116 ? 4.830   -48.563 120.762 1.00 15.31 ? 116 ARG A CA  1 
ATOM   419  C  C   . ARG A 1 116 ? 5.361   -49.706 121.563 1.00 15.32 ? 116 ARG A C   1 
ATOM   420  O  O   . ARG A 1 116 ? 6.560   -50.098 121.553 1.00 16.04 ? 116 ARG A O   1 
ATOM   421  C  CB  . ARG A 1 116 ? 4.580   -48.863 119.297 1.00 15.15 ? 116 ARG A CB  1 
ATOM   422  C  CG  . ARG A 1 116 ? 3.826   -50.124 118.992 1.00 15.23 ? 116 ARG A CG  1 
ATOM   423  C  CD  . ARG A 1 116 ? 4.585   -50.810 117.883 1.00 15.41 ? 116 ARG A CD  1 
ATOM   424  N  NE  . ARG A 1 116 ? 3.625   -51.408 116.957 1.00 15.52 ? 116 ARG A NE  1 
ATOM   425  C  CZ  . ARG A 1 116 ? 3.119   -50.722 115.920 1.00 15.36 ? 116 ARG A CZ  1 
ATOM   426  N  NH1 . ARG A 1 116 ? 3.797   -49.651 115.503 1.00 15.65 ? 116 ARG A NH1 1 
ATOM   427  N  NH2 . ARG A 1 116 ? 1.916   -51.126 115.440 1.00 15.10 ? 116 ARG A NH2 1 
ATOM   428  N  N   . TYR A 1 117 ? 4.400   -50.283 122.283 1.00 14.51 ? 117 TYR A N   1 
ATOM   429  C  CA  . TYR A 1 117 ? 4.693   -51.396 123.218 1.00 13.36 ? 117 TYR A CA  1 
ATOM   430  C  C   . TYR A 1 117 ? 4.155   -52.693 122.651 1.00 14.33 ? 117 TYR A C   1 
ATOM   431  O  O   . TYR A 1 117 ? 3.035   -52.738 122.122 1.00 14.80 ? 117 TYR A O   1 
ATOM   432  C  CB  . TYR A 1 117 ? 4.105   -51.014 124.540 1.00 10.81 ? 117 TYR A CB  1 
ATOM   433  C  CG  . TYR A 1 117 ? 4.522   -49.699 125.089 1.00 9.53  ? 117 TYR A CG  1 
ATOM   434  C  CD1 . TYR A 1 117 ? 3.830   -48.521 124.869 1.00 10.17 ? 117 TYR A CD1 1 
ATOM   435  C  CD2 . TYR A 1 117 ? 5.639   -49.589 125.851 1.00 9.66  ? 117 TYR A CD2 1 
ATOM   436  C  CE1 . TYR A 1 117 ? 4.219   -47.283 125.400 1.00 10.51 ? 117 TYR A CE1 1 
ATOM   437  C  CE2 . TYR A 1 117 ? 6.067   -48.408 126.446 1.00 10.34 ? 117 TYR A CE2 1 
ATOM   438  C  CZ  . TYR A 1 117 ? 5.335   -47.238 126.213 1.00 11.05 ? 117 TYR A CZ  1 
ATOM   439  O  OH  . TYR A 1 117 ? 5.806   -46.079 126.817 1.00 11.78 ? 117 TYR A OH  1 
ATOM   440  N  N   . THR A 1 118 ? 5.005   -53.684 122.778 1.00 15.13 ? 118 THR A N   1 
ATOM   441  C  CA  . THR A 1 118 ? 4.730   -55.039 122.331 1.00 16.02 ? 118 THR A CA  1 
ATOM   442  C  C   . THR A 1 118 ? 5.029   -55.970 123.492 1.00 17.39 ? 118 THR A C   1 
ATOM   443  O  O   . THR A 1 118 ? 5.942   -55.535 124.254 1.00 17.57 ? 118 THR A O   1 
ATOM   444  C  CB  . THR A 1 118 ? 5.601   -55.378 121.078 1.00 15.29 ? 118 THR A CB  1 
ATOM   445  O  OG1 . THR A 1 118 ? 5.720   -54.099 120.398 1.00 15.20 ? 118 THR A OG1 1 
ATOM   446  C  CG2 . THR A 1 118 ? 4.951   -56.505 120.329 1.00 15.24 ? 118 THR A CG2 1 
ATOM   447  N  N   . TYR A 1 119 ? 4.352   -57.067 123.606 1.00 18.32 ? 119 TYR A N   1 
ATOM   448  C  CA  . TYR A 1 119 ? 4.572   -57.989 124.725 1.00 19.62 ? 119 TYR A CA  1 
ATOM   449  C  C   . TYR A 1 119 ? 5.042   -59.284 124.108 1.00 19.80 ? 119 TYR A C   1 
ATOM   450  O  O   . TYR A 1 119 ? 4.406   -59.557 123.070 1.00 20.35 ? 119 TYR A O   1 
ATOM   451  C  CB  . TYR A 1 119 ? 3.306   -58.175 125.532 1.00 21.11 ? 119 TYR A CB  1 
ATOM   452  C  CG  . TYR A 1 119 ? 3.206   -59.477 126.307 1.00 22.29 ? 119 TYR A CG  1 
ATOM   453  C  CD1 . TYR A 1 119 ? 2.866   -60.683 125.701 1.00 22.94 ? 119 TYR A CD1 1 
ATOM   454  C  CD2 . TYR A 1 119 ? 3.444   -59.504 127.673 1.00 22.74 ? 119 TYR A CD2 1 
ATOM   455  C  CE1 . TYR A 1 119 ? 2.771   -61.871 126.423 1.00 23.65 ? 119 TYR A CE1 1 
ATOM   456  C  CE2 . TYR A 1 119 ? 3.369   -60.665 128.428 1.00 23.38 ? 119 TYR A CE2 1 
ATOM   457  C  CZ  . TYR A 1 119 ? 3.022   -61.859 127.811 1.00 23.96 ? 119 TYR A CZ  1 
ATOM   458  O  OH  . TYR A 1 119 ? 2.915   -63.001 128.587 1.00 23.87 ? 119 TYR A OH  1 
ATOM   459  N  N   . LEU A 1 120 ? 5.996   -59.908 124.697 1.00 20.24 ? 120 LEU A N   1 
ATOM   460  C  CA  . LEU A 1 120 ? 6.563   -61.183 124.175 1.00 20.98 ? 120 LEU A CA  1 
ATOM   461  C  C   . LEU A 1 120 ? 6.488   -62.245 125.251 1.00 22.10 ? 120 LEU A C   1 
ATOM   462  O  O   . LEU A 1 120 ? 6.961   -62.053 126.390 1.00 23.15 ? 120 LEU A O   1 
ATOM   463  C  CB  . LEU A 1 120 ? 7.952   -60.862 123.644 1.00 20.01 ? 120 LEU A CB  1 
ATOM   464  C  CG  . LEU A 1 120 ? 7.948   -60.078 122.326 1.00 19.70 ? 120 LEU A CG  1 
ATOM   465  C  CD1 . LEU A 1 120 ? 9.259   -60.288 121.590 1.00 19.57 ? 120 LEU A CD1 1 
ATOM   466  C  CD2 . LEU A 1 120 ? 6.763   -60.554 121.487 1.00 18.75 ? 120 LEU A CD2 1 
ATOM   467  N  N   . PRO A 1 121 ? 5.880   -63.345 124.939 1.00 22.78 ? 121 PRO A N   1 
ATOM   468  C  CA  . PRO A 1 121 ? 5.705   -64.428 125.882 1.00 24.02 ? 121 PRO A CA  1 
ATOM   469  C  C   . PRO A 1 121 ? 7.025   -65.026 126.249 1.00 25.31 ? 121 PRO A C   1 
ATOM   470  O  O   . PRO A 1 121 ? 7.914   -64.921 125.397 1.00 25.81 ? 121 PRO A O   1 
ATOM   471  C  CB  . PRO A 1 121 ? 4.825   -65.425 125.129 1.00 24.31 ? 121 PRO A CB  1 
ATOM   472  C  CG  . PRO A 1 121 ? 5.210   -65.198 123.687 1.00 23.62 ? 121 PRO A CG  1 
ATOM   473  C  CD  . PRO A 1 121 ? 5.291   -63.664 123.629 1.00 23.46 ? 121 PRO A CD  1 
ATOM   474  N  N   . SER A 1 122 ? 7.087   -65.616 127.422 1.00 26.99 ? 122 SER A N   1 
ATOM   475  C  CA  . SER A 1 122 ? 8.313   -66.325 127.879 1.00 28.23 ? 122 SER A CA  1 
ATOM   476  C  C   . SER A 1 122 ? 7.828   -67.661 128.507 1.00 29.21 ? 122 SER A C   1 
ATOM   477  O  O   . SER A 1 122 ? 8.699   -68.563 128.731 1.00 30.64 ? 122 SER A O   1 
ATOM   478  C  CB  . SER A 1 122 ? 9.203   -65.479 128.735 1.00 27.65 ? 122 SER A CB  1 
ATOM   479  O  OG  . SER A 1 122 ? 8.462   -64.918 129.808 1.00 28.17 ? 122 SER A OG  1 
ATOM   480  N  N   . CYS A 1 123 ? 6.560   -67.897 128.753 1.00 28.91 ? 123 CYS A N   1 
ATOM   481  C  CA  . CYS A 1 123 ? 6.019   -69.101 129.275 1.00 29.39 ? 123 CYS A CA  1 
ATOM   482  C  C   . CYS A 1 123 ? 5.797   -70.306 128.370 1.00 28.48 ? 123 CYS A C   1 
ATOM   483  O  O   . CYS A 1 123 ? 5.909   -70.181 127.178 1.00 29.33 ? 123 CYS A O   1 
ATOM   484  C  CB  . CYS A 1 123 ? 4.479   -68.941 129.585 1.00 30.20 ? 123 CYS A CB  1 
ATOM   485  S  SG  . CYS A 1 123 ? 4.040   -67.266 129.579 1.00 33.13 ? 123 CYS A SG  1 
ATOM   486  N  N   . PRO A 1 124 ? 5.342   -71.355 129.007 1.00 27.61 ? 124 PRO A N   1 
ATOM   487  C  CA  . PRO A 1 124 ? 4.890   -72.585 128.360 1.00 27.08 ? 124 PRO A CA  1 
ATOM   488  C  C   . PRO A 1 124 ? 3.439   -72.213 127.976 1.00 26.23 ? 124 PRO A C   1 
ATOM   489  O  O   . PRO A 1 124 ? 2.950   -71.159 128.439 1.00 26.10 ? 124 PRO A O   1 
ATOM   490  C  CB  . PRO A 1 124 ? 5.004   -73.670 129.341 1.00 27.33 ? 124 PRO A CB  1 
ATOM   491  C  CG  . PRO A 1 124 ? 4.864   -72.971 130.669 1.00 27.56 ? 124 PRO A CG  1 
ATOM   492  C  CD  . PRO A 1 124 ? 5.140   -71.511 130.459 1.00 27.69 ? 124 PRO A CD  1 
ATOM   493  N  N   . THR A 1 125 ? 2.804   -72.993 127.210 1.00 25.02 ? 125 THR A N   1 
ATOM   494  C  CA  . THR A 1 125 ? 1.496   -72.856 126.612 1.00 24.02 ? 125 THR A CA  1 
ATOM   495  C  C   . THR A 1 125 ? 0.403   -73.170 127.627 1.00 23.69 ? 125 THR A C   1 
ATOM   496  O  O   . THR A 1 125 ? -0.876  -73.190 127.363 1.00 22.81 ? 125 THR A O   1 
ATOM   497  C  CB  . THR A 1 125 ? 0.611   -73.237 125.343 1.00 24.25 ? 125 THR A CB  1 
ATOM   498  O  OG1 . THR A 1 125 ? 0.553   -74.649 125.216 1.00 24.44 ? 125 THR A OG1 1 
ATOM   499  C  CG2 . THR A 1 125 ? 1.155   -72.680 124.026 1.00 24.15 ? 125 THR A CG2 1 
ATOM   500  N  N   . THR A 1 126 ? 0.907   -73.282 128.791 1.00 23.69 ? 126 THR A N   1 
ATOM   501  C  CA  . THR A 1 126 ? 0.144   -73.790 129.842 1.00 22.82 ? 126 THR A CA  1 
ATOM   502  C  C   . THR A 1 126 ? -0.026  -72.887 130.974 1.00 22.43 ? 126 THR A C   1 
ATOM   503  O  O   . THR A 1 126 ? -0.588  -73.286 131.994 1.00 22.77 ? 126 THR A O   1 
ATOM   504  C  CB  . THR A 1 126 ? 0.872   -75.205 130.145 1.00 22.68 ? 126 THR A CB  1 
ATOM   505  O  OG1 . THR A 1 126 ? 0.000   -75.998 130.935 1.00 23.72 ? 126 THR A OG1 1 
ATOM   506  C  CG2 . THR A 1 126 ? 2.197   -75.053 130.891 1.00 22.65 ? 126 THR A CG2 1 
ATOM   507  N  N   . THR A 1 127 ? 0.367   -71.645 130.809 1.00 22.64 ? 127 THR A N   1 
ATOM   508  C  CA  . THR A 1 127 ? 0.199   -70.620 131.891 1.00 22.44 ? 127 THR A CA  1 
ATOM   509  C  C   . THR A 1 127 ? -1.195  -70.124 131.903 1.00 22.88 ? 127 THR A C   1 
ATOM   510  O  O   . THR A 1 127 ? -1.959  -70.516 130.995 1.00 23.48 ? 127 THR A O   1 
ATOM   511  C  CB  . THR A 1 127 ? 1.326   -69.579 131.668 1.00 21.90 ? 127 THR A CB  1 
ATOM   512  O  OG1 . THR A 1 127 ? 2.383   -70.498 131.174 1.00 22.60 ? 127 THR A OG1 1 
ATOM   513  C  CG2 . THR A 1 127 ? 1.760   -68.796 132.861 1.00 21.06 ? 127 THR A CG2 1 
ATOM   514  N  N   . SER A 1 128 ? -1.571  -69.294 132.870 1.00 23.99 ? 128 SER A N   1 
ATOM   515  C  CA  . SER A 1 128 ? -3.012  -68.921 132.805 1.00 25.01 ? 128 SER A CA  1 
ATOM   516  C  C   . SER A 1 128 ? -3.264  -67.491 132.926 1.00 25.24 ? 128 SER A C   1 
ATOM   517  O  O   . SER A 1 128 ? -3.488  -67.207 134.141 1.00 28.20 ? 128 SER A O   1 
ATOM   518  C  CB  . SER A 1 128 ? -3.743  -69.691 133.942 1.00 24.79 ? 128 SER A CB  1 
ATOM   519  O  OG  . SER A 1 128 ? -4.207  -70.859 133.327 1.00 25.84 ? 128 SER A OG  1 
ATOM   520  N  N   . GLY A 1 129 ? -3.308  -66.692 131.915 1.00 24.25 ? 129 GLY A N   1 
ATOM   521  C  CA  . GLY A 1 129 ? -3.565  -65.243 132.242 1.00 22.26 ? 129 GLY A CA  1 
ATOM   522  C  C   . GLY A 1 129 ? -3.604  -64.485 130.939 1.00 20.95 ? 129 GLY A C   1 
ATOM   523  O  O   . GLY A 1 129 ? -3.425  -65.065 129.852 1.00 20.70 ? 129 GLY A O   1 
ATOM   524  N  N   . ALA A 1 130 ? -3.819  -63.210 131.140 1.00 19.64 ? 130 ALA A N   1 
ATOM   525  C  CA  . ALA A 1 130 ? -3.943  -62.381 129.939 1.00 19.62 ? 130 ALA A CA  1 
ATOM   526  C  C   . ALA A 1 130 ? -3.436  -61.018 130.214 1.00 19.59 ? 130 ALA A C   1 
ATOM   527  O  O   . ALA A 1 130 ? -3.699  -60.653 131.392 1.00 21.09 ? 130 ALA A O   1 
ATOM   528  C  CB  . ALA A 1 130 ? -5.445  -62.356 129.615 1.00 19.06 ? 130 ALA A CB  1 
ATOM   529  N  N   . ILE A 1 131 ? -2.832  -60.375 129.260 1.00 18.34 ? 131 ILE A N   1 
ATOM   530  C  CA  . ILE A 1 131 ? -2.365  -58.982 129.497 1.00 16.18 ? 131 ILE A CA  1 
ATOM   531  C  C   . ILE A 1 131 ? -3.401  -58.157 128.767 1.00 15.06 ? 131 ILE A C   1 
ATOM   532  O  O   . ILE A 1 131 ? -4.083  -58.718 127.857 1.00 14.32 ? 131 ILE A O   1 
ATOM   533  C  CB  . ILE A 1 131 ? -0.899  -58.911 129.070 1.00 16.62 ? 131 ILE A CB  1 
ATOM   534  C  CG1 . ILE A 1 131 ? -0.386  -57.448 129.134 1.00 16.69 ? 131 ILE A CG1 1 
ATOM   535  C  CG2 . ILE A 1 131 ? -0.669  -59.533 127.643 1.00 15.75 ? 131 ILE A CG2 1 
ATOM   536  C  CD1 . ILE A 1 131 ? 1.044   -57.325 128.533 1.00 16.90 ? 131 ILE A CD1 1 
ATOM   537  N  N   . HIS A 1 132 ? -3.538  -56.945 129.147 1.00 14.65 ? 132 HIS A N   1 
ATOM   538  C  CA  . HIS A 1 132 ? -4.450  -55.963 128.569 1.00 15.47 ? 132 HIS A CA  1 
ATOM   539  C  C   . HIS A 1 132 ? -3.749  -54.604 128.486 1.00 16.27 ? 132 HIS A C   1 
ATOM   540  O  O   . HIS A 1 132 ? -2.786  -54.463 129.304 1.00 17.52 ? 132 HIS A O   1 
ATOM   541  C  CB  . HIS A 1 132 ? -5.694  -55.799 129.410 1.00 14.85 ? 132 HIS A CB  1 
ATOM   542  C  CG  . HIS A 1 132 ? -6.457  -57.041 129.600 1.00 15.60 ? 132 HIS A CG  1 
ATOM   543  N  ND1 . HIS A 1 132 ? -7.792  -57.213 129.258 1.00 16.06 ? 132 HIS A ND1 1 
ATOM   544  C  CD2 . HIS A 1 132 ? -6.103  -58.223 130.156 1.00 15.98 ? 132 HIS A CD2 1 
ATOM   545  C  CE1 . HIS A 1 132 ? -8.233  -58.405 129.552 1.00 15.44 ? 132 HIS A CE1 1 
ATOM   546  N  NE2 . HIS A 1 132 ? -7.225  -59.020 130.121 1.00 16.27 ? 132 HIS A NE2 1 
ATOM   547  N  N   . MET A 1 133 ? -4.145  -53.649 127.676 1.00 15.99 ? 133 MET A N   1 
ATOM   548  C  CA  . MET A 1 133 ? -3.446  -52.332 127.745 1.00 16.31 ? 133 MET A CA  1 
ATOM   549  C  C   . MET A 1 133 ? -4.298  -51.358 126.853 1.00 15.53 ? 133 MET A C   1 
ATOM   550  O  O   . MET A 1 133 ? -4.922  -51.837 125.903 1.00 14.37 ? 133 MET A O   1 
ATOM   551  C  CB  . MET A 1 133 ? -2.002  -52.242 127.391 1.00 16.72 ? 133 MET A CB  1 
ATOM   552  C  CG  . MET A 1 133 ? -1.436  -53.054 126.272 1.00 17.03 ? 133 MET A CG  1 
ATOM   553  S  SD  . MET A 1 133 ? 0.172   -53.623 126.873 1.00 18.49 ? 133 MET A SD  1 
ATOM   554  C  CE  . MET A 1 133 ? 1.155   -54.047 125.487 1.00 18.04 ? 133 MET A CE  1 
ATOM   555  N  N   . GLY A 1 134 ? -4.164  -50.142 127.330 1.00 14.56 ? 134 GLY A N   1 
ATOM   556  C  CA  . GLY A 1 134 ? -4.882  -49.016 126.741 1.00 15.10 ? 134 GLY A CA  1 
ATOM   557  C  C   . GLY A 1 134 ? -4.167  -47.771 127.220 1.00 16.23 ? 134 GLY A C   1 
ATOM   558  O  O   . GLY A 1 134 ? -3.461  -47.802 128.261 1.00 17.26 ? 134 GLY A O   1 
ATOM   559  N  N   . PHE A 1 135 ? -4.310  -46.726 126.438 1.00 16.66 ? 135 PHE A N   1 
ATOM   560  C  CA  . PHE A 1 135 ? -3.602  -45.462 126.752 1.00 16.62 ? 135 PHE A CA  1 
ATOM   561  C  C   . PHE A 1 135 ? -4.594  -44.558 127.446 1.00 15.43 ? 135 PHE A C   1 
ATOM   562  O  O   . PHE A 1 135 ? -5.776  -44.780 127.195 1.00 15.50 ? 135 PHE A O   1 
ATOM   563  C  CB  . PHE A 1 135 ? -3.051  -44.808 125.524 1.00 18.39 ? 135 PHE A CB  1 
ATOM   564  C  CG  . PHE A 1 135 ? -1.900  -45.364 124.783 1.00 19.36 ? 135 PHE A CG  1 
ATOM   565  C  CD1 . PHE A 1 135 ? -2.074  -46.185 123.675 1.00 19.39 ? 135 PHE A CD1 1 
ATOM   566  C  CD2 . PHE A 1 135 ? -0.591  -45.033 125.196 1.00 19.53 ? 135 PHE A CD2 1 
ATOM   567  C  CE1 . PHE A 1 135 ? -0.961  -46.684 122.971 1.00 19.09 ? 135 PHE A CE1 1 
ATOM   568  C  CE2 . PHE A 1 135 ? 0.516   -45.533 124.493 1.00 18.89 ? 135 PHE A CE2 1 
ATOM   569  C  CZ  . PHE A 1 135 ? 0.304   -46.364 123.384 1.00 18.82 ? 135 PHE A CZ  1 
ATOM   570  N  N   . GLN A 1 136 ? -4.045  -43.642 128.140 1.00 14.72 ? 136 GLN A N   1 
ATOM   571  C  CA  . GLN A 1 136 ? -4.972  -42.695 128.910 1.00 15.13 ? 136 GLN A CA  1 
ATOM   572  C  C   . GLN A 1 136 ? -4.316  -41.376 128.749 1.00 14.90 ? 136 GLN A C   1 
ATOM   573  O  O   . GLN A 1 136 ? -3.041  -41.378 128.565 1.00 15.49 ? 136 GLN A O   1 
ATOM   574  C  CB  . GLN A 1 136 ? -5.147  -43.383 130.230 1.00 15.71 ? 136 GLN A CB  1 
ATOM   575  C  CG  . GLN A 1 136 ? -5.967  -42.857 131.292 1.00 16.60 ? 136 GLN A CG  1 
ATOM   576  C  CD  . GLN A 1 136 ? -6.571  -43.774 132.318 1.00 17.22 ? 136 GLN A CD  1 
ATOM   577  O  OE1 . GLN A 1 136 ? -7.543  -44.466 132.052 1.00 16.86 ? 136 GLN A OE1 1 
ATOM   578  N  NE2 . GLN A 1 136 ? -6.008  -43.760 133.536 1.00 17.93 ? 136 GLN A NE2 1 
ATOM   579  N  N   . TYR A 1 137 ? -5.061  -40.272 128.808 1.00 14.28 ? 137 TYR A N   1 
ATOM   580  C  CA  . TYR A 1 137 ? -4.342  -38.980 128.579 1.00 13.46 ? 137 TYR A CA  1 
ATOM   581  C  C   . TYR A 1 137 ? -4.521  -37.832 129.502 1.00 14.11 ? 137 TYR A C   1 
ATOM   582  O  O   . TYR A 1 137 ? -3.990  -36.719 129.200 1.00 14.29 ? 137 TYR A O   1 
ATOM   583  C  CB  . TYR A 1 137 ? -4.888  -38.578 127.191 1.00 12.31 ? 137 TYR A CB  1 
ATOM   584  C  CG  . TYR A 1 137 ? -4.737  -39.655 126.153 1.00 11.31 ? 137 TYR A CG  1 
ATOM   585  C  CD1 . TYR A 1 137 ? -5.692  -40.646 125.938 1.00 10.43 ? 137 TYR A CD1 1 
ATOM   586  C  CD2 . TYR A 1 137 ? -3.565  -39.633 125.358 1.00 10.59 ? 137 TYR A CD2 1 
ATOM   587  C  CE1 . TYR A 1 137 ? -5.507  -41.622 124.961 1.00 9.66  ? 137 TYR A CE1 1 
ATOM   588  C  CE2 . TYR A 1 137 ? -3.396  -40.602 124.371 1.00 10.32 ? 137 TYR A CE2 1 
ATOM   589  C  CZ  . TYR A 1 137 ? -4.369  -41.602 124.161 1.00 9.50  ? 137 TYR A CZ  1 
ATOM   590  O  OH  . TYR A 1 137 ? -4.105  -42.484 123.166 1.00 8.03  ? 137 TYR A OH  1 
ATOM   591  N  N   . ASP A 1 138 ? -5.272  -37.964 130.547 1.00 15.22 ? 138 ASP A N   1 
ATOM   592  C  CA  . ASP A 1 138 ? -5.517  -36.857 131.516 1.00 16.14 ? 138 ASP A CA  1 
ATOM   593  C  C   . ASP A 1 138 ? -4.756  -37.327 132.717 1.00 17.73 ? 138 ASP A C   1 
ATOM   594  O  O   . ASP A 1 138 ? -5.323  -38.211 133.438 1.00 19.01 ? 138 ASP A O   1 
ATOM   595  C  CB  . ASP A 1 138 ? -7.006  -36.665 131.677 1.00 15.69 ? 138 ASP A CB  1 
ATOM   596  C  CG  . ASP A 1 138 ? -7.357  -35.486 132.575 1.00 15.88 ? 138 ASP A CG  1 
ATOM   597  O  OD1 . ASP A 1 138 ? -8.552  -35.224 132.921 1.00 15.33 ? 138 ASP A OD1 1 
ATOM   598  O  OD2 . ASP A 1 138 ? -6.314  -34.841 132.897 1.00 15.88 ? 138 ASP A OD2 1 
ATOM   599  N  N   . MET A 1 139 ? -3.547  -36.888 132.955 1.00 18.95 ? 139 MET A N   1 
ATOM   600  C  CA  . MET A 1 139 ? -2.849  -37.391 134.158 1.00 19.51 ? 139 MET A CA  1 
ATOM   601  C  C   . MET A 1 139 ? -3.846  -37.318 135.322 1.00 19.74 ? 139 MET A C   1 
ATOM   602  O  O   . MET A 1 139 ? -3.457  -37.879 136.368 1.00 20.89 ? 139 MET A O   1 
ATOM   603  C  CB  . MET A 1 139 ? -1.557  -36.646 134.510 1.00 19.36 ? 139 MET A CB  1 
ATOM   604  C  CG  . MET A 1 139 ? -0.430  -37.051 133.636 1.00 19.16 ? 139 MET A CG  1 
ATOM   605  S  SD  . MET A 1 139 ? -1.257  -38.472 132.671 1.00 19.83 ? 139 MET A SD  1 
ATOM   606  C  CE  . MET A 1 139 ? 0.220   -39.535 132.761 1.00 19.27 ? 139 MET A CE  1 
ATOM   607  N  N   . ALA A 1 140 ? -5.004  -36.686 135.195 1.00 19.07 ? 140 ALA A N   1 
ATOM   608  C  CA  . ALA A 1 140 ? -5.933  -36.584 136.304 1.00 18.42 ? 140 ALA A CA  1 
ATOM   609  C  C   . ALA A 1 140 ? -6.994  -37.641 136.355 1.00 18.56 ? 140 ALA A C   1 
ATOM   610  O  O   . ALA A 1 140 ? -7.538  -37.783 137.481 1.00 18.89 ? 140 ALA A O   1 
ATOM   611  C  CB  . ALA A 1 140 ? -6.635  -35.197 136.288 1.00 18.13 ? 140 ALA A CB  1 
ATOM   612  N  N   . ASP A 1 141 ? -7.345  -38.331 135.309 1.00 19.13 ? 141 ASP A N   1 
ATOM   613  C  CA  . ASP A 1 141 ? -8.418  -39.354 135.457 1.00 20.70 ? 141 ASP A CA  1 
ATOM   614  C  C   . ASP A 1 141 ? -7.875  -40.565 136.217 1.00 21.10 ? 141 ASP A C   1 
ATOM   615  O  O   . ASP A 1 141 ? -6.646  -40.788 136.308 1.00 22.27 ? 141 ASP A O   1 
ATOM   616  C  CB  . ASP A 1 141 ? -8.987  -39.770 134.116 1.00 21.67 ? 141 ASP A CB  1 
ATOM   617  C  CG  . ASP A 1 141 ? -9.095  -38.766 133.022 1.00 22.15 ? 141 ASP A CG  1 
ATOM   618  O  OD1 . ASP A 1 141 ? -9.538  -37.615 133.284 1.00 23.22 ? 141 ASP A OD1 1 
ATOM   619  O  OD2 . ASP A 1 141 ? -8.722  -39.150 131.874 1.00 22.03 ? 141 ASP A OD2 1 
ATOM   620  N  N   . THR A 1 142 ? -8.709  -41.393 136.721 1.00 20.98 ? 142 THR A N   1 
ATOM   621  C  CA  . THR A 1 142 ? -8.578  -42.601 137.457 1.00 21.02 ? 142 THR A CA  1 
ATOM   622  C  C   . THR A 1 142 ? -8.126  -43.824 136.756 1.00 20.93 ? 142 THR A C   1 
ATOM   623  O  O   . THR A 1 142 ? -8.575  -43.867 135.566 1.00 21.23 ? 142 THR A O   1 
ATOM   624  C  CB  . THR A 1 142 ? -10.100 -42.941 137.893 1.00 21.66 ? 142 THR A CB  1 
ATOM   625  O  OG1 . THR A 1 142 ? -10.491 -41.817 138.736 1.00 22.21 ? 142 THR A OG1 1 
ATOM   626  C  CG2 . THR A 1 142 ? -10.267 -44.297 138.530 1.00 22.08 ? 142 THR A CG2 1 
ATOM   627  N  N   . LEU A 1 143 ? -7.415  -44.784 137.326 1.00 20.81 ? 143 LEU A N   1 
ATOM   628  C  CA  . LEU A 1 143 ? -7.112  -45.965 136.473 1.00 20.77 ? 143 LEU A CA  1 
ATOM   629  C  C   . LEU A 1 143 ? -8.376  -46.831 136.435 1.00 20.57 ? 143 LEU A C   1 
ATOM   630  O  O   . LEU A 1 143 ? -9.142  -46.837 137.367 1.00 20.80 ? 143 LEU A O   1 
ATOM   631  C  CB  . LEU A 1 143 ? -5.921  -46.768 136.925 1.00 20.81 ? 143 LEU A CB  1 
ATOM   632  C  CG  . LEU A 1 143 ? -4.601  -46.047 136.743 1.00 21.21 ? 143 LEU A CG  1 
ATOM   633  C  CD1 . LEU A 1 143 ? -4.745  -44.758 137.605 1.00 21.99 ? 143 LEU A CD1 1 
ATOM   634  C  CD2 . LEU A 1 143 ? -3.412  -46.841 137.190 1.00 20.75 ? 143 LEU A CD2 1 
ATOM   635  N  N   . PRO A 1 144 ? -8.509  -47.535 135.355 1.00 20.85 ? 144 PRO A N   1 
ATOM   636  C  CA  . PRO A 1 144 ? -9.609  -48.465 135.189 1.00 21.42 ? 144 PRO A CA  1 
ATOM   637  C  C   . PRO A 1 144 ? -9.497  -49.375 136.393 1.00 21.85 ? 144 PRO A C   1 
ATOM   638  O  O   . PRO A 1 144 ? -8.408  -49.478 137.049 1.00 22.18 ? 144 PRO A O   1 
ATOM   639  C  CB  . PRO A 1 144 ? -9.369  -49.163 133.879 1.00 21.77 ? 144 PRO A CB  1 
ATOM   640  C  CG  . PRO A 1 144 ? -7.830  -49.075 133.753 1.00 21.08 ? 144 PRO A CG  1 
ATOM   641  C  CD  . PRO A 1 144 ? -7.585  -47.620 134.190 1.00 21.05 ? 144 PRO A CD  1 
ATOM   642  N  N   . VAL A 1 145 ? -10.597 -50.056 136.621 1.00 22.07 ? 145 VAL A N   1 
ATOM   643  C  CA  . VAL A 1 145 ? -10.583 -50.977 137.806 1.00 22.09 ? 145 VAL A CA  1 
ATOM   644  C  C   . VAL A 1 145 ? -11.090 -52.347 137.483 1.00 22.40 ? 145 VAL A C   1 
ATOM   645  O  O   . VAL A 1 145 ? -11.110 -53.266 138.328 1.00 23.16 ? 145 VAL A O   1 
ATOM   646  C  CB  . VAL A 1 145 ? -11.418 -50.164 138.828 1.00 21.16 ? 145 VAL A CB  1 
ATOM   647  C  CG1 . VAL A 1 145 ? -12.595 -50.986 139.273 1.00 21.11 ? 145 VAL A CG1 1 
ATOM   648  C  CG2 . VAL A 1 145 ? -10.543 -49.660 139.920 1.00 20.98 ? 145 VAL A CG2 1 
ATOM   649  N  N   . SER A 1 146 ? -11.506 -52.488 136.247 1.00 21.91 ? 146 SER A N   1 
ATOM   650  C  CA  . SER A 1 146 ? -12.124 -53.653 135.658 1.00 21.17 ? 146 SER A CA  1 
ATOM   651  C  C   . SER A 1 146 ? -11.792 -53.923 134.234 1.00 20.57 ? 146 SER A C   1 
ATOM   652  O  O   . SER A 1 146 ? -11.612 -52.923 133.498 1.00 20.61 ? 146 SER A O   1 
ATOM   653  C  CB  . SER A 1 146 ? -13.614 -53.218 135.830 1.00 21.17 ? 146 SER A CB  1 
ATOM   654  O  OG  . SER A 1 146 ? -14.287 -53.376 134.625 1.00 21.52 ? 146 SER A OG  1 
ATOM   655  N  N   . VAL A 1 147 ? -11.727 -55.166 133.777 1.00 20.58 ? 147 VAL A N   1 
ATOM   656  C  CA  . VAL A 1 147 ? -11.354 -55.394 132.354 1.00 20.89 ? 147 VAL A CA  1 
ATOM   657  C  C   . VAL A 1 147 ? -12.254 -54.494 131.491 1.00 21.64 ? 147 VAL A C   1 
ATOM   658  O  O   . VAL A 1 147 ? -11.668 -53.625 130.836 1.00 21.83 ? 147 VAL A O   1 
ATOM   659  C  CB  . VAL A 1 147 ? -11.352 -56.833 131.905 1.00 20.46 ? 147 VAL A CB  1 
ATOM   660  C  CG1 . VAL A 1 147 ? -12.162 -57.038 130.623 1.00 20.81 ? 147 VAL A CG1 1 
ATOM   661  C  CG2 . VAL A 1 147 ? -9.939  -57.337 131.686 1.00 20.00 ? 147 VAL A CG2 1 
ATOM   662  N  N   . ASN A 1 148 ? -13.531 -54.714 131.547 1.00 22.22 ? 148 ASN A N   1 
ATOM   663  C  CA  . ASN A 1 148 ? -14.526 -53.923 130.867 1.00 22.93 ? 148 ASN A CA  1 
ATOM   664  C  C   . ASN A 1 148 ? -14.149 -52.449 130.740 1.00 22.45 ? 148 ASN A C   1 
ATOM   665  O  O   . ASN A 1 148 ? -14.095 -51.885 129.640 1.00 21.93 ? 148 ASN A O   1 
ATOM   666  C  CB  . ASN A 1 148 ? -15.818 -54.035 131.687 1.00 24.85 ? 148 ASN A CB  1 
ATOM   667  C  CG  . ASN A 1 148 ? -17.008 -53.468 130.971 1.00 26.37 ? 148 ASN A CG  1 
ATOM   668  O  OD1 . ASN A 1 148 ? -18.144 -53.972 131.016 1.00 27.13 ? 148 ASN A OD1 1 
ATOM   669  N  ND2 . ASN A 1 148 ? -16.797 -52.378 130.244 1.00 27.92 ? 148 ASN A ND2 1 
ATOM   670  N  N   . GLN A 1 149 ? -13.935 -51.812 131.856 1.00 22.49 ? 149 GLN A N   1 
ATOM   671  C  CA  . GLN A 1 149 ? -13.569 -50.390 131.835 1.00 24.30 ? 149 GLN A CA  1 
ATOM   672  C  C   . GLN A 1 149 ? -12.421 -50.201 130.849 1.00 23.95 ? 149 GLN A C   1 
ATOM   673  O  O   . GLN A 1 149 ? -12.467 -49.501 129.862 1.00 24.22 ? 149 GLN A O   1 
ATOM   674  C  CB  . GLN A 1 149 ? -13.140 -49.890 133.178 1.00 26.35 ? 149 GLN A CB  1 
ATOM   675  C  CG  . GLN A 1 149 ? -14.198 -50.121 134.269 1.00 28.47 ? 149 GLN A CG  1 
ATOM   676  C  CD  . GLN A 1 149 ? -14.027 -48.949 135.224 1.00 29.62 ? 149 GLN A CD  1 
ATOM   677  O  OE1 . GLN A 1 149 ? -12.949 -48.373 135.228 1.00 30.59 ? 149 GLN A OE1 1 
ATOM   678  N  NE2 . GLN A 1 149 ? -15.070 -48.640 135.955 1.00 30.75 ? 149 GLN A NE2 1 
ATOM   679  N  N   . LEU A 1 150 ? -11.352 -50.856 131.220 1.00 23.81 ? 150 LEU A N   1 
ATOM   680  C  CA  . LEU A 1 150 ? -10.085 -50.815 130.440 1.00 23.51 ? 150 LEU A CA  1 
ATOM   681  C  C   . LEU A 1 150 ? -10.348 -51.132 128.984 1.00 23.18 ? 150 LEU A C   1 
ATOM   682  O  O   . LEU A 1 150 ? -9.703  -50.609 128.069 1.00 23.53 ? 150 LEU A O   1 
ATOM   683  C  CB  . LEU A 1 150 ? -9.153  -51.729 131.234 1.00 23.33 ? 150 LEU A CB  1 
ATOM   684  C  CG  . LEU A 1 150 ? -7.813  -52.064 130.615 1.00 23.06 ? 150 LEU A CG  1 
ATOM   685  C  CD1 . LEU A 1 150 ? -7.216  -50.922 129.849 1.00 22.46 ? 150 LEU A CD1 1 
ATOM   686  C  CD2 . LEU A 1 150 ? -6.909  -52.406 131.799 1.00 23.47 ? 150 LEU A CD2 1 
ATOM   687  N  N   . SER A 1 151 ? -11.303 -51.994 128.752 1.00 22.85 ? 151 SER A N   1 
ATOM   688  C  CA  . SER A 1 151 ? -11.764 -52.451 127.442 1.00 22.32 ? 151 SER A CA  1 
ATOM   689  C  C   . SER A 1 151 ? -11.983 -51.259 126.519 1.00 22.61 ? 151 SER A C   1 
ATOM   690  O  O   . SER A 1 151 ? -11.721 -51.466 125.324 1.00 22.77 ? 151 SER A O   1 
ATOM   691  C  CB  . SER A 1 151 ? -13.034 -53.255 127.576 1.00 21.78 ? 151 SER A CB  1 
ATOM   692  O  OG  . SER A 1 151 ? -13.911 -53.410 126.529 1.00 20.59 ? 151 SER A OG  1 
ATOM   693  N  N   . ASN A 1 152 ? -12.424 -50.110 126.992 1.00 22.94 ? 152 ASN A N   1 
ATOM   694  C  CA  . ASN A 1 152 ? -12.620 -49.063 125.929 1.00 24.39 ? 152 ASN A CA  1 
ATOM   695  C  C   . ASN A 1 152 ? -11.607 -47.941 125.997 1.00 24.21 ? 152 ASN A C   1 
ATOM   696  O  O   . ASN A 1 152 ? -11.884 -46.776 125.698 1.00 23.65 ? 152 ASN A O   1 
ATOM   697  C  CB  . ASN A 1 152 ? -14.088 -48.663 125.903 1.00 26.13 ? 152 ASN A CB  1 
ATOM   698  C  CG  . ASN A 1 152 ? -14.891 -48.657 127.149 1.00 27.40 ? 152 ASN A CG  1 
ATOM   699  O  OD1 . ASN A 1 152 ? -14.388 -48.729 128.277 1.00 28.57 ? 152 ASN A OD1 1 
ATOM   700  N  ND2 . ASN A 1 152 ? -16.243 -48.598 127.059 1.00 27.96 ? 152 ASN A ND2 1 
ATOM   701  N  N   . LEU A 1 153 ? -10.384 -48.358 126.316 1.00 24.37 ? 153 LEU A N   1 
ATOM   702  C  CA  . LEU A 1 153 ? -9.272  -47.336 126.304 1.00 24.10 ? 153 LEU A CA  1 
ATOM   703  C  C   . LEU A 1 153 ? -8.885  -47.230 124.818 1.00 23.55 ? 153 LEU A C   1 
ATOM   704  O  O   . LEU A 1 153 ? -9.588  -47.923 124.008 1.00 23.72 ? 153 LEU A O   1 
ATOM   705  C  CB  . LEU A 1 153 ? -8.302  -47.774 127.378 1.00 23.78 ? 153 LEU A CB  1 
ATOM   706  C  CG  . LEU A 1 153 ? -8.010  -46.623 128.349 1.00 24.21 ? 153 LEU A CG  1 
ATOM   707  C  CD1 . LEU A 1 153 ? -9.332  -46.007 128.786 1.00 24.21 ? 153 LEU A CD1 1 
ATOM   708  C  CD2 . LEU A 1 153 ? -7.212  -47.153 129.520 1.00 24.40 ? 153 LEU A CD2 1 
ATOM   709  N  N   . LYS A 1 154 ? -7.903  -46.484 124.442 1.00 22.94 ? 154 LYS A N   1 
ATOM   710  C  CA  . LYS A 1 154 ? -7.431  -46.277 123.096 1.00 22.95 ? 154 LYS A CA  1 
ATOM   711  C  C   . LYS A 1 154 ? -6.685  -47.441 122.500 1.00 22.18 ? 154 LYS A C   1 
ATOM   712  O  O   . LYS A 1 154 ? -7.268  -47.926 121.432 1.00 23.46 ? 154 LYS A O   1 
ATOM   713  C  CB  . LYS A 1 154 ? -6.492  -45.053 122.964 1.00 24.04 ? 154 LYS A CB  1 
ATOM   714  C  CG  . LYS A 1 154 ? -6.643  -44.348 121.610 1.00 24.90 ? 154 LYS A CG  1 
ATOM   715  C  CD  . LYS A 1 154 ? -5.772  -44.969 120.528 1.00 26.13 ? 154 LYS A CD  1 
ATOM   716  C  CE  . LYS A 1 154 ? -6.515  -45.042 119.204 1.00 26.84 ? 154 LYS A CE  1 
ATOM   717  N  NZ  . LYS A 1 154 ? -5.532  -44.886 118.101 1.00 28.26 ? 154 LYS A NZ  1 
ATOM   718  N  N   . GLY A 1 155 ? -5.580  -47.962 122.873 1.00 21.10 ? 155 GLY A N   1 
ATOM   719  C  CA  . GLY A 1 155 ? -5.143  -49.151 121.948 1.00 20.67 ? 155 GLY A CA  1 
ATOM   720  C  C   . GLY A 1 155 ? -5.716  -50.439 122.471 1.00 20.11 ? 155 GLY A C   1 
ATOM   721  O  O   . GLY A 1 155 ? -4.990  -51.472 122.280 1.00 20.70 ? 155 GLY A O   1 
ATOM   722  N  N   . TYR A 1 156 ? -6.860  -50.522 123.103 1.00 19.18 ? 156 TYR A N   1 
ATOM   723  C  CA  . TYR A 1 156 ? -7.249  -51.815 123.678 1.00 19.17 ? 156 TYR A CA  1 
ATOM   724  C  C   . TYR A 1 156 ? -6.699  -52.996 122.843 1.00 17.77 ? 156 TYR A C   1 
ATOM   725  O  O   . TYR A 1 156 ? -6.978  -53.015 121.654 1.00 17.94 ? 156 TYR A O   1 
ATOM   726  C  CB  . TYR A 1 156 ? -8.724  -52.068 123.888 1.00 20.47 ? 156 TYR A CB  1 
ATOM   727  C  CG  . TYR A 1 156 ? -8.909  -53.219 124.863 1.00 21.29 ? 156 TYR A CG  1 
ATOM   728  C  CD1 . TYR A 1 156 ? -9.913  -54.166 124.635 1.00 21.96 ? 156 TYR A CD1 1 
ATOM   729  C  CD2 . TYR A 1 156 ? -8.099  -53.353 125.977 1.00 21.86 ? 156 TYR A CD2 1 
ATOM   730  C  CE1 . TYR A 1 156 ? -10.138 -55.239 125.510 1.00 21.81 ? 156 TYR A CE1 1 
ATOM   731  C  CE2 . TYR A 1 156 ? -8.299  -54.415 126.865 1.00 22.21 ? 156 TYR A CE2 1 
ATOM   732  C  CZ  . TYR A 1 156 ? -9.308  -55.340 126.630 1.00 21.85 ? 156 TYR A CZ  1 
ATOM   733  O  OH  . TYR A 1 156 ? -9.467  -56.357 127.500 1.00 21.85 ? 156 TYR A OH  1 
ATOM   734  N  N   . VAL A 1 157 ? -6.032  -53.850 123.560 1.00 16.24 ? 157 VAL A N   1 
ATOM   735  C  CA  . VAL A 1 157 ? -5.422  -55.045 122.988 1.00 15.93 ? 157 VAL A CA  1 
ATOM   736  C  C   . VAL A 1 157 ? -5.204  -56.083 124.070 1.00 16.27 ? 157 VAL A C   1 
ATOM   737  O  O   . VAL A 1 157 ? -4.771  -55.637 125.179 1.00 17.76 ? 157 VAL A O   1 
ATOM   738  C  CB  . VAL A 1 157 ? -4.080  -54.702 122.318 1.00 15.65 ? 157 VAL A CB  1 
ATOM   739  C  CG1 . VAL A 1 157 ? -2.878  -54.621 123.252 1.00 14.57 ? 157 VAL A CG1 1 
ATOM   740  C  CG2 . VAL A 1 157 ? -3.799  -55.684 121.193 1.00 14.94 ? 157 VAL A CG2 1 
ATOM   741  N  N   . THR A 1 158 ? -5.410  -57.337 123.848 1.00 15.65 ? 158 THR A N   1 
ATOM   742  C  CA  . THR A 1 158 ? -5.204  -58.334 124.893 1.00 15.80 ? 158 THR A CA  1 
ATOM   743  C  C   . THR A 1 158 ? -5.069  -59.697 124.290 1.00 15.99 ? 158 THR A C   1 
ATOM   744  O  O   . THR A 1 158 ? -5.442  -59.960 123.159 1.00 15.98 ? 158 THR A O   1 
ATOM   745  C  CB  . THR A 1 158 ? -6.422  -58.304 125.895 1.00 16.16 ? 158 THR A CB  1 
ATOM   746  O  OG1 . THR A 1 158 ? -6.741  -59.611 126.462 1.00 16.04 ? 158 THR A OG1 1 
ATOM   747  C  CG2 . THR A 1 158 ? -7.670  -57.759 125.172 1.00 15.85 ? 158 THR A CG2 1 
ATOM   748  N  N   . GLY A 1 159 ? -4.565  -60.556 125.157 1.00 16.42 ? 159 GLY A N   1 
ATOM   749  C  CA  . GLY A 1 159 ? -4.398  -61.971 124.842 1.00 15.98 ? 159 GLY A CA  1 
ATOM   750  C  C   . GLY A 1 159 ? -3.807  -62.715 126.029 1.00 15.23 ? 159 GLY A C   1 
ATOM   751  O  O   . GLY A 1 159 ? -3.265  -62.137 126.977 1.00 15.29 ? 159 GLY A O   1 
ATOM   752  N  N   . PRO A 1 160 ? -3.893  -64.018 125.906 1.00 15.20 ? 160 PRO A N   1 
ATOM   753  C  CA  . PRO A 1 160 ? -3.357  -64.942 126.878 1.00 15.56 ? 160 PRO A CA  1 
ATOM   754  C  C   . PRO A 1 160 ? -1.888  -64.730 127.086 1.00 15.67 ? 160 PRO A C   1 
ATOM   755  O  O   . PRO A 1 160 ? -1.130  -64.659 126.113 1.00 15.85 ? 160 PRO A O   1 
ATOM   756  C  CB  . PRO A 1 160 ? -3.599  -66.333 126.277 1.00 15.30 ? 160 PRO A CB  1 
ATOM   757  C  CG  . PRO A 1 160 ? -3.600  -65.997 124.814 1.00 14.85 ? 160 PRO A CG  1 
ATOM   758  C  CD  . PRO A 1 160 ? -4.488  -64.759 124.772 1.00 14.87 ? 160 PRO A CD  1 
ATOM   759  N  N   . VAL A 1 161 ? -1.476  -64.676 128.294 1.00 16.56 ? 161 VAL A N   1 
ATOM   760  C  CA  . VAL A 1 161 ? -0.037  -64.493 128.564 1.00 17.89 ? 161 VAL A CA  1 
ATOM   761  C  C   . VAL A 1 161 ? 0.796   -65.427 127.730 1.00 18.98 ? 161 VAL A C   1 
ATOM   762  O  O   . VAL A 1 161 ? 2.069   -65.224 127.871 1.00 19.82 ? 161 VAL A O   1 
ATOM   763  C  CB  . VAL A 1 161 ? 0.118   -64.639 130.105 1.00 17.19 ? 161 VAL A CB  1 
ATOM   764  C  CG1 . VAL A 1 161 ? -0.655  -63.555 130.815 1.00 16.89 ? 161 VAL A CG1 1 
ATOM   765  C  CG2 . VAL A 1 161 ? -0.276  -66.022 130.544 1.00 16.72 ? 161 VAL A CG2 1 
ATOM   766  N  N   . TRP A 1 162 ? 0.322   -66.362 126.942 1.00 19.67 ? 162 TRP A N   1 
ATOM   767  C  CA  . TRP A 1 162 ? 1.349   -67.202 126.231 1.00 21.35 ? 162 TRP A CA  1 
ATOM   768  C  C   . TRP A 1 162 ? 1.487   -66.860 124.758 1.00 21.84 ? 162 TRP A C   1 
ATOM   769  O  O   . TRP A 1 162 ? 2.433   -67.329 124.118 1.00 22.02 ? 162 TRP A O   1 
ATOM   770  C  CB  . TRP A 1 162 ? 1.063   -68.675 126.291 1.00 22.37 ? 162 TRP A CB  1 
ATOM   771  C  CG  . TRP A 1 162 ? -0.368  -69.004 126.051 1.00 23.82 ? 162 TRP A CG  1 
ATOM   772  C  CD1 . TRP A 1 162 ? -1.404  -69.019 126.949 1.00 24.27 ? 162 TRP A CD1 1 
ATOM   773  C  CD2 . TRP A 1 162 ? -0.941  -69.371 124.800 1.00 24.83 ? 162 TRP A CD2 1 
ATOM   774  N  NE1 . TRP A 1 162 ? -2.567  -69.386 126.349 1.00 24.49 ? 162 TRP A NE1 1 
ATOM   775  C  CE2 . TRP A 1 162 ? -2.323  -69.612 125.034 1.00 25.04 ? 162 TRP A CE2 1 
ATOM   776  C  CE3 . TRP A 1 162 ? -0.405  -69.526 123.519 1.00 24.75 ? 162 TRP A CE3 1 
ATOM   777  C  CZ2 . TRP A 1 162 ? -3.176  -70.007 124.010 1.00 25.32 ? 162 TRP A CZ2 1 
ATOM   778  C  CZ3 . TRP A 1 162 ? -1.239  -69.918 122.528 1.00 24.98 ? 162 TRP A CZ3 1 
ATOM   779  C  CH2 . TRP A 1 162 ? -2.604  -70.154 122.771 1.00 25.51 ? 162 TRP A CH2 1 
ATOM   780  N  N   . GLU A 1 163 ? 0.517   -66.142 124.292 1.00 22.01 ? 163 GLU A N   1 
ATOM   781  C  CA  . GLU A 1 163 ? 0.423   -65.701 122.902 1.00 21.96 ? 163 GLU A CA  1 
ATOM   782  C  C   . GLU A 1 163 ? 1.307   -64.484 122.722 1.00 22.56 ? 163 GLU A C   1 
ATOM   783  O  O   . GLU A 1 163 ? 1.923   -64.053 123.740 1.00 22.92 ? 163 GLU A O   1 
ATOM   784  C  CB  . GLU A 1 163 ? -1.028  -65.458 122.676 1.00 21.30 ? 163 GLU A CB  1 
ATOM   785  C  CG  . GLU A 1 163 ? -1.512  -65.492 121.308 1.00 21.79 ? 163 GLU A CG  1 
ATOM   786  C  CD  . GLU A 1 163 ? -0.984  -66.343 120.231 1.00 22.03 ? 163 GLU A CD  1 
ATOM   787  O  OE1 . GLU A 1 163 ? 0.034   -66.050 119.603 1.00 22.52 ? 163 GLU A OE1 1 
ATOM   788  O  OE2 . GLU A 1 163 ? -1.736  -67.338 120.022 1.00 22.52 ? 163 GLU A OE2 1 
ATOM   789  N  N   . GLY A 1 164 ? 1.470   -63.951 121.512 1.00 22.32 ? 164 GLY A N   1 
ATOM   790  C  CA  . GLY A 1 164 ? 2.272   -62.797 121.262 1.00 21.82 ? 164 GLY A CA  1 
ATOM   791  C  C   . GLY A 1 164 ? 3.459   -62.775 120.394 1.00 22.06 ? 164 GLY A C   1 
ATOM   792  O  O   . GLY A 1 164 ? 3.884   -61.704 119.878 1.00 22.45 ? 164 GLY A O   1 
ATOM   793  N  N   . GLN A 1 165 ? 4.103   -63.877 120.174 1.00 22.95 ? 165 GLN A N   1 
ATOM   794  C  CA  . GLN A 1 165 ? 5.321   -64.094 119.397 1.00 23.06 ? 165 GLN A CA  1 
ATOM   795  C  C   . GLN A 1 165 ? 5.210   -63.337 118.083 1.00 24.10 ? 165 GLN A C   1 
ATOM   796  O  O   . GLN A 1 165 ? 6.241   -62.713 117.695 1.00 25.29 ? 165 GLN A O   1 
ATOM   797  C  CB  . GLN A 1 165 ? 5.693   -65.563 119.053 1.00 21.58 ? 165 GLN A CB  1 
ATOM   798  C  CG  . GLN A 1 165 ? 7.123   -65.694 118.611 1.00 19.81 ? 165 GLN A CG  1 
ATOM   799  C  CD  . GLN A 1 165 ? 8.113   -65.252 119.617 1.00 19.55 ? 165 GLN A CD  1 
ATOM   800  O  OE1 . GLN A 1 165 ? 9.267   -65.627 119.662 1.00 20.01 ? 165 GLN A OE1 1 
ATOM   801  N  NE2 . GLN A 1 165 ? 7.810   -64.375 120.577 1.00 19.81 ? 165 GLN A NE2 1 
ATOM   802  N  N   . SER A 1 166 ? 4.052   -63.430 117.521 1.00 24.98 ? 166 SER A N   1 
ATOM   803  C  CA  . SER A 1 166 ? 3.878   -62.669 116.210 1.00 26.62 ? 166 SER A CA  1 
ATOM   804  C  C   . SER A 1 166 ? 4.052   -61.203 116.512 1.00 26.62 ? 166 SER A C   1 
ATOM   805  O  O   . SER A 1 166 ? 3.199   -60.410 116.136 1.00 26.78 ? 166 SER A O   1 
ATOM   806  C  CB  . SER A 1 166 ? 2.566   -63.202 115.725 1.00 27.97 ? 166 SER A CB  1 
ATOM   807  O  OG  . SER A 1 166 ? 1.928   -62.602 114.625 1.00 30.09 ? 166 SER A OG  1 
ATOM   808  N  N   . GLY A 1 167 ? 5.056   -60.711 117.207 1.00 26.99 ? 167 GLY A N   1 
ATOM   809  C  CA  . GLY A 1 167 ? 5.277   -59.343 117.583 1.00 27.57 ? 167 GLY A CA  1 
ATOM   810  C  C   . GLY A 1 167 ? 6.744   -59.022 117.473 1.00 28.94 ? 167 GLY A C   1 
ATOM   811  O  O   . GLY A 1 167 ? 7.092   -57.851 117.403 1.00 28.72 ? 167 GLY A O   1 
ATOM   812  N  N   . LEU A 1 168 ? 7.530   -60.092 117.489 1.00 30.94 ? 168 LEU A N   1 
ATOM   813  C  CA  . LEU A 1 168 ? 9.026   -59.881 117.321 1.00 33.52 ? 168 LEU A CA  1 
ATOM   814  C  C   . LEU A 1 168 ? 8.962   -59.070 116.089 1.00 36.33 ? 168 LEU A C   1 
ATOM   815  O  O   . LEU A 1 168 ? 8.084   -59.806 115.399 1.00 37.48 ? 168 LEU A O   1 
ATOM   816  C  CB  . LEU A 1 168 ? 9.633   -61.174 117.052 1.00 32.13 ? 168 LEU A CB  1 
ATOM   817  C  CG  . LEU A 1 168 ? 10.664  -61.919 117.774 1.00 31.31 ? 168 LEU A CG  1 
ATOM   818  C  CD1 . LEU A 1 168 ? 11.205  -63.020 116.855 1.00 30.89 ? 168 LEU A CD1 1 
ATOM   819  C  CD2 . LEU A 1 168 ? 11.722  -60.896 118.155 1.00 31.19 ? 168 LEU A CD2 1 
ATOM   820  N  N   . CYS A 1 169 ? 9.452   -58.066 115.594 1.00 40.03 ? 169 CYS A N   1 
ATOM   821  C  CA  . CYS A 1 169 ? 8.968   -57.688 114.173 1.00 43.58 ? 169 CYS A CA  1 
ATOM   822  C  C   . CYS A 1 169 ? 8.915   -56.202 114.416 1.00 43.85 ? 169 CYS A C   1 
ATOM   823  O  O   . CYS A 1 169 ? 9.412   -55.446 113.637 1.00 44.80 ? 169 CYS A O   1 
ATOM   824  C  CB  . CYS A 1 169 ? 7.707   -58.281 113.860 1.00 47.28 ? 169 CYS A CB  1 
ATOM   825  S  SG  . CYS A 1 169 ? 6.687   -58.159 112.464 1.00 52.25 ? 169 CYS A SG  1 
ATOM   826  N  N   . PHE A 1 170 ? 8.302   -56.016 115.574 1.00 44.12 ? 170 PHE A N   1 
ATOM   827  C  CA  . PHE A 1 170 ? 8.198   -54.561 116.003 1.00 44.83 ? 170 PHE A CA  1 
ATOM   828  C  C   . PHE A 1 170 ? 9.521   -54.403 116.742 1.00 45.37 ? 170 PHE A C   1 
ATOM   829  O  O   . PHE A 1 170 ? 10.185  -53.377 116.612 1.00 45.80 ? 170 PHE A O   1 
ATOM   830  C  CB  . PHE A 1 170 ? 6.870   -54.364 116.623 1.00 45.45 ? 170 PHE A CB  1 
ATOM   831  C  CG  . PHE A 1 170 ? 5.680   -54.508 115.709 1.00 46.10 ? 170 PHE A CG  1 
ATOM   832  C  CD1 . PHE A 1 170 ? 4.607   -53.637 115.831 1.00 46.06 ? 170 PHE A CD1 1 
ATOM   833  C  CD2 . PHE A 1 170 ? 5.628   -55.499 114.726 1.00 46.71 ? 170 PHE A CD2 1 
ATOM   834  C  CE1 . PHE A 1 170 ? 3.487   -53.741 115.025 1.00 46.25 ? 170 PHE A CE1 1 
ATOM   835  C  CE2 . PHE A 1 170 ? 4.511   -55.617 113.888 1.00 46.82 ? 170 PHE A CE2 1 
ATOM   836  C  CZ  . PHE A 1 170 ? 3.430   -54.719 114.051 1.00 46.44 ? 170 PHE A CZ  1 
ATOM   837  N  N   . VAL A 1 171 ? 9.932   -55.455 117.428 1.00 45.86 ? 171 VAL A N   1 
ATOM   838  C  CA  . VAL A 1 171 ? 11.194  -55.482 118.141 1.00 46.04 ? 171 VAL A CA  1 
ATOM   839  C  C   . VAL A 1 171 ? 12.291  -55.548 117.076 1.00 47.28 ? 171 VAL A C   1 
ATOM   840  O  O   . VAL A 1 171 ? 13.110  -54.700 116.794 1.00 47.45 ? 171 VAL A O   1 
ATOM   841  C  CB  . VAL A 1 171 ? 11.242  -56.698 119.045 1.00 45.47 ? 171 VAL A CB  1 
ATOM   842  C  CG1 . VAL A 1 171 ? 12.298  -56.527 120.106 1.00 45.18 ? 171 VAL A CG1 1 
ATOM   843  C  CG2 . VAL A 1 171 ? 9.879   -56.996 119.616 1.00 45.61 ? 171 VAL A CG2 1 
ATOM   844  N  N   . ASN A 1 172 ? 12.213  -56.694 116.464 1.00 49.22 ? 172 ASN A N   1 
ATOM   845  C  CA  . ASN A 1 172 ? 12.987  -57.251 115.399 1.00 51.22 ? 172 ASN A CA  1 
ATOM   846  C  C   . ASN A 1 172 ? 13.343  -56.285 114.289 1.00 52.98 ? 172 ASN A C   1 
ATOM   847  O  O   . ASN A 1 172 ? 14.449  -56.237 113.786 1.00 53.54 ? 172 ASN A O   1 
ATOM   848  C  CB  . ASN A 1 172 ? 12.155  -58.362 114.717 1.00 51.06 ? 172 ASN A CB  1 
ATOM   849  C  CG  . ASN A 1 172 ? 12.984  -59.375 114.003 1.00 51.34 ? 172 ASN A CG  1 
ATOM   850  O  OD1 . ASN A 1 172 ? 12.448  -60.422 113.555 1.00 51.89 ? 172 ASN A OD1 1 
ATOM   851  N  ND2 . ASN A 1 172 ? 14.279  -59.111 113.903 1.00 51.69 ? 172 ASN A ND2 1 
ATOM   852  N  N   . ASN A 1 173 ? 12.328  -55.577 113.887 1.00 55.59 ? 173 ASN A N   1 
ATOM   853  C  CA  . ASN A 1 173 ? 12.335  -54.597 112.824 1.00 58.03 ? 173 ASN A CA  1 
ATOM   854  C  C   . ASN A 1 173 ? 12.333  -55.353 111.481 1.00 59.06 ? 173 ASN A C   1 
ATOM   855  O  O   . ASN A 1 173 ? 13.130  -55.067 110.606 1.00 60.01 ? 173 ASN A O   1 
ATOM   856  C  CB  . ASN A 1 173 ? 13.507  -53.624 112.844 1.00 59.45 ? 173 ASN A CB  1 
ATOM   857  C  CG  . ASN A 1 173 ? 12.936  -52.271 112.391 1.00 60.97 ? 173 ASN A CG  1 
ATOM   858  O  OD1 . ASN A 1 173 ? 13.699  -51.345 112.127 1.00 62.09 ? 173 ASN A OD1 1 
ATOM   859  N  ND2 . ASN A 1 173 ? 11.595  -52.227 112.330 1.00 61.50 ? 173 ASN A ND2 1 
ATOM   860  N  N   . THR A 1 174 ? 11.442  -56.267 111.467 1.00 59.74 ? 174 THR A N   1 
ATOM   861  C  CA  . THR A 1 174 ? 11.228  -57.153 110.305 1.00 60.47 ? 174 THR A CA  1 
ATOM   862  C  C   . THR A 1 174 ? 9.931   -56.705 109.719 1.00 61.70 ? 174 THR A C   1 
ATOM   863  O  O   . THR A 1 174 ? 9.082   -56.124 110.436 1.00 61.65 ? 174 THR A O   1 
ATOM   864  C  CB  . THR A 1 174 ? 11.458  -58.567 110.934 1.00 60.26 ? 174 THR A CB  1 
ATOM   865  O  OG1 . THR A 1 174 ? 12.946  -58.586 110.833 1.00 60.12 ? 174 THR A OG1 1 
ATOM   866  C  CG2 . THR A 1 174 ? 10.804  -59.799 110.339 1.00 60.27 ? 174 THR A CG2 1 
ATOM   867  N  N   . LYS A 1 175 ? 9.795   -56.881 108.409 1.00 63.39 ? 175 LYS A N   1 
ATOM   868  C  CA  . LYS A 1 175 ? 8.519   -56.519 107.772 1.00 64.83 ? 175 LYS A CA  1 
ATOM   869  C  C   . LYS A 1 175 ? 7.809   -57.914 107.845 1.00 64.58 ? 175 LYS A C   1 
ATOM   870  O  O   . LYS A 1 175 ? 8.375   -58.898 107.328 1.00 64.88 ? 175 LYS A O   1 
ATOM   871  C  CB  . LYS A 1 175 ? 8.409   -56.014 106.386 1.00 66.48 ? 175 LYS A CB  1 
ATOM   872  C  CG  . LYS A 1 175 ? 6.895   -55.702 106.088 1.00 68.36 ? 175 LYS A CG  1 
ATOM   873  C  CD  . LYS A 1 175 ? 6.748   -54.409 105.288 1.00 69.97 ? 175 LYS A CD  1 
ATOM   874  C  CE  . LYS A 1 175 ? 6.835   -53.127 106.113 1.00 71.03 ? 175 LYS A CE  1 
ATOM   875  N  NZ  . LYS A 1 175 ? 6.219   -51.951 105.358 1.00 71.51 ? 175 LYS A NZ  1 
ATOM   876  N  N   . CYS A 1 176 ? 6.688   -57.844 108.544 1.00 63.89 ? 176 CYS A N   1 
ATOM   877  C  CA  . CYS A 1 176 ? 5.980   -59.168 108.700 1.00 63.06 ? 176 CYS A CA  1 
ATOM   878  C  C   . CYS A 1 176 ? 4.477   -58.857 108.624 1.00 64.05 ? 176 CYS A C   1 
ATOM   879  O  O   . CYS A 1 176 ? 3.891   -58.184 109.465 1.00 64.31 ? 176 CYS A O   1 
ATOM   880  C  CB  . CYS A 1 176 ? 6.426   -59.957 109.887 1.00 60.61 ? 176 CYS A CB  1 
ATOM   881  S  SG  . CYS A 1 176 ? 7.609   -59.627 111.176 1.00 58.02 ? 176 CYS A SG  1 
ATOM   882  N  N   . PRO A 1 177 ? 3.928   -59.381 107.536 1.00 65.22 ? 177 PRO A N   1 
ATOM   883  C  CA  . PRO A 1 177 ? 2.537   -59.304 107.164 1.00 65.97 ? 177 PRO A CA  1 
ATOM   884  C  C   . PRO A 1 177 ? 1.565   -59.979 108.091 1.00 66.49 ? 177 PRO A C   1 
ATOM   885  O  O   . PRO A 1 177 ? 0.598   -60.605 107.583 1.00 66.92 ? 177 PRO A O   1 
ATOM   886  C  CB  . PRO A 1 177 ? 2.475   -60.112 105.831 1.00 65.96 ? 177 PRO A CB  1 
ATOM   887  C  CG  . PRO A 1 177 ? 3.572   -61.174 106.108 1.00 65.61 ? 177 PRO A CG  1 
ATOM   888  C  CD  . PRO A 1 177 ? 4.710   -60.202 106.527 1.00 65.52 ? 177 PRO A CD  1 
ATOM   889  N  N   . ASP A 1 178 ? 1.854   -59.916 109.363 1.00 66.86 ? 178 ASP A N   1 
ATOM   890  C  CA  . ASP A 1 178 ? 0.947   -60.621 110.386 1.00 66.67 ? 178 ASP A CA  1 
ATOM   891  C  C   . ASP A 1 178 ? 1.360   -59.959 111.719 1.00 65.81 ? 178 ASP A C   1 
ATOM   892  O  O   . ASP A 1 178 ? 2.419   -59.831 112.313 1.00 65.45 ? 178 ASP A O   1 
ATOM   893  C  CB  . ASP A 1 178 ? 0.990   -62.065 110.046 1.00 67.24 ? 178 ASP A CB  1 
ATOM   894  C  CG  . ASP A 1 178 ? 2.082   -63.006 110.304 1.00 67.86 ? 178 ASP A CG  1 
ATOM   895  O  OD1 . ASP A 1 178 ? 3.219   -62.651 110.663 1.00 68.24 ? 178 ASP A OD1 1 
ATOM   896  O  OD2 . ASP A 1 178 ? 1.806   -64.237 110.159 1.00 68.23 ? 178 ASP A OD2 1 
ATOM   897  N  N   . THR A 1 179 ? 0.372   -59.318 112.220 1.00 65.04 ? 179 THR A N   1 
ATOM   898  C  CA  . THR A 1 179 ? -0.097  -58.489 113.258 1.00 64.27 ? 179 THR A CA  1 
ATOM   899  C  C   . THR A 1 179 ? -1.466  -59.112 113.617 1.00 62.71 ? 179 THR A C   1 
ATOM   900  O  O   . THR A 1 179 ? -2.377  -58.734 114.335 1.00 62.69 ? 179 THR A O   1 
ATOM   901  C  CB  . THR A 1 179 ? -0.246  -56.998 112.769 1.00 64.97 ? 179 THR A CB  1 
ATOM   902  O  OG1 . THR A 1 179 ? 1.015   -56.684 112.052 1.00 65.14 ? 179 THR A OG1 1 
ATOM   903  C  CG2 . THR A 1 179 ? -0.562  -55.964 113.856 1.00 65.31 ? 179 THR A CG2 1 
ATOM   904  N  N   . SER A 1 180 ? -1.464  -60.232 112.870 1.00 60.35 ? 180 SER A N   1 
ATOM   905  C  CA  . SER A 1 180 ? -2.532  -61.204 112.852 1.00 57.99 ? 180 SER A CA  1 
ATOM   906  C  C   . SER A 1 180 ? -3.180  -61.021 114.220 1.00 55.31 ? 180 SER A C   1 
ATOM   907  O  O   . SER A 1 180 ? -4.342  -60.743 114.392 1.00 55.48 ? 180 SER A O   1 
ATOM   908  C  CB  . SER A 1 180 ? -1.922  -62.567 112.615 1.00 59.00 ? 180 SER A CB  1 
ATOM   909  O  OG  . SER A 1 180 ? -1.277  -62.652 111.322 1.00 59.65 ? 180 SER A OG  1 
ATOM   910  N  N   . ARG A 1 181 ? -2.315  -61.139 115.178 1.00 51.82 ? 181 ARG A N   1 
ATOM   911  C  CA  . ARG A 1 181 ? -2.399  -61.069 116.590 1.00 48.35 ? 181 ARG A CA  1 
ATOM   912  C  C   . ARG A 1 181 ? -0.988  -60.668 117.041 1.00 45.08 ? 181 ARG A C   1 
ATOM   913  O  O   . ARG A 1 181 ? -0.039  -61.160 116.435 1.00 45.59 ? 181 ARG A O   1 
ATOM   914  C  CB  . ARG A 1 181 ? -2.612  -62.381 117.332 1.00 49.39 ? 181 ARG A CB  1 
ATOM   915  C  CG  . ARG A 1 181 ? -1.520  -63.350 116.792 1.00 50.59 ? 181 ARG A CG  1 
ATOM   916  C  CD  . ARG A 1 181 ? -2.106  -63.998 115.547 1.00 51.40 ? 181 ARG A CD  1 
ATOM   917  N  NE  . ARG A 1 181 ? -2.721  -65.242 116.050 1.00 52.65 ? 181 ARG A NE  1 
ATOM   918  C  CZ  . ARG A 1 181 ? -2.007  -66.374 116.218 1.00 53.19 ? 181 ARG A CZ  1 
ATOM   919  N  NH1 . ARG A 1 181 ? -0.725  -66.547 115.898 1.00 53.13 ? 181 ARG A NH1 1 
ATOM   920  N  NH2 . ARG A 1 181 ? -2.675  -67.418 116.757 1.00 53.86 ? 181 ARG A NH2 1 
ATOM   921  N  N   . ALA A 1 182 ? -0.891  -59.892 118.018 1.00 40.99 ? 182 ALA A N   1 
ATOM   922  C  CA  . ALA A 1 182 ? 0.419   -59.394 118.459 1.00 37.04 ? 182 ALA A CA  1 
ATOM   923  C  C   . ALA A 1 182 ? -0.033  -58.466 119.546 1.00 34.61 ? 182 ALA A C   1 
ATOM   924  O  O   . ALA A 1 182 ? -0.819  -57.575 119.117 1.00 34.07 ? 182 ALA A O   1 
ATOM   925  C  CB  . ALA A 1 182 ? 1.028   -58.723 117.275 1.00 36.45 ? 182 ALA A CB  1 
ATOM   926  N  N   . ILE A 1 183 ? 0.389   -58.764 120.748 1.00 31.49 ? 183 ILE A N   1 
ATOM   927  C  CA  . ILE A 1 183 ? -0.148  -57.819 121.781 1.00 28.58 ? 183 ILE A CA  1 
ATOM   928  C  C   . ILE A 1 183 ? 0.663   -56.546 121.628 1.00 26.40 ? 183 ILE A C   1 
ATOM   929  O  O   . ILE A 1 183 ? 1.686   -56.381 122.340 1.00 27.01 ? 183 ILE A O   1 
ATOM   930  C  CB  . ILE A 1 183 ? -0.182  -58.479 123.158 1.00 28.59 ? 183 ILE A CB  1 
ATOM   931  C  CG1 . ILE A 1 183 ? -0.233  -60.020 123.078 1.00 28.39 ? 183 ILE A CG1 1 
ATOM   932  C  CG2 . ILE A 1 183 ? -1.427  -57.920 123.918 1.00 28.67 ? 183 ILE A CG2 1 
ATOM   933  C  CD1 . ILE A 1 183 ? -1.614  -60.510 122.543 1.00 28.21 ? 183 ILE A CD1 1 
ATOM   934  N  N   . THR A 1 184 ? 0.176   -55.717 120.693 1.00 22.98 ? 184 THR A N   1 
ATOM   935  C  CA  . THR A 1 184 ? 0.917   -54.447 120.496 1.00 20.00 ? 184 THR A CA  1 
ATOM   936  C  C   . THR A 1 184 ? 0.045   -53.237 120.515 1.00 17.86 ? 184 THR A C   1 
ATOM   937  O  O   . THR A 1 184 ? -1.113  -53.280 120.065 1.00 17.90 ? 184 THR A O   1 
ATOM   938  C  CB  . THR A 1 184 ? 1.779   -54.583 119.193 1.00 20.05 ? 184 THR A CB  1 
ATOM   939  O  OG1 . THR A 1 184 ? 3.110   -54.149 119.708 1.00 20.99 ? 184 THR A OG1 1 
ATOM   940  C  CG2 . THR A 1 184 ? 1.350   -53.798 117.997 1.00 19.97 ? 184 THR A CG2 1 
ATOM   941  N  N   . ILE A 1 185 ? 0.577   -52.154 121.056 1.00 15.66 ? 185 ILE A N   1 
ATOM   942  C  CA  . ILE A 1 185 ? -0.238  -50.920 121.125 1.00 14.33 ? 185 ILE A CA  1 
ATOM   943  C  C   . ILE A 1 185 ? 0.652   -49.788 120.735 1.00 15.35 ? 185 ILE A C   1 
ATOM   944  O  O   . ILE A 1 185 ? 1.668   -49.679 121.473 1.00 16.49 ? 185 ILE A O   1 
ATOM   945  C  CB  . ILE A 1 185 ? -0.842  -50.762 122.546 1.00 12.80 ? 185 ILE A CB  1 
ATOM   946  C  CG1 . ILE A 1 185 ? -1.933  -49.667 122.488 1.00 11.17 ? 185 ILE A CG1 1 
ATOM   947  C  CG2 . ILE A 1 185 ? 0.205   -50.460 123.634 1.00 11.91 ? 185 ILE A CG2 1 
ATOM   948  C  CD1 . ILE A 1 185 ? -2.647  -49.394 123.810 1.00 9.88  ? 185 ILE A CD1 1 
ATOM   949  N  N   . ALA A 1 186 ? 0.323   -49.059 119.710 1.00 15.31 ? 186 ALA A N   1 
ATOM   950  C  CA  . ALA A 1 186 ? 1.178   -47.906 119.249 1.00 14.80 ? 186 ALA A CA  1 
ATOM   951  C  C   . ALA A 1 186 ? 0.523   -46.620 119.666 1.00 15.14 ? 186 ALA A C   1 
ATOM   952  O  O   . ALA A 1 186 ? -0.728  -46.698 119.684 1.00 15.24 ? 186 ALA A O   1 
ATOM   953  C  CB  . ALA A 1 186 ? 1.325   -48.118 117.782 1.00 14.64 ? 186 ALA A CB  1 
ATOM   954  N  N   . LEU A 1 187 ? 1.194   -45.533 120.005 1.00 15.56 ? 187 LEU A N   1 
ATOM   955  C  CA  . LEU A 1 187 ? 0.500   -44.301 120.461 1.00 16.22 ? 187 LEU A CA  1 
ATOM   956  C  C   . LEU A 1 187 ? -0.066  -43.546 119.287 1.00 18.71 ? 187 LEU A C   1 
ATOM   957  O  O   . LEU A 1 187 ? 0.453   -43.719 118.174 1.00 19.83 ? 187 LEU A O   1 
ATOM   958  C  CB  . LEU A 1 187 ? 1.479   -43.485 121.302 1.00 13.93 ? 187 LEU A CB  1 
ATOM   959  C  CG  . LEU A 1 187 ? 1.065   -42.032 121.544 1.00 11.70 ? 187 LEU A CG  1 
ATOM   960  C  CD1 . LEU A 1 187 ? -0.123  -41.974 122.484 1.00 11.16 ? 187 LEU A CD1 1 
ATOM   961  C  CD2 . LEU A 1 187 ? 2.217   -41.297 122.157 1.00 10.54 ? 187 LEU A CD2 1 
ATOM   962  N  N   . ASP A 1 188 ? -1.102  -42.793 119.497 1.00 21.68 ? 188 ASP A N   1 
ATOM   963  C  CA  . ASP A 1 188 ? -1.778  -42.010 118.415 1.00 24.27 ? 188 ASP A CA  1 
ATOM   964  C  C   . ASP A 1 188 ? -1.030  -40.690 118.387 1.00 26.42 ? 188 ASP A C   1 
ATOM   965  O  O   . ASP A 1 188 ? -1.609  -39.641 118.710 1.00 27.26 ? 188 ASP A O   1 
ATOM   966  C  CB  . ASP A 1 188 ? -3.236  -41.970 118.715 1.00 24.46 ? 188 ASP A CB  1 
ATOM   967  C  CG  . ASP A 1 188 ? -3.722  -41.359 119.990 1.00 25.23 ? 188 ASP A CG  1 
ATOM   968  O  OD1 . ASP A 1 188 ? -4.792  -40.677 119.978 1.00 25.92 ? 188 ASP A OD1 1 
ATOM   969  O  OD2 . ASP A 1 188 ? -3.125  -41.487 121.077 1.00 25.18 ? 188 ASP A OD2 1 
ATOM   970  N  N   . THR A 1 189 ? 0.227   -40.769 118.057 1.00 28.59 ? 189 THR A N   1 
ATOM   971  C  CA  . THR A 1 189 ? 1.142   -39.627 118.071 1.00 30.90 ? 189 THR A CA  1 
ATOM   972  C  C   . THR A 1 189 ? 0.789   -38.357 117.383 1.00 31.85 ? 189 THR A C   1 
ATOM   973  O  O   . THR A 1 189 ? 1.665   -37.512 117.103 1.00 31.90 ? 189 THR A O   1 
ATOM   974  C  CB  . THR A 1 189 ? 2.524   -40.211 117.478 1.00 31.58 ? 189 THR A CB  1 
ATOM   975  O  OG1 . THR A 1 189 ? 3.476   -39.184 117.925 1.00 32.81 ? 189 THR A OG1 1 
ATOM   976  C  CG2 . THR A 1 189 ? 2.526   -40.473 116.002 1.00 31.87 ? 189 THR A CG2 1 
ATOM   977  N  N   . ASN A 1 190 ? -0.426  -38.074 117.101 1.00 34.05 ? 190 ASN A N   1 
ATOM   978  C  CA  . ASN A 1 190 ? -1.000  -36.958 116.444 1.00 35.90 ? 190 ASN A CA  1 
ATOM   979  C  C   . ASN A 1 190 ? -1.868  -35.978 117.208 1.00 35.78 ? 190 ASN A C   1 
ATOM   980  O  O   . ASN A 1 190 ? -2.063  -34.857 116.826 1.00 35.85 ? 190 ASN A O   1 
ATOM   981  C  CB  . ASN A 1 190 ? -2.172  -37.504 115.551 1.00 37.75 ? 190 ASN A CB  1 
ATOM   982  C  CG  . ASN A 1 190 ? -1.678  -37.807 114.178 1.00 39.55 ? 190 ASN A CG  1 
ATOM   983  O  OD1 . ASN A 1 190 ? -2.455  -38.528 113.490 1.00 40.75 ? 190 ASN A OD1 1 
ATOM   984  N  ND2 . ASN A 1 190 ? -0.486  -37.279 113.911 1.00 40.14 ? 190 ASN A ND2 1 
ATOM   985  N  N   . GLU A 1 191 ? -2.465  -36.663 118.173 1.00 35.49 ? 191 GLU A N   1 
ATOM   986  C  CA  . GLU A 1 191 ? -3.472  -36.041 119.040 1.00 35.16 ? 191 GLU A CA  1 
ATOM   987  C  C   . GLU A 1 191 ? -2.897  -35.752 120.396 1.00 34.62 ? 191 GLU A C   1 
ATOM   988  O  O   . GLU A 1 191 ? -3.631  -35.833 121.395 1.00 35.05 ? 191 GLU A O   1 
ATOM   989  C  CB  . GLU A 1 191 ? -4.601  -37.010 119.091 1.00 35.40 ? 191 GLU A CB  1 
ATOM   990  C  CG  . GLU A 1 191 ? -5.653  -37.417 118.174 1.00 35.48 ? 191 GLU A CG  1 
ATOM   991  C  CD  . GLU A 1 191 ? -5.871  -36.928 116.813 1.00 35.45 ? 191 GLU A CD  1 
ATOM   992  O  OE1 . GLU A 1 191 ? -6.192  -37.638 115.868 1.00 35.74 ? 191 GLU A OE1 1 
ATOM   993  O  OE2 . GLU A 1 191 ? -5.690  -35.693 116.737 1.00 35.63 ? 191 GLU A OE2 1 
ATOM   994  N  N   . VAL A 1 192 ? -1.618  -35.419 120.415 1.00 34.03 ? 192 VAL A N   1 
ATOM   995  C  CA  . VAL A 1 192 ? -0.994  -35.102 121.754 1.00 33.64 ? 192 VAL A CA  1 
ATOM   996  C  C   . VAL A 1 192 ? -1.326  -33.661 122.051 1.00 33.17 ? 192 VAL A C   1 
ATOM   997  O  O   . VAL A 1 192 ? -1.445  -32.868 121.100 1.00 33.33 ? 192 VAL A O   1 
ATOM   998  C  CB  . VAL A 1 192 ? 0.458   -35.527 121.667 1.00 33.33 ? 192 VAL A CB  1 
ATOM   999  C  CG1 . VAL A 1 192 ? 0.601   -37.040 121.709 1.00 32.93 ? 192 VAL A CG1 1 
ATOM   1000 C  CG2 . VAL A 1 192 ? 1.061   -34.922 120.426 1.00 33.47 ? 192 VAL A CG2 1 
ATOM   1001 N  N   . SER A 1 193 ? -1.511  -33.321 123.280 1.00 33.16 ? 193 SER A N   1 
ATOM   1002 C  CA  . SER A 1 193 ? -1.862  -31.980 123.665 1.00 34.52 ? 193 SER A CA  1 
ATOM   1003 C  C   . SER A 1 193 ? -0.901  -30.890 123.257 1.00 34.32 ? 193 SER A C   1 
ATOM   1004 O  O   . SER A 1 193 ? -1.311  -29.866 122.733 1.00 34.04 ? 193 SER A O   1 
ATOM   1005 C  CB  . SER A 1 193 ? -1.942  -31.910 125.221 1.00 35.99 ? 193 SER A CB  1 
ATOM   1006 O  OG  . SER A 1 193 ? -3.019  -32.831 125.546 1.00 38.16 ? 193 SER A OG  1 
ATOM   1007 N  N   . GLU A 1 194 ? 0.334   -31.137 123.594 1.00 34.67 ? 194 GLU A N   1 
ATOM   1008 C  CA  . GLU A 1 194 ? 1.458   -30.222 123.409 1.00 35.03 ? 194 GLU A CA  1 
ATOM   1009 C  C   . GLU A 1 194 ? 2.246   -30.533 122.197 1.00 34.83 ? 194 GLU A C   1 
ATOM   1010 O  O   . GLU A 1 194 ? 2.371   -31.678 121.778 1.00 34.90 ? 194 GLU A O   1 
ATOM   1011 C  CB  . GLU A 1 194 ? 2.352   -30.279 124.664 1.00 36.68 ? 194 GLU A CB  1 
ATOM   1012 C  CG  . GLU A 1 194 ? 1.371   -29.919 125.923 1.00 38.21 ? 194 GLU A CG  1 
ATOM   1013 C  CD  . GLU A 1 194 ? 0.978   -28.478 125.629 1.00 38.54 ? 194 GLU A CD  1 
ATOM   1014 O  OE1 . GLU A 1 194 ? 0.118   -28.138 124.833 1.00 39.30 ? 194 GLU A OE1 1 
ATOM   1015 O  OE2 . GLU A 1 194 ? 1.770   -27.784 126.268 1.00 38.95 ? 194 GLU A OE2 1 
ATOM   1016 N  N   . LYS A 1 195 ? 2.736   -29.420 121.643 1.00 35.03 ? 195 LYS A N   1 
ATOM   1017 C  CA  . LYS A 1 195 ? 3.507   -29.517 120.354 1.00 34.31 ? 195 LYS A CA  1 
ATOM   1018 C  C   . LYS A 1 195 ? 4.652   -30.469 120.589 1.00 32.25 ? 195 LYS A C   1 
ATOM   1019 O  O   . LYS A 1 195 ? 4.861   -31.454 119.889 1.00 31.62 ? 195 LYS A O   1 
ATOM   1020 C  CB  . LYS A 1 195 ? 3.855   -28.138 119.888 1.00 36.71 ? 195 LYS A CB  1 
ATOM   1021 C  CG  . LYS A 1 195 ? 3.417   -27.782 118.454 1.00 39.60 ? 195 LYS A CG  1 
ATOM   1022 C  CD  . LYS A 1 195 ? 3.231   -26.254 118.292 1.00 42.13 ? 195 LYS A CD  1 
ATOM   1023 C  CE  . LYS A 1 195 ? 3.139   -25.757 116.854 1.00 43.89 ? 195 LYS A CE  1 
ATOM   1024 N  NZ  . LYS A 1 195 ? 2.356   -24.448 116.682 1.00 44.72 ? 195 LYS A NZ  1 
ATOM   1025 N  N   . ARG A 1 196 ? 5.353   -30.143 121.645 1.00 30.16 ? 196 ARG A N   1 
ATOM   1026 C  CA  . ARG A 1 196 ? 6.489   -30.867 122.143 1.00 28.28 ? 196 ARG A CA  1 
ATOM   1027 C  C   . ARG A 1 196 ? 6.349   -30.809 123.670 1.00 25.93 ? 196 ARG A C   1 
ATOM   1028 O  O   . ARG A 1 196 ? 5.556   -30.020 124.165 1.00 25.34 ? 196 ARG A O   1 
ATOM   1029 C  CB  . ARG A 1 196 ? 7.860   -30.318 121.811 1.00 29.94 ? 196 ARG A CB  1 
ATOM   1030 C  CG  . ARG A 1 196 ? 7.756   -28.820 121.483 1.00 31.84 ? 196 ARG A CG  1 
ATOM   1031 C  CD  . ARG A 1 196 ? 7.254   -28.717 120.061 1.00 33.59 ? 196 ARG A CD  1 
ATOM   1032 N  NE  . ARG A 1 196 ? 8.099   -29.307 119.108 1.00 35.01 ? 196 ARG A NE  1 
ATOM   1033 C  CZ  . ARG A 1 196 ? 8.341   -29.310 117.827 1.00 35.83 ? 196 ARG A CZ  1 
ATOM   1034 N  NH1 . ARG A 1 196 ? 7.743   -28.841 116.747 1.00 35.45 ? 196 ARG A NH1 1 
ATOM   1035 N  NH2 . ARG A 1 196 ? 9.563   -29.885 117.560 1.00 37.06 ? 196 ARG A NH2 1 
ATOM   1036 N  N   . TYR A 1 197 ? 7.136   -31.650 124.240 1.00 23.44 ? 197 TYR A N   1 
ATOM   1037 C  CA  . TYR A 1 197 ? 7.255   -31.884 125.622 1.00 21.13 ? 197 TYR A CA  1 
ATOM   1038 C  C   . TYR A 1 197 ? 8.685   -31.792 126.035 1.00 20.13 ? 197 TYR A C   1 
ATOM   1039 O  O   . TYR A 1 197 ? 9.497   -32.158 125.185 1.00 20.59 ? 197 TYR A O   1 
ATOM   1040 C  CB  . TYR A 1 197 ? 6.826   -33.373 125.969 1.00 20.70 ? 197 TYR A CB  1 
ATOM   1041 C  CG  . TYR A 1 197 ? 5.343   -33.453 125.776 1.00 20.10 ? 197 TYR A CG  1 
ATOM   1042 C  CD1 . TYR A 1 197 ? 4.491   -33.212 126.854 1.00 20.48 ? 197 TYR A CD1 1 
ATOM   1043 C  CD2 . TYR A 1 197 ? 4.808   -33.728 124.549 1.00 20.49 ? 197 TYR A CD2 1 
ATOM   1044 C  CE1 . TYR A 1 197 ? 3.115   -33.237 126.698 1.00 21.11 ? 197 TYR A CE1 1 
ATOM   1045 C  CE2 . TYR A 1 197 ? 3.418   -33.784 124.345 1.00 21.02 ? 197 TYR A CE2 1 
ATOM   1046 C  CZ  . TYR A 1 197 ? 2.594   -33.518 125.419 1.00 21.48 ? 197 TYR A CZ  1 
ATOM   1047 O  OH  . TYR A 1 197 ? 1.241   -33.536 125.226 1.00 22.39 ? 197 TYR A OH  1 
ATOM   1048 N  N   . PRO A 1 198 ? 8.882   -31.398 127.246 1.00 19.61 ? 198 PRO A N   1 
ATOM   1049 C  CA  . PRO A 1 198 ? 10.214  -31.323 127.839 1.00 19.51 ? 198 PRO A CA  1 
ATOM   1050 C  C   . PRO A 1 198 ? 10.587  -32.631 128.464 1.00 20.31 ? 198 PRO A C   1 
ATOM   1051 O  O   . PRO A 1 198 ? 9.720   -33.517 128.751 1.00 20.73 ? 198 PRO A O   1 
ATOM   1052 C  CB  . PRO A 1 198 ? 10.013  -30.236 128.865 1.00 19.11 ? 198 PRO A CB  1 
ATOM   1053 C  CG  . PRO A 1 198 ? 8.705   -30.675 129.467 1.00 19.12 ? 198 PRO A CG  1 
ATOM   1054 C  CD  . PRO A 1 198 ? 7.864   -30.968 128.223 1.00 19.49 ? 198 PRO A CD  1 
ATOM   1055 N  N   . PHE A 1 199 ? 11.884  -32.752 128.677 1.00 20.76 ? 199 PHE A N   1 
ATOM   1056 C  CA  . PHE A 1 199 ? 12.496  -33.893 129.309 1.00 20.67 ? 199 PHE A CA  1 
ATOM   1057 C  C   . PHE A 1 199 ? 12.141  -33.778 130.803 1.00 19.97 ? 199 PHE A C   1 
ATOM   1058 O  O   . PHE A 1 199 ? 12.629  -32.783 131.369 1.00 20.66 ? 199 PHE A O   1 
ATOM   1059 C  CB  . PHE A 1 199 ? 14.011  -33.987 129.272 1.00 22.22 ? 199 PHE A CB  1 
ATOM   1060 C  CG  . PHE A 1 199 ? 14.442  -35.378 129.612 1.00 23.88 ? 199 PHE A CG  1 
ATOM   1061 C  CD1 . PHE A 1 199 ? 15.730  -35.813 129.331 1.00 25.17 ? 199 PHE A CD1 1 
ATOM   1062 C  CD2 . PHE A 1 199 ? 13.559  -36.282 130.157 1.00 24.47 ? 199 PHE A CD2 1 
ATOM   1063 C  CE1 . PHE A 1 199 ? 16.120  -37.124 129.603 1.00 24.94 ? 199 PHE A CE1 1 
ATOM   1064 C  CE2 . PHE A 1 199 ? 13.948  -37.580 130.432 1.00 24.99 ? 199 PHE A CE2 1 
ATOM   1065 C  CZ  . PHE A 1 199 ? 15.247  -38.006 130.138 1.00 24.68 ? 199 PHE A CZ  1 
ATOM   1066 N  N   . LYS A 1 200 ? 11.378  -34.694 131.327 1.00 19.24 ? 200 LYS A N   1 
ATOM   1067 C  CA  . LYS A 1 200 ? 11.119  -34.584 132.791 1.00 18.56 ? 200 LYS A CA  1 
ATOM   1068 C  C   . LYS A 1 200 ? 11.654  -35.945 133.305 1.00 19.42 ? 200 LYS A C   1 
ATOM   1069 O  O   . LYS A 1 200 ? 11.516  -36.990 132.682 1.00 19.48 ? 200 LYS A O   1 
ATOM   1070 C  CB  . LYS A 1 200 ? 9.751   -34.287 133.241 1.00 17.28 ? 200 LYS A CB  1 
ATOM   1071 C  CG  . LYS A 1 200 ? 9.378   -32.814 133.273 1.00 16.46 ? 200 LYS A CG  1 
ATOM   1072 C  CD  . LYS A 1 200 ? 10.538  -31.835 133.332 1.00 15.92 ? 200 LYS A CD  1 
ATOM   1073 C  CE  . LYS A 1 200 ? 11.139  -31.608 134.631 1.00 15.93 ? 200 LYS A CE  1 
ATOM   1074 N  NZ  . LYS A 1 200 ? 10.665  -30.500 135.462 1.00 15.73 ? 200 LYS A NZ  1 
ATOM   1075 N  N   . THR A 1 201 ? 12.283  -35.779 134.423 1.00 20.38 ? 201 THR A N   1 
ATOM   1076 C  CA  . THR A 1 201 ? 12.891  -36.798 135.233 1.00 20.54 ? 201 THR A CA  1 
ATOM   1077 C  C   . THR A 1 201 ? 11.907  -37.223 136.318 1.00 20.43 ? 201 THR A C   1 
ATOM   1078 O  O   . THR A 1 201 ? 11.488  -36.366 137.125 1.00 20.86 ? 201 THR A O   1 
ATOM   1079 C  CB  . THR A 1 201 ? 14.230  -36.273 135.876 1.00 20.67 ? 201 THR A CB  1 
ATOM   1080 O  OG1 . THR A 1 201 ? 14.525  -37.318 136.859 1.00 21.61 ? 201 THR A OG1 1 
ATOM   1081 C  CG2 . THR A 1 201 ? 14.208  -34.943 136.584 1.00 20.44 ? 201 THR A CG2 1 
ATOM   1082 N  N   . ALA A 1 202 ? 11.541  -38.439 136.353 1.00 20.83 ? 202 ALA A N   1 
ATOM   1083 C  CA  . ALA A 1 202 ? 10.590  -39.048 137.291 1.00 21.69 ? 202 ALA A CA  1 
ATOM   1084 C  C   . ALA A 1 202 ? 10.362  -38.281 138.576 1.00 22.50 ? 202 ALA A C   1 
ATOM   1085 O  O   . ALA A 1 202 ? 9.312   -37.702 138.893 1.00 22.70 ? 202 ALA A O   1 
ATOM   1086 C  CB  . ALA A 1 202 ? 11.087  -40.453 137.646 1.00 21.07 ? 202 ALA A CB  1 
ATOM   1087 N  N   . THR A 1 203 ? 11.441  -38.324 139.358 1.00 23.33 ? 203 THR A N   1 
ATOM   1088 C  CA  . THR A 1 203 ? 11.339  -37.659 140.682 1.00 24.45 ? 203 THR A CA  1 
ATOM   1089 C  C   . THR A 1 203 ? 10.739  -36.292 140.512 1.00 23.61 ? 203 THR A C   1 
ATOM   1090 O  O   . THR A 1 203 ? 9.933   -35.962 141.401 1.00 23.81 ? 203 THR A O   1 
ATOM   1091 C  CB  . THR A 1 203 ? 12.723  -37.736 141.407 1.00 25.83 ? 203 THR A CB  1 
ATOM   1092 O  OG1 . THR A 1 203 ? 13.523  -36.638 140.875 1.00 27.72 ? 203 THR A OG1 1 
ATOM   1093 C  CG2 . THR A 1 203 ? 13.340  -39.125 141.189 1.00 26.52 ? 203 THR A CG2 1 
ATOM   1094 N  N   . ASP A 1 204 ? 11.073  -35.541 139.477 1.00 23.32 ? 204 ASP A N   1 
ATOM   1095 C  CA  . ASP A 1 204 ? 10.468  -34.173 139.365 1.00 22.24 ? 204 ASP A CA  1 
ATOM   1096 C  C   . ASP A 1 204 ? 8.975   -34.366 139.069 1.00 20.17 ? 204 ASP A C   1 
ATOM   1097 O  O   . ASP A 1 204 ? 8.054   -33.982 139.817 1.00 18.35 ? 204 ASP A O   1 
ATOM   1098 C  CB  . ASP A 1 204 ? 11.241  -33.281 138.392 1.00 23.59 ? 204 ASP A CB  1 
ATOM   1099 C  CG  . ASP A 1 204 ? 10.883  -31.836 138.655 1.00 25.43 ? 204 ASP A CG  1 
ATOM   1100 O  OD1 . ASP A 1 204 ? 11.689  -30.905 138.818 1.00 26.35 ? 204 ASP A OD1 1 
ATOM   1101 O  OD2 . ASP A 1 204 ? 9.670   -31.477 138.763 1.00 26.76 ? 204 ASP A OD2 1 
ATOM   1102 N  N   . TYR A 1 205 ? 8.738   -34.999 137.940 1.00 19.01 ? 205 TYR A N   1 
ATOM   1103 C  CA  . TYR A 1 205 ? 7.379   -35.293 137.524 1.00 18.99 ? 205 TYR A CA  1 
ATOM   1104 C  C   . TYR A 1 205 ? 6.480   -35.549 138.756 1.00 19.50 ? 205 TYR A C   1 
ATOM   1105 O  O   . TYR A 1 205 ? 5.460   -34.942 139.031 1.00 19.70 ? 205 TYR A O   1 
ATOM   1106 C  CB  . TYR A 1 205 ? 7.310   -36.538 136.681 1.00 18.03 ? 205 TYR A CB  1 
ATOM   1107 C  CG  . TYR A 1 205 ? 5.897   -36.867 136.314 1.00 18.04 ? 205 TYR A CG  1 
ATOM   1108 C  CD1 . TYR A 1 205 ? 5.299   -36.281 135.175 1.00 18.29 ? 205 TYR A CD1 1 
ATOM   1109 C  CD2 . TYR A 1 205 ? 5.149   -37.740 137.065 1.00 18.27 ? 205 TYR A CD2 1 
ATOM   1110 C  CE1 . TYR A 1 205 ? 3.989   -36.603 134.820 1.00 18.33 ? 205 TYR A CE1 1 
ATOM   1111 C  CE2 . TYR A 1 205 ? 3.831   -38.094 136.723 1.00 17.90 ? 205 TYR A CE2 1 
ATOM   1112 C  CZ  . TYR A 1 205 ? 3.269   -37.525 135.609 1.00 18.07 ? 205 TYR A CZ  1 
ATOM   1113 O  OH  . TYR A 1 205 ? 1.982   -37.845 135.316 1.00 18.79 ? 205 TYR A OH  1 
ATOM   1114 N  N   . ALA A 1 206 ? 6.946   -36.569 139.466 1.00 19.59 ? 206 ALA A N   1 
ATOM   1115 C  CA  . ALA A 1 206 ? 6.401   -37.109 140.683 1.00 18.96 ? 206 ALA A CA  1 
ATOM   1116 C  C   . ALA A 1 206 ? 5.906   -36.022 141.631 1.00 18.40 ? 206 ALA A C   1 
ATOM   1117 O  O   . ALA A 1 206 ? 4.756   -35.909 142.072 1.00 17.43 ? 206 ALA A O   1 
ATOM   1118 C  CB  . ALA A 1 206 ? 7.508   -37.890 141.392 1.00 19.63 ? 206 ALA A CB  1 
ATOM   1119 N  N   . THR A 1 207 ? 6.951   -35.213 141.896 1.00 17.92 ? 207 THR A N   1 
ATOM   1120 C  CA  . THR A 1 207 ? 6.832   -34.087 142.783 1.00 18.23 ? 207 THR A CA  1 
ATOM   1121 C  C   . THR A 1 207 ? 5.724   -33.092 142.418 1.00 18.42 ? 207 THR A C   1 
ATOM   1122 O  O   . THR A 1 207 ? 5.032   -32.606 143.273 1.00 17.47 ? 207 THR A O   1 
ATOM   1123 C  CB  . THR A 1 207 ? 8.147   -33.221 142.851 1.00 18.31 ? 207 THR A CB  1 
ATOM   1124 O  OG1 . THR A 1 207 ? 8.969   -33.755 143.883 1.00 18.70 ? 207 THR A OG1 1 
ATOM   1125 C  CG2 . THR A 1 207 ? 7.841   -31.727 143.095 1.00 18.77 ? 207 THR A CG2 1 
ATOM   1126 N  N   . ALA A 1 208 ? 5.752   -32.798 141.145 1.00 19.73 ? 208 ALA A N   1 
ATOM   1127 C  CA  . ALA A 1 208 ? 4.867   -31.838 140.521 1.00 20.60 ? 208 ALA A CA  1 
ATOM   1128 C  C   . ALA A 1 208 ? 3.435   -32.322 140.488 1.00 21.12 ? 208 ALA A C   1 
ATOM   1129 O  O   . ALA A 1 208 ? 2.446   -31.624 140.801 1.00 21.71 ? 208 ALA A O   1 
ATOM   1130 C  CB  . ALA A 1 208 ? 5.438   -31.616 139.123 1.00 20.58 ? 208 ALA A CB  1 
ATOM   1131 N  N   . VAL A 1 209 ? 3.336   -33.555 140.080 1.00 21.66 ? 209 VAL A N   1 
ATOM   1132 C  CA  . VAL A 1 209 ? 2.049   -34.245 139.925 1.00 22.50 ? 209 VAL A CA  1 
ATOM   1133 C  C   . VAL A 1 209 ? 1.370   -34.342 141.258 1.00 22.88 ? 209 VAL A C   1 
ATOM   1134 O  O   . VAL A 1 209 ? 0.180   -34.643 141.455 1.00 23.02 ? 209 VAL A O   1 
ATOM   1135 C  CB  . VAL A 1 209 ? 2.400   -35.623 139.317 1.00 22.61 ? 209 VAL A CB  1 
ATOM   1136 C  CG1 . VAL A 1 209 ? 1.328   -36.642 139.527 1.00 23.25 ? 209 VAL A CG1 1 
ATOM   1137 C  CG2 . VAL A 1 209 ? 2.687   -35.522 137.856 1.00 23.37 ? 209 VAL A CG2 1 
ATOM   1138 N  N   . GLY A 1 210 ? 2.256   -34.144 142.263 1.00 22.81 ? 210 GLY A N   1 
ATOM   1139 C  CA  . GLY A 1 210 ? 1.644   -34.317 143.614 1.00 22.80 ? 210 GLY A CA  1 
ATOM   1140 C  C   . GLY A 1 210 ? 1.274   -32.949 144.102 1.00 22.88 ? 210 GLY A C   1 
ATOM   1141 O  O   . GLY A 1 210 ? 0.925   -32.854 145.315 1.00 23.82 ? 210 GLY A O   1 
ATOM   1142 N  N   . VAL A 1 211 ? 1.409   -31.999 143.215 1.00 22.74 ? 211 VAL A N   1 
ATOM   1143 C  CA  . VAL A 1 211 ? 1.045   -30.645 143.753 1.00 23.58 ? 211 VAL A CA  1 
ATOM   1144 C  C   . VAL A 1 211 ? -0.449  -30.600 143.420 1.00 24.82 ? 211 VAL A C   1 
ATOM   1145 O  O   . VAL A 1 211 ? -1.338  -30.277 144.184 1.00 25.59 ? 211 VAL A O   1 
ATOM   1146 C  CB  . VAL A 1 211 ? 1.885   -29.575 143.169 1.00 23.44 ? 211 VAL A CB  1 
ATOM   1147 C  CG1 . VAL A 1 211 ? 1.181   -28.228 143.337 1.00 23.30 ? 211 VAL A CG1 1 
ATOM   1148 C  CG2 . VAL A 1 211 ? 3.285   -29.580 143.758 1.00 23.69 ? 211 VAL A CG2 1 
ATOM   1149 N  N   . ASN A 1 212 ? -0.572  -30.983 142.152 1.00 25.05 ? 212 ASN A N   1 
ATOM   1150 C  CA  . ASN A 1 212 ? -1.892  -31.090 141.517 1.00 24.65 ? 212 ASN A CA  1 
ATOM   1151 C  C   . ASN A 1 212 ? -1.563  -32.038 140.332 1.00 24.45 ? 212 ASN A C   1 
ATOM   1152 O  O   . ASN A 1 212 ? -0.596  -31.923 139.617 1.00 24.00 ? 212 ASN A O   1 
ATOM   1153 C  CB  . ASN A 1 212 ? -2.598  -29.806 141.158 1.00 24.34 ? 212 ASN A CB  1 
ATOM   1154 C  CG  . ASN A 1 212 ? -3.924  -30.317 140.532 1.00 23.96 ? 212 ASN A CG  1 
ATOM   1155 O  OD1 . ASN A 1 212 ? -3.717  -31.064 139.571 1.00 24.41 ? 212 ASN A OD1 1 
ATOM   1156 N  ND2 . ASN A 1 212 ? -5.052  -29.979 141.066 1.00 23.94 ? 212 ASN A ND2 1 
ATOM   1157 N  N   . ALA A 1 213 ? -2.471  -32.993 140.339 1.00 25.07 ? 213 ALA A N   1 
ATOM   1158 C  CA  . ALA A 1 213 ? -2.370  -34.082 139.354 1.00 25.22 ? 213 ALA A CA  1 
ATOM   1159 C  C   . ALA A 1 213 ? -2.844  -33.529 138.043 1.00 24.59 ? 213 ALA A C   1 
ATOM   1160 O  O   . ALA A 1 213 ? -3.669  -34.314 137.535 1.00 25.57 ? 213 ALA A O   1 
ATOM   1161 C  CB  . ALA A 1 213 ? -3.251  -35.262 139.715 1.00 25.81 ? 213 ALA A CB  1 
ATOM   1162 N  N   . ASN A 1 214 ? -2.440  -32.377 137.676 1.00 23.41 ? 214 ASN A N   1 
ATOM   1163 C  CA  . ASN A 1 214 ? -2.996  -31.834 136.408 1.00 22.10 ? 214 ASN A CA  1 
ATOM   1164 C  C   . ASN A 1 214 ? -1.820  -31.138 135.786 1.00 21.73 ? 214 ASN A C   1 
ATOM   1165 O  O   . ASN A 1 214 ? -1.990  -30.666 134.681 1.00 22.66 ? 214 ASN A O   1 
ATOM   1166 C  CB  . ASN A 1 214 ? -4.161  -30.926 136.680 1.00 21.54 ? 214 ASN A CB  1 
ATOM   1167 C  CG  . ASN A 1 214 ? -5.518  -31.417 136.298 1.00 21.67 ? 214 ASN A CG  1 
ATOM   1168 O  OD1 . ASN A 1 214 ? -6.562  -31.145 136.885 1.00 21.15 ? 214 ASN A OD1 1 
ATOM   1169 N  ND2 . ASN A 1 214 ? -5.598  -32.211 135.202 1.00 22.33 ? 214 ASN A ND2 1 
ATOM   1170 N  N   . ILE A 1 215 ? -0.780  -31.075 136.596 1.00 20.41 ? 215 ILE A N   1 
ATOM   1171 C  CA  . ILE A 1 215 ? 0.396   -30.390 136.029 1.00 19.28 ? 215 ILE A CA  1 
ATOM   1172 C  C   . ILE A 1 215 ? 0.979   -31.423 135.085 1.00 20.12 ? 215 ILE A C   1 
ATOM   1173 O  O   . ILE A 1 215 ? 1.362   -31.103 133.977 1.00 20.40 ? 215 ILE A O   1 
ATOM   1174 C  CB  . ILE A 1 215 ? 1.321   -29.860 137.118 1.00 18.12 ? 215 ILE A CB  1 
ATOM   1175 C  CG1 . ILE A 1 215 ? 0.533   -28.925 138.059 1.00 17.76 ? 215 ILE A CG1 1 
ATOM   1176 C  CG2 . ILE A 1 215 ? 2.555   -29.096 136.575 1.00 18.02 ? 215 ILE A CG2 1 
ATOM   1177 C  CD1 . ILE A 1 215 ? 1.417   -28.214 139.139 1.00 16.14 ? 215 ILE A CD1 1 
ATOM   1178 N  N   . GLY A 1 216 ? 1.021   -32.664 135.489 1.00 21.36 ? 216 GLY A N   1 
ATOM   1179 C  CA  . GLY A 1 216 ? 1.630   -33.737 134.648 1.00 22.82 ? 216 GLY A CA  1 
ATOM   1180 C  C   . GLY A 1 216 ? 1.173   -33.641 133.201 1.00 23.44 ? 216 GLY A C   1 
ATOM   1181 O  O   . GLY A 1 216 ? 1.884   -33.993 132.239 1.00 23.22 ? 216 GLY A O   1 
ATOM   1182 N  N   . ASN A 1 217 ? -0.053  -33.154 133.059 1.00 23.84 ? 217 ASN A N   1 
ATOM   1183 C  CA  . ASN A 1 217 ? -0.660  -32.995 131.734 1.00 24.10 ? 217 ASN A CA  1 
ATOM   1184 C  C   . ASN A 1 217 ? 0.131   -32.109 130.785 1.00 24.01 ? 217 ASN A C   1 
ATOM   1185 O  O   . ASN A 1 217 ? -0.126  -32.120 129.575 1.00 24.53 ? 217 ASN A O   1 
ATOM   1186 C  CB  . ASN A 1 217 ? -2.014  -32.437 132.022 1.00 25.10 ? 217 ASN A CB  1 
ATOM   1187 C  CG  . ASN A 1 217 ? -3.120  -33.414 132.045 1.00 26.75 ? 217 ASN A CG  1 
ATOM   1188 O  OD1 . ASN A 1 217 ? -3.172  -34.637 132.224 1.00 27.40 ? 217 ASN A OD1 1 
ATOM   1189 N  ND2 . ASN A 1 217 ? -4.315  -32.770 131.816 1.00 28.12 ? 217 ASN A ND2 1 
ATOM   1190 N  N   . ILE A 1 218 ? 1.031   -31.297 131.219 1.00 23.22 ? 218 ILE A N   1 
ATOM   1191 C  CA  . ILE A 1 218 ? 1.895   -30.410 130.638 1.00 22.23 ? 218 ILE A CA  1 
ATOM   1192 C  C   . ILE A 1 218 ? 3.217   -31.136 130.276 1.00 22.23 ? 218 ILE A C   1 
ATOM   1193 O  O   . ILE A 1 218 ? 3.871   -30.744 129.324 1.00 23.35 ? 218 ILE A O   1 
ATOM   1194 C  CB  . ILE A 1 218 ? 2.583   -29.338 131.595 1.00 22.05 ? 218 ILE A CB  1 
ATOM   1195 C  CG1 . ILE A 1 218 ? 1.564   -28.700 132.495 1.00 22.45 ? 218 ILE A CG1 1 
ATOM   1196 C  CG2 . ILE A 1 218 ? 3.403   -28.375 130.722 1.00 21.61 ? 218 ILE A CG2 1 
ATOM   1197 C  CD1 . ILE A 1 218 ? 1.259   -27.225 132.194 1.00 23.99 ? 218 ILE A CD1 1 
ATOM   1198 N  N   . LEU A 1 219 ? 3.496   -32.031 131.203 1.00 21.29 ? 219 LEU A N   1 
ATOM   1199 C  CA  . LEU A 1 219 ? 4.750   -32.799 131.126 1.00 20.29 ? 219 LEU A CA  1 
ATOM   1200 C  C   . LEU A 1 219 ? 4.696   -34.094 130.374 1.00 19.48 ? 219 LEU A C   1 
ATOM   1201 O  O   . LEU A 1 219 ? 5.815   -34.539 129.992 1.00 19.39 ? 219 LEU A O   1 
ATOM   1202 C  CB  . LEU A 1 219 ? 5.149   -32.926 132.629 1.00 20.77 ? 219 LEU A CB  1 
ATOM   1203 C  CG  . LEU A 1 219 ? 5.291   -31.553 133.277 1.00 21.12 ? 219 LEU A CG  1 
ATOM   1204 C  CD1 . LEU A 1 219 ? 4.183   -31.323 134.280 1.00 21.59 ? 219 LEU A CD1 1 
ATOM   1205 C  CD2 . LEU A 1 219 ? 6.621   -31.429 134.011 1.00 21.40 ? 219 LEU A CD2 1 
ATOM   1206 N  N   . VAL A 1 220 ? 3.599   -34.769 130.093 1.00 18.79 ? 220 VAL A N   1 
ATOM   1207 C  CA  . VAL A 1 220 ? 3.600   -36.045 129.362 1.00 17.63 ? 220 VAL A CA  1 
ATOM   1208 C  C   . VAL A 1 220 ? 2.411   -36.235 128.421 1.00 17.45 ? 220 VAL A C   1 
ATOM   1209 O  O   . VAL A 1 220 ? 1.270   -35.962 128.710 1.00 17.56 ? 220 VAL A O   1 
ATOM   1210 C  CB  . VAL A 1 220 ? 3.602   -37.226 130.324 1.00 16.77 ? 220 VAL A CB  1 
ATOM   1211 C  CG1 . VAL A 1 220 ? 4.700   -37.088 131.312 1.00 17.06 ? 220 VAL A CG1 1 
ATOM   1212 C  CG2 . VAL A 1 220 ? 2.250   -37.349 131.004 1.00 16.76 ? 220 VAL A CG2 1 
ATOM   1213 N  N   . PRO A 1 221 ? 2.759   -36.781 127.291 1.00 17.64 ? 221 PRO A N   1 
ATOM   1214 C  CA  . PRO A 1 221 ? 1.731   -36.978 126.274 1.00 17.84 ? 221 PRO A CA  1 
ATOM   1215 C  C   . PRO A 1 221 ? 0.811   -38.072 126.648 1.00 18.06 ? 221 PRO A C   1 
ATOM   1216 O  O   . PRO A 1 221 ? -0.318  -37.891 126.110 1.00 18.28 ? 221 PRO A O   1 
ATOM   1217 C  CB  . PRO A 1 221 ? 2.575   -37.147 124.996 1.00 17.94 ? 221 PRO A CB  1 
ATOM   1218 C  CG  . PRO A 1 221 ? 3.834   -37.803 125.464 1.00 17.31 ? 221 PRO A CG  1 
ATOM   1219 C  CD  . PRO A 1 221 ? 4.103   -37.172 126.821 1.00 17.53 ? 221 PRO A CD  1 
ATOM   1220 N  N   . ALA A 1 222 ? 1.158   -39.065 127.440 1.00 18.76 ? 222 ALA A N   1 
ATOM   1221 C  CA  . ALA A 1 222 ? 0.099   -40.113 127.697 1.00 20.46 ? 222 ALA A CA  1 
ATOM   1222 C  C   . ALA A 1 222 ? 0.517   -41.177 128.674 1.00 20.68 ? 222 ALA A C   1 
ATOM   1223 O  O   . ALA A 1 222 ? 1.729   -41.201 129.002 1.00 21.97 ? 222 ALA A O   1 
ATOM   1224 C  CB  . ALA A 1 222 ? -0.329  -40.727 126.346 1.00 20.59 ? 222 ALA A CB  1 
ATOM   1225 N  N   . ARG A 1 223 ? -0.386  -42.055 129.112 1.00 19.91 ? 223 ARG A N   1 
ATOM   1226 C  CA  . ARG A 1 223 ? 0.051   -43.078 130.082 1.00 19.38 ? 223 ARG A CA  1 
ATOM   1227 C  C   . ARG A 1 223 ? -0.516  -44.412 129.685 1.00 17.86 ? 223 ARG A C   1 
ATOM   1228 O  O   . ARG A 1 223 ? -1.709  -44.458 129.408 1.00 17.35 ? 223 ARG A O   1 
ATOM   1229 C  CB  . ARG A 1 223 ? -0.355  -42.691 131.505 1.00 21.15 ? 223 ARG A CB  1 
ATOM   1230 C  CG  . ARG A 1 223 ? -1.401  -43.590 132.135 1.00 22.78 ? 223 ARG A CG  1 
ATOM   1231 C  CD  . ARG A 1 223 ? -2.362  -42.886 132.962 1.00 23.96 ? 223 ARG A CD  1 
ATOM   1232 N  NE  . ARG A 1 223 ? -1.830  -42.331 134.271 1.00 24.34 ? 223 ARG A NE  1 
ATOM   1233 C  CZ  . ARG A 1 223 ? -2.897  -41.724 134.888 1.00 24.48 ? 223 ARG A CZ  1 
ATOM   1234 N  NH1 . ARG A 1 223 ? -4.137  -42.077 134.483 1.00 24.48 ? 223 ARG A NH1 1 
ATOM   1235 N  NH2 . ARG A 1 223 ? -2.723  -40.760 135.747 1.00 24.95 ? 223 ARG A NH2 1 
ATOM   1236 N  N   . LEU A 1 224 ? 0.365   -45.425 129.720 1.00 16.44 ? 224 LEU A N   1 
ATOM   1237 C  CA  . LEU A 1 224 ? -0.055  -46.773 129.349 1.00 14.74 ? 224 LEU A CA  1 
ATOM   1238 C  C   . LEU A 1 224 ? -0.701  -47.454 130.530 1.00 14.24 ? 224 LEU A C   1 
ATOM   1239 O  O   . LEU A 1 224 ? -0.078  -47.260 131.607 1.00 15.14 ? 224 LEU A O   1 
ATOM   1240 C  CB  . LEU A 1 224 ? 1.162   -47.575 128.891 1.00 14.07 ? 224 LEU A CB  1 
ATOM   1241 C  CG  . LEU A 1 224 ? 0.861   -48.989 128.428 1.00 13.18 ? 224 LEU A CG  1 
ATOM   1242 C  CD1 . LEU A 1 224 ? -0.271  -48.969 127.400 1.00 13.59 ? 224 LEU A CD1 1 
ATOM   1243 C  CD2 . LEU A 1 224 ? 2.072   -49.616 127.771 1.00 12.83 ? 224 LEU A CD2 1 
ATOM   1244 N  N   . VAL A 1 225 ? -1.762  -48.136 130.347 1.00 13.14 ? 225 VAL A N   1 
ATOM   1245 C  CA  . VAL A 1 225 ? -2.366  -48.846 131.504 1.00 13.00 ? 225 VAL A CA  1 
ATOM   1246 C  C   . VAL A 1 225 ? -2.162  -50.316 131.245 1.00 14.69 ? 225 VAL A C   1 
ATOM   1247 O  O   . VAL A 1 225 ? -2.518  -50.761 130.075 1.00 15.16 ? 225 VAL A O   1 
ATOM   1248 C  CB  . VAL A 1 225 ? -3.801  -48.372 131.602 1.00 11.80 ? 225 VAL A CB  1 
ATOM   1249 C  CG1 . VAL A 1 225 ? -4.700  -49.542 131.981 1.00 11.72 ? 225 VAL A CG1 1 
ATOM   1250 C  CG2 . VAL A 1 225 ? -4.081  -47.217 132.544 1.00 11.29 ? 225 VAL A CG2 1 
ATOM   1251 N  N   . THR A 1 226 ? -1.684  -51.086 132.196 1.00 16.42 ? 226 THR A N   1 
ATOM   1252 C  CA  . THR A 1 226 ? -1.555  -52.550 131.812 1.00 18.62 ? 226 THR A CA  1 
ATOM   1253 C  C   . THR A 1 226 ? -2.233  -53.303 132.943 1.00 20.08 ? 226 THR A C   1 
ATOM   1254 O  O   . THR A 1 226 ? -1.967  -52.941 134.105 1.00 20.13 ? 226 THR A O   1 
ATOM   1255 C  CB  . THR A 1 226 ? -0.112  -52.943 131.459 1.00 18.64 ? 226 THR A CB  1 
ATOM   1256 O  OG1 . THR A 1 226 ? 0.468   -53.527 132.676 1.00 19.55 ? 226 THR A OG1 1 
ATOM   1257 C  CG2 . THR A 1 226 ? 0.865   -51.819 131.015 1.00 18.32 ? 226 THR A CG2 1 
ATOM   1258 N  N   . ALA A 1 227 ? -3.078  -54.257 132.582 1.00 21.66 ? 227 ALA A N   1 
ATOM   1259 C  CA  . ALA A 1 227 ? -3.743  -55.041 133.666 1.00 23.15 ? 227 ALA A CA  1 
ATOM   1260 C  C   . ALA A 1 227 ? -3.352  -56.510 133.452 1.00 24.15 ? 227 ALA A C   1 
ATOM   1261 O  O   . ALA A 1 227 ? -3.422  -56.937 132.322 1.00 23.78 ? 227 ALA A O   1 
ATOM   1262 C  CB  . ALA A 1 227 ? -5.206  -54.836 133.684 1.00 23.03 ? 227 ALA A CB  1 
ATOM   1263 N  N   . MET A 1 228 ? -2.944  -57.180 134.496 1.00 26.33 ? 228 MET A N   1 
ATOM   1264 C  CA  . MET A 1 228 ? -2.559  -58.594 134.557 1.00 27.58 ? 228 MET A CA  1 
ATOM   1265 C  C   . MET A 1 228 ? -3.664  -59.245 135.459 1.00 28.29 ? 228 MET A C   1 
ATOM   1266 O  O   . MET A 1 228 ? -3.867  -59.019 136.669 1.00 28.21 ? 228 MET A O   1 
ATOM   1267 C  CB  . MET A 1 228 ? -1.212  -58.916 135.087 1.00 28.51 ? 228 MET A CB  1 
ATOM   1268 C  CG  . MET A 1 228 ? -0.095  -58.224 134.365 1.00 29.37 ? 228 MET A CG  1 
ATOM   1269 S  SD  . MET A 1 228 ? -0.072  -58.907 132.661 1.00 30.26 ? 228 MET A SD  1 
ATOM   1270 C  CE  . MET A 1 228 ? 1.389   -59.918 132.706 1.00 29.26 ? 228 MET A CE  1 
ATOM   1271 N  N   . GLU A 1 229 ? -4.378  -60.012 134.709 1.00 28.61 ? 229 GLU A N   1 
ATOM   1272 C  CA  . GLU A 1 229 ? -5.574  -60.764 135.257 1.00 29.31 ? 229 GLU A CA  1 
ATOM   1273 C  C   . GLU A 1 229 ? -5.300  -62.127 134.752 1.00 30.46 ? 229 GLU A C   1 
ATOM   1274 O  O   . GLU A 1 229 ? -4.599  -62.037 133.654 1.00 31.05 ? 229 GLU A O   1 
ATOM   1275 C  CB  . GLU A 1 229 ? -6.744  -60.018 134.771 1.00 28.63 ? 229 GLU A CB  1 
ATOM   1276 C  CG  . GLU A 1 229 ? -8.034  -60.812 134.670 1.00 28.35 ? 229 GLU A CG  1 
ATOM   1277 C  CD  . GLU A 1 229 ? -8.145  -61.484 133.339 1.00 27.44 ? 229 GLU A CD  1 
ATOM   1278 O  OE1 . GLU A 1 229 ? -8.234  -62.669 133.305 1.00 28.62 ? 229 GLU A OE1 1 
ATOM   1279 O  OE2 . GLU A 1 229 ? -8.118  -60.741 132.399 1.00 26.74 ? 229 GLU A OE2 1 
ATOM   1280 N  N   . GLY A 1 230 ? -5.632  -63.209 135.365 1.00 31.50 ? 230 GLY A N   1 
ATOM   1281 C  CA  . GLY A 1 230 ? -5.153  -64.551 134.681 1.00 33.67 ? 230 GLY A CA  1 
ATOM   1282 C  C   . GLY A 1 230 ? -5.488  -65.539 135.808 1.00 35.08 ? 230 GLY A C   1 
ATOM   1283 O  O   . GLY A 1 230 ? -6.597  -66.015 135.830 1.00 35.43 ? 230 GLY A O   1 
ATOM   1284 N  N   . GLY A 1 231 ? -4.519  -65.705 136.687 1.00 36.44 ? 231 GLY A N   1 
ATOM   1285 C  CA  . GLY A 1 231 ? -4.634  -66.425 137.878 1.00 38.54 ? 231 GLY A CA  1 
ATOM   1286 C  C   . GLY A 1 231 ? -4.638  -67.863 137.936 1.00 40.42 ? 231 GLY A C   1 
ATOM   1287 O  O   . GLY A 1 231 ? -5.618  -68.517 137.516 1.00 41.61 ? 231 GLY A O   1 
ATOM   1288 N  N   . SER A 1 232 ? -3.524  -68.367 138.466 1.00 41.67 ? 232 SER A N   1 
ATOM   1289 C  CA  . SER A 1 232 ? -3.547  -69.857 138.620 1.00 42.43 ? 232 SER A CA  1 
ATOM   1290 C  C   . SER A 1 232 ? -3.368  -69.923 140.145 1.00 43.28 ? 232 SER A C   1 
ATOM   1291 O  O   . SER A 1 232 ? -4.166  -70.466 140.861 1.00 43.04 ? 232 SER A O   1 
ATOM   1292 C  CB  . SER A 1 232 ? -2.567  -70.560 137.789 1.00 42.80 ? 232 SER A CB  1 
ATOM   1293 O  OG  . SER A 1 232 ? -3.102  -71.903 137.693 1.00 43.44 ? 232 SER A OG  1 
ATOM   1294 N  N   . SER A 1 233 ? -2.304  -69.228 140.475 1.00 44.84 ? 233 SER A N   1 
ATOM   1295 C  CA  . SER A 1 233 ? -1.789  -69.057 141.803 1.00 46.81 ? 233 SER A CA  1 
ATOM   1296 C  C   . SER A 1 233 ? -1.860  -67.623 142.296 1.00 47.53 ? 233 SER A C   1 
ATOM   1297 O  O   . SER A 1 233 ? -1.748  -66.741 141.425 1.00 48.79 ? 233 SER A O   1 
ATOM   1298 C  CB  . SER A 1 233 ? -0.286  -69.404 141.838 1.00 47.09 ? 233 SER A CB  1 
ATOM   1299 O  OG  . SER A 1 233 ? -0.122  -70.674 141.232 1.00 48.12 ? 233 SER A OG  1 
ATOM   1300 N  N   . LYS A 1 234 ? -1.976  -67.485 143.583 1.00 47.56 ? 234 LYS A N   1 
ATOM   1301 C  CA  . LYS A 1 234 ? -2.031  -66.111 144.155 1.00 47.97 ? 234 LYS A CA  1 
ATOM   1302 C  C   . LYS A 1 234 ? -0.585  -65.703 144.393 1.00 47.23 ? 234 LYS A C   1 
ATOM   1303 O  O   . LYS A 1 234 ? -0.236  -64.740 145.090 1.00 47.25 ? 234 LYS A O   1 
ATOM   1304 C  CB  . LYS A 1 234 ? -2.956  -66.097 145.328 1.00 49.93 ? 234 LYS A CB  1 
ATOM   1305 C  CG  . LYS A 1 234 ? -2.447  -65.724 146.697 1.00 51.75 ? 234 LYS A CG  1 
ATOM   1306 C  CD  . LYS A 1 234 ? -3.017  -66.543 147.845 1.00 52.92 ? 234 LYS A CD  1 
ATOM   1307 C  CE  . LYS A 1 234 ? -2.106  -67.705 148.243 1.00 53.91 ? 234 LYS A CE  1 
ATOM   1308 N  NZ  . LYS A 1 234 ? -1.525  -67.608 149.616 1.00 54.17 ? 234 LYS A NZ  1 
ATOM   1309 N  N   . THR A 1 235 ? 0.292   -66.459 143.749 1.00 46.32 ? 235 THR A N   1 
ATOM   1310 C  CA  . THR A 1 235 ? 1.745   -66.187 143.796 1.00 45.75 ? 235 THR A CA  1 
ATOM   1311 C  C   . THR A 1 235 ? 2.005   -65.483 142.460 1.00 44.93 ? 235 THR A C   1 
ATOM   1312 O  O   . THR A 1 235 ? 1.130   -65.682 141.567 1.00 44.77 ? 235 THR A O   1 
ATOM   1313 C  CB  . THR A 1 235 ? 2.638   -67.432 143.899 1.00 46.03 ? 235 THR A CB  1 
ATOM   1314 O  OG1 . THR A 1 235 ? 1.878   -68.271 142.873 1.00 46.39 ? 235 THR A OG1 1 
ATOM   1315 C  CG2 . THR A 1 235 ? 2.816   -68.077 145.251 1.00 45.84 ? 235 THR A CG2 1 
ATOM   1316 N  N   . ALA A 1 236 ? 3.107   -64.806 142.346 1.00 43.30 ? 236 ALA A N   1 
ATOM   1317 C  CA  . ALA A 1 236 ? 3.367   -64.082 141.079 1.00 41.68 ? 236 ALA A CA  1 
ATOM   1318 C  C   . ALA A 1 236 ? 4.083   -64.863 140.026 1.00 40.39 ? 236 ALA A C   1 
ATOM   1319 O  O   . ALA A 1 236 ? 5.223   -65.328 140.267 1.00 41.12 ? 236 ALA A O   1 
ATOM   1320 C  CB  . ALA A 1 236 ? 4.135   -62.825 141.546 1.00 41.97 ? 236 ALA A CB  1 
ATOM   1321 N  N   . VAL A 1 237 ? 3.506   -64.998 138.825 1.00 38.17 ? 237 VAL A N   1 
ATOM   1322 C  CA  . VAL A 1 237 ? 4.180   -65.740 137.741 1.00 35.79 ? 237 VAL A CA  1 
ATOM   1323 C  C   . VAL A 1 237 ? 4.653   -64.853 136.583 1.00 34.47 ? 237 VAL A C   1 
ATOM   1324 O  O   . VAL A 1 237 ? 3.940   -64.108 135.903 1.00 33.94 ? 237 VAL A O   1 
ATOM   1325 C  CB  . VAL A 1 237 ? 3.269   -66.872 137.221 1.00 35.32 ? 237 VAL A CB  1 
ATOM   1326 C  CG1 . VAL A 1 237 ? 4.149   -67.903 136.576 1.00 34.74 ? 237 VAL A CG1 1 
ATOM   1327 C  CG2 . VAL A 1 237 ? 2.349   -67.406 138.295 1.00 35.47 ? 237 VAL A CG2 1 
ATOM   1328 N  N   . ASN A 1 238 ? 5.930   -64.987 136.368 1.00 33.38 ? 238 ASN A N   1 
ATOM   1329 C  CA  . ASN A 1 238 ? 6.676   -64.274 135.308 1.00 32.59 ? 238 ASN A CA  1 
ATOM   1330 C  C   . ASN A 1 238 ? 6.101   -64.812 134.024 1.00 31.78 ? 238 ASN A C   1 
ATOM   1331 O  O   . ASN A 1 238 ? 6.135   -66.062 133.830 1.00 32.36 ? 238 ASN A O   1 
ATOM   1332 C  CB  . ASN A 1 238 ? 8.153   -64.488 135.636 1.00 33.93 ? 238 ASN A CB  1 
ATOM   1333 C  CG  . ASN A 1 238 ? 8.422   -63.502 136.777 1.00 35.16 ? 238 ASN A CG  1 
ATOM   1334 O  OD1 . ASN A 1 238 ? 9.138   -62.516 136.666 1.00 36.35 ? 238 ASN A OD1 1 
ATOM   1335 N  ND2 . ASN A 1 238 ? 7.743   -63.769 137.887 1.00 36.27 ? 238 ASN A ND2 1 
ATOM   1336 N  N   . THR A 1 239 ? 5.567   -63.933 133.185 1.00 29.45 ? 239 THR A N   1 
ATOM   1337 C  CA  . THR A 1 239 ? 4.929   -64.412 131.960 1.00 27.14 ? 239 THR A CA  1 
ATOM   1338 C  C   . THR A 1 239 ? 5.502   -63.922 130.686 1.00 26.06 ? 239 THR A C   1 
ATOM   1339 O  O   . THR A 1 239 ? 5.354   -64.554 129.625 1.00 25.72 ? 239 THR A O   1 
ATOM   1340 C  CB  . THR A 1 239 ? 3.400   -63.998 132.132 1.00 27.07 ? 239 THR A CB  1 
ATOM   1341 O  OG1 . THR A 1 239 ? 2.693   -64.808 131.179 1.00 27.00 ? 239 THR A OG1 1 
ATOM   1342 C  CG2 . THR A 1 239 ? 3.226   -62.502 131.946 1.00 27.40 ? 239 THR A CG2 1 
ATOM   1343 N  N   . GLY A 1 240 ? 6.178   -62.827 130.739 1.00 25.64 ? 240 GLY A N   1 
ATOM   1344 C  CA  . GLY A 1 240 ? 6.786   -62.238 129.541 1.00 26.40 ? 240 GLY A CA  1 
ATOM   1345 C  C   . GLY A 1 240 ? 7.185   -60.789 129.794 1.00 26.23 ? 240 GLY A C   1 
ATOM   1346 O  O   . GLY A 1 240 ? 7.254   -60.366 130.968 1.00 27.00 ? 240 GLY A O   1 
ATOM   1347 N  N   . ARG A 1 241 ? 7.453   -60.100 128.692 1.00 25.43 ? 241 ARG A N   1 
ATOM   1348 C  CA  . ARG A 1 241 ? 7.900   -58.722 128.853 1.00 25.34 ? 241 ARG A CA  1 
ATOM   1349 C  C   . ARG A 1 241 ? 7.338   -57.759 127.848 1.00 24.52 ? 241 ARG A C   1 
ATOM   1350 O  O   . ARG A 1 241 ? 6.900   -58.174 126.766 1.00 25.06 ? 241 ARG A O   1 
ATOM   1351 C  CB  . ARG A 1 241 ? 9.442   -58.727 128.749 1.00 26.09 ? 241 ARG A CB  1 
ATOM   1352 C  CG  . ARG A 1 241 ? 10.072  -59.898 129.517 1.00 26.43 ? 241 ARG A CG  1 
ATOM   1353 C  CD  . ARG A 1 241 ? 11.503  -59.961 129.214 1.00 27.27 ? 241 ARG A CD  1 
ATOM   1354 N  NE  . ARG A 1 241 ? 12.083  -61.288 129.414 1.00 28.34 ? 241 ARG A NE  1 
ATOM   1355 C  CZ  . ARG A 1 241 ? 12.715  -61.493 130.605 1.00 28.69 ? 241 ARG A CZ  1 
ATOM   1356 N  NH1 . ARG A 1 241 ? 12.693  -60.443 131.466 1.00 28.63 ? 241 ARG A NH1 1 
ATOM   1357 N  NH2 . ARG A 1 241 ? 13.279  -62.674 130.837 1.00 27.90 ? 241 ARG A NH2 1 
ATOM   1358 N  N   . LEU A 1 242 ? 7.391   -56.513 128.258 1.00 23.26 ? 242 LEU A N   1 
ATOM   1359 C  CA  . LEU A 1 242 ? 6.895   -55.475 127.404 1.00 23.51 ? 242 LEU A CA  1 
ATOM   1360 C  C   . LEU A 1 242 ? 8.053   -54.759 126.737 1.00 24.31 ? 242 LEU A C   1 
ATOM   1361 O  O   . LEU A 1 242 ? 8.935   -54.369 127.533 1.00 25.56 ? 242 LEU A O   1 
ATOM   1362 C  CB  . LEU A 1 242 ? 6.051   -54.499 128.230 1.00 22.69 ? 242 LEU A CB  1 
ATOM   1363 C  CG  . LEU A 1 242 ? 5.178   -53.704 127.255 1.00 22.08 ? 242 LEU A CG  1 
ATOM   1364 C  CD1 . LEU A 1 242 ? 4.085   -54.610 126.727 1.00 21.87 ? 242 LEU A CD1 1 
ATOM   1365 C  CD2 . LEU A 1 242 ? 4.646   -52.511 128.018 1.00 22.61 ? 242 LEU A CD2 1 
ATOM   1366 N  N   . TYR A 1 243 ? 7.983   -54.600 125.426 1.00 24.25 ? 243 TYR A N   1 
ATOM   1367 C  CA  . TYR A 1 243 ? 9.082   -53.881 124.740 1.00 23.59 ? 243 TYR A CA  1 
ATOM   1368 C  C   . TYR A 1 243 ? 8.631   -52.619 124.017 1.00 23.37 ? 243 TYR A C   1 
ATOM   1369 O  O   . TYR A 1 243 ? 7.595   -52.653 123.265 1.00 24.35 ? 243 TYR A O   1 
ATOM   1370 C  CB  . TYR A 1 243 ? 9.726   -54.854 123.771 1.00 22.67 ? 243 TYR A CB  1 
ATOM   1371 C  CG  . TYR A 1 243 ? 10.410  -56.070 124.326 1.00 22.30 ? 243 TYR A CG  1 
ATOM   1372 C  CD1 . TYR A 1 243 ? 9.699   -57.253 124.573 1.00 22.37 ? 243 TYR A CD1 1 
ATOM   1373 C  CD2 . TYR A 1 243 ? 11.788  -56.075 124.576 1.00 21.56 ? 243 TYR A CD2 1 
ATOM   1374 C  CE1 . TYR A 1 243 ? 10.347  -58.394 125.048 1.00 22.32 ? 243 TYR A CE1 1 
ATOM   1375 C  CE2 . TYR A 1 243 ? 12.439  -57.200 125.030 1.00 21.87 ? 243 TYR A CE2 1 
ATOM   1376 C  CZ  . TYR A 1 243 ? 11.721  -58.368 125.280 1.00 22.26 ? 243 TYR A CZ  1 
ATOM   1377 O  OH  . TYR A 1 243 ? 12.386  -59.467 125.785 1.00 21.84 ? 243 TYR A OH  1 
ATOM   1378 N  N   . ALA A 1 244 ? 9.409   -51.566 124.196 1.00 22.09 ? 244 ALA A N   1 
ATOM   1379 C  CA  . ALA A 1 244 ? 9.083   -50.306 123.502 1.00 21.69 ? 244 ALA A CA  1 
ATOM   1380 C  C   . ALA A 1 244 ? 9.983   -50.114 122.259 1.00 20.72 ? 244 ALA A C   1 
ATOM   1381 O  O   . ALA A 1 244 ? 11.174  -50.388 122.211 1.00 20.68 ? 244 ALA A O   1 
ATOM   1382 C  CB  . ALA A 1 244 ? 9.170   -49.102 124.384 1.00 21.91 ? 244 ALA A CB  1 
ATOM   1383 N  N   . SER A 1 245 ? 9.286   -49.603 121.260 1.00 19.97 ? 245 SER A N   1 
ATOM   1384 C  CA  . SER A 1 245 ? 9.791   -49.295 119.921 1.00 18.89 ? 245 SER A CA  1 
ATOM   1385 C  C   . SER A 1 245 ? 9.358   -47.917 119.515 1.00 17.56 ? 245 SER A C   1 
ATOM   1386 O  O   . SER A 1 245 ? 8.192   -47.668 119.192 1.00 17.33 ? 245 SER A O   1 
ATOM   1387 C  CB  . SER A 1 245 ? 9.270   -50.325 118.946 1.00 20.10 ? 245 SER A CB  1 
ATOM   1388 O  OG  . SER A 1 245 ? 10.498  -51.088 118.706 1.00 22.16 ? 245 SER A OG  1 
ATOM   1389 N  N   . TYR A 1 246 ? 10.372  -47.074 119.570 1.00 16.57 ? 246 TYR A N   1 
ATOM   1390 C  CA  . TYR A 1 246 ? 10.138  -45.657 119.309 1.00 15.69 ? 246 TYR A CA  1 
ATOM   1391 C  C   . TYR A 1 246 ? 11.042  -45.015 118.299 1.00 14.89 ? 246 TYR A C   1 
ATOM   1392 O  O   . TYR A 1 246 ? 12.101  -45.521 117.973 1.00 14.36 ? 246 TYR A O   1 
ATOM   1393 C  CB  . TYR A 1 246 ? 10.292  -44.886 120.700 1.00 14.99 ? 246 TYR A CB  1 
ATOM   1394 C  CG  . TYR A 1 246 ? 11.607  -45.348 121.334 1.00 14.41 ? 246 TYR A CG  1 
ATOM   1395 C  CD1 . TYR A 1 246 ? 11.653  -46.515 122.100 1.00 13.74 ? 246 TYR A CD1 1 
ATOM   1396 C  CD2 . TYR A 1 246 ? 12.791  -44.633 121.145 1.00 14.12 ? 246 TYR A CD2 1 
ATOM   1397 C  CE1 . TYR A 1 246 ? 12.836  -46.926 122.655 1.00 14.01 ? 246 TYR A CE1 1 
ATOM   1398 C  CE2 . TYR A 1 246 ? 13.981  -45.047 121.710 1.00 14.04 ? 246 TYR A CE2 1 
ATOM   1399 C  CZ  . TYR A 1 246 ? 14.021  -46.201 122.467 1.00 14.08 ? 246 TYR A CZ  1 
ATOM   1400 O  OH  . TYR A 1 246 ? 15.203  -46.617 123.032 1.00 13.57 ? 246 TYR A OH  1 
ATOM   1401 N  N   . THR A 1 247 ? 10.534  -43.857 117.875 1.00 14.56 ? 247 THR A N   1 
ATOM   1402 C  CA  . THR A 1 247 ? 11.261  -42.995 116.958 1.00 14.77 ? 247 THR A CA  1 
ATOM   1403 C  C   . THR A 1 247 ? 10.952  -41.587 117.528 1.00 15.18 ? 247 THR A C   1 
ATOM   1404 O  O   . THR A 1 247 ? 9.863   -41.099 117.392 1.00 14.55 ? 247 THR A O   1 
ATOM   1405 C  CB  . THR A 1 247 ? 10.994  -43.064 115.455 1.00 14.31 ? 247 THR A CB  1 
ATOM   1406 O  OG1 . THR A 1 247 ? 11.615  -44.316 115.066 1.00 14.46 ? 247 THR A OG1 1 
ATOM   1407 C  CG2 . THR A 1 247 ? 11.635  -41.881 114.739 1.00 14.20 ? 247 THR A CG2 1 
ATOM   1408 N  N   . ILE A 1 248 ? 12.042  -41.136 118.146 1.00 16.38 ? 248 ILE A N   1 
ATOM   1409 C  CA  . ILE A 1 248 ? 11.968  -39.850 118.826 1.00 17.52 ? 248 ILE A CA  1 
ATOM   1410 C  C   . ILE A 1 248 ? 12.839  -38.816 118.144 1.00 18.69 ? 248 ILE A C   1 
ATOM   1411 O  O   . ILE A 1 248 ? 13.911  -39.130 117.617 1.00 19.74 ? 248 ILE A O   1 
ATOM   1412 C  CB  . ILE A 1 248 ? 12.398  -40.005 120.314 1.00 17.15 ? 248 ILE A CB  1 
ATOM   1413 C  CG1 . ILE A 1 248 ? 11.973  -38.753 121.104 1.00 17.48 ? 248 ILE A CG1 1 
ATOM   1414 C  CG2 . ILE A 1 248 ? 13.925  -40.256 120.476 1.00 17.19 ? 248 ILE A CG2 1 
ATOM   1415 C  CD1 . ILE A 1 248 ? 12.056  -38.962 122.649 1.00 17.20 ? 248 ILE A CD1 1 
ATOM   1416 N  N   . ARG A 1 249 ? 12.341  -37.628 118.246 1.00 19.77 ? 249 ARG A N   1 
ATOM   1417 C  CA  . ARG A 1 249 ? 12.942  -36.416 117.720 1.00 20.25 ? 249 ARG A CA  1 
ATOM   1418 C  C   . ARG A 1 249 ? 13.374  -35.481 118.845 1.00 19.56 ? 249 ARG A C   1 
ATOM   1419 O  O   . ARG A 1 249 ? 12.524  -34.718 119.365 1.00 19.66 ? 249 ARG A O   1 
ATOM   1420 C  CB  . ARG A 1 249 ? 11.891  -35.739 116.846 1.00 21.64 ? 249 ARG A CB  1 
ATOM   1421 C  CG  . ARG A 1 249 ? 12.382  -34.515 116.104 1.00 23.18 ? 249 ARG A CG  1 
ATOM   1422 C  CD  . ARG A 1 249 ? 11.237  -33.508 115.997 1.00 23.79 ? 249 ARG A CD  1 
ATOM   1423 N  NE  . ARG A 1 249 ? 11.889  -32.195 115.809 1.00 24.41 ? 249 ARG A NE  1 
ATOM   1424 C  CZ  . ARG A 1 249 ? 11.489  -31.342 114.871 1.00 24.53 ? 249 ARG A CZ  1 
ATOM   1425 N  NH1 . ARG A 1 249 ? 10.299  -31.563 114.320 1.00 25.43 ? 249 ARG A NH1 1 
ATOM   1426 N  NH2 . ARG A 1 249 ? 12.210  -30.340 114.420 1.00 24.09 ? 249 ARG A NH2 1 
ATOM   1427 N  N   . LEU A 1 250 ? 14.613  -35.558 119.208 1.00 18.33 ? 250 LEU A N   1 
ATOM   1428 C  CA  . LEU A 1 250 ? 15.404  -34.865 120.177 1.00 16.70 ? 250 LEU A CA  1 
ATOM   1429 C  C   . LEU A 1 250 ? 15.725  -33.449 119.716 1.00 16.52 ? 250 LEU A C   1 
ATOM   1430 O  O   . LEU A 1 250 ? 16.027  -33.194 118.553 1.00 15.25 ? 250 LEU A O   1 
ATOM   1431 C  CB  . LEU A 1 250 ? 16.709  -35.670 120.448 1.00 15.36 ? 250 LEU A CB  1 
ATOM   1432 C  CG  . LEU A 1 250 ? 16.456  -36.840 121.385 1.00 14.33 ? 250 LEU A CG  1 
ATOM   1433 C  CD1 . LEU A 1 250 ? 15.123  -37.482 121.065 1.00 14.25 ? 250 LEU A CD1 1 
ATOM   1434 C  CD2 . LEU A 1 250 ? 17.562  -37.841 121.193 1.00 14.26 ? 250 LEU A CD2 1 
ATOM   1435 N  N   . ILE A 1 251 ? 15.659  -32.551 120.738 1.00 17.63 ? 251 ILE A N   1 
ATOM   1436 C  CA  . ILE A 1 251 ? 15.903  -31.153 120.275 1.00 17.99 ? 251 ILE A CA  1 
ATOM   1437 C  C   . ILE A 1 251 ? 16.585  -30.097 121.004 1.00 17.77 ? 251 ILE A C   1 
ATOM   1438 O  O   . ILE A 1 251 ? 16.933  -29.208 120.096 1.00 18.69 ? 251 ILE A O   1 
ATOM   1439 C  CB  . ILE A 1 251 ? 14.381  -30.730 119.967 1.00 18.41 ? 251 ILE A CB  1 
ATOM   1440 C  CG1 . ILE A 1 251 ? 14.359  -30.542 118.427 1.00 18.64 ? 251 ILE A CG1 1 
ATOM   1441 C  CG2 . ILE A 1 251 ? 13.852  -29.546 120.751 1.00 18.57 ? 251 ILE A CG2 1 
ATOM   1442 C  CD1 . ILE A 1 251 ? 12.841  -30.303 118.013 1.00 19.93 ? 251 ILE A CD1 1 
ATOM   1443 N  N   . GLU A 1 252 ? 16.844  -29.892 122.231 1.00 17.19 ? 252 GLU A N   1 
ATOM   1444 C  CA  . GLU A 1 252 ? 17.674  -28.547 122.464 1.00 16.42 ? 252 GLU A CA  1 
ATOM   1445 C  C   . GLU A 1 252 ? 18.627  -29.109 123.483 1.00 15.71 ? 252 GLU A C   1 
ATOM   1446 O  O   . GLU A 1 252 ? 18.344  -29.359 124.676 1.00 15.80 ? 252 GLU A O   1 
ATOM   1447 C  CB  . GLU A 1 252 ? 16.814  -27.412 122.685 1.00 16.60 ? 252 GLU A CB  1 
ATOM   1448 C  CG  . GLU A 1 252 ? 15.394  -27.420 122.158 1.00 17.56 ? 252 GLU A CG  1 
ATOM   1449 C  CD  . GLU A 1 252 ? 14.699  -26.148 121.925 1.00 18.15 ? 252 GLU A CD  1 
ATOM   1450 O  OE1 . GLU A 1 252 ? 13.539  -25.838 122.018 1.00 18.69 ? 252 GLU A OE1 1 
ATOM   1451 O  OE2 . GLU A 1 252 ? 15.569  -25.302 121.568 1.00 18.90 ? 252 GLU A OE2 1 
ATOM   1452 N  N   . PRO A 1 253 ? 19.765  -29.456 122.910 1.00 14.44 ? 253 PRO A N   1 
ATOM   1453 C  CA  . PRO A 1 253 ? 20.816  -30.116 123.706 1.00 14.93 ? 253 PRO A CA  1 
ATOM   1454 C  C   . PRO A 1 253 ? 21.095  -29.360 124.990 1.00 15.48 ? 253 PRO A C   1 
ATOM   1455 O  O   . PRO A 1 253 ? 21.192  -28.118 125.008 1.00 15.54 ? 253 PRO A O   1 
ATOM   1456 C  CB  . PRO A 1 253 ? 21.999  -30.260 122.768 1.00 14.20 ? 253 PRO A CB  1 
ATOM   1457 C  CG  . PRO A 1 253 ? 21.695  -29.268 121.703 1.00 13.66 ? 253 PRO A CG  1 
ATOM   1458 C  CD  . PRO A 1 253 ? 20.188  -29.265 121.552 1.00 13.52 ? 253 PRO A CD  1 
ATOM   1459 N  N   . ILE A 1 254 ? 21.214  -30.224 126.035 1.00 15.58 ? 254 ILE A N   1 
ATOM   1460 C  CA  . ILE A 1 254 ? 21.540  -29.642 127.362 1.00 15.26 ? 254 ILE A CA  1 
ATOM   1461 C  C   . ILE A 1 254 ? 22.573  -30.544 128.027 1.00 15.18 ? 254 ILE A C   1 
ATOM   1462 O  O   . ILE A 1 254 ? 22.599  -31.703 127.642 1.00 14.73 ? 254 ILE A O   1 
ATOM   1463 C  CB  . ILE A 1 254 ? 20.266  -29.432 128.194 1.00 14.78 ? 254 ILE A CB  1 
ATOM   1464 C  CG1 . ILE A 1 254 ? 20.633  -28.498 129.359 1.00 14.61 ? 254 ILE A CG1 1 
ATOM   1465 C  CG2 . ILE A 1 254 ? 19.641  -30.752 128.725 1.00 14.79 ? 254 ILE A CG2 1 
ATOM   1466 C  CD1 . ILE A 1 254 ? 19.395  -28.123 130.205 1.00 15.60 ? 254 ILE A CD1 1 
ATOM   1467 N  N   . ALA A 1 255 ? 23.347  -29.995 128.943 1.00 16.15 ? 255 ALA A N   1 
ATOM   1468 C  CA  . ALA A 1 255 ? 24.345  -30.903 129.637 1.00 17.59 ? 255 ALA A CA  1 
ATOM   1469 C  C   . ALA A 1 255 ? 23.407  -31.895 130.337 1.00 18.56 ? 255 ALA A C   1 
ATOM   1470 O  O   . ALA A 1 255 ? 22.381  -31.445 130.885 1.00 18.63 ? 255 ALA A O   1 
ATOM   1471 C  CB  . ALA A 1 255 ? 25.325  -30.212 130.499 1.00 17.44 ? 255 ALA A CB  1 
ATOM   1472 N  N   . ALA A 1 256 ? 23.759  -33.173 130.265 1.00 19.64 ? 256 ALA A N   1 
ATOM   1473 C  CA  . ALA A 1 256 ? 22.845  -34.186 130.841 1.00 19.94 ? 256 ALA A CA  1 
ATOM   1474 C  C   . ALA A 1 256 ? 22.476  -33.901 132.287 1.00 19.25 ? 256 ALA A C   1 
ATOM   1475 O  O   . ALA A 1 256 ? 21.336  -33.901 132.720 1.00 19.43 ? 256 ALA A O   1 
ATOM   1476 C  CB  . ALA A 1 256 ? 23.467  -35.559 130.758 1.00 20.83 ? 256 ALA A CB  1 
ATOM   1477 N  N   . ALA A 1 257 ? 23.540  -33.721 132.995 1.00 18.78 ? 257 ALA A N   1 
ATOM   1478 C  CA  . ALA A 1 257 ? 23.523  -33.466 134.408 1.00 19.06 ? 257 ALA A CA  1 
ATOM   1479 C  C   . ALA A 1 257 ? 22.590  -32.391 134.856 1.00 18.77 ? 257 ALA A C   1 
ATOM   1480 O  O   . ALA A 1 257 ? 22.372  -32.332 136.065 1.00 19.69 ? 257 ALA A O   1 
ATOM   1481 C  CB  . ALA A 1 257 ? 24.950  -32.983 134.723 1.00 20.42 ? 257 ALA A CB  1 
ATOM   1482 N  N   . LEU A 1 258 ? 22.129  -31.541 134.023 1.00 18.21 ? 258 LEU A N   1 
ATOM   1483 C  CA  . LEU A 1 258 ? 21.302  -30.418 134.385 1.00 18.23 ? 258 LEU A CA  1 
ATOM   1484 C  C   . LEU A 1 258 ? 19.827  -30.432 134.126 1.00 18.08 ? 258 LEU A C   1 
ATOM   1485 O  O   . LEU A 1 258 ? 19.121  -29.412 134.361 1.00 17.27 ? 258 LEU A O   1 
ATOM   1486 C  CB  . LEU A 1 258 ? 21.966  -29.363 133.403 1.00 18.44 ? 258 LEU A CB  1 
ATOM   1487 C  CG  . LEU A 1 258 ? 23.077  -28.515 133.928 1.00 18.25 ? 258 LEU A CG  1 
ATOM   1488 C  CD1 . LEU A 1 258 ? 23.189  -27.197 133.172 1.00 17.76 ? 258 LEU A CD1 1 
ATOM   1489 C  CD2 . LEU A 1 258 ? 22.747  -28.222 135.370 1.00 18.91 ? 258 LEU A CD2 1 
ATOM   1490 N  N   . ASN A 1 259 ? 19.385  -31.559 133.576 1.00 17.74 ? 259 ASN A N   1 
ATOM   1491 C  CA  . ASN A 1 259 ? 18.042  -31.793 133.154 1.00 17.49 ? 259 ASN A CA  1 
ATOM   1492 C  C   . ASN A 1 259 ? 17.093  -32.371 134.167 1.00 17.65 ? 259 ASN A C   1 
ATOM   1493 O  O   . ASN A 1 259 ? 17.208  -33.597 134.367 1.00 17.42 ? 259 ASN A O   1 
ATOM   1494 C  CB  . ASN A 1 259 ? 18.099  -32.817 131.976 1.00 18.07 ? 259 ASN A CB  1 
ATOM   1495 C  CG  . ASN A 1 259 ? 16.835  -32.725 131.146 1.00 19.38 ? 259 ASN A CG  1 
ATOM   1496 O  OD1 . ASN A 1 259 ? 15.688  -32.372 131.491 1.00 19.88 ? 259 ASN A OD1 1 
ATOM   1497 N  ND2 . ASN A 1 259 ? 17.069  -33.052 129.862 1.00 20.22 ? 259 ASN A ND2 1 
ATOM   1498 N  N   . LEU A 1 260 ? 16.202  -31.579 134.743 1.00 18.24 ? 260 LEU A N   1 
ATOM   1499 C  CA  . LEU A 1 260 ? 15.235  -32.240 135.657 1.00 18.60 ? 260 LEU A CA  1 
ATOM   1500 C  C   . LEU A 1 260 ? 13.939  -32.455 134.802 1.00 18.92 ? 260 LEU A C   1 
ATOM   1501 O  O   . LEU A 1 260 ? 13.911  -32.069 133.625 1.00 18.09 ? 260 LEU A O   1 
ATOM   1502 C  CB  . LEU A 1 260 ? 14.980  -31.517 136.926 1.00 18.53 ? 260 LEU A CB  1 
ATOM   1503 C  CG  . LEU A 1 260 ? 16.247  -30.985 137.578 1.00 18.51 ? 260 LEU A CG  1 
ATOM   1504 C  CD1 . LEU A 1 260 ? 15.980  -30.814 139.051 1.00 18.71 ? 260 LEU A CD1 1 
ATOM   1505 C  CD2 . LEU A 1 260 ? 17.376  -31.979 137.333 1.00 18.86 ? 260 LEU A CD2 1 
ATOM   1506 O  OXT . LEU A 1 260 ? 13.044  -33.008 135.478 1.00 19.92 ? 260 LEU A OXT 1 
ATOM   1507 N  N   . SER B 1 62  ? -16.462 -38.421 110.318 1.00 62.02 ? 62  SER B N   1 
ATOM   1508 C  CA  . SER B 1 62  ? -15.790 -39.118 111.421 1.00 62.15 ? 62  SER B CA  1 
ATOM   1509 C  C   . SER B 1 62  ? -14.988 -40.345 110.929 1.00 62.77 ? 62  SER B C   1 
ATOM   1510 O  O   . SER B 1 62  ? -15.412 -41.105 110.037 1.00 63.42 ? 62  SER B O   1 
ATOM   1511 C  CB  . SER B 1 62  ? -16.707 -39.635 112.525 1.00 61.28 ? 62  SER B CB  1 
ATOM   1512 O  OG  . SER B 1 62  ? -17.860 -38.958 112.829 1.00 60.83 ? 62  SER B OG  1 
ATOM   1513 N  N   . SER B 1 63  ? -13.842 -40.539 111.573 1.00 62.72 ? 63  SER B N   1 
ATOM   1514 C  CA  . SER B 1 63  ? -12.900 -41.678 111.327 1.00 61.72 ? 63  SER B CA  1 
ATOM   1515 C  C   . SER B 1 63  ? -13.283 -42.809 112.293 1.00 60.82 ? 63  SER B C   1 
ATOM   1516 O  O   . SER B 1 63  ? -14.376 -42.773 112.943 1.00 60.92 ? 63  SER B O   1 
ATOM   1517 C  CB  . SER B 1 63  ? -11.489 -41.166 111.396 1.00 61.86 ? 63  SER B CB  1 
ATOM   1518 O  OG  . SER B 1 63  ? -10.451 -41.961 111.834 1.00 62.01 ? 63  SER B OG  1 
ATOM   1519 N  N   . MET B 1 64  ? -12.458 -43.824 112.405 1.00 59.61 ? 64  MET B N   1 
ATOM   1520 C  CA  . MET B 1 64  ? -12.743 -44.958 113.317 1.00 58.59 ? 64  MET B CA  1 
ATOM   1521 C  C   . MET B 1 64  ? -12.004 -44.775 114.637 1.00 56.08 ? 64  MET B C   1 
ATOM   1522 O  O   . MET B 1 64  ? -11.907 -45.649 115.515 1.00 56.25 ? 64  MET B O   1 
ATOM   1523 C  CB  . MET B 1 64  ? -12.419 -46.265 112.575 1.00 60.45 ? 64  MET B CB  1 
ATOM   1524 C  CG  . MET B 1 64  ? -13.438 -46.381 111.454 1.00 62.74 ? 64  MET B CG  1 
ATOM   1525 S  SD  . MET B 1 64  ? -13.876 -48.141 111.148 1.00 64.62 ? 64  MET B SD  1 
ATOM   1526 C  CE  . MET B 1 64  ? -12.936 -48.376 109.587 1.00 64.88 ? 64  MET B CE  1 
ATOM   1527 N  N   . ASP B 1 65  ? -11.456 -43.595 114.769 1.00 52.76 ? 65  ASP B N   1 
ATOM   1528 C  CA  . ASP B 1 65  ? -10.646 -43.123 115.854 1.00 49.51 ? 65  ASP B CA  1 
ATOM   1529 C  C   . ASP B 1 65  ? -11.228 -41.833 116.430 1.00 46.02 ? 65  ASP B C   1 
ATOM   1530 O  O   . ASP B 1 65  ? -11.209 -41.637 117.642 1.00 45.97 ? 65  ASP B O   1 
ATOM   1531 C  CB  . ASP B 1 65  ? -9.189  -42.888 115.366 1.00 51.20 ? 65  ASP B CB  1 
ATOM   1532 C  CG  . ASP B 1 65  ? -8.428  -44.181 115.139 1.00 52.28 ? 65  ASP B CG  1 
ATOM   1533 O  OD1 . ASP B 1 65  ? -7.683  -44.690 116.010 1.00 52.78 ? 65  ASP B OD1 1 
ATOM   1534 O  OD2 . ASP B 1 65  ? -8.606  -44.693 114.003 1.00 53.13 ? 65  ASP B OD2 1 
ATOM   1535 N  N   . VAL B 1 66  ? -11.692 -41.044 115.493 1.00 41.25 ? 66  VAL B N   1 
ATOM   1536 C  CA  . VAL B 1 66  ? -12.266 -39.741 115.764 1.00 37.19 ? 66  VAL B CA  1 
ATOM   1537 C  C   . VAL B 1 66  ? -13.746 -39.676 115.593 1.00 34.32 ? 66  VAL B C   1 
ATOM   1538 O  O   . VAL B 1 66  ? -14.234 -40.465 114.796 1.00 34.91 ? 66  VAL B O   1 
ATOM   1539 C  CB  . VAL B 1 66  ? -11.601 -38.772 114.770 1.00 37.37 ? 66  VAL B CB  1 
ATOM   1540 C  CG1 . VAL B 1 66  ? -11.752 -37.343 115.203 1.00 37.74 ? 66  VAL B CG1 1 
ATOM   1541 C  CG2 . VAL B 1 66  ? -10.156 -39.184 114.578 1.00 37.44 ? 66  VAL B CG2 1 
ATOM   1542 N  N   . THR B 1 67  ? -14.403 -38.792 116.287 1.00 30.74 ? 67  THR B N   1 
ATOM   1543 C  CA  . THR B 1 67  ? -15.856 -38.675 116.127 1.00 27.08 ? 67  THR B CA  1 
ATOM   1544 C  C   . THR B 1 67  ? -16.154 -37.244 115.907 1.00 25.59 ? 67  THR B C   1 
ATOM   1545 O  O   . THR B 1 67  ? -15.500 -36.465 116.656 1.00 26.12 ? 67  THR B O   1 
ATOM   1546 C  CB  . THR B 1 67  ? -16.609 -39.237 117.364 1.00 26.50 ? 67  THR B CB  1 
ATOM   1547 O  OG1 . THR B 1 67  ? -16.437 -40.646 117.091 1.00 27.44 ? 67  THR B OG1 1 
ATOM   1548 C  CG2 . THR B 1 67  ? -18.029 -38.758 117.447 1.00 25.71 ? 67  THR B CG2 1 
ATOM   1549 N  N   . ILE B 1 68  ? -17.022 -36.927 114.992 1.00 23.76 ? 68  ILE B N   1 
ATOM   1550 C  CA  . ILE B 1 68  ? -17.265 -35.461 114.883 1.00 22.37 ? 68  ILE B CA  1 
ATOM   1551 C  C   . ILE B 1 68  ? -18.732 -35.285 115.267 1.00 21.25 ? 68  ILE B C   1 
ATOM   1552 O  O   . ILE B 1 68  ? -19.474 -36.057 114.675 1.00 20.96 ? 68  ILE B O   1 
ATOM   1553 C  CB  . ILE B 1 68  ? -17.005 -34.815 113.545 1.00 22.34 ? 68  ILE B CB  1 
ATOM   1554 C  CG1 . ILE B 1 68  ? -15.450 -34.815 113.370 1.00 22.70 ? 68  ILE B CG1 1 
ATOM   1555 C  CG2 . ILE B 1 68  ? -17.593 -33.405 113.421 1.00 22.83 ? 68  ILE B CG2 1 
ATOM   1556 C  CD1 . ILE B 1 68  ? -15.206 -36.115 112.481 1.00 23.85 ? 68  ILE B CD1 1 
ATOM   1557 N  N   . LEU B 1 69  ? -18.951 -34.341 116.104 1.00 20.45 ? 69  LEU B N   1 
ATOM   1558 C  CA  . LEU B 1 69  ? -20.294 -34.095 116.542 1.00 20.66 ? 69  LEU B CA  1 
ATOM   1559 C  C   . LEU B 1 69  ? -20.660 -32.638 116.542 1.00 21.63 ? 69  LEU B C   1 
ATOM   1560 O  O   . LEU B 1 69  ? -19.888 -31.793 117.065 1.00 21.12 ? 69  LEU B O   1 
ATOM   1561 C  CB  . LEU B 1 69  ? -20.305 -34.707 117.978 1.00 20.39 ? 69  LEU B CB  1 
ATOM   1562 C  CG  . LEU B 1 69  ? -21.702 -34.522 118.577 1.00 20.19 ? 69  LEU B CG  1 
ATOM   1563 C  CD1 . LEU B 1 69  ? -22.399 -35.883 118.515 1.00 20.37 ? 69  LEU B CD1 1 
ATOM   1564 C  CD2 . LEU B 1 69  ? -21.613 -33.965 119.969 1.00 19.56 ? 69  LEU B CD2 1 
ATOM   1565 N  N   . SER B 1 70  ? -21.839 -32.393 115.974 1.00 23.02 ? 70  SER B N   1 
ATOM   1566 C  CA  . SER B 1 70  ? -22.336 -30.999 115.937 1.00 24.23 ? 70  SER B CA  1 
ATOM   1567 C  C   . SER B 1 70  ? -23.661 -30.979 116.660 1.00 25.41 ? 70  SER B C   1 
ATOM   1568 O  O   . SER B 1 70  ? -24.349 -32.027 116.576 1.00 26.72 ? 70  SER B O   1 
ATOM   1569 C  CB  . SER B 1 70  ? -22.521 -30.498 114.553 1.00 24.32 ? 70  SER B CB  1 
ATOM   1570 O  OG  . SER B 1 70  ? -21.336 -30.377 113.817 1.00 25.13 ? 70  SER B OG  1 
ATOM   1571 N  N   . HIS B 1 71  ? -23.981 -29.855 117.271 1.00 25.94 ? 71  HIS B N   1 
ATOM   1572 C  CA  . HIS B 1 71  ? -25.256 -29.784 118.008 1.00 25.88 ? 71  HIS B CA  1 
ATOM   1573 C  C   . HIS B 1 71  ? -25.581 -28.414 118.500 1.00 25.64 ? 71  HIS B C   1 
ATOM   1574 O  O   . HIS B 1 71  ? -24.761 -27.472 118.490 1.00 26.18 ? 71  HIS B O   1 
ATOM   1575 C  CB  . HIS B 1 71  ? -25.105 -30.735 119.224 1.00 26.96 ? 71  HIS B CB  1 
ATOM   1576 C  CG  . HIS B 1 71  ? -26.345 -31.182 119.868 1.00 27.83 ? 71  HIS B CG  1 
ATOM   1577 N  ND1 . HIS B 1 71  ? -27.513 -30.469 119.914 1.00 28.95 ? 71  HIS B ND1 1 
ATOM   1578 C  CD2 . HIS B 1 71  ? -26.636 -32.293 120.526 1.00 28.24 ? 71  HIS B CD2 1 
ATOM   1579 C  CE1 . HIS B 1 71  ? -28.468 -31.099 120.574 1.00 28.58 ? 71  HIS B CE1 1 
ATOM   1580 N  NE2 . HIS B 1 71  ? -27.957 -32.216 120.955 1.00 28.98 ? 71  HIS B NE2 1 
ATOM   1581 N  N   . CYS B 1 72  ? -26.777 -28.269 119.010 1.00 25.55 ? 72  CYS B N   1 
ATOM   1582 C  CA  . CYS B 1 72  ? -27.343 -27.100 119.627 1.00 25.52 ? 72  CYS B CA  1 
ATOM   1583 C  C   . CYS B 1 72  ? -27.856 -27.285 121.040 1.00 25.34 ? 72  CYS B C   1 
ATOM   1584 O  O   . CYS B 1 72  ? -28.223 -28.459 121.372 1.00 26.72 ? 72  CYS B O   1 
ATOM   1585 C  CB  . CYS B 1 72  ? -28.478 -26.608 118.712 1.00 26.03 ? 72  CYS B CB  1 
ATOM   1586 S  SG  . CYS B 1 72  ? -28.258 -24.843 119.047 1.00 28.05 ? 72  CYS B SG  1 
ATOM   1587 N  N   . GLU B 1 73  ? -27.936 -26.295 121.922 1.00 24.42 ? 73  GLU B N   1 
ATOM   1588 C  CA  . GLU B 1 73  ? -28.428 -26.652 123.323 1.00 23.39 ? 73  GLU B CA  1 
ATOM   1589 C  C   . GLU B 1 73  ? -28.631 -25.487 124.187 1.00 21.56 ? 73  GLU B C   1 
ATOM   1590 O  O   . GLU B 1 73  ? -27.975 -24.478 123.702 1.00 20.94 ? 73  GLU B O   1 
ATOM   1591 C  CB  . GLU B 1 73  ? -27.309 -27.509 123.868 1.00 24.78 ? 73  GLU B CB  1 
ATOM   1592 C  CG  . GLU B 1 73  ? -27.303 -28.178 125.170 1.00 26.66 ? 73  GLU B CG  1 
ATOM   1593 C  CD  . GLU B 1 73  ? -26.467 -29.440 125.307 1.00 27.98 ? 73  GLU B CD  1 
ATOM   1594 O  OE1 . GLU B 1 73  ? -26.826 -30.376 126.030 1.00 28.66 ? 73  GLU B OE1 1 
ATOM   1595 O  OE2 . GLU B 1 73  ? -25.426 -29.376 124.627 1.00 28.31 ? 73  GLU B OE2 1 
ATOM   1596 N  N   . LEU B 1 74  ? -29.389 -25.413 125.304 1.00 19.63 ? 74  LEU B N   1 
ATOM   1597 C  CA  . LEU B 1 74  ? -29.303 -24.053 125.902 1.00 18.85 ? 74  LEU B CA  1 
ATOM   1598 C  C   . LEU B 1 74  ? -28.030 -24.321 126.845 1.00 18.68 ? 74  LEU B C   1 
ATOM   1599 O  O   . LEU B 1 74  ? -28.090 -25.318 127.470 1.00 18.90 ? 74  LEU B O   1 
ATOM   1600 C  CB  . LEU B 1 74  ? -30.205 -23.316 126.761 1.00 17.94 ? 74  LEU B CB  1 
ATOM   1601 C  CG  . LEU B 1 74  ? -31.343 -23.881 127.495 1.00 18.80 ? 74  LEU B CG  1 
ATOM   1602 C  CD1 . LEU B 1 74  ? -31.265 -25.431 127.441 1.00 19.06 ? 74  LEU B CD1 1 
ATOM   1603 C  CD2 . LEU B 1 74  ? -31.308 -23.350 128.931 1.00 18.49 ? 74  LEU B CD2 1 
ATOM   1604 N  N   . SER B 1 75  ? -27.190 -23.343 126.678 1.00 18.16 ? 75  SER B N   1 
ATOM   1605 C  CA  . SER B 1 75  ? -26.006 -23.372 127.508 1.00 17.61 ? 75  SER B CA  1 
ATOM   1606 C  C   . SER B 1 75  ? -26.522 -22.660 128.771 1.00 17.95 ? 75  SER B C   1 
ATOM   1607 O  O   . SER B 1 75  ? -26.114 -23.129 129.859 1.00 19.27 ? 75  SER B O   1 
ATOM   1608 C  CB  . SER B 1 75  ? -24.862 -22.745 126.843 1.00 18.17 ? 75  SER B CB  1 
ATOM   1609 O  OG  . SER B 1 75  ? -23.834 -22.421 127.785 1.00 19.72 ? 75  SER B OG  1 
ATOM   1610 N  N   . THR B 1 76  ? -27.375 -21.644 128.687 1.00 17.20 ? 76  THR B N   1 
ATOM   1611 C  CA  . THR B 1 76  ? -27.805 -21.037 129.975 1.00 17.15 ? 76  THR B CA  1 
ATOM   1612 C  C   . THR B 1 76  ? -28.961 -20.114 129.890 1.00 17.19 ? 76  THR B C   1 
ATOM   1613 O  O   . THR B 1 76  ? -29.336 -19.700 128.810 1.00 17.44 ? 76  THR B O   1 
ATOM   1614 C  CB  . THR B 1 76  ? -26.530 -20.343 130.599 1.00 18.30 ? 76  THR B CB  1 
ATOM   1615 O  OG1 . THR B 1 76  ? -27.007 -19.762 131.841 1.00 19.24 ? 76  THR B OG1 1 
ATOM   1616 C  CG2 . THR B 1 76  ? -25.910 -19.364 129.620 1.00 18.50 ? 76  THR B CG2 1 
ATOM   1617 N  N   . GLU B 1 77  ? -29.573 -19.795 131.003 1.00 18.31 ? 77  GLU B N   1 
ATOM   1618 C  CA  . GLU B 1 77  ? -30.784 -18.937 131.024 1.00 20.40 ? 77  GLU B CA  1 
ATOM   1619 C  C   . GLU B 1 77  ? -30.509 -17.663 131.777 1.00 20.63 ? 77  GLU B C   1 
ATOM   1620 O  O   . GLU B 1 77  ? -29.683 -17.815 132.721 1.00 21.81 ? 77  GLU B O   1 
ATOM   1621 C  CB  . GLU B 1 77  ? -31.951 -19.676 131.637 1.00 21.97 ? 77  GLU B CB  1 
ATOM   1622 C  CG  . GLU B 1 77  ? -32.109 -21.173 131.644 1.00 24.78 ? 77  GLU B CG  1 
ATOM   1623 C  CD  . GLU B 1 77  ? -33.423 -21.787 132.037 1.00 27.06 ? 77  GLU B CD  1 
ATOM   1624 O  OE1 . GLU B 1 77  ? -34.550 -21.603 131.556 1.00 27.94 ? 77  GLU B OE1 1 
ATOM   1625 O  OE2 . GLU B 1 77  ? -33.329 -22.628 133.001 1.00 28.96 ? 77  GLU B OE2 1 
ATOM   1626 N  N   . LEU B 1 78  ? -31.105 -16.519 131.451 1.00 19.82 ? 78  LEU B N   1 
ATOM   1627 C  CA  . LEU B 1 78  ? -30.734 -15.318 132.234 1.00 19.14 ? 78  LEU B CA  1 
ATOM   1628 C  C   . LEU B 1 78  ? -31.869 -14.306 132.392 1.00 19.01 ? 78  LEU B C   1 
ATOM   1629 O  O   . LEU B 1 78  ? -32.909 -14.441 131.778 1.00 18.34 ? 78  LEU B O   1 
ATOM   1630 C  CB  . LEU B 1 78  ? -29.455 -14.723 131.630 1.00 18.58 ? 78  LEU B CB  1 
ATOM   1631 C  CG  . LEU B 1 78  ? -28.925 -15.140 130.294 1.00 17.83 ? 78  LEU B CG  1 
ATOM   1632 C  CD1 . LEU B 1 78  ? -30.053 -15.066 129.247 1.00 17.66 ? 78  LEU B CD1 1 
ATOM   1633 C  CD2 . LEU B 1 78  ? -27.775 -14.230 129.881 1.00 16.38 ? 78  LEU B CD2 1 
ATOM   1634 N  N   . ALA B 1 79  ? -31.542 -13.376 133.334 1.00 19.12 ? 79  ALA B N   1 
ATOM   1635 C  CA  . ALA B 1 79  ? -32.454 -12.295 133.669 1.00 19.15 ? 79  ALA B CA  1 
ATOM   1636 C  C   . ALA B 1 79  ? -31.605 -11.034 133.967 1.00 20.23 ? 79  ALA B C   1 
ATOM   1637 O  O   . ALA B 1 79  ? -30.381 -11.063 134.089 1.00 19.35 ? 79  ALA B O   1 
ATOM   1638 C  CB  . ALA B 1 79  ? -33.327 -12.519 134.849 1.00 18.30 ? 79  ALA B CB  1 
ATOM   1639 N  N   . VAL B 1 80  ? -32.400 -9.967  134.092 1.00 21.67 ? 80  VAL B N   1 
ATOM   1640 C  CA  . VAL B 1 80  ? -31.810 -8.674  134.357 1.00 23.08 ? 80  VAL B CA  1 
ATOM   1641 C  C   . VAL B 1 80  ? -32.391 -7.938  135.540 1.00 24.23 ? 80  VAL B C   1 
ATOM   1642 O  O   . VAL B 1 80  ? -33.596 -8.148  135.848 1.00 24.08 ? 80  VAL B O   1 
ATOM   1643 C  CB  . VAL B 1 80  ? -31.991 -7.737  133.102 1.00 23.01 ? 80  VAL B CB  1 
ATOM   1644 C  CG1 . VAL B 1 80  ? -30.936 -8.097  132.086 1.00 23.41 ? 80  VAL B CG1 1 
ATOM   1645 C  CG2 . VAL B 1 80  ? -33.419 -7.784  132.649 1.00 22.21 ? 80  VAL B CG2 1 
ATOM   1646 N  N   . THR B 1 81  ? -31.466 -7.061  136.040 1.00 24.49 ? 81  THR B N   1 
ATOM   1647 C  CA  . THR B 1 81  ? -31.994 -6.283  137.203 1.00 25.02 ? 81  THR B CA  1 
ATOM   1648 C  C   . THR B 1 81  ? -31.777 -4.820  137.083 1.00 25.02 ? 81  THR B C   1 
ATOM   1649 O  O   . THR B 1 81  ? -31.497 -4.290  136.033 1.00 25.75 ? 81  THR B O   1 
ATOM   1650 C  CB  . THR B 1 81  ? -31.317 -6.839  138.506 1.00 25.16 ? 81  THR B CB  1 
ATOM   1651 O  OG1 . THR B 1 81  ? -29.908 -6.794  138.110 1.00 26.46 ? 81  THR B OG1 1 
ATOM   1652 C  CG2 . THR B 1 81  ? -31.834 -8.190  138.880 1.00 25.00 ? 81  THR B CG2 1 
ATOM   1653 N  N   . VAL B 1 82  ? -31.933 -4.141  138.203 1.00 25.31 ? 82  VAL B N   1 
ATOM   1654 C  CA  . VAL B 1 82  ? -31.786 -2.736  138.413 1.00 24.78 ? 82  VAL B CA  1 
ATOM   1655 C  C   . VAL B 1 82  ? -30.342 -2.386  137.963 1.00 25.15 ? 82  VAL B C   1 
ATOM   1656 O  O   . VAL B 1 82  ? -30.103 -1.403  137.324 1.00 25.70 ? 82  VAL B O   1 
ATOM   1657 C  CB  . VAL B 1 82  ? -31.863 -2.204  139.890 1.00 23.38 ? 82  VAL B CB  1 
ATOM   1658 C  CG1 . VAL B 1 82  ? -32.830 -1.058  140.071 1.00 22.82 ? 82  VAL B CG1 1 
ATOM   1659 C  CG2 . VAL B 1 82  ? -32.093 -3.327  140.873 1.00 22.14 ? 82  VAL B CG2 1 
ATOM   1660 N  N   . THR B 1 83  ? -29.499 -3.293  138.448 1.00 25.03 ? 83  THR B N   1 
ATOM   1661 C  CA  . THR B 1 83  ? -28.068 -3.173  138.297 1.00 25.40 ? 83  THR B CA  1 
ATOM   1662 C  C   . THR B 1 83  ? -27.369 -4.261  137.529 1.00 25.80 ? 83  THR B C   1 
ATOM   1663 O  O   . THR B 1 83  ? -27.910 -5.262  137.018 1.00 26.28 ? 83  THR B O   1 
ATOM   1664 C  CB  . THR B 1 83  ? -27.537 -3.075  139.798 1.00 25.15 ? 83  THR B CB  1 
ATOM   1665 O  OG1 . THR B 1 83  ? -27.302 -4.419  140.225 1.00 24.94 ? 83  THR B OG1 1 
ATOM   1666 C  CG2 . THR B 1 83  ? -28.537 -2.375  140.720 1.00 25.80 ? 83  THR B CG2 1 
ATOM   1667 N  N   . ILE B 1 84  ? -26.059 -4.077  137.421 1.00 25.60 ? 84  ILE B N   1 
ATOM   1668 C  CA  . ILE B 1 84  ? -25.204 -4.974  136.732 1.00 26.28 ? 84  ILE B CA  1 
ATOM   1669 C  C   . ILE B 1 84  ? -24.884 -6.276  137.398 1.00 26.38 ? 84  ILE B C   1 
ATOM   1670 O  O   . ILE B 1 84  ? -24.641 -6.280  138.630 1.00 27.29 ? 84  ILE B O   1 
ATOM   1671 C  CB  . ILE B 1 84  ? -23.816 -4.189  136.585 1.00 27.41 ? 84  ILE B CB  1 
ATOM   1672 C  CG1 . ILE B 1 84  ? -24.140 -2.865  135.870 1.00 28.98 ? 84  ILE B CG1 1 
ATOM   1673 C  CG2 . ILE B 1 84  ? -22.708 -4.994  135.896 1.00 27.33 ? 84  ILE B CG2 1 
ATOM   1674 C  CD1 . ILE B 1 84  ? -22.876 -2.098  135.298 1.00 29.73 ? 84  ILE B CD1 1 
ATOM   1675 N  N   . VAL B 1 85  ? -24.772 -7.324  136.630 1.00 25.35 ? 85  VAL B N   1 
ATOM   1676 C  CA  . VAL B 1 85  ? -24.336 -8.627  137.175 1.00 24.86 ? 85  VAL B CA  1 
ATOM   1677 C  C   . VAL B 1 85  ? -23.627 -9.208  135.913 1.00 25.17 ? 85  VAL B C   1 
ATOM   1678 O  O   . VAL B 1 85  ? -24.089 -9.191  134.783 1.00 24.38 ? 85  VAL B O   1 
ATOM   1679 C  CB  . VAL B 1 85  ? -25.374 -9.461  137.846 1.00 24.67 ? 85  VAL B CB  1 
ATOM   1680 C  CG1 . VAL B 1 85  ? -26.791 -8.865  137.753 1.00 25.49 ? 85  VAL B CG1 1 
ATOM   1681 C  CG2 . VAL B 1 85  ? -25.410 -10.890 137.318 1.00 24.62 ? 85  VAL B CG2 1 
ATOM   1682 N  N   . VAL B 1 86  ? -22.449 -9.642  136.309 1.00 25.39 ? 86  VAL B N   1 
ATOM   1683 C  CA  . VAL B 1 86  ? -21.437 -10.224 135.439 1.00 24.79 ? 86  VAL B CA  1 
ATOM   1684 C  C   . VAL B 1 86  ? -21.207 -11.654 135.725 1.00 25.42 ? 86  VAL B C   1 
ATOM   1685 O  O   . VAL B 1 86  ? -20.723 -11.888 136.869 1.00 26.87 ? 86  VAL B O   1 
ATOM   1686 C  CB  . VAL B 1 86  ? -20.192 -9.325  135.762 1.00 23.92 ? 86  VAL B CB  1 
ATOM   1687 C  CG1 . VAL B 1 86  ? -18.899 -9.776  135.164 1.00 23.22 ? 86  VAL B CG1 1 
ATOM   1688 C  CG2 . VAL B 1 86  ? -20.591 -7.903  135.399 1.00 23.16 ? 86  VAL B CG2 1 
ATOM   1689 N  N   . THR B 1 87  ? -21.476 -12.585 134.911 1.00 25.62 ? 87  THR B N   1 
ATOM   1690 C  CA  . THR B 1 87  ? -21.285 -13.986 135.033 1.00 25.50 ? 87  THR B CA  1 
ATOM   1691 C  C   . THR B 1 87  ? -20.102 -14.397 134.154 1.00 25.25 ? 87  THR B C   1 
ATOM   1692 O  O   . THR B 1 87  ? -19.672 -13.557 133.328 1.00 24.71 ? 87  THR B O   1 
ATOM   1693 C  CB  . THR B 1 87  ? -22.529 -14.805 134.494 1.00 26.10 ? 87  THR B CB  1 
ATOM   1694 O  OG1 . THR B 1 87  ? -23.672 -13.889 134.537 1.00 25.89 ? 87  THR B OG1 1 
ATOM   1695 C  CG2 . THR B 1 87  ? -22.681 -16.141 135.235 1.00 26.78 ? 87  THR B CG2 1 
ATOM   1696 N  N   . SER B 1 88  ? -19.715 -15.643 134.300 1.00 25.21 ? 88  SER B N   1 
ATOM   1697 C  CA  . SER B 1 88  ? -18.630 -16.153 133.400 1.00 25.46 ? 88  SER B CA  1 
ATOM   1698 C  C   . SER B 1 88  ? -18.936 -17.641 133.219 1.00 24.90 ? 88  SER B C   1 
ATOM   1699 O  O   . SER B 1 88  ? -19.449 -18.204 134.187 1.00 24.38 ? 88  SER B O   1 
ATOM   1700 C  CB  . SER B 1 88  ? -17.295 -15.813 133.949 1.00 25.83 ? 88  SER B CB  1 
ATOM   1701 O  OG  . SER B 1 88  ? -16.605 -17.007 134.339 1.00 27.89 ? 88  SER B OG  1 
ATOM   1702 N  N   . GLU B 1 89  ? -18.683 -18.228 132.095 1.00 25.08 ? 89  GLU B N   1 
ATOM   1703 C  CA  . GLU B 1 89  ? -18.941 -19.692 131.896 1.00 25.77 ? 89  GLU B CA  1 
ATOM   1704 C  C   . GLU B 1 89  ? -17.759 -20.235 131.118 1.00 24.40 ? 89  GLU B C   1 
ATOM   1705 O  O   . GLU B 1 89  ? -17.401 -19.590 130.133 1.00 24.05 ? 89  GLU B O   1 
ATOM   1706 C  CB  . GLU B 1 89  ? -20.261 -19.952 131.233 1.00 27.90 ? 89  GLU B CB  1 
ATOM   1707 C  CG  . GLU B 1 89  ? -21.541 -19.754 131.968 1.00 31.24 ? 89  GLU B CG  1 
ATOM   1708 C  CD  . GLU B 1 89  ? -22.175 -20.571 133.032 1.00 33.83 ? 89  GLU B CD  1 
ATOM   1709 O  OE1 . GLU B 1 89  ? -23.343 -20.278 133.503 1.00 35.04 ? 89  GLU B OE1 1 
ATOM   1710 O  OE2 . GLU B 1 89  ? -21.601 -21.611 133.550 1.00 34.40 ? 89  GLU B OE2 1 
ATOM   1711 N  N   . LEU B 1 90  ? -17.103 -21.301 131.536 1.00 23.47 ? 90  LEU B N   1 
ATOM   1712 C  CA  . LEU B 1 90  ? -15.917 -21.854 130.830 1.00 21.93 ? 90  LEU B CA  1 
ATOM   1713 C  C   . LEU B 1 90  ? -16.406 -22.515 129.493 1.00 20.19 ? 90  LEU B C   1 
ATOM   1714 O  O   . LEU B 1 90  ? -17.495 -23.137 129.437 1.00 20.29 ? 90  LEU B O   1 
ATOM   1715 C  CB  . LEU B 1 90  ? -15.165 -22.773 131.682 1.00 22.51 ? 90  LEU B CB  1 
ATOM   1716 C  CG  . LEU B 1 90  ? -14.389 -22.716 132.934 1.00 22.89 ? 90  LEU B CG  1 
ATOM   1717 C  CD1 . LEU B 1 90  ? -13.822 -21.305 133.184 1.00 23.65 ? 90  LEU B CD1 1 
ATOM   1718 C  CD2 . LEU B 1 90  ? -15.278 -23.061 134.107 1.00 23.13 ? 90  LEU B CD2 1 
ATOM   1719 N  N   . VAL B 1 91  ? -15.573 -22.364 128.475 1.00 17.41 ? 91  VAL B N   1 
ATOM   1720 C  CA  . VAL B 1 91  ? -15.923 -22.903 127.162 1.00 16.03 ? 91  VAL B CA  1 
ATOM   1721 C  C   . VAL B 1 91  ? -15.342 -24.299 126.988 1.00 16.02 ? 91  VAL B C   1 
ATOM   1722 O  O   . VAL B 1 91  ? -14.545 -24.603 126.123 1.00 16.10 ? 91  VAL B O   1 
ATOM   1723 C  CB  . VAL B 1 91  ? -15.482 -21.884 126.121 1.00 15.31 ? 91  VAL B CB  1 
ATOM   1724 C  CG1 . VAL B 1 91  ? -16.123 -22.172 124.771 1.00 15.11 ? 91  VAL B CG1 1 
ATOM   1725 C  CG2 . VAL B 1 91  ? -15.807 -20.496 126.587 1.00 14.94 ? 91  VAL B CG2 1 
ATOM   1726 N  N   . MET B 1 92  ? -15.765 -25.154 127.824 1.00 15.86 ? 92  MET B N   1 
ATOM   1727 C  CA  . MET B 1 92  ? -15.453 -26.527 128.067 1.00 16.09 ? 92  MET B CA  1 
ATOM   1728 C  C   . MET B 1 92  ? -16.775 -27.256 127.907 1.00 16.58 ? 92  MET B C   1 
ATOM   1729 O  O   . MET B 1 92  ? -17.852 -26.817 128.392 1.00 16.97 ? 92  MET B O   1 
ATOM   1730 C  CB  . MET B 1 92  ? -14.871 -26.592 129.423 1.00 16.96 ? 92  MET B CB  1 
ATOM   1731 C  CG  . MET B 1 92  ? -14.684 -27.853 130.221 1.00 18.22 ? 92  MET B CG  1 
ATOM   1732 S  SD  . MET B 1 92  ? -14.305 -27.067 131.899 1.00 17.85 ? 92  MET B SD  1 
ATOM   1733 C  CE  . MET B 1 92  ? -14.177 -28.522 132.902 1.00 18.60 ? 92  MET B CE  1 
ATOM   1734 N  N   . PRO B 1 93  ? -16.623 -28.377 127.220 1.00 16.23 ? 93  PRO B N   1 
ATOM   1735 C  CA  . PRO B 1 93  ? -17.781 -29.227 126.966 1.00 16.20 ? 93  PRO B CA  1 
ATOM   1736 C  C   . PRO B 1 93  ? -18.445 -29.595 128.256 1.00 16.59 ? 93  PRO B C   1 
ATOM   1737 O  O   . PRO B 1 93  ? -19.577 -30.095 128.203 1.00 16.75 ? 93  PRO B O   1 
ATOM   1738 C  CB  . PRO B 1 93  ? -17.228 -30.424 126.235 1.00 16.01 ? 93  PRO B CB  1 
ATOM   1739 C  CG  . PRO B 1 93  ? -15.772 -30.398 126.561 1.00 16.13 ? 93  PRO B CG  1 
ATOM   1740 C  CD  . PRO B 1 93  ? -15.401 -28.920 126.648 1.00 15.75 ? 93  PRO B CD  1 
ATOM   1741 N  N   . PHE B 1 94  ? -17.795 -29.417 129.407 1.00 17.17 ? 94  PHE B N   1 
ATOM   1742 C  CA  . PHE B 1 94  ? -18.584 -29.934 130.602 1.00 17.10 ? 94  PHE B CA  1 
ATOM   1743 C  C   . PHE B 1 94  ? -19.672 -28.940 130.912 1.00 18.05 ? 94  PHE B C   1 
ATOM   1744 O  O   . PHE B 1 94  ? -20.828 -29.273 131.187 1.00 16.87 ? 94  PHE B O   1 
ATOM   1745 C  CB  . PHE B 1 94  ? -17.650 -30.318 131.720 1.00 16.17 ? 94  PHE B CB  1 
ATOM   1746 C  CG  . PHE B 1 94  ? -18.351 -30.687 132.989 1.00 15.60 ? 94  PHE B CG  1 
ATOM   1747 C  CD1 . PHE B 1 94  ? -18.415 -31.999 133.420 1.00 15.19 ? 94  PHE B CD1 1 
ATOM   1748 C  CD2 . PHE B 1 94  ? -18.961 -29.670 133.764 1.00 15.17 ? 94  PHE B CD2 1 
ATOM   1749 C  CE1 . PHE B 1 94  ? -19.087 -32.326 134.605 1.00 14.56 ? 94  PHE B CE1 1 
ATOM   1750 C  CE2 . PHE B 1 94  ? -19.630 -30.004 134.951 1.00 14.19 ? 94  PHE B CE2 1 
ATOM   1751 C  CZ  . PHE B 1 94  ? -19.691 -31.330 135.362 1.00 14.10 ? 94  PHE B CZ  1 
ATOM   1752 N  N   . THR B 1 95  ? -19.305 -27.718 130.856 1.00 19.90 ? 95  THR B N   1 
ATOM   1753 C  CA  . THR B 1 95  ? -20.159 -26.584 131.136 1.00 21.85 ? 95  THR B CA  1 
ATOM   1754 C  C   . THR B 1 95  ? -20.928 -26.045 129.987 1.00 21.94 ? 95  THR B C   1 
ATOM   1755 O  O   . THR B 1 95  ? -21.682 -25.058 130.260 1.00 22.64 ? 95  THR B O   1 
ATOM   1756 C  CB  . THR B 1 95  ? -19.112 -25.465 131.620 1.00 22.81 ? 95  THR B CB  1 
ATOM   1757 O  OG1 . THR B 1 95  ? -17.815 -26.147 131.263 1.00 24.00 ? 95  THR B OG1 1 
ATOM   1758 C  CG2 . THR B 1 95  ? -19.096 -25.010 133.038 1.00 23.26 ? 95  THR B CG2 1 
ATOM   1759 N  N   . VAL B 1 96  ? -20.703 -26.608 128.779 1.00 21.37 ? 96  VAL B N   1 
ATOM   1760 C  CA  . VAL B 1 96  ? -21.436 -25.818 127.684 1.00 20.90 ? 96  VAL B CA  1 
ATOM   1761 C  C   . VAL B 1 96  ? -22.871 -26.133 127.684 1.00 20.60 ? 96  VAL B C   1 
ATOM   1762 O  O   . VAL B 1 96  ? -23.606 -25.142 127.457 1.00 20.40 ? 96  VAL B O   1 
ATOM   1763 C  CB  . VAL B 1 96  ? -20.558 -25.932 126.440 1.00 21.08 ? 96  VAL B CB  1 
ATOM   1764 C  CG1 . VAL B 1 96  ? -21.158 -25.984 125.109 1.00 20.51 ? 96  VAL B CG1 1 
ATOM   1765 C  CG2 . VAL B 1 96  ? -19.632 -24.646 126.565 1.00 21.54 ? 96  VAL B CG2 1 
ATOM   1766 N  N   . GLY B 1 97  ? -23.215 -27.330 127.958 1.00 21.18 ? 97  GLY B N   1 
ATOM   1767 C  CA  . GLY B 1 97  ? -24.696 -27.726 127.974 1.00 21.41 ? 97  GLY B CA  1 
ATOM   1768 C  C   . GLY B 1 97  ? -24.712 -29.075 128.696 1.00 20.97 ? 97  GLY B C   1 
ATOM   1769 O  O   . GLY B 1 97  ? -23.623 -29.563 129.042 1.00 21.35 ? 97  GLY B O   1 
ATOM   1770 N  N   . THR B 1 98  ? -25.813 -29.679 128.935 1.00 20.90 ? 98  THR B N   1 
ATOM   1771 C  CA  . THR B 1 98  ? -25.943 -30.941 129.650 1.00 20.78 ? 98  THR B CA  1 
ATOM   1772 C  C   . THR B 1 98  ? -25.763 -32.174 128.794 1.00 19.99 ? 98  THR B C   1 
ATOM   1773 O  O   . THR B 1 98  ? -25.395 -33.283 129.248 1.00 20.37 ? 98  THR B O   1 
ATOM   1774 C  CB  . THR B 1 98  ? -27.385 -30.991 130.319 1.00 21.28 ? 98  THR B CB  1 
ATOM   1775 O  OG1 . THR B 1 98  ? -27.525 -29.754 131.054 1.00 21.71 ? 98  THR B OG1 1 
ATOM   1776 C  CG2 . THR B 1 98  ? -27.615 -32.178 131.241 1.00 22.37 ? 98  THR B CG2 1 
ATOM   1777 N  N   . TRP B 1 99  ? -26.093 -31.955 127.525 1.00 18.03 ? 99  TRP B N   1 
ATOM   1778 C  CA  . TRP B 1 99  ? -26.012 -33.160 126.623 1.00 16.24 ? 99  TRP B CA  1 
ATOM   1779 C  C   . TRP B 1 99  ? -24.556 -33.335 126.325 1.00 15.80 ? 99  TRP B C   1 
ATOM   1780 O  O   . TRP B 1 99  ? -23.987 -34.419 126.450 1.00 15.63 ? 99  TRP B O   1 
ATOM   1781 C  CB  . TRP B 1 99  ? -27.024 -32.890 125.513 1.00 15.00 ? 99  TRP B CB  1 
ATOM   1782 C  CG  . TRP B 1 99  ? -27.358 -33.835 124.450 1.00 13.09 ? 99  TRP B CG  1 
ATOM   1783 C  CD1 . TRP B 1 99  ? -28.477 -34.632 124.278 1.00 12.68 ? 99  TRP B CD1 1 
ATOM   1784 C  CD2 . TRP B 1 99  ? -26.534 -34.155 123.327 1.00 12.45 ? 99  TRP B CD2 1 
ATOM   1785 N  NE1 . TRP B 1 99  ? -28.431 -35.407 123.156 1.00 11.43 ? 99  TRP B NE1 1 
ATOM   1786 C  CE2 . TRP B 1 99  ? -27.226 -35.139 122.559 1.00 12.40 ? 99  TRP B CE2 1 
ATOM   1787 C  CE3 . TRP B 1 99  ? -25.271 -33.716 122.946 1.00 11.91 ? 99  TRP B CE3 1 
ATOM   1788 C  CZ2 . TRP B 1 99  ? -26.665 -35.693 121.398 1.00 12.28 ? 99  TRP B CZ2 1 
ATOM   1789 C  CZ3 . TRP B 1 99  ? -24.748 -34.258 121.790 1.00 12.10 ? 99  TRP B CZ3 1 
ATOM   1790 C  CH2 . TRP B 1 99  ? -25.415 -35.215 121.038 1.00 12.09 ? 99  TRP B CH2 1 
ATOM   1791 N  N   . LEU B 1 100 ? -24.004 -32.166 125.919 1.00 15.57 ? 100 LEU B N   1 
ATOM   1792 C  CA  . LEU B 1 100 ? -22.578 -32.240 125.501 1.00 15.17 ? 100 LEU B CA  1 
ATOM   1793 C  C   . LEU B 1 100 ? -21.875 -32.927 126.665 1.00 14.35 ? 100 LEU B C   1 
ATOM   1794 O  O   . LEU B 1 100 ? -21.054 -33.797 126.353 1.00 14.28 ? 100 LEU B O   1 
ATOM   1795 C  CB  . LEU B 1 100 ? -22.058 -30.920 125.056 1.00 15.66 ? 100 LEU B CB  1 
ATOM   1796 C  CG  . LEU B 1 100 ? -21.026 -30.852 123.937 1.00 15.23 ? 100 LEU B CG  1 
ATOM   1797 C  CD1 . LEU B 1 100 ? -19.824 -30.071 124.406 1.00 15.03 ? 100 LEU B CD1 1 
ATOM   1798 C  CD2 . LEU B 1 100 ? -20.632 -32.269 123.557 1.00 14.99 ? 100 LEU B CD2 1 
ATOM   1799 N  N   . ARG B 1 101 ? -22.302 -32.530 127.825 1.00 13.92 ? 101 ARG B N   1 
ATOM   1800 C  CA  . ARG B 1 101 ? -21.663 -33.136 129.023 1.00 14.60 ? 101 ARG B CA  1 
ATOM   1801 C  C   . ARG B 1 101 ? -21.796 -34.643 128.998 1.00 14.48 ? 101 ARG B C   1 
ATOM   1802 O  O   . ARG B 1 101 ? -20.837 -35.416 128.849 1.00 15.15 ? 101 ARG B O   1 
ATOM   1803 C  CB  . ARG B 1 101 ? -22.252 -32.525 130.264 1.00 15.97 ? 101 ARG B CB  1 
ATOM   1804 C  CG  . ARG B 1 101 ? -21.411 -32.917 131.487 1.00 17.79 ? 101 ARG B CG  1 
ATOM   1805 C  CD  . ARG B 1 101 ? -21.548 -32.095 132.607 1.00 19.55 ? 101 ARG B CD  1 
ATOM   1806 N  NE  . ARG B 1 101 ? -22.683 -31.737 133.370 1.00 21.95 ? 101 ARG B NE  1 
ATOM   1807 C  CZ  . ARG B 1 101 ? -22.908 -30.412 133.648 1.00 23.37 ? 101 ARG B CZ  1 
ATOM   1808 N  NH1 . ARG B 1 101 ? -22.498 -29.445 132.829 1.00 24.07 ? 101 ARG B NH1 1 
ATOM   1809 N  NH2 . ARG B 1 101 ? -23.432 -30.009 134.811 1.00 24.18 ? 101 ARG B NH2 1 
ATOM   1810 N  N   . GLY B 1 102 ? -23.001 -35.136 129.141 1.00 14.01 ? 102 GLY B N   1 
ATOM   1811 C  CA  . GLY B 1 102 ? -23.246 -36.551 129.089 1.00 14.00 ? 102 GLY B CA  1 
ATOM   1812 C  C   . GLY B 1 102 ? -22.646 -37.138 127.825 1.00 14.25 ? 102 GLY B C   1 
ATOM   1813 O  O   . GLY B 1 102 ? -22.425 -38.375 127.877 1.00 15.07 ? 102 GLY B O   1 
ATOM   1814 N  N   . VAL B 1 103 ? -22.392 -36.414 126.728 1.00 14.09 ? 103 VAL B N   1 
ATOM   1815 C  CA  . VAL B 1 103 ? -21.814 -37.194 125.605 1.00 13.65 ? 103 VAL B CA  1 
ATOM   1816 C  C   . VAL B 1 103 ? -20.277 -37.148 125.695 1.00 15.08 ? 103 VAL B C   1 
ATOM   1817 O  O   . VAL B 1 103 ? -19.647 -38.198 125.853 1.00 14.77 ? 103 VAL B O   1 
ATOM   1818 C  CB  . VAL B 1 103 ? -22.290 -36.793 124.225 1.00 12.42 ? 103 VAL B CB  1 
ATOM   1819 C  CG1 . VAL B 1 103 ? -21.689 -37.839 123.259 1.00 11.42 ? 103 VAL B CG1 1 
ATOM   1820 C  CG2 . VAL B 1 103 ? -23.770 -36.652 124.089 1.00 11.17 ? 103 VAL B CG2 1 
ATOM   1821 N  N   . ALA B 1 104 ? -19.754 -35.951 125.560 1.00 16.88 ? 104 ALA B N   1 
ATOM   1822 C  CA  . ALA B 1 104 ? -18.313 -35.692 125.563 1.00 18.91 ? 104 ALA B CA  1 
ATOM   1823 C  C   . ALA B 1 104 ? -17.580 -36.560 126.586 1.00 21.06 ? 104 ALA B C   1 
ATOM   1824 O  O   . ALA B 1 104 ? -16.468 -37.087 126.393 1.00 21.68 ? 104 ALA B O   1 
ATOM   1825 C  CB  . ALA B 1 104 ? -18.054 -34.254 125.879 1.00 19.19 ? 104 ALA B CB  1 
ATOM   1826 N  N   . GLN B 1 105 ? -18.255 -36.653 127.692 1.00 22.71 ? 105 GLN B N   1 
ATOM   1827 C  CA  . GLN B 1 105 ? -17.880 -37.432 128.880 1.00 24.30 ? 105 GLN B CA  1 
ATOM   1828 C  C   . GLN B 1 105 ? -17.189 -38.753 128.585 1.00 23.20 ? 105 GLN B C   1 
ATOM   1829 O  O   . GLN B 1 105 ? -16.282 -39.099 129.349 1.00 22.05 ? 105 GLN B O   1 
ATOM   1830 C  CB  . GLN B 1 105 ? -19.202 -37.630 129.563 1.00 27.36 ? 105 GLN B CB  1 
ATOM   1831 C  CG  . GLN B 1 105 ? -19.493 -38.473 130.690 1.00 30.85 ? 105 GLN B CG  1 
ATOM   1832 C  CD  . GLN B 1 105 ? -19.683 -37.691 131.994 1.00 33.67 ? 105 GLN B CD  1 
ATOM   1833 O  OE1 . GLN B 1 105 ? -18.743 -37.368 132.781 1.00 34.81 ? 105 GLN B OE1 1 
ATOM   1834 N  NE2 . GLN B 1 105 ? -20.991 -37.414 132.184 1.00 34.74 ? 105 GLN B NE2 1 
ATOM   1835 N  N   . ASN B 1 106 ? -17.578 -39.469 127.529 1.00 22.66 ? 106 ASN B N   1 
ATOM   1836 C  CA  . ASN B 1 106 ? -16.975 -40.792 127.253 1.00 22.27 ? 106 ASN B CA  1 
ATOM   1837 C  C   . ASN B 1 106 ? -15.794 -40.689 126.306 1.00 21.10 ? 106 ASN B C   1 
ATOM   1838 O  O   . ASN B 1 106 ? -15.360 -41.678 125.720 1.00 21.00 ? 106 ASN B O   1 
ATOM   1839 C  CB  . ASN B 1 106 ? -18.035 -41.810 126.800 1.00 23.74 ? 106 ASN B CB  1 
ATOM   1840 C  CG  . ASN B 1 106 ? -19.440 -41.314 127.173 1.00 24.90 ? 106 ASN B CG  1 
ATOM   1841 O  OD1 . ASN B 1 106 ? -20.181 -41.907 127.970 1.00 25.43 ? 106 ASN B OD1 1 
ATOM   1842 N  ND2 . ASN B 1 106 ? -19.826 -40.175 126.575 1.00 25.02 ? 106 ASN B ND2 1 
ATOM   1843 N  N   . TRP B 1 107 ? -15.223 -39.528 126.240 1.00 20.02 ? 107 TRP B N   1 
ATOM   1844 C  CA  . TRP B 1 107 ? -14.014 -39.273 125.428 1.00 18.62 ? 107 TRP B CA  1 
ATOM   1845 C  C   . TRP B 1 107 ? -12.965 -38.650 126.353 1.00 18.19 ? 107 TRP B C   1 
ATOM   1846 O  O   . TRP B 1 107 ? -13.326 -37.883 127.255 1.00 17.23 ? 107 TRP B O   1 
ATOM   1847 C  CB  . TRP B 1 107 ? -14.359 -38.424 124.208 1.00 16.95 ? 107 TRP B CB  1 
ATOM   1848 C  CG  . TRP B 1 107 ? -14.903 -39.255 123.103 1.00 15.87 ? 107 TRP B CG  1 
ATOM   1849 C  CD1 . TRP B 1 107 ? -14.243 -40.012 122.178 1.00 15.67 ? 107 TRP B CD1 1 
ATOM   1850 C  CD2 . TRP B 1 107 ? -16.303 -39.427 122.825 1.00 15.43 ? 107 TRP B CD2 1 
ATOM   1851 N  NE1 . TRP B 1 107 ? -15.129 -40.657 121.335 1.00 15.25 ? 107 TRP B NE1 1 
ATOM   1852 C  CE2 . TRP B 1 107 ? -16.399 -40.305 121.716 1.00 15.38 ? 107 TRP B CE2 1 
ATOM   1853 C  CE3 . TRP B 1 107 ? -17.453 -38.946 123.437 1.00 14.52 ? 107 TRP B CE3 1 
ATOM   1854 C  CZ2 . TRP B 1 107 ? -17.626 -40.695 121.200 1.00 15.09 ? 107 TRP B CZ2 1 
ATOM   1855 C  CZ3 . TRP B 1 107 ? -18.646 -39.307 122.937 1.00 14.12 ? 107 TRP B CZ3 1 
ATOM   1856 C  CH2 . TRP B 1 107 ? -18.725 -40.166 121.836 1.00 14.85 ? 107 TRP B CH2 1 
ATOM   1857 N  N   . SER B 1 108 ? -11.702 -38.951 126.142 1.00 18.52 ? 108 SER B N   1 
ATOM   1858 C  CA  . SER B 1 108 ? -10.682 -38.383 127.034 1.00 18.69 ? 108 SER B CA  1 
ATOM   1859 C  C   . SER B 1 108 ? -10.311 -36.996 126.558 1.00 19.40 ? 108 SER B C   1 
ATOM   1860 O  O   . SER B 1 108 ? -10.335 -36.073 127.396 1.00 20.47 ? 108 SER B O   1 
ATOM   1861 C  CB  . SER B 1 108 ? -9.406  -39.205 127.178 1.00 17.97 ? 108 SER B CB  1 
ATOM   1862 O  OG  . SER B 1 108 ? -9.573  -40.576 126.975 1.00 17.39 ? 108 SER B OG  1 
ATOM   1863 N  N   . LYS B 1 109 ? -9.922  -36.871 125.314 1.00 19.96 ? 109 LYS B N   1 
ATOM   1864 C  CA  . LYS B 1 109 ? -9.505  -35.445 124.913 1.00 19.99 ? 109 LYS B CA  1 
ATOM   1865 C  C   . LYS B 1 109 ? -10.591 -34.901 124.013 1.00 19.54 ? 109 LYS B C   1 
ATOM   1866 O  O   . LYS B 1 109 ? -11.628 -35.607 123.873 1.00 20.16 ? 109 LYS B O   1 
ATOM   1867 C  CB  . LYS B 1 109 ? -8.072  -35.506 124.433 1.00 19.72 ? 109 LYS B CB  1 
ATOM   1868 C  CG  . LYS B 1 109 ? -7.140  -34.737 125.356 1.00 19.31 ? 109 LYS B CG  1 
ATOM   1869 C  CD  . LYS B 1 109 ? -5.699  -34.989 125.347 1.00 19.82 ? 109 LYS B CD  1 
ATOM   1870 C  CE  . LYS B 1 109 ? -4.816  -35.425 124.227 1.00 19.28 ? 109 LYS B CE  1 
ATOM   1871 N  NZ  . LYS B 1 109 ? -5.394  -36.606 123.510 1.00 18.93 ? 109 LYS B NZ  1 
ATOM   1872 N  N   . TYR B 1 110 ? -10.460 -33.731 123.465 1.00 18.35 ? 110 TYR B N   1 
ATOM   1873 C  CA  . TYR B 1 110 ? -11.430 -33.133 122.557 1.00 17.86 ? 110 TYR B CA  1 
ATOM   1874 C  C   . TYR B 1 110 ? -10.807 -31.871 121.941 1.00 16.40 ? 110 TYR B C   1 
ATOM   1875 O  O   . TYR B 1 110 ? -9.733  -31.451 122.398 1.00 15.95 ? 110 TYR B O   1 
ATOM   1876 C  CB  . TYR B 1 110 ? -12.775 -32.798 123.210 1.00 19.65 ? 110 TYR B CB  1 
ATOM   1877 C  CG  . TYR B 1 110 ? -12.688 -31.440 123.917 1.00 20.99 ? 110 TYR B CG  1 
ATOM   1878 C  CD1 . TYR B 1 110 ? -12.792 -30.227 123.263 1.00 21.48 ? 110 TYR B CD1 1 
ATOM   1879 C  CD2 . TYR B 1 110 ? -12.442 -31.428 125.283 1.00 20.92 ? 110 TYR B CD2 1 
ATOM   1880 C  CE1 . TYR B 1 110 ? -12.648 -29.045 123.985 1.00 22.48 ? 110 TYR B CE1 1 
ATOM   1881 C  CE2 . TYR B 1 110 ? -12.313 -30.287 126.007 1.00 21.49 ? 110 TYR B CE2 1 
ATOM   1882 C  CZ  . TYR B 1 110 ? -12.420 -29.087 125.349 1.00 22.69 ? 110 TYR B CZ  1 
ATOM   1883 O  OH  . TYR B 1 110 ? -12.275 -27.939 126.117 1.00 24.50 ? 110 TYR B OH  1 
ATOM   1884 N  N   . ALA B 1 111 ? -11.489 -31.340 120.970 1.00 15.14 ? 111 ALA B N   1 
ATOM   1885 C  CA  . ALA B 1 111 ? -11.008 -30.103 120.275 1.00 14.14 ? 111 ALA B CA  1 
ATOM   1886 C  C   . ALA B 1 111 ? -12.230 -29.429 119.669 1.00 13.84 ? 111 ALA B C   1 
ATOM   1887 O  O   . ALA B 1 111 ? -13.131 -30.094 119.050 1.00 12.95 ? 111 ALA B O   1 
ATOM   1888 C  CB  . ALA B 1 111 ? -9.926  -30.456 119.318 1.00 13.42 ? 111 ALA B CB  1 
ATOM   1889 N  N   . TRP B 1 112 ? -12.226 -28.096 119.909 1.00 13.47 ? 112 TRP B N   1 
ATOM   1890 C  CA  . TRP B 1 112 ? -13.408 -27.305 119.387 1.00 13.23 ? 112 TRP B CA  1 
ATOM   1891 C  C   . TRP B 1 112 ? -13.284 -27.067 117.903 1.00 13.68 ? 112 TRP B C   1 
ATOM   1892 O  O   . TRP B 1 112 ? -12.282 -26.413 117.479 1.00 14.46 ? 112 TRP B O   1 
ATOM   1893 C  CB  . TRP B 1 112 ? -13.540 -25.994 120.107 1.00 12.13 ? 112 TRP B CB  1 
ATOM   1894 C  CG  . TRP B 1 112 ? -14.127 -25.989 121.469 1.00 11.94 ? 112 TRP B CG  1 
ATOM   1895 C  CD1 . TRP B 1 112 ? -13.547 -25.506 122.640 1.00 11.46 ? 112 TRP B CD1 1 
ATOM   1896 C  CD2 . TRP B 1 112 ? -15.401 -26.524 121.880 1.00 10.91 ? 112 TRP B CD2 1 
ATOM   1897 N  NE1 . TRP B 1 112 ? -14.366 -25.717 123.700 1.00 10.29 ? 112 TRP B NE1 1 
ATOM   1898 C  CE2 . TRP B 1 112 ? -15.511 -26.327 123.258 1.00 10.37 ? 112 TRP B CE2 1 
ATOM   1899 C  CE3 . TRP B 1 112 ? -16.420 -27.149 121.184 1.00 10.62 ? 112 TRP B CE3 1 
ATOM   1900 C  CZ2 . TRP B 1 112 ? -16.650 -26.701 123.962 1.00 10.15 ? 112 TRP B CZ2 1 
ATOM   1901 C  CZ3 . TRP B 1 112 ? -17.559 -27.501 121.878 1.00 10.28 ? 112 TRP B CZ3 1 
ATOM   1902 C  CH2 . TRP B 1 112 ? -17.657 -27.279 123.249 1.00 9.99  ? 112 TRP B CH2 1 
ATOM   1903 N  N   . VAL B 1 113 ? -14.187 -27.560 117.082 1.00 13.97 ? 113 VAL B N   1 
ATOM   1904 C  CA  . VAL B 1 113 ? -13.940 -27.208 115.621 1.00 13.91 ? 113 VAL B CA  1 
ATOM   1905 C  C   . VAL B 1 113 ? -14.613 -25.837 115.522 1.00 14.15 ? 113 VAL B C   1 
ATOM   1906 O  O   . VAL B 1 113 ? -14.027 -24.876 115.039 1.00 14.83 ? 113 VAL B O   1 
ATOM   1907 C  CB  . VAL B 1 113 ? -14.398 -28.240 114.672 1.00 13.70 ? 113 VAL B CB  1 
ATOM   1908 C  CG1 . VAL B 1 113 ? -14.104 -27.775 113.260 1.00 13.50 ? 113 VAL B CG1 1 
ATOM   1909 C  CG2 . VAL B 1 113 ? -13.742 -29.560 115.038 1.00 13.84 ? 113 VAL B CG2 1 
ATOM   1910 N  N   . ALA B 1 114 ? -15.803 -25.827 116.069 1.00 14.10 ? 114 ALA B N   1 
ATOM   1911 C  CA  . ALA B 1 114 ? -16.470 -24.509 116.088 1.00 14.97 ? 114 ALA B CA  1 
ATOM   1912 C  C   . ALA B 1 114 ? -17.346 -24.415 117.313 1.00 15.59 ? 114 ALA B C   1 
ATOM   1913 O  O   . ALA B 1 114 ? -18.008 -25.459 117.680 1.00 16.76 ? 114 ALA B O   1 
ATOM   1914 C  CB  . ALA B 1 114 ? -17.211 -24.408 114.795 1.00 15.44 ? 114 ALA B CB  1 
ATOM   1915 N  N   . ILE B 1 115 ? -17.378 -23.216 117.864 1.00 15.06 ? 115 ILE B N   1 
ATOM   1916 C  CA  . ILE B 1 115 ? -18.295 -23.056 119.017 1.00 14.35 ? 115 ILE B CA  1 
ATOM   1917 C  C   . ILE B 1 115 ? -18.874 -21.648 119.030 1.00 14.91 ? 115 ILE B C   1 
ATOM   1918 O  O   . ILE B 1 115 ? -18.146 -20.676 118.832 1.00 14.46 ? 115 ILE B O   1 
ATOM   1919 C  CB  . ILE B 1 115 ? -17.645 -23.474 120.361 1.00 13.52 ? 115 ILE B CB  1 
ATOM   1920 C  CG1 . ILE B 1 115 ? -18.962 -23.841 121.142 1.00 13.56 ? 115 ILE B CG1 1 
ATOM   1921 C  CG2 . ILE B 1 115 ? -16.739 -22.432 120.950 1.00 12.86 ? 115 ILE B CG2 1 
ATOM   1922 C  CD1 . ILE B 1 115 ? -18.847 -23.852 122.662 1.00 14.49 ? 115 ILE B CD1 1 
ATOM   1923 N  N   . ARG B 1 116 ? -20.180 -21.598 119.273 1.00 15.66 ? 116 ARG B N   1 
ATOM   1924 C  CA  . ARG B 1 116 ? -20.869 -20.310 119.274 1.00 16.53 ? 116 ARG B CA  1 
ATOM   1925 C  C   . ARG B 1 116 ? -22.004 -20.135 120.209 1.00 16.42 ? 116 ARG B C   1 
ATOM   1926 O  O   . ARG B 1 116 ? -22.929 -21.033 120.270 1.00 17.26 ? 116 ARG B O   1 
ATOM   1927 C  CB  . ARG B 1 116 ? -21.418 -20.201 117.814 1.00 18.05 ? 116 ARG B CB  1 
ATOM   1928 C  CG  . ARG B 1 116 ? -22.398 -19.036 117.680 1.00 19.52 ? 116 ARG B CG  1 
ATOM   1929 C  CD  . ARG B 1 116 ? -22.965 -19.070 116.281 1.00 20.66 ? 116 ARG B CD  1 
ATOM   1930 N  NE  . ARG B 1 116 ? -22.618 -17.735 115.731 1.00 22.61 ? 116 ARG B NE  1 
ATOM   1931 C  CZ  . ARG B 1 116 ? -21.754 -17.668 114.694 1.00 23.40 ? 116 ARG B CZ  1 
ATOM   1932 N  NH1 . ARG B 1 116 ? -21.403 -18.787 114.060 1.00 24.08 ? 116 ARG B NH1 1 
ATOM   1933 N  NH2 . ARG B 1 116 ? -21.267 -16.478 114.331 1.00 23.73 ? 116 ARG B NH2 1 
ATOM   1934 N  N   . TYR B 1 117 ? -22.036 -19.011 120.893 1.00 15.66 ? 117 TYR B N   1 
ATOM   1935 C  CA  . TYR B 1 117 ? -23.166 -18.759 121.854 1.00 14.52 ? 117 TYR B CA  1 
ATOM   1936 C  C   . TYR B 1 117 ? -24.093 -17.803 121.156 1.00 13.57 ? 117 TYR B C   1 
ATOM   1937 O  O   . TYR B 1 117 ? -23.620 -16.875 120.512 1.00 13.13 ? 117 TYR B O   1 
ATOM   1938 C  CB  . TYR B 1 117 ? -22.664 -18.241 123.157 1.00 15.42 ? 117 TYR B CB  1 
ATOM   1939 C  CG  . TYR B 1 117 ? -21.738 -19.122 123.938 1.00 16.70 ? 117 TYR B CG  1 
ATOM   1940 C  CD1 . TYR B 1 117 ? -22.156 -19.910 125.010 1.00 16.93 ? 117 TYR B CD1 1 
ATOM   1941 C  CD2 . TYR B 1 117 ? -20.381 -19.166 123.525 1.00 17.52 ? 117 TYR B CD2 1 
ATOM   1942 C  CE1 . TYR B 1 117 ? -21.244 -20.722 125.689 1.00 17.77 ? 117 TYR B CE1 1 
ATOM   1943 C  CE2 . TYR B 1 117 ? -19.461 -19.968 124.196 1.00 17.88 ? 117 TYR B CE2 1 
ATOM   1944 C  CZ  . TYR B 1 117 ? -19.916 -20.717 125.286 1.00 18.22 ? 117 TYR B CZ  1 
ATOM   1945 O  OH  . TYR B 1 117 ? -18.983 -21.452 125.918 1.00 19.19 ? 117 TYR B OH  1 
ATOM   1946 N  N   . THR B 1 118 ? -25.348 -17.999 121.274 1.00 13.49 ? 118 THR B N   1 
ATOM   1947 C  CA  . THR B 1 118 ? -26.356 -17.144 120.608 1.00 13.56 ? 118 THR B CA  1 
ATOM   1948 C  C   . THR B 1 118 ? -27.429 -16.899 121.617 1.00 14.22 ? 118 THR B C   1 
ATOM   1949 O  O   . THR B 1 118 ? -27.511 -17.793 122.504 1.00 15.07 ? 118 THR B O   1 
ATOM   1950 C  CB  . THR B 1 118 ? -26.891 -17.845 119.320 1.00 12.60 ? 118 THR B CB  1 
ATOM   1951 O  OG1 . THR B 1 118 ? -25.718 -18.655 118.892 1.00 12.98 ? 118 THR B OG1 1 
ATOM   1952 C  CG2 . THR B 1 118 ? -27.375 -16.915 118.279 1.00 12.01 ? 118 THR B CG2 1 
ATOM   1953 N  N   . TYR B 1 119 ? -28.165 -15.841 121.496 1.00 14.08 ? 119 TYR B N   1 
ATOM   1954 C  CA  . TYR B 1 119 ? -29.214 -15.576 122.498 1.00 13.95 ? 119 TYR B CA  1 
ATOM   1955 C  C   . TYR B 1 119 ? -30.566 -15.645 121.891 1.00 13.24 ? 119 TYR B C   1 
ATOM   1956 O  O   . TYR B 1 119 ? -30.528 -15.402 120.667 1.00 14.37 ? 119 TYR B O   1 
ATOM   1957 C  CB  . TYR B 1 119 ? -28.881 -14.171 122.970 1.00 14.71 ? 119 TYR B CB  1 
ATOM   1958 C  CG  . TYR B 1 119 ? -29.865 -13.547 123.913 1.00 15.82 ? 119 TYR B CG  1 
ATOM   1959 C  CD1 . TYR B 1 119 ? -31.021 -12.932 123.445 1.00 16.01 ? 119 TYR B CD1 1 
ATOM   1960 C  CD2 . TYR B 1 119 ? -29.659 -13.566 125.292 1.00 16.18 ? 119 TYR B CD2 1 
ATOM   1961 C  CE1 . TYR B 1 119 ? -31.913 -12.343 124.327 1.00 16.45 ? 119 TYR B CE1 1 
ATOM   1962 C  CE2 . TYR B 1 119 ? -30.551 -12.959 126.178 1.00 16.37 ? 119 TYR B CE2 1 
ATOM   1963 C  CZ  . TYR B 1 119 ? -31.677 -12.352 125.686 1.00 16.47 ? 119 TYR B CZ  1 
ATOM   1964 O  OH  . TYR B 1 119 ? -32.560 -11.745 126.534 1.00 17.51 ? 119 TYR B OH  1 
ATOM   1965 N  N   . LEU B 1 120 ? -31.639 -15.866 122.561 1.00 12.04 ? 120 LEU B N   1 
ATOM   1966 C  CA  . LEU B 1 120 ? -32.970 -15.803 121.843 1.00 11.41 ? 120 LEU B CA  1 
ATOM   1967 C  C   . LEU B 1 120 ? -33.862 -15.153 122.901 1.00 12.58 ? 120 LEU B C   1 
ATOM   1968 O  O   . LEU B 1 120 ? -33.909 -15.558 124.083 1.00 13.13 ? 120 LEU B O   1 
ATOM   1969 C  CB  . LEU B 1 120 ? -33.323 -17.108 121.268 1.00 9.99  ? 120 LEU B CB  1 
ATOM   1970 C  CG  . LEU B 1 120 ? -32.488 -17.830 120.229 1.00 8.35  ? 120 LEU B CG  1 
ATOM   1971 C  CD1 . LEU B 1 120 ? -33.237 -19.068 119.734 1.00 7.73  ? 120 LEU B CD1 1 
ATOM   1972 C  CD2 . LEU B 1 120 ? -32.236 -16.942 119.049 1.00 7.55  ? 120 LEU B CD2 1 
ATOM   1973 N  N   . PRO B 1 121 ? -34.498 -14.090 122.464 1.00 13.92 ? 121 PRO B N   1 
ATOM   1974 C  CA  . PRO B 1 121 ? -35.359 -13.333 123.382 1.00 14.88 ? 121 PRO B CA  1 
ATOM   1975 C  C   . PRO B 1 121 ? -36.591 -14.206 123.628 1.00 15.98 ? 121 PRO B C   1 
ATOM   1976 O  O   . PRO B 1 121 ? -37.040 -15.013 122.811 1.00 16.60 ? 121 PRO B O   1 
ATOM   1977 C  CB  . PRO B 1 121 ? -35.585 -11.989 122.755 1.00 14.04 ? 121 PRO B CB  1 
ATOM   1978 C  CG  . PRO B 1 121 ? -35.639 -12.361 121.317 1.00 14.68 ? 121 PRO B CG  1 
ATOM   1979 C  CD  . PRO B 1 121 ? -34.528 -13.470 121.145 1.00 14.62 ? 121 PRO B CD  1 
ATOM   1980 N  N   . SER B 1 122 ? -37.054 -13.945 124.833 1.00 16.69 ? 122 SER B N   1 
ATOM   1981 C  CA  . SER B 1 122 ? -38.226 -14.569 125.374 1.00 17.16 ? 122 SER B CA  1 
ATOM   1982 C  C   . SER B 1 122 ? -39.031 -13.601 126.209 1.00 16.18 ? 122 SER B C   1 
ATOM   1983 O  O   . SER B 1 122 ? -40.006 -14.072 126.839 1.00 17.36 ? 122 SER B O   1 
ATOM   1984 C  CB  . SER B 1 122 ? -37.700 -15.821 126.104 1.00 18.53 ? 122 SER B CB  1 
ATOM   1985 O  OG  . SER B 1 122 ? -38.838 -16.305 126.853 1.00 19.73 ? 122 SER B OG  1 
ATOM   1986 N  N   . CYS B 1 123 ? -38.785 -12.335 126.252 1.00 15.15 ? 123 CYS B N   1 
ATOM   1987 C  CA  . CYS B 1 123 ? -39.624 -11.406 127.085 1.00 14.61 ? 123 CYS B CA  1 
ATOM   1988 C  C   . CYS B 1 123 ? -40.377 -10.471 126.206 1.00 14.20 ? 123 CYS B C   1 
ATOM   1989 O  O   . CYS B 1 123 ? -40.284 -10.569 124.985 1.00 14.55 ? 123 CYS B O   1 
ATOM   1990 C  CB  . CYS B 1 123 ? -38.644 -10.737 128.031 1.00 14.33 ? 123 CYS B CB  1 
ATOM   1991 S  SG  . CYS B 1 123 ? -37.368 -10.026 126.931 1.00 15.91 ? 123 CYS B SG  1 
ATOM   1992 N  N   . PRO B 1 124 ? -41.141 -9.567  126.759 1.00 14.24 ? 124 PRO B N   1 
ATOM   1993 C  CA  . PRO B 1 124 ? -41.945 -8.574  126.056 1.00 14.49 ? 124 PRO B CA  1 
ATOM   1994 C  C   . PRO B 1 124 ? -41.100 -7.476  125.446 1.00 14.68 ? 124 PRO B C   1 
ATOM   1995 O  O   . PRO B 1 124 ? -40.003 -7.165  125.954 1.00 14.57 ? 124 PRO B O   1 
ATOM   1996 C  CB  . PRO B 1 124 ? -42.872 -7.932  127.074 1.00 14.00 ? 124 PRO B CB  1 
ATOM   1997 C  CG  . PRO B 1 124 ? -42.746 -8.813  128.240 1.00 14.05 ? 124 PRO B CG  1 
ATOM   1998 C  CD  . PRO B 1 124 ? -41.342 -9.412  128.205 1.00 14.19 ? 124 PRO B CD  1 
ATOM   1999 N  N   . THR B 1 125 ? -41.653 -6.892  124.390 1.00 15.04 ? 125 THR B N   1 
ATOM   2000 C  CA  . THR B 1 125 ? -40.976 -5.794  123.736 1.00 15.51 ? 125 THR B CA  1 
ATOM   2001 C  C   . THR B 1 125 ? -40.826 -4.646  124.734 1.00 16.34 ? 125 THR B C   1 
ATOM   2002 O  O   . THR B 1 125 ? -40.382 -3.606  124.264 1.00 17.22 ? 125 THR B O   1 
ATOM   2003 C  CB  . THR B 1 125 ? -41.681 -5.111  122.519 1.00 15.38 ? 125 THR B CB  1 
ATOM   2004 O  OG1 . THR B 1 125 ? -42.351 -6.043  121.620 1.00 16.36 ? 125 THR B OG1 1 
ATOM   2005 C  CG2 . THR B 1 125 ? -40.636 -4.325  121.745 1.00 15.63 ? 125 THR B CG2 1 
ATOM   2006 N  N   . THR B 1 126 ? -41.201 -4.773  125.977 1.00 17.20 ? 126 THR B N   1 
ATOM   2007 C  CA  . THR B 1 126 ? -41.076 -3.590  126.885 1.00 17.52 ? 126 THR B CA  1 
ATOM   2008 C  C   . THR B 1 126 ? -40.140 -3.837  128.023 1.00 17.26 ? 126 THR B C   1 
ATOM   2009 O  O   . THR B 1 126 ? -39.889 -2.934  128.841 1.00 17.30 ? 126 THR B O   1 
ATOM   2010 C  CB  . THR B 1 126 ? -42.526 -3.137  127.296 1.00 17.88 ? 126 THR B CB  1 
ATOM   2011 O  OG1 . THR B 1 126 ? -43.129 -4.177  128.104 1.00 18.09 ? 126 THR B OG1 1 
ATOM   2012 C  CG2 . THR B 1 126 ? -43.378 -2.845  126.055 1.00 17.93 ? 126 THR B CG2 1 
ATOM   2013 N  N   . THR B 1 127 ? -39.631 -5.047  128.098 1.00 17.04 ? 127 THR B N   1 
ATOM   2014 C  CA  . THR B 1 127 ? -38.618 -5.414  129.111 1.00 16.54 ? 127 THR B CA  1 
ATOM   2015 C  C   . THR B 1 127 ? -37.450 -4.488  128.930 1.00 16.54 ? 127 THR B C   1 
ATOM   2016 O  O   . THR B 1 127 ? -36.952 -4.518  127.748 1.00 17.47 ? 127 THR B O   1 
ATOM   2017 C  CB  . THR B 1 127 ? -38.110 -6.879  128.892 1.00 15.71 ? 127 THR B CB  1 
ATOM   2018 O  OG1 . THR B 1 127 ? -39.373 -7.556  128.656 1.00 15.23 ? 127 THR B OG1 1 
ATOM   2019 C  CG2 . THR B 1 127 ? -37.225 -7.354  130.018 1.00 15.38 ? 127 THR B CG2 1 
ATOM   2020 N  N   . SER B 1 128 ? -36.993 -3.736  129.871 1.00 15.93 ? 128 SER B N   1 
ATOM   2021 C  CA  . SER B 1 128 ? -35.843 -2.829  129.414 1.00 15.22 ? 128 SER B CA  1 
ATOM   2022 C  C   . SER B 1 128 ? -34.539 -3.406  129.786 1.00 14.72 ? 128 SER B C   1 
ATOM   2023 O  O   . SER B 1 128 ? -34.548 -3.926  130.921 1.00 15.85 ? 128 SER B O   1 
ATOM   2024 C  CB  . SER B 1 128 ? -36.261 -1.487  129.996 1.00 14.99 ? 128 SER B CB  1 
ATOM   2025 O  OG  . SER B 1 128 ? -35.640 -1.210  131.227 1.00 14.49 ? 128 SER B OG  1 
ATOM   2026 N  N   . GLY B 1 129 ? -33.477 -3.357  129.017 1.00 13.96 ? 129 GLY B N   1 
ATOM   2027 C  CA  . GLY B 1 129 ? -32.178 -3.946  129.439 1.00 12.20 ? 129 GLY B CA  1 
ATOM   2028 C  C   . GLY B 1 129 ? -31.272 -4.321  128.292 1.00 11.64 ? 129 GLY B C   1 
ATOM   2029 O  O   . GLY B 1 129 ? -31.597 -4.137  127.097 1.00 11.44 ? 129 GLY B O   1 
ATOM   2030 N  N   . ALA B 1 130 ? -30.120 -4.896  128.592 1.00 11.60 ? 130 ALA B N   1 
ATOM   2031 C  CA  . ALA B 1 130 ? -29.111 -5.333  127.667 1.00 11.32 ? 130 ALA B CA  1 
ATOM   2032 C  C   . ALA B 1 130 ? -28.231 -6.482  128.089 1.00 11.30 ? 130 ALA B C   1 
ATOM   2033 O  O   . ALA B 1 130 ? -27.943 -6.726  129.257 1.00 11.25 ? 130 ALA B O   1 
ATOM   2034 C  CB  . ALA B 1 130 ? -28.024 -4.226  127.443 1.00 10.81 ? 130 ALA B CB  1 
ATOM   2035 N  N   . ILE B 1 131 ? -27.721 -7.086  127.001 1.00 11.90 ? 131 ILE B N   1 
ATOM   2036 C  CA  . ILE B 1 131 ? -26.757 -8.228  127.229 1.00 11.19 ? 131 ILE B CA  1 
ATOM   2037 C  C   . ILE B 1 131 ? -25.405 -7.861  126.626 1.00 11.81 ? 131 ILE B C   1 
ATOM   2038 O  O   . ILE B 1 131 ? -25.316 -7.139  125.600 1.00 11.42 ? 131 ILE B O   1 
ATOM   2039 C  CB  . ILE B 1 131 ? -27.474 -9.470  126.699 1.00 9.91  ? 131 ILE B CB  1 
ATOM   2040 C  CG1 . ILE B 1 131 ? -26.613 -10.696 126.979 1.00 9.86  ? 131 ILE B CG1 1 
ATOM   2041 C  CG2 . ILE B 1 131 ? -27.753 -9.213  125.196 1.00 9.60  ? 131 ILE B CG2 1 
ATOM   2042 C  CD1 . ILE B 1 131 ? -27.235 -12.027 126.465 1.00 9.47  ? 131 ILE B CD1 1 
ATOM   2043 N  N   . HIS B 1 132 ? -24.342 -8.313  127.256 1.00 11.98 ? 132 HIS B N   1 
ATOM   2044 C  CA  . HIS B 1 132 ? -23.008 -8.013  126.745 1.00 13.38 ? 132 HIS B CA  1 
ATOM   2045 C  C   . HIS B 1 132 ? -22.183 -9.287  126.899 1.00 14.02 ? 132 HIS B C   1 
ATOM   2046 O  O   . HIS B 1 132 ? -22.231 -9.771  128.038 1.00 14.68 ? 132 HIS B O   1 
ATOM   2047 C  CB  . HIS B 1 132 ? -22.305 -6.877  127.445 1.00 13.61 ? 132 HIS B CB  1 
ATOM   2048 C  CG  . HIS B 1 132 ? -23.167 -5.684  127.609 1.00 13.49 ? 132 HIS B CG  1 
ATOM   2049 N  ND1 . HIS B 1 132 ? -22.815 -4.445  127.109 1.00 13.80 ? 132 HIS B ND1 1 
ATOM   2050 C  CD2 . HIS B 1 132 ? -24.336 -5.524  128.232 1.00 13.43 ? 132 HIS B CD2 1 
ATOM   2051 C  CE1 . HIS B 1 132 ? -23.740 -3.544  127.411 1.00 12.73 ? 132 HIS B CE1 1 
ATOM   2052 N  NE2 . HIS B 1 132 ? -24.677 -4.191  128.087 1.00 13.35 ? 132 HIS B NE2 1 
ATOM   2053 N  N   . MET B 1 133 ? -21.547 -9.717  125.834 1.00 14.25 ? 133 MET B N   1 
ATOM   2054 C  CA  . MET B 1 133 ? -20.730 -10.972 126.032 1.00 14.67 ? 133 MET B CA  1 
ATOM   2055 C  C   . MET B 1 133 ? -19.374 -10.562 125.444 1.00 15.18 ? 133 MET B C   1 
ATOM   2056 O  O   . MET B 1 133 ? -19.380 -9.571  124.671 1.00 15.51 ? 133 MET B O   1 
ATOM   2057 C  CB  . MET B 1 133 ? -21.390 -12.150 125.484 1.00 14.74 ? 133 MET B CB  1 
ATOM   2058 C  CG  . MET B 1 133 ? -22.889 -12.121 125.685 1.00 15.58 ? 133 MET B CG  1 
ATOM   2059 S  SD  . MET B 1 133 ? -23.443 -13.719 124.857 1.00 17.14 ? 133 MET B SD  1 
ATOM   2060 C  CE  . MET B 1 133 ? -22.879 -13.308 123.211 1.00 17.73 ? 133 MET B CE  1 
ATOM   2061 N  N   . GLY B 1 134 ? -18.361 -11.267 125.863 1.00 15.15 ? 134 GLY B N   1 
ATOM   2062 C  CA  . GLY B 1 134 ? -16.965 -11.086 125.491 1.00 14.79 ? 134 GLY B CA  1 
ATOM   2063 C  C   . GLY B 1 134 ? -16.148 -12.287 125.970 1.00 14.82 ? 134 GLY B C   1 
ATOM   2064 O  O   . GLY B 1 134 ? -16.664 -13.110 126.800 1.00 15.46 ? 134 GLY B O   1 
ATOM   2065 N  N   . PHE B 1 135 ? -14.917 -12.411 125.506 1.00 14.28 ? 135 PHE B N   1 
ATOM   2066 C  CA  . PHE B 1 135 ? -14.055 -13.539 125.888 1.00 13.44 ? 135 PHE B CA  1 
ATOM   2067 C  C   . PHE B 1 135 ? -12.701 -13.192 126.520 1.00 12.90 ? 135 PHE B C   1 
ATOM   2068 O  O   . PHE B 1 135 ? -11.955 -12.353 126.067 1.00 11.60 ? 135 PHE B O   1 
ATOM   2069 C  CB  . PHE B 1 135 ? -13.640 -14.403 124.692 1.00 12.92 ? 135 PHE B CB  1 
ATOM   2070 C  CG  . PHE B 1 135 ? -14.550 -15.265 123.935 1.00 12.26 ? 135 PHE B CG  1 
ATOM   2071 C  CD1 . PHE B 1 135 ? -15.590 -15.978 124.524 1.00 12.37 ? 135 PHE B CD1 1 
ATOM   2072 C  CD2 . PHE B 1 135 ? -14.329 -15.432 122.565 1.00 12.09 ? 135 PHE B CD2 1 
ATOM   2073 C  CE1 . PHE B 1 135 ? -16.421 -16.818 123.781 1.00 12.41 ? 135 PHE B CE1 1 
ATOM   2074 C  CE2 . PHE B 1 135 ? -15.135 -16.277 121.792 1.00 12.17 ? 135 PHE B CE2 1 
ATOM   2075 C  CZ  . PHE B 1 135 ? -16.185 -16.956 122.390 1.00 12.36 ? 135 PHE B CZ  1 
ATOM   2076 N  N   . GLN B 1 136 ? -12.409 -13.989 127.500 1.00 14.52 ? 136 GLN B N   1 
ATOM   2077 C  CA  . GLN B 1 136 ? -11.143 -13.938 128.250 1.00 16.24 ? 136 GLN B CA  1 
ATOM   2078 C  C   . GLN B 1 136 ? -10.395 -15.250 127.950 1.00 16.93 ? 136 GLN B C   1 
ATOM   2079 O  O   . GLN B 1 136 ? -11.053 -16.286 127.710 1.00 16.74 ? 136 GLN B O   1 
ATOM   2080 C  CB  . GLN B 1 136 ? -11.381 -13.672 129.714 1.00 16.87 ? 136 GLN B CB  1 
ATOM   2081 C  CG  . GLN B 1 136 ? -11.787 -12.249 130.015 1.00 18.53 ? 136 GLN B CG  1 
ATOM   2082 C  CD  . GLN B 1 136 ? -11.767 -11.796 131.453 1.00 19.61 ? 136 GLN B CD  1 
ATOM   2083 O  OE1 . GLN B 1 136 ? -11.722 -10.579 131.709 1.00 20.02 ? 136 GLN B OE1 1 
ATOM   2084 N  NE2 . GLN B 1 136 ? -11.812 -12.698 132.453 1.00 19.74 ? 136 GLN B NE2 1 
ATOM   2085 N  N   . TYR B 1 137 ? -9.054  -15.130 127.991 1.00 17.82 ? 137 TYR B N   1 
ATOM   2086 C  CA  . TYR B 1 137 ? -8.296  -16.364 127.711 1.00 19.03 ? 137 TYR B CA  1 
ATOM   2087 C  C   . TYR B 1 137 ? -7.181  -16.700 128.659 1.00 20.16 ? 137 TYR B C   1 
ATOM   2088 O  O   . TYR B 1 137 ? -6.390  -17.643 128.145 1.00 21.77 ? 137 TYR B O   1 
ATOM   2089 C  CB  . TYR B 1 137 ? -7.775  -16.292 126.247 1.00 18.52 ? 137 TYR B CB  1 
ATOM   2090 C  CG  . TYR B 1 137 ? -8.677  -15.765 125.183 1.00 18.19 ? 137 TYR B CG  1 
ATOM   2091 C  CD1 . TYR B 1 137 ? -8.861  -14.409 124.963 1.00 17.63 ? 137 TYR B CD1 1 
ATOM   2092 C  CD2 . TYR B 1 137 ? -9.349  -16.632 124.303 1.00 18.72 ? 137 TYR B CD2 1 
ATOM   2093 C  CE1 . TYR B 1 137 ? -9.675  -13.940 123.951 1.00 17.60 ? 137 TYR B CE1 1 
ATOM   2094 C  CE2 . TYR B 1 137 ? -10.193 -16.198 123.266 1.00 17.85 ? 137 TYR B CE2 1 
ATOM   2095 C  CZ  . TYR B 1 137 ? -10.344 -14.834 123.113 1.00 17.75 ? 137 TYR B CZ  1 
ATOM   2096 O  OH  . TYR B 1 137 ? -11.144 -14.356 122.120 1.00 17.69 ? 137 TYR B OH  1 
ATOM   2097 N  N   . ASP B 1 138 ? -6.953  -16.188 129.812 1.00 20.51 ? 138 ASP B N   1 
ATOM   2098 C  CA  . ASP B 1 138 ? -5.728  -16.707 130.622 1.00 21.61 ? 138 ASP B CA  1 
ATOM   2099 C  C   . ASP B 1 138 ? -6.467  -16.661 131.956 1.00 22.29 ? 138 ASP B C   1 
ATOM   2100 O  O   . ASP B 1 138 ? -6.706  -15.461 132.230 1.00 22.59 ? 138 ASP B O   1 
ATOM   2101 C  CB  . ASP B 1 138 ? -4.466  -15.993 130.539 1.00 21.45 ? 138 ASP B CB  1 
ATOM   2102 C  CG  . ASP B 1 138 ? -3.757  -15.278 131.645 1.00 21.39 ? 138 ASP B CG  1 
ATOM   2103 O  OD1 . ASP B 1 138 ? -3.330  -14.099 131.417 1.00 22.12 ? 138 ASP B OD1 1 
ATOM   2104 O  OD2 . ASP B 1 138 ? -3.555  -15.800 132.757 1.00 20.44 ? 138 ASP B OD2 1 
ATOM   2105 N  N   . MET B 1 139 ? -6.754  -17.819 132.454 1.00 23.13 ? 139 MET B N   1 
ATOM   2106 C  CA  . MET B 1 139 ? -7.590  -17.777 133.679 1.00 24.46 ? 139 MET B CA  1 
ATOM   2107 C  C   . MET B 1 139 ? -7.012  -16.951 134.793 1.00 24.33 ? 139 MET B C   1 
ATOM   2108 O  O   . MET B 1 139 ? -7.818  -16.616 135.704 1.00 24.04 ? 139 MET B O   1 
ATOM   2109 C  CB  . MET B 1 139 ? -7.960  -19.201 134.107 1.00 26.40 ? 139 MET B CB  1 
ATOM   2110 C  CG  . MET B 1 139 ? -9.485  -19.263 133.692 1.00 27.99 ? 139 MET B CG  1 
ATOM   2111 S  SD  . MET B 1 139 ? -9.282  -19.694 131.936 1.00 30.02 ? 139 MET B SD  1 
ATOM   2112 C  CE  . MET B 1 139 ? -10.414 -18.519 131.151 1.00 28.57 ? 139 MET B CE  1 
ATOM   2113 N  N   . ALA B 1 140 ? -5.757  -16.590 134.752 1.00 24.50 ? 140 ALA B N   1 
ATOM   2114 C  CA  . ALA B 1 140 ? -5.244  -15.720 135.842 1.00 24.30 ? 140 ALA B CA  1 
ATOM   2115 C  C   . ALA B 1 140 ? -5.865  -14.324 135.794 1.00 24.28 ? 140 ALA B C   1 
ATOM   2116 O  O   . ALA B 1 140 ? -5.897  -13.521 136.751 1.00 23.90 ? 140 ALA B O   1 
ATOM   2117 C  CB  . ALA B 1 140 ? -3.743  -15.678 135.682 1.00 24.30 ? 140 ALA B CB  1 
ATOM   2118 N  N   . ASP B 1 141 ? -6.366  -14.000 134.619 1.00 24.33 ? 141 ASP B N   1 
ATOM   2119 C  CA  . ASP B 1 141 ? -6.953  -12.639 134.322 1.00 24.46 ? 141 ASP B CA  1 
ATOM   2120 C  C   . ASP B 1 141 ? -8.135  -12.386 135.218 1.00 23.68 ? 141 ASP B C   1 
ATOM   2121 O  O   . ASP B 1 141 ? -8.642  -13.320 135.884 1.00 24.57 ? 141 ASP B O   1 
ATOM   2122 C  CB  . ASP B 1 141 ? -7.019  -12.677 132.763 1.00 24.80 ? 141 ASP B CB  1 
ATOM   2123 C  CG  . ASP B 1 141 ? -5.682  -12.211 132.187 1.00 25.25 ? 141 ASP B CG  1 
ATOM   2124 O  OD1 . ASP B 1 141 ? -4.946  -11.593 133.024 1.00 25.49 ? 141 ASP B OD1 1 
ATOM   2125 O  OD2 . ASP B 1 141 ? -5.385  -12.437 130.983 1.00 25.70 ? 141 ASP B OD2 1 
ATOM   2126 N  N   . THR B 1 142 ? -8.644  -11.193 135.359 1.00 22.26 ? 142 THR B N   1 
ATOM   2127 C  CA  . THR B 1 142 ? -9.741  -10.791 136.234 1.00 20.52 ? 142 THR B CA  1 
ATOM   2128 C  C   . THR B 1 142 ? -11.034 -10.458 135.563 1.00 20.21 ? 142 THR B C   1 
ATOM   2129 O  O   . THR B 1 142 ? -11.068 -9.639  134.618 1.00 19.44 ? 142 THR B O   1 
ATOM   2130 C  CB  . THR B 1 142 ? -9.188  -9.515  137.061 1.00 19.75 ? 142 THR B CB  1 
ATOM   2131 O  OG1 . THR B 1 142 ? -8.057  -10.002 137.830 1.00 18.49 ? 142 THR B OG1 1 
ATOM   2132 C  CG2 . THR B 1 142 ? -10.224 -8.834  137.910 1.00 18.92 ? 142 THR B CG2 1 
ATOM   2133 N  N   . LEU B 1 143 ? -12.141 -11.018 136.035 1.00 20.32 ? 143 LEU B N   1 
ATOM   2134 C  CA  . LEU B 1 143 ? -13.421 -10.688 135.366 1.00 20.44 ? 143 LEU B CA  1 
ATOM   2135 C  C   . LEU B 1 143 ? -13.618 -9.201  135.472 1.00 21.69 ? 143 LEU B C   1 
ATOM   2136 O  O   . LEU B 1 143 ? -13.451 -8.624  136.556 1.00 22.98 ? 143 LEU B O   1 
ATOM   2137 C  CB  . LEU B 1 143 ? -14.519 -11.499 135.952 1.00 20.29 ? 143 LEU B CB  1 
ATOM   2138 C  CG  . LEU B 1 143 ? -14.398 -12.998 135.754 1.00 20.73 ? 143 LEU B CG  1 
ATOM   2139 C  CD1 . LEU B 1 143 ? -15.798 -13.574 135.861 1.00 21.11 ? 143 LEU B CD1 1 
ATOM   2140 C  CD2 . LEU B 1 143 ? -13.783 -13.347 134.396 1.00 20.74 ? 143 LEU B CD2 1 
ATOM   2141 N  N   . PRO B 1 144 ? -13.965 -8.659  134.344 1.00 22.58 ? 144 PRO B N   1 
ATOM   2142 C  CA  . PRO B 1 144 ? -14.238 -7.210  134.238 1.00 23.30 ? 144 PRO B CA  1 
ATOM   2143 C  C   . PRO B 1 144 ? -15.274 -6.926  135.295 1.00 24.21 ? 144 PRO B C   1 
ATOM   2144 O  O   . PRO B 1 144 ? -16.164 -7.738  135.555 1.00 24.56 ? 144 PRO B O   1 
ATOM   2145 C  CB  . PRO B 1 144 ? -14.675 -7.005  132.841 1.00 23.18 ? 144 PRO B CB  1 
ATOM   2146 C  CG  . PRO B 1 144 ? -15.340 -8.349  132.564 1.00 23.08 ? 144 PRO B CG  1 
ATOM   2147 C  CD  . PRO B 1 144 ? -14.218 -9.319  133.057 1.00 22.83 ? 144 PRO B CD  1 
ATOM   2148 N  N   . VAL B 1 145 ? -15.143 -5.817  135.913 1.00 25.51 ? 145 VAL B N   1 
ATOM   2149 C  CA  . VAL B 1 145 ? -15.953 -5.285  136.956 1.00 26.84 ? 145 VAL B CA  1 
ATOM   2150 C  C   . VAL B 1 145 ? -17.205 -4.604  136.415 1.00 28.06 ? 145 VAL B C   1 
ATOM   2151 O  O   . VAL B 1 145 ? -18.252 -4.849  136.949 1.00 28.74 ? 145 VAL B O   1 
ATOM   2152 C  CB  . VAL B 1 145 ? -15.167 -4.192  137.729 1.00 26.63 ? 145 VAL B CB  1 
ATOM   2153 C  CG1 . VAL B 1 145 ? -16.089 -3.107  138.221 1.00 26.05 ? 145 VAL B CG1 1 
ATOM   2154 C  CG2 . VAL B 1 145 ? -14.327 -4.878  138.777 1.00 27.11 ? 145 VAL B CG2 1 
ATOM   2155 N  N   . SER B 1 146 ? -16.988 -3.763  135.479 1.00 29.27 ? 146 SER B N   1 
ATOM   2156 C  CA  . SER B 1 146 ? -17.735 -2.899  134.669 1.00 30.13 ? 146 SER B CA  1 
ATOM   2157 C  C   . SER B 1 146 ? -18.023 -3.442  133.269 1.00 30.09 ? 146 SER B C   1 
ATOM   2158 O  O   . SER B 1 146 ? -17.401 -4.457  132.907 1.00 31.06 ? 146 SER B O   1 
ATOM   2159 C  CB  . SER B 1 146 ? -16.869 -1.623  134.449 1.00 31.28 ? 146 SER B CB  1 
ATOM   2160 O  OG  . SER B 1 146 ? -17.552 -0.892  133.405 1.00 33.01 ? 146 SER B OG  1 
ATOM   2161 N  N   . VAL B 1 147 ? -18.830 -2.816  132.484 1.00 29.09 ? 147 VAL B N   1 
ATOM   2162 C  CA  . VAL B 1 147 ? -19.244 -3.161  131.131 1.00 28.14 ? 147 VAL B CA  1 
ATOM   2163 C  C   . VAL B 1 147 ? -18.217 -2.586  130.169 1.00 28.28 ? 147 VAL B C   1 
ATOM   2164 O  O   . VAL B 1 147 ? -17.807 -3.065  129.120 1.00 28.06 ? 147 VAL B O   1 
ATOM   2165 C  CB  . VAL B 1 147 ? -20.656 -2.634  130.954 1.00 27.87 ? 147 VAL B CB  1 
ATOM   2166 C  CG1 . VAL B 1 147 ? -21.518 -3.508  130.093 1.00 28.20 ? 147 VAL B CG1 1 
ATOM   2167 C  CG2 . VAL B 1 147 ? -21.290 -2.444  132.319 1.00 28.12 ? 147 VAL B CG2 1 
ATOM   2168 N  N   . ASN B 1 148 ? -17.814 -1.439  130.639 1.00 28.48 ? 148 ASN B N   1 
ATOM   2169 C  CA  . ASN B 1 148 ? -16.771 -0.624  130.151 1.00 28.83 ? 148 ASN B CA  1 
ATOM   2170 C  C   . ASN B 1 148 ? -15.594 -1.540  129.764 1.00 27.48 ? 148 ASN B C   1 
ATOM   2171 O  O   . ASN B 1 148 ? -15.229 -1.622  128.647 1.00 27.34 ? 148 ASN B O   1 
ATOM   2172 C  CB  . ASN B 1 148 ? -16.217 0.218   131.297 1.00 31.19 ? 148 ASN B CB  1 
ATOM   2173 C  CG  . ASN B 1 148 ? -16.886 1.535   131.458 1.00 32.64 ? 148 ASN B CG  1 
ATOM   2174 O  OD1 . ASN B 1 148 ? -18.088 1.649   131.266 1.00 33.87 ? 148 ASN B OD1 1 
ATOM   2175 N  ND2 . ASN B 1 148 ? -16.048 2.523   131.784 1.00 34.20 ? 148 ASN B ND2 1 
ATOM   2176 N  N   . GLN B 1 149 ? -15.062 -2.185  130.816 1.00 26.55 ? 149 GLN B N   1 
ATOM   2177 C  CA  . GLN B 1 149 ? -13.893 -3.050  130.574 1.00 25.56 ? 149 GLN B CA  1 
ATOM   2178 C  C   . GLN B 1 149 ? -14.300 -4.160  129.605 1.00 23.78 ? 149 GLN B C   1 
ATOM   2179 O  O   . GLN B 1 149 ? -13.493 -4.609  128.792 1.00 23.12 ? 149 GLN B O   1 
ATOM   2180 C  CB  . GLN B 1 149 ? -13.309 -3.687  131.809 1.00 26.34 ? 149 GLN B CB  1 
ATOM   2181 C  CG  . GLN B 1 149 ? -13.315 -2.794  133.019 1.00 27.42 ? 149 GLN B CG  1 
ATOM   2182 C  CD  . GLN B 1 149 ? -12.932 -3.562  134.277 1.00 27.89 ? 149 GLN B CD  1 
ATOM   2183 O  OE1 . GLN B 1 149 ? -13.693 -4.415  134.743 1.00 28.24 ? 149 GLN B OE1 1 
ATOM   2184 N  NE2 . GLN B 1 149 ? -11.751 -3.220  134.781 1.00 27.83 ? 149 GLN B NE2 1 
ATOM   2185 N  N   . LEU B 1 150 ? -15.559 -4.501  129.817 1.00 22.31 ? 150 LEU B N   1 
ATOM   2186 C  CA  . LEU B 1 150 ? -16.043 -5.642  128.962 1.00 20.91 ? 150 LEU B CA  1 
ATOM   2187 C  C   . LEU B 1 150 ? -16.208 -5.238  127.525 1.00 19.77 ? 150 LEU B C   1 
ATOM   2188 O  O   . LEU B 1 150 ? -16.154 -6.193  126.719 1.00 19.33 ? 150 LEU B O   1 
ATOM   2189 C  CB  . LEU B 1 150 ? -17.242 -6.179  129.671 1.00 20.44 ? 150 LEU B CB  1 
ATOM   2190 C  CG  . LEU B 1 150 ? -18.374 -6.952  129.191 1.00 20.80 ? 150 LEU B CG  1 
ATOM   2191 C  CD1 . LEU B 1 150 ? -18.184 -7.679  127.865 1.00 21.56 ? 150 LEU B CD1 1 
ATOM   2192 C  CD2 . LEU B 1 150 ? -18.613 -8.108  130.205 1.00 21.53 ? 150 LEU B CD2 1 
ATOM   2193 N  N   . SER B 1 151 ? -16.365 -4.001  127.216 1.00 18.94 ? 151 SER B N   1 
ATOM   2194 C  CA  . SER B 1 151 ? -16.605 -3.640  125.790 1.00 18.18 ? 151 SER B CA  1 
ATOM   2195 C  C   . SER B 1 151 ? -15.327 -3.690  125.027 1.00 19.19 ? 151 SER B C   1 
ATOM   2196 O  O   . SER B 1 151 ? -15.287 -3.431  123.809 1.00 19.80 ? 151 SER B O   1 
ATOM   2197 C  CB  . SER B 1 151 ? -17.250 -2.279  125.781 1.00 16.81 ? 151 SER B CB  1 
ATOM   2198 O  OG  . SER B 1 151 ? -16.179 -1.403  126.137 1.00 15.24 ? 151 SER B OG  1 
ATOM   2199 N  N   . ASN B 1 152 ? -14.273 -4.017  125.763 1.00 20.34 ? 152 ASN B N   1 
ATOM   2200 C  CA  . ASN B 1 152 ? -12.962 -4.067  125.086 1.00 21.40 ? 152 ASN B CA  1 
ATOM   2201 C  C   . ASN B 1 152 ? -12.530 -5.508  124.841 1.00 22.43 ? 152 ASN B C   1 
ATOM   2202 O  O   . ASN B 1 152 ? -11.338 -5.508  124.398 1.00 23.80 ? 152 ASN B O   1 
ATOM   2203 C  CB  . ASN B 1 152 ? -11.864 -3.386  125.870 1.00 21.19 ? 152 ASN B CB  1 
ATOM   2204 C  CG  . ASN B 1 152 ? -12.098 -2.210  126.731 1.00 21.17 ? 152 ASN B CG  1 
ATOM   2205 O  OD1 . ASN B 1 152 ? -11.457 -1.892  127.780 1.00 20.90 ? 152 ASN B OD1 1 
ATOM   2206 N  ND2 . ASN B 1 152 ? -13.091 -1.472  126.232 1.00 21.56 ? 152 ASN B ND2 1 
ATOM   2207 N  N   . LEU B 1 153 ? -13.257 -6.536  125.109 1.00 22.48 ? 153 LEU B N   1 
ATOM   2208 C  CA  . LEU B 1 153 ? -12.775 -7.908  124.895 1.00 22.82 ? 153 LEU B CA  1 
ATOM   2209 C  C   . LEU B 1 153 ? -12.994 -8.459  123.511 1.00 21.97 ? 153 LEU B C   1 
ATOM   2210 O  O   . LEU B 1 153 ? -13.838 -7.967  122.754 1.00 22.03 ? 153 LEU B O   1 
ATOM   2211 C  CB  . LEU B 1 153 ? -13.539 -8.762  125.938 1.00 24.04 ? 153 LEU B CB  1 
ATOM   2212 C  CG  . LEU B 1 153 ? -13.063 -8.555  127.361 1.00 25.11 ? 153 LEU B CG  1 
ATOM   2213 C  CD1 . LEU B 1 153 ? -14.181 -8.164  128.309 1.00 25.55 ? 153 LEU B CD1 1 
ATOM   2214 C  CD2 . LEU B 1 153 ? -12.466 -9.894  127.787 1.00 25.68 ? 153 LEU B CD2 1 
ATOM   2215 N  N   . LYS B 1 154 ? -12.290 -9.509  123.182 1.00 21.54 ? 154 LYS B N   1 
ATOM   2216 C  CA  . LYS B 1 154 ? -12.406 -10.139 121.846 1.00 20.82 ? 154 LYS B CA  1 
ATOM   2217 C  C   . LYS B 1 154 ? -13.837 -10.559 121.677 1.00 19.77 ? 154 LYS B C   1 
ATOM   2218 O  O   . LYS B 1 154 ? -14.210 -11.430 122.505 1.00 20.15 ? 154 LYS B O   1 
ATOM   2219 C  CB  . LYS B 1 154 ? -11.570 -11.371 121.659 1.00 22.04 ? 154 LYS B CB  1 
ATOM   2220 C  CG  . LYS B 1 154 ? -11.019 -11.668 120.295 1.00 23.79 ? 154 LYS B CG  1 
ATOM   2221 C  CD  . LYS B 1 154 ? -11.988 -12.133 119.247 1.00 25.16 ? 154 LYS B CD  1 
ATOM   2222 C  CE  . LYS B 1 154 ? -11.388 -12.090 117.841 1.00 25.45 ? 154 LYS B CE  1 
ATOM   2223 N  NZ  . LYS B 1 154 ? -12.502 -11.512 116.970 1.00 26.76 ? 154 LYS B NZ  1 
ATOM   2224 N  N   . GLY B 1 155 ? -14.550 -10.032 120.711 1.00 18.54 ? 155 GLY B N   1 
ATOM   2225 C  CA  . GLY B 1 155 ? -15.913 -10.494 120.548 1.00 16.65 ? 155 GLY B CA  1 
ATOM   2226 C  C   . GLY B 1 155 ? -17.054 -9.817  121.172 1.00 15.47 ? 155 GLY B C   1 
ATOM   2227 O  O   . GLY B 1 155 ? -18.158 -10.415 121.089 1.00 15.81 ? 155 GLY B O   1 
ATOM   2228 N  N   . TYR B 1 156 ? -16.910 -8.665  121.748 1.00 14.68 ? 156 TYR B N   1 
ATOM   2229 C  CA  . TYR B 1 156 ? -17.901 -7.819  122.362 1.00 13.24 ? 156 TYR B CA  1 
ATOM   2230 C  C   . TYR B 1 156 ? -19.142 -7.650  121.487 1.00 11.12 ? 156 TYR B C   1 
ATOM   2231 O  O   . TYR B 1 156 ? -19.011 -7.478  120.258 1.00 8.91  ? 156 TYR B O   1 
ATOM   2232 C  CB  . TYR B 1 156 ? -17.261 -6.410  122.642 1.00 14.37 ? 156 TYR B CB  1 
ATOM   2233 C  CG  . TYR B 1 156 ? -18.301 -5.544  123.349 1.00 14.74 ? 156 TYR B CG  1 
ATOM   2234 C  CD1 . TYR B 1 156 ? -18.945 -4.535  122.639 1.00 15.30 ? 156 TYR B CD1 1 
ATOM   2235 C  CD2 . TYR B 1 156 ? -18.641 -5.751  124.662 1.00 14.48 ? 156 TYR B CD2 1 
ATOM   2236 C  CE1 . TYR B 1 156 ? -19.906 -3.739  123.269 1.00 16.00 ? 156 TYR B CE1 1 
ATOM   2237 C  CE2 . TYR B 1 156 ? -19.610 -4.980  125.294 1.00 14.94 ? 156 TYR B CE2 1 
ATOM   2238 C  CZ  . TYR B 1 156 ? -20.242 -3.981  124.620 1.00 15.24 ? 156 TYR B CZ  1 
ATOM   2239 O  OH  . TYR B 1 156 ? -21.183 -3.213  125.216 1.00 15.38 ? 156 TYR B OH  1 
ATOM   2240 N  N   . VAL B 1 157 ? -20.262 -7.702  122.164 1.00 9.79  ? 157 VAL B N   1 
ATOM   2241 C  CA  . VAL B 1 157 ? -21.574 -7.617  121.531 1.00 9.84  ? 157 VAL B CA  1 
ATOM   2242 C  C   . VAL B 1 157 ? -22.707 -7.186  122.426 1.00 10.55 ? 157 VAL B C   1 
ATOM   2243 O  O   . VAL B 1 157 ? -22.749 -7.842  123.511 1.00 11.44 ? 157 VAL B O   1 
ATOM   2244 C  CB  . VAL B 1 157 ? -21.895 -9.058  121.036 1.00 8.53  ? 157 VAL B CB  1 
ATOM   2245 C  CG1 . VAL B 1 157 ? -23.209 -9.143  120.348 1.00 7.71  ? 157 VAL B CG1 1 
ATOM   2246 C  CG2 . VAL B 1 157 ? -20.798 -9.564  120.149 1.00 9.58  ? 157 VAL B CG2 1 
ATOM   2247 N  N   . THR B 1 158 ? -23.599 -6.282  122.138 1.00 10.82 ? 158 THR B N   1 
ATOM   2248 C  CA  . THR B 1 158 ? -24.655 -5.957  123.041 1.00 12.31 ? 158 THR B CA  1 
ATOM   2249 C  C   . THR B 1 158 ? -25.954 -5.828  122.234 1.00 12.50 ? 158 THR B C   1 
ATOM   2250 O  O   . THR B 1 158 ? -25.719 -5.513  121.083 1.00 12.47 ? 158 THR B O   1 
ATOM   2251 C  CB  . THR B 1 158 ? -24.688 -4.573  123.785 1.00 13.34 ? 158 THR B CB  1 
ATOM   2252 O  OG1 . THR B 1 158 ? -23.312 -4.161  123.989 1.00 15.01 ? 158 THR B OG1 1 
ATOM   2253 C  CG2 . THR B 1 158 ? -25.516 -4.682  125.053 1.00 13.93 ? 158 THR B CG2 1 
ATOM   2254 N  N   . GLY B 1 159 ? -27.021 -5.958  122.968 1.00 13.10 ? 159 GLY B N   1 
ATOM   2255 C  CA  . GLY B 1 159 ? -28.361 -5.826  122.344 1.00 13.65 ? 159 GLY B CA  1 
ATOM   2256 C  C   . GLY B 1 159 ? -29.420 -5.792  123.438 1.00 14.11 ? 159 GLY B C   1 
ATOM   2257 O  O   . GLY B 1 159 ? -29.248 -6.322  124.559 1.00 14.41 ? 159 GLY B O   1 
ATOM   2258 N  N   . PRO B 1 160 ? -30.524 -5.142  123.131 1.00 14.59 ? 160 PRO B N   1 
ATOM   2259 C  CA  . PRO B 1 160 ? -31.667 -5.054  124.061 1.00 15.45 ? 160 PRO B CA  1 
ATOM   2260 C  C   . PRO B 1 160 ? -32.160 -6.477  124.328 1.00 16.26 ? 160 PRO B C   1 
ATOM   2261 O  O   . PRO B 1 160 ? -32.259 -7.274  123.341 1.00 16.90 ? 160 PRO B O   1 
ATOM   2262 C  CB  . PRO B 1 160 ? -32.629 -4.140  123.383 1.00 14.83 ? 160 PRO B CB  1 
ATOM   2263 C  CG  . PRO B 1 160 ? -32.357 -4.414  121.927 1.00 14.45 ? 160 PRO B CG  1 
ATOM   2264 C  CD  . PRO B 1 160 ? -30.838 -4.484  121.860 1.00 14.63 ? 160 PRO B CD  1 
ATOM   2265 N  N   . VAL B 1 161 ? -32.433 -6.786  125.582 1.00 15.70 ? 161 VAL B N   1 
ATOM   2266 C  CA  . VAL B 1 161 ? -32.867 -8.123  125.983 1.00 15.38 ? 161 VAL B CA  1 
ATOM   2267 C  C   . VAL B 1 161 ? -34.007 -8.755  125.220 1.00 14.80 ? 161 VAL B C   1 
ATOM   2268 O  O   . VAL B 1 161 ? -34.154 -9.999  125.427 1.00 14.81 ? 161 VAL B O   1 
ATOM   2269 C  CB  . VAL B 1 161 ? -33.219 -8.043  127.501 1.00 15.53 ? 161 VAL B CB  1 
ATOM   2270 C  CG1 . VAL B 1 161 ? -32.077 -8.241  128.429 1.00 15.32 ? 161 VAL B CG1 1 
ATOM   2271 C  CG2 . VAL B 1 161 ? -33.850 -6.697  127.784 1.00 16.63 ? 161 VAL B CG2 1 
ATOM   2272 N  N   . TRP B 1 162 ? -34.759 -8.073  124.424 1.00 14.47 ? 162 TRP B N   1 
ATOM   2273 C  CA  . TRP B 1 162 ? -35.890 -8.545  123.663 1.00 14.37 ? 162 TRP B CA  1 
ATOM   2274 C  C   . TRP B 1 162 ? -35.646 -8.780  122.182 1.00 15.20 ? 162 TRP B C   1 
ATOM   2275 O  O   . TRP B 1 162 ? -36.519 -9.272  121.435 1.00 15.91 ? 162 TRP B O   1 
ATOM   2276 C  CB  . TRP B 1 162 ? -37.060 -7.519  123.713 1.00 14.17 ? 162 TRP B CB  1 
ATOM   2277 C  CG  . TRP B 1 162 ? -36.782 -6.171  123.132 1.00 13.25 ? 162 TRP B CG  1 
ATOM   2278 C  CD1 . TRP B 1 162 ? -36.433 -5.072  123.884 1.00 13.16 ? 162 TRP B CD1 1 
ATOM   2279 C  CD2 . TRP B 1 162 ? -36.803 -5.706  121.795 1.00 12.58 ? 162 TRP B CD2 1 
ATOM   2280 N  NE1 . TRP B 1 162 ? -36.250 -3.975  123.111 1.00 12.83 ? 162 TRP B NE1 1 
ATOM   2281 C  CE2 . TRP B 1 162 ? -36.463 -4.338  121.824 1.00 12.88 ? 162 TRP B CE2 1 
ATOM   2282 C  CE3 . TRP B 1 162 ? -37.083 -6.305  120.586 1.00 12.27 ? 162 TRP B CE3 1 
ATOM   2283 C  CZ2 . TRP B 1 162 ? -36.362 -3.525  120.681 1.00 13.43 ? 162 TRP B CZ2 1 
ATOM   2284 C  CZ3 . TRP B 1 162 ? -37.012 -5.513  119.454 1.00 12.47 ? 162 TRP B CZ3 1 
ATOM   2285 C  CH2 . TRP B 1 162 ? -36.668 -4.174  119.479 1.00 12.89 ? 162 TRP B CH2 1 
ATOM   2286 N  N   . GLU B 1 163 ? -34.519 -8.382  121.740 1.00 16.70 ? 163 GLU B N   1 
ATOM   2287 C  CA  . GLU B 1 163 ? -34.102 -8.533  120.334 1.00 18.11 ? 163 GLU B CA  1 
ATOM   2288 C  C   . GLU B 1 163 ? -33.309 -9.804  120.240 1.00 18.44 ? 163 GLU B C   1 
ATOM   2289 O  O   . GLU B 1 163 ? -32.987 -10.382 121.327 1.00 17.08 ? 163 GLU B O   1 
ATOM   2290 C  CB  . GLU B 1 163 ? -33.305 -7.286  119.936 1.00 18.06 ? 163 GLU B CB  1 
ATOM   2291 C  CG  . GLU B 1 163 ? -32.579 -7.318  118.579 1.00 19.01 ? 163 GLU B CG  1 
ATOM   2292 C  CD  . GLU B 1 163 ? -33.606 -7.623  117.468 1.00 20.29 ? 163 GLU B CD  1 
ATOM   2293 O  OE1 . GLU B 1 163 ? -33.539 -8.499  116.582 1.00 20.03 ? 163 GLU B OE1 1 
ATOM   2294 O  OE2 . GLU B 1 163 ? -34.522 -6.794  117.729 1.00 20.35 ? 163 GLU B OE2 1 
ATOM   2295 N  N   . GLY B 1 164 ? -32.990 -10.248 119.031 1.00 19.75 ? 164 GLY B N   1 
ATOM   2296 C  CA  . GLY B 1 164 ? -32.120 -11.420 118.914 1.00 21.87 ? 164 GLY B CA  1 
ATOM   2297 C  C   . GLY B 1 164 ? -32.615 -12.618 118.196 1.00 22.67 ? 164 GLY B C   1 
ATOM   2298 O  O   . GLY B 1 164 ? -31.853 -13.571 117.978 1.00 22.88 ? 164 GLY B O   1 
ATOM   2299 N  N   . GLN B 1 165 ? -33.868 -12.507 117.812 1.00 23.98 ? 165 GLN B N   1 
ATOM   2300 C  CA  . GLN B 1 165 ? -34.403 -13.657 117.104 1.00 25.75 ? 165 GLN B CA  1 
ATOM   2301 C  C   . GLN B 1 165 ? -34.098 -13.718 115.645 1.00 26.56 ? 165 GLN B C   1 
ATOM   2302 O  O   . GLN B 1 165 ? -34.977 -14.265 114.960 1.00 27.10 ? 165 GLN B O   1 
ATOM   2303 C  CB  . GLN B 1 165 ? -35.929 -13.720 117.290 1.00 26.24 ? 165 GLN B CB  1 
ATOM   2304 C  CG  . GLN B 1 165 ? -35.993 -15.282 117.673 1.00 26.79 ? 165 GLN B CG  1 
ATOM   2305 C  CD  . GLN B 1 165 ? -37.450 -15.582 117.455 1.00 27.16 ? 165 GLN B CD  1 
ATOM   2306 O  OE1 . GLN B 1 165 ? -37.913 -16.605 117.888 1.00 27.08 ? 165 GLN B OE1 1 
ATOM   2307 N  NE2 . GLN B 1 165 ? -37.968 -14.541 116.758 1.00 27.33 ? 165 GLN B NE2 1 
ATOM   2308 N  N   . SER B 1 166 ? -32.978 -13.224 115.248 1.00 27.90 ? 166 SER B N   1 
ATOM   2309 C  CA  . SER B 1 166 ? -32.677 -13.309 113.765 1.00 28.78 ? 166 SER B CA  1 
ATOM   2310 C  C   . SER B 1 166 ? -31.544 -14.335 113.757 1.00 28.49 ? 166 SER B C   1 
ATOM   2311 O  O   . SER B 1 166 ? -31.126 -14.694 112.716 1.00 28.10 ? 166 SER B O   1 
ATOM   2312 C  CB  . SER B 1 166 ? -32.348 -12.017 113.107 1.00 29.14 ? 166 SER B CB  1 
ATOM   2313 O  OG  . SER B 1 166 ? -33.386 -11.092 113.518 1.00 29.81 ? 166 SER B OG  1 
ATOM   2314 N  N   . GLY B 1 167 ? -31.258 -14.641 115.016 1.00 28.63 ? 167 GLY B N   1 
ATOM   2315 C  CA  . GLY B 1 167 ? -30.196 -15.567 115.369 1.00 28.70 ? 167 GLY B CA  1 
ATOM   2316 C  C   . GLY B 1 167 ? -30.789 -16.958 115.408 1.00 28.89 ? 167 GLY B C   1 
ATOM   2317 O  O   . GLY B 1 167 ? -30.053 -17.964 115.345 1.00 28.87 ? 167 GLY B O   1 
ATOM   2318 N  N   . LEU B 1 168 ? -32.135 -16.901 115.502 1.00 28.93 ? 168 LEU B N   1 
ATOM   2319 C  CA  . LEU B 1 168 ? -32.761 -18.265 115.577 1.00 29.41 ? 168 LEU B CA  1 
ATOM   2320 C  C   . LEU B 1 168 ? -32.190 -19.137 114.487 1.00 30.16 ? 168 LEU B C   1 
ATOM   2321 O  O   . LEU B 1 168 ? -32.321 -20.320 114.657 1.00 29.39 ? 168 LEU B O   1 
ATOM   2322 C  CB  . LEU B 1 168 ? -34.239 -18.096 115.518 1.00 28.69 ? 168 LEU B CB  1 
ATOM   2323 C  CG  . LEU B 1 168 ? -35.321 -19.126 115.442 1.00 28.18 ? 168 LEU B CG  1 
ATOM   2324 C  CD1 . LEU B 1 168 ? -35.412 -19.714 114.026 1.00 28.78 ? 168 LEU B CD1 1 
ATOM   2325 C  CD2 . LEU B 1 168 ? -35.090 -20.280 116.400 1.00 27.56 ? 168 LEU B CD2 1 
ATOM   2326 N  N   . CYS B 1 169 ? -31.666 -18.582 113.436 1.00 33.32 ? 169 CYS B N   1 
ATOM   2327 C  CA  . CYS B 1 169 ? -31.200 -19.489 112.338 1.00 36.57 ? 169 CYS B CA  1 
ATOM   2328 C  C   . CYS B 1 169 ? -30.031 -20.282 112.853 1.00 36.22 ? 169 CYS B C   1 
ATOM   2329 O  O   . CYS B 1 169 ? -29.955 -21.429 112.393 1.00 36.57 ? 169 CYS B O   1 
ATOM   2330 C  CB  . CYS B 1 169 ? -30.975 -18.668 111.076 1.00 39.37 ? 169 CYS B CB  1 
ATOM   2331 S  SG  . CYS B 1 169 ? -29.549 -17.694 111.521 1.00 43.66 ? 169 CYS B SG  1 
ATOM   2332 N  N   . PHE B 1 170 ? -29.219 -19.843 113.745 1.00 36.12 ? 170 PHE B N   1 
ATOM   2333 C  CA  . PHE B 1 170 ? -28.080 -20.602 114.268 1.00 36.34 ? 170 PHE B CA  1 
ATOM   2334 C  C   . PHE B 1 170 ? -28.486 -21.788 115.130 1.00 37.36 ? 170 PHE B C   1 
ATOM   2335 O  O   . PHE B 1 170 ? -27.718 -22.773 115.270 1.00 37.54 ? 170 PHE B O   1 
ATOM   2336 C  CB  . PHE B 1 170 ? -27.199 -19.640 115.035 1.00 36.23 ? 170 PHE B CB  1 
ATOM   2337 C  CG  . PHE B 1 170 ? -26.493 -18.601 114.259 1.00 36.56 ? 170 PHE B CG  1 
ATOM   2338 C  CD1 . PHE B 1 170 ? -25.964 -17.487 114.910 1.00 36.90 ? 170 PHE B CD1 1 
ATOM   2339 C  CD2 . PHE B 1 170 ? -26.329 -18.675 112.892 1.00 36.99 ? 170 PHE B CD2 1 
ATOM   2340 C  CE1 . PHE B 1 170 ? -25.286 -16.491 114.206 1.00 36.84 ? 170 PHE B CE1 1 
ATOM   2341 C  CE2 . PHE B 1 170 ? -25.644 -17.678 112.169 1.00 36.75 ? 170 PHE B CE2 1 
ATOM   2342 C  CZ  . PHE B 1 170 ? -25.127 -16.587 112.838 1.00 36.50 ? 170 PHE B CZ  1 
ATOM   2343 N  N   . VAL B 1 171 ? -29.622 -21.773 115.737 1.00 38.64 ? 171 VAL B N   1 
ATOM   2344 C  CA  . VAL B 1 171 ? -30.124 -22.853 116.566 1.00 40.44 ? 171 VAL B CA  1 
ATOM   2345 C  C   . VAL B 1 171 ? -30.828 -23.824 115.637 1.00 43.29 ? 171 VAL B C   1 
ATOM   2346 O  O   . VAL B 1 171 ? -31.019 -24.988 115.890 1.00 43.86 ? 171 VAL B O   1 
ATOM   2347 C  CB  . VAL B 1 171 ? -31.084 -22.337 117.622 1.00 39.79 ? 171 VAL B CB  1 
ATOM   2348 C  CG1 . VAL B 1 171 ? -30.946 -23.087 118.936 1.00 39.40 ? 171 VAL B CG1 1 
ATOM   2349 C  CG2 . VAL B 1 171 ? -30.925 -20.836 117.794 1.00 39.68 ? 171 VAL B CG2 1 
ATOM   2350 N  N   . ASN B 1 172 ? -31.232 -23.240 114.534 1.00 47.43 ? 172 ASN B N   1 
ATOM   2351 C  CA  . ASN B 1 172 ? -31.943 -23.814 113.435 1.00 50.89 ? 172 ASN B CA  1 
ATOM   2352 C  C   . ASN B 1 172 ? -31.143 -24.602 112.423 1.00 53.58 ? 172 ASN B C   1 
ATOM   2353 O  O   . ASN B 1 172 ? -31.202 -25.788 112.227 1.00 55.10 ? 172 ASN B O   1 
ATOM   2354 C  CB  . ASN B 1 172 ? -32.593 -22.687 112.545 1.00 50.76 ? 172 ASN B CB  1 
ATOM   2355 C  CG  . ASN B 1 172 ? -34.086 -22.952 112.704 1.00 51.38 ? 172 ASN B CG  1 
ATOM   2356 O  OD1 . ASN B 1 172 ? -34.868 -22.079 112.344 1.00 51.99 ? 172 ASN B OD1 1 
ATOM   2357 N  ND2 . ASN B 1 172 ? -34.304 -24.151 113.259 1.00 51.49 ? 172 ASN B ND2 1 
ATOM   2358 N  N   . ASN B 1 173 ? -30.415 -23.784 111.746 1.00 56.66 ? 173 ASN B N   1 
ATOM   2359 C  CA  . ASN B 1 173 ? -29.488 -23.982 110.655 1.00 59.49 ? 173 ASN B CA  1 
ATOM   2360 C  C   . ASN B 1 173 ? -30.386 -23.765 109.386 1.00 60.66 ? 173 ASN B C   1 
ATOM   2361 O  O   . ASN B 1 173 ? -31.179 -24.484 108.847 1.00 60.86 ? 173 ASN B O   1 
ATOM   2362 C  CB  . ASN B 1 173 ? -28.654 -25.247 110.654 1.00 60.54 ? 173 ASN B CB  1 
ATOM   2363 C  CG  . ASN B 1 173 ? -27.392 -24.955 109.810 1.00 61.72 ? 173 ASN B CG  1 
ATOM   2364 O  OD1 . ASN B 1 173 ? -26.272 -25.249 110.234 1.00 62.33 ? 173 ASN B OD1 1 
ATOM   2365 N  ND2 . ASN B 1 173 ? -27.607 -24.365 108.625 1.00 62.17 ? 173 ASN B ND2 1 
ATOM   2366 N  N   . THR B 1 174 ? -30.182 -22.528 109.055 1.00 62.10 ? 174 THR B N   1 
ATOM   2367 C  CA  . THR B 1 174 ? -30.671 -21.781 107.940 1.00 63.59 ? 174 THR B CA  1 
ATOM   2368 C  C   . THR B 1 174 ? -29.283 -21.163 107.573 1.00 63.63 ? 174 THR B C   1 
ATOM   2369 O  O   . THR B 1 174 ? -28.263 -21.774 107.983 1.00 63.92 ? 174 THR B O   1 
ATOM   2370 C  CB  . THR B 1 174 ? -31.771 -20.727 108.147 1.00 64.48 ? 174 THR B CB  1 
ATOM   2371 O  OG1 . THR B 1 174 ? -32.803 -21.382 108.972 1.00 64.74 ? 174 THR B OG1 1 
ATOM   2372 C  CG2 . THR B 1 174 ? -32.376 -20.139 106.828 1.00 64.88 ? 174 THR B CG2 1 
ATOM   2373 N  N   . LYS B 1 175 ? -29.408 -20.062 106.934 1.00 63.47 ? 175 LYS B N   1 
ATOM   2374 C  CA  . LYS B 1 175 ? -28.116 -19.376 106.567 1.00 63.21 ? 175 LYS B CA  1 
ATOM   2375 C  C   . LYS B 1 175 ? -28.466 -17.939 106.898 1.00 61.16 ? 175 LYS B C   1 
ATOM   2376 O  O   . LYS B 1 175 ? -28.972 -17.228 105.993 1.00 61.53 ? 175 LYS B O   1 
ATOM   2377 C  CB  . LYS B 1 175 ? -27.738 -19.767 105.174 1.00 64.85 ? 175 LYS B CB  1 
ATOM   2378 C  CG  . LYS B 1 175 ? -26.238 -20.044 104.940 1.00 66.53 ? 175 LYS B CG  1 
ATOM   2379 C  CD  . LYS B 1 175 ? -25.497 -18.710 104.698 1.00 67.96 ? 175 LYS B CD  1 
ATOM   2380 C  CE  . LYS B 1 175 ? -26.101 -17.932 103.519 1.00 68.64 ? 175 LYS B CE  1 
ATOM   2381 N  NZ  . LYS B 1 175 ? -25.107 -17.007 102.887 1.00 68.98 ? 175 LYS B NZ  1 
ATOM   2382 N  N   . CYS B 1 176 ? -28.216 -17.590 108.185 1.00 57.66 ? 176 CYS B N   1 
ATOM   2383 C  CA  . CYS B 1 176 ? -28.628 -16.221 108.497 1.00 54.93 ? 176 CYS B CA  1 
ATOM   2384 C  C   . CYS B 1 176 ? -28.158 -15.172 107.475 1.00 54.63 ? 176 CYS B C   1 
ATOM   2385 O  O   . CYS B 1 176 ? -27.009 -14.749 107.531 1.00 55.15 ? 176 CYS B O   1 
ATOM   2386 C  CB  . CYS B 1 176 ? -28.264 -15.663 109.894 1.00 51.83 ? 176 CYS B CB  1 
ATOM   2387 S  SG  . CYS B 1 176 ? -29.975 -15.788 110.740 1.00 48.22 ? 176 CYS B SG  1 
ATOM   2388 N  N   . PRO B 1 177 ? -29.144 -14.793 106.665 1.00 53.89 ? 177 PRO B N   1 
ATOM   2389 C  CA  . PRO B 1 177 ? -28.871 -13.725 105.694 1.00 54.06 ? 177 PRO B CA  1 
ATOM   2390 C  C   . PRO B 1 177 ? -28.538 -12.469 106.508 1.00 54.43 ? 177 PRO B C   1 
ATOM   2391 O  O   . PRO B 1 177 ? -27.588 -11.706 106.301 1.00 54.72 ? 177 PRO B O   1 
ATOM   2392 C  CB  . PRO B 1 177 ? -30.100 -13.671 104.845 1.00 53.75 ? 177 PRO B CB  1 
ATOM   2393 C  CG  . PRO B 1 177 ? -31.182 -14.433 105.564 1.00 53.20 ? 177 PRO B CG  1 
ATOM   2394 C  CD  . PRO B 1 177 ? -30.526 -15.260 106.618 1.00 53.21 ? 177 PRO B CD  1 
ATOM   2395 N  N   . ASP B 1 178 ? -29.343 -12.232 107.535 1.00 54.56 ? 178 ASP B N   1 
ATOM   2396 C  CA  . ASP B 1 178 ? -29.248 -11.097 108.428 1.00 54.48 ? 178 ASP B CA  1 
ATOM   2397 C  C   . ASP B 1 178 ? -28.321 -11.311 109.593 1.00 53.18 ? 178 ASP B C   1 
ATOM   2398 O  O   . ASP B 1 178 ? -28.943 -11.189 110.713 1.00 53.72 ? 178 ASP B O   1 
ATOM   2399 C  CB  . ASP B 1 178 ? -30.682 -10.791 108.984 1.00 56.27 ? 178 ASP B CB  1 
ATOM   2400 C  CG  . ASP B 1 178 ? -30.940 -9.300  109.182 1.00 57.70 ? 178 ASP B CG  1 
ATOM   2401 O  OD1 . ASP B 1 178 ? -32.117 -8.908  109.462 1.00 58.08 ? 178 ASP B OD1 1 
ATOM   2402 O  OD2 . ASP B 1 178 ? -29.934 -8.538  109.023 1.00 58.29 ? 178 ASP B OD2 1 
ATOM   2403 N  N   . THR B 1 179 ? -27.047 -11.583 109.520 1.00 50.88 ? 179 THR B N   1 
ATOM   2404 C  CA  . THR B 1 179 ? -26.357 -11.763 110.832 1.00 48.80 ? 179 THR B CA  1 
ATOM   2405 C  C   . THR B 1 179 ? -26.163 -10.425 111.516 1.00 47.30 ? 179 THR B C   1 
ATOM   2406 O  O   . THR B 1 179 ? -25.595 -10.355 112.624 1.00 47.50 ? 179 THR B O   1 
ATOM   2407 C  CB  . THR B 1 179 ? -25.005 -12.534 110.732 1.00 49.14 ? 179 THR B CB  1 
ATOM   2408 O  OG1 . THR B 1 179 ? -24.236 -11.767 109.755 1.00 49.59 ? 179 THR B OG1 1 
ATOM   2409 C  CG2 . THR B 1 179 ? -25.238 -14.004 110.406 1.00 49.31 ? 179 THR B CG2 1 
ATOM   2410 N  N   . SER B 1 180 ? -26.614 -9.398  110.862 1.00 45.30 ? 180 SER B N   1 
ATOM   2411 C  CA  . SER B 1 180 ? -26.551 -8.023  111.300 1.00 42.91 ? 180 SER B CA  1 
ATOM   2412 C  C   . SER B 1 180 ? -27.275 -7.781  112.596 1.00 40.37 ? 180 SER B C   1 
ATOM   2413 O  O   . SER B 1 180 ? -27.212 -6.645  113.071 1.00 39.65 ? 180 SER B O   1 
ATOM   2414 C  CB  . SER B 1 180 ? -27.300 -7.131  110.282 1.00 44.12 ? 180 SER B CB  1 
ATOM   2415 O  OG  . SER B 1 180 ? -26.716 -5.816  110.169 1.00 45.27 ? 180 SER B OG  1 
ATOM   2416 N  N   . ARG B 1 181 ? -28.002 -8.770  113.087 1.00 38.33 ? 181 ARG B N   1 
ATOM   2417 C  CA  . ARG B 1 181 ? -28.761 -8.413  114.337 1.00 36.40 ? 181 ARG B CA  1 
ATOM   2418 C  C   . ARG B 1 181 ? -29.174 -9.622  115.109 1.00 33.27 ? 181 ARG B C   1 
ATOM   2419 O  O   . ARG B 1 181 ? -30.251 -9.792  115.646 1.00 32.67 ? 181 ARG B O   1 
ATOM   2420 C  CB  . ARG B 1 181 ? -29.909 -7.524  113.891 1.00 38.75 ? 181 ARG B CB  1 
ATOM   2421 C  CG  . ARG B 1 181 ? -31.045 -8.245  113.169 1.00 41.21 ? 181 ARG B CG  1 
ATOM   2422 C  CD  . ARG B 1 181 ? -32.019 -7.308  112.490 1.00 43.35 ? 181 ARG B CD  1 
ATOM   2423 N  NE  . ARG B 1 181 ? -31.443 -6.317  111.600 1.00 45.42 ? 181 ARG B NE  1 
ATOM   2424 C  CZ  . ARG B 1 181 ? -32.216 -5.588  110.763 1.00 46.79 ? 181 ARG B CZ  1 
ATOM   2425 N  NH1 . ARG B 1 181 ? -31.669 -4.705  109.919 1.00 47.45 ? 181 ARG B NH1 1 
ATOM   2426 N  NH2 . ARG B 1 181 ? -33.554 -5.778  110.829 1.00 47.53 ? 181 ARG B NH2 1 
ATOM   2427 N  N   . ALA B 1 182 ? -28.199 -10.495 115.123 1.00 29.96 ? 182 ALA B N   1 
ATOM   2428 C  CA  . ALA B 1 182 ? -28.146 -11.761 115.782 1.00 26.53 ? 182 ALA B CA  1 
ATOM   2429 C  C   . ALA B 1 182 ? -27.310 -11.376 117.004 1.00 24.87 ? 182 ALA B C   1 
ATOM   2430 O  O   . ALA B 1 182 ? -26.238 -10.760 116.680 1.00 25.30 ? 182 ALA B O   1 
ATOM   2431 C  CB  . ALA B 1 182 ? -27.451 -12.815 114.995 1.00 25.49 ? 182 ALA B CB  1 
ATOM   2432 N  N   . ILE B 1 183 ? -27.803 -11.691 118.170 1.00 22.44 ? 183 ILE B N   1 
ATOM   2433 C  CA  . ILE B 1 183 ? -26.848 -11.336 119.275 1.00 19.92 ? 183 ILE B CA  1 
ATOM   2434 C  C   . ILE B 1 183 ? -26.048 -12.642 119.404 1.00 18.22 ? 183 ILE B C   1 
ATOM   2435 O  O   . ILE B 1 183 ? -26.574 -13.551 120.083 1.00 18.29 ? 183 ILE B O   1 
ATOM   2436 C  CB  . ILE B 1 183 ? -27.462 -10.889 120.580 1.00 19.78 ? 183 ILE B CB  1 
ATOM   2437 C  CG1 . ILE B 1 183 ? -28.050 -9.487  120.469 1.00 19.20 ? 183 ILE B CG1 1 
ATOM   2438 C  CG2 . ILE B 1 183 ? -26.335 -11.007 121.663 1.00 19.93 ? 183 ILE B CG2 1 
ATOM   2439 C  CD1 . ILE B 1 183 ? -29.414 -9.315  121.148 1.00 18.95 ? 183 ILE B CD1 1 
ATOM   2440 N  N   . THR B 1 184 ? -24.934 -12.770 118.773 1.00 16.33 ? 184 THR B N   1 
ATOM   2441 C  CA  . THR B 1 184 ? -24.191 -14.054 118.886 1.00 15.04 ? 184 THR B CA  1 
ATOM   2442 C  C   . THR B 1 184 ? -22.739 -13.770 119.104 1.00 14.18 ? 184 THR B C   1 
ATOM   2443 O  O   . THR B 1 184 ? -22.342 -12.600 118.962 1.00 14.45 ? 184 THR B O   1 
ATOM   2444 C  CB  . THR B 1 184 ? -24.520 -14.863 117.596 1.00 14.77 ? 184 THR B CB  1 
ATOM   2445 O  OG1 . THR B 1 184 ? -24.128 -16.255 117.686 1.00 14.65 ? 184 THR B OG1 1 
ATOM   2446 C  CG2 . THR B 1 184 ? -23.784 -14.118 116.467 1.00 15.01 ? 184 THR B CG2 1 
ATOM   2447 N  N   . ILE B 1 185 ? -21.915 -14.722 119.408 1.00 13.54 ? 185 ILE B N   1 
ATOM   2448 C  CA  . ILE B 1 185 ? -20.514 -14.676 119.672 1.00 12.93 ? 185 ILE B CA  1 
ATOM   2449 C  C   . ILE B 1 185 ? -19.891 -16.035 119.390 1.00 14.52 ? 185 ILE B C   1 
ATOM   2450 O  O   . ILE B 1 185 ? -20.402 -17.081 119.870 1.00 15.59 ? 185 ILE B O   1 
ATOM   2451 C  CB  . ILE B 1 185 ? -20.222 -14.295 121.169 1.00 11.67 ? 185 ILE B CB  1 
ATOM   2452 C  CG1 . ILE B 1 185 ? -18.759 -14.136 121.323 1.00 11.60 ? 185 ILE B CG1 1 
ATOM   2453 C  CG2 . ILE B 1 185 ? -20.851 -15.410 122.042 1.00 11.48 ? 185 ILE B CG2 1 
ATOM   2454 C  CD1 . ILE B 1 185 ? -17.885 -13.880 122.502 1.00 11.11 ? 185 ILE B CD1 1 
ATOM   2455 N  N   . ALA B 1 186 ? -18.815 -16.012 118.618 1.00 15.85 ? 186 ALA B N   1 
ATOM   2456 C  CA  . ALA B 1 186 ? -18.144 -17.290 118.228 1.00 16.34 ? 186 ALA B CA  1 
ATOM   2457 C  C   . ALA B 1 186 ? -16.660 -17.167 118.452 1.00 16.76 ? 186 ALA B C   1 
ATOM   2458 O  O   . ALA B 1 186 ? -16.076 -16.133 118.161 1.00 16.30 ? 186 ALA B O   1 
ATOM   2459 C  CB  . ALA B 1 186 ? -18.656 -17.556 116.819 1.00 16.21 ? 186 ALA B CB  1 
ATOM   2460 N  N   . LEU B 1 187 ? -16.044 -18.185 118.985 1.00 18.26 ? 187 LEU B N   1 
ATOM   2461 C  CA  . LEU B 1 187 ? -14.694 -18.363 119.369 1.00 20.06 ? 187 LEU B CA  1 
ATOM   2462 C  C   . LEU B 1 187 ? -13.628 -18.345 118.283 1.00 22.59 ? 187 LEU B C   1 
ATOM   2463 O  O   . LEU B 1 187 ? -13.807 -18.943 117.211 1.00 22.94 ? 187 LEU B O   1 
ATOM   2464 C  CB  . LEU B 1 187 ? -14.656 -19.761 120.121 1.00 18.66 ? 187 LEU B CB  1 
ATOM   2465 C  CG  . LEU B 1 187 ? -13.194 -20.052 120.536 1.00 17.54 ? 187 LEU B CG  1 
ATOM   2466 C  CD1 . LEU B 1 187 ? -12.817 -19.026 121.591 1.00 17.43 ? 187 LEU B CD1 1 
ATOM   2467 C  CD2 . LEU B 1 187 ? -13.067 -21.436 121.051 1.00 16.57 ? 187 LEU B CD2 1 
ATOM   2468 N  N   . ASP B 1 188 ? -12.490 -17.702 118.597 1.00 25.14 ? 188 ASP B N   1 
ATOM   2469 C  CA  . ASP B 1 188 ? -11.403 -17.655 117.587 1.00 27.68 ? 188 ASP B CA  1 
ATOM   2470 C  C   . ASP B 1 188 ? -10.545 -18.901 117.742 1.00 29.85 ? 188 ASP B C   1 
ATOM   2471 O  O   . ASP B 1 188 ? -9.386  -18.828 118.225 1.00 31.27 ? 188 ASP B O   1 
ATOM   2472 C  CB  . ASP B 1 188 ? -10.635 -16.354 117.715 1.00 27.63 ? 188 ASP B CB  1 
ATOM   2473 C  CG  . ASP B 1 188 ? -10.294 -16.072 119.166 1.00 27.81 ? 188 ASP B CG  1 
ATOM   2474 O  OD1 . ASP B 1 188 ? -9.140  -16.240 119.538 1.00 28.25 ? 188 ASP B OD1 1 
ATOM   2475 O  OD2 . ASP B 1 188 ? -11.256 -15.712 119.865 1.00 27.99 ? 188 ASP B OD2 1 
ATOM   2476 N  N   . THR B 1 189 ? -11.073 -20.008 117.337 1.00 31.38 ? 189 THR B N   1 
ATOM   2477 C  CA  . THR B 1 189 ? -10.355 -21.312 117.437 1.00 33.21 ? 189 THR B CA  1 
ATOM   2478 C  C   . THR B 1 189 ? -8.960  -21.328 116.883 1.00 34.25 ? 189 THR B C   1 
ATOM   2479 O  O   . THR B 1 189 ? -8.140  -22.255 117.256 1.00 34.95 ? 189 THR B O   1 
ATOM   2480 C  CB  . THR B 1 189 ? -11.363 -22.358 116.807 1.00 33.31 ? 189 THR B CB  1 
ATOM   2481 O  OG1 . THR B 1 189 ? -12.113 -21.508 115.872 1.00 34.11 ? 189 THR B OG1 1 
ATOM   2482 C  CG2 . THR B 1 189 ? -12.299 -23.059 117.765 1.00 32.95 ? 189 THR B CG2 1 
ATOM   2483 N  N   . ASN B 1 190 ? -8.521  -20.418 116.065 1.00 35.39 ? 190 ASN B N   1 
ATOM   2484 C  CA  . ASN B 1 190 ? -7.129  -20.438 115.543 1.00 36.66 ? 190 ASN B CA  1 
ATOM   2485 C  C   . ASN B 1 190 ? -6.183  -20.206 116.735 1.00 35.65 ? 190 ASN B C   1 
ATOM   2486 O  O   . ASN B 1 190 ? -5.317  -20.992 117.048 1.00 36.23 ? 190 ASN B O   1 
ATOM   2487 C  CB  . ASN B 1 190 ? -6.819  -19.420 114.444 1.00 38.69 ? 190 ASN B CB  1 
ATOM   2488 C  CG  . ASN B 1 190 ? -8.092  -18.685 114.001 1.00 40.83 ? 190 ASN B CG  1 
ATOM   2489 O  OD1 . ASN B 1 190 ? -8.239  -17.431 114.094 1.00 41.50 ? 190 ASN B OD1 1 
ATOM   2490 N  ND2 . ASN B 1 190 ? -9.058  -19.517 113.538 1.00 41.60 ? 190 ASN B ND2 1 
ATOM   2491 N  N   . GLU B 1 191 ? -6.419  -19.089 117.323 1.00 34.73 ? 191 GLU B N   1 
ATOM   2492 C  CA  . GLU B 1 191 ? -5.771  -18.495 118.434 1.00 34.80 ? 191 GLU B CA  1 
ATOM   2493 C  C   . GLU B 1 191 ? -5.863  -19.229 119.735 1.00 34.82 ? 191 GLU B C   1 
ATOM   2494 O  O   . GLU B 1 191 ? -5.414  -18.703 120.777 1.00 35.21 ? 191 GLU B O   1 
ATOM   2495 C  CB  . GLU B 1 191 ? -6.442  -17.110 118.653 1.00 35.17 ? 191 GLU B CB  1 
ATOM   2496 C  CG  . GLU B 1 191 ? -6.588  -16.375 117.336 1.00 35.54 ? 191 GLU B CG  1 
ATOM   2497 C  CD  . GLU B 1 191 ? -5.440  -16.075 116.451 1.00 35.46 ? 191 GLU B CD  1 
ATOM   2498 O  OE1 . GLU B 1 191 ? -4.257  -16.345 116.534 1.00 35.01 ? 191 GLU B OE1 1 
ATOM   2499 O  OE2 . GLU B 1 191 ? -5.886  -15.361 115.477 1.00 36.08 ? 191 GLU B OE2 1 
ATOM   2500 N  N   . VAL B 1 192 ? -6.398  -20.429 119.705 1.00 34.71 ? 192 VAL B N   1 
ATOM   2501 C  CA  . VAL B 1 192 ? -6.488  -21.241 120.939 1.00 33.75 ? 192 VAL B CA  1 
ATOM   2502 C  C   . VAL B 1 192 ? -5.061  -21.624 121.292 1.00 33.13 ? 192 VAL B C   1 
ATOM   2503 O  O   . VAL B 1 192 ? -4.310  -21.791 120.312 1.00 32.25 ? 192 VAL B O   1 
ATOM   2504 C  CB  . VAL B 1 192 ? -7.414  -22.425 120.743 1.00 33.65 ? 192 VAL B CB  1 
ATOM   2505 C  CG1 . VAL B 1 192 ? -7.574  -23.167 122.066 1.00 34.23 ? 192 VAL B CG1 1 
ATOM   2506 C  CG2 . VAL B 1 192 ? -8.770  -22.011 120.208 1.00 34.07 ? 192 VAL B CG2 1 
ATOM   2507 N  N   . SER B 1 193 ? -4.768  -21.761 122.563 1.00 33.45 ? 193 SER B N   1 
ATOM   2508 C  CA  . SER B 1 193 ? -3.379  -22.123 122.921 1.00 34.54 ? 193 SER B CA  1 
ATOM   2509 C  C   . SER B 1 193 ? -2.971  -23.561 122.777 1.00 34.49 ? 193 SER B C   1 
ATOM   2510 O  O   . SER B 1 193 ? -1.792  -23.795 122.426 1.00 33.99 ? 193 SER B O   1 
ATOM   2511 C  CB  . SER B 1 193 ? -3.100  -21.704 124.386 1.00 35.40 ? 193 SER B CB  1 
ATOM   2512 O  OG  . SER B 1 193 ? -2.982  -20.264 124.375 1.00 36.55 ? 193 SER B OG  1 
ATOM   2513 N  N   . GLU B 1 194 ? -3.866  -24.493 123.057 1.00 35.14 ? 194 GLU B N   1 
ATOM   2514 C  CA  . GLU B 1 194 ? -3.460  -25.927 122.958 1.00 35.61 ? 194 GLU B CA  1 
ATOM   2515 C  C   . GLU B 1 194 ? -4.177  -26.596 121.801 1.00 35.00 ? 194 GLU B C   1 
ATOM   2516 O  O   . GLU B 1 194 ? -5.369  -26.390 121.498 1.00 34.96 ? 194 GLU B O   1 
ATOM   2517 C  CB  . GLU B 1 194 ? -3.688  -26.635 124.284 1.00 36.75 ? 194 GLU B CB  1 
ATOM   2518 C  CG  . GLU B 1 194 ? -3.113  -25.905 125.544 1.00 37.63 ? 194 GLU B CG  1 
ATOM   2519 C  CD  . GLU B 1 194 ? -1.626  -25.867 125.587 1.00 38.12 ? 194 GLU B CD  1 
ATOM   2520 O  OE1 . GLU B 1 194 ? -0.918  -25.176 124.880 1.00 39.28 ? 194 GLU B OE1 1 
ATOM   2521 O  OE2 . GLU B 1 194 ? -1.101  -26.648 126.406 1.00 38.57 ? 194 GLU B OE2 1 
ATOM   2522 N  N   . LYS B 1 195 ? -3.358  -27.418 121.139 1.00 33.55 ? 195 LYS B N   1 
ATOM   2523 C  CA  . LYS B 1 195 ? -3.771  -28.214 120.000 1.00 31.93 ? 195 LYS B CA  1 
ATOM   2524 C  C   . LYS B 1 195 ? -5.029  -28.954 120.440 1.00 30.17 ? 195 LYS B C   1 
ATOM   2525 O  O   . LYS B 1 195 ? -6.039  -28.959 119.683 1.00 31.41 ? 195 LYS B O   1 
ATOM   2526 C  CB  . LYS B 1 195 ? -2.698  -29.164 119.528 1.00 33.57 ? 195 LYS B CB  1 
ATOM   2527 C  CG  . LYS B 1 195 ? -1.511  -28.546 118.783 1.00 35.29 ? 195 LYS B CG  1 
ATOM   2528 C  CD  . LYS B 1 195 ? -1.716  -28.289 117.260 1.00 36.90 ? 195 LYS B CD  1 
ATOM   2529 C  CE  . LYS B 1 195 ? -2.369  -26.985 116.854 1.00 37.54 ? 195 LYS B CE  1 
ATOM   2530 N  NZ  . LYS B 1 195 ? -2.663  -26.553 115.480 1.00 36.63 ? 195 LYS B NZ  1 
ATOM   2531 N  N   . ARG B 1 196 ? -5.018  -29.540 121.612 1.00 27.29 ? 196 ARG B N   1 
ATOM   2532 C  CA  . ARG B 1 196 ? -6.178  -30.287 122.154 1.00 23.90 ? 196 ARG B CA  1 
ATOM   2533 C  C   . ARG B 1 196 ? -6.345  -30.023 123.635 1.00 20.91 ? 196 ARG B C   1 
ATOM   2534 O  O   . ARG B 1 196 ? -5.434  -29.569 124.339 1.00 20.31 ? 196 ARG B O   1 
ATOM   2535 C  CB  . ARG B 1 196 ? -6.069  -31.785 121.963 1.00 24.87 ? 196 ARG B CB  1 
ATOM   2536 C  CG  . ARG B 1 196 ? -6.358  -32.258 120.564 1.00 27.09 ? 196 ARG B CG  1 
ATOM   2537 C  CD  . ARG B 1 196 ? -5.217  -32.137 119.633 1.00 29.57 ? 196 ARG B CD  1 
ATOM   2538 N  NE  . ARG B 1 196 ? -5.518  -31.529 118.327 1.00 31.73 ? 196 ARG B NE  1 
ATOM   2539 C  CZ  . ARG B 1 196 ? -6.105  -32.136 117.298 1.00 32.85 ? 196 ARG B CZ  1 
ATOM   2540 N  NH1 . ARG B 1 196 ? -6.679  -33.328 117.366 1.00 32.82 ? 196 ARG B NH1 1 
ATOM   2541 N  NH2 . ARG B 1 196 ? -6.177  -31.522 116.085 1.00 33.37 ? 196 ARG B NH2 1 
ATOM   2542 N  N   . TYR B 1 197 ? -7.535  -30.339 124.055 1.00 18.21 ? 197 TYR B N   1 
ATOM   2543 C  CA  . TYR B 1 197 ? -7.873  -30.134 125.493 1.00 16.67 ? 197 TYR B CA  1 
ATOM   2544 C  C   . TYR B 1 197 ? -8.481  -31.398 126.097 1.00 15.71 ? 197 TYR B C   1 
ATOM   2545 O  O   . TYR B 1 197 ? -9.238  -32.120 125.433 1.00 15.02 ? 197 TYR B O   1 
ATOM   2546 C  CB  . TYR B 1 197 ? -8.743  -28.878 125.647 1.00 15.95 ? 197 TYR B CB  1 
ATOM   2547 C  CG  . TYR B 1 197 ? -8.112  -27.524 125.434 1.00 15.27 ? 197 TYR B CG  1 
ATOM   2548 C  CD1 . TYR B 1 197 ? -8.565  -26.656 124.443 1.00 15.25 ? 197 TYR B CD1 1 
ATOM   2549 C  CD2 . TYR B 1 197 ? -7.067  -27.061 126.223 1.00 15.28 ? 197 TYR B CD2 1 
ATOM   2550 C  CE1 . TYR B 1 197 ? -8.023  -25.401 124.226 1.00 15.17 ? 197 TYR B CE1 1 
ATOM   2551 C  CE2 . TYR B 1 197 ? -6.482  -25.822 126.020 1.00 15.63 ? 197 TYR B CE2 1 
ATOM   2552 C  CZ  . TYR B 1 197 ? -6.956  -24.975 125.001 1.00 15.52 ? 197 TYR B CZ  1 
ATOM   2553 O  OH  . TYR B 1 197 ? -6.367  -23.749 124.848 1.00 15.11 ? 197 TYR B OH  1 
ATOM   2554 N  N   . PRO B 1 198 ? -8.087  -31.658 127.355 1.00 15.17 ? 198 PRO B N   1 
ATOM   2555 C  CA  . PRO B 1 198 ? -8.525  -32.796 128.169 1.00 14.75 ? 198 PRO B CA  1 
ATOM   2556 C  C   . PRO B 1 198 ? -9.911  -32.545 128.646 1.00 15.48 ? 198 PRO B C   1 
ATOM   2557 O  O   . PRO B 1 198 ? -10.211 -31.304 128.733 1.00 16.02 ? 198 PRO B O   1 
ATOM   2558 C  CB  . PRO B 1 198 ? -7.512  -32.836 129.314 1.00 13.75 ? 198 PRO B CB  1 
ATOM   2559 C  CG  . PRO B 1 198 ? -7.418  -31.361 129.575 1.00 14.30 ? 198 PRO B CG  1 
ATOM   2560 C  CD  . PRO B 1 198 ? -7.160  -30.793 128.145 1.00 14.46 ? 198 PRO B CD  1 
ATOM   2561 N  N   . PHE B 1 199 ? -10.708 -33.553 128.907 1.00 16.49 ? 199 PHE B N   1 
ATOM   2562 C  CA  . PHE B 1 199 ? -12.083 -33.237 129.373 1.00 17.33 ? 199 PHE B CA  1 
ATOM   2563 C  C   . PHE B 1 199 ? -12.025 -33.090 130.905 1.00 17.40 ? 199 PHE B C   1 
ATOM   2564 O  O   . PHE B 1 199 ? -11.867 -34.108 131.590 1.00 16.78 ? 199 PHE B O   1 
ATOM   2565 C  CB  . PHE B 1 199 ? -13.116 -34.217 128.926 1.00 18.54 ? 199 PHE B CB  1 
ATOM   2566 C  CG  . PHE B 1 199 ? -14.480 -34.181 129.534 1.00 20.36 ? 199 PHE B CG  1 
ATOM   2567 C  CD1 . PHE B 1 199 ? -15.598 -34.532 128.738 1.00 21.38 ? 199 PHE B CD1 1 
ATOM   2568 C  CD2 . PHE B 1 199 ? -14.728 -33.818 130.841 1.00 20.79 ? 199 PHE B CD2 1 
ATOM   2569 C  CE1 . PHE B 1 199 ? -16.899 -34.517 129.263 1.00 21.57 ? 199 PHE B CE1 1 
ATOM   2570 C  CE2 . PHE B 1 199 ? -16.022 -33.796 131.385 1.00 20.84 ? 199 PHE B CE2 1 
ATOM   2571 C  CZ  . PHE B 1 199 ? -17.106 -34.166 130.589 1.00 21.04 ? 199 PHE B CZ  1 
ATOM   2572 N  N   . LYS B 1 200 ? -12.206 -31.829 131.329 1.00 17.85 ? 200 LYS B N   1 
ATOM   2573 C  CA  . LYS B 1 200 ? -12.231 -31.668 132.834 1.00 18.42 ? 200 LYS B CA  1 
ATOM   2574 C  C   . LYS B 1 200 ? -13.678 -31.642 133.296 1.00 18.76 ? 200 LYS B C   1 
ATOM   2575 O  O   . LYS B 1 200 ? -14.625 -31.347 132.538 1.00 19.60 ? 200 LYS B O   1 
ATOM   2576 C  CB  . LYS B 1 200 ? -11.364 -30.500 133.261 1.00 17.09 ? 200 LYS B CB  1 
ATOM   2577 C  CG  . LYS B 1 200 ? -9.901  -30.910 133.058 1.00 17.31 ? 200 LYS B CG  1 
ATOM   2578 C  CD  . LYS B 1 200 ? -9.631  -32.377 133.434 1.00 17.26 ? 200 LYS B CD  1 
ATOM   2579 C  CE  . LYS B 1 200 ? -8.636  -32.539 134.524 1.00 17.91 ? 200 LYS B CE  1 
ATOM   2580 N  NZ  . LYS B 1 200 ? -8.959  -32.888 135.901 1.00 17.22 ? 200 LYS B NZ  1 
ATOM   2581 N  N   . THR B 1 201 ? -13.932 -32.011 134.501 1.00 19.70 ? 201 THR B N   1 
ATOM   2582 C  CA  . THR B 1 201 ? -15.217 -32.021 135.216 1.00 20.72 ? 201 THR B CA  1 
ATOM   2583 C  C   . THR B 1 201 ? -15.182 -30.698 135.982 1.00 21.21 ? 201 THR B C   1 
ATOM   2584 O  O   . THR B 1 201 ? -14.013 -30.213 136.237 1.00 21.86 ? 201 THR B O   1 
ATOM   2585 C  CB  . THR B 1 201 ? -15.449 -33.207 136.161 1.00 20.92 ? 201 THR B CB  1 
ATOM   2586 O  OG1 . THR B 1 201 ? -14.425 -33.069 137.224 1.00 21.50 ? 201 THR B OG1 1 
ATOM   2587 C  CG2 . THR B 1 201 ? -15.329 -34.602 135.521 1.00 20.91 ? 201 THR B CG2 1 
ATOM   2588 N  N   . ALA B 1 202 ? -16.306 -30.146 136.318 1.00 21.40 ? 202 ALA B N   1 
ATOM   2589 C  CA  . ALA B 1 202 ? -16.226 -28.781 136.959 1.00 21.90 ? 202 ALA B CA  1 
ATOM   2590 C  C   . ALA B 1 202 ? -15.383 -28.697 138.215 1.00 21.72 ? 202 ALA B C   1 
ATOM   2591 O  O   . ALA B 1 202 ? -14.688 -27.714 138.482 1.00 21.21 ? 202 ALA B O   1 
ATOM   2592 C  CB  . ALA B 1 202 ? -17.623 -28.309 137.249 1.00 22.42 ? 202 ALA B CB  1 
ATOM   2593 N  N   . THR B 1 203 ? -15.524 -29.740 138.953 1.00 22.37 ? 203 THR B N   1 
ATOM   2594 C  CA  . THR B 1 203 ? -14.884 -29.970 140.225 1.00 22.89 ? 203 THR B CA  1 
ATOM   2595 C  C   . THR B 1 203 ? -13.380 -30.036 140.133 1.00 22.92 ? 203 THR B C   1 
ATOM   2596 O  O   . THR B 1 203 ? -12.647 -29.241 140.692 1.00 22.28 ? 203 THR B O   1 
ATOM   2597 C  CB  . THR B 1 203 ? -15.370 -31.352 140.868 1.00 22.74 ? 203 THR B CB  1 
ATOM   2598 O  OG1 . THR B 1 203 ? -16.710 -31.518 140.331 1.00 23.02 ? 203 THR B OG1 1 
ATOM   2599 C  CG2 . THR B 1 203 ? -15.261 -31.301 142.371 1.00 22.88 ? 203 THR B CG2 1 
ATOM   2600 N  N   . ASP B 1 204 ? -12.993 -31.097 139.400 1.00 23.72 ? 204 ASP B N   1 
ATOM   2601 C  CA  . ASP B 1 204 ? -11.562 -31.265 139.219 1.00 25.02 ? 204 ASP B CA  1 
ATOM   2602 C  C   . ASP B 1 204 ? -10.966 -29.894 138.796 1.00 25.58 ? 204 ASP B C   1 
ATOM   2603 O  O   . ASP B 1 204 ? -9.964  -29.380 139.361 1.00 25.64 ? 204 ASP B O   1 
ATOM   2604 C  CB  . ASP B 1 204 ? -11.135 -32.336 138.205 1.00 25.30 ? 204 ASP B CB  1 
ATOM   2605 C  CG  . ASP B 1 204 ? -9.736  -32.713 138.708 1.00 26.02 ? 204 ASP B CG  1 
ATOM   2606 O  OD1 . ASP B 1 204 ? -9.613  -33.813 139.211 1.00 26.35 ? 204 ASP B OD1 1 
ATOM   2607 O  OD2 . ASP B 1 204 ? -8.805  -31.871 138.698 1.00 27.19 ? 204 ASP B OD2 1 
ATOM   2608 N  N   . TYR B 1 205 ? -11.648 -29.385 137.751 1.00 25.39 ? 205 TYR B N   1 
ATOM   2609 C  CA  . TYR B 1 205 ? -11.150 -28.109 137.211 1.00 24.84 ? 205 TYR B CA  1 
ATOM   2610 C  C   . TYR B 1 205 ? -10.902 -27.141 138.373 1.00 24.81 ? 205 TYR B C   1 
ATOM   2611 O  O   . TYR B 1 205 ? -9.788  -26.688 138.616 1.00 24.95 ? 205 TYR B O   1 
ATOM   2612 C  CB  . TYR B 1 205 ? -12.095 -27.511 136.195 1.00 24.42 ? 205 TYR B CB  1 
ATOM   2613 C  CG  . TYR B 1 205 ? -11.633 -26.112 135.804 1.00 23.99 ? 205 TYR B CG  1 
ATOM   2614 C  CD1 . TYR B 1 205 ? -12.516 -25.051 135.947 1.00 24.66 ? 205 TYR B CD1 1 
ATOM   2615 C  CD2 . TYR B 1 205 ? -10.385 -25.834 135.319 1.00 23.93 ? 205 TYR B CD2 1 
ATOM   2616 C  CE1 . TYR B 1 205 ? -12.154 -23.758 135.599 1.00 24.68 ? 205 TYR B CE1 1 
ATOM   2617 C  CE2 . TYR B 1 205 ? -10.006 -24.533 134.955 1.00 23.84 ? 205 TYR B CE2 1 
ATOM   2618 C  CZ  . TYR B 1 205 ? -10.882 -23.497 135.103 1.00 23.65 ? 205 TYR B CZ  1 
ATOM   2619 O  OH  . TYR B 1 205 ? -10.555 -22.224 134.778 1.00 23.13 ? 205 TYR B OH  1 
ATOM   2620 N  N   . ALA B 1 206 ? -12.014 -26.921 139.026 1.00 24.72 ? 206 ALA B N   1 
ATOM   2621 C  CA  . ALA B 1 206 ? -12.036 -25.993 140.189 1.00 25.10 ? 206 ALA B CA  1 
ATOM   2622 C  C   . ALA B 1 206 ? -10.864 -26.225 141.106 1.00 24.87 ? 206 ALA B C   1 
ATOM   2623 O  O   . ALA B 1 206 ? -9.915  -25.425 141.192 1.00 25.00 ? 206 ALA B O   1 
ATOM   2624 C  CB  . ALA B 1 206 ? -13.435 -26.193 140.761 1.00 25.78 ? 206 ALA B CB  1 
ATOM   2625 N  N   . THR B 1 207 ? -10.833 -27.297 141.816 1.00 25.33 ? 207 THR B N   1 
ATOM   2626 C  CA  . THR B 1 207 ? -9.766  -27.723 142.724 1.00 26.27 ? 207 THR B CA  1 
ATOM   2627 C  C   . THR B 1 207 ? -8.380  -27.418 142.194 1.00 25.91 ? 207 THR B C   1 
ATOM   2628 O  O   . THR B 1 207 ? -7.465  -26.911 142.853 1.00 25.77 ? 207 THR B O   1 
ATOM   2629 C  CB  . THR B 1 207 ? -9.993  -29.267 142.947 1.00 27.16 ? 207 THR B CB  1 
ATOM   2630 O  OG1 . THR B 1 207 ? -11.235 -29.261 143.761 1.00 28.48 ? 207 THR B OG1 1 
ATOM   2631 C  CG2 . THR B 1 207 ? -8.817  -29.994 143.534 1.00 27.38 ? 207 THR B CG2 1 
ATOM   2632 N  N   . ALA B 1 208 ? -8.286  -27.747 140.895 1.00 25.81 ? 208 ALA B N   1 
ATOM   2633 C  CA  . ALA B 1 208 ? -7.034  -27.541 140.126 1.00 24.56 ? 208 ALA B CA  1 
ATOM   2634 C  C   . ALA B 1 208 ? -6.664  -26.062 140.174 1.00 23.14 ? 208 ALA B C   1 
ATOM   2635 O  O   . ALA B 1 208 ? -5.595  -25.662 140.604 1.00 22.72 ? 208 ALA B O   1 
ATOM   2636 C  CB  . ALA B 1 208 ? -7.188  -28.059 138.718 1.00 24.06 ? 208 ALA B CB  1 
ATOM   2637 N  N   . VAL B 1 209 ? -7.606  -25.292 139.716 1.00 22.44 ? 209 VAL B N   1 
ATOM   2638 C  CA  . VAL B 1 209 ? -7.356  -23.800 139.668 1.00 22.30 ? 209 VAL B CA  1 
ATOM   2639 C  C   . VAL B 1 209 ? -6.891  -23.343 141.034 1.00 22.58 ? 209 VAL B C   1 
ATOM   2640 O  O   . VAL B 1 209 ? -5.753  -22.764 141.117 1.00 23.08 ? 209 VAL B O   1 
ATOM   2641 C  CB  . VAL B 1 209 ? -8.613  -23.265 139.009 1.00 21.62 ? 209 VAL B CB  1 
ATOM   2642 C  CG1 . VAL B 1 209 ? -9.172  -22.053 139.637 1.00 21.31 ? 209 VAL B CG1 1 
ATOM   2643 C  CG2 . VAL B 1 209 ? -8.285  -23.038 137.519 1.00 21.91 ? 209 VAL B CG2 1 
ATOM   2644 N  N   . GLY B 1 210 ? -7.669  -23.614 142.065 1.00 21.70 ? 210 GLY B N   1 
ATOM   2645 C  CA  . GLY B 1 210 ? -7.479  -23.343 143.443 1.00 21.11 ? 210 GLY B CA  1 
ATOM   2646 C  C   . GLY B 1 210 ? -6.067  -23.383 143.997 1.00 21.09 ? 210 GLY B C   1 
ATOM   2647 O  O   . GLY B 1 210 ? -5.705  -22.820 145.053 1.00 21.02 ? 210 GLY B O   1 
ATOM   2648 N  N   . VAL B 1 211 ? -5.198  -24.076 143.303 1.00 20.78 ? 211 VAL B N   1 
ATOM   2649 C  CA  . VAL B 1 211 ? -3.795  -24.271 143.484 1.00 19.51 ? 211 VAL B CA  1 
ATOM   2650 C  C   . VAL B 1 211 ? -3.143  -23.040 142.829 1.00 20.44 ? 211 VAL B C   1 
ATOM   2651 O  O   . VAL B 1 211 ? -2.532  -22.276 143.618 1.00 21.97 ? 211 VAL B O   1 
ATOM   2652 C  CB  . VAL B 1 211 ? -3.351  -25.590 142.879 1.00 18.47 ? 211 VAL B CB  1 
ATOM   2653 C  CG1 . VAL B 1 211 ? -1.855  -25.748 143.069 1.00 18.18 ? 211 VAL B CG1 1 
ATOM   2654 C  CG2 . VAL B 1 211 ? -4.145  -26.747 143.412 1.00 17.37 ? 211 VAL B CG2 1 
ATOM   2655 N  N   . ASN B 1 212 ? -3.275  -22.855 141.531 1.00 20.27 ? 212 ASN B N   1 
ATOM   2656 C  CA  . ASN B 1 212 ? -2.648  -21.612 140.924 1.00 20.04 ? 212 ASN B CA  1 
ATOM   2657 C  C   . ASN B 1 212 ? -3.332  -21.415 139.581 1.00 18.79 ? 212 ASN B C   1 
ATOM   2658 O  O   . ASN B 1 212 ? -2.938  -22.152 138.647 1.00 18.29 ? 212 ASN B O   1 
ATOM   2659 C  CB  . ASN B 1 212 ? -1.123  -21.657 140.847 1.00 20.95 ? 212 ASN B CB  1 
ATOM   2660 C  CG  . ASN B 1 212 ? -0.575  -20.414 140.149 1.00 22.37 ? 212 ASN B CG  1 
ATOM   2661 O  OD1 . ASN B 1 212 ? -0.103  -19.384 140.720 1.00 23.01 ? 212 ASN B OD1 1 
ATOM   2662 N  ND2 . ASN B 1 212 ? -0.610  -20.388 138.806 1.00 22.88 ? 212 ASN B ND2 1 
ATOM   2663 N  N   . ALA B 1 213 ? -4.315  -20.521 139.532 1.00 17.15 ? 213 ALA B N   1 
ATOM   2664 C  CA  . ALA B 1 213 ? -5.050  -20.351 138.264 1.00 16.13 ? 213 ALA B CA  1 
ATOM   2665 C  C   . ALA B 1 213 ? -4.228  -20.693 136.999 1.00 16.00 ? 213 ALA B C   1 
ATOM   2666 O  O   . ALA B 1 213 ? -4.802  -21.441 136.151 1.00 16.00 ? 213 ALA B O   1 
ATOM   2667 C  CB  . ALA B 1 213 ? -5.601  -18.967 138.037 1.00 15.43 ? 213 ALA B CB  1 
ATOM   2668 N  N   . ASN B 1 214 ? -3.011  -20.174 136.912 1.00 15.28 ? 214 ASN B N   1 
ATOM   2669 C  CA  . ASN B 1 214 ? -2.217  -20.474 135.686 1.00 14.51 ? 214 ASN B CA  1 
ATOM   2670 C  C   . ASN B 1 214 ? -2.514  -21.884 135.251 1.00 14.20 ? 214 ASN B C   1 
ATOM   2671 O  O   . ASN B 1 214 ? -2.647  -22.030 134.030 1.00 14.36 ? 214 ASN B O   1 
ATOM   2672 C  CB  . ASN B 1 214 ? -0.772  -20.084 135.926 1.00 15.33 ? 214 ASN B CB  1 
ATOM   2673 C  CG  . ASN B 1 214 ? -0.730  -18.588 135.677 1.00 16.69 ? 214 ASN B CG  1 
ATOM   2674 O  OD1 . ASN B 1 214 ? -1.721  -17.933 135.382 1.00 17.43 ? 214 ASN B OD1 1 
ATOM   2675 N  ND2 . ASN B 1 214 ? 0.369   -17.888 135.737 1.00 18.36 ? 214 ASN B ND2 1 
ATOM   2676 N  N   . ILE B 1 215 ? -2.710  -22.878 136.051 1.00 14.16 ? 215 ILE B N   1 
ATOM   2677 C  CA  . ILE B 1 215 ? -3.050  -24.213 135.578 1.00 13.96 ? 215 ILE B CA  1 
ATOM   2678 C  C   . ILE B 1 215 ? -4.295  -24.273 134.725 1.00 14.49 ? 215 ILE B C   1 
ATOM   2679 O  O   . ILE B 1 215 ? -4.387  -25.166 133.840 1.00 15.30 ? 215 ILE B O   1 
ATOM   2680 C  CB  . ILE B 1 215 ? -3.224  -25.130 136.836 1.00 13.66 ? 215 ILE B CB  1 
ATOM   2681 C  CG1 . ILE B 1 215 ? -1.845  -25.190 137.573 1.00 13.77 ? 215 ILE B CG1 1 
ATOM   2682 C  CG2 . ILE B 1 215 ? -3.774  -26.501 136.473 1.00 12.93 ? 215 ILE B CG2 1 
ATOM   2683 C  CD1 . ILE B 1 215 ? -2.045  -25.750 139.035 1.00 13.43 ? 215 ILE B CD1 1 
ATOM   2684 N  N   . GLY B 1 216 ? -5.294  -23.444 134.929 1.00 14.63 ? 216 GLY B N   1 
ATOM   2685 C  CA  . GLY B 1 216 ? -6.516  -23.513 134.091 1.00 15.07 ? 216 GLY B CA  1 
ATOM   2686 C  C   . GLY B 1 216 ? -6.075  -23.277 132.633 1.00 16.11 ? 216 GLY B C   1 
ATOM   2687 O  O   . GLY B 1 216 ? -6.609  -23.894 131.654 1.00 16.47 ? 216 GLY B O   1 
ATOM   2688 N  N   . ASN B 1 217 ? -5.084  -22.389 132.479 1.00 15.90 ? 217 ASN B N   1 
ATOM   2689 C  CA  . ASN B 1 217 ? -4.575  -22.136 131.102 1.00 15.64 ? 217 ASN B CA  1 
ATOM   2690 C  C   . ASN B 1 217 ? -4.407  -23.430 130.337 1.00 16.01 ? 217 ASN B C   1 
ATOM   2691 O  O   . ASN B 1 217 ? -4.800  -23.292 129.115 1.00 17.93 ? 217 ASN B O   1 
ATOM   2692 C  CB  . ASN B 1 217 ? -3.354  -21.266 131.167 1.00 16.15 ? 217 ASN B CB  1 
ATOM   2693 C  CG  . ASN B 1 217 ? -3.868  -19.840 131.456 1.00 17.18 ? 217 ASN B CG  1 
ATOM   2694 O  OD1 . ASN B 1 217 ? -3.097  -19.037 131.995 1.00 17.48 ? 217 ASN B OD1 1 
ATOM   2695 N  ND2 . ASN B 1 217 ? -5.136  -19.605 131.098 1.00 17.79 ? 217 ASN B ND2 1 
ATOM   2696 N  N   . ILE B 1 218 ? -3.985  -24.569 130.790 1.00 15.97 ? 218 ILE B N   1 
ATOM   2697 C  CA  . ILE B 1 218 ? -3.929  -25.731 129.944 1.00 16.33 ? 218 ILE B CA  1 
ATOM   2698 C  C   . ILE B 1 218 ? -5.258  -26.497 130.096 1.00 17.11 ? 218 ILE B C   1 
ATOM   2699 O  O   . ILE B 1 218 ? -5.386  -27.487 129.284 1.00 18.43 ? 218 ILE B O   1 
ATOM   2700 C  CB  . ILE B 1 218 ? -2.863  -26.873 130.131 1.00 16.62 ? 218 ILE B CB  1 
ATOM   2701 C  CG1 . ILE B 1 218 ? -2.942  -27.486 131.535 1.00 15.25 ? 218 ILE B CG1 1 
ATOM   2702 C  CG2 . ILE B 1 218 ? -1.412  -26.398 129.731 1.00 17.02 ? 218 ILE B CG2 1 
ATOM   2703 C  CD1 . ILE B 1 218 ? -2.028  -26.849 132.590 1.00 14.36 ? 218 ILE B CD1 1 
ATOM   2704 N  N   . LEU B 1 219 ? -6.090  -26.112 131.015 1.00 16.99 ? 219 LEU B N   1 
ATOM   2705 C  CA  . LEU B 1 219 ? -7.336  -26.965 131.032 1.00 17.53 ? 219 LEU B CA  1 
ATOM   2706 C  C   . LEU B 1 219 ? -8.392  -26.485 130.084 1.00 16.83 ? 219 LEU B C   1 
ATOM   2707 O  O   . LEU B 1 219 ? -9.302  -27.307 129.865 1.00 16.42 ? 219 LEU B O   1 
ATOM   2708 C  CB  . LEU B 1 219 ? -7.785  -27.067 132.491 1.00 19.01 ? 219 LEU B CB  1 
ATOM   2709 C  CG  . LEU B 1 219 ? -7.086  -28.147 133.329 1.00 19.65 ? 219 LEU B CG  1 
ATOM   2710 C  CD1 . LEU B 1 219 ? -5.607  -28.151 133.061 1.00 19.60 ? 219 LEU B CD1 1 
ATOM   2711 C  CD2 . LEU B 1 219 ? -7.350  -27.834 134.797 1.00 19.41 ? 219 LEU B CD2 1 
ATOM   2712 N  N   . VAL B 1 220 ? -8.336  -25.310 129.548 1.00 17.08 ? 220 VAL B N   1 
ATOM   2713 C  CA  . VAL B 1 220 ? -9.307  -24.670 128.700 1.00 17.01 ? 220 VAL B CA  1 
ATOM   2714 C  C   . VAL B 1 220 ? -8.934  -23.548 127.758 1.00 18.59 ? 220 VAL B C   1 
ATOM   2715 O  O   . VAL B 1 220 ? -8.070  -22.629 127.999 1.00 19.47 ? 220 VAL B O   1 
ATOM   2716 C  CB  . VAL B 1 220 ? -10.294 -24.040 129.791 1.00 15.45 ? 220 VAL B CB  1 
ATOM   2717 C  CG1 . VAL B 1 220 ? -10.947 -22.836 129.212 1.00 14.87 ? 220 VAL B CG1 1 
ATOM   2718 C  CG2 . VAL B 1 220 ? -11.166 -25.116 130.289 1.00 15.07 ? 220 VAL B CG2 1 
ATOM   2719 N  N   . PRO B 1 221 ? -9.630  -23.525 126.622 1.00 18.83 ? 221 PRO B N   1 
ATOM   2720 C  CA  . PRO B 1 221 ? -9.377  -22.526 125.591 1.00 18.84 ? 221 PRO B CA  1 
ATOM   2721 C  C   . PRO B 1 221 ? -9.664  -21.094 125.944 1.00 19.45 ? 221 PRO B C   1 
ATOM   2722 O  O   . PRO B 1 221 ? -8.827  -20.180 125.655 1.00 20.35 ? 221 PRO B O   1 
ATOM   2723 C  CB  . PRO B 1 221 ? -10.263 -23.007 124.448 1.00 18.83 ? 221 PRO B CB  1 
ATOM   2724 C  CG  . PRO B 1 221 ? -11.366 -23.776 125.134 1.00 18.95 ? 221 PRO B CG  1 
ATOM   2725 C  CD  . PRO B 1 221 ? -10.642 -24.542 126.252 1.00 18.56 ? 221 PRO B CD  1 
ATOM   2726 N  N   . ALA B 1 222 ? -10.836 -20.858 126.515 1.00 19.45 ? 222 ALA B N   1 
ATOM   2727 C  CA  . ALA B 1 222 ? -11.248 -19.462 126.839 1.00 18.87 ? 222 ALA B CA  1 
ATOM   2728 C  C   . ALA B 1 222 ? -12.418 -19.409 127.768 1.00 18.60 ? 222 ALA B C   1 
ATOM   2729 O  O   . ALA B 1 222 ? -13.072 -20.480 127.916 1.00 18.56 ? 222 ALA B O   1 
ATOM   2730 C  CB  . ALA B 1 222 ? -11.521 -18.859 125.458 1.00 18.61 ? 222 ALA B CB  1 
ATOM   2731 N  N   . ARG B 1 223 ? -12.710 -18.265 128.363 1.00 18.57 ? 223 ARG B N   1 
ATOM   2732 C  CA  . ARG B 1 223 ? -13.909 -18.160 129.273 1.00 18.20 ? 223 ARG B CA  1 
ATOM   2733 C  C   . ARG B 1 223 ? -14.778 -17.027 128.700 1.00 17.20 ? 223 ARG B C   1 
ATOM   2734 O  O   . ARG B 1 223 ? -14.207 -16.003 128.298 1.00 17.39 ? 223 ARG B O   1 
ATOM   2735 C  CB  . ARG B 1 223 ? -13.572 -17.891 130.667 1.00 19.49 ? 223 ARG B CB  1 
ATOM   2736 C  CG  . ARG B 1 223 ? -14.078 -16.551 131.210 1.00 20.51 ? 223 ARG B CG  1 
ATOM   2737 C  CD  . ARG B 1 223 ? -13.618 -16.513 132.653 1.00 21.50 ? 223 ARG B CD  1 
ATOM   2738 N  NE  . ARG B 1 223 ? -12.322 -15.822 132.650 1.00 22.87 ? 223 ARG B NE  1 
ATOM   2739 C  CZ  . ARG B 1 223 ? -11.504 -15.874 133.735 1.00 23.04 ? 223 ARG B CZ  1 
ATOM   2740 N  NH1 . ARG B 1 223 ? -11.849 -16.747 134.699 1.00 22.89 ? 223 ARG B NH1 1 
ATOM   2741 N  NH2 . ARG B 1 223 ? -10.461 -15.039 133.712 1.00 22.39 ? 223 ARG B NH2 1 
ATOM   2742 N  N   . LEU B 1 224 ? -16.055 -17.212 128.653 1.00 16.04 ? 224 LEU B N   1 
ATOM   2743 C  CA  . LEU B 1 224 ? -17.010 -16.278 128.104 1.00 15.58 ? 224 LEU B CA  1 
ATOM   2744 C  C   . LEU B 1 224 ? -17.455 -15.354 129.201 1.00 16.03 ? 224 LEU B C   1 
ATOM   2745 O  O   . LEU B 1 224 ? -17.672 -16.043 130.218 1.00 16.89 ? 224 LEU B O   1 
ATOM   2746 C  CB  . LEU B 1 224 ? -18.200 -17.057 127.595 1.00 15.34 ? 224 LEU B CB  1 
ATOM   2747 C  CG  . LEU B 1 224 ? -19.505 -16.361 127.306 1.00 15.38 ? 224 LEU B CG  1 
ATOM   2748 C  CD1 . LEU B 1 224 ? -19.368 -15.351 126.162 1.00 15.59 ? 224 LEU B CD1 1 
ATOM   2749 C  CD2 . LEU B 1 224 ? -20.546 -17.370 126.854 1.00 14.74 ? 224 LEU B CD2 1 
ATOM   2750 N  N   . VAL B 1 225 ? -17.629 -14.106 129.028 1.00 16.03 ? 225 VAL B N   1 
ATOM   2751 C  CA  . VAL B 1 225 ? -18.080 -13.218 130.146 1.00 15.89 ? 225 VAL B CA  1 
ATOM   2752 C  C   . VAL B 1 225 ? -19.408 -12.611 129.791 1.00 16.92 ? 225 VAL B C   1 
ATOM   2753 O  O   . VAL B 1 225 ? -19.537 -11.907 128.759 1.00 17.47 ? 225 VAL B O   1 
ATOM   2754 C  CB  . VAL B 1 225 ? -16.895 -12.269 130.367 1.00 14.84 ? 225 VAL B CB  1 
ATOM   2755 C  CG1 . VAL B 1 225 ? -17.116 -11.222 131.398 1.00 14.48 ? 225 VAL B CG1 1 
ATOM   2756 C  CG2 . VAL B 1 225 ? -15.673 -13.125 130.666 1.00 14.45 ? 225 VAL B CG2 1 
ATOM   2757 N  N   . THR B 1 226 ? -20.432 -12.860 130.594 1.00 17.45 ? 226 THR B N   1 
ATOM   2758 C  CA  . THR B 1 226 ? -21.757 -12.279 130.181 1.00 17.45 ? 226 THR B CA  1 
ATOM   2759 C  C   . THR B 1 226 ? -22.194 -11.303 131.221 1.00 18.29 ? 226 THR B C   1 
ATOM   2760 O  O   . THR B 1 226 ? -22.265 -11.586 132.432 1.00 19.30 ? 226 THR B O   1 
ATOM   2761 C  CB  . THR B 1 226 ? -22.714 -13.474 129.772 1.00 17.08 ? 226 THR B CB  1 
ATOM   2762 O  OG1 . THR B 1 226 ? -24.069 -12.932 129.965 1.00 16.82 ? 226 THR B OG1 1 
ATOM   2763 C  CG2 . THR B 1 226 ? -22.637 -14.809 130.487 1.00 16.13 ? 226 THR B CG2 1 
ATOM   2764 N  N   . ALA B 1 227 ? -22.509 -10.102 130.789 1.00 18.76 ? 227 ALA B N   1 
ATOM   2765 C  CA  . ALA B 1 227 ? -22.949 -8.978  131.626 1.00 18.91 ? 227 ALA B CA  1 
ATOM   2766 C  C   . ALA B 1 227 ? -24.401 -8.674  131.435 1.00 19.56 ? 227 ALA B C   1 
ATOM   2767 O  O   . ALA B 1 227 ? -24.849 -8.504  130.285 1.00 20.48 ? 227 ALA B O   1 
ATOM   2768 C  CB  . ALA B 1 227 ? -22.065 -7.795  131.247 1.00 18.70 ? 227 ALA B CB  1 
ATOM   2769 N  N   . MET B 1 228 ? -25.182 -8.547  132.475 1.00 20.70 ? 228 MET B N   1 
ATOM   2770 C  CA  . MET B 1 228 ? -26.653 -8.263  132.306 1.00 20.91 ? 228 MET B CA  1 
ATOM   2771 C  C   . MET B 1 228 ? -27.015 -7.052  133.081 1.00 22.78 ? 228 MET B C   1 
ATOM   2772 O  O   . MET B 1 228 ? -27.354 -7.184  134.276 1.00 23.90 ? 228 MET B O   1 
ATOM   2773 C  CB  . MET B 1 228 ? -27.347 -9.550  132.714 1.00 19.25 ? 228 MET B CB  1 
ATOM   2774 C  CG  . MET B 1 228 ? -27.073 -10.642 131.679 1.00 17.26 ? 228 MET B CG  1 
ATOM   2775 S  SD  . MET B 1 228 ? -28.396 -10.358 130.438 1.00 15.44 ? 228 MET B SD  1 
ATOM   2776 C  CE  . MET B 1 228 ? -29.585 -11.619 130.795 1.00 15.42 ? 228 MET B CE  1 
ATOM   2777 N  N   . GLU B 1 229 ? -26.926 -5.887  132.553 1.00 25.47 ? 229 GLU B N   1 
ATOM   2778 C  CA  . GLU B 1 229 ? -27.216 -4.588  133.040 1.00 28.30 ? 229 GLU B CA  1 
ATOM   2779 C  C   . GLU B 1 229 ? -28.546 -4.166  132.457 1.00 29.38 ? 229 GLU B C   1 
ATOM   2780 O  O   . GLU B 1 229 ? -28.771 -4.765  131.337 1.00 29.47 ? 229 GLU B O   1 
ATOM   2781 C  CB  . GLU B 1 229 ? -26.256 -3.487  132.490 1.00 29.77 ? 229 GLU B CB  1 
ATOM   2782 C  CG  . GLU B 1 229 ? -26.832 -2.970  131.157 1.00 32.61 ? 229 GLU B CG  1 
ATOM   2783 C  CD  . GLU B 1 229 ? -26.227 -1.812  130.515 1.00 34.70 ? 229 GLU B CD  1 
ATOM   2784 O  OE1 . GLU B 1 229 ? -26.347 -0.653  130.867 1.00 36.15 ? 229 GLU B OE1 1 
ATOM   2785 O  OE2 . GLU B 1 229 ? -25.559 -2.148  129.508 1.00 35.97 ? 229 GLU B OE2 1 
ATOM   2786 N  N   . GLY B 1 230 ? -29.329 -3.246  132.954 1.00 30.62 ? 230 GLY B N   1 
ATOM   2787 C  CA  . GLY B 1 230 ? -30.539 -3.012  132.083 1.00 33.28 ? 230 GLY B CA  1 
ATOM   2788 C  C   . GLY B 1 230 ? -31.660 -2.356  132.801 1.00 34.75 ? 230 GLY B C   1 
ATOM   2789 O  O   . GLY B 1 230 ? -31.859 -1.156  132.604 1.00 35.05 ? 230 GLY B O   1 
ATOM   2790 N  N   . GLY B 1 231 ? -32.391 -3.106  133.569 1.00 36.35 ? 231 GLY B N   1 
ATOM   2791 C  CA  . GLY B 1 231 ? -33.433 -2.997  134.377 1.00 38.56 ? 231 GLY B CA  1 
ATOM   2792 C  C   . GLY B 1 231 ? -34.422 -2.096  134.934 1.00 40.32 ? 231 GLY B C   1 
ATOM   2793 O  O   . GLY B 1 231 ? -34.369 -0.849  135.013 1.00 40.91 ? 231 GLY B O   1 
ATOM   2794 N  N   . SER B 1 232 ? -35.486 -2.748  135.449 1.00 41.70 ? 232 SER B N   1 
ATOM   2795 C  CA  . SER B 1 232 ? -36.608 -2.098  136.102 1.00 42.48 ? 232 SER B CA  1 
ATOM   2796 C  C   . SER B 1 232 ? -36.786 -2.654  137.503 1.00 42.70 ? 232 SER B C   1 
ATOM   2797 O  O   . SER B 1 232 ? -36.992 -1.811  138.382 1.00 43.86 ? 232 SER B O   1 
ATOM   2798 C  CB  . SER B 1 232 ? -37.877 -2.289  135.303 1.00 43.42 ? 232 SER B CB  1 
ATOM   2799 O  OG  . SER B 1 232 ? -37.674 -1.634  134.050 1.00 44.74 ? 232 SER B OG  1 
ATOM   2800 N  N   . SER B 1 233 ? -36.729 -3.950  137.679 1.00 42.56 ? 233 SER B N   1 
ATOM   2801 C  CA  . SER B 1 233 ? -36.958 -4.527  139.018 1.00 42.63 ? 233 SER B CA  1 
ATOM   2802 C  C   . SER B 1 233 ? -35.640 -4.916  139.658 1.00 42.21 ? 233 SER B C   1 
ATOM   2803 O  O   . SER B 1 233 ? -34.689 -5.205  138.950 1.00 42.37 ? 233 SER B O   1 
ATOM   2804 C  CB  . SER B 1 233 ? -37.890 -5.726  138.982 1.00 43.38 ? 233 SER B CB  1 
ATOM   2805 O  OG  . SER B 1 233 ? -39.269 -5.318  138.871 1.00 44.69 ? 233 SER B OG  1 
ATOM   2806 N  N   . LYS B 1 234 ? -35.692 -4.887  140.967 1.00 41.95 ? 234 LYS B N   1 
ATOM   2807 C  CA  . LYS B 1 234 ? -34.524 -5.268  141.789 1.00 41.59 ? 234 LYS B CA  1 
ATOM   2808 C  C   . LYS B 1 234 ? -34.619 -6.805  141.828 1.00 40.07 ? 234 LYS B C   1 
ATOM   2809 O  O   . LYS B 1 234 ? -33.741 -7.520  142.268 1.00 40.43 ? 234 LYS B O   1 
ATOM   2810 C  CB  . LYS B 1 234 ? -34.519 -4.710  143.152 1.00 43.44 ? 234 LYS B CB  1 
ATOM   2811 C  CG  . LYS B 1 234 ? -33.490 -3.793  143.710 1.00 45.20 ? 234 LYS B CG  1 
ATOM   2812 C  CD  . LYS B 1 234 ? -33.855 -2.295  143.560 1.00 46.73 ? 234 LYS B CD  1 
ATOM   2813 C  CE  . LYS B 1 234 ? -32.889 -1.433  144.402 1.00 47.43 ? 234 LYS B CE  1 
ATOM   2814 N  NZ  . LYS B 1 234 ? -31.639 -1.101  143.640 1.00 47.98 ? 234 LYS B NZ  1 
ATOM   2815 N  N   . THR B 1 235 ? -35.754 -7.216  141.373 1.00 38.39 ? 235 THR B N   1 
ATOM   2816 C  CA  . THR B 1 235 ? -36.266 -8.548  141.196 1.00 37.12 ? 235 THR B CA  1 
ATOM   2817 C  C   . THR B 1 235 ? -35.817 -9.063  139.869 1.00 35.63 ? 235 THR B C   1 
ATOM   2818 O  O   . THR B 1 235 ? -36.220 -8.380  138.864 1.00 35.87 ? 235 THR B O   1 
ATOM   2819 C  CB  . THR B 1 235 ? -37.848 -8.474  141.279 1.00 37.98 ? 235 THR B CB  1 
ATOM   2820 O  OG1 . THR B 1 235 ? -38.150 -9.201  142.503 1.00 38.97 ? 235 THR B OG1 1 
ATOM   2821 C  CG2 . THR B 1 235 ? -38.628 -9.001  140.058 1.00 37.99 ? 235 THR B CG2 1 
ATOM   2822 N  N   . ALA B 1 236 ? -35.058 -10.104 139.752 1.00 34.12 ? 236 ALA B N   1 
ATOM   2823 C  CA  . ALA B 1 236 ? -34.661 -10.540 138.398 1.00 33.14 ? 236 ALA B CA  1 
ATOM   2824 C  C   . ALA B 1 236 ? -35.929 -10.860 137.588 1.00 32.11 ? 236 ALA B C   1 
ATOM   2825 O  O   . ALA B 1 236 ? -36.821 -11.552 138.079 1.00 32.01 ? 236 ALA B O   1 
ATOM   2826 C  CB  . ALA B 1 236 ? -33.745 -11.747 138.403 1.00 33.28 ? 236 ALA B CB  1 
ATOM   2827 N  N   . VAL B 1 237 ? -35.966 -10.375 136.389 1.00 31.20 ? 237 VAL B N   1 
ATOM   2828 C  CA  . VAL B 1 237 ? -36.946 -10.577 135.372 1.00 30.80 ? 237 VAL B CA  1 
ATOM   2829 C  C   . VAL B 1 237 ? -36.306 -11.517 134.297 1.00 30.76 ? 237 VAL B C   1 
ATOM   2830 O  O   . VAL B 1 237 ? -35.279 -11.035 133.730 1.00 31.35 ? 237 VAL B O   1 
ATOM   2831 C  CB  . VAL B 1 237 ? -37.378 -9.308  134.639 1.00 30.56 ? 237 VAL B CB  1 
ATOM   2832 C  CG1 . VAL B 1 237 ? -37.955 -9.759  133.262 1.00 30.45 ? 237 VAL B CG1 1 
ATOM   2833 C  CG2 . VAL B 1 237 ? -38.316 -8.402  135.353 1.00 30.26 ? 237 VAL B CG2 1 
ATOM   2834 N  N   . ASN B 1 238 ? -36.779 -12.680 134.010 1.00 30.20 ? 238 ASN B N   1 
ATOM   2835 C  CA  . ASN B 1 238 ? -36.148 -13.498 132.982 1.00 30.59 ? 238 ASN B CA  1 
ATOM   2836 C  C   . ASN B 1 238 ? -36.162 -12.872 131.602 1.00 29.34 ? 238 ASN B C   1 
ATOM   2837 O  O   . ASN B 1 238 ? -37.361 -12.628 131.268 1.00 30.12 ? 238 ASN B O   1 
ATOM   2838 C  CB  . ASN B 1 238 ? -36.932 -14.814 132.895 1.00 32.34 ? 238 ASN B CB  1 
ATOM   2839 C  CG  . ASN B 1 238 ? -36.544 -15.605 134.153 1.00 34.03 ? 238 ASN B CG  1 
ATOM   2840 O  OD1 . ASN B 1 238 ? -37.422 -16.359 134.610 1.00 35.38 ? 238 ASN B OD1 1 
ATOM   2841 N  ND2 . ASN B 1 238 ? -35.314 -15.371 134.578 1.00 33.85 ? 238 ASN B ND2 1 
ATOM   2842 N  N   . THR B 1 239 ? -35.117 -12.681 130.839 1.00 26.75 ? 239 THR B N   1 
ATOM   2843 C  CA  . THR B 1 239 ? -35.332 -12.072 129.507 1.00 25.18 ? 239 THR B CA  1 
ATOM   2844 C  C   . THR B 1 239 ? -35.138 -13.024 128.352 1.00 23.98 ? 239 THR B C   1 
ATOM   2845 O  O   . THR B 1 239 ? -35.885 -13.078 127.335 1.00 23.53 ? 239 THR B O   1 
ATOM   2846 C  CB  . THR B 1 239 ? -34.362 -10.856 129.363 1.00 25.40 ? 239 THR B CB  1 
ATOM   2847 O  OG1 . THR B 1 239 ? -33.093 -11.579 129.321 1.00 26.08 ? 239 THR B OG1 1 
ATOM   2848 C  CG2 . THR B 1 239 ? -34.482 -9.870  130.499 1.00 25.81 ? 239 THR B CG2 1 
ATOM   2849 N  N   . GLY B 1 240 ? -34.068 -13.816 128.486 1.00 22.42 ? 240 GLY B N   1 
ATOM   2850 C  CA  . GLY B 1 240 ? -33.745 -14.766 127.452 1.00 20.36 ? 240 GLY B CA  1 
ATOM   2851 C  C   . GLY B 1 240 ? -33.031 -16.032 127.848 1.00 18.67 ? 240 GLY B C   1 
ATOM   2852 O  O   . GLY B 1 240 ? -32.959 -16.469 128.993 1.00 17.61 ? 240 GLY B O   1 
ATOM   2853 N  N   . ARG B 1 241 ? -32.515 -16.575 126.723 1.00 17.34 ? 241 ARG B N   1 
ATOM   2854 C  CA  . ARG B 1 241 ? -31.749 -17.838 126.885 1.00 16.72 ? 241 ARG B CA  1 
ATOM   2855 C  C   . ARG B 1 241 ? -30.600 -17.824 125.899 1.00 16.43 ? 241 ARG B C   1 
ATOM   2856 O  O   . ARG B 1 241 ? -30.714 -17.284 124.756 1.00 17.22 ? 241 ARG B O   1 
ATOM   2857 C  CB  . ARG B 1 241 ? -32.752 -18.957 126.794 1.00 16.60 ? 241 ARG B CB  1 
ATOM   2858 C  CG  . ARG B 1 241 ? -33.142 -19.475 128.200 1.00 16.40 ? 241 ARG B CG  1 
ATOM   2859 C  CD  . ARG B 1 241 ? -33.833 -20.823 127.954 1.00 16.75 ? 241 ARG B CD  1 
ATOM   2860 N  NE  . ARG B 1 241 ? -35.171 -20.415 127.435 1.00 17.26 ? 241 ARG B NE  1 
ATOM   2861 C  CZ  . ARG B 1 241 ? -36.180 -20.478 128.381 1.00 16.26 ? 241 ARG B CZ  1 
ATOM   2862 N  NH1 . ARG B 1 241 ? -36.208 -21.326 129.334 1.00 14.55 ? 241 ARG B NH1 1 
ATOM   2863 N  NH2 . ARG B 1 241 ? -37.056 -19.468 128.237 1.00 17.07 ? 241 ARG B NH2 1 
ATOM   2864 N  N   . LEU B 1 242 ? -29.487 -18.367 126.356 1.00 14.73 ? 242 LEU B N   1 
ATOM   2865 C  CA  . LEU B 1 242 ? -28.266 -18.472 125.599 1.00 13.24 ? 242 LEU B CA  1 
ATOM   2866 C  C   . LEU B 1 242 ? -28.076 -19.857 125.043 1.00 12.95 ? 242 LEU B C   1 
ATOM   2867 O  O   . LEU B 1 242 ? -27.840 -20.741 125.866 1.00 12.75 ? 242 LEU B O   1 
ATOM   2868 C  CB  . LEU B 1 242 ? -27.111 -18.064 126.550 1.00 12.54 ? 242 LEU B CB  1 
ATOM   2869 C  CG  . LEU B 1 242 ? -26.029 -17.267 125.835 1.00 12.46 ? 242 LEU B CG  1 
ATOM   2870 C  CD1 . LEU B 1 242 ? -24.760 -17.070 126.623 1.00 12.46 ? 242 LEU B CD1 1 
ATOM   2871 C  CD2 . LEU B 1 242 ? -25.667 -18.078 124.620 1.00 13.21 ? 242 LEU B CD2 1 
ATOM   2872 N  N   . TYR B 1 243 ? -28.093 -20.087 123.759 1.00 14.05 ? 243 TYR B N   1 
ATOM   2873 C  CA  . TYR B 1 243 ? -27.867 -21.467 123.245 1.00 15.16 ? 243 TYR B CA  1 
ATOM   2874 C  C   . TYR B 1 243 ? -26.490 -21.663 122.642 1.00 15.38 ? 243 TYR B C   1 
ATOM   2875 O  O   . TYR B 1 243 ? -26.012 -20.649 122.131 1.00 15.98 ? 243 TYR B O   1 
ATOM   2876 C  CB  . TYR B 1 243 ? -28.893 -21.775 122.206 1.00 15.52 ? 243 TYR B CB  1 
ATOM   2877 C  CG  . TYR B 1 243 ? -30.320 -21.663 122.635 1.00 16.06 ? 243 TYR B CG  1 
ATOM   2878 C  CD1 . TYR B 1 243 ? -30.991 -20.458 122.815 1.00 16.68 ? 243 TYR B CD1 1 
ATOM   2879 C  CD2 . TYR B 1 243 ? -31.013 -22.853 122.834 1.00 16.49 ? 243 TYR B CD2 1 
ATOM   2880 C  CE1 . TYR B 1 243 ? -32.330 -20.435 123.198 1.00 17.63 ? 243 TYR B CE1 1 
ATOM   2881 C  CE2 . TYR B 1 243 ? -32.350 -22.876 123.184 1.00 17.57 ? 243 TYR B CE2 1 
ATOM   2882 C  CZ  . TYR B 1 243 ? -32.991 -21.652 123.374 1.00 18.53 ? 243 TYR B CZ  1 
ATOM   2883 O  OH  . TYR B 1 243 ? -34.312 -21.749 123.762 1.00 20.66 ? 243 TYR B OH  1 
ATOM   2884 N  N   . ALA B 1 244 ? -25.968 -22.860 122.683 1.00 15.80 ? 244 ALA B N   1 
ATOM   2885 C  CA  . ALA B 1 244 ? -24.643 -23.201 122.146 1.00 16.50 ? 244 ALA B CA  1 
ATOM   2886 C  C   . ALA B 1 244 ? -24.815 -24.055 120.877 1.00 17.20 ? 244 ALA B C   1 
ATOM   2887 O  O   . ALA B 1 244 ? -25.739 -24.874 120.831 1.00 18.26 ? 244 ALA B O   1 
ATOM   2888 C  CB  . ALA B 1 244 ? -23.749 -23.967 123.077 1.00 16.03 ? 244 ALA B CB  1 
ATOM   2889 N  N   . SER B 1 245 ? -23.934 -23.821 119.969 1.00 17.37 ? 245 SER B N   1 
ATOM   2890 C  CA  . SER B 1 245 ? -23.827 -24.448 118.648 1.00 17.63 ? 245 SER B CA  1 
ATOM   2891 C  C   . SER B 1 245 ? -22.413 -24.899 118.413 1.00 17.88 ? 245 SER B C   1 
ATOM   2892 O  O   . SER B 1 245 ? -21.492 -24.027 118.127 1.00 18.48 ? 245 SER B O   1 
ATOM   2893 C  CB  . SER B 1 245 ? -24.259 -23.365 117.673 1.00 17.98 ? 245 SER B CB  1 
ATOM   2894 O  OG  . SER B 1 245 ? -25.586 -23.055 118.003 1.00 18.86 ? 245 SER B OG  1 
ATOM   2895 N  N   . TYR B 1 246 ? -22.133 -26.187 118.556 1.00 17.31 ? 246 TYR B N   1 
ATOM   2896 C  CA  . TYR B 1 246 ? -20.740 -26.579 118.415 1.00 17.37 ? 246 TYR B CA  1 
ATOM   2897 C  C   . TYR B 1 246 ? -20.509 -27.704 117.458 1.00 17.11 ? 246 TYR B C   1 
ATOM   2898 O  O   . TYR B 1 246 ? -21.462 -28.440 117.154 1.00 16.89 ? 246 TYR B O   1 
ATOM   2899 C  CB  . TYR B 1 246 ? -20.160 -27.051 119.806 1.00 18.15 ? 246 TYR B CB  1 
ATOM   2900 C  CG  . TYR B 1 246 ? -21.183 -27.963 120.450 1.00 19.15 ? 246 TYR B CG  1 
ATOM   2901 C  CD1 . TYR B 1 246 ? -22.314 -27.351 121.011 1.00 19.56 ? 246 TYR B CD1 1 
ATOM   2902 C  CD2 . TYR B 1 246 ? -21.105 -29.338 120.521 1.00 19.74 ? 246 TYR B CD2 1 
ATOM   2903 C  CE1 . TYR B 1 246 ? -23.301 -28.104 121.603 1.00 20.20 ? 246 TYR B CE1 1 
ATOM   2904 C  CE2 . TYR B 1 246 ? -22.103 -30.118 121.125 1.00 20.09 ? 246 TYR B CE2 1 
ATOM   2905 C  CZ  . TYR B 1 246 ? -23.200 -29.492 121.676 1.00 20.32 ? 246 TYR B CZ  1 
ATOM   2906 O  OH  . TYR B 1 246 ? -24.242 -30.173 122.282 1.00 20.94 ? 246 TYR B OH  1 
ATOM   2907 N  N   . THR B 1 247 ? -19.216 -27.735 117.107 1.00 16.32 ? 247 THR B N   1 
ATOM   2908 C  CA  . THR B 1 247 ? -18.831 -28.865 116.262 1.00 17.06 ? 247 THR B CA  1 
ATOM   2909 C  C   . THR B 1 247 ? -17.548 -29.361 116.927 1.00 17.39 ? 247 THR B C   1 
ATOM   2910 O  O   . THR B 1 247 ? -16.497 -28.905 116.526 1.00 17.81 ? 247 THR B O   1 
ATOM   2911 C  CB  . THR B 1 247 ? -18.692 -28.583 114.768 1.00 17.62 ? 247 THR B CB  1 
ATOM   2912 O  OG1 . THR B 1 247 ? -19.980 -27.906 114.526 1.00 19.50 ? 247 THR B OG1 1 
ATOM   2913 C  CG2 . THR B 1 247 ? -18.515 -29.813 113.906 1.00 17.00 ? 247 THR B CG2 1 
ATOM   2914 N  N   . ILE B 1 248 ? -17.806 -30.222 117.878 1.00 17.18 ? 248 ILE B N   1 
ATOM   2915 C  CA  . ILE B 1 248 ? -16.738 -30.825 118.688 1.00 17.02 ? 248 ILE B CA  1 
ATOM   2916 C  C   . ILE B 1 248 ? -16.008 -31.922 117.977 1.00 16.61 ? 248 ILE B C   1 
ATOM   2917 O  O   . ILE B 1 248 ? -16.538 -32.641 117.087 1.00 15.39 ? 248 ILE B O   1 
ATOM   2918 C  CB  . ILE B 1 248 ? -17.530 -31.260 119.974 1.00 17.62 ? 248 ILE B CB  1 
ATOM   2919 C  CG1 . ILE B 1 248 ? -16.683 -31.253 121.242 1.00 17.72 ? 248 ILE B CG1 1 
ATOM   2920 C  CG2 . ILE B 1 248 ? -18.243 -32.640 119.668 1.00 17.70 ? 248 ILE B CG2 1 
ATOM   2921 C  CD1 . ILE B 1 248 ? -15.361 -32.013 121.213 1.00 18.10 ? 248 ILE B CD1 1 
ATOM   2922 N  N   . ARG B 1 249 ? -14.745 -32.069 118.367 1.00 17.06 ? 249 ARG B N   1 
ATOM   2923 C  CA  . ARG B 1 249 ? -13.932 -33.137 117.762 1.00 18.38 ? 249 ARG B CA  1 
ATOM   2924 C  C   . ARG B 1 249 ? -13.654 -34.158 118.844 1.00 19.03 ? 249 ARG B C   1 
ATOM   2925 O  O   . ARG B 1 249 ? -12.602 -33.944 119.462 1.00 18.96 ? 249 ARG B O   1 
ATOM   2926 C  CB  . ARG B 1 249 ? -12.616 -32.667 117.232 1.00 19.26 ? 249 ARG B CB  1 
ATOM   2927 C  CG  . ARG B 1 249 ? -11.819 -33.857 116.705 1.00 20.95 ? 249 ARG B CG  1 
ATOM   2928 C  CD  . ARG B 1 249 ? -10.581 -33.403 116.022 1.00 22.95 ? 249 ARG B CD  1 
ATOM   2929 N  NE  . ARG B 1 249 ? -9.522  -34.456 116.014 1.00 24.36 ? 249 ARG B NE  1 
ATOM   2930 C  CZ  . ARG B 1 249 ? -9.058  -34.879 114.817 1.00 24.98 ? 249 ARG B CZ  1 
ATOM   2931 N  NH1 . ARG B 1 249 ? -9.745  -34.642 113.703 1.00 25.08 ? 249 ARG B NH1 1 
ATOM   2932 N  NH2 . ARG B 1 249 ? -7.932  -35.578 114.734 1.00 25.78 ? 249 ARG B NH2 1 
ATOM   2933 N  N   . LEU B 1 250 ? -14.541 -35.118 119.026 1.00 20.15 ? 250 LEU B N   1 
ATOM   2934 C  CA  . LEU B 1 250 ? -14.389 -36.122 120.104 1.00 20.57 ? 250 LEU B CA  1 
ATOM   2935 C  C   . LEU B 1 250 ? -13.187 -37.019 119.892 1.00 21.42 ? 250 LEU B C   1 
ATOM   2936 O  O   . LEU B 1 250 ? -13.029 -37.495 118.767 1.00 20.61 ? 250 LEU B O   1 
ATOM   2937 C  CB  . LEU B 1 250 ? -15.689 -36.903 120.238 1.00 20.06 ? 250 LEU B CB  1 
ATOM   2938 C  CG  . LEU B 1 250 ? -16.663 -36.255 121.222 1.00 19.36 ? 250 LEU B CG  1 
ATOM   2939 C  CD1 . LEU B 1 250 ? -15.992 -35.095 121.917 1.00 18.74 ? 250 LEU B CD1 1 
ATOM   2940 C  CD2 . LEU B 1 250 ? -17.860 -35.829 120.383 1.00 20.07 ? 250 LEU B CD2 1 
ATOM   2941 N  N   . ILE B 1 251 ? -12.455 -37.167 121.039 1.00 23.26 ? 251 ILE B N   1 
ATOM   2942 C  CA  . ILE B 1 251 ? -11.234 -37.960 120.774 1.00 25.94 ? 251 ILE B CA  1 
ATOM   2943 C  C   . ILE B 1 251 ? -10.693 -39.152 121.408 1.00 26.25 ? 251 ILE B C   1 
ATOM   2944 O  O   . ILE B 1 251 ? -10.058 -39.680 120.334 1.00 28.01 ? 251 ILE B O   1 
ATOM   2945 C  CB  . ILE B 1 251 ? -10.047 -36.880 120.911 1.00 27.05 ? 251 ILE B CB  1 
ATOM   2946 C  CG1 . ILE B 1 251 ? -9.630  -36.778 119.415 1.00 28.20 ? 251 ILE B CG1 1 
ATOM   2947 C  CG2 . ILE B 1 251 ? -8.910  -37.234 121.824 1.00 27.63 ? 251 ILE B CG2 1 
ATOM   2948 C  CD1 . ILE B 1 251 ? -8.359  -35.825 119.415 1.00 29.89 ? 251 ILE B CD1 1 
ATOM   2949 N  N   . GLU B 1 252 ? -10.554 -39.690 122.504 1.00 25.90 ? 252 GLU B N   1 
ATOM   2950 C  CA  . GLU B 1 252 ? -9.841  -41.087 122.609 1.00 24.99 ? 252 GLU B CA  1 
ATOM   2951 C  C   . GLU B 1 252 ? -10.689 -41.507 123.827 1.00 25.09 ? 252 GLU B C   1 
ATOM   2952 O  O   . GLU B 1 252 ? -10.744 -40.867 124.894 1.00 25.58 ? 252 GLU B O   1 
ATOM   2953 C  CB  . GLU B 1 252 ? -8.432  -41.130 122.653 1.00 24.84 ? 252 GLU B CB  1 
ATOM   2954 C  CG  . GLU B 1 252 ? -7.493  -40.197 123.273 1.00 25.60 ? 252 GLU B CG  1 
ATOM   2955 C  CD  . GLU B 1 252 ? -6.355  -39.538 122.673 1.00 26.22 ? 252 GLU B CD  1 
ATOM   2956 O  OE1 . GLU B 1 252 ? -5.177  -39.469 122.948 1.00 26.66 ? 252 GLU B OE1 1 
ATOM   2957 O  OE2 . GLU B 1 252 ? -6.588  -38.832 121.667 1.00 27.35 ? 252 GLU B OE2 1 
ATOM   2958 N  N   . PRO B 1 253 ? -11.504 -42.506 123.489 1.00 24.06 ? 253 PRO B N   1 
ATOM   2959 C  CA  . PRO B 1 253 ? -12.480 -43.037 124.412 1.00 22.58 ? 253 PRO B CA  1 
ATOM   2960 C  C   . PRO B 1 253 ? -11.808 -43.392 125.734 1.00 21.89 ? 253 PRO B C   1 
ATOM   2961 O  O   . PRO B 1 253 ? -10.624 -43.670 125.811 1.00 21.62 ? 253 PRO B O   1 
ATOM   2962 C  CB  . PRO B 1 253 ? -13.082 -44.231 123.766 1.00 22.52 ? 253 PRO B CB  1 
ATOM   2963 C  CG  . PRO B 1 253 ? -12.475 -44.381 122.434 1.00 23.18 ? 253 PRO B CG  1 
ATOM   2964 C  CD  . PRO B 1 253 ? -11.502 -43.233 122.214 1.00 23.66 ? 253 PRO B CD  1 
ATOM   2965 N  N   . ILE B 1 254 ? -12.703 -43.342 126.688 1.00 21.04 ? 254 ILE B N   1 
ATOM   2966 C  CA  . ILE B 1 254 ? -12.527 -43.629 128.089 1.00 19.51 ? 254 ILE B CA  1 
ATOM   2967 C  C   . ILE B 1 254 ? -13.963 -43.874 128.572 1.00 19.28 ? 254 ILE B C   1 
ATOM   2968 O  O   . ILE B 1 254 ? -14.807 -43.257 127.916 1.00 18.82 ? 254 ILE B O   1 
ATOM   2969 C  CB  . ILE B 1 254 ? -11.889 -42.463 128.829 1.00 18.83 ? 254 ILE B CB  1 
ATOM   2970 C  CG1 . ILE B 1 254 ? -11.799 -42.693 130.316 1.00 18.14 ? 254 ILE B CG1 1 
ATOM   2971 C  CG2 . ILE B 1 254 ? -12.733 -41.168 128.526 1.00 20.06 ? 254 ILE B CG2 1 
ATOM   2972 C  CD1 . ILE B 1 254 ? -10.456 -42.162 130.896 1.00 18.12 ? 254 ILE B CD1 1 
ATOM   2973 N  N   . ALA B 1 255 ? -14.126 -44.655 129.556 1.00 19.61 ? 255 ALA B N   1 
ATOM   2974 C  CA  . ALA B 1 255 ? -15.343 -45.019 130.265 1.00 19.46 ? 255 ALA B CA  1 
ATOM   2975 C  C   . ALA B 1 255 ? -15.733 -43.882 131.187 1.00 19.76 ? 255 ALA B C   1 
ATOM   2976 O  O   . ALA B 1 255 ? -14.946 -43.635 132.132 1.00 20.06 ? 255 ALA B O   1 
ATOM   2977 C  CB  . ALA B 1 255 ? -14.994 -46.273 131.041 1.00 19.93 ? 255 ALA B CB  1 
ATOM   2978 N  N   . ALA B 1 256 ? -16.792 -43.173 130.994 1.00 20.17 ? 256 ALA B N   1 
ATOM   2979 C  CA  . ALA B 1 256 ? -17.270 -42.009 131.694 1.00 20.08 ? 256 ALA B CA  1 
ATOM   2980 C  C   . ALA B 1 256 ? -16.778 -41.808 133.125 1.00 20.86 ? 256 ALA B C   1 
ATOM   2981 O  O   . ALA B 1 256 ? -16.135 -40.856 133.644 1.00 20.82 ? 256 ALA B O   1 
ATOM   2982 C  CB  . ALA B 1 256 ? -18.806 -42.062 131.752 1.00 19.82 ? 256 ALA B CB  1 
ATOM   2983 N  N   . ALA B 1 257 ? -17.197 -42.880 133.803 1.00 21.44 ? 257 ALA B N   1 
ATOM   2984 C  CA  . ALA B 1 257 ? -16.955 -43.036 135.233 1.00 21.37 ? 257 ALA B CA  1 
ATOM   2985 C  C   . ALA B 1 257 ? -15.544 -42.698 135.616 1.00 21.16 ? 257 ALA B C   1 
ATOM   2986 O  O   . ALA B 1 257 ? -15.382 -42.129 136.683 1.00 21.49 ? 257 ALA B O   1 
ATOM   2987 C  CB  . ALA B 1 257 ? -17.299 -44.468 135.544 1.00 22.82 ? 257 ALA B CB  1 
ATOM   2988 N  N   . LEU B 1 258 ? -14.613 -43.066 134.795 1.00 21.85 ? 258 LEU B N   1 
ATOM   2989 C  CA  . LEU B 1 258 ? -13.196 -42.823 134.997 1.00 22.78 ? 258 LEU B CA  1 
ATOM   2990 C  C   . LEU B 1 258 ? -12.760 -41.403 134.673 1.00 23.83 ? 258 LEU B C   1 
ATOM   2991 O  O   . LEU B 1 258 ? -11.539 -41.161 134.832 1.00 24.22 ? 258 LEU B O   1 
ATOM   2992 C  CB  . LEU B 1 258 ? -12.458 -43.852 134.112 1.00 22.23 ? 258 LEU B CB  1 
ATOM   2993 C  CG  . LEU B 1 258 ? -12.147 -45.243 134.583 1.00 22.11 ? 258 LEU B CG  1 
ATOM   2994 C  CD1 . LEU B 1 258 ? -10.939 -45.874 133.848 1.00 20.97 ? 258 LEU B CD1 1 
ATOM   2995 C  CD2 . LEU B 1 258 ? -11.833 -45.199 136.080 1.00 22.16 ? 258 LEU B CD2 1 
ATOM   2996 N  N   . ASN B 1 259 ? -13.590 -40.473 134.213 1.00 25.11 ? 259 ASN B N   1 
ATOM   2997 C  CA  . ASN B 1 259 ? -13.048 -39.147 133.870 1.00 26.69 ? 259 ASN B CA  1 
ATOM   2998 C  C   . ASN B 1 259 ? -13.034 -37.974 134.806 1.00 26.18 ? 259 ASN B C   1 
ATOM   2999 O  O   . ASN B 1 259 ? -14.098 -37.704 135.466 1.00 26.89 ? 259 ASN B O   1 
ATOM   3000 C  CB  . ASN B 1 259 ? -13.908 -38.626 132.639 1.00 28.71 ? 259 ASN B CB  1 
ATOM   3001 C  CG  . ASN B 1 259 ? -12.955 -37.774 131.799 1.00 30.33 ? 259 ASN B CG  1 
ATOM   3002 O  OD1 . ASN B 1 259 ? -11.962 -37.215 132.298 1.00 31.33 ? 259 ASN B OD1 1 
ATOM   3003 N  ND2 . ASN B 1 259 ? -13.279 -37.763 130.504 1.00 30.99 ? 259 ASN B ND2 1 
ATOM   3004 N  N   . LEU B 1 260 ? -11.968 -37.187 134.819 1.00 25.01 ? 260 LEU B N   1 
ATOM   3005 C  CA  . LEU B 1 260 ? -12.068 -35.981 135.730 1.00 24.21 ? 260 LEU B CA  1 
ATOM   3006 C  C   . LEU B 1 260 ? -11.679 -34.729 134.919 1.00 24.09 ? 260 LEU B C   1 
ATOM   3007 O  O   . LEU B 1 260 ? -10.986 -34.914 133.871 1.00 23.49 ? 260 LEU B O   1 
ATOM   3008 C  CB  . LEU B 1 260 ? -11.316 -36.212 136.996 1.00 23.75 ? 260 LEU B CB  1 
ATOM   3009 C  CG  . LEU B 1 260 ? -11.558 -37.545 137.698 1.00 24.09 ? 260 LEU B CG  1 
ATOM   3010 C  CD1 . LEU B 1 260 ? -10.446 -37.990 138.632 1.00 23.36 ? 260 LEU B CD1 1 
ATOM   3011 C  CD2 . LEU B 1 260 ? -12.847 -37.391 138.507 1.00 24.00 ? 260 LEU B CD2 1 
ATOM   3012 O  OXT . LEU B 1 260 ? -12.170 -33.739 135.502 1.00 23.27 ? 260 LEU B OXT 1 
ATOM   3013 N  N   . GLN C 1 39  ? 45.434  -9.844  100.620 1.00 57.61 ? 39  GLN C N   1 
ATOM   3014 C  CA  . GLN C 1 39  ? 45.006  -9.409  102.007 1.00 56.75 ? 39  GLN C CA  1 
ATOM   3015 C  C   . GLN C 1 39  ? 44.166  -10.500 102.658 1.00 54.06 ? 39  GLN C C   1 
ATOM   3016 O  O   . GLN C 1 39  ? 42.909  -10.480 102.610 1.00 54.65 ? 39  GLN C O   1 
ATOM   3017 C  CB  . GLN C 1 39  ? 44.296  -8.050  101.953 1.00 58.69 ? 39  GLN C CB  1 
ATOM   3018 C  CG  . GLN C 1 39  ? 44.183  -7.456  103.342 1.00 61.68 ? 39  GLN C CG  1 
ATOM   3019 C  CD  . GLN C 1 39  ? 43.125  -6.415  103.594 1.00 63.51 ? 39  GLN C CD  1 
ATOM   3020 O  OE1 . GLN C 1 39  ? 43.416  -5.310  104.149 1.00 64.54 ? 39  GLN C OE1 1 
ATOM   3021 N  NE2 . GLN C 1 39  ? 41.851  -6.692  103.243 1.00 64.04 ? 39  GLN C NE2 1 
ATOM   3022 N  N   . ALA C 1 40  ? 44.823  -11.469 103.259 1.00 50.05 ? 40  ALA C N   1 
ATOM   3023 C  CA  . ALA C 1 40  ? 44.045  -12.578 103.859 1.00 46.36 ? 40  ALA C CA  1 
ATOM   3024 C  C   . ALA C 1 40  ? 44.823  -13.127 105.016 1.00 43.71 ? 40  ALA C C   1 
ATOM   3025 O  O   . ALA C 1 40  ? 46.032  -13.341 104.861 1.00 43.63 ? 40  ALA C O   1 
ATOM   3026 C  CB  . ALA C 1 40  ? 43.784  -13.546 102.742 1.00 46.23 ? 40  ALA C CB  1 
ATOM   3027 N  N   . GLY C 1 41  ? 44.121  -13.322 106.086 1.00 40.91 ? 41  GLY C N   1 
ATOM   3028 C  CA  . GLY C 1 41  ? 44.741  -13.888 107.325 1.00 38.28 ? 41  GLY C CA  1 
ATOM   3029 C  C   . GLY C 1 41  ? 45.600  -12.775 107.950 1.00 35.66 ? 41  GLY C C   1 
ATOM   3030 O  O   . GLY C 1 41  ? 46.710  -13.021 108.430 1.00 34.86 ? 41  GLY C O   1 
ATOM   3031 N  N   . VAL C 1 42  ? 44.985  -11.602 107.885 1.00 33.24 ? 42  VAL C N   1 
ATOM   3032 C  CA  . VAL C 1 42  ? 45.728  -10.439 108.443 1.00 31.14 ? 42  VAL C CA  1 
ATOM   3033 C  C   . VAL C 1 42  ? 44.727  -9.595  109.172 1.00 30.21 ? 42  VAL C C   1 
ATOM   3034 O  O   . VAL C 1 42  ? 43.784  -9.067  108.536 1.00 30.38 ? 42  VAL C O   1 
ATOM   3035 C  CB  . VAL C 1 42  ? 46.482  -9.804  107.258 1.00 30.41 ? 42  VAL C CB  1 
ATOM   3036 C  CG1 . VAL C 1 42  ? 47.001  -8.434  107.635 1.00 30.31 ? 42  VAL C CG1 1 
ATOM   3037 C  CG2 . VAL C 1 42  ? 47.650  -10.585 106.706 1.00 29.86 ? 42  VAL C CG2 1 
ATOM   3038 N  N   . SER C 1 43  ? 44.873  -9.461  110.462 1.00 28.95 ? 43  SER C N   1 
ATOM   3039 C  CA  . SER C 1 43  ? 44.012  -8.674  111.332 1.00 27.52 ? 43  SER C CA  1 
ATOM   3040 C  C   . SER C 1 43  ? 44.829  -7.450  111.748 1.00 27.22 ? 43  SER C C   1 
ATOM   3041 O  O   . SER C 1 43  ? 46.029  -7.428  111.593 1.00 27.47 ? 43  SER C O   1 
ATOM   3042 C  CB  . SER C 1 43  ? 43.612  -9.358  112.588 1.00 27.11 ? 43  SER C CB  1 
ATOM   3043 O  OG  . SER C 1 43  ? 42.445  -10.077 112.621 1.00 27.34 ? 43  SER C OG  1 
ATOM   3044 N  N   . MET C 1 44  ? 44.189  -6.498  112.314 1.00 27.68 ? 44  MET C N   1 
ATOM   3045 C  CA  . MET C 1 44  ? 44.724  -5.252  112.877 1.00 27.58 ? 44  MET C CA  1 
ATOM   3046 C  C   . MET C 1 44  ? 43.926  -4.998  114.175 1.00 26.19 ? 44  MET C C   1 
ATOM   3047 O  O   . MET C 1 44  ? 42.756  -4.632  114.152 1.00 26.80 ? 44  MET C O   1 
ATOM   3048 C  CB  . MET C 1 44  ? 44.679  -4.130  111.899 1.00 29.62 ? 44  MET C CB  1 
ATOM   3049 C  CG  . MET C 1 44  ? 45.566  -4.562  110.737 1.00 32.72 ? 44  MET C CG  1 
ATOM   3050 S  SD  . MET C 1 44  ? 46.493  -3.011  110.348 1.00 37.37 ? 44  MET C SD  1 
ATOM   3051 C  CE  . MET C 1 44  ? 48.042  -3.789  109.704 1.00 36.14 ? 44  MET C CE  1 
ATOM   3052 N  N   . ALA C 1 45  ? 44.574  -5.251  115.289 1.00 23.94 ? 45  ALA C N   1 
ATOM   3053 C  CA  . ALA C 1 45  ? 44.034  -5.119  116.610 1.00 21.39 ? 45  ALA C CA  1 
ATOM   3054 C  C   . ALA C 1 45  ? 43.904  -3.658  117.021 1.00 19.30 ? 45  ALA C C   1 
ATOM   3055 O  O   . ALA C 1 45  ? 44.926  -3.000  117.220 1.00 18.79 ? 45  ALA C O   1 
ATOM   3056 C  CB  . ALA C 1 45  ? 44.942  -5.835  117.610 1.00 22.08 ? 45  ALA C CB  1 
ATOM   3057 N  N   . PRO C 1 46  ? 42.652  -3.277  117.131 1.00 17.17 ? 46  PRO C N   1 
ATOM   3058 C  CA  . PRO C 1 46  ? 42.307  -1.937  117.567 1.00 16.64 ? 46  PRO C CA  1 
ATOM   3059 C  C   . PRO C 1 46  ? 42.445  -1.937  119.079 1.00 17.04 ? 46  PRO C C   1 
ATOM   3060 O  O   . PRO C 1 46  ? 42.630  -2.969  119.737 1.00 17.66 ? 46  PRO C O   1 
ATOM   3061 C  CB  . PRO C 1 46  ? 40.925  -1.728  117.082 1.00 15.65 ? 46  PRO C CB  1 
ATOM   3062 C  CG  . PRO C 1 46  ? 40.353  -3.073  117.181 1.00 15.55 ? 46  PRO C CG  1 
ATOM   3063 C  CD  . PRO C 1 46  ? 41.461  -4.063  116.928 1.00 16.22 ? 46  PRO C CD  1 
ATOM   3064 N  N   . ILE C 1 47  ? 42.348  -0.764  119.622 1.00 17.35 ? 47  ILE C N   1 
ATOM   3065 C  CA  . ILE C 1 47  ? 42.487  -0.567  121.042 1.00 17.35 ? 47  ILE C CA  1 
ATOM   3066 C  C   . ILE C 1 47  ? 41.112  -0.453  121.650 1.00 17.42 ? 47  ILE C C   1 
ATOM   3067 O  O   . ILE C 1 47  ? 41.029  -0.503  122.847 1.00 18.19 ? 47  ILE C O   1 
ATOM   3068 C  CB  . ILE C 1 47  ? 43.306  0.726   121.339 1.00 16.96 ? 47  ILE C CB  1 
ATOM   3069 C  CG1 . ILE C 1 47  ? 44.400  0.422   122.383 1.00 16.75 ? 47  ILE C CG1 1 
ATOM   3070 C  CG2 . ILE C 1 47  ? 42.403  1.868   121.835 1.00 17.07 ? 47  ILE C CG2 1 
ATOM   3071 C  CD1 . ILE C 1 47  ? 43.704  -0.139  123.656 1.00 16.75 ? 47  ILE C CD1 1 
ATOM   3072 N  N   . ALA C 1 48  ? 40.166  -0.256  120.794 1.00 17.64 ? 48  ALA C N   1 
ATOM   3073 C  CA  . ALA C 1 48  ? 38.790  -0.031  121.263 1.00 18.08 ? 48  ALA C CA  1 
ATOM   3074 C  C   . ALA C 1 48  ? 37.875  -0.180  120.070 1.00 19.15 ? 48  ALA C C   1 
ATOM   3075 O  O   . ALA C 1 48  ? 38.318  0.191   118.949 1.00 18.36 ? 48  ALA C O   1 
ATOM   3076 C  CB  . ALA C 1 48  ? 38.789  1.361   121.848 1.00 17.11 ? 48  ALA C CB  1 
ATOM   3077 N  N   . GLN C 1 49  ? 36.708  -0.726  120.348 1.00 20.06 ? 49  GLN C N   1 
ATOM   3078 C  CA  . GLN C 1 49  ? 35.726  -0.880  119.226 1.00 20.47 ? 49  GLN C CA  1 
ATOM   3079 C  C   . GLN C 1 49  ? 34.685  0.195   119.421 1.00 21.38 ? 49  GLN C C   1 
ATOM   3080 O  O   . GLN C 1 49  ? 33.993  0.115   120.500 1.00 23.06 ? 49  GLN C O   1 
ATOM   3081 C  CB  . GLN C 1 49  ? 35.182  -2.259  119.263 1.00 20.17 ? 49  GLN C CB  1 
ATOM   3082 C  CG  . GLN C 1 49  ? 36.087  -3.318  118.681 1.00 19.79 ? 49  GLN C CG  1 
ATOM   3083 C  CD  . GLN C 1 49  ? 35.275  -4.599  118.448 1.00 19.75 ? 49  GLN C CD  1 
ATOM   3084 O  OE1 . GLN C 1 49  ? 35.773  -5.578  117.906 1.00 19.84 ? 49  GLN C OE1 1 
ATOM   3085 N  NE2 . GLN C 1 49  ? 34.013  -4.583  118.878 1.00 19.80 ? 49  GLN C NE2 1 
ATOM   3086 N  N   . GLY C 1 50  ? 34.502  1.151   118.547 1.00 21.17 ? 50  GLY C N   1 
ATOM   3087 C  CA  . GLY C 1 50  ? 33.460  2.198   118.794 1.00 20.14 ? 50  GLY C CA  1 
ATOM   3088 C  C   . GLY C 1 50  ? 32.179  1.792   118.078 1.00 19.56 ? 50  GLY C C   1 
ATOM   3089 O  O   . GLY C 1 50  ? 32.298  1.214   116.994 1.00 19.55 ? 50  GLY C O   1 
ATOM   3090 N  N   . THR C 1 51  ? 31.033  2.080   118.621 1.00 19.58 ? 51  THR C N   1 
ATOM   3091 C  CA  . THR C 1 51  ? 29.706  1.808   118.070 1.00 19.57 ? 51  THR C CA  1 
ATOM   3092 C  C   . THR C 1 51  ? 28.695  2.834   118.553 1.00 19.66 ? 51  THR C C   1 
ATOM   3093 O  O   . THR C 1 51  ? 28.576  3.007   119.759 1.00 19.26 ? 51  THR C O   1 
ATOM   3094 C  CB  . THR C 1 51  ? 29.154  0.369   118.390 1.00 19.42 ? 51  THR C CB  1 
ATOM   3095 O  OG1 . THR C 1 51  ? 29.541  0.075   119.731 1.00 19.31 ? 51  THR C OG1 1 
ATOM   3096 C  CG2 . THR C 1 51  ? 29.672  -0.713  117.408 1.00 19.72 ? 51  THR C CG2 1 
ATOM   3097 N  N   . MET C 1 52  ? 27.990  3.474   117.628 1.00 21.13 ? 52  MET C N   1 
ATOM   3098 C  CA  . MET C 1 52  ? 27.021  4.488   118.063 1.00 22.75 ? 52  MET C CA  1 
ATOM   3099 C  C   . MET C 1 52  ? 25.615  3.984   117.744 1.00 22.58 ? 52  MET C C   1 
ATOM   3100 O  O   . MET C 1 52  ? 25.292  4.016   116.558 1.00 23.49 ? 52  MET C O   1 
ATOM   3101 C  CB  . MET C 1 52  ? 27.229  5.858   117.454 1.00 24.35 ? 52  MET C CB  1 
ATOM   3102 C  CG  . MET C 1 52  ? 28.536  6.496   117.740 1.00 26.96 ? 52  MET C CG  1 
ATOM   3103 S  SD  . MET C 1 52  ? 29.903  5.394   117.082 1.00 30.05 ? 52  MET C SD  1 
ATOM   3104 C  CE  . MET C 1 52  ? 30.987  6.690   116.376 1.00 29.49 ? 52  MET C CE  1 
ATOM   3105 N  N   . VAL C 1 53  ? 24.887  3.592   118.741 1.00 22.42 ? 53  VAL C N   1 
ATOM   3106 C  CA  . VAL C 1 53  ? 23.526  3.159   118.599 1.00 23.24 ? 53  VAL C CA  1 
ATOM   3107 C  C   . VAL C 1 53  ? 22.530  4.312   118.490 1.00 24.15 ? 53  VAL C C   1 
ATOM   3108 O  O   . VAL C 1 53  ? 22.577  5.209   119.383 1.00 23.79 ? 53  VAL C O   1 
ATOM   3109 C  CB  . VAL C 1 53  ? 23.083  2.376   119.871 1.00 22.90 ? 53  VAL C CB  1 
ATOM   3110 C  CG1 . VAL C 1 53  ? 21.605  2.033   119.725 1.00 22.31 ? 53  VAL C CG1 1 
ATOM   3111 C  CG2 . VAL C 1 53  ? 23.966  1.225   120.185 1.00 22.69 ? 53  VAL C CG2 1 
ATOM   3112 N  N   . LYS C 1 54  ? 21.650  4.302   117.555 1.00 25.77 ? 54  LYS C N   1 
ATOM   3113 C  CA  . LYS C 1 54  ? 20.613  5.405   117.490 1.00 27.78 ? 54  LYS C CA  1 
ATOM   3114 C  C   . LYS C 1 54  ? 19.367  4.619   117.125 1.00 27.12 ? 54  LYS C C   1 
ATOM   3115 O  O   . LYS C 1 54  ? 19.108  4.293   115.981 1.00 27.47 ? 54  LYS C O   1 
ATOM   3116 C  CB  . LYS C 1 54  ? 20.953  6.537   116.582 1.00 30.19 ? 54  LYS C CB  1 
ATOM   3117 C  CG  . LYS C 1 54  ? 21.818  6.005   115.412 1.00 34.38 ? 54  LYS C CG  1 
ATOM   3118 C  CD  . LYS C 1 54  ? 20.959  5.991   114.109 1.00 37.83 ? 54  LYS C CD  1 
ATOM   3119 C  CE  . LYS C 1 54  ? 21.054  4.673   113.280 1.00 39.14 ? 54  LYS C CE  1 
ATOM   3120 N  NZ  . LYS C 1 54  ? 22.250  4.788   112.300 1.00 40.52 ? 54  LYS C NZ  1 
ATOM   3121 N  N   . LEU C 1 55  ? 18.624  4.263   118.138 1.00 26.82 ? 55  LEU C N   1 
ATOM   3122 C  CA  . LEU C 1 55  ? 17.435  3.449   118.028 1.00 26.36 ? 55  LEU C CA  1 
ATOM   3123 C  C   . LEU C 1 55  ? 16.344  4.050   117.174 1.00 27.37 ? 55  LEU C C   1 
ATOM   3124 O  O   . LEU C 1 55  ? 16.143  5.271   117.186 1.00 27.69 ? 55  LEU C O   1 
ATOM   3125 C  CB  . LEU C 1 55  ? 16.930  3.218   119.457 1.00 24.87 ? 55  LEU C CB  1 
ATOM   3126 C  CG  . LEU C 1 55  ? 17.661  2.075   120.121 1.00 24.25 ? 55  LEU C CG  1 
ATOM   3127 C  CD1 . LEU C 1 55  ? 16.930  1.730   121.405 1.00 24.72 ? 55  LEU C CD1 1 
ATOM   3128 C  CD2 . LEU C 1 55  ? 17.687  0.899   119.160 1.00 23.89 ? 55  LEU C CD2 1 
ATOM   3129 N  N   . ARG C 1 56  ? 15.696  3.115   116.528 1.00 28.49 ? 56  ARG C N   1 
ATOM   3130 C  CA  . ARG C 1 56  ? 14.569  3.432   115.665 1.00 30.14 ? 56  ARG C CA  1 
ATOM   3131 C  C   . ARG C 1 56  ? 13.240  3.388   116.356 1.00 28.90 ? 56  ARG C C   1 
ATOM   3132 O  O   . ARG C 1 56  ? 13.051  2.472   117.177 1.00 28.99 ? 56  ARG C O   1 
ATOM   3133 C  CB  . ARG C 1 56  ? 14.590  2.396   114.501 1.00 33.43 ? 56  ARG C CB  1 
ATOM   3134 C  CG  . ARG C 1 56  ? 14.849  3.151   113.208 1.00 37.32 ? 56  ARG C CG  1 
ATOM   3135 C  CD  . ARG C 1 56  ? 14.753  2.377   111.941 1.00 40.33 ? 56  ARG C CD  1 
ATOM   3136 N  NE  . ARG C 1 56  ? 15.895  2.753   111.092 1.00 43.37 ? 56  ARG C NE  1 
ATOM   3137 C  CZ  . ARG C 1 56  ? 16.471  2.185   110.046 1.00 44.96 ? 56  ARG C CZ  1 
ATOM   3138 N  NH1 . ARG C 1 56  ? 16.207  0.964   109.541 1.00 45.50 ? 56  ARG C NH1 1 
ATOM   3139 N  NH2 . ARG C 1 56  ? 17.421  2.936   109.360 1.00 46.03 ? 56  ARG C NH2 1 
ATOM   3140 N  N   . PRO C 1 57  ? 12.332  4.284   116.012 1.00 28.08 ? 57  PRO C N   1 
ATOM   3141 C  CA  . PRO C 1 57  ? 10.972  4.395   116.580 1.00 27.68 ? 57  PRO C CA  1 
ATOM   3142 C  C   . PRO C 1 57  ? 10.225  3.100   116.464 1.00 27.54 ? 57  PRO C C   1 
ATOM   3143 O  O   . PRO C 1 57  ? 10.477  2.376   115.485 1.00 28.09 ? 57  PRO C O   1 
ATOM   3144 C  CB  . PRO C 1 57  ? 10.299  5.524   115.841 1.00 27.49 ? 57  PRO C CB  1 
ATOM   3145 C  CG  . PRO C 1 57  ? 11.159  5.845   114.697 1.00 27.49 ? 57  PRO C CG  1 
ATOM   3146 C  CD  . PRO C 1 57  ? 12.564  5.329   115.011 1.00 27.86 ? 57  PRO C CD  1 
ATOM   3147 N  N   . PRO C 1 58  ? 9.387   2.813   117.427 1.00 27.61 ? 58  PRO C N   1 
ATOM   3148 C  CA  . PRO C 1 58  ? 8.654   1.548   117.434 1.00 28.33 ? 58  PRO C CA  1 
ATOM   3149 C  C   . PRO C 1 58  ? 7.736   1.535   116.224 1.00 29.55 ? 58  PRO C C   1 
ATOM   3150 O  O   . PRO C 1 58  ? 7.332   2.615   115.794 1.00 29.91 ? 58  PRO C O   1 
ATOM   3151 C  CB  . PRO C 1 58  ? 7.923   1.440   118.724 1.00 27.73 ? 58  PRO C CB  1 
ATOM   3152 C  CG  . PRO C 1 58  ? 8.025   2.781   119.339 1.00 28.08 ? 58  PRO C CG  1 
ATOM   3153 C  CD  . PRO C 1 58  ? 9.071   3.612   118.590 1.00 27.70 ? 58  PRO C CD  1 
ATOM   3154 N  N   . MET C 1 59  ? 7.509   0.318   115.790 1.00 31.12 ? 59  MET C N   1 
ATOM   3155 C  CA  . MET C 1 59  ? 6.646   0.119   114.673 1.00 33.47 ? 59  MET C CA  1 
ATOM   3156 C  C   . MET C 1 59  ? 5.493   -0.833  115.061 1.00 32.96 ? 59  MET C C   1 
ATOM   3157 O  O   . MET C 1 59  ? 5.681   -1.998  115.426 1.00 32.44 ? 59  MET C O   1 
ATOM   3158 C  CB  . MET C 1 59  ? 7.361   -0.433  113.465 1.00 36.86 ? 59  MET C CB  1 
ATOM   3159 C  CG  . MET C 1 59  ? 6.118   -0.487  112.483 1.00 41.17 ? 59  MET C CG  1 
ATOM   3160 S  SD  . MET C 1 59  ? 6.715   -1.560  111.115 1.00 45.29 ? 59  MET C SD  1 
ATOM   3161 C  CE  . MET C 1 59  ? 8.314   -0.616  110.836 1.00 45.67 ? 59  MET C CE  1 
ATOM   3162 N  N   . LEU C 1 60  ? 4.353   -0.210  114.905 1.00 32.58 ? 60  LEU C N   1 
ATOM   3163 C  CA  . LEU C 1 60  ? 3.093   -0.876  115.220 1.00 33.16 ? 60  LEU C CA  1 
ATOM   3164 C  C   . LEU C 1 60  ? 2.176   -0.945  114.028 1.00 34.47 ? 60  LEU C C   1 
ATOM   3165 O  O   . LEU C 1 60  ? 2.078   0.106   113.360 1.00 35.06 ? 60  LEU C O   1 
ATOM   3166 C  CB  . LEU C 1 60  ? 2.520   -0.022  116.308 1.00 31.90 ? 60  LEU C CB  1 
ATOM   3167 C  CG  . LEU C 1 60  ? 2.442   -0.572  117.675 1.00 31.57 ? 60  LEU C CG  1 
ATOM   3168 C  CD1 . LEU C 1 60  ? 3.753   -0.485  118.389 1.00 31.50 ? 60  LEU C CD1 1 
ATOM   3169 C  CD2 . LEU C 1 60  ? 1.440   0.337   118.402 1.00 31.99 ? 60  LEU C CD2 1 
ATOM   3170 N  N   . ARG C 1 61  ? 1.551   -2.065  113.805 1.00 36.01 ? 61  ARG C N   1 
ATOM   3171 C  CA  . ARG C 1 61  ? 0.612   -2.128  112.628 1.00 37.58 ? 61  ARG C CA  1 
ATOM   3172 C  C   . ARG C 1 61  ? -0.251  -3.349  112.880 1.00 37.02 ? 61  ARG C C   1 
ATOM   3173 O  O   . ARG C 1 61  ? 0.139   -4.486  113.107 1.00 37.12 ? 61  ARG C O   1 
ATOM   3174 C  CB  . ARG C 1 61  ? 1.360   -2.073  111.375 1.00 40.84 ? 61  ARG C CB  1 
ATOM   3175 C  CG  . ARG C 1 61  ? 1.048   -2.716  110.089 1.00 44.85 ? 61  ARG C CG  1 
ATOM   3176 C  CD  . ARG C 1 61  ? 1.915   -3.897  109.757 1.00 48.56 ? 61  ARG C CD  1 
ATOM   3177 N  NE  . ARG C 1 61  ? 1.241   -5.211  109.805 1.00 51.76 ? 61  ARG C NE  1 
ATOM   3178 C  CZ  . ARG C 1 61  ? 1.671   -6.340  109.187 1.00 53.48 ? 61  ARG C CZ  1 
ATOM   3179 N  NH1 . ARG C 1 61  ? 2.773   -6.370  108.398 1.00 54.28 ? 61  ARG C NH1 1 
ATOM   3180 N  NH2 . ARG C 1 61  ? 1.001   -7.526  109.346 1.00 53.94 ? 61  ARG C NH2 1 
ATOM   3181 N  N   . SER C 1 62  ? -1.493  -3.022  112.893 1.00 36.29 ? 62  SER C N   1 
ATOM   3182 C  CA  . SER C 1 62  ? -2.696  -3.751  113.140 1.00 35.95 ? 62  SER C CA  1 
ATOM   3183 C  C   . SER C 1 62  ? -3.315  -4.405  111.963 1.00 36.17 ? 62  SER C C   1 
ATOM   3184 O  O   . SER C 1 62  ? -3.628  -3.578  111.078 1.00 36.37 ? 62  SER C O   1 
ATOM   3185 C  CB  . SER C 1 62  ? -3.614  -2.602  113.656 1.00 35.86 ? 62  SER C CB  1 
ATOM   3186 O  OG  . SER C 1 62  ? -4.969  -2.770  113.660 1.00 35.91 ? 62  SER C OG  1 
ATOM   3187 N  N   . SER C 1 63  ? -3.530  -5.697  111.876 1.00 36.84 ? 63  SER C N   1 
ATOM   3188 C  CA  . SER C 1 63  ? -4.256  -6.239  110.647 1.00 37.13 ? 63  SER C CA  1 
ATOM   3189 C  C   . SER C 1 63  ? -5.674  -6.328  111.135 1.00 37.35 ? 63  SER C C   1 
ATOM   3190 O  O   . SER C 1 63  ? -6.037  -5.191  111.622 1.00 38.72 ? 63  SER C O   1 
ATOM   3191 C  CB  . SER C 1 63  ? -3.707  -7.490  110.116 1.00 37.57 ? 63  SER C CB  1 
ATOM   3192 O  OG  . SER C 1 63  ? -2.380  -7.134  109.594 1.00 38.10 ? 63  SER C OG  1 
ATOM   3193 N  N   . MET C 1 64  ? -6.421  -7.368  111.135 1.00 37.47 ? 64  MET C N   1 
ATOM   3194 C  CA  . MET C 1 64  ? -7.786  -7.072  111.749 1.00 37.94 ? 64  MET C CA  1 
ATOM   3195 C  C   . MET C 1 64  ? -7.618  -7.324  113.269 1.00 36.10 ? 64  MET C C   1 
ATOM   3196 O  O   . MET C 1 64  ? -7.580  -6.308  114.007 1.00 35.91 ? 64  MET C O   1 
ATOM   3197 C  CB  . MET C 1 64  ? -8.864  -7.781  111.161 1.00 41.52 ? 64  MET C CB  1 
ATOM   3198 C  CG  . MET C 1 64  ? -8.989  -8.106  109.715 1.00 46.14 ? 64  MET C CG  1 
ATOM   3199 S  SD  . MET C 1 64  ? -10.744 -8.875  109.723 1.00 51.92 ? 64  MET C SD  1 
ATOM   3200 C  CE  . MET C 1 64  ? -11.581 -7.388  110.534 1.00 50.78 ? 64  MET C CE  1 
ATOM   3201 N  N   . ASP C 1 65  ? -7.563  -8.558  113.707 1.00 33.98 ? 65  ASP C N   1 
ATOM   3202 C  CA  . ASP C 1 65  ? -7.457  -8.829  115.136 1.00 32.00 ? 65  ASP C CA  1 
ATOM   3203 C  C   . ASP C 1 65  ? -5.993  -8.884  115.574 1.00 29.60 ? 65  ASP C C   1 
ATOM   3204 O  O   . ASP C 1 65  ? -5.839  -8.697  116.798 1.00 29.56 ? 65  ASP C O   1 
ATOM   3205 C  CB  . ASP C 1 65  ? -8.078  -10.142 115.658 1.00 33.78 ? 65  ASP C CB  1 
ATOM   3206 C  CG  . ASP C 1 65  ? -9.293  -10.461 114.800 1.00 35.18 ? 65  ASP C CG  1 
ATOM   3207 O  OD1 . ASP C 1 65  ? -10.433 -10.163 115.189 1.00 35.83 ? 65  ASP C OD1 1 
ATOM   3208 O  OD2 . ASP C 1 65  ? -8.962  -11.001 113.714 1.00 36.31 ? 65  ASP C OD2 1 
ATOM   3209 N  N   . VAL C 1 66  ? -5.107  -9.141  114.634 1.00 26.37 ? 66  VAL C N   1 
ATOM   3210 C  CA  . VAL C 1 66  ? -3.726  -9.187  115.227 1.00 23.88 ? 66  VAL C CA  1 
ATOM   3211 C  C   . VAL C 1 66  ? -3.086  -7.816  115.079 1.00 21.70 ? 66  VAL C C   1 
ATOM   3212 O  O   . VAL C 1 66  ? -3.393  -7.098  114.106 1.00 21.33 ? 66  VAL C O   1 
ATOM   3213 C  CB  . VAL C 1 66  ? -3.010  -10.366 114.616 1.00 24.07 ? 66  VAL C CB  1 
ATOM   3214 C  CG1 . VAL C 1 66  ? -4.022  -11.459 114.313 1.00 24.32 ? 66  VAL C CG1 1 
ATOM   3215 C  CG2 . VAL C 1 66  ? -2.222  -10.017 113.383 1.00 24.71 ? 66  VAL C CG2 1 
ATOM   3216 N  N   . THR C 1 67  ? -2.255  -7.546  116.070 1.00 18.49 ? 67  THR C N   1 
ATOM   3217 C  CA  . THR C 1 67  ? -1.484  -6.312  116.053 1.00 16.35 ? 67  THR C CA  1 
ATOM   3218 C  C   . THR C 1 67  ? -0.040  -6.837  115.978 1.00 14.92 ? 67  THR C C   1 
ATOM   3219 O  O   . THR C 1 67  ? 0.200   -7.854  116.653 1.00 15.10 ? 67  THR C O   1 
ATOM   3220 C  CB  . THR C 1 67  ? -1.621  -5.311  117.211 1.00 16.21 ? 67  THR C CB  1 
ATOM   3221 O  OG1 . THR C 1 67  ? -2.631  -4.310  116.862 1.00 15.96 ? 67  THR C OG1 1 
ATOM   3222 C  CG2 . THR C 1 67  ? -0.254  -4.638  117.543 1.00 15.90 ? 67  THR C CG2 1 
ATOM   3223 N  N   . ILE C 1 68  ? 0.797   -6.183  115.218 1.00 13.45 ? 68  ILE C N   1 
ATOM   3224 C  CA  . ILE C 1 68  ? 2.188   -6.639  115.155 1.00 11.85 ? 68  ILE C CA  1 
ATOM   3225 C  C   . ILE C 1 68  ? 3.129   -5.571  115.702 1.00 11.78 ? 68  ILE C C   1 
ATOM   3226 O  O   . ILE C 1 68  ? 2.997   -4.480  115.118 1.00 12.56 ? 68  ILE C O   1 
ATOM   3227 C  CB  . ILE C 1 68  ? 2.778   -6.924  113.755 1.00 10.73 ? 68  ILE C CB  1 
ATOM   3228 C  CG1 . ILE C 1 68  ? 2.153   -8.144  113.142 1.00 10.11 ? 68  ILE C CG1 1 
ATOM   3229 C  CG2 . ILE C 1 68  ? 4.342   -7.025  113.944 1.00 10.36 ? 68  ILE C CG2 1 
ATOM   3230 C  CD1 . ILE C 1 68  ? 2.349   -9.379  114.105 1.00 10.78 ? 68  ILE C CD1 1 
ATOM   3231 N  N   . LEU C 1 69  ? 3.982   -5.872  116.614 1.00 11.68 ? 69  LEU C N   1 
ATOM   3232 C  CA  . LEU C 1 69  ? 4.881   -4.802  117.093 1.00 11.77 ? 69  LEU C CA  1 
ATOM   3233 C  C   . LEU C 1 69  ? 6.315   -5.270  116.902 1.00 12.66 ? 69  LEU C C   1 
ATOM   3234 O  O   . LEU C 1 69  ? 6.643   -6.432  117.170 1.00 12.84 ? 69  LEU C O   1 
ATOM   3235 C  CB  . LEU C 1 69  ? 4.501   -4.468  118.524 1.00 10.41 ? 69  LEU C CB  1 
ATOM   3236 C  CG  . LEU C 1 69  ? 5.638   -3.939  119.388 1.00 8.94  ? 69  LEU C CG  1 
ATOM   3237 C  CD1 . LEU C 1 69  ? 6.221   -2.685  118.761 1.00 8.72  ? 69  LEU C CD1 1 
ATOM   3238 C  CD2 . LEU C 1 69  ? 5.093   -3.680  120.771 1.00 7.85  ? 69  LEU C CD2 1 
ATOM   3239 N  N   . SER C 1 70  ? 7.084   -4.327  116.441 1.00 14.10 ? 70  SER C N   1 
ATOM   3240 C  CA  . SER C 1 70  ? 8.515   -4.570  116.212 1.00 15.61 ? 70  SER C CA  1 
ATOM   3241 C  C   . SER C 1 70  ? 9.310   -3.384  116.764 1.00 16.92 ? 70  SER C C   1 
ATOM   3242 O  O   . SER C 1 70  ? 9.092   -2.229  116.371 1.00 16.81 ? 70  SER C O   1 
ATOM   3243 C  CB  . SER C 1 70  ? 8.859   -4.770  114.772 1.00 15.36 ? 70  SER C CB  1 
ATOM   3244 O  OG  . SER C 1 70  ? 9.112   -6.146  114.611 1.00 16.09 ? 70  SER C OG  1 
ATOM   3245 N  N   . HIS C 1 71  ? 10.192  -3.802  117.665 1.00 18.36 ? 71  HIS C N   1 
ATOM   3246 C  CA  . HIS C 1 71  ? 11.034  -2.770  118.331 1.00 19.40 ? 71  HIS C CA  1 
ATOM   3247 C  C   . HIS C 1 71  ? 12.299  -3.374  118.851 1.00 19.32 ? 71  HIS C C   1 
ATOM   3248 O  O   . HIS C 1 71  ? 12.527  -4.613  118.699 1.00 19.41 ? 71  HIS C O   1 
ATOM   3249 C  CB  . HIS C 1 71  ? 10.200  -2.123  119.463 1.00 20.12 ? 71  HIS C CB  1 
ATOM   3250 C  CG  . HIS C 1 71  ? 10.706  -0.813  119.935 1.00 21.27 ? 71  HIS C CG  1 
ATOM   3251 N  ND1 . HIS C 1 71  ? 11.670  -0.059  119.257 1.00 21.97 ? 71  HIS C ND1 1 
ATOM   3252 C  CD2 . HIS C 1 71  ? 10.363  -0.087  121.034 1.00 21.43 ? 71  HIS C CD2 1 
ATOM   3253 C  CE1 . HIS C 1 71  ? 11.872  1.060   119.940 1.00 21.72 ? 71  HIS C CE1 1 
ATOM   3254 N  NE2 . HIS C 1 71  ? 11.100  1.075   121.018 1.00 21.65 ? 71  HIS C NE2 1 
ATOM   3255 N  N   . CYS C 1 72  ? 13.069  -2.510  119.484 1.00 19.78 ? 72  CYS C N   1 
ATOM   3256 C  CA  . CYS C 1 72  ? 14.336  -2.969  120.118 1.00 20.86 ? 72  CYS C CA  1 
ATOM   3257 C  C   . CYS C 1 72  ? 14.590  -2.100  121.347 1.00 20.38 ? 72  CYS C C   1 
ATOM   3258 O  O   . CYS C 1 72  ? 14.557  -0.900  121.132 1.00 20.31 ? 72  CYS C O   1 
ATOM   3259 C  CB  . CYS C 1 72  ? 15.507  -2.934  119.190 1.00 21.98 ? 72  CYS C CB  1 
ATOM   3260 S  SG  . CYS C 1 72  ? 17.153  -2.619  119.800 1.00 23.06 ? 72  CYS C SG  1 
ATOM   3261 N  N   . GLU C 1 73  ? 14.815  -2.755  122.467 1.00 20.59 ? 73  GLU C N   1 
ATOM   3262 C  CA  . GLU C 1 73  ? 15.101  -1.816  123.641 1.00 20.79 ? 73  GLU C CA  1 
ATOM   3263 C  C   . GLU C 1 73  ? 16.359  -2.398  124.238 1.00 21.25 ? 73  GLU C C   1 
ATOM   3264 O  O   . GLU C 1 73  ? 16.866  -3.438  123.736 1.00 21.67 ? 73  GLU C O   1 
ATOM   3265 C  CB  . GLU C 1 73  ? 13.925  -1.652  124.438 1.00 21.20 ? 73  GLU C CB  1 
ATOM   3266 C  CG  . GLU C 1 73  ? 12.989  -2.594  125.075 1.00 22.09 ? 73  GLU C CG  1 
ATOM   3267 C  CD  . GLU C 1 73  ? 11.557  -2.093  125.197 1.00 22.45 ? 73  GLU C CD  1 
ATOM   3268 O  OE1 . GLU C 1 73  ? 10.894  -1.770  126.156 1.00 22.81 ? 73  GLU C OE1 1 
ATOM   3269 O  OE2 . GLU C 1 73  ? 11.111  -2.074  124.030 1.00 22.79 ? 73  GLU C OE2 1 
ATOM   3270 N  N   . LEU C 1 74  ? 16.943  -1.701  125.177 1.00 21.80 ? 74  LEU C N   1 
ATOM   3271 C  CA  . LEU C 1 74  ? 18.212  -2.188  125.779 1.00 22.73 ? 74  LEU C CA  1 
ATOM   3272 C  C   . LEU C 1 74  ? 17.752  -3.130  126.875 1.00 23.76 ? 74  LEU C C   1 
ATOM   3273 O  O   . LEU C 1 74  ? 16.758  -2.747  127.508 1.00 24.03 ? 74  LEU C O   1 
ATOM   3274 C  CB  . LEU C 1 74  ? 18.995  -1.022  126.241 1.00 22.48 ? 74  LEU C CB  1 
ATOM   3275 C  CG  . LEU C 1 74  ? 19.739  -1.056  127.545 1.00 22.34 ? 74  LEU C CG  1 
ATOM   3276 C  CD1 . LEU C 1 74  ? 20.662  -2.237  127.722 1.00 22.27 ? 74  LEU C CD1 1 
ATOM   3277 C  CD2 . LEU C 1 74  ? 20.618  0.200   127.533 1.00 22.86 ? 74  LEU C CD2 1 
ATOM   3278 N  N   . SER C 1 75  ? 18.421  -4.207  127.080 1.00 25.11 ? 75  SER C N   1 
ATOM   3279 C  CA  . SER C 1 75  ? 18.010  -5.148  128.092 1.00 26.46 ? 75  SER C CA  1 
ATOM   3280 C  C   . SER C 1 75  ? 18.746  -5.252  129.385 1.00 27.03 ? 75  SER C C   1 
ATOM   3281 O  O   . SER C 1 75  ? 18.030  -5.361  130.409 1.00 27.94 ? 75  SER C O   1 
ATOM   3282 C  CB  . SER C 1 75  ? 18.168  -6.596  127.500 1.00 27.02 ? 75  SER C CB  1 
ATOM   3283 O  OG  . SER C 1 75  ? 17.365  -7.427  128.323 1.00 27.94 ? 75  SER C OG  1 
ATOM   3284 N  N   . THR C 1 76  ? 20.044  -5.332  129.346 1.00 27.55 ? 76  THR C N   1 
ATOM   3285 C  CA  . THR C 1 76  ? 20.844  -5.506  130.544 1.00 28.67 ? 76  THR C CA  1 
ATOM   3286 C  C   . THR C 1 76  ? 22.176  -4.883  130.538 1.00 29.54 ? 76  THR C C   1 
ATOM   3287 O  O   . THR C 1 76  ? 22.492  -4.646  129.331 1.00 30.14 ? 76  THR C O   1 
ATOM   3288 C  CB  . THR C 1 76  ? 21.148  -7.076  130.617 1.00 28.68 ? 76  THR C CB  1 
ATOM   3289 O  OG1 . THR C 1 76  ? 19.912  -7.613  131.114 1.00 29.83 ? 76  THR C OG1 1 
ATOM   3290 C  CG2 . THR C 1 76  ? 22.376  -7.417  131.442 1.00 28.55 ? 76  THR C CG2 1 
ATOM   3291 N  N   . GLU C 1 77  ? 22.887  -4.722  131.650 1.00 30.03 ? 77  GLU C N   1 
ATOM   3292 C  CA  . GLU C 1 77  ? 24.281  -4.198  131.433 1.00 30.50 ? 77  GLU C CA  1 
ATOM   3293 C  C   . GLU C 1 77  ? 25.152  -5.337  131.998 1.00 28.68 ? 77  GLU C C   1 
ATOM   3294 O  O   . GLU C 1 77  ? 24.691  -5.886  133.015 1.00 29.17 ? 77  GLU C O   1 
ATOM   3295 C  CB  . GLU C 1 77  ? 24.738  -2.970  132.048 1.00 33.59 ? 77  GLU C CB  1 
ATOM   3296 C  CG  . GLU C 1 77  ? 24.147  -1.681  131.439 1.00 38.40 ? 77  GLU C CG  1 
ATOM   3297 C  CD  . GLU C 1 77  ? 23.583  -0.896  132.625 1.00 42.47 ? 77  GLU C CD  1 
ATOM   3298 O  OE1 . GLU C 1 77  ? 22.368  -0.882  132.964 1.00 44.35 ? 77  GLU C OE1 1 
ATOM   3299 O  OE2 . GLU C 1 77  ? 24.563  -0.315  133.222 1.00 44.45 ? 77  GLU C OE2 1 
ATOM   3300 N  N   . LEU C 1 78  ? 26.253  -5.595  131.360 1.00 26.09 ? 78  LEU C N   1 
ATOM   3301 C  CA  . LEU C 1 78  ? 27.096  -6.707  131.846 1.00 24.44 ? 78  LEU C CA  1 
ATOM   3302 C  C   . LEU C 1 78  ? 28.425  -6.306  132.378 1.00 24.59 ? 78  LEU C C   1 
ATOM   3303 O  O   . LEU C 1 78  ? 29.014  -5.286  131.953 1.00 25.56 ? 78  LEU C O   1 
ATOM   3304 C  CB  . LEU C 1 78  ? 27.072  -7.631  130.595 1.00 23.17 ? 78  LEU C CB  1 
ATOM   3305 C  CG  . LEU C 1 78  ? 26.286  -8.920  130.855 1.00 22.43 ? 78  LEU C CG  1 
ATOM   3306 C  CD1 . LEU C 1 78  ? 25.411  -8.731  132.097 1.00 22.70 ? 78  LEU C CD1 1 
ATOM   3307 C  CD2 . LEU C 1 78  ? 25.435  -9.268  129.664 1.00 21.42 ? 78  LEU C CD2 1 
ATOM   3308 N  N   . ALA C 1 79  ? 28.947  -7.091  133.310 1.00 24.06 ? 79  ALA C N   1 
ATOM   3309 C  CA  . ALA C 1 79  ? 30.301  -6.781  133.894 1.00 23.32 ? 79  ALA C CA  1 
ATOM   3310 C  C   . ALA C 1 79  ? 30.929  -8.106  134.282 1.00 23.42 ? 79  ALA C C   1 
ATOM   3311 O  O   . ALA C 1 79  ? 30.225  -9.055  134.689 1.00 23.99 ? 79  ALA C O   1 
ATOM   3312 C  CB  . ALA C 1 79  ? 30.153  -5.814  134.992 1.00 23.28 ? 79  ALA C CB  1 
ATOM   3313 N  N   . VAL C 1 80  ? 32.230  -8.177  134.118 1.00 23.79 ? 80  VAL C N   1 
ATOM   3314 C  CA  . VAL C 1 80  ? 33.016  -9.368  134.381 1.00 24.03 ? 80  VAL C CA  1 
ATOM   3315 C  C   . VAL C 1 80  ? 33.761  -9.383  135.694 1.00 24.48 ? 80  VAL C C   1 
ATOM   3316 O  O   . VAL C 1 80  ? 34.114  -8.340  136.256 1.00 25.37 ? 80  VAL C O   1 
ATOM   3317 C  CB  . VAL C 1 80  ? 34.079  -9.536  133.273 1.00 23.70 ? 80  VAL C CB  1 
ATOM   3318 C  CG1 . VAL C 1 80  ? 35.412  -9.934  133.826 1.00 23.74 ? 80  VAL C CG1 1 
ATOM   3319 C  CG2 . VAL C 1 80  ? 33.542  -10.555 132.318 1.00 24.66 ? 80  VAL C CG2 1 
ATOM   3320 N  N   . THR C 1 81  ? 34.065  -10.594 136.070 1.00 24.64 ? 81  THR C N   1 
ATOM   3321 C  CA  . THR C 1 81  ? 34.796  -10.841 137.326 1.00 24.30 ? 81  THR C CA  1 
ATOM   3322 C  C   . THR C 1 81  ? 35.787  -11.922 137.132 1.00 23.96 ? 81  THR C C   1 
ATOM   3323 O  O   . THR C 1 81  ? 35.678  -12.720 136.212 1.00 23.07 ? 81  THR C O   1 
ATOM   3324 C  CB  . THR C 1 81  ? 33.668  -11.208 138.356 1.00 24.62 ? 81  THR C CB  1 
ATOM   3325 O  OG1 . THR C 1 81  ? 34.311  -11.639 139.533 1.00 24.30 ? 81  THR C OG1 1 
ATOM   3326 C  CG2 . THR C 1 81  ? 32.721  -12.269 137.675 1.00 25.02 ? 81  THR C CG2 1 
ATOM   3327 N  N   . VAL C 1 82  ? 36.761  -12.031 137.952 1.00 25.17 ? 82  VAL C N   1 
ATOM   3328 C  CA  . VAL C 1 82  ? 37.812  -12.993 138.099 1.00 25.78 ? 82  VAL C CA  1 
ATOM   3329 C  C   . VAL C 1 82  ? 37.249  -14.406 137.898 1.00 25.46 ? 82  VAL C C   1 
ATOM   3330 O  O   . VAL C 1 82  ? 37.974  -15.316 137.544 1.00 26.14 ? 82  VAL C O   1 
ATOM   3331 C  CB  . VAL C 1 82  ? 38.359  -12.963 139.566 1.00 26.16 ? 82  VAL C CB  1 
ATOM   3332 C  CG1 . VAL C 1 82  ? 37.802  -14.188 140.366 1.00 26.54 ? 82  VAL C CG1 1 
ATOM   3333 C  CG2 . VAL C 1 82  ? 39.828  -12.865 139.733 1.00 26.21 ? 82  VAL C CG2 1 
ATOM   3334 N  N   . THR C 1 83  ? 35.963  -14.521 138.245 1.00 24.49 ? 83  THR C N   1 
ATOM   3335 C  CA  . THR C 1 83  ? 35.294  -15.811 138.188 1.00 24.13 ? 83  THR C CA  1 
ATOM   3336 C  C   . THR C 1 83  ? 34.018  -15.973 137.384 1.00 22.91 ? 83  THR C C   1 
ATOM   3337 O  O   . THR C 1 83  ? 33.472  -14.910 136.984 1.00 23.23 ? 83  THR C O   1 
ATOM   3338 C  CB  . THR C 1 83  ? 34.987  -16.201 139.712 1.00 24.41 ? 83  THR C CB  1 
ATOM   3339 O  OG1 . THR C 1 83  ? 35.101  -17.644 139.619 1.00 25.73 ? 83  THR C OG1 1 
ATOM   3340 C  CG2 . THR C 1 83  ? 33.644  -15.754 140.261 1.00 24.67 ? 83  THR C CG2 1 
ATOM   3341 N  N   . ILE C 1 84  ? 33.554  -17.218 137.180 1.00 20.58 ? 84  ILE C N   1 
ATOM   3342 C  CA  . ILE C 1 84  ? 32.336  -17.383 136.411 1.00 20.30 ? 84  ILE C CA  1 
ATOM   3343 C  C   . ILE C 1 84  ? 31.105  -16.715 137.067 1.00 19.39 ? 84  ILE C C   1 
ATOM   3344 O  O   . ILE C 1 84  ? 31.079  -16.607 138.281 1.00 19.35 ? 84  ILE C O   1 
ATOM   3345 C  CB  . ILE C 1 84  ? 31.934  -18.873 136.113 1.00 20.80 ? 84  ILE C CB  1 
ATOM   3346 C  CG1 . ILE C 1 84  ? 32.112  -19.168 134.615 1.00 20.69 ? 84  ILE C CG1 1 
ATOM   3347 C  CG2 . ILE C 1 84  ? 30.484  -19.165 136.605 1.00 20.27 ? 84  ILE C CG2 1 
ATOM   3348 C  CD1 . ILE C 1 84  ? 30.893  -19.837 133.911 1.00 20.83 ? 84  ILE C CD1 1 
ATOM   3349 N  N   . VAL C 1 85  ? 30.132  -16.354 136.235 1.00 18.37 ? 85  VAL C N   1 
ATOM   3350 C  CA  . VAL C 1 85  ? 28.926  -15.755 136.860 1.00 18.24 ? 85  VAL C CA  1 
ATOM   3351 C  C   . VAL C 1 85  ? 27.719  -15.939 135.918 1.00 18.40 ? 85  VAL C C   1 
ATOM   3352 O  O   . VAL C 1 85  ? 27.624  -15.241 134.869 1.00 19.13 ? 85  VAL C O   1 
ATOM   3353 C  CB  . VAL C 1 85  ? 29.078  -14.299 137.243 1.00 17.55 ? 85  VAL C CB  1 
ATOM   3354 C  CG1 . VAL C 1 85  ? 27.704  -13.628 137.368 1.00 17.61 ? 85  VAL C CG1 1 
ATOM   3355 C  CG2 . VAL C 1 85  ? 29.847  -14.121 138.498 1.00 17.73 ? 85  VAL C CG2 1 
ATOM   3356 N  N   . VAL C 1 86  ? 26.861  -16.865 136.383 1.00 16.94 ? 86  VAL C N   1 
ATOM   3357 C  CA  . VAL C 1 86  ? 25.733  -17.085 135.539 1.00 16.32 ? 86  VAL C CA  1 
ATOM   3358 C  C   . VAL C 1 86  ? 24.453  -16.422 136.011 1.00 18.08 ? 86  VAL C C   1 
ATOM   3359 O  O   . VAL C 1 86  ? 23.919  -16.876 137.028 1.00 19.10 ? 86  VAL C O   1 
ATOM   3360 C  CB  . VAL C 1 86  ? 25.473  -18.589 135.451 1.00 14.86 ? 86  VAL C CB  1 
ATOM   3361 C  CG1 . VAL C 1 86  ? 24.218  -18.696 134.594 1.00 14.56 ? 86  VAL C CG1 1 
ATOM   3362 C  CG2 . VAL C 1 86  ? 26.621  -19.343 134.958 1.00 14.39 ? 86  VAL C CG2 1 
ATOM   3363 N  N   . THR C 1 87  ? 23.989  -15.510 135.275 1.00 19.16 ? 87  THR C N   1 
ATOM   3364 C  CA  . THR C 1 87  ? 22.768  -14.730 135.387 1.00 20.55 ? 87  THR C CA  1 
ATOM   3365 C  C   . THR C 1 87  ? 21.775  -15.310 134.425 1.00 21.17 ? 87  THR C C   1 
ATOM   3366 O  O   . THR C 1 87  ? 22.185  -16.146 133.541 1.00 20.63 ? 87  THR C O   1 
ATOM   3367 C  CB  . THR C 1 87  ? 23.332  -13.294 135.109 1.00 21.85 ? 87  THR C CB  1 
ATOM   3368 O  OG1 . THR C 1 87  ? 22.312  -12.467 134.429 1.00 23.24 ? 87  THR C OG1 1 
ATOM   3369 C  CG2 . THR C 1 87  ? 24.681  -13.359 134.306 1.00 21.49 ? 87  THR C CG2 1 
ATOM   3370 N  N   . SER C 1 88  ? 20.484  -15.013 134.426 1.00 22.64 ? 88  SER C N   1 
ATOM   3371 C  CA  . SER C 1 88  ? 19.586  -15.613 133.392 1.00 24.09 ? 88  SER C CA  1 
ATOM   3372 C  C   . SER C 1 88  ? 18.311  -14.767 133.298 1.00 24.99 ? 88  SER C C   1 
ATOM   3373 O  O   . SER C 1 88  ? 17.933  -14.158 134.279 1.00 25.06 ? 88  SER C O   1 
ATOM   3374 C  CB  . SER C 1 88  ? 19.133  -17.017 133.604 1.00 24.43 ? 88  SER C CB  1 
ATOM   3375 O  OG  . SER C 1 88  ? 17.799  -16.879 134.136 1.00 24.24 ? 88  SER C OG  1 
ATOM   3376 N  N   . GLU C 1 89  ? 17.715  -14.814 132.141 1.00 27.16 ? 89  GLU C N   1 
ATOM   3377 C  CA  . GLU C 1 89  ? 16.537  -14.061 131.809 1.00 29.27 ? 89  GLU C CA  1 
ATOM   3378 C  C   . GLU C 1 89  ? 15.348  -14.696 131.161 1.00 28.87 ? 89  GLU C C   1 
ATOM   3379 O  O   . GLU C 1 89  ? 15.527  -15.400 130.137 1.00 29.58 ? 89  GLU C O   1 
ATOM   3380 C  CB  . GLU C 1 89  ? 16.997  -13.118 130.650 1.00 31.78 ? 89  GLU C CB  1 
ATOM   3381 C  CG  . GLU C 1 89  ? 16.177  -11.817 130.740 1.00 35.57 ? 89  GLU C CG  1 
ATOM   3382 C  CD  . GLU C 1 89  ? 16.938  -10.795 131.543 1.00 37.90 ? 89  GLU C CD  1 
ATOM   3383 O  OE1 . GLU C 1 89  ? 16.401  -9.762  131.922 1.00 39.85 ? 89  GLU C OE1 1 
ATOM   3384 O  OE2 . GLU C 1 89  ? 18.134  -11.119 131.756 1.00 39.13 ? 89  GLU C OE2 1 
ATOM   3385 N  N   . LEU C 1 90  ? 14.162  -14.462 131.641 1.00 28.08 ? 90  LEU C N   1 
ATOM   3386 C  CA  . LEU C 1 90  ? 12.956  -14.990 131.050 1.00 27.64 ? 90  LEU C CA  1 
ATOM   3387 C  C   . LEU C 1 90  ? 12.582  -14.467 129.697 1.00 27.41 ? 90  LEU C C   1 
ATOM   3388 O  O   . LEU C 1 90  ? 12.187  -13.254 129.733 1.00 27.32 ? 90  LEU C O   1 
ATOM   3389 C  CB  . LEU C 1 90  ? 11.854  -14.536 132.072 1.00 27.72 ? 90  LEU C CB  1 
ATOM   3390 C  CG  . LEU C 1 90  ? 11.770  -15.446 133.269 1.00 27.88 ? 90  LEU C CG  1 
ATOM   3391 C  CD1 . LEU C 1 90  ? 10.394  -15.385 133.907 1.00 27.89 ? 90  LEU C CD1 1 
ATOM   3392 C  CD2 . LEU C 1 90  ? 12.036  -16.875 132.780 1.00 27.77 ? 90  LEU C CD2 1 
ATOM   3393 N  N   . VAL C 1 91  ? 12.542  -15.147 128.573 1.00 26.70 ? 91  VAL C N   1 
ATOM   3394 C  CA  . VAL C 1 91  ? 12.102  -14.429 127.329 1.00 25.63 ? 91  VAL C CA  1 
ATOM   3395 C  C   . VAL C 1 91  ? 10.615  -14.258 127.185 1.00 24.92 ? 91  VAL C C   1 
ATOM   3396 O  O   . VAL C 1 91  ? 9.964   -14.717 126.239 1.00 24.80 ? 91  VAL C O   1 
ATOM   3397 C  CB  . VAL C 1 91  ? 12.743  -15.199 126.164 1.00 25.88 ? 91  VAL C CB  1 
ATOM   3398 C  CG1 . VAL C 1 91  ? 12.426  -14.552 124.827 1.00 26.12 ? 91  VAL C CG1 1 
ATOM   3399 C  CG2 . VAL C 1 91  ? 14.213  -15.373 126.466 1.00 25.62 ? 91  VAL C CG2 1 
ATOM   3400 N  N   . MET C 1 92  ? 10.014  -13.549 128.111 1.00 24.40 ? 92  MET C N   1 
ATOM   3401 C  CA  . MET C 1 92  ? 8.547   -13.219 128.130 1.00 22.44 ? 92  MET C CA  1 
ATOM   3402 C  C   . MET C 1 92  ? 8.502   -11.708 127.959 1.00 20.80 ? 92  MET C C   1 
ATOM   3403 O  O   . MET C 1 92  ? 9.493   -11.076 128.346 1.00 21.19 ? 92  MET C O   1 
ATOM   3404 C  CB  . MET C 1 92  ? 7.959   -13.741 129.349 1.00 22.68 ? 92  MET C CB  1 
ATOM   3405 C  CG  . MET C 1 92  ? 7.523   -12.753 130.368 1.00 23.49 ? 92  MET C CG  1 
ATOM   3406 S  SD  . MET C 1 92  ? 7.100   -13.959 131.784 1.00 24.77 ? 92  MET C SD  1 
ATOM   3407 C  CE  . MET C 1 92  ? 6.972   -12.711 133.053 1.00 25.17 ? 92  MET C CE  1 
ATOM   3408 N  N   . PRO C 1 93  ? 7.455   -11.183 127.410 1.00 19.69 ? 93  PRO C N   1 
ATOM   3409 C  CA  . PRO C 1 93  ? 7.348   -9.757  127.114 1.00 18.47 ? 93  PRO C CA  1 
ATOM   3410 C  C   . PRO C 1 93  ? 7.439   -8.821  128.260 1.00 17.55 ? 93  PRO C C   1 
ATOM   3411 O  O   . PRO C 1 93  ? 7.752   -7.629  128.023 1.00 17.60 ? 93  PRO C O   1 
ATOM   3412 C  CB  . PRO C 1 93  ? 5.981   -9.600  126.412 1.00 18.01 ? 93  PRO C CB  1 
ATOM   3413 C  CG  . PRO C 1 93  ? 5.248   -10.809 126.849 1.00 17.99 ? 93  PRO C CG  1 
ATOM   3414 C  CD  . PRO C 1 93  ? 6.273   -11.924 126.884 1.00 19.13 ? 93  PRO C CD  1 
ATOM   3415 N  N   . PHE C 1 94  ? 7.170   -9.250  129.449 1.00 16.84 ? 94  PHE C N   1 
ATOM   3416 C  CA  . PHE C 1 94  ? 7.196   -8.252  130.542 1.00 16.89 ? 94  PHE C CA  1 
ATOM   3417 C  C   . PHE C 1 94  ? 8.587   -7.913  130.948 1.00 17.14 ? 94  PHE C C   1 
ATOM   3418 O  O   . PHE C 1 94  ? 9.001   -6.859  131.414 1.00 17.65 ? 94  PHE C O   1 
ATOM   3419 C  CB  . PHE C 1 94  ? 6.434   -8.867  131.688 1.00 17.38 ? 94  PHE C CB  1 
ATOM   3420 C  CG  . PHE C 1 94  ? 6.377   -8.050  132.942 1.00 17.17 ? 94  PHE C CG  1 
ATOM   3421 C  CD1 . PHE C 1 94  ? 5.169   -7.454  133.287 1.00 17.11 ? 94  PHE C CD1 1 
ATOM   3422 C  CD2 . PHE C 1 94  ? 7.489   -7.876  133.747 1.00 16.95 ? 94  PHE C CD2 1 
ATOM   3423 C  CE1 . PHE C 1 94  ? 5.092   -6.698  134.434 1.00 17.20 ? 94  PHE C CE1 1 
ATOM   3424 C  CE2 . PHE C 1 94  ? 7.403   -7.109  134.909 1.00 16.64 ? 94  PHE C CE2 1 
ATOM   3425 C  CZ  . PHE C 1 94  ? 6.207   -6.528  135.256 1.00 16.43 ? 94  PHE C CZ  1 
ATOM   3426 N  N   . THR C 1 95  ? 9.231   -9.041  130.823 1.00 17.58 ? 95  THR C N   1 
ATOM   3427 C  CA  . THR C 1 95  ? 10.637  -9.155  131.145 1.00 18.00 ? 95  THR C CA  1 
ATOM   3428 C  C   . THR C 1 95  ? 11.526  -8.656  130.064 1.00 17.90 ? 95  THR C C   1 
ATOM   3429 O  O   . THR C 1 95  ? 12.652  -8.295  130.478 1.00 19.03 ? 95  THR C O   1 
ATOM   3430 C  CB  . THR C 1 95  ? 10.823  -10.682 131.475 1.00 18.15 ? 95  THR C CB  1 
ATOM   3431 O  OG1 . THR C 1 95  ? 10.419  -10.523 132.858 1.00 19.45 ? 95  THR C OG1 1 
ATOM   3432 C  CG2 . THR C 1 95  ? 12.179  -11.301 131.405 1.00 19.16 ? 95  THR C CG2 1 
ATOM   3433 N  N   . VAL C 1 96  ? 11.097  -8.645  128.819 1.00 17.30 ? 96  VAL C N   1 
ATOM   3434 C  CA  . VAL C 1 96  ? 12.043  -8.252  127.795 1.00 17.44 ? 96  VAL C CA  1 
ATOM   3435 C  C   . VAL C 1 96  ? 12.277  -6.778  127.705 1.00 18.07 ? 96  VAL C C   1 
ATOM   3436 O  O   . VAL C 1 96  ? 13.472  -6.521  127.473 1.00 18.92 ? 96  VAL C O   1 
ATOM   3437 C  CB  . VAL C 1 96  ? 11.667  -8.735  126.375 1.00 17.28 ? 96  VAL C CB  1 
ATOM   3438 C  CG1 . VAL C 1 96  ? 12.705  -8.300  125.391 1.00 16.11 ? 96  VAL C CG1 1 
ATOM   3439 C  CG2 . VAL C 1 96  ? 11.463  -10.222 126.387 1.00 18.46 ? 96  VAL C CG2 1 
ATOM   3440 N  N   . GLY C 1 97  ? 11.247  -6.006  127.835 1.00 18.81 ? 97  GLY C N   1 
ATOM   3441 C  CA  . GLY C 1 97  ? 11.483  -4.542  127.711 1.00 19.30 ? 97  GLY C CA  1 
ATOM   3442 C  C   . GLY C 1 97  ? 10.578  -3.737  128.597 1.00 19.52 ? 97  GLY C C   1 
ATOM   3443 O  O   . GLY C 1 97  ? 9.446   -4.080  128.936 1.00 19.53 ? 97  GLY C O   1 
ATOM   3444 N  N   . THR C 1 98  ? 11.103  -2.599  128.955 1.00 20.52 ? 98  THR C N   1 
ATOM   3445 C  CA  . THR C 1 98  ? 10.437  -1.605  129.801 1.00 21.37 ? 98  THR C CA  1 
ATOM   3446 C  C   . THR C 1 98  ? 9.262   -0.987  129.074 1.00 21.24 ? 98  THR C C   1 
ATOM   3447 O  O   . THR C 1 98  ? 8.287   -0.505  129.692 1.00 21.90 ? 98  THR C O   1 
ATOM   3448 C  CB  . THR C 1 98  ? 11.484  -0.534  130.252 1.00 21.91 ? 98  THR C CB  1 
ATOM   3449 O  OG1 . THR C 1 98  ? 12.670  -0.734  129.426 1.00 23.44 ? 98  THR C OG1 1 
ATOM   3450 C  CG2 . THR C 1 98  ? 11.861  -0.666  131.711 1.00 22.76 ? 98  THR C CG2 1 
ATOM   3451 N  N   . TRP C 1 99  ? 9.402   -0.993  127.756 1.00 20.40 ? 99  TRP C N   1 
ATOM   3452 C  CA  . TRP C 1 99  ? 8.313   -0.386  126.961 1.00 20.06 ? 99  TRP C CA  1 
ATOM   3453 C  C   . TRP C 1 99  ? 7.354   -1.531  126.685 1.00 19.86 ? 99  TRP C C   1 
ATOM   3454 O  O   . TRP C 1 99  ? 6.178   -1.465  127.097 1.00 20.59 ? 99  TRP C O   1 
ATOM   3455 C  CB  . TRP C 1 99  ? 8.856   0.313   125.744 1.00 19.75 ? 99  TRP C CB  1 
ATOM   3456 C  CG  . TRP C 1 99  ? 7.948   1.274   125.084 1.00 19.01 ? 99  TRP C CG  1 
ATOM   3457 C  CD1 . TRP C 1 99  ? 7.610   2.533   125.511 1.00 18.87 ? 99  TRP C CD1 1 
ATOM   3458 C  CD2 . TRP C 1 99  ? 7.215   1.061   123.880 1.00 19.01 ? 99  TRP C CD2 1 
ATOM   3459 N  NE1 . TRP C 1 99  ? 6.718   3.121   124.656 1.00 18.47 ? 99  TRP C NE1 1 
ATOM   3460 C  CE2 . TRP C 1 99  ? 6.462   2.250   123.638 1.00 18.88 ? 99  TRP C CE2 1 
ATOM   3461 C  CE3 . TRP C 1 99  ? 7.127   0.004   122.989 1.00 18.66 ? 99  TRP C CE3 1 
ATOM   3462 C  CZ2 . TRP C 1 99  ? 5.658   2.391   122.512 1.00 18.78 ? 99  TRP C CZ2 1 
ATOM   3463 C  CZ3 . TRP C 1 99  ? 6.314   0.155   121.863 1.00 18.63 ? 99  TRP C CZ3 1 
ATOM   3464 C  CH2 . TRP C 1 99  ? 5.609   1.324   121.633 1.00 18.70 ? 99  TRP C CH2 1 
ATOM   3465 N  N   . LEU C 1 100 ? 8.010   -2.492  126.020 1.00 18.58 ? 100 LEU C N   1 
ATOM   3466 C  CA  . LEU C 1 100 ? 7.207   -3.657  125.660 1.00 18.10 ? 100 LEU C CA  1 
ATOM   3467 C  C   . LEU C 1 100 ? 6.120   -3.946  126.699 1.00 18.37 ? 100 LEU C C   1 
ATOM   3468 O  O   . LEU C 1 100 ? 4.931   -3.857  126.362 1.00 19.28 ? 100 LEU C O   1 
ATOM   3469 C  CB  . LEU C 1 100 ? 8.074   -4.898  125.420 1.00 16.81 ? 100 LEU C CB  1 
ATOM   3470 C  CG  . LEU C 1 100 ? 7.182   -6.037  124.893 1.00 16.00 ? 100 LEU C CG  1 
ATOM   3471 C  CD1 . LEU C 1 100 ? 6.218   -5.491  123.851 1.00 16.16 ? 100 LEU C CD1 1 
ATOM   3472 C  CD2 . LEU C 1 100 ? 8.062   -7.109  124.295 1.00 15.80 ? 100 LEU C CD2 1 
ATOM   3473 N  N   . ARG C 1 101 ? 6.544   -4.278  127.873 1.00 18.73 ? 101 ARG C N   1 
ATOM   3474 C  CA  . ARG C 1 101 ? 5.646   -4.660  128.952 1.00 19.53 ? 101 ARG C CA  1 
ATOM   3475 C  C   . ARG C 1 101 ? 4.427   -3.767  129.125 1.00 18.53 ? 101 ARG C C   1 
ATOM   3476 O  O   . ARG C 1 101 ? 3.310   -4.256  129.360 1.00 17.40 ? 101 ARG C O   1 
ATOM   3477 C  CB  . ARG C 1 101 ? 6.475   -4.718  130.269 1.00 21.28 ? 101 ARG C CB  1 
ATOM   3478 C  CG  . ARG C 1 101 ? 6.266   -3.378  130.971 1.00 23.41 ? 101 ARG C CG  1 
ATOM   3479 C  CD  . ARG C 1 101 ? 7.328   -3.067  131.906 1.00 24.92 ? 101 ARG C CD  1 
ATOM   3480 N  NE  . ARG C 1 101 ? 7.526   -4.147  132.853 1.00 26.13 ? 101 ARG C NE  1 
ATOM   3481 C  CZ  . ARG C 1 101 ? 8.753   -4.416  133.246 1.00 27.76 ? 101 ARG C CZ  1 
ATOM   3482 N  NH1 . ARG C 1 101 ? 9.901   -4.514  132.614 1.00 28.64 ? 101 ARG C NH1 1 
ATOM   3483 N  NH2 . ARG C 1 101 ? 8.882   -4.349  134.598 1.00 29.39 ? 101 ARG C NH2 1 
ATOM   3484 N  N   . GLY C 1 102 ? 4.638   -2.466  129.032 1.00 17.77 ? 102 GLY C N   1 
ATOM   3485 C  CA  . GLY C 1 102 ? 3.599   -1.485  129.181 1.00 16.85 ? 102 GLY C CA  1 
ATOM   3486 C  C   . GLY C 1 102 ? 2.579   -1.547  128.037 1.00 16.63 ? 102 GLY C C   1 
ATOM   3487 O  O   . GLY C 1 102 ? 1.386   -1.249  128.371 1.00 16.55 ? 102 GLY C O   1 
ATOM   3488 N  N   . VAL C 1 103 ? 2.995   -1.893  126.824 1.00 15.83 ? 103 VAL C N   1 
ATOM   3489 C  CA  . VAL C 1 103 ? 2.011   -1.921  125.727 1.00 15.73 ? 103 VAL C CA  1 
ATOM   3490 C  C   . VAL C 1 103 ? 1.362   -3.290  125.573 1.00 16.79 ? 103 VAL C C   1 
ATOM   3491 O  O   . VAL C 1 103 ? 0.115   -3.525  125.554 1.00 15.98 ? 103 VAL C O   1 
ATOM   3492 C  CB  . VAL C 1 103 ? 2.663   -1.356  124.410 1.00 14.86 ? 103 VAL C CB  1 
ATOM   3493 C  CG1 . VAL C 1 103 ? 4.023   -0.712  124.675 1.00 14.45 ? 103 VAL C CG1 1 
ATOM   3494 C  CG2 . VAL C 1 103 ? 2.729   -2.327  123.284 1.00 13.17 ? 103 VAL C CG2 1 
ATOM   3495 N  N   . ALA C 1 104 ? 2.271   -4.238  125.435 1.00 18.09 ? 104 ALA C N   1 
ATOM   3496 C  CA  . ALA C 1 104 ? 1.953   -5.661  125.236 1.00 19.05 ? 104 ALA C CA  1 
ATOM   3497 C  C   . ALA C 1 104 ? 0.921   -6.179  126.224 1.00 19.54 ? 104 ALA C C   1 
ATOM   3498 O  O   . ALA C 1 104 ? 0.220   -7.183  126.080 1.00 18.53 ? 104 ALA C O   1 
ATOM   3499 C  CB  . ALA C 1 104 ? 3.290   -6.394  125.332 1.00 18.96 ? 104 ALA C CB  1 
ATOM   3500 N  N   . GLN C 1 105 ? 0.860   -5.426  127.315 1.00 21.17 ? 105 GLN C N   1 
ATOM   3501 C  CA  . GLN C 1 105 ? -0.042  -5.722  128.444 1.00 22.36 ? 105 GLN C CA  1 
ATOM   3502 C  C   . GLN C 1 105 ? -1.502  -5.430  128.148 1.00 21.72 ? 105 GLN C C   1 
ATOM   3503 O  O   . GLN C 1 105 ? -2.373  -5.895  128.915 1.00 21.69 ? 105 GLN C O   1 
ATOM   3504 C  CB  . GLN C 1 105 ? 0.407   -4.933  129.667 1.00 24.20 ? 105 GLN C CB  1 
ATOM   3505 C  CG  . GLN C 1 105 ? -0.487  -5.034  130.857 1.00 27.08 ? 105 GLN C CG  1 
ATOM   3506 C  CD  . GLN C 1 105 ? 0.057   -4.474  132.151 1.00 28.61 ? 105 GLN C CD  1 
ATOM   3507 O  OE1 . GLN C 1 105 ? -0.259  -4.999  133.235 1.00 29.64 ? 105 GLN C OE1 1 
ATOM   3508 N  NE2 . GLN C 1 105 ? 0.859   -3.393  132.070 1.00 29.22 ? 105 GLN C NE2 1 
ATOM   3509 N  N   . ASN C 1 106 ? -1.750  -4.683  127.077 1.00 20.91 ? 106 ASN C N   1 
ATOM   3510 C  CA  . ASN C 1 106 ? -3.140  -4.336  126.723 1.00 19.33 ? 106 ASN C CA  1 
ATOM   3511 C  C   . ASN C 1 106 ? -3.802  -5.470  125.941 1.00 18.49 ? 106 ASN C C   1 
ATOM   3512 O  O   . ASN C 1 106 ? -4.998  -5.334  125.583 1.00 18.20 ? 106 ASN C O   1 
ATOM   3513 C  CB  . ASN C 1 106 ? -3.166  -3.027  125.959 1.00 19.29 ? 106 ASN C CB  1 
ATOM   3514 C  CG  . ASN C 1 106 ? -2.922  -1.855  126.898 1.00 18.87 ? 106 ASN C CG  1 
ATOM   3515 O  OD1 . ASN C 1 106 ? -1.769  -1.437  126.987 1.00 18.04 ? 106 ASN C OD1 1 
ATOM   3516 N  ND2 . ASN C 1 106 ? -4.018  -1.396  127.551 1.00 19.69 ? 106 ASN C ND2 1 
ATOM   3517 N  N   . TRP C 1 107 ? -3.018  -6.525  125.751 1.00 17.25 ? 107 TRP C N   1 
ATOM   3518 C  CA  . TRP C 1 107 ? -3.515  -7.668  124.968 1.00 16.49 ? 107 TRP C CA  1 
ATOM   3519 C  C   . TRP C 1 107 ? -3.443  -9.009  125.613 1.00 16.07 ? 107 TRP C C   1 
ATOM   3520 O  O   . TRP C 1 107 ? -2.346  -9.254  126.172 1.00 17.25 ? 107 TRP C O   1 
ATOM   3521 C  CB  . TRP C 1 107 ? -2.601  -7.668  123.726 1.00 16.24 ? 107 TRP C CB  1 
ATOM   3522 C  CG  . TRP C 1 107 ? -2.997  -6.874  122.561 1.00 15.23 ? 107 TRP C CG  1 
ATOM   3523 C  CD1 . TRP C 1 107 ? -3.859  -7.243  121.560 1.00 15.31 ? 107 TRP C CD1 1 
ATOM   3524 C  CD2 . TRP C 1 107 ? -2.532  -5.559  122.239 1.00 14.61 ? 107 TRP C CD2 1 
ATOM   3525 N  NE1 . TRP C 1 107 ? -3.952  -6.235  120.617 1.00 15.11 ? 107 TRP C NE1 1 
ATOM   3526 C  CE2 . TRP C 1 107 ? -3.160  -5.189  121.033 1.00 14.84 ? 107 TRP C CE2 1 
ATOM   3527 C  CE3 . TRP C 1 107 ? -1.653  -4.695  122.851 1.00 14.20 ? 107 TRP C CE3 1 
ATOM   3528 C  CZ2 . TRP C 1 107 ? -2.929  -3.967  120.408 1.00 14.47 ? 107 TRP C CZ2 1 
ATOM   3529 C  CZ3 . TRP C 1 107 ? -1.420  -3.497  122.223 1.00 14.16 ? 107 TRP C CZ3 1 
ATOM   3530 C  CH2 . TRP C 1 107 ? -2.046  -3.132  121.040 1.00 14.11 ? 107 TRP C CH2 1 
ATOM   3531 N  N   . SER C 1 108 ? -4.401  -9.887  125.502 1.00 15.49 ? 108 SER C N   1 
ATOM   3532 C  CA  . SER C 1 108 ? -4.348  -11.190 126.187 1.00 15.29 ? 108 SER C CA  1 
ATOM   3533 C  C   . SER C 1 108 ? -3.216  -12.134 125.916 1.00 15.10 ? 108 SER C C   1 
ATOM   3534 O  O   . SER C 1 108 ? -2.578  -12.626 126.914 1.00 14.97 ? 108 SER C O   1 
ATOM   3535 C  CB  . SER C 1 108 ? -5.672  -11.934 125.895 1.00 15.39 ? 108 SER C CB  1 
ATOM   3536 O  OG  . SER C 1 108 ? -6.658  -11.430 126.820 1.00 16.22 ? 108 SER C OG  1 
ATOM   3537 N  N   . LYS C 1 109 ? -2.917  -12.485 124.701 1.00 15.20 ? 109 LYS C N   1 
ATOM   3538 C  CA  . LYS C 1 109 ? -1.822  -13.485 124.508 1.00 15.11 ? 109 LYS C CA  1 
ATOM   3539 C  C   . LYS C 1 109 ? -1.038  -13.084 123.276 1.00 14.61 ? 109 LYS C C   1 
ATOM   3540 O  O   . LYS C 1 109 ? -1.775  -12.574 122.429 1.00 15.87 ? 109 LYS C O   1 
ATOM   3541 C  CB  . LYS C 1 109 ? -2.327  -14.868 124.283 1.00 14.74 ? 109 LYS C CB  1 
ATOM   3542 C  CG  . LYS C 1 109 ? -3.397  -15.492 125.113 1.00 13.77 ? 109 LYS C CG  1 
ATOM   3543 C  CD  . LYS C 1 109 ? -3.658  -16.921 124.560 1.00 13.57 ? 109 LYS C CD  1 
ATOM   3544 C  CE  . LYS C 1 109 ? -4.764  -16.933 123.534 1.00 13.24 ? 109 LYS C CE  1 
ATOM   3545 N  NZ  . LYS C 1 109 ? -5.628  -18.148 123.783 1.00 13.67 ? 109 LYS C NZ  1 
ATOM   3546 N  N   . TYR C 1 110 ? 0.215   -13.314 123.203 1.00 13.47 ? 110 TYR C N   1 
ATOM   3547 C  CA  . TYR C 1 110 ? 1.078   -13.008 122.134 1.00 13.27 ? 110 TYR C CA  1 
ATOM   3548 C  C   . TYR C 1 110 ? 1.722   -14.300 121.616 1.00 12.94 ? 110 TYR C C   1 
ATOM   3549 O  O   . TYR C 1 110 ? 1.481   -15.345 122.188 1.00 12.04 ? 110 TYR C O   1 
ATOM   3550 C  CB  . TYR C 1 110 ? 2.323   -12.133 122.526 1.00 13.79 ? 110 TYR C CB  1 
ATOM   3551 C  CG  . TYR C 1 110 ? 3.071   -12.909 123.607 1.00 14.72 ? 110 TYR C CG  1 
ATOM   3552 C  CD1 . TYR C 1 110 ? 4.140   -13.742 123.398 1.00 15.59 ? 110 TYR C CD1 1 
ATOM   3553 C  CD2 . TYR C 1 110 ? 2.580   -12.841 124.909 1.00 15.20 ? 110 TYR C CD2 1 
ATOM   3554 C  CE1 . TYR C 1 110 ? 4.747   -14.452 124.456 1.00 16.33 ? 110 TYR C CE1 1 
ATOM   3555 C  CE2 . TYR C 1 110 ? 3.155   -13.554 125.937 1.00 16.00 ? 110 TYR C CE2 1 
ATOM   3556 C  CZ  . TYR C 1 110 ? 4.260   -14.358 125.727 1.00 16.23 ? 110 TYR C CZ  1 
ATOM   3557 O  OH  . TYR C 1 110 ? 4.763   -15.001 126.847 1.00 17.10 ? 110 TYR C OH  1 
ATOM   3558 N  N   . ALA C 1 111 ? 2.556   -14.013 120.642 1.00 13.51 ? 111 ALA C N   1 
ATOM   3559 C  CA  . ALA C 1 111 ? 3.404   -15.040 120.033 1.00 14.28 ? 111 ALA C CA  1 
ATOM   3560 C  C   . ALA C 1 111 ? 4.688   -14.344 119.574 1.00 14.37 ? 111 ALA C C   1 
ATOM   3561 O  O   . ALA C 1 111 ? 4.487   -13.284 118.914 1.00 14.25 ? 111 ALA C O   1 
ATOM   3562 C  CB  . ALA C 1 111 ? 2.675   -15.720 118.916 1.00 14.71 ? 111 ALA C CB  1 
ATOM   3563 N  N   . TRP C 1 112 ? 5.841   -14.879 119.863 1.00 14.54 ? 112 TRP C N   1 
ATOM   3564 C  CA  . TRP C 1 112 ? 7.080   -14.260 119.375 1.00 15.34 ? 112 TRP C CA  1 
ATOM   3565 C  C   . TRP C 1 112 ? 7.221   -14.524 117.881 1.00 15.34 ? 112 TRP C C   1 
ATOM   3566 O  O   . TRP C 1 112 ? 6.711   -15.626 117.516 1.00 16.63 ? 112 TRP C O   1 
ATOM   3567 C  CB  . TRP C 1 112 ? 8.336   -14.842 119.987 1.00 16.10 ? 112 TRP C CB  1 
ATOM   3568 C  CG  . TRP C 1 112 ? 8.547   -14.441 121.395 1.00 17.26 ? 112 TRP C CG  1 
ATOM   3569 C  CD1 . TRP C 1 112 ? 8.537   -15.240 122.481 1.00 17.19 ? 112 TRP C CD1 1 
ATOM   3570 C  CD2 . TRP C 1 112 ? 8.755   -13.100 121.873 1.00 18.37 ? 112 TRP C CD2 1 
ATOM   3571 N  NE1 . TRP C 1 112 ? 8.735   -14.507 123.611 1.00 18.00 ? 112 TRP C NE1 1 
ATOM   3572 C  CE2 . TRP C 1 112 ? 8.886   -13.192 123.276 1.00 18.77 ? 112 TRP C CE2 1 
ATOM   3573 C  CE3 . TRP C 1 112 ? 8.852   -11.842 121.279 1.00 18.56 ? 112 TRP C CE3 1 
ATOM   3574 C  CZ2 . TRP C 1 112 ? 9.125   -12.059 124.071 1.00 19.07 ? 112 TRP C CZ2 1 
ATOM   3575 C  CZ3 . TRP C 1 112 ? 9.068   -10.740 122.073 1.00 18.20 ? 112 TRP C CZ3 1 
ATOM   3576 C  CH2 . TRP C 1 112 ? 9.209   -10.837 123.435 1.00 18.44 ? 112 TRP C CH2 1 
ATOM   3577 N  N   . VAL C 1 113 ? 7.842   -13.701 117.115 1.00 14.30 ? 113 VAL C N   1 
ATOM   3578 C  CA  . VAL C 1 113 ? 8.017   -13.885 115.675 1.00 13.50 ? 113 VAL C CA  1 
ATOM   3579 C  C   . VAL C 1 113 ? 9.514   -13.836 115.407 1.00 13.44 ? 113 VAL C C   1 
ATOM   3580 O  O   . VAL C 1 113 ? 10.150  -14.329 114.496 1.00 13.10 ? 113 VAL C O   1 
ATOM   3581 C  CB  . VAL C 1 113 ? 7.287   -12.791 114.891 1.00 13.89 ? 113 VAL C CB  1 
ATOM   3582 C  CG1 . VAL C 1 113 ? 7.433   -12.988 113.383 1.00 13.30 ? 113 VAL C CG1 1 
ATOM   3583 C  CG2 . VAL C 1 113 ? 5.819   -12.607 115.233 1.00 13.36 ? 113 VAL C CG2 1 
ATOM   3584 N  N   . ALA C 1 114 ? 10.130  -13.123 116.356 1.00 13.66 ? 114 ALA C N   1 
ATOM   3585 C  CA  . ALA C 1 114 ? 11.538  -12.887 116.444 1.00 13.22 ? 114 ALA C CA  1 
ATOM   3586 C  C   . ALA C 1 114 ? 11.999  -12.224 117.728 1.00 14.06 ? 114 ALA C C   1 
ATOM   3587 O  O   . ALA C 1 114 ? 11.327  -11.203 118.110 1.00 15.01 ? 114 ALA C O   1 
ATOM   3588 C  CB  . ALA C 1 114 ? 11.896  -11.900 115.341 1.00 13.16 ? 114 ALA C CB  1 
ATOM   3589 N  N   . ILE C 1 115 ? 13.077  -12.711 118.275 1.00 13.39 ? 115 ILE C N   1 
ATOM   3590 C  CA  . ILE C 1 115 ? 13.660  -12.137 119.474 1.00 12.86 ? 115 ILE C CA  1 
ATOM   3591 C  C   . ILE C 1 115 ? 15.137  -12.458 119.361 1.00 14.35 ? 115 ILE C C   1 
ATOM   3592 O  O   . ILE C 1 115 ? 15.671  -13.580 119.180 1.00 13.86 ? 115 ILE C O   1 
ATOM   3593 C  CB  . ILE C 1 115 ? 12.924  -12.667 120.714 1.00 12.74 ? 115 ILE C CB  1 
ATOM   3594 C  CG1 . ILE C 1 115 ? 13.716  -12.149 121.984 1.00 12.73 ? 115 ILE C CG1 1 
ATOM   3595 C  CG2 . ILE C 1 115 ? 12.726  -14.171 120.801 1.00 12.41 ? 115 ILE C CG2 1 
ATOM   3596 C  CD1 . ILE C 1 115 ? 12.698  -11.219 122.714 1.00 13.78 ? 115 ILE C CD1 1 
ATOM   3597 N  N   . ARG C 1 116 ? 15.846  -11.344 119.466 1.00 16.22 ? 116 ARG C N   1 
ATOM   3598 C  CA  . ARG C 1 116 ? 17.313  -11.330 119.367 1.00 16.46 ? 116 ARG C CA  1 
ATOM   3599 C  C   . ARG C 1 116 ? 17.998  -10.602 120.487 1.00 16.34 ? 116 ARG C C   1 
ATOM   3600 O  O   . ARG C 1 116 ? 17.620  -9.473  120.892 1.00 17.15 ? 116 ARG C O   1 
ATOM   3601 C  CB  . ARG C 1 116 ? 17.713  -10.637 118.052 1.00 16.68 ? 116 ARG C CB  1 
ATOM   3602 C  CG  . ARG C 1 116 ? 19.031  -11.191 117.589 1.00 17.14 ? 116 ARG C CG  1 
ATOM   3603 C  CD  . ARG C 1 116 ? 19.294  -10.687 116.202 1.00 17.19 ? 116 ARG C CD  1 
ATOM   3604 N  NE  . ARG C 1 116 ? 20.296  -11.575 115.609 1.00 17.51 ? 116 ARG C NE  1 
ATOM   3605 C  CZ  . ARG C 1 116 ? 19.990  -12.517 114.716 1.00 17.60 ? 116 ARG C CZ  1 
ATOM   3606 N  NH1 . ARG C 1 116 ? 18.751  -12.732 114.291 1.00 17.70 ? 116 ARG C NH1 1 
ATOM   3607 N  NH2 . ARG C 1 116 ? 21.001  -13.251 114.204 1.00 18.13 ? 116 ARG C NH2 1 
ATOM   3608 N  N   . TYR C 1 117 ? 19.025  -11.264 120.947 1.00 16.02 ? 117 TYR C N   1 
ATOM   3609 C  CA  . TYR C 1 117 ? 19.854  -10.662 122.055 1.00 15.13 ? 117 TYR C CA  1 
ATOM   3610 C  C   . TYR C 1 117 ? 21.177  -10.388 121.343 1.00 14.58 ? 117 TYR C C   1 
ATOM   3611 O  O   . TYR C 1 117 ? 21.804  -11.285 120.732 1.00 15.28 ? 117 TYR C O   1 
ATOM   3612 C  CB  . TYR C 1 117 ? 19.853  -11.519 123.277 1.00 14.43 ? 117 TYR C CB  1 
ATOM   3613 C  CG  . TYR C 1 117 ? 18.531  -11.581 124.040 1.00 14.10 ? 117 TYR C CG  1 
ATOM   3614 C  CD1 . TYR C 1 117 ? 17.649  -12.636 123.846 1.00 13.90 ? 117 TYR C CD1 1 
ATOM   3615 C  CD2 . TYR C 1 117 ? 18.146  -10.612 124.966 1.00 13.98 ? 117 TYR C CD2 1 
ATOM   3616 C  CE1 . TYR C 1 117 ? 16.442  -12.752 124.530 1.00 13.71 ? 117 TYR C CE1 1 
ATOM   3617 C  CE2 . TYR C 1 117 ? 16.940  -10.714 125.656 1.00 14.02 ? 117 TYR C CE2 1 
ATOM   3618 C  CZ  . TYR C 1 117 ? 16.090  -11.787 125.430 1.00 14.26 ? 117 TYR C CZ  1 
ATOM   3619 O  OH  . TYR C 1 117 ? 14.888  -11.835 126.126 1.00 15.84 ? 117 TYR C OH  1 
ATOM   3620 N  N   . THR C 1 118 ? 21.536  -9.133  121.376 1.00 13.71 ? 118 THR C N   1 
ATOM   3621 C  CA  . THR C 1 118 ? 22.844  -8.817  120.683 1.00 13.77 ? 118 THR C CA  1 
ATOM   3622 C  C   . THR C 1 118 ? 23.520  -7.907  121.668 1.00 14.58 ? 118 THR C C   1 
ATOM   3623 O  O   . THR C 1 118 ? 22.886  -7.124  122.379 1.00 14.45 ? 118 THR C O   1 
ATOM   3624 C  CB  . THR C 1 118 ? 22.493  -8.425  119.239 1.00 13.83 ? 118 THR C CB  1 
ATOM   3625 O  OG1 . THR C 1 118 ? 23.458  -7.406  118.833 1.00 13.27 ? 118 THR C OG1 1 
ATOM   3626 C  CG2 . THR C 1 118 ? 20.995  -7.989  119.096 1.00 13.80 ? 118 THR C CG2 1 
ATOM   3627 N  N   . TYR C 1 119 ? 24.799  -8.079  121.797 1.00 15.86 ? 119 TYR C N   1 
ATOM   3628 C  CA  . TYR C 1 119 ? 25.732  -7.451  122.684 1.00 16.87 ? 119 TYR C CA  1 
ATOM   3629 C  C   . TYR C 1 119 ? 26.645  -6.367  122.212 1.00 17.14 ? 119 TYR C C   1 
ATOM   3630 O  O   . TYR C 1 119 ? 26.979  -6.527  120.977 1.00 18.48 ? 119 TYR C O   1 
ATOM   3631 C  CB  . TYR C 1 119 ? 26.695  -8.693  123.020 1.00 16.76 ? 119 TYR C CB  1 
ATOM   3632 C  CG  . TYR C 1 119 ? 27.819  -8.159  123.902 1.00 16.69 ? 119 TYR C CG  1 
ATOM   3633 C  CD1 . TYR C 1 119 ? 28.974  -7.640  123.343 1.00 16.97 ? 119 TYR C CD1 1 
ATOM   3634 C  CD2 . TYR C 1 119 ? 27.683  -8.176  125.288 1.00 16.49 ? 119 TYR C CD2 1 
ATOM   3635 C  CE1 . TYR C 1 119 ? 30.008  -7.144  124.146 1.00 16.71 ? 119 TYR C CE1 1 
ATOM   3636 C  CE2 . TYR C 1 119 ? 28.690  -7.703  126.111 1.00 16.34 ? 119 TYR C CE2 1 
ATOM   3637 C  CZ  . TYR C 1 119 ? 29.849  -7.185  125.542 1.00 16.01 ? 119 TYR C CZ  1 
ATOM   3638 O  OH  . TYR C 1 119 ? 30.819  -6.704  126.314 1.00 14.73 ? 119 TYR C OH  1 
ATOM   3639 N  N   . LEU C 1 120 ? 27.135  -5.419  122.976 1.00 16.08 ? 120 LEU C N   1 
ATOM   3640 C  CA  . LEU C 1 120 ? 28.081  -4.417  122.318 1.00 15.59 ? 120 LEU C CA  1 
ATOM   3641 C  C   . LEU C 1 120 ? 29.039  -3.988  123.420 1.00 16.00 ? 120 LEU C C   1 
ATOM   3642 O  O   . LEU C 1 120 ? 28.706  -3.762  124.576 1.00 16.07 ? 120 LEU C O   1 
ATOM   3643 C  CB  . LEU C 1 120 ? 27.320  -3.376  121.626 1.00 15.69 ? 120 LEU C CB  1 
ATOM   3644 C  CG  . LEU C 1 120 ? 26.298  -3.627  120.553 1.00 16.15 ? 120 LEU C CG  1 
ATOM   3645 C  CD1 . LEU C 1 120 ? 25.234  -2.519  120.496 1.00 15.74 ? 120 LEU C CD1 1 
ATOM   3646 C  CD2 . LEU C 1 120 ? 26.997  -3.663  119.182 1.00 16.44 ? 120 LEU C CD2 1 
ATOM   3647 N  N   . PRO C 1 121 ? 30.280  -3.919  123.026 1.00 16.48 ? 121 PRO C N   1 
ATOM   3648 C  CA  . PRO C 1 121 ? 31.357  -3.627  123.957 1.00 17.42 ? 121 PRO C CA  1 
ATOM   3649 C  C   . PRO C 1 121 ? 31.457  -2.195  124.332 1.00 18.80 ? 121 PRO C C   1 
ATOM   3650 O  O   . PRO C 1 121 ? 30.969  -1.317  123.614 1.00 19.40 ? 121 PRO C O   1 
ATOM   3651 C  CB  . PRO C 1 121 ? 32.570  -4.192  123.181 1.00 17.25 ? 121 PRO C CB  1 
ATOM   3652 C  CG  . PRO C 1 121 ? 32.242  -3.694  121.796 1.00 16.52 ? 121 PRO C CG  1 
ATOM   3653 C  CD  . PRO C 1 121 ? 30.785  -4.175  121.672 1.00 16.58 ? 121 PRO C CD  1 
ATOM   3654 N  N   . SER C 1 122 ? 32.092  -1.997  125.485 1.00 20.18 ? 122 SER C N   1 
ATOM   3655 C  CA  . SER C 1 122 ? 32.336  -0.662  126.010 1.00 22.04 ? 122 SER C CA  1 
ATOM   3656 C  C   . SER C 1 122 ? 33.794  -0.480  126.465 1.00 22.98 ? 122 SER C C   1 
ATOM   3657 O  O   . SER C 1 122 ? 34.256  0.695   126.499 1.00 25.51 ? 122 SER C O   1 
ATOM   3658 C  CB  . SER C 1 122 ? 31.462  -0.187  127.198 1.00 21.47 ? 122 SER C CB  1 
ATOM   3659 O  OG  . SER C 1 122 ? 30.603  0.733   126.513 1.00 20.95 ? 122 SER C OG  1 
ATOM   3660 N  N   . CYS C 1 123 ? 34.463  -1.512  126.809 1.00 22.45 ? 123 CYS C N   1 
ATOM   3661 C  CA  . CYS C 1 123 ? 35.827  -1.503  127.254 1.00 21.89 ? 123 CYS C CA  1 
ATOM   3662 C  C   . CYS C 1 123 ? 36.792  -1.686  126.114 1.00 21.57 ? 123 CYS C C   1 
ATOM   3663 O  O   . CYS C 1 123 ? 36.425  -2.216  125.050 1.00 22.43 ? 123 CYS C O   1 
ATOM   3664 C  CB  . CYS C 1 123 ? 35.998  -2.700  128.197 1.00 22.37 ? 123 CYS C CB  1 
ATOM   3665 S  SG  . CYS C 1 123 ? 35.073  -4.139  127.471 1.00 23.15 ? 123 CYS C SG  1 
ATOM   3666 N  N   . PRO C 1 124 ? 38.006  -1.323  126.377 1.00 20.96 ? 124 PRO C N   1 
ATOM   3667 C  CA  . PRO C 1 124 ? 39.104  -1.465  125.405 1.00 21.13 ? 124 PRO C CA  1 
ATOM   3668 C  C   . PRO C 1 124 ? 39.507  -2.892  125.208 1.00 20.92 ? 124 PRO C C   1 
ATOM   3669 O  O   . PRO C 1 124 ? 39.287  -3.715  126.095 1.00 20.92 ? 124 PRO C O   1 
ATOM   3670 C  CB  . PRO C 1 124 ? 40.187  -0.585  126.030 1.00 21.20 ? 124 PRO C CB  1 
ATOM   3671 C  CG  . PRO C 1 124 ? 39.981  -0.968  127.479 1.00 21.17 ? 124 PRO C CG  1 
ATOM   3672 C  CD  . PRO C 1 124 ? 38.465  -0.725  127.633 1.00 20.78 ? 124 PRO C CD  1 
ATOM   3673 N  N   . THR C 1 125 ? 40.084  -3.229  124.104 1.00 21.47 ? 125 THR C N   1 
ATOM   3674 C  CA  . THR C 1 125 ? 40.541  -4.567  123.733 1.00 22.25 ? 125 THR C CA  1 
ATOM   3675 C  C   . THR C 1 125 ? 41.705  -4.946  124.601 1.00 23.57 ? 125 THR C C   1 
ATOM   3676 O  O   . THR C 1 125 ? 42.700  -5.446  124.038 1.00 24.82 ? 125 THR C O   1 
ATOM   3677 C  CB  . THR C 1 125 ? 40.957  -4.562  122.226 1.00 21.62 ? 125 THR C CB  1 
ATOM   3678 O  OG1 . THR C 1 125 ? 41.204  -3.148  121.906 1.00 21.34 ? 125 THR C OG1 1 
ATOM   3679 C  CG2 . THR C 1 125 ? 39.933  -5.063  121.246 1.00 21.60 ? 125 THR C CG2 1 
ATOM   3680 N  N   . THR C 1 126 ? 41.652  -4.667  125.874 1.00 23.86 ? 126 THR C N   1 
ATOM   3681 C  CA  . THR C 1 126 ? 42.744  -4.935  126.814 1.00 23.48 ? 126 THR C CA  1 
ATOM   3682 C  C   . THR C 1 126 ? 42.072  -5.564  128.035 1.00 23.56 ? 126 THR C C   1 
ATOM   3683 O  O   . THR C 1 126 ? 42.733  -6.171  128.879 1.00 24.28 ? 126 THR C O   1 
ATOM   3684 C  CB  . THR C 1 126 ? 43.632  -3.712  127.211 1.00 23.80 ? 126 THR C CB  1 
ATOM   3685 O  OG1 . THR C 1 126 ? 42.693  -2.708  127.774 1.00 24.71 ? 126 THR C OG1 1 
ATOM   3686 C  CG2 . THR C 1 126 ? 44.473  -3.039  126.139 1.00 22.83 ? 126 THR C CG2 1 
ATOM   3687 N  N   . THR C 1 127 ? 40.765  -5.404  128.040 1.00 23.10 ? 127 THR C N   1 
ATOM   3688 C  CA  . THR C 1 127 ? 39.907  -5.967  129.136 1.00 22.52 ? 127 THR C CA  1 
ATOM   3689 C  C   . THR C 1 127 ? 39.945  -7.468  129.026 1.00 22.62 ? 127 THR C C   1 
ATOM   3690 O  O   . THR C 1 127 ? 39.975  -8.001  127.881 1.00 23.17 ? 127 THR C O   1 
ATOM   3691 C  CB  . THR C 1 127 ? 38.516  -5.288  129.030 1.00 22.19 ? 127 THR C CB  1 
ATOM   3692 O  OG1 . THR C 1 127 ? 38.717  -4.118  128.115 1.00 22.12 ? 127 THR C OG1 1 
ATOM   3693 C  CG2 . THR C 1 127 ? 37.877  -4.745  130.287 1.00 21.92 ? 127 THR C CG2 1 
ATOM   3694 N  N   . SER C 1 128 ? 39.998  -8.225  130.102 1.00 22.90 ? 128 SER C N   1 
ATOM   3695 C  CA  . SER C 1 128 ? 40.092  -9.703  130.045 1.00 22.42 ? 128 SER C CA  1 
ATOM   3696 C  C   . SER C 1 128 ? 38.733  -10.303 130.394 1.00 22.30 ? 128 SER C C   1 
ATOM   3697 O  O   . SER C 1 128 ? 38.102  -9.706  131.266 1.00 22.15 ? 128 SER C O   1 
ATOM   3698 C  CB  . SER C 1 128 ? 41.085  -10.342 130.989 1.00 22.08 ? 128 SER C CB  1 
ATOM   3699 O  OG  . SER C 1 128 ? 42.226  -9.601  131.291 1.00 21.47 ? 128 SER C OG  1 
ATOM   3700 N  N   . GLY C 1 129 ? 38.429  -11.406 129.746 1.00 22.54 ? 129 GLY C N   1 
ATOM   3701 C  CA  . GLY C 1 129 ? 37.127  -12.053 130.057 1.00 22.63 ? 129 GLY C CA  1 
ATOM   3702 C  C   . GLY C 1 129 ? 36.214  -12.152 128.855 1.00 21.94 ? 129 GLY C C   1 
ATOM   3703 O  O   . GLY C 1 129 ? 36.147  -11.181 128.095 1.00 21.88 ? 129 GLY C O   1 
ATOM   3704 N  N   . ALA C 1 130 ? 35.542  -13.307 128.762 1.00 21.40 ? 130 ALA C N   1 
ATOM   3705 C  CA  . ALA C 1 130 ? 34.635  -13.339 127.543 1.00 21.51 ? 130 ALA C CA  1 
ATOM   3706 C  C   . ALA C 1 130 ? 33.183  -13.458 127.995 1.00 20.81 ? 130 ALA C C   1 
ATOM   3707 O  O   . ALA C 1 130 ? 32.865  -13.383 129.218 1.00 20.99 ? 130 ALA C O   1 
ATOM   3708 C  CB  . ALA C 1 130 ? 35.135  -14.386 126.606 1.00 22.51 ? 130 ALA C CB  1 
ATOM   3709 N  N   . ILE C 1 131 ? 32.311  -13.614 126.983 1.00 18.92 ? 131 ILE C N   1 
ATOM   3710 C  CA  . ILE C 1 131 ? 30.878  -13.730 127.319 1.00 16.92 ? 131 ILE C CA  1 
ATOM   3711 C  C   . ILE C 1 131 ? 30.331  -14.964 126.603 1.00 15.31 ? 131 ILE C C   1 
ATOM   3712 O  O   . ILE C 1 131 ? 30.880  -15.373 125.588 1.00 14.11 ? 131 ILE C O   1 
ATOM   3713 C  CB  . ILE C 1 131 ? 30.050  -12.459 127.007 1.00 16.73 ? 131 ILE C CB  1 
ATOM   3714 C  CG1 . ILE C 1 131 ? 28.549  -12.661 127.351 1.00 16.46 ? 131 ILE C CG1 1 
ATOM   3715 C  CG2 . ILE C 1 131 ? 30.120  -12.001 125.524 1.00 16.76 ? 131 ILE C CG2 1 
ATOM   3716 C  CD1 . ILE C 1 131 ? 27.649  -11.491 126.882 1.00 15.62 ? 131 ILE C CD1 1 
ATOM   3717 N  N   . HIS C 1 132 ? 29.265  -15.449 127.245 1.00 13.99 ? 132 HIS C N   1 
ATOM   3718 C  CA  . HIS C 1 132 ? 28.602  -16.603 126.712 1.00 13.35 ? 132 HIS C CA  1 
ATOM   3719 C  C   . HIS C 1 132 ? 27.110  -16.569 126.877 1.00 12.89 ? 132 HIS C C   1 
ATOM   3720 O  O   . HIS C 1 132 ? 26.719  -16.187 128.016 1.00 13.95 ? 132 HIS C O   1 
ATOM   3721 C  CB  . HIS C 1 132 ? 28.974  -17.918 127.462 1.00 13.02 ? 132 HIS C CB  1 
ATOM   3722 C  CG  . HIS C 1 132 ? 30.450  -18.009 127.545 1.00 13.81 ? 132 HIS C CG  1 
ATOM   3723 N  ND1 . HIS C 1 132 ? 31.214  -18.890 126.810 1.00 14.02 ? 132 HIS C ND1 1 
ATOM   3724 C  CD2 . HIS C 1 132 ? 31.310  -17.271 128.305 1.00 13.91 ? 132 HIS C CD2 1 
ATOM   3725 C  CE1 . HIS C 1 132 ? 32.496  -18.720 127.132 1.00 14.13 ? 132 HIS C CE1 1 
ATOM   3726 N  NE2 . HIS C 1 132 ? 32.575  -17.737 128.029 1.00 14.17 ? 132 HIS C NE2 1 
ATOM   3727 N  N   . MET C 1 133 ? 26.432  -17.007 125.830 1.00 11.56 ? 133 MET C N   1 
ATOM   3728 C  CA  . MET C 1 133 ? 24.922  -17.042 126.159 1.00 10.45 ? 133 MET C CA  1 
ATOM   3729 C  C   . MET C 1 133 ? 24.380  -18.247 125.407 1.00 10.85 ? 133 MET C C   1 
ATOM   3730 O  O   . MET C 1 133 ? 25.021  -18.789 124.456 1.00 10.99 ? 133 MET C O   1 
ATOM   3731 C  CB  . MET C 1 133 ? 24.448  -15.716 125.993 1.00 9.33  ? 133 MET C CB  1 
ATOM   3732 C  CG  . MET C 1 133 ? 24.087  -15.025 124.820 1.00 8.93  ? 133 MET C CG  1 
ATOM   3733 S  SD  . MET C 1 133 ? 23.895  -13.247 125.416 1.00 8.75  ? 133 MET C SD  1 
ATOM   3734 C  CE  . MET C 1 133 ? 24.836  -12.551 123.973 1.00 8.16  ? 133 MET C CE  1 
ATOM   3735 N  N   . GLY C 1 134 ? 23.251  -18.697 125.907 1.00 11.14 ? 134 GLY C N   1 
ATOM   3736 C  CA  . GLY C 1 134 ? 22.608  -19.897 125.254 1.00 12.76 ? 134 GLY C CA  1 
ATOM   3737 C  C   . GLY C 1 134 ? 21.210  -19.943 125.847 1.00 14.25 ? 134 GLY C C   1 
ATOM   3738 O  O   . GLY C 1 134 ? 20.945  -19.210 126.844 1.00 14.60 ? 134 GLY C O   1 
ATOM   3739 N  N   . PHE C 1 135 ? 20.389  -20.805 125.257 1.00 14.76 ? 135 PHE C N   1 
ATOM   3740 C  CA  . PHE C 1 135 ? 18.975  -20.932 125.709 1.00 14.05 ? 135 PHE C CA  1 
ATOM   3741 C  C   . PHE C 1 135 ? 18.697  -22.219 126.465 1.00 13.53 ? 135 PHE C C   1 
ATOM   3742 O  O   . PHE C 1 135 ? 19.449  -23.157 126.202 1.00 13.51 ? 135 PHE C O   1 
ATOM   3743 C  CB  . PHE C 1 135 ? 18.119  -20.846 124.475 1.00 14.13 ? 135 PHE C CB  1 
ATOM   3744 C  CG  . PHE C 1 135 ? 17.940  -19.509 123.880 1.00 14.16 ? 135 PHE C CG  1 
ATOM   3745 C  CD1 . PHE C 1 135 ? 18.277  -19.288 122.543 1.00 14.47 ? 135 PHE C CD1 1 
ATOM   3746 C  CD2 . PHE C 1 135 ? 17.413  -18.476 124.645 1.00 14.34 ? 135 PHE C CD2 1 
ATOM   3747 C  CE1 . PHE C 1 135 ? 18.058  -18.035 121.954 1.00 14.57 ? 135 PHE C CE1 1 
ATOM   3748 C  CE2 . PHE C 1 135 ? 17.187  -17.216 124.058 1.00 14.23 ? 135 PHE C CE2 1 
ATOM   3749 C  CZ  . PHE C 1 135 ? 17.516  -17.008 122.718 1.00 14.14 ? 135 PHE C CZ  1 
ATOM   3750 N  N   . GLN C 1 136 ? 17.663  -22.196 127.264 1.00 13.37 ? 136 GLN C N   1 
ATOM   3751 C  CA  . GLN C 1 136 ? 17.174  -23.273 128.115 1.00 13.68 ? 136 GLN C CA  1 
ATOM   3752 C  C   . GLN C 1 136 ? 15.643  -23.310 128.024 1.00 14.15 ? 136 GLN C C   1 
ATOM   3753 O  O   . GLN C 1 136 ? 15.006  -22.236 127.833 1.00 13.88 ? 136 GLN C O   1 
ATOM   3754 C  CB  . GLN C 1 136 ? 17.558  -23.165 129.599 1.00 13.02 ? 136 GLN C CB  1 
ATOM   3755 C  CG  . GLN C 1 136 ? 18.943  -23.588 129.992 1.00 12.10 ? 136 GLN C CG  1 
ATOM   3756 C  CD  . GLN C 1 136 ? 19.104  -23.912 131.468 1.00 12.03 ? 136 GLN C CD  1 
ATOM   3757 O  OE1 . GLN C 1 136 ? 18.751  -23.145 132.368 1.00 11.85 ? 136 GLN C OE1 1 
ATOM   3758 N  NE2 . GLN C 1 136 ? 19.673  -25.095 131.780 1.00 11.17 ? 136 GLN C NE2 1 
ATOM   3759 N  N   . TYR C 1 137 ? 15.075  -24.524 128.198 1.00 15.13 ? 137 TYR C N   1 
ATOM   3760 C  CA  . TYR C 1 137 ? 13.585  -24.494 128.039 1.00 16.20 ? 137 TYR C CA  1 
ATOM   3761 C  C   . TYR C 1 137 ? 12.687  -25.115 129.042 1.00 16.44 ? 137 TYR C C   1 
ATOM   3762 O  O   . TYR C 1 137 ? 11.484  -24.678 128.956 1.00 16.84 ? 137 TYR C O   1 
ATOM   3763 C  CB  . TYR C 1 137 ? 13.262  -25.122 126.637 1.00 16.60 ? 137 TYR C CB  1 
ATOM   3764 C  CG  . TYR C 1 137 ? 14.083  -24.520 125.522 1.00 17.28 ? 137 TYR C CG  1 
ATOM   3765 C  CD1 . TYR C 1 137 ? 15.388  -24.962 125.297 1.00 16.93 ? 137 TYR C CD1 1 
ATOM   3766 C  CD2 . TYR C 1 137 ? 13.598  -23.505 124.693 1.00 17.73 ? 137 TYR C CD2 1 
ATOM   3767 C  CE1 . TYR C 1 137 ? 16.183  -24.449 124.305 1.00 16.82 ? 137 TYR C CE1 1 
ATOM   3768 C  CE2 . TYR C 1 137 ? 14.385  -22.974 123.658 1.00 17.72 ? 137 TYR C CE2 1 
ATOM   3769 C  CZ  . TYR C 1 137 ? 15.695  -23.445 123.478 1.00 17.21 ? 137 TYR C CZ  1 
ATOM   3770 O  OH  . TYR C 1 137 ? 16.463  -22.930 122.472 1.00 16.51 ? 137 TYR C OH  1 
ATOM   3771 N  N   . ASP C 1 138 ? 13.068  -26.010 129.858 1.00 17.26 ? 138 ASP C N   1 
ATOM   3772 C  CA  . ASP C 1 138 ? 12.161  -26.655 130.886 1.00 17.76 ? 138 ASP C CA  1 
ATOM   3773 C  C   . ASP C 1 138 ? 12.482  -25.800 132.100 1.00 18.27 ? 138 ASP C C   1 
ATOM   3774 O  O   . ASP C 1 138 ? 13.614  -25.863 132.584 1.00 18.09 ? 138 ASP C O   1 
ATOM   3775 C  CB  . ASP C 1 138 ? 12.411  -28.128 130.892 1.00 17.65 ? 138 ASP C CB  1 
ATOM   3776 C  CG  . ASP C 1 138 ? 12.063  -28.783 132.226 1.00 17.68 ? 138 ASP C CG  1 
ATOM   3777 O  OD1 . ASP C 1 138 ? 12.835  -29.666 132.649 1.00 17.97 ? 138 ASP C OD1 1 
ATOM   3778 O  OD2 . ASP C 1 138 ? 11.025  -28.313 132.758 1.00 16.83 ? 138 ASP C OD2 1 
ATOM   3779 N  N   . MET C 1 139 ? 11.552  -25.003 132.501 1.00 19.35 ? 139 MET C N   1 
ATOM   3780 C  CA  . MET C 1 139 ? 11.769  -24.049 133.595 1.00 21.03 ? 139 MET C CA  1 
ATOM   3781 C  C   . MET C 1 139 ? 12.241  -24.654 134.875 1.00 22.38 ? 139 MET C C   1 
ATOM   3782 O  O   . MET C 1 139 ? 12.550  -23.882 135.818 1.00 23.98 ? 139 MET C O   1 
ATOM   3783 C  CB  . MET C 1 139 ? 10.470  -23.285 133.806 1.00 21.55 ? 139 MET C CB  1 
ATOM   3784 C  CG  . MET C 1 139 ? 10.249  -22.422 132.578 1.00 22.82 ? 139 MET C CG  1 
ATOM   3785 S  SD  . MET C 1 139 ? 11.598  -21.236 132.461 1.00 23.42 ? 139 MET C SD  1 
ATOM   3786 C  CE  . MET C 1 139 ? 12.780  -21.992 131.381 1.00 23.51 ? 139 MET C CE  1 
ATOM   3787 N  N   . ALA C 1 140 ? 12.307  -25.921 134.974 1.00 23.11 ? 140 ALA C N   1 
ATOM   3788 C  CA  . ALA C 1 140 ? 12.710  -26.695 136.094 1.00 23.59 ? 140 ALA C CA  1 
ATOM   3789 C  C   . ALA C 1 140 ? 14.145  -27.130 135.977 1.00 24.14 ? 140 ALA C C   1 
ATOM   3790 O  O   . ALA C 1 140 ? 14.569  -27.903 136.870 1.00 25.55 ? 140 ALA C O   1 
ATOM   3791 C  CB  . ALA C 1 140 ? 11.866  -27.999 136.114 1.00 23.73 ? 140 ALA C CB  1 
ATOM   3792 N  N   . ASP C 1 141 ? 14.812  -26.732 134.939 1.00 23.83 ? 141 ASP C N   1 
ATOM   3793 C  CA  . ASP C 1 141 ? 16.200  -27.267 134.758 1.00 23.67 ? 141 ASP C CA  1 
ATOM   3794 C  C   . ASP C 1 141 ? 17.171  -26.382 135.458 1.00 23.46 ? 141 ASP C C   1 
ATOM   3795 O  O   . ASP C 1 141 ? 17.027  -25.163 135.226 1.00 24.73 ? 141 ASP C O   1 
ATOM   3796 C  CB  . ASP C 1 141 ? 16.516  -27.355 133.297 1.00 24.24 ? 141 ASP C CB  1 
ATOM   3797 C  CG  . ASP C 1 141 ? 15.990  -28.464 132.452 1.00 24.24 ? 141 ASP C CG  1 
ATOM   3798 O  OD1 . ASP C 1 141 ? 15.713  -28.159 131.262 1.00 24.36 ? 141 ASP C OD1 1 
ATOM   3799 O  OD2 . ASP C 1 141 ? 15.910  -29.582 133.003 1.00 24.22 ? 141 ASP C OD2 1 
ATOM   3800 N  N   . THR C 1 142 ? 18.101  -26.944 136.153 1.00 22.92 ? 142 THR C N   1 
ATOM   3801 C  CA  . THR C 1 142 ? 19.081  -26.033 136.836 1.00 22.48 ? 142 THR C CA  1 
ATOM   3802 C  C   . THR C 1 142 ? 19.999  -25.410 135.824 1.00 21.44 ? 142 THR C C   1 
ATOM   3803 O  O   . THR C 1 142 ? 20.258  -26.060 134.796 1.00 21.77 ? 142 THR C O   1 
ATOM   3804 C  CB  . THR C 1 142 ? 19.774  -26.856 137.977 1.00 22.65 ? 142 THR C CB  1 
ATOM   3805 O  OG1 . THR C 1 142 ? 20.756  -27.719 137.363 1.00 23.09 ? 142 THR C OG1 1 
ATOM   3806 C  CG2 . THR C 1 142 ? 18.802  -27.724 138.803 1.00 22.61 ? 142 THR C CG2 1 
ATOM   3807 N  N   . LEU C 1 143 ? 20.485  -24.228 136.060 1.00 20.80 ? 143 LEU C N   1 
ATOM   3808 C  CA  . LEU C 1 143 ? 21.409  -23.537 135.210 1.00 20.96 ? 143 LEU C CA  1 
ATOM   3809 C  C   . LEU C 1 143 ? 22.788  -24.192 135.204 1.00 21.27 ? 143 LEU C C   1 
ATOM   3810 O  O   . LEU C 1 143 ? 23.125  -24.739 136.254 1.00 22.38 ? 143 LEU C O   1 
ATOM   3811 C  CB  . LEU C 1 143 ? 21.698  -22.092 135.715 1.00 19.88 ? 143 LEU C CB  1 
ATOM   3812 C  CG  . LEU C 1 143 ? 20.435  -21.295 135.897 1.00 19.40 ? 143 LEU C CG  1 
ATOM   3813 C  CD1 . LEU C 1 143 ? 20.602  -19.830 136.129 1.00 18.21 ? 143 LEU C CD1 1 
ATOM   3814 C  CD2 . LEU C 1 143 ? 19.684  -21.572 134.534 1.00 20.29 ? 143 LEU C CD2 1 
ATOM   3815 N  N   . PRO C 1 144 ? 23.478  -24.004 134.112 1.00 21.08 ? 144 PRO C N   1 
ATOM   3816 C  CA  . PRO C 1 144 ? 24.840  -24.501 133.963 1.00 20.70 ? 144 PRO C CA  1 
ATOM   3817 C  C   . PRO C 1 144 ? 25.746  -23.698 134.875 1.00 20.44 ? 144 PRO C C   1 
ATOM   3818 O  O   . PRO C 1 144 ? 25.441  -22.538 135.202 1.00 21.17 ? 144 PRO C O   1 
ATOM   3819 C  CB  . PRO C 1 144 ? 25.194  -24.339 132.506 1.00 20.27 ? 144 PRO C CB  1 
ATOM   3820 C  CG  . PRO C 1 144 ? 24.346  -23.150 132.151 1.00 20.76 ? 144 PRO C CG  1 
ATOM   3821 C  CD  . PRO C 1 144 ? 23.024  -23.309 132.897 1.00 20.92 ? 144 PRO C CD  1 
ATOM   3822 N  N   . VAL C 1 145 ? 26.817  -24.335 135.254 1.00 19.89 ? 145 VAL C N   1 
ATOM   3823 C  CA  . VAL C 1 145 ? 27.820  -23.771 136.085 1.00 20.10 ? 145 VAL C CA  1 
ATOM   3824 C  C   . VAL C 1 145 ? 29.190  -23.815 135.419 1.00 19.64 ? 145 VAL C C   1 
ATOM   3825 O  O   . VAL C 1 145 ? 30.134  -23.366 136.071 1.00 20.57 ? 145 VAL C O   1 
ATOM   3826 C  CB  . VAL C 1 145 ? 27.982  -24.525 137.428 1.00 20.99 ? 145 VAL C CB  1 
ATOM   3827 C  CG1 . VAL C 1 145 ? 27.117  -23.725 138.425 1.00 22.47 ? 145 VAL C CG1 1 
ATOM   3828 C  CG2 . VAL C 1 145 ? 27.711  -25.983 137.397 1.00 20.21 ? 145 VAL C CG2 1 
ATOM   3829 N  N   . SER C 1 146 ? 29.222  -24.365 134.259 1.00 18.54 ? 146 SER C N   1 
ATOM   3830 C  CA  . SER C 1 146 ? 30.546  -24.486 133.589 1.00 17.14 ? 146 SER C CA  1 
ATOM   3831 C  C   . SER C 1 146 ? 30.415  -23.944 132.219 1.00 16.14 ? 146 SER C C   1 
ATOM   3832 O  O   . SER C 1 146 ? 29.300  -24.063 131.654 1.00 14.82 ? 146 SER C O   1 
ATOM   3833 C  CB  . SER C 1 146 ? 30.792  -25.957 133.724 1.00 17.77 ? 146 SER C CB  1 
ATOM   3834 O  OG  . SER C 1 146 ? 31.356  -26.776 132.797 1.00 18.23 ? 146 SER C OG  1 
ATOM   3835 N  N   . VAL C 1 147 ? 31.561  -23.438 131.744 1.00 15.67 ? 147 VAL C N   1 
ATOM   3836 C  CA  . VAL C 1 147 ? 31.513  -22.944 130.323 1.00 15.01 ? 147 VAL C CA  1 
ATOM   3837 C  C   . VAL C 1 147 ? 31.285  -24.196 129.481 1.00 15.02 ? 147 VAL C C   1 
ATOM   3838 O  O   . VAL C 1 147 ? 30.496  -24.149 128.548 1.00 15.70 ? 147 VAL C O   1 
ATOM   3839 C  CB  . VAL C 1 147 ? 32.711  -22.152 129.899 1.00 14.44 ? 147 VAL C CB  1 
ATOM   3840 C  CG1 . VAL C 1 147 ? 32.863  -21.821 128.451 1.00 14.10 ? 147 VAL C CG1 1 
ATOM   3841 C  CG2 . VAL C 1 147 ? 32.673  -20.815 130.620 1.00 15.38 ? 147 VAL C CG2 1 
ATOM   3842 N  N   . ASN C 1 148 ? 31.980  -25.232 129.916 1.00 15.03 ? 148 ASN C N   1 
ATOM   3843 C  CA  . ASN C 1 148 ? 31.870  -26.519 129.202 1.00 14.76 ? 148 ASN C CA  1 
ATOM   3844 C  C   . ASN C 1 148 ? 30.384  -26.824 128.978 1.00 14.96 ? 148 ASN C C   1 
ATOM   3845 O  O   . ASN C 1 148 ? 29.875  -27.095 127.896 1.00 14.30 ? 148 ASN C O   1 
ATOM   3846 C  CB  . ASN C 1 148 ? 32.533  -27.575 130.002 1.00 14.84 ? 148 ASN C CB  1 
ATOM   3847 C  CG  . ASN C 1 148 ? 32.550  -28.912 129.274 1.00 14.85 ? 148 ASN C CG  1 
ATOM   3848 O  OD1 . ASN C 1 148 ? 33.455  -28.996 128.465 1.00 14.33 ? 148 ASN C OD1 1 
ATOM   3849 N  ND2 . ASN C 1 148 ? 31.647  -29.859 129.548 1.00 15.32 ? 148 ASN C ND2 1 
ATOM   3850 N  N   . GLN C 1 149 ? 29.752  -26.770 130.121 1.00 15.78 ? 149 GLN C N   1 
ATOM   3851 C  CA  . GLN C 1 149 ? 28.334  -27.027 130.223 1.00 17.63 ? 149 GLN C CA  1 
ATOM   3852 C  C   . GLN C 1 149 ? 27.489  -26.204 129.271 1.00 18.18 ? 149 GLN C C   1 
ATOM   3853 O  O   . GLN C 1 149 ? 26.666  -26.589 128.492 1.00 17.23 ? 149 GLN C O   1 
ATOM   3854 C  CB  . GLN C 1 149 ? 27.890  -26.625 131.628 1.00 18.83 ? 149 GLN C CB  1 
ATOM   3855 C  CG  . GLN C 1 149 ? 27.428  -27.850 132.375 1.00 20.27 ? 149 GLN C CG  1 
ATOM   3856 C  CD  . GLN C 1 149 ? 27.292  -27.520 133.867 1.00 21.09 ? 149 GLN C CD  1 
ATOM   3857 O  OE1 . GLN C 1 149 ? 26.960  -28.509 134.525 1.00 21.98 ? 149 GLN C OE1 1 
ATOM   3858 N  NE2 . GLN C 1 149 ? 27.528  -26.288 134.297 1.00 20.51 ? 149 GLN C NE2 1 
ATOM   3859 N  N   . LEU C 1 150 ? 27.738  -24.906 129.461 1.00 19.45 ? 150 LEU C N   1 
ATOM   3860 C  CA  . LEU C 1 150 ? 27.065  -23.850 128.745 1.00 19.67 ? 150 LEU C CA  1 
ATOM   3861 C  C   . LEU C 1 150 ? 27.162  -23.990 127.241 1.00 19.59 ? 150 LEU C C   1 
ATOM   3862 O  O   . LEU C 1 150 ? 26.226  -23.600 126.518 1.00 19.44 ? 150 LEU C O   1 
ATOM   3863 C  CB  . LEU C 1 150 ? 27.708  -22.512 129.196 1.00 19.60 ? 150 LEU C CB  1 
ATOM   3864 C  CG  . LEU C 1 150 ? 26.726  -21.358 129.054 1.00 19.51 ? 150 LEU C CG  1 
ATOM   3865 C  CD1 . LEU C 1 150 ? 26.437  -21.051 127.585 1.00 20.30 ? 150 LEU C CD1 1 
ATOM   3866 C  CD2 . LEU C 1 150 ? 25.469  -21.814 129.701 1.00 19.47 ? 150 LEU C CD2 1 
ATOM   3867 N  N   . SER C 1 151 ? 28.316  -24.531 126.871 1.00 19.02 ? 151 SER C N   1 
ATOM   3868 C  CA  . SER C 1 151 ? 28.541  -24.623 125.430 1.00 19.35 ? 151 SER C CA  1 
ATOM   3869 C  C   . SER C 1 151 ? 27.670  -25.570 124.671 1.00 19.01 ? 151 SER C C   1 
ATOM   3870 O  O   . SER C 1 151 ? 27.964  -25.563 123.419 1.00 19.46 ? 151 SER C O   1 
ATOM   3871 C  CB  . SER C 1 151 ? 29.990  -25.036 125.186 1.00 20.36 ? 151 SER C CB  1 
ATOM   3872 O  OG  . SER C 1 151 ? 30.024  -26.472 125.343 1.00 21.11 ? 151 SER C OG  1 
ATOM   3873 N  N   . ASN C 1 152 ? 26.761  -26.307 125.205 1.00 18.78 ? 152 ASN C N   1 
ATOM   3874 C  CA  . ASN C 1 152 ? 25.996  -27.203 124.288 1.00 19.43 ? 152 ASN C CA  1 
ATOM   3875 C  C   . ASN C 1 152 ? 24.544  -26.706 124.233 1.00 19.75 ? 152 ASN C C   1 
ATOM   3876 O  O   . ASN C 1 152 ? 23.697  -27.480 123.751 1.00 19.77 ? 152 ASN C O   1 
ATOM   3877 C  CB  . ASN C 1 152 ? 26.047  -28.640 124.644 1.00 19.96 ? 152 ASN C CB  1 
ATOM   3878 C  CG  . ASN C 1 152 ? 27.042  -29.270 125.482 1.00 20.79 ? 152 ASN C CG  1 
ATOM   3879 O  OD1 . ASN C 1 152 ? 28.248  -29.467 125.306 1.00 22.24 ? 152 ASN C OD1 1 
ATOM   3880 N  ND2 . ASN C 1 152 ? 26.623  -29.782 126.653 1.00 21.75 ? 152 ASN C ND2 1 
ATOM   3881 N  N   . LEU C 1 153 ? 24.308  -25.519 124.726 1.00 20.15 ? 153 LEU C N   1 
ATOM   3882 C  CA  . LEU C 1 153 ? 22.890  -25.033 124.711 1.00 20.33 ? 153 LEU C CA  1 
ATOM   3883 C  C   . LEU C 1 153 ? 22.611  -24.519 123.289 1.00 21.18 ? 153 LEU C C   1 
ATOM   3884 O  O   . LEU C 1 153 ? 23.587  -24.265 122.595 1.00 21.81 ? 153 LEU C O   1 
ATOM   3885 C  CB  . LEU C 1 153 ? 22.731  -24.048 125.779 1.00 19.52 ? 153 LEU C CB  1 
ATOM   3886 C  CG  . LEU C 1 153 ? 22.150  -23.970 127.111 1.00 19.25 ? 153 LEU C CG  1 
ATOM   3887 C  CD1 . LEU C 1 153 ? 22.300  -25.162 128.029 1.00 18.53 ? 153 LEU C CD1 1 
ATOM   3888 C  CD2 . LEU C 1 153 ? 22.944  -22.786 127.790 1.00 19.78 ? 153 LEU C CD2 1 
ATOM   3889 N  N   . LYS C 1 154 ? 21.352  -24.347 122.974 1.00 22.21 ? 154 LYS C N   1 
ATOM   3890 C  CA  . LYS C 1 154 ? 20.860  -23.878 121.727 1.00 22.56 ? 154 LYS C CA  1 
ATOM   3891 C  C   . LYS C 1 154 ? 21.477  -22.589 121.258 1.00 22.41 ? 154 LYS C C   1 
ATOM   3892 O  O   . LYS C 1 154 ? 22.017  -22.874 120.097 1.00 24.33 ? 154 LYS C O   1 
ATOM   3893 C  CB  . LYS C 1 154 ? 19.343  -23.593 121.660 1.00 24.03 ? 154 LYS C CB  1 
ATOM   3894 C  CG  . LYS C 1 154 ? 18.761  -24.087 120.305 1.00 25.51 ? 154 LYS C CG  1 
ATOM   3895 C  CD  . LYS C 1 154 ? 19.129  -23.306 119.063 1.00 26.70 ? 154 LYS C CD  1 
ATOM   3896 C  CE  . LYS C 1 154 ? 18.712  -24.031 117.772 1.00 28.07 ? 154 LYS C CE  1 
ATOM   3897 N  NZ  . LYS C 1 154 ? 19.097  -23.227 116.511 1.00 28.66 ? 154 LYS C NZ  1 
ATOM   3898 N  N   . GLY C 1 155 ? 21.511  -21.410 121.739 1.00 21.72 ? 155 GLY C N   1 
ATOM   3899 C  CA  . GLY C 1 155 ? 22.266  -20.423 120.743 1.00 21.85 ? 155 GLY C CA  1 
ATOM   3900 C  C   . GLY C 1 155 ? 23.681  -20.240 121.166 1.00 20.83 ? 155 GLY C C   1 
ATOM   3901 O  O   . GLY C 1 155 ? 24.141  -19.062 121.192 1.00 21.02 ? 155 GLY C O   1 
ATOM   3902 N  N   . TYR C 1 156 ? 24.377  -21.298 121.525 1.00 20.30 ? 156 TYR C N   1 
ATOM   3903 C  CA  . TYR C 1 156 ? 25.732  -21.043 122.112 1.00 19.69 ? 156 TYR C CA  1 
ATOM   3904 C  C   . TYR C 1 156 ? 26.501  -20.033 121.277 1.00 18.52 ? 156 TYR C C   1 
ATOM   3905 O  O   . TYR C 1 156 ? 26.640  -20.304 120.083 1.00 19.56 ? 156 TYR C O   1 
ATOM   3906 C  CB  . TYR C 1 156 ? 26.489  -22.350 122.403 1.00 19.37 ? 156 TYR C CB  1 
ATOM   3907 C  CG  . TYR C 1 156 ? 27.777  -21.928 123.110 1.00 19.42 ? 156 TYR C CG  1 
ATOM   3908 C  CD1 . TYR C 1 156 ? 28.971  -21.992 122.440 1.00 19.50 ? 156 TYR C CD1 1 
ATOM   3909 C  CD2 . TYR C 1 156 ? 27.761  -21.416 124.400 1.00 19.65 ? 156 TYR C CD2 1 
ATOM   3910 C  CE1 . TYR C 1 156 ? 30.175  -21.613 123.041 1.00 19.65 ? 156 TYR C CE1 1 
ATOM   3911 C  CE2 . TYR C 1 156 ? 28.945  -21.026 125.000 1.00 19.94 ? 156 TYR C CE2 1 
ATOM   3912 C  CZ  . TYR C 1 156 ? 30.156  -21.124 124.327 1.00 19.70 ? 156 TYR C CZ  1 
ATOM   3913 O  OH  . TYR C 1 156 ? 31.316  -20.737 124.949 1.00 19.66 ? 156 TYR C OH  1 
ATOM   3914 N  N   . VAL C 1 157 ? 26.897  -18.971 121.902 1.00 16.60 ? 157 VAL C N   1 
ATOM   3915 C  CA  . VAL C 1 157 ? 27.670  -17.900 121.274 1.00 15.75 ? 157 VAL C CA  1 
ATOM   3916 C  C   . VAL C 1 157 ? 28.604  -17.400 122.411 1.00 15.79 ? 157 VAL C C   1 
ATOM   3917 O  O   . VAL C 1 157 ? 28.168  -17.399 123.579 1.00 15.53 ? 157 VAL C O   1 
ATOM   3918 C  CB  . VAL C 1 157 ? 26.840  -16.818 120.650 1.00 15.54 ? 157 VAL C CB  1 
ATOM   3919 C  CG1 . VAL C 1 157 ? 25.914  -16.046 121.569 1.00 15.40 ? 157 VAL C CG1 1 
ATOM   3920 C  CG2 . VAL C 1 157 ? 27.732  -15.736 120.001 1.00 16.01 ? 157 VAL C CG2 1 
ATOM   3921 N  N   . THR C 1 158 ? 29.801  -17.026 122.049 1.00 15.57 ? 158 THR C N   1 
ATOM   3922 C  CA  . THR C 1 158 ? 30.781  -16.558 123.027 1.00 16.10 ? 158 THR C CA  1 
ATOM   3923 C  C   . THR C 1 158 ? 31.748  -15.573 122.382 1.00 16.19 ? 158 THR C C   1 
ATOM   3924 O  O   . THR C 1 158 ? 31.885  -15.678 121.163 1.00 17.46 ? 158 THR C O   1 
ATOM   3925 C  CB  . THR C 1 158 ? 31.664  -17.694 123.649 1.00 15.89 ? 158 THR C CB  1 
ATOM   3926 O  OG1 . THR C 1 158 ? 32.597  -17.067 124.564 1.00 15.91 ? 158 THR C OG1 1 
ATOM   3927 C  CG2 . THR C 1 158 ? 32.459  -18.464 122.590 1.00 15.80 ? 158 THR C CG2 1 
ATOM   3928 N  N   . GLY C 1 159 ? 32.392  -14.724 123.124 1.00 15.26 ? 159 GLY C N   1 
ATOM   3929 C  CA  . GLY C 1 159 ? 33.347  -13.806 122.542 1.00 14.40 ? 159 GLY C CA  1 
ATOM   3930 C  C   . GLY C 1 159 ? 34.022  -13.031 123.645 1.00 14.60 ? 159 GLY C C   1 
ATOM   3931 O  O   . GLY C 1 159 ? 33.423  -12.831 124.735 1.00 15.42 ? 159 GLY C O   1 
ATOM   3932 N  N   . PRO C 1 160 ? 35.240  -12.638 123.344 1.00 13.91 ? 160 PRO C N   1 
ATOM   3933 C  CA  . PRO C 1 160 ? 36.000  -11.796 124.289 1.00 14.09 ? 160 PRO C CA  1 
ATOM   3934 C  C   . PRO C 1 160 ? 35.068  -10.620 124.509 1.00 14.21 ? 160 PRO C C   1 
ATOM   3935 O  O   . PRO C 1 160 ? 34.298  -10.224 123.605 1.00 14.71 ? 160 PRO C O   1 
ATOM   3936 C  CB  . PRO C 1 160 ? 37.277  -11.539 123.594 1.00 14.53 ? 160 PRO C CB  1 
ATOM   3937 C  CG  . PRO C 1 160 ? 37.013  -11.776 122.125 1.00 14.31 ? 160 PRO C CG  1 
ATOM   3938 C  CD  . PRO C 1 160 ? 35.936  -12.837 122.083 1.00 13.63 ? 160 PRO C CD  1 
ATOM   3939 N  N   . VAL C 1 161 ? 35.037  -10.063 125.626 1.00 15.13 ? 161 VAL C N   1 
ATOM   3940 C  CA  . VAL C 1 161 ? 34.185  -8.990  126.139 1.00 16.00 ? 161 VAL C CA  1 
ATOM   3941 C  C   . VAL C 1 161 ? 34.374  -7.671  125.471 1.00 16.28 ? 161 VAL C C   1 
ATOM   3942 O  O   . VAL C 1 161 ? 33.626  -6.726  125.704 1.00 15.40 ? 161 VAL C O   1 
ATOM   3943 C  CB  . VAL C 1 161 ? 34.563  -9.057  127.660 1.00 16.26 ? 161 VAL C CB  1 
ATOM   3944 C  CG1 . VAL C 1 161 ? 35.679  -8.064  127.970 1.00 16.79 ? 161 VAL C CG1 1 
ATOM   3945 C  CG2 . VAL C 1 161 ? 33.399  -8.950  128.554 1.00 16.71 ? 161 VAL C CG2 1 
ATOM   3946 N  N   . TRP C 1 162 ? 35.411  -7.623  124.635 1.00 17.74 ? 162 TRP C N   1 
ATOM   3947 C  CA  . TRP C 1 162 ? 35.718  -6.331  123.968 1.00 19.28 ? 162 TRP C CA  1 
ATOM   3948 C  C   . TRP C 1 162 ? 35.218  -6.276  122.543 1.00 19.81 ? 162 TRP C C   1 
ATOM   3949 O  O   . TRP C 1 162 ? 35.261  -5.206  121.931 1.00 19.73 ? 162 TRP C O   1 
ATOM   3950 C  CB  . TRP C 1 162 ? 37.225  -6.047  124.049 1.00 19.63 ? 162 TRP C CB  1 
ATOM   3951 C  CG  . TRP C 1 162 ? 38.142  -7.156  123.722 1.00 19.33 ? 162 TRP C CG  1 
ATOM   3952 C  CD1 . TRP C 1 162 ? 38.855  -7.970  124.556 1.00 19.68 ? 162 TRP C CD1 1 
ATOM   3953 C  CD2 . TRP C 1 162 ? 38.480  -7.601  122.410 1.00 19.46 ? 162 TRP C CD2 1 
ATOM   3954 N  NE1 . TRP C 1 162 ? 39.597  -8.887  123.871 1.00 19.14 ? 162 TRP C NE1 1 
ATOM   3955 C  CE2 . TRP C 1 162 ? 39.379  -8.685  122.548 1.00 19.24 ? 162 TRP C CE2 1 
ATOM   3956 C  CE3 . TRP C 1 162 ? 38.075  -7.169  121.145 1.00 19.06 ? 162 TRP C CE3 1 
ATOM   3957 C  CZ2 . TRP C 1 162 ? 39.905  -9.339  121.446 1.00 19.18 ? 162 TRP C CZ2 1 
ATOM   3958 C  CZ3 . TRP C 1 162 ? 38.612  -7.852  120.074 1.00 18.77 ? 162 TRP C CZ3 1 
ATOM   3959 C  CH2 . TRP C 1 162 ? 39.488  -8.893  120.218 1.00 18.74 ? 162 TRP C CH2 1 
ATOM   3960 N  N   . GLU C 1 163 ? 34.793  -7.436  122.101 1.00 20.38 ? 163 GLU C N   1 
ATOM   3961 C  CA  . GLU C 1 163 ? 34.249  -7.659  120.784 1.00 20.58 ? 163 GLU C CA  1 
ATOM   3962 C  C   . GLU C 1 163 ? 32.760  -7.353  120.761 1.00 21.19 ? 163 GLU C C   1 
ATOM   3963 O  O   . GLU C 1 163 ? 32.059  -7.166  121.810 1.00 20.56 ? 163 GLU C O   1 
ATOM   3964 C  CB  . GLU C 1 163 ? 34.374  -9.144  120.388 1.00 20.20 ? 163 GLU C CB  1 
ATOM   3965 C  CG  . GLU C 1 163 ? 33.949  -9.457  118.950 1.00 20.40 ? 163 GLU C CG  1 
ATOM   3966 C  CD  . GLU C 1 163 ? 35.033  -9.178  117.942 1.00 20.77 ? 163 GLU C CD  1 
ATOM   3967 O  OE1 . GLU C 1 163 ? 35.009  -8.445  116.978 1.00 20.83 ? 163 GLU C OE1 1 
ATOM   3968 O  OE2 . GLU C 1 163 ? 36.029  -9.884  118.281 1.00 21.38 ? 163 GLU C OE2 1 
ATOM   3969 N  N   . GLY C 1 164 ? 32.250  -7.348  119.521 1.00 21.91 ? 164 GLY C N   1 
ATOM   3970 C  CA  . GLY C 1 164 ? 30.797  -7.189  119.423 1.00 23.30 ? 164 GLY C CA  1 
ATOM   3971 C  C   . GLY C 1 164 ? 30.175  -6.216  118.498 1.00 23.52 ? 164 GLY C C   1 
ATOM   3972 O  O   . GLY C 1 164 ? 28.924  -6.320  118.311 1.00 23.78 ? 164 GLY C O   1 
ATOM   3973 N  N   . GLN C 1 165 ? 31.026  -5.376  117.939 1.00 23.08 ? 165 GLN C N   1 
ATOM   3974 C  CA  . GLN C 1 165 ? 30.603  -4.287  117.072 1.00 22.59 ? 165 GLN C CA  1 
ATOM   3975 C  C   . GLN C 1 165 ? 30.143  -4.683  115.703 1.00 20.70 ? 165 GLN C C   1 
ATOM   3976 O  O   . GLN C 1 165 ? 29.851  -3.799  114.921 1.00 20.29 ? 165 GLN C O   1 
ATOM   3977 C  CB  . GLN C 1 165 ? 31.783  -3.289  116.965 1.00 24.06 ? 165 GLN C CB  1 
ATOM   3978 C  CG  . GLN C 1 165 ? 32.929  -4.055  116.297 1.00 26.01 ? 165 GLN C CG  1 
ATOM   3979 C  CD  . GLN C 1 165 ? 33.496  -3.129  115.219 1.00 27.17 ? 165 GLN C CD  1 
ATOM   3980 O  OE1 . GLN C 1 165 ? 33.029  -3.323  114.082 1.00 28.66 ? 165 GLN C OE1 1 
ATOM   3981 N  NE2 . GLN C 1 165 ? 34.373  -2.239  115.651 1.00 26.88 ? 165 GLN C NE2 1 
ATOM   3982 N  N   . SER C 1 166 ? 30.075  -5.938  115.483 1.00 20.38 ? 166 SER C N   1 
ATOM   3983 C  CA  . SER C 1 166 ? 29.602  -6.437  114.187 1.00 20.64 ? 166 SER C CA  1 
ATOM   3984 C  C   . SER C 1 166 ? 28.067  -6.432  114.310 1.00 20.75 ? 166 SER C C   1 
ATOM   3985 O  O   . SER C 1 166 ? 27.441  -6.152  113.320 1.00 21.87 ? 166 SER C O   1 
ATOM   3986 C  CB  . SER C 1 166 ? 30.097  -7.804  113.772 1.00 19.60 ? 166 SER C CB  1 
ATOM   3987 O  OG  . SER C 1 166 ? 31.472  -7.765  113.510 1.00 18.60 ? 166 SER C OG  1 
ATOM   3988 N  N   . GLY C 1 167 ? 27.635  -6.727  115.504 1.00 20.80 ? 167 GLY C N   1 
ATOM   3989 C  CA  . GLY C 1 167 ? 26.219  -6.848  115.792 1.00 20.63 ? 167 GLY C CA  1 
ATOM   3990 C  C   . GLY C 1 167 ? 25.478  -5.564  115.553 1.00 20.42 ? 167 GLY C C   1 
ATOM   3991 O  O   . GLY C 1 167 ? 24.273  -5.610  115.231 1.00 20.43 ? 167 GLY C O   1 
ATOM   3992 N  N   . LEU C 1 168 ? 26.203  -4.458  115.684 1.00 20.35 ? 168 LEU C N   1 
ATOM   3993 C  CA  . LEU C 1 168 ? 25.525  -3.175  115.575 1.00 20.25 ? 168 LEU C CA  1 
ATOM   3994 C  C   . LEU C 1 168 ? 24.313  -3.166  114.648 1.00 20.54 ? 168 LEU C C   1 
ATOM   3995 O  O   . LEU C 1 168 ? 23.222  -2.802  115.160 1.00 19.10 ? 168 LEU C O   1 
ATOM   3996 C  CB  . LEU C 1 168 ? 26.528  -2.030  115.229 1.00 19.51 ? 168 LEU C CB  1 
ATOM   3997 C  CG  . LEU C 1 168 ? 25.609  -0.731  115.229 1.00 18.81 ? 168 LEU C CG  1 
ATOM   3998 C  CD1 . LEU C 1 168 ? 25.211  -0.432  116.651 1.00 18.51 ? 168 LEU C CD1 1 
ATOM   3999 C  CD2 . LEU C 1 168 ? 26.338  0.398   114.594 1.00 18.40 ? 168 LEU C CD2 1 
ATOM   4000 N  N   . CYS C 1 169 ? 24.447  -3.505  113.376 1.00 22.10 ? 169 CYS C N   1 
ATOM   4001 C  CA  . CYS C 1 169 ? 23.187  -3.411  112.563 1.00 23.88 ? 169 CYS C CA  1 
ATOM   4002 C  C   . CYS C 1 169 ? 21.993  -4.013  113.296 1.00 24.49 ? 169 CYS C C   1 
ATOM   4003 O  O   . CYS C 1 169 ? 20.959  -3.348  113.338 1.00 25.38 ? 169 CYS C O   1 
ATOM   4004 C  CB  . CYS C 1 169 ? 23.293  -4.033  111.209 1.00 24.18 ? 169 CYS C CB  1 
ATOM   4005 S  SG  . CYS C 1 169 ? 24.131  -5.625  111.365 1.00 24.70 ? 169 CYS C SG  1 
ATOM   4006 N  N   . PHE C 1 170 ? 22.034  -5.160  113.872 1.00 25.20 ? 170 PHE C N   1 
ATOM   4007 C  CA  . PHE C 1 170 ? 20.883  -5.757  114.567 1.00 24.79 ? 170 PHE C CA  1 
ATOM   4008 C  C   . PHE C 1 170 ? 20.228  -4.771  115.523 1.00 24.69 ? 170 PHE C C   1 
ATOM   4009 O  O   . PHE C 1 170 ? 18.988  -4.828  115.587 1.00 24.75 ? 170 PHE C O   1 
ATOM   4010 C  CB  . PHE C 1 170 ? 21.256  -6.995  115.332 1.00 24.87 ? 170 PHE C CB  1 
ATOM   4011 C  CG  . PHE C 1 170 ? 21.732  -8.119  114.458 1.00 25.17 ? 170 PHE C CG  1 
ATOM   4012 C  CD1 . PHE C 1 170 ? 23.018  -8.105  113.957 1.00 25.32 ? 170 PHE C CD1 1 
ATOM   4013 C  CD2 . PHE C 1 170 ? 20.910  -9.183  114.167 1.00 25.30 ? 170 PHE C CD2 1 
ATOM   4014 C  CE1 . PHE C 1 170 ? 23.458  -9.151  113.166 1.00 25.82 ? 170 PHE C CE1 1 
ATOM   4015 C  CE2 . PHE C 1 170 ? 21.352  -10.234 113.385 1.00 25.62 ? 170 PHE C CE2 1 
ATOM   4016 C  CZ  . PHE C 1 170 ? 22.648  -10.231 112.872 1.00 25.47 ? 170 PHE C CZ  1 
ATOM   4017 N  N   . VAL C 1 171 ? 21.004  -3.992  116.193 1.00 24.96 ? 171 VAL C N   1 
ATOM   4018 C  CA  . VAL C 1 171 ? 20.408  -3.040  117.190 1.00 25.45 ? 171 VAL C CA  1 
ATOM   4019 C  C   . VAL C 1 171 ? 19.900  -1.830  116.480 1.00 26.54 ? 171 VAL C C   1 
ATOM   4020 O  O   . VAL C 1 171 ? 18.731  -1.453  116.621 1.00 27.05 ? 171 VAL C O   1 
ATOM   4021 C  CB  . VAL C 1 171 ? 21.486  -2.838  118.250 1.00 24.96 ? 171 VAL C CB  1 
ATOM   4022 C  CG1 . VAL C 1 171 ? 21.223  -1.707  119.207 1.00 25.21 ? 171 VAL C CG1 1 
ATOM   4023 C  CG2 . VAL C 1 171 ? 21.667  -4.167  118.968 1.00 24.33 ? 171 VAL C CG2 1 
ATOM   4024 N  N   . ASN C 1 172 ? 20.782  -1.246  115.714 1.00 28.47 ? 172 ASN C N   1 
ATOM   4025 C  CA  . ASN C 1 172 ? 20.430  -0.069  114.915 1.00 30.56 ? 172 ASN C CA  1 
ATOM   4026 C  C   . ASN C 1 172 ? 19.333  -0.508  113.929 1.00 31.73 ? 172 ASN C C   1 
ATOM   4027 O  O   . ASN C 1 172 ? 18.279  0.073   113.738 1.00 32.55 ? 172 ASN C O   1 
ATOM   4028 C  CB  . ASN C 1 172 ? 21.663  0.517   114.227 1.00 30.92 ? 172 ASN C CB  1 
ATOM   4029 C  CG  . ASN C 1 172 ? 22.239  1.675   115.028 1.00 31.43 ? 172 ASN C CG  1 
ATOM   4030 O  OD1 . ASN C 1 172 ? 23.441  1.917   115.074 1.00 31.68 ? 172 ASN C OD1 1 
ATOM   4031 N  ND2 . ASN C 1 172 ? 21.339  2.403   115.704 1.00 32.08 ? 172 ASN C ND2 1 
ATOM   4032 N  N   . ASN C 1 173 ? 19.648  -1.576  113.301 1.00 32.63 ? 173 ASN C N   1 
ATOM   4033 C  CA  . ASN C 1 173 ? 18.996  -2.319  112.223 1.00 33.63 ? 173 ASN C CA  1 
ATOM   4034 C  C   . ASN C 1 173 ? 19.036  -1.228  111.082 1.00 33.80 ? 173 ASN C C   1 
ATOM   4035 O  O   . ASN C 1 173 ? 18.309  -0.334  110.910 1.00 33.81 ? 173 ASN C O   1 
ATOM   4036 C  CB  . ASN C 1 173 ? 17.716  -2.910  112.429 1.00 34.94 ? 173 ASN C CB  1 
ATOM   4037 C  CG  . ASN C 1 173 ? 16.420  -2.333  112.071 1.00 36.38 ? 173 ASN C CG  1 
ATOM   4038 O  OD1 . ASN C 1 173 ? 16.003  -1.277  112.598 1.00 37.08 ? 173 ASN C OD1 1 
ATOM   4039 N  ND2 . ASN C 1 173 ? 15.715  -3.061  111.195 1.00 37.23 ? 173 ASN C ND2 1 
ATOM   4040 N  N   . THR C 1 174 ? 20.039  -1.405  110.398 1.00 34.46 ? 174 THR C N   1 
ATOM   4041 C  CA  . THR C 1 174 ? 20.896  -1.056  109.351 1.00 34.99 ? 174 THR C CA  1 
ATOM   4042 C  C   . THR C 1 174 ? 20.866  -2.286  108.474 1.00 35.59 ? 174 THR C C   1 
ATOM   4043 O  O   . THR C 1 174 ? 19.940  -3.114  108.764 1.00 35.54 ? 174 THR C O   1 
ATOM   4044 C  CB  . THR C 1 174 ? 22.260  -0.659  110.050 1.00 35.24 ? 174 THR C CB  1 
ATOM   4045 O  OG1 . THR C 1 174 ? 22.087  0.808   110.194 1.00 35.22 ? 174 THR C OG1 1 
ATOM   4046 C  CG2 . THR C 1 174 ? 23.582  -1.051  109.407 1.00 35.75 ? 174 THR C CG2 1 
ATOM   4047 N  N   . LYS C 1 175 ? 21.712  -2.391  107.522 1.00 36.46 ? 175 LYS C N   1 
ATOM   4048 C  CA  . LYS C 1 175 ? 21.711  -3.585  106.635 1.00 37.64 ? 175 LYS C CA  1 
ATOM   4049 C  C   . LYS C 1 175 ? 22.972  -4.282  107.103 1.00 36.51 ? 175 LYS C C   1 
ATOM   4050 O  O   . LYS C 1 175 ? 24.039  -3.595  107.048 1.00 37.14 ? 175 LYS C O   1 
ATOM   4051 C  CB  . LYS C 1 175 ? 21.703  -3.270  105.174 1.00 40.46 ? 175 LYS C CB  1 
ATOM   4052 C  CG  . LYS C 1 175 ? 21.616  -4.584  104.330 1.00 43.93 ? 175 LYS C CG  1 
ATOM   4053 C  CD  . LYS C 1 175 ? 22.033  -4.410  102.868 1.00 46.32 ? 175 LYS C CD  1 
ATOM   4054 C  CE  . LYS C 1 175 ? 23.282  -5.159  102.407 1.00 47.48 ? 175 LYS C CE  1 
ATOM   4055 N  NZ  . LYS C 1 175 ? 23.543  -6.455  103.132 1.00 47.82 ? 175 LYS C NZ  1 
ATOM   4056 N  N   . CYS C 1 176 ? 22.852  -5.497  107.566 1.00 33.96 ? 176 CYS C N   1 
ATOM   4057 C  CA  . CYS C 1 176 ? 24.110  -6.076  108.085 1.00 31.62 ? 176 CYS C CA  1 
ATOM   4058 C  C   . CYS C 1 176 ? 25.222  -6.360  107.120 1.00 31.47 ? 176 CYS C C   1 
ATOM   4059 O  O   . CYS C 1 176 ? 25.014  -6.985  106.107 1.00 32.04 ? 176 CYS C O   1 
ATOM   4060 C  CB  . CYS C 1 176 ? 23.673  -7.341  108.850 1.00 29.88 ? 176 CYS C CB  1 
ATOM   4061 S  SG  . CYS C 1 176 ? 22.918  -6.850  110.373 1.00 27.00 ? 176 CYS C SG  1 
ATOM   4062 N  N   . PRO C 1 177 ? 26.413  -5.931  107.530 1.00 31.62 ? 177 PRO C N   1 
ATOM   4063 C  CA  . PRO C 1 177 ? 27.646  -6.138  106.822 1.00 32.09 ? 177 PRO C CA  1 
ATOM   4064 C  C   . PRO C 1 177 ? 28.111  -7.585  106.783 1.00 32.68 ? 177 PRO C C   1 
ATOM   4065 O  O   . PRO C 1 177 ? 27.966  -8.206  105.702 1.00 33.66 ? 177 PRO C O   1 
ATOM   4066 C  CB  . PRO C 1 177 ? 28.684  -5.259  107.517 1.00 32.07 ? 177 PRO C CB  1 
ATOM   4067 C  CG  . PRO C 1 177 ? 28.066  -4.769  108.766 1.00 32.21 ? 177 PRO C CG  1 
ATOM   4068 C  CD  . PRO C 1 177 ? 26.629  -5.168  108.790 1.00 31.99 ? 177 PRO C CD  1 
ATOM   4069 N  N   . ASP C 1 178 ? 28.697  -8.175  107.762 1.00 33.07 ? 178 ASP C N   1 
ATOM   4070 C  CA  . ASP C 1 178 ? 29.214  -9.537  107.847 1.00 33.08 ? 178 ASP C CA  1 
ATOM   4071 C  C   . ASP C 1 178 ? 29.143  -9.891  109.334 1.00 32.61 ? 178 ASP C C   1 
ATOM   4072 O  O   . ASP C 1 178 ? 30.048  -9.444  110.116 1.00 32.67 ? 178 ASP C O   1 
ATOM   4073 C  CB  . ASP C 1 178 ? 30.640  -9.703  107.338 1.00 34.59 ? 178 ASP C CB  1 
ATOM   4074 C  CG  . ASP C 1 178 ? 31.214  -11.026 107.825 1.00 36.25 ? 178 ASP C CG  1 
ATOM   4075 O  OD1 . ASP C 1 178 ? 31.548  -11.316 109.000 1.00 37.46 ? 178 ASP C OD1 1 
ATOM   4076 O  OD2 . ASP C 1 178 ? 31.327  -11.897 106.947 1.00 37.53 ? 178 ASP C OD2 1 
ATOM   4077 N  N   . THR C 1 179 ? 28.124  -10.643 109.689 1.00 31.42 ? 179 THR C N   1 
ATOM   4078 C  CA  . THR C 1 179 ? 28.022  -10.934 111.191 1.00 29.26 ? 179 THR C CA  1 
ATOM   4079 C  C   . THR C 1 179 ? 28.792  -12.098 111.661 1.00 28.73 ? 179 THR C C   1 
ATOM   4080 O  O   . THR C 1 179 ? 28.690  -12.487 112.867 1.00 29.39 ? 179 THR C O   1 
ATOM   4081 C  CB  . THR C 1 179 ? 26.467  -10.906 111.397 1.00 28.58 ? 179 THR C CB  1 
ATOM   4082 O  OG1 . THR C 1 179 ? 25.986  -12.079 110.727 1.00 28.82 ? 179 THR C OG1 1 
ATOM   4083 C  CG2 . THR C 1 179 ? 25.906  -9.604  110.811 1.00 28.17 ? 179 THR C CG2 1 
ATOM   4084 N  N   . SER C 1 180 ? 29.621  -12.685 110.815 1.00 27.96 ? 180 SER C N   1 
ATOM   4085 C  CA  . SER C 1 180 ? 30.507  -13.820 111.074 1.00 26.25 ? 180 SER C CA  1 
ATOM   4086 C  C   . SER C 1 180 ? 30.841  -13.853 112.581 1.00 24.56 ? 180 SER C C   1 
ATOM   4087 O  O   . SER C 1 180 ? 30.537  -14.777 113.347 1.00 23.73 ? 180 SER C O   1 
ATOM   4088 C  CB  . SER C 1 180 ? 31.747  -13.733 110.210 1.00 26.37 ? 180 SER C CB  1 
ATOM   4089 O  OG  . SER C 1 180 ? 32.337  -15.072 110.056 1.00 28.04 ? 180 SER C OG  1 
ATOM   4090 N  N   . ARG C 1 181 ? 31.439  -12.759 112.971 1.00 23.24 ? 181 ARG C N   1 
ATOM   4091 C  CA  . ARG C 1 181 ? 31.822  -12.538 114.356 1.00 23.07 ? 181 ARG C CA  1 
ATOM   4092 C  C   . ARG C 1 181 ? 30.858  -11.685 115.135 1.00 21.58 ? 181 ARG C C   1 
ATOM   4093 O  O   . ARG C 1 181 ? 31.379  -10.644 115.639 1.00 21.80 ? 181 ARG C O   1 
ATOM   4094 C  CB  . ARG C 1 181 ? 33.253  -11.881 114.378 1.00 23.70 ? 181 ARG C CB  1 
ATOM   4095 C  CG  . ARG C 1 181 ? 33.624  -11.307 113.045 1.00 24.56 ? 181 ARG C CG  1 
ATOM   4096 C  CD  . ARG C 1 181 ? 35.059  -11.140 112.791 1.00 25.59 ? 181 ARG C CD  1 
ATOM   4097 N  NE  . ARG C 1 181 ? 35.713  -10.291 113.793 1.00 26.75 ? 181 ARG C NE  1 
ATOM   4098 C  CZ  . ARG C 1 181 ? 37.039  -10.417 113.996 1.00 27.30 ? 181 ARG C CZ  1 
ATOM   4099 N  NH1 . ARG C 1 181 ? 37.817  -11.025 113.096 1.00 27.85 ? 181 ARG C NH1 1 
ATOM   4100 N  NH2 . ARG C 1 181 ? 37.533  -9.989  115.160 1.00 27.71 ? 181 ARG C NH2 1 
ATOM   4101 N  N   . ALA C 1 182 ? 29.577  -11.978 115.283 1.00 19.83 ? 182 ALA C N   1 
ATOM   4102 C  CA  . ALA C 1 182 ? 28.797  -10.948 116.124 1.00 18.28 ? 182 ALA C CA  1 
ATOM   4103 C  C   . ALA C 1 182 ? 28.556  -11.648 117.431 1.00 17.17 ? 182 ALA C C   1 
ATOM   4104 O  O   . ALA C 1 182 ? 28.966  -12.822 117.393 1.00 17.40 ? 182 ALA C O   1 
ATOM   4105 C  CB  . ALA C 1 182 ? 27.628  -10.511 115.359 1.00 17.73 ? 182 ALA C CB  1 
ATOM   4106 N  N   . ILE C 1 183 ? 27.992  -11.065 118.430 1.00 15.86 ? 183 ILE C N   1 
ATOM   4107 C  CA  . ILE C 1 183 ? 27.734  -11.939 119.664 1.00 14.26 ? 183 ILE C CA  1 
ATOM   4108 C  C   . ILE C 1 183 ? 26.225  -11.851 119.733 1.00 14.25 ? 183 ILE C C   1 
ATOM   4109 O  O   . ILE C 1 183 ? 25.675  -11.028 120.504 1.00 14.81 ? 183 ILE C O   1 
ATOM   4110 C  CB  . ILE C 1 183 ? 28.595  -11.445 120.794 1.00 13.86 ? 183 ILE C CB  1 
ATOM   4111 C  CG1 . ILE C 1 183 ? 30.106  -11.791 120.581 1.00 13.21 ? 183 ILE C CG1 1 
ATOM   4112 C  CG2 . ILE C 1 183 ? 28.213  -11.968 122.216 1.00 14.14 ? 183 ILE C CG2 1 
ATOM   4113 C  CD1 . ILE C 1 183 ? 31.014  -10.875 121.487 1.00 12.92 ? 183 ILE C CD1 1 
ATOM   4114 N  N   . THR C 1 184 ? 25.547  -12.577 118.841 1.00 13.19 ? 184 THR C N   1 
ATOM   4115 C  CA  . THR C 1 184 ? 24.077  -12.477 118.861 1.00 12.24 ? 184 THR C CA  1 
ATOM   4116 C  C   . THR C 1 184 ? 23.431  -13.768 119.239 1.00 10.89 ? 184 THR C C   1 
ATOM   4117 O  O   . THR C 1 184 ? 24.099  -14.832 119.109 1.00 11.25 ? 184 THR C O   1 
ATOM   4118 C  CB  . THR C 1 184 ? 23.630  -12.023 117.422 1.00 13.24 ? 184 THR C CB  1 
ATOM   4119 O  OG1 . THR C 1 184 ? 22.987  -10.735 117.552 1.00 13.95 ? 184 THR C OG1 1 
ATOM   4120 C  CG2 . THR C 1 184 ? 22.668  -13.041 116.726 1.00 13.42 ? 184 THR C CG2 1 
ATOM   4121 N  N   . ILE C 1 185 ? 22.207  -13.811 119.598 1.00 9.44  ? 185 ILE C N   1 
ATOM   4122 C  CA  . ILE C 1 185 ? 21.539  -15.136 119.883 1.00 8.89  ? 185 ILE C CA  1 
ATOM   4123 C  C   . ILE C 1 185 ? 20.089  -14.752 119.583 1.00 9.02  ? 185 ILE C C   1 
ATOM   4124 O  O   . ILE C 1 185 ? 19.679  -13.586 119.753 1.00 8.94  ? 185 ILE C O   1 
ATOM   4125 C  CB  . ILE C 1 185 ? 21.923  -15.730 121.214 1.00 8.46  ? 185 ILE C CB  1 
ATOM   4126 C  CG1 . ILE C 1 185 ? 21.246  -17.093 121.448 1.00 7.59  ? 185 ILE C CG1 1 
ATOM   4127 C  CG2 . ILE C 1 185 ? 21.574  -14.711 122.344 1.00 8.73  ? 185 ILE C CG2 1 
ATOM   4128 C  CD1 . ILE C 1 185 ? 21.314  -17.554 122.924 1.00 7.27  ? 185 ILE C CD1 1 
ATOM   4129 N  N   . ALA C 1 186 ? 19.455  -15.748 119.001 1.00 8.97  ? 186 ALA C N   1 
ATOM   4130 C  CA  . ALA C 1 186 ? 18.055  -15.556 118.511 1.00 8.48  ? 186 ALA C CA  1 
ATOM   4131 C  C   . ALA C 1 186 ? 17.174  -16.714 118.868 1.00 7.98  ? 186 ALA C C   1 
ATOM   4132 O  O   . ALA C 1 186 ? 17.593  -17.868 118.842 1.00 7.66  ? 186 ALA C O   1 
ATOM   4133 C  CB  . ALA C 1 186 ? 18.271  -15.297 117.037 1.00 7.72  ? 186 ALA C CB  1 
ATOM   4134 N  N   . LEU C 1 187 ? 15.915  -16.422 119.216 1.00 8.55  ? 187 LEU C N   1 
ATOM   4135 C  CA  . LEU C 1 187 ? 15.061  -17.555 119.621 1.00 9.49  ? 187 LEU C CA  1 
ATOM   4136 C  C   . LEU C 1 187 ? 14.884  -18.518 118.461 1.00 12.09 ? 187 LEU C C   1 
ATOM   4137 O  O   . LEU C 1 187 ? 15.077  -18.130 117.280 1.00 14.28 ? 187 LEU C O   1 
ATOM   4138 C  CB  . LEU C 1 187 ? 13.780  -17.017 120.216 1.00 7.42  ? 187 LEU C CB  1 
ATOM   4139 C  CG  . LEU C 1 187 ? 13.434  -17.942 121.428 1.00 6.43  ? 187 LEU C CG  1 
ATOM   4140 C  CD1 . LEU C 1 187 ? 11.928  -17.930 121.536 1.00 5.36  ? 187 LEU C CD1 1 
ATOM   4141 C  CD2 . LEU C 1 187 ? 14.062  -19.306 121.257 1.00 4.49  ? 187 LEU C CD2 1 
ATOM   4142 N  N   . ASP C 1 188 ? 14.589  -19.726 118.786 1.00 13.70 ? 188 ASP C N   1 
ATOM   4143 C  CA  . ASP C 1 188 ? 14.357  -20.780 117.720 1.00 15.25 ? 188 ASP C CA  1 
ATOM   4144 C  C   . ASP C 1 188 ? 12.826  -20.772 117.881 1.00 17.46 ? 188 ASP C C   1 
ATOM   4145 O  O   . ASP C 1 188 ? 12.185  -21.636 118.434 1.00 18.21 ? 188 ASP C O   1 
ATOM   4146 C  CB  . ASP C 1 188 ? 15.174  -21.931 118.005 1.00 15.20 ? 188 ASP C CB  1 
ATOM   4147 C  CG  . ASP C 1 188 ? 15.068  -22.782 119.258 1.00 15.23 ? 188 ASP C CG  1 
ATOM   4148 O  OD1 . ASP C 1 188 ? 15.023  -24.022 119.057 1.00 14.51 ? 188 ASP C OD1 1 
ATOM   4149 O  OD2 . ASP C 1 188 ? 15.063  -22.278 120.416 1.00 15.21 ? 188 ASP C OD2 1 
ATOM   4150 N  N   . THR C 1 189 ? 12.296  -19.653 117.485 1.00 19.72 ? 189 THR C N   1 
ATOM   4151 C  CA  . THR C 1 189 ? 10.921  -19.282 117.479 1.00 22.44 ? 189 THR C CA  1 
ATOM   4152 C  C   . THR C 1 189 ? 9.964   -20.361 117.049 1.00 24.22 ? 189 THR C C   1 
ATOM   4153 O  O   . THR C 1 189 ? 8.821   -20.498 117.572 1.00 25.39 ? 189 THR C O   1 
ATOM   4154 C  CB  . THR C 1 189 ? 10.806  -18.032 116.497 1.00 23.10 ? 189 THR C CB  1 
ATOM   4155 O  OG1 . THR C 1 189 ? 9.832   -17.158 117.172 1.00 24.11 ? 189 THR C OG1 1 
ATOM   4156 C  CG2 . THR C 1 189 ? 10.417  -18.313 115.042 1.00 23.24 ? 189 THR C CG2 1 
ATOM   4157 N  N   . ASN C 1 190 ? 10.359  -21.149 116.096 1.00 26.14 ? 190 ASN C N   1 
ATOM   4158 C  CA  . ASN C 1 190 ? 9.471   -22.211 115.536 1.00 28.16 ? 190 ASN C CA  1 
ATOM   4159 C  C   . ASN C 1 190 ? 9.505   -23.480 116.340 1.00 27.86 ? 190 ASN C C   1 
ATOM   4160 O  O   . ASN C 1 190 ? 8.641   -24.383 116.059 1.00 28.84 ? 190 ASN C O   1 
ATOM   4161 C  CB  . ASN C 1 190 ? 9.880   -22.333 114.043 1.00 30.30 ? 190 ASN C CB  1 
ATOM   4162 C  CG  . ASN C 1 190 ? 11.339  -22.871 114.129 1.00 33.04 ? 190 ASN C CG  1 
ATOM   4163 O  OD1 . ASN C 1 190 ? 12.311  -22.124 114.484 1.00 33.67 ? 190 ASN C OD1 1 
ATOM   4164 N  ND2 . ASN C 1 190 ? 11.351  -24.202 113.842 1.00 33.91 ? 190 ASN C ND2 1 
ATOM   4165 N  N   . GLU C 1 191 ? 10.413  -23.582 117.311 1.00 26.42 ? 191 GLU C N   1 
ATOM   4166 C  CA  . GLU C 1 191 ? 10.388  -24.848 118.101 1.00 25.48 ? 191 GLU C CA  1 
ATOM   4167 C  C   . GLU C 1 191 ? 9.954   -24.669 119.550 1.00 25.89 ? 191 GLU C C   1 
ATOM   4168 O  O   . GLU C 1 191 ? 10.141  -25.466 120.508 1.00 25.28 ? 191 GLU C O   1 
ATOM   4169 C  CB  . GLU C 1 191 ? 11.715  -25.601 117.960 1.00 23.84 ? 191 GLU C CB  1 
ATOM   4170 C  CG  . GLU C 1 191 ? 11.313  -27.071 117.664 1.00 22.89 ? 191 GLU C CG  1 
ATOM   4171 C  CD  . GLU C 1 191 ? 11.752  -27.623 116.355 1.00 22.30 ? 191 GLU C CD  1 
ATOM   4172 O  OE1 . GLU C 1 191 ? 11.203  -28.564 115.780 1.00 20.78 ? 191 GLU C OE1 1 
ATOM   4173 O  OE2 . GLU C 1 191 ? 12.801  -26.979 115.993 1.00 22.43 ? 191 GLU C OE2 1 
ATOM   4174 N  N   . VAL C 1 192 ? 9.239   -23.565 119.792 1.00 26.25 ? 192 VAL C N   1 
ATOM   4175 C  CA  . VAL C 1 192 ? 8.675   -23.312 121.133 1.00 26.78 ? 192 VAL C CA  1 
ATOM   4176 C  C   . VAL C 1 192 ? 7.555   -24.327 121.383 1.00 27.69 ? 192 VAL C C   1 
ATOM   4177 O  O   . VAL C 1 192 ? 6.956   -24.834 120.412 1.00 27.74 ? 192 VAL C O   1 
ATOM   4178 C  CB  . VAL C 1 192 ? 8.244   -21.861 121.167 1.00 26.63 ? 192 VAL C CB  1 
ATOM   4179 C  CG1 . VAL C 1 192 ? 6.990   -21.672 122.018 1.00 26.61 ? 192 VAL C CG1 1 
ATOM   4180 C  CG2 . VAL C 1 192 ? 9.419   -20.985 121.591 1.00 26.18 ? 192 VAL C CG2 1 
ATOM   4181 N  N   . SER C 1 193 ? 7.218   -24.604 122.612 1.00 28.87 ? 193 SER C N   1 
ATOM   4182 C  CA  . SER C 1 193 ? 6.194   -25.547 123.034 1.00 30.41 ? 193 SER C CA  1 
ATOM   4183 C  C   . SER C 1 193 ? 4.712   -25.236 122.882 1.00 31.24 ? 193 SER C C   1 
ATOM   4184 O  O   . SER C 1 193 ? 3.865   -26.117 122.528 1.00 30.23 ? 193 SER C O   1 
ATOM   4185 C  CB  . SER C 1 193 ? 6.516   -25.766 124.557 1.00 30.69 ? 193 SER C CB  1 
ATOM   4186 O  OG  . SER C 1 193 ? 7.343   -26.946 124.617 1.00 30.94 ? 193 SER C OG  1 
ATOM   4187 N  N   . GLU C 1 194 ? 4.328   -24.019 123.180 1.00 32.59 ? 194 GLU C N   1 
ATOM   4188 C  CA  . GLU C 1 194 ? 2.937   -23.556 123.083 1.00 34.33 ? 194 GLU C CA  1 
ATOM   4189 C  C   . GLU C 1 194 ? 2.776   -22.785 121.786 1.00 33.92 ? 194 GLU C C   1 
ATOM   4190 O  O   . GLU C 1 194 ? 3.814   -22.341 121.262 1.00 33.69 ? 194 GLU C O   1 
ATOM   4191 C  CB  . GLU C 1 194 ? 2.506   -22.708 124.269 1.00 36.27 ? 194 GLU C CB  1 
ATOM   4192 C  CG  . GLU C 1 194 ? 2.573   -23.492 125.620 1.00 38.31 ? 194 GLU C CG  1 
ATOM   4193 C  CD  . GLU C 1 194 ? 1.879   -24.846 125.542 1.00 38.86 ? 194 GLU C CD  1 
ATOM   4194 O  OE1 . GLU C 1 194 ? 2.182   -25.755 124.761 1.00 39.39 ? 194 GLU C OE1 1 
ATOM   4195 O  OE2 . GLU C 1 194 ? 0.951   -24.892 126.388 1.00 38.77 ? 194 GLU C OE2 1 
ATOM   4196 N  N   . LYS C 1 195 ? 1.543   -22.705 121.313 1.00 33.74 ? 195 LYS C N   1 
ATOM   4197 C  CA  . LYS C 1 195 ? 1.345   -21.984 119.999 1.00 33.59 ? 195 LYS C CA  1 
ATOM   4198 C  C   . LYS C 1 195 ? 1.243   -20.502 120.333 1.00 32.40 ? 195 LYS C C   1 
ATOM   4199 O  O   . LYS C 1 195 ? 1.758   -19.664 119.575 1.00 32.60 ? 195 LYS C O   1 
ATOM   4200 C  CB  . LYS C 1 195 ? 0.231   -22.533 119.217 1.00 34.86 ? 195 LYS C CB  1 
ATOM   4201 C  CG  . LYS C 1 195 ? -1.198  -22.088 119.334 1.00 36.51 ? 195 LYS C CG  1 
ATOM   4202 C  CD  . LYS C 1 195 ? -2.168  -22.719 118.271 1.00 36.72 ? 195 LYS C CD  1 
ATOM   4203 C  CE  . LYS C 1 195 ? -2.129  -24.234 118.281 1.00 36.35 ? 195 LYS C CE  1 
ATOM   4204 N  NZ  . LYS C 1 195 ? -0.719  -24.752 118.339 1.00 35.37 ? 195 LYS C NZ  1 
ATOM   4205 N  N   . ARG C 1 196 ? 0.646   -20.250 121.464 1.00 31.00 ? 196 ARG C N   1 
ATOM   4206 C  CA  . ARG C 1 196 ? 0.530   -18.886 121.967 1.00 29.84 ? 196 ARG C CA  1 
ATOM   4207 C  C   . ARG C 1 196 ? 0.698   -19.002 123.511 1.00 28.16 ? 196 ARG C C   1 
ATOM   4208 O  O   . ARG C 1 196 ? 0.385   -20.071 124.030 1.00 29.17 ? 196 ARG C O   1 
ATOM   4209 C  CB  . ARG C 1 196 ? -0.620  -18.009 121.768 1.00 30.57 ? 196 ARG C CB  1 
ATOM   4210 C  CG  . ARG C 1 196 ? -1.666  -18.088 120.754 1.00 31.06 ? 196 ARG C CG  1 
ATOM   4211 C  CD  . ARG C 1 196 ? -1.221  -17.204 119.584 1.00 31.71 ? 196 ARG C CD  1 
ATOM   4212 N  NE  . ARG C 1 196 ? -0.791  -18.131 118.562 1.00 32.92 ? 196 ARG C NE  1 
ATOM   4213 C  CZ  . ARG C 1 196 ? -1.248  -18.234 117.316 1.00 32.21 ? 196 ARG C CZ  1 
ATOM   4214 N  NH1 . ARG C 1 196 ? -1.749  -17.238 116.656 1.00 31.81 ? 196 ARG C NH1 1 
ATOM   4215 N  NH2 . ARG C 1 196 ? -1.159  -19.487 116.834 1.00 33.00 ? 196 ARG C NH2 1 
ATOM   4216 N  N   . TYR C 1 197 ? 1.086   -17.932 124.096 1.00 25.17 ? 197 TYR C N   1 
ATOM   4217 C  CA  . TYR C 1 197 ? 1.316   -17.728 125.485 1.00 22.50 ? 197 TYR C CA  1 
ATOM   4218 C  C   . TYR C 1 197 ? 0.534   -16.546 125.987 1.00 20.67 ? 197 TYR C C   1 
ATOM   4219 O  O   . TYR C 1 197 ? 0.456   -15.557 125.209 1.00 20.76 ? 197 TYR C O   1 
ATOM   4220 C  CB  . TYR C 1 197 ? 2.851   -17.403 125.657 1.00 22.79 ? 197 TYR C CB  1 
ATOM   4221 C  CG  . TYR C 1 197 ? 3.754   -18.568 125.392 1.00 22.60 ? 197 TYR C CG  1 
ATOM   4222 C  CD1 . TYR C 1 197 ? 4.429   -19.207 126.427 1.00 22.45 ? 197 TYR C CD1 1 
ATOM   4223 C  CD2 . TYR C 1 197 ? 3.944   -19.072 124.103 1.00 22.95 ? 197 TYR C CD2 1 
ATOM   4224 C  CE1 . TYR C 1 197 ? 5.244   -20.312 126.224 1.00 22.05 ? 197 TYR C CE1 1 
ATOM   4225 C  CE2 . TYR C 1 197 ? 4.776   -20.175 123.888 1.00 23.02 ? 197 TYR C CE2 1 
ATOM   4226 C  CZ  . TYR C 1 197 ? 5.413   -20.795 124.959 1.00 22.40 ? 197 TYR C CZ  1 
ATOM   4227 O  OH  . TYR C 1 197 ? 6.203   -21.871 124.682 1.00 22.93 ? 197 TYR C OH  1 
ATOM   4228 N  N   . PRO C 1 198 ? 0.012   -16.604 127.186 1.00 18.67 ? 198 PRO C N   1 
ATOM   4229 C  CA  . PRO C 1 198 ? -0.725  -15.513 127.814 1.00 17.46 ? 198 PRO C CA  1 
ATOM   4230 C  C   . PRO C 1 198 ? 0.356   -14.575 128.344 1.00 16.91 ? 198 PRO C C   1 
ATOM   4231 O  O   . PRO C 1 198 ? 1.501   -15.018 128.500 1.00 16.73 ? 198 PRO C O   1 
ATOM   4232 C  CB  . PRO C 1 198 ? -1.543  -16.110 128.885 1.00 16.62 ? 198 PRO C CB  1 
ATOM   4233 C  CG  . PRO C 1 198 ? -0.549  -17.089 129.401 1.00 17.15 ? 198 PRO C CG  1 
ATOM   4234 C  CD  . PRO C 1 198 ? 0.063   -17.709 128.128 1.00 18.47 ? 198 PRO C CD  1 
ATOM   4235 N  N   . PHE C 1 199 ? -0.098  -13.376 128.540 1.00 16.35 ? 199 PHE C N   1 
ATOM   4236 C  CA  . PHE C 1 199 ? 0.806   -12.303 129.013 1.00 15.88 ? 199 PHE C CA  1 
ATOM   4237 C  C   . PHE C 1 199 ? 0.820   -12.474 130.508 1.00 15.75 ? 199 PHE C C   1 
ATOM   4238 O  O   . PHE C 1 199 ? -0.285  -12.624 131.057 1.00 15.97 ? 199 PHE C O   1 
ATOM   4239 C  CB  . PHE C 1 199 ? 0.300   -10.990 128.499 1.00 15.98 ? 199 PHE C CB  1 
ATOM   4240 C  CG  . PHE C 1 199 ? 1.085   -9.837  129.040 1.00 15.59 ? 199 PHE C CG  1 
ATOM   4241 C  CD1 . PHE C 1 199 ? 1.909   -9.141  128.139 1.00 15.60 ? 199 PHE C CD1 1 
ATOM   4242 C  CD2 . PHE C 1 199 ? 0.977   -9.451  130.353 1.00 14.98 ? 199 PHE C CD2 1 
ATOM   4243 C  CE1 . PHE C 1 199 ? 2.675   -8.077  128.569 1.00 15.38 ? 199 PHE C CE1 1 
ATOM   4244 C  CE2 . PHE C 1 199 ? 1.725   -8.361  130.806 1.00 14.89 ? 199 PHE C CE2 1 
ATOM   4245 C  CZ  . PHE C 1 199 ? 2.572   -7.712  129.928 1.00 15.31 ? 199 PHE C CZ  1 
ATOM   4246 N  N   . LYS C 1 200 ? 2.022   -12.476 131.040 1.00 16.09 ? 200 LYS C N   1 
ATOM   4247 C  CA  . LYS C 1 200 ? 2.056   -12.667 132.532 1.00 15.87 ? 200 LYS C CA  1 
ATOM   4248 C  C   . LYS C 1 200 ? 2.834   -11.494 133.086 1.00 15.97 ? 200 LYS C C   1 
ATOM   4249 O  O   . LYS C 1 200 ? 3.741   -10.968 132.388 1.00 15.63 ? 200 LYS C O   1 
ATOM   4250 C  CB  . LYS C 1 200 ? 2.602   -14.016 132.901 1.00 15.62 ? 200 LYS C CB  1 
ATOM   4251 C  CG  . LYS C 1 200 ? 1.661   -15.186 133.111 1.00 15.26 ? 200 LYS C CG  1 
ATOM   4252 C  CD  . LYS C 1 200 ? 0.215   -14.721 133.163 1.00 15.89 ? 200 LYS C CD  1 
ATOM   4253 C  CE  . LYS C 1 200 ? -0.718  -15.536 133.940 1.00 16.19 ? 200 LYS C CE  1 
ATOM   4254 N  NZ  . LYS C 1 200 ? -0.545  -15.461 135.434 1.00 16.09 ? 200 LYS C NZ  1 
ATOM   4255 N  N   . THR C 1 201 ? 2.430   -11.141 134.266 1.00 16.76 ? 201 THR C N   1 
ATOM   4256 C  CA  . THR C 1 201 ? 3.068   -10.071 135.078 1.00 18.38 ? 201 THR C CA  1 
ATOM   4257 C  C   . THR C 1 201 ? 4.219   -10.751 135.817 1.00 18.41 ? 201 THR C C   1 
ATOM   4258 O  O   . THR C 1 201 ? 4.070   -12.003 135.987 1.00 18.38 ? 201 THR C O   1 
ATOM   4259 C  CB  . THR C 1 201 ? 2.057   -9.461  136.048 1.00 18.78 ? 201 THR C CB  1 
ATOM   4260 O  OG1 . THR C 1 201 ? 1.828   -10.613 136.988 1.00 19.55 ? 201 THR C OG1 1 
ATOM   4261 C  CG2 . THR C 1 201 ? 0.723   -9.005  135.475 1.00 19.53 ? 201 THR C CG2 1 
ATOM   4262 N  N   . ALA C 1 202 ? 5.275   -10.135 136.248 1.00 18.71 ? 202 ALA C N   1 
ATOM   4263 C  CA  . ALA C 1 202 ? 6.333   -10.898 136.936 1.00 19.48 ? 202 ALA C CA  1 
ATOM   4264 C  C   . ALA C 1 202 ? 5.810   -11.690 138.153 1.00 19.47 ? 202 ALA C C   1 
ATOM   4265 O  O   . ALA C 1 202 ? 6.012   -12.912 138.327 1.00 19.27 ? 202 ALA C O   1 
ATOM   4266 C  CB  . ALA C 1 202 ? 7.458   -10.026 137.438 1.00 19.70 ? 202 ALA C CB  1 
ATOM   4267 N  N   . THR C 1 203 ? 5.158   -10.900 138.961 1.00 19.46 ? 203 THR C N   1 
ATOM   4268 C  CA  . THR C 1 203 ? 4.609   -11.394 140.226 1.00 20.69 ? 203 THR C CA  1 
ATOM   4269 C  C   . THR C 1 203 ? 3.660   -12.538 139.992 1.00 21.56 ? 203 THR C C   1 
ATOM   4270 O  O   . THR C 1 203 ? 3.769   -13.567 140.725 1.00 21.34 ? 203 THR C O   1 
ATOM   4271 C  CB  . THR C 1 203 ? 3.984   -10.162 140.937 1.00 21.08 ? 203 THR C CB  1 
ATOM   4272 O  OG1 . THR C 1 203 ? 2.538   -10.378 140.906 1.00 21.70 ? 203 THR C OG1 1 
ATOM   4273 C  CG2 . THR C 1 203 ? 4.435   -8.862  140.233 1.00 20.95 ? 203 THR C CG2 1 
ATOM   4274 N  N   . ASP C 1 204 ? 2.758   -12.356 138.979 1.00 22.19 ? 204 ASP C N   1 
ATOM   4275 C  CA  . ASP C 1 204 ? 1.840   -13.496 138.799 1.00 22.41 ? 204 ASP C CA  1 
ATOM   4276 C  C   . ASP C 1 204 ? 2.765   -14.715 138.494 1.00 21.74 ? 204 ASP C C   1 
ATOM   4277 O  O   . ASP C 1 204 ? 2.542   -15.738 139.188 1.00 22.24 ? 204 ASP C O   1 
ATOM   4278 C  CB  . ASP C 1 204 ? 0.708   -13.455 137.801 1.00 23.99 ? 204 ASP C CB  1 
ATOM   4279 C  CG  . ASP C 1 204 ? -0.295  -14.548 138.327 1.00 25.81 ? 204 ASP C CG  1 
ATOM   4280 O  OD1 . ASP C 1 204 ? -1.181  -14.137 139.108 1.00 26.11 ? 204 ASP C OD1 1 
ATOM   4281 O  OD2 . ASP C 1 204 ? -0.140  -15.773 138.017 1.00 26.67 ? 204 ASP C OD2 1 
ATOM   4282 N  N   . TYR C 1 205 ? 3.665   -14.510 137.584 1.00 20.73 ? 205 TYR C N   1 
ATOM   4283 C  CA  . TYR C 1 205 ? 4.588   -15.608 137.183 1.00 20.06 ? 205 TYR C CA  1 
ATOM   4284 C  C   . TYR C 1 205 ? 5.094   -16.305 138.428 1.00 19.11 ? 205 TYR C C   1 
ATOM   4285 O  O   . TYR C 1 205 ? 4.716   -17.420 138.856 1.00 18.38 ? 205 TYR C O   1 
ATOM   4286 C  CB  . TYR C 1 205 ? 5.682   -15.066 136.254 1.00 20.97 ? 205 TYR C CB  1 
ATOM   4287 C  CG  . TYR C 1 205 ? 6.614   -16.189 135.827 1.00 21.94 ? 205 TYR C CG  1 
ATOM   4288 C  CD1 . TYR C 1 205 ? 7.910   -16.220 136.360 1.00 22.59 ? 205 TYR C CD1 1 
ATOM   4289 C  CD2 . TYR C 1 205 ? 6.247   -17.189 134.958 1.00 22.25 ? 205 TYR C CD2 1 
ATOM   4290 C  CE1 . TYR C 1 205 ? 8.824   -17.222 136.045 1.00 22.88 ? 205 TYR C CE1 1 
ATOM   4291 C  CE2 . TYR C 1 205 ? 7.154   -18.200 134.613 1.00 23.10 ? 205 TYR C CE2 1 
ATOM   4292 C  CZ  . TYR C 1 205 ? 8.434   -18.221 135.155 1.00 23.08 ? 205 TYR C CZ  1 
ATOM   4293 O  OH  . TYR C 1 205 ? 9.293   -19.240 134.850 1.00 23.10 ? 205 TYR C OH  1 
ATOM   4294 N  N   . ALA C 1 206 ? 5.954   -15.574 139.053 1.00 18.64 ? 206 ALA C N   1 
ATOM   4295 C  CA  . ALA C 1 206 ? 6.596   -15.927 140.308 1.00 18.83 ? 206 ALA C CA  1 
ATOM   4296 C  C   . ALA C 1 206 ? 5.738   -16.798 141.205 1.00 19.32 ? 206 ALA C C   1 
ATOM   4297 O  O   . ALA C 1 206 ? 6.031   -17.968 141.566 1.00 19.64 ? 206 ALA C O   1 
ATOM   4298 C  CB  . ALA C 1 206 ? 6.838   -14.562 140.914 1.00 18.84 ? 206 ALA C CB  1 
ATOM   4299 N  N   . THR C 1 207 ? 4.621   -16.173 141.616 1.00 18.85 ? 207 THR C N   1 
ATOM   4300 C  CA  . THR C 1 207 ? 3.683   -16.860 142.482 1.00 18.57 ? 207 THR C CA  1 
ATOM   4301 C  C   . THR C 1 207 ? 3.513   -18.265 141.908 1.00 18.15 ? 207 THR C C   1 
ATOM   4302 O  O   . THR C 1 207 ? 3.674   -19.203 142.655 1.00 18.32 ? 207 THR C O   1 
ATOM   4303 C  CB  . THR C 1 207 ? 2.271   -16.246 142.592 1.00 19.47 ? 207 THR C CB  1 
ATOM   4304 O  OG1 . THR C 1 207 ? 2.351   -14.980 143.342 1.00 20.72 ? 207 THR C OG1 1 
ATOM   4305 C  CG2 . THR C 1 207 ? 1.260   -17.188 143.249 1.00 19.81 ? 207 THR C CG2 1 
ATOM   4306 N  N   . ALA C 1 208 ? 3.196   -18.304 140.631 1.00 18.24 ? 208 ALA C N   1 
ATOM   4307 C  CA  . ALA C 1 208 ? 2.931   -19.607 139.957 1.00 18.26 ? 208 ALA C CA  1 
ATOM   4308 C  C   . ALA C 1 208 ? 4.048   -20.619 140.058 1.00 18.30 ? 208 ALA C C   1 
ATOM   4309 O  O   . ALA C 1 208 ? 4.031   -21.819 140.376 1.00 16.70 ? 208 ALA C O   1 
ATOM   4310 C  CB  . ALA C 1 208 ? 2.561   -19.330 138.491 1.00 17.55 ? 208 ALA C CB  1 
ATOM   4311 N  N   . VAL C 1 209 ? 5.191   -20.113 139.706 1.00 20.33 ? 209 VAL C N   1 
ATOM   4312 C  CA  . VAL C 1 209 ? 6.463   -20.824 139.710 1.00 21.59 ? 209 VAL C CA  1 
ATOM   4313 C  C   . VAL C 1 209 ? 6.775   -21.379 141.091 1.00 22.13 ? 209 VAL C C   1 
ATOM   4314 O  O   . VAL C 1 209 ? 7.344   -22.461 141.322 1.00 22.85 ? 209 VAL C O   1 
ATOM   4315 C  CB  . VAL C 1 209 ? 7.555   -19.807 139.332 1.00 21.56 ? 209 VAL C CB  1 
ATOM   4316 C  CG1 . VAL C 1 209 ? 8.830   -20.565 139.121 1.00 21.71 ? 209 VAL C CG1 1 
ATOM   4317 C  CG2 . VAL C 1 209 ? 7.096   -18.933 138.191 1.00 22.21 ? 209 VAL C CG2 1 
ATOM   4318 N  N   . GLY C 1 210 ? 6.418   -20.494 142.029 1.00 22.12 ? 210 GLY C N   1 
ATOM   4319 C  CA  . GLY C 1 210 ? 6.645   -20.857 143.432 1.00 23.01 ? 210 GLY C CA  1 
ATOM   4320 C  C   . GLY C 1 210 ? 5.806   -22.102 143.756 1.00 23.05 ? 210 GLY C C   1 
ATOM   4321 O  O   . GLY C 1 210 ? 6.288   -22.918 144.569 1.00 23.83 ? 210 GLY C O   1 
ATOM   4322 N  N   . VAL C 1 211 ? 4.629   -22.235 143.193 1.00 22.80 ? 211 VAL C N   1 
ATOM   4323 C  CA  . VAL C 1 211 ? 3.842   -23.446 143.527 1.00 23.11 ? 211 VAL C CA  1 
ATOM   4324 C  C   . VAL C 1 211 ? 4.652   -24.628 143.023 1.00 23.37 ? 211 VAL C C   1 
ATOM   4325 O  O   . VAL C 1 211 ? 5.109   -25.461 143.767 1.00 24.38 ? 211 VAL C O   1 
ATOM   4326 C  CB  . VAL C 1 211 ? 2.454   -23.415 142.943 1.00 23.17 ? 211 VAL C CB  1 
ATOM   4327 C  CG1 . VAL C 1 211 ? 1.712   -24.699 143.197 1.00 22.85 ? 211 VAL C CG1 1 
ATOM   4328 C  CG2 . VAL C 1 211 ? 1.704   -22.193 143.479 1.00 23.92 ? 211 VAL C CG2 1 
ATOM   4329 N  N   . ASN C 1 212 ? 4.784   -24.645 141.719 1.00 24.02 ? 212 ASN C N   1 
ATOM   4330 C  CA  . ASN C 1 212 ? 5.620   -25.697 141.109 1.00 24.12 ? 212 ASN C CA  1 
ATOM   4331 C  C   . ASN C 1 212 ? 6.374   -25.028 139.932 1.00 23.63 ? 212 ASN C C   1 
ATOM   4332 O  O   . ASN C 1 212 ? 5.738   -24.472 139.024 1.00 24.62 ? 212 ASN C O   1 
ATOM   4333 C  CB  . ASN C 1 212 ? 4.922   -26.930 140.639 1.00 24.39 ? 212 ASN C CB  1 
ATOM   4334 C  CG  . ASN C 1 212 ? 6.004   -27.892 140.117 1.00 24.46 ? 212 ASN C CG  1 
ATOM   4335 O  OD1 . ASN C 1 212 ? 6.356   -28.807 140.855 1.00 25.00 ? 212 ASN C OD1 1 
ATOM   4336 N  ND2 . ASN C 1 212 ? 6.471   -27.627 138.911 1.00 24.86 ? 212 ASN C ND2 1 
ATOM   4337 N  N   . ALA C 1 213 ? 7.684   -25.177 140.066 1.00 21.89 ? 213 ALA C N   1 
ATOM   4338 C  CA  . ALA C 1 213 ? 8.478   -24.604 139.011 1.00 20.38 ? 213 ALA C CA  1 
ATOM   4339 C  C   . ALA C 1 213 ? 7.921   -25.008 137.664 1.00 19.31 ? 213 ALA C C   1 
ATOM   4340 O  O   . ALA C 1 213 ? 8.390   -24.266 136.773 1.00 19.98 ? 213 ALA C O   1 
ATOM   4341 C  CB  . ALA C 1 213 ? 9.942   -25.102 138.981 1.00 20.25 ? 213 ALA C CB  1 
ATOM   4342 N  N   . ASN C 1 214 ? 7.108   -26.024 137.470 1.00 17.69 ? 214 ASN C N   1 
ATOM   4343 C  CA  . ASN C 1 214 ? 7.000   -26.153 135.937 1.00 16.88 ? 214 ASN C CA  1 
ATOM   4344 C  C   . ASN C 1 214 ? 5.641   -25.951 135.431 1.00 16.56 ? 214 ASN C C   1 
ATOM   4345 O  O   . ASN C 1 214 ? 5.283   -26.310 134.287 1.00 15.65 ? 214 ASN C O   1 
ATOM   4346 C  CB  . ASN C 1 214 ? 7.917   -27.329 135.796 1.00 18.19 ? 214 ASN C CB  1 
ATOM   4347 C  CG  . ASN C 1 214 ? 7.400   -28.697 136.040 1.00 19.01 ? 214 ASN C CG  1 
ATOM   4348 O  OD1 . ASN C 1 214 ? 8.180   -29.617 135.740 1.00 19.15 ? 214 ASN C OD1 1 
ATOM   4349 N  ND2 . ASN C 1 214 ? 6.159   -28.711 136.499 1.00 19.56 ? 214 ASN C ND2 1 
ATOM   4350 N  N   . ILE C 1 215 ? 4.979   -25.153 136.287 1.00 15.90 ? 215 ILE C N   1 
ATOM   4351 C  CA  . ILE C 1 215 ? 3.681   -24.588 135.959 1.00 15.10 ? 215 ILE C CA  1 
ATOM   4352 C  C   . ILE C 1 215 ? 4.139   -23.482 134.940 1.00 15.56 ? 215 ILE C C   1 
ATOM   4353 O  O   . ILE C 1 215 ? 3.625   -23.004 133.963 1.00 15.23 ? 215 ILE C O   1 
ATOM   4354 C  CB  . ILE C 1 215 ? 2.986   -23.992 137.141 1.00 14.39 ? 215 ILE C CB  1 
ATOM   4355 C  CG1 . ILE C 1 215 ? 2.274   -25.108 137.926 1.00 15.20 ? 215 ILE C CG1 1 
ATOM   4356 C  CG2 . ILE C 1 215 ? 1.985   -22.854 136.755 1.00 14.20 ? 215 ILE C CG2 1 
ATOM   4357 C  CD1 . ILE C 1 215 ? 1.288   -24.498 139.007 1.00 15.27 ? 215 ILE C CD1 1 
ATOM   4358 N  N   . GLY C 1 216 ? 5.371   -23.095 135.312 1.00 16.04 ? 216 GLY C N   1 
ATOM   4359 C  CA  . GLY C 1 216 ? 6.098   -22.059 134.584 1.00 17.17 ? 216 GLY C CA  1 
ATOM   4360 C  C   . GLY C 1 216 ? 6.184   -22.412 133.098 1.00 17.38 ? 216 GLY C C   1 
ATOM   4361 O  O   . GLY C 1 216 ? 6.026   -21.494 132.245 1.00 17.02 ? 216 GLY C O   1 
ATOM   4362 N  N   . ASN C 1 217 ? 6.453   -23.730 132.942 1.00 17.06 ? 217 ASN C N   1 
ATOM   4363 C  CA  . ASN C 1 217 ? 6.631   -24.201 131.549 1.00 16.97 ? 217 ASN C CA  1 
ATOM   4364 C  C   . ASN C 1 217 ? 5.522   -23.717 130.633 1.00 16.68 ? 217 ASN C C   1 
ATOM   4365 O  O   . ASN C 1 217 ? 5.943   -23.869 129.492 1.00 16.39 ? 217 ASN C O   1 
ATOM   4366 C  CB  . ASN C 1 217 ? 6.807   -25.676 131.309 1.00 17.38 ? 217 ASN C CB  1 
ATOM   4367 C  CG  . ASN C 1 217 ? 8.224   -26.022 131.736 1.00 17.42 ? 217 ASN C CG  1 
ATOM   4368 O  OD1 . ASN C 1 217 ? 8.278   -27.153 132.208 1.00 18.28 ? 217 ASN C OD1 1 
ATOM   4369 N  ND2 . ASN C 1 217 ? 9.131   -25.099 131.557 1.00 17.11 ? 217 ASN C ND2 1 
ATOM   4370 N  N   . ILE C 1 218 ? 4.387   -23.268 131.024 1.00 17.89 ? 218 ILE C N   1 
ATOM   4371 C  CA  . ILE C 1 218 ? 3.485   -22.672 130.065 1.00 18.41 ? 218 ILE C CA  1 
ATOM   4372 C  C   . ILE C 1 218 ? 3.894   -21.135 129.996 1.00 19.27 ? 218 ILE C C   1 
ATOM   4373 O  O   . ILE C 1 218 ? 4.523   -20.636 129.040 1.00 20.81 ? 218 ILE C O   1 
ATOM   4374 C  CB  . ILE C 1 218 ? 2.016   -22.618 130.322 1.00 18.15 ? 218 ILE C CB  1 
ATOM   4375 C  CG1 . ILE C 1 218 ? 1.614   -23.972 130.898 1.00 18.12 ? 218 ILE C CG1 1 
ATOM   4376 C  CG2 . ILE C 1 218 ? 1.394   -22.127 128.949 1.00 19.25 ? 218 ILE C CG2 1 
ATOM   4377 C  CD1 . ILE C 1 218 ? 0.361   -23.599 131.852 1.00 18.44 ? 218 ILE C CD1 1 
ATOM   4378 N  N   . LEU C 1 219 ? 3.575   -20.390 131.014 1.00 18.57 ? 219 LEU C N   1 
ATOM   4379 C  CA  . LEU C 1 219 ? 3.949   -18.950 131.013 1.00 17.73 ? 219 LEU C CA  1 
ATOM   4380 C  C   . LEU C 1 219 ? 5.143   -18.520 130.199 1.00 16.54 ? 219 LEU C C   1 
ATOM   4381 O  O   . LEU C 1 219 ? 5.001   -17.322 129.712 1.00 16.08 ? 219 LEU C O   1 
ATOM   4382 C  CB  . LEU C 1 219 ? 4.027   -18.667 132.547 1.00 18.24 ? 219 LEU C CB  1 
ATOM   4383 C  CG  . LEU C 1 219 ? 2.831   -19.289 133.295 1.00 18.59 ? 219 LEU C CG  1 
ATOM   4384 C  CD1 . LEU C 1 219 ? 3.045   -19.008 134.772 1.00 19.28 ? 219 LEU C CD1 1 
ATOM   4385 C  CD2 . LEU C 1 219 ? 1.497   -18.728 132.854 1.00 17.93 ? 219 LEU C CD2 1 
ATOM   4386 N  N   . VAL C 1 220 ? 6.228   -19.206 129.969 1.00 15.87 ? 220 VAL C N   1 
ATOM   4387 C  CA  . VAL C 1 220 ? 7.366   -18.683 129.142 1.00 15.96 ? 220 VAL C CA  1 
ATOM   4388 C  C   . VAL C 1 220 ? 7.892   -19.768 128.235 1.00 16.54 ? 220 VAL C C   1 
ATOM   4389 O  O   . VAL C 1 220 ? 7.903   -20.945 128.656 1.00 17.50 ? 220 VAL C O   1 
ATOM   4390 C  CB  . VAL C 1 220 ? 8.459   -18.075 129.990 1.00 16.27 ? 220 VAL C CB  1 
ATOM   4391 C  CG1 . VAL C 1 220 ? 7.857   -16.811 130.689 1.00 17.12 ? 220 VAL C CG1 1 
ATOM   4392 C  CG2 . VAL C 1 220 ? 9.094   -18.974 131.007 1.00 16.25 ? 220 VAL C CG2 1 
ATOM   4393 N  N   . PRO C 1 221 ? 8.271   -19.386 127.027 1.00 16.68 ? 221 PRO C N   1 
ATOM   4394 C  CA  . PRO C 1 221 ? 8.741   -20.339 126.021 1.00 16.46 ? 221 PRO C CA  1 
ATOM   4395 C  C   . PRO C 1 221 ? 10.179  -20.719 126.163 1.00 16.76 ? 221 PRO C C   1 
ATOM   4396 O  O   . PRO C 1 221 ? 10.522  -21.764 125.572 1.00 17.17 ? 221 PRO C O   1 
ATOM   4397 C  CB  . PRO C 1 221 ? 8.497   -19.592 124.715 1.00 16.10 ? 221 PRO C CB  1 
ATOM   4398 C  CG  . PRO C 1 221 ? 8.913   -18.197 125.092 1.00 15.81 ? 221 PRO C CG  1 
ATOM   4399 C  CD  . PRO C 1 221 ? 8.252   -18.033 126.470 1.00 16.57 ? 221 PRO C CD  1 
ATOM   4400 N  N   . ALA C 1 222 ? 10.955  -19.922 126.886 1.00 16.83 ? 222 ALA C N   1 
ATOM   4401 C  CA  . ALA C 1 222 ? 12.398  -20.140 127.060 1.00 16.60 ? 222 ALA C CA  1 
ATOM   4402 C  C   . ALA C 1 222 ? 13.131  -19.121 127.876 1.00 16.74 ? 222 ALA C C   1 
ATOM   4403 O  O   . ALA C 1 222 ? 12.658  -17.916 128.008 1.00 18.07 ? 222 ALA C O   1 
ATOM   4404 C  CB  . ALA C 1 222 ? 12.923  -20.118 125.598 1.00 16.84 ? 222 ALA C CB  1 
ATOM   4405 N  N   . ARG C 1 223 ? 14.270  -19.420 128.454 1.00 16.01 ? 223 ARG C N   1 
ATOM   4406 C  CA  . ARG C 1 223 ? 14.995  -18.409 129.252 1.00 15.76 ? 223 ARG C CA  1 
ATOM   4407 C  C   . ARG C 1 223 ? 16.404  -18.335 128.698 1.00 15.33 ? 223 ARG C C   1 
ATOM   4408 O  O   . ARG C 1 223 ? 16.882  -19.460 128.377 1.00 15.59 ? 223 ARG C O   1 
ATOM   4409 C  CB  . ARG C 1 223 ? 15.097  -18.704 130.718 1.00 17.17 ? 223 ARG C CB  1 
ATOM   4410 C  CG  . ARG C 1 223 ? 15.879  -20.004 131.052 1.00 18.80 ? 223 ARG C CG  1 
ATOM   4411 C  CD  . ARG C 1 223 ? 16.505  -19.778 132.422 1.00 20.22 ? 223 ARG C CD  1 
ATOM   4412 N  NE  . ARG C 1 223 ? 16.919  -21.031 133.043 1.00 21.29 ? 223 ARG C NE  1 
ATOM   4413 C  CZ  . ARG C 1 223 ? 16.030  -21.742 133.786 1.00 22.08 ? 223 ARG C CZ  1 
ATOM   4414 N  NH1 . ARG C 1 223 ? 14.966  -21.112 134.302 1.00 22.49 ? 223 ARG C NH1 1 
ATOM   4415 N  NH2 . ARG C 1 223 ? 16.212  -23.058 133.925 1.00 22.14 ? 223 ARG C NH2 1 
ATOM   4416 N  N   . LEU C 1 224 ? 16.922  -17.133 128.639 1.00 14.10 ? 224 LEU C N   1 
ATOM   4417 C  CA  . LEU C 1 224 ? 18.269  -16.880 128.100 1.00 13.16 ? 224 LEU C CA  1 
ATOM   4418 C  C   . LEU C 1 224 ? 19.273  -17.022 129.223 1.00 14.05 ? 224 LEU C C   1 
ATOM   4419 O  O   . LEU C 1 224 ? 18.937  -16.572 130.324 1.00 15.26 ? 224 LEU C O   1 
ATOM   4420 C  CB  . LEU C 1 224 ? 18.308  -15.521 127.472 1.00 11.39 ? 224 LEU C CB  1 
ATOM   4421 C  CG  . LEU C 1 224 ? 19.579  -14.744 127.291 1.00 10.15 ? 224 LEU C CG  1 
ATOM   4422 C  CD1 . LEU C 1 224 ? 20.482  -15.194 126.165 1.00 8.47  ? 224 LEU C CD1 1 
ATOM   4423 C  CD2 . LEU C 1 224 ? 19.164  -13.281 126.955 1.00 8.84  ? 224 LEU C CD2 1 
ATOM   4424 N  N   . VAL C 1 225 ? 20.401  -17.589 128.957 1.00 14.76 ? 225 VAL C N   1 
ATOM   4425 C  CA  . VAL C 1 225 ? 21.425  -17.786 129.984 1.00 14.91 ? 225 VAL C CA  1 
ATOM   4426 C  C   . VAL C 1 225 ? 22.705  -17.065 129.663 1.00 16.13 ? 225 VAL C C   1 
ATOM   4427 O  O   . VAL C 1 225 ? 23.280  -17.219 128.588 1.00 16.84 ? 225 VAL C O   1 
ATOM   4428 C  CB  . VAL C 1 225 ? 21.685  -19.299 130.116 1.00 14.06 ? 225 VAL C CB  1 
ATOM   4429 C  CG1 . VAL C 1 225 ? 22.945  -19.486 130.937 1.00 12.76 ? 225 VAL C CG1 1 
ATOM   4430 C  CG2 . VAL C 1 225 ? 20.415  -19.939 130.589 1.00 13.51 ? 225 VAL C CG2 1 
ATOM   4431 N  N   . THR C 1 226 ? 23.144  -16.317 130.634 1.00 17.68 ? 226 THR C N   1 
ATOM   4432 C  CA  . THR C 1 226 ? 24.368  -15.511 130.471 1.00 18.43 ? 226 THR C CA  1 
ATOM   4433 C  C   . THR C 1 226 ? 25.491  -15.912 131.371 1.00 18.10 ? 226 THR C C   1 
ATOM   4434 O  O   . THR C 1 226 ? 25.304  -16.222 132.566 1.00 17.23 ? 226 THR C O   1 
ATOM   4435 C  CB  . THR C 1 226 ? 23.847  -14.004 130.634 1.00 18.73 ? 226 THR C CB  1 
ATOM   4436 O  OG1 . THR C 1 226 ? 22.751  -13.869 129.684 1.00 19.10 ? 226 THR C OG1 1 
ATOM   4437 C  CG2 . THR C 1 226 ? 24.932  -12.993 130.393 1.00 19.10 ? 226 THR C CG2 1 
ATOM   4438 N  N   . ALA C 1 227 ? 26.708  -15.882 130.812 1.00 18.54 ? 227 ALA C N   1 
ATOM   4439 C  CA  . ALA C 1 227 ? 27.901  -16.239 131.620 1.00 19.17 ? 227 ALA C CA  1 
ATOM   4440 C  C   . ALA C 1 227 ? 29.029  -15.244 131.364 1.00 20.01 ? 227 ALA C C   1 
ATOM   4441 O  O   . ALA C 1 227 ? 29.265  -14.915 130.189 1.00 20.60 ? 227 ALA C O   1 
ATOM   4442 C  CB  . ALA C 1 227 ? 28.422  -17.623 131.334 1.00 18.08 ? 227 ALA C CB  1 
ATOM   4443 N  N   . MET C 1 228 ? 29.646  -14.859 132.469 1.00 20.98 ? 228 MET C N   1 
ATOM   4444 C  CA  . MET C 1 228 ? 30.803  -13.934 132.385 1.00 21.72 ? 228 MET C CA  1 
ATOM   4445 C  C   . MET C 1 228 ? 31.941  -14.528 133.229 1.00 22.91 ? 228 MET C C   1 
ATOM   4446 O  O   . MET C 1 228 ? 31.824  -14.565 134.440 1.00 22.74 ? 228 MET C O   1 
ATOM   4447 C  CB  . MET C 1 228 ? 30.433  -12.573 132.824 1.00 21.32 ? 228 MET C CB  1 
ATOM   4448 C  CG  . MET C 1 228 ? 29.124  -12.168 132.202 1.00 21.07 ? 228 MET C CG  1 
ATOM   4449 S  SD  . MET C 1 228 ? 29.586  -10.852 130.957 1.00 20.36 ? 228 MET C SD  1 
ATOM   4450 C  CE  . MET C 1 228 ? 28.225  -11.135 129.874 1.00 20.31 ? 228 MET C CE  1 
ATOM   4451 N  N   . GLU C 1 229 ? 32.955  -14.973 132.524 1.00 24.76 ? 229 GLU C N   1 
ATOM   4452 C  CA  . GLU C 1 229 ? 34.151  -15.603 133.110 1.00 26.66 ? 229 GLU C CA  1 
ATOM   4453 C  C   . GLU C 1 229 ? 35.373  -14.790 132.822 1.00 27.97 ? 229 GLU C C   1 
ATOM   4454 O  O   . GLU C 1 229 ? 35.261  -13.535 132.902 1.00 29.29 ? 229 GLU C O   1 
ATOM   4455 C  CB  . GLU C 1 229 ? 34.295  -16.957 132.457 1.00 26.62 ? 229 GLU C CB  1 
ATOM   4456 C  CG  . GLU C 1 229 ? 34.384  -16.690 130.913 1.00 27.44 ? 229 GLU C CG  1 
ATOM   4457 C  CD  . GLU C 1 229 ? 35.376  -17.716 130.408 1.00 27.91 ? 229 GLU C CD  1 
ATOM   4458 O  OE1 . GLU C 1 229 ? 36.527  -17.718 130.769 1.00 28.24 ? 229 GLU C OE1 1 
ATOM   4459 O  OE2 . GLU C 1 229 ? 34.792  -18.504 129.656 1.00 28.82 ? 229 GLU C OE2 1 
ATOM   4460 N  N   . GLY C 1 230 ? 36.522  -15.255 132.486 1.00 28.95 ? 230 GLY C N   1 
ATOM   4461 C  CA  . GLY C 1 230 ? 37.723  -14.575 132.156 1.00 30.66 ? 230 GLY C CA  1 
ATOM   4462 C  C   . GLY C 1 230 ? 38.429  -13.459 132.840 1.00 31.38 ? 230 GLY C C   1 
ATOM   4463 O  O   . GLY C 1 230 ? 39.666  -13.142 132.630 1.00 31.00 ? 230 GLY C O   1 
ATOM   4464 N  N   . GLY C 1 231 ? 37.820  -12.693 133.704 1.00 32.22 ? 231 GLY C N   1 
ATOM   4465 C  CA  . GLY C 1 231 ? 38.248  -11.652 134.401 1.00 34.77 ? 231 GLY C CA  1 
ATOM   4466 C  C   . GLY C 1 231 ? 39.221  -10.766 134.901 1.00 37.36 ? 231 GLY C C   1 
ATOM   4467 O  O   . GLY C 1 231 ? 38.813  -9.502  134.940 1.00 38.79 ? 231 GLY C O   1 
ATOM   4468 N  N   . SER C 1 232 ? 40.414  -11.096 135.383 1.00 38.75 ? 232 SER C N   1 
ATOM   4469 C  CA  . SER C 1 232 ? 41.341  -10.092 135.927 1.00 40.56 ? 232 SER C CA  1 
ATOM   4470 C  C   . SER C 1 232 ? 40.972  -9.431  137.236 1.00 41.84 ? 232 SER C C   1 
ATOM   4471 O  O   . SER C 1 232 ? 41.853  -9.556  138.146 1.00 42.84 ? 232 SER C O   1 
ATOM   4472 C  CB  . SER C 1 232 ? 41.524  -8.989  134.863 1.00 41.06 ? 232 SER C CB  1 
ATOM   4473 O  OG  . SER C 1 232 ? 42.639  -8.172  135.182 1.00 41.80 ? 232 SER C OG  1 
ATOM   4474 N  N   . SER C 1 233 ? 39.920  -8.710  137.478 1.00 43.52 ? 233 SER C N   1 
ATOM   4475 C  CA  . SER C 1 233 ? 39.623  -8.084  138.800 1.00 45.36 ? 233 SER C CA  1 
ATOM   4476 C  C   . SER C 1 233 ? 38.672  -9.036  139.552 1.00 45.82 ? 233 SER C C   1 
ATOM   4477 O  O   . SER C 1 233 ? 37.853  -9.717  138.923 1.00 46.87 ? 233 SER C O   1 
ATOM   4478 C  CB  . SER C 1 233 ? 39.011  -6.710  138.805 1.00 46.19 ? 233 SER C CB  1 
ATOM   4479 O  OG  . SER C 1 233 ? 40.030  -5.668  138.639 1.00 48.54 ? 233 SER C OG  1 
ATOM   4480 N  N   . LYS C 1 234 ? 38.740  -9.093  140.836 1.00 46.16 ? 234 LYS C N   1 
ATOM   4481 C  CA  . LYS C 1 234 ? 37.946  -9.905  141.761 1.00 46.18 ? 234 LYS C CA  1 
ATOM   4482 C  C   . LYS C 1 234 ? 36.617  -9.183  141.976 1.00 45.03 ? 234 LYS C C   1 
ATOM   4483 O  O   . LYS C 1 234 ? 35.557  -9.721  142.270 1.00 45.60 ? 234 LYS C O   1 
ATOM   4484 C  CB  . LYS C 1 234 ? 38.654  -10.125 143.086 1.00 47.98 ? 234 LYS C CB  1 
ATOM   4485 C  CG  . LYS C 1 234 ? 40.132  -9.706  143.111 1.00 49.73 ? 234 LYS C CG  1 
ATOM   4486 C  CD  . LYS C 1 234 ? 40.405  -8.201  143.109 1.00 51.18 ? 234 LYS C CD  1 
ATOM   4487 C  CE  . LYS C 1 234 ? 41.158  -7.623  141.917 1.00 51.80 ? 234 LYS C CE  1 
ATOM   4488 N  NZ  . LYS C 1 234 ? 41.363  -6.128  142.026 1.00 51.96 ? 234 LYS C NZ  1 
ATOM   4489 N  N   . THR C 1 235 ? 36.659  -7.904  141.842 1.00 43.65 ? 235 THR C N   1 
ATOM   4490 C  CA  . THR C 1 235 ? 35.714  -6.849  141.860 1.00 42.64 ? 235 THR C CA  1 
ATOM   4491 C  C   . THR C 1 235 ? 35.188  -6.648  140.442 1.00 41.30 ? 235 THR C C   1 
ATOM   4492 O  O   . THR C 1 235 ? 36.106  -6.567  139.540 1.00 41.80 ? 235 THR C O   1 
ATOM   4493 C  CB  . THR C 1 235 ? 36.376  -5.456  142.189 1.00 43.09 ? 235 THR C CB  1 
ATOM   4494 O  OG1 . THR C 1 235 ? 37.797  -5.807  141.870 1.00 43.83 ? 235 THR C OG1 1 
ATOM   4495 C  CG2 . THR C 1 235 ? 36.199  -4.864  143.547 1.00 43.45 ? 235 THR C CG2 1 
ATOM   4496 N  N   . ALA C 1 236 ? 33.938  -6.473  140.198 1.00 39.09 ? 236 ALA C N   1 
ATOM   4497 C  CA  . ALA C 1 236 ? 33.452  -6.340  138.831 1.00 37.06 ? 236 ALA C CA  1 
ATOM   4498 C  C   . ALA C 1 236 ? 33.844  -5.189  137.935 1.00 35.64 ? 236 ALA C C   1 
ATOM   4499 O  O   . ALA C 1 236 ? 33.663  -4.017  138.306 1.00 36.43 ? 236 ALA C O   1 
ATOM   4500 C  CB  . ALA C 1 236 ? 31.896  -6.267  138.884 1.00 37.00 ? 236 ALA C CB  1 
ATOM   4501 N  N   . VAL C 1 237 ? 34.256  -5.610  136.726 1.00 33.25 ? 237 VAL C N   1 
ATOM   4502 C  CA  . VAL C 1 237 ? 34.598  -4.643  135.677 1.00 31.49 ? 237 VAL C CA  1 
ATOM   4503 C  C   . VAL C 1 237 ? 33.470  -4.628  134.650 1.00 30.53 ? 237 VAL C C   1 
ATOM   4504 O  O   . VAL C 1 237 ? 33.144  -5.702  134.110 1.00 30.25 ? 237 VAL C O   1 
ATOM   4505 C  CB  . VAL C 1 237 ? 35.949  -4.945  135.039 1.00 31.20 ? 237 VAL C CB  1 
ATOM   4506 C  CG1 . VAL C 1 237 ? 36.299  -3.949  133.947 1.00 30.78 ? 237 VAL C CG1 1 
ATOM   4507 C  CG2 . VAL C 1 237 ? 36.964  -5.015  136.151 1.00 31.53 ? 237 VAL C CG2 1 
ATOM   4508 N  N   . ASN C 1 238 ? 32.966  -3.415  134.451 1.00 29.54 ? 238 ASN C N   1 
ATOM   4509 C  CA  . ASN C 1 238 ? 31.860  -3.292  133.466 1.00 28.91 ? 238 ASN C CA  1 
ATOM   4510 C  C   . ASN C 1 238 ? 32.415  -3.479  132.037 1.00 28.03 ? 238 ASN C C   1 
ATOM   4511 O  O   . ASN C 1 238 ? 33.402  -2.854  131.698 1.00 27.65 ? 238 ASN C O   1 
ATOM   4512 C  CB  . ASN C 1 238 ? 31.140  -1.995  133.580 1.00 29.49 ? 238 ASN C CB  1 
ATOM   4513 C  CG  . ASN C 1 238 ? 30.739  -1.537  134.973 1.00 29.53 ? 238 ASN C CG  1 
ATOM   4514 O  OD1 . ASN C 1 238 ? 29.825  -2.109  135.586 1.00 28.86 ? 238 ASN C OD1 1 
ATOM   4515 N  ND2 . ASN C 1 238 ? 31.499  -0.471  135.348 1.00 29.69 ? 238 ASN C ND2 1 
ATOM   4516 N  N   . THR C 1 239 ? 31.721  -4.305  131.268 1.00 27.27 ? 239 THR C N   1 
ATOM   4517 C  CA  . THR C 1 239 ? 32.109  -4.567  129.899 1.00 26.08 ? 239 THR C CA  1 
ATOM   4518 C  C   . THR C 1 239 ? 31.298  -3.976  128.758 1.00 25.00 ? 239 THR C C   1 
ATOM   4519 O  O   . THR C 1 239 ? 31.722  -3.051  128.072 1.00 24.50 ? 239 THR C O   1 
ATOM   4520 C  CB  . THR C 1 239 ? 32.122  -6.134  129.680 1.00 26.07 ? 239 THR C CB  1 
ATOM   4521 O  OG1 . THR C 1 239 ? 33.375  -6.507  130.285 1.00 27.11 ? 239 THR C OG1 1 
ATOM   4522 C  CG2 . THR C 1 239 ? 32.096  -6.503  128.236 1.00 26.61 ? 239 THR C CG2 1 
ATOM   4523 N  N   . GLY C 1 240 ? 30.151  -4.575  128.494 1.00 24.33 ? 240 GLY C N   1 
ATOM   4524 C  CA  . GLY C 1 240 ? 29.237  -4.195  127.398 1.00 22.86 ? 240 GLY C CA  1 
ATOM   4525 C  C   . GLY C 1 240 ? 27.823  -4.087  127.904 1.00 21.74 ? 240 GLY C C   1 
ATOM   4526 O  O   . GLY C 1 240 ? 27.614  -3.834  129.107 1.00 21.76 ? 240 GLY C O   1 
ATOM   4527 N  N   . ARG C 1 241 ? 26.866  -4.235  127.044 1.00 21.46 ? 241 ARG C N   1 
ATOM   4528 C  CA  . ARG C 1 241 ? 25.424  -4.166  127.427 1.00 21.26 ? 241 ARG C CA  1 
ATOM   4529 C  C   . ARG C 1 241 ? 24.717  -4.911  126.303 1.00 20.07 ? 241 ARG C C   1 
ATOM   4530 O  O   . ARG C 1 241 ? 25.414  -4.975  125.229 1.00 20.23 ? 241 ARG C O   1 
ATOM   4531 C  CB  . ARG C 1 241 ? 24.872  -2.808  127.601 1.00 22.86 ? 241 ARG C CB  1 
ATOM   4532 C  CG  . ARG C 1 241 ? 24.928  -1.816  126.469 1.00 25.09 ? 241 ARG C CG  1 
ATOM   4533 C  CD  . ARG C 1 241 ? 25.329  -0.449  127.030 1.00 27.23 ? 241 ARG C CD  1 
ATOM   4534 N  NE  . ARG C 1 241 ? 25.207  0.514   125.908 1.00 29.27 ? 241 ARG C NE  1 
ATOM   4535 C  CZ  . ARG C 1 241 ? 26.234  0.685   125.058 1.00 29.85 ? 241 ARG C CZ  1 
ATOM   4536 N  NH1 . ARG C 1 241 ? 27.309  -0.054  125.364 1.00 31.08 ? 241 ARG C NH1 1 
ATOM   4537 N  NH2 . ARG C 1 241 ? 26.249  1.500   124.018 1.00 29.94 ? 241 ARG C NH2 1 
ATOM   4538 N  N   . LEU C 1 242 ? 23.512  -5.397  126.573 1.00 17.75 ? 242 LEU C N   1 
ATOM   4539 C  CA  . LEU C 1 242 ? 22.943  -6.121  125.368 1.00 15.94 ? 242 LEU C CA  1 
ATOM   4540 C  C   . LEU C 1 242 ? 21.520  -5.624  125.198 1.00 15.14 ? 242 LEU C C   1 
ATOM   4541 O  O   . LEU C 1 242 ? 20.857  -5.222  126.099 1.00 14.49 ? 242 LEU C O   1 
ATOM   4542 C  CB  . LEU C 1 242 ? 23.268  -7.563  125.566 1.00 15.30 ? 242 LEU C CB  1 
ATOM   4543 C  CG  . LEU C 1 242 ? 22.241  -8.590  125.948 1.00 15.09 ? 242 LEU C CG  1 
ATOM   4544 C  CD1 . LEU C 1 242 ? 22.895  -9.982  125.843 1.00 14.92 ? 242 LEU C CD1 1 
ATOM   4545 C  CD2 . LEU C 1 242 ? 21.700  -8.330  127.349 1.00 14.39 ? 242 LEU C CD2 1 
ATOM   4546 N  N   . TYR C 1 243 ? 21.135  -5.692  123.927 1.00 15.06 ? 243 TYR C N   1 
ATOM   4547 C  CA  . TYR C 1 243 ? 19.863  -5.267  123.406 1.00 14.80 ? 243 TYR C CA  1 
ATOM   4548 C  C   . TYR C 1 243 ? 18.996  -6.383  122.899 1.00 15.19 ? 243 TYR C C   1 
ATOM   4549 O  O   . TYR C 1 243 ? 19.447  -7.427  122.419 1.00 15.95 ? 243 TYR C O   1 
ATOM   4550 C  CB  . TYR C 1 243 ? 20.218  -4.277  122.270 1.00 14.19 ? 243 TYR C CB  1 
ATOM   4551 C  CG  . TYR C 1 243 ? 20.892  -2.994  122.701 1.00 13.44 ? 243 TYR C CG  1 
ATOM   4552 C  CD1 . TYR C 1 243 ? 22.240  -2.912  122.956 1.00 13.13 ? 243 TYR C CD1 1 
ATOM   4553 C  CD2 . TYR C 1 243 ? 20.172  -1.826  122.855 1.00 13.33 ? 243 TYR C CD2 1 
ATOM   4554 C  CE1 . TYR C 1 243 ? 22.883  -1.732  123.349 1.00 12.90 ? 243 TYR C CE1 1 
ATOM   4555 C  CE2 . TYR C 1 243 ? 20.757  -0.623  123.257 1.00 13.36 ? 243 TYR C CE2 1 
ATOM   4556 C  CZ  . TYR C 1 243 ? 22.136  -0.587  123.508 1.00 13.16 ? 243 TYR C CZ  1 
ATOM   4557 O  OH  . TYR C 1 243 ? 22.681  0.606   123.879 1.00 12.72 ? 243 TYR C OH  1 
ATOM   4558 N  N   . ALA C 1 244 ? 17.702  -6.147  123.008 1.00 15.66 ? 244 ALA C N   1 
ATOM   4559 C  CA  . ALA C 1 244 ? 16.664  -7.103  122.573 1.00 15.73 ? 244 ALA C CA  1 
ATOM   4560 C  C   . ALA C 1 244 ? 15.975  -6.429  121.376 1.00 16.36 ? 244 ALA C C   1 
ATOM   4561 O  O   . ALA C 1 244 ? 15.817  -5.227  121.322 1.00 15.88 ? 244 ALA C O   1 
ATOM   4562 C  CB  . ALA C 1 244 ? 15.677  -7.489  123.607 1.00 15.08 ? 244 ALA C CB  1 
ATOM   4563 N  N   . SER C 1 245 ? 15.642  -7.340  120.501 1.00 17.96 ? 245 SER C N   1 
ATOM   4564 C  CA  . SER C 1 245 ? 14.994  -6.950  119.202 1.00 19.18 ? 245 SER C CA  1 
ATOM   4565 C  C   . SER C 1 245 ? 14.046  -8.096  118.902 1.00 19.66 ? 245 SER C C   1 
ATOM   4566 O  O   . SER C 1 245 ? 14.435  -9.260  118.706 1.00 19.67 ? 245 SER C O   1 
ATOM   4567 C  CB  . SER C 1 245 ? 16.084  -6.680  118.208 1.00 18.98 ? 245 SER C CB  1 
ATOM   4568 O  OG  . SER C 1 245 ? 17.233  -7.386  118.773 1.00 19.56 ? 245 SER C OG  1 
ATOM   4569 N  N   . TYR C 1 246 ? 12.801  -7.649  118.947 1.00 19.86 ? 246 TYR C N   1 
ATOM   4570 C  CA  . TYR C 1 246 ? 11.645  -8.469  118.778 1.00 19.90 ? 246 TYR C CA  1 
ATOM   4571 C  C   . TYR C 1 246 ? 10.613  -8.004  117.765 1.00 18.86 ? 246 TYR C C   1 
ATOM   4572 O  O   . TYR C 1 246 ? 10.474  -6.858  117.365 1.00 19.61 ? 246 TYR C O   1 
ATOM   4573 C  CB  . TYR C 1 246 ? 10.864  -8.499  120.123 1.00 20.80 ? 246 TYR C CB  1 
ATOM   4574 C  CG  . TYR C 1 246 ? 10.559  -7.142  120.731 1.00 21.39 ? 246 TYR C CG  1 
ATOM   4575 C  CD1 . TYR C 1 246 ? 11.582  -6.410  121.389 1.00 21.50 ? 246 TYR C CD1 1 
ATOM   4576 C  CD2 . TYR C 1 246 ? 9.289   -6.612  120.747 1.00 21.17 ? 246 TYR C CD2 1 
ATOM   4577 C  CE1 . TYR C 1 246 ? 11.336  -5.202  122.024 1.00 21.09 ? 246 TYR C CE1 1 
ATOM   4578 C  CE2 . TYR C 1 246 ? 9.026   -5.384  121.377 1.00 21.62 ? 246 TYR C CE2 1 
ATOM   4579 C  CZ  . TYR C 1 246 ? 10.042  -4.687  122.011 1.00 21.34 ? 246 TYR C CZ  1 
ATOM   4580 O  OH  . TYR C 1 246 ? 9.718   -3.509  122.594 1.00 21.23 ? 246 TYR C OH  1 
ATOM   4581 N  N   . THR C 1 247 ? 9.800   -8.977  117.465 1.00 17.40 ? 247 THR C N   1 
ATOM   4582 C  CA  . THR C 1 247 ? 8.644   -8.855  116.607 1.00 15.96 ? 247 THR C CA  1 
ATOM   4583 C  C   . THR C 1 247 ? 7.651   -9.868  117.204 1.00 14.88 ? 247 THR C C   1 
ATOM   4584 O  O   . THR C 1 247 ? 7.882   -11.080 117.083 1.00 14.62 ? 247 THR C O   1 
ATOM   4585 C  CB  . THR C 1 247 ? 8.817   -9.111  115.098 1.00 15.98 ? 247 THR C CB  1 
ATOM   4586 O  OG1 . THR C 1 247 ? 9.992   -8.381  114.729 1.00 16.34 ? 247 THR C OG1 1 
ATOM   4587 C  CG2 . THR C 1 247 ? 7.577   -8.626  114.343 1.00 16.53 ? 247 THR C CG2 1 
ATOM   4588 N  N   . ILE C 1 248 ? 6.672   -9.261  117.773 1.00 13.79 ? 248 ILE C N   1 
ATOM   4589 C  CA  . ILE C 1 248 ? 5.635   -10.055 118.453 1.00 13.64 ? 248 ILE C CA  1 
ATOM   4590 C  C   . ILE C 1 248 ? 4.258   -9.919  117.922 1.00 14.11 ? 248 ILE C C   1 
ATOM   4591 O  O   . ILE C 1 248 ? 3.925   -8.787  117.482 1.00 14.48 ? 248 ILE C O   1 
ATOM   4592 C  CB  . ILE C 1 248 ? 5.879   -9.381  119.844 1.00 12.98 ? 248 ILE C CB  1 
ATOM   4593 C  CG1 . ILE C 1 248 ? 5.268   -10.116 120.993 1.00 12.71 ? 248 ILE C CG1 1 
ATOM   4594 C  CG2 . ILE C 1 248 ? 5.362   -7.908  119.656 1.00 13.56 ? 248 ILE C CG2 1 
ATOM   4595 C  CD1 . ILE C 1 248 ? 5.238   -9.285  122.308 1.00 12.41 ? 248 ILE C CD1 1 
ATOM   4596 N  N   . ARG C 1 249 ? 3.430   -10.965 117.943 1.00 14.56 ? 249 ARG C N   1 
ATOM   4597 C  CA  . ARG C 1 249 ? 2.055   -10.907 117.506 1.00 15.32 ? 249 ARG C CA  1 
ATOM   4598 C  C   . ARG C 1 249 ? 1.171   -10.488 118.655 1.00 15.73 ? 249 ARG C C   1 
ATOM   4599 O  O   . ARG C 1 249 ? 1.281   -11.289 119.621 1.00 16.68 ? 249 ARG C O   1 
ATOM   4600 C  CB  . ARG C 1 249 ? 1.429   -12.237 117.108 1.00 15.45 ? 249 ARG C CB  1 
ATOM   4601 C  CG  . ARG C 1 249 ? 0.983   -12.180 115.681 1.00 17.18 ? 249 ARG C CG  1 
ATOM   4602 C  CD  . ARG C 1 249 ? 0.936   -13.567 115.099 1.00 19.29 ? 249 ARG C CD  1 
ATOM   4603 N  NE  . ARG C 1 249 ? -0.340  -14.203 115.491 1.00 20.99 ? 249 ARG C NE  1 
ATOM   4604 C  CZ  . ARG C 1 249 ? -1.462  -14.198 114.736 1.00 20.87 ? 249 ARG C CZ  1 
ATOM   4605 N  NH1 . ARG C 1 249 ? -1.592  -13.547 113.583 1.00 20.25 ? 249 ARG C NH1 1 
ATOM   4606 N  NH2 . ARG C 1 249 ? -2.490  -14.935 115.237 1.00 21.10 ? 249 ARG C NH2 1 
ATOM   4607 N  N   . LEU C 1 250 ? 0.403   -9.462  118.623 1.00 16.24 ? 250 LEU C N   1 
ATOM   4608 C  CA  . LEU C 1 250 ? -0.436  -9.222  119.863 1.00 16.69 ? 250 LEU C CA  1 
ATOM   4609 C  C   . LEU C 1 250 ? -1.790  -9.793  119.554 1.00 17.34 ? 250 LEU C C   1 
ATOM   4610 O  O   . LEU C 1 250 ? -2.138  -9.811  118.374 1.00 16.91 ? 250 LEU C O   1 
ATOM   4611 C  CB  . LEU C 1 250 ? -0.284  -7.764  120.204 1.00 16.55 ? 250 LEU C CB  1 
ATOM   4612 C  CG  . LEU C 1 250 ? 0.715   -7.511  121.355 1.00 17.25 ? 250 LEU C CG  1 
ATOM   4613 C  CD1 . LEU C 1 250 ? 1.983   -8.331  121.212 1.00 16.99 ? 250 LEU C CD1 1 
ATOM   4614 C  CD2 . LEU C 1 250 ? 1.037   -6.022  121.362 1.00 16.97 ? 250 LEU C CD2 1 
ATOM   4615 N  N   . ILE C 1 251 ? -2.552  -10.246 120.578 1.00 19.08 ? 251 ILE C N   1 
ATOM   4616 C  CA  . ILE C 1 251 ? -3.844  -10.795 120.152 1.00 19.70 ? 251 ILE C CA  1 
ATOM   4617 C  C   . ILE C 1 251 ? -5.046  -10.771 120.977 1.00 20.19 ? 251 ILE C C   1 
ATOM   4618 O  O   . ILE C 1 251 ? -6.012  -11.083 120.077 1.00 22.31 ? 251 ILE C O   1 
ATOM   4619 C  CB  . ILE C 1 251 ? -3.488  -12.269 119.670 1.00 20.34 ? 251 ILE C CB  1 
ATOM   4620 C  CG1 . ILE C 1 251 ? -4.123  -12.216 118.229 1.00 21.62 ? 251 ILE C CG1 1 
ATOM   4621 C  CG2 . ILE C 1 251 ? -3.982  -13.461 120.434 1.00 20.63 ? 251 ILE C CG2 1 
ATOM   4622 C  CD1 . ILE C 1 251 ? -3.099  -12.651 117.129 1.00 22.86 ? 251 ILE C CD1 1 
ATOM   4623 N  N   . GLU C 1 252 ? -5.413  -10.512 122.122 1.00 20.09 ? 252 GLU C N   1 
ATOM   4624 C  CA  . GLU C 1 252 ? -7.064  -10.629 122.291 1.00 19.65 ? 252 GLU C CA  1 
ATOM   4625 C  C   . GLU C 1 252 ? -7.154  -9.612  123.398 1.00 20.33 ? 252 GLU C C   1 
ATOM   4626 O  O   . GLU C 1 252 ? -6.911  -9.787  124.603 1.00 20.78 ? 252 GLU C O   1 
ATOM   4627 C  CB  . GLU C 1 252 ? -7.373  -12.009 122.246 1.00 18.14 ? 252 GLU C CB  1 
ATOM   4628 C  CG  . GLU C 1 252 ? -7.006  -13.325 122.617 1.00 17.52 ? 252 GLU C CG  1 
ATOM   4629 C  CD  . GLU C 1 252 ? -7.364  -14.563 121.896 1.00 17.72 ? 252 GLU C CD  1 
ATOM   4630 O  OE1 . GLU C 1 252 ? -7.213  -15.729 122.268 1.00 18.13 ? 252 GLU C OE1 1 
ATOM   4631 O  OE2 . GLU C 1 252 ? -7.860  -14.337 120.782 1.00 17.70 ? 252 GLU C OE2 1 
ATOM   4632 N  N   . PRO C 1 253 ? -7.353  -8.396  122.868 1.00 20.12 ? 253 PRO C N   1 
ATOM   4633 C  CA  . PRO C 1 253 ? -7.389  -7.171  123.670 1.00 20.34 ? 253 PRO C CA  1 
ATOM   4634 C  C   . PRO C 1 253 ? -8.150  -7.389  124.972 1.00 21.15 ? 253 PRO C C   1 
ATOM   4635 O  O   . PRO C 1 253 ? -9.213  -8.079  124.964 1.00 21.46 ? 253 PRO C O   1 
ATOM   4636 C  CB  . PRO C 1 253 ? -7.970  -6.146  122.735 1.00 19.68 ? 253 PRO C CB  1 
ATOM   4637 C  CG  . PRO C 1 253 ? -8.596  -6.948  121.648 1.00 19.53 ? 253 PRO C CG  1 
ATOM   4638 C  CD  . PRO C 1 253 ? -7.611  -8.105  121.453 1.00 19.52 ? 253 PRO C CD  1 
ATOM   4639 N  N   . ILE C 1 254 ? -7.566  -6.811  126.005 1.00 21.26 ? 254 ILE C N   1 
ATOM   4640 C  CA  . ILE C 1 254 ? -8.040  -6.813  127.378 1.00 21.83 ? 254 ILE C CA  1 
ATOM   4641 C  C   . ILE C 1 254 ? -7.649  -5.492  128.034 1.00 22.20 ? 254 ILE C C   1 
ATOM   4642 O  O   . ILE C 1 254 ? -6.598  -5.035  127.512 1.00 22.68 ? 254 ILE C O   1 
ATOM   4643 C  CB  . ILE C 1 254 ? -7.455  -7.996  128.174 1.00 22.09 ? 254 ILE C CB  1 
ATOM   4644 C  CG1 . ILE C 1 254 ? -8.048  -7.914  129.622 1.00 22.71 ? 254 ILE C CG1 1 
ATOM   4645 C  CG2 . ILE C 1 254 ? -5.909  -8.031  128.175 1.00 21.73 ? 254 ILE C CG2 1 
ATOM   4646 C  CD1 . ILE C 1 254 ? -7.674  -9.161  130.505 1.00 23.03 ? 254 ILE C CD1 1 
ATOM   4647 N  N   . ALA C 1 255 ? -8.341  -4.921  128.990 1.00 22.33 ? 255 ALA C N   1 
ATOM   4648 C  CA  . ALA C 1 255 ? -7.817  -3.620  129.551 1.00 22.52 ? 255 ALA C CA  1 
ATOM   4649 C  C   . ALA C 1 255 ? -6.612  -4.041  130.414 1.00 22.61 ? 255 ALA C C   1 
ATOM   4650 O  O   . ALA C 1 255 ? -6.682  -5.163  130.892 1.00 21.99 ? 255 ALA C O   1 
ATOM   4651 C  CB  . ALA C 1 255 ? -8.744  -2.825  130.338 1.00 22.92 ? 255 ALA C CB  1 
ATOM   4652 N  N   . ALA C 1 256 ? -5.641  -3.163  130.511 1.00 23.58 ? 256 ALA C N   1 
ATOM   4653 C  CA  . ALA C 1 256 ? -4.418  -3.602  131.292 1.00 23.95 ? 256 ALA C CA  1 
ATOM   4654 C  C   . ALA C 1 256 ? -4.835  -3.991  132.693 1.00 24.20 ? 256 ALA C C   1 
ATOM   4655 O  O   . ALA C 1 256 ? -4.635  -5.172  133.130 1.00 25.21 ? 256 ALA C O   1 
ATOM   4656 C  CB  . ALA C 1 256 ? -3.363  -2.542  131.189 1.00 24.01 ? 256 ALA C CB  1 
ATOM   4657 N  N   . ALA C 1 257 ? -5.419  -3.058  133.424 1.00 23.60 ? 257 ALA C N   1 
ATOM   4658 C  CA  . ALA C 1 257 ? -5.856  -3.415  134.781 1.00 22.69 ? 257 ALA C CA  1 
ATOM   4659 C  C   . ALA C 1 257 ? -6.283  -4.866  134.886 1.00 21.80 ? 257 ALA C C   1 
ATOM   4660 O  O   . ALA C 1 257 ? -5.930  -5.405  135.952 1.00 22.16 ? 257 ALA C O   1 
ATOM   4661 C  CB  . ALA C 1 257 ? -7.017  -2.565  135.238 1.00 23.36 ? 257 ALA C CB  1 
ATOM   4662 N  N   . LEU C 1 258 ? -6.967  -5.497  133.980 1.00 21.19 ? 258 LEU C N   1 
ATOM   4663 C  CA  . LEU C 1 258 ? -7.359  -6.909  134.236 1.00 20.99 ? 258 LEU C CA  1 
ATOM   4664 C  C   . LEU C 1 258 ? -6.357  -7.983  133.929 1.00 21.00 ? 258 LEU C C   1 
ATOM   4665 O  O   . LEU C 1 258 ? -6.534  -9.170  134.365 1.00 20.78 ? 258 LEU C O   1 
ATOM   4666 C  CB  . LEU C 1 258 ? -8.652  -7.081  133.411 1.00 21.09 ? 258 LEU C CB  1 
ATOM   4667 C  CG  . LEU C 1 258 ? -9.772  -6.118  133.647 1.00 21.63 ? 258 LEU C CG  1 
ATOM   4668 C  CD1 . LEU C 1 258 ? -11.051 -6.473  132.850 1.00 21.71 ? 258 LEU C CD1 1 
ATOM   4669 C  CD2 . LEU C 1 258 ? -10.215 -6.137  135.112 1.00 21.75 ? 258 LEU C CD2 1 
ATOM   4670 N  N   . ASN C 1 259 ? -5.325  -7.659  133.180 1.00 21.02 ? 259 ASN C N   1 
ATOM   4671 C  CA  . ASN C 1 259 ? -4.313  -8.606  132.757 1.00 21.08 ? 259 ASN C CA  1 
ATOM   4672 C  C   . ASN C 1 259 ? -3.281  -8.827  133.865 1.00 21.39 ? 259 ASN C C   1 
ATOM   4673 O  O   . ASN C 1 259 ? -2.695  -7.831  134.309 1.00 21.94 ? 259 ASN C O   1 
ATOM   4674 C  CB  . ASN C 1 259 ? -3.587  -8.162  131.505 1.00 21.22 ? 259 ASN C CB  1 
ATOM   4675 C  CG  . ASN C 1 259 ? -2.862  -9.266  130.769 1.00 22.34 ? 259 ASN C CG  1 
ATOM   4676 O  OD1 . ASN C 1 259 ? -2.632  -10.442 131.144 1.00 22.22 ? 259 ASN C OD1 1 
ATOM   4677 N  ND2 . ASN C 1 259 ? -2.459  -8.799  129.547 1.00 22.79 ? 259 ASN C ND2 1 
ATOM   4678 N  N   . LEU C 1 260 ? -3.107  -10.074 134.198 1.00 21.48 ? 260 LEU C N   1 
ATOM   4679 C  CA  . LEU C 1 260 ? -2.099  -10.492 135.141 1.00 21.90 ? 260 LEU C CA  1 
ATOM   4680 C  C   . LEU C 1 260 ? -1.261  -11.569 134.364 1.00 23.17 ? 260 LEU C C   1 
ATOM   4681 O  O   . LEU C 1 260 ? -1.693  -11.968 133.269 1.00 23.86 ? 260 LEU C O   1 
ATOM   4682 C  CB  . LEU C 1 260 ? -2.541  -11.105 136.431 1.00 20.74 ? 260 LEU C CB  1 
ATOM   4683 C  CG  . LEU C 1 260 ? -3.649  -10.446 137.203 1.00 19.70 ? 260 LEU C CG  1 
ATOM   4684 C  CD1 . LEU C 1 260 ? -4.530  -11.516 137.828 1.00 19.71 ? 260 LEU C CD1 1 
ATOM   4685 C  CD2 . LEU C 1 260 ? -3.065  -9.599  138.303 1.00 19.53 ? 260 LEU C CD2 1 
ATOM   4686 O  OXT . LEU C 1 260 ? -0.266  -11.912 135.005 1.00 24.57 ? 260 LEU C OXT 1 
HETATM 4687 CA CA  . CA  D 2 .   ? -10.440 -36.005 131.769 1.00 27.22 ? 261 CA  A CA  1 
HETATM 4688 CA CA  . CA  E 2 .   ? -2.626  -12.452 131.627 1.00 16.55 ? 261 CA  B CA  1 
HETATM 4689 CA CA  . CA  F 2 .   ? 14.199  -30.910 131.562 1.00 20.89 ? 261 CA  C CA  1 
HETATM 4690 O  O   . HOH G 3 .   ? 23.465  -29.443 111.059 1.00 70.24 ? 262 HOH A O   1 
HETATM 4691 O  O   . HOH G 3 .   ? -2.569  -48.734 140.551 1.00 88.72 ? 263 HOH A O   1 
HETATM 4692 O  O   . HOH G 3 .   ? 6.988   -46.401 129.456 1.00 42.07 ? 264 HOH A O   1 
HETATM 4693 O  O   . HOH G 3 .   ? -16.952 -52.571 135.378 1.00 83.93 ? 265 HOH A O   1 
HETATM 4694 O  O   . HOH G 3 .   ? -3.577  -47.034 118.227 1.00 63.81 ? 266 HOH A O   1 
HETATM 4695 O  O   . HOH G 3 .   ? 0.712   -39.745 136.910 1.00 30.53 ? 267 HOH A O   1 
HETATM 4696 O  O   . HOH G 3 .   ? -0.187  -34.154 127.760 1.00 31.01 ? 268 HOH A O   1 
HETATM 4697 O  O   . HOH G 3 .   ? -2.281  -35.804 126.350 1.00 25.37 ? 269 HOH A O   1 
HETATM 4698 O  O   . HOH G 3 .   ? -1.451  -73.744 143.029 1.00 82.97 ? 270 HOH A O   1 
HETATM 4699 O  O   . HOH G 3 .   ? 0.962   -71.662 144.962 1.00 53.06 ? 271 HOH A O   1 
HETATM 4700 O  O   . HOH G 3 .   ? 18.785  -25.905 111.553 1.00 67.59 ? 272 HOH A O   1 
HETATM 4701 O  O   . HOH G 3 .   ? -4.465  -40.891 138.665 1.00 74.90 ? 273 HOH A O   1 
HETATM 4702 O  O   . HOH G 3 .   ? 17.521  -52.521 117.914 1.00 65.10 ? 274 HOH A O   1 
HETATM 4703 O  O   . HOH G 3 .   ? 4.721   -36.265 120.308 1.00 57.17 ? 275 HOH A O   1 
HETATM 4704 O  O   . HOH G 3 .   ? -2.025  -73.605 134.117 1.00 55.74 ? 276 HOH A O   1 
HETATM 4705 O  O   . HOH H 3 .   ? -21.400 -19.212 136.268 1.00 31.46 ? 262 HOH B O   1 
HETATM 4706 O  O   . HOH H 3 .   ? -21.216 -21.953 129.170 1.00 34.17 ? 263 HOH B O   1 
HETATM 4707 O  O   . HOH H 3 .   ? -36.963 -17.056 121.657 1.00 53.43 ? 264 HOH B O   1 
HETATM 4708 O  O   . HOH H 3 .   ? -19.565 -2.872  137.975 1.00 38.59 ? 265 HOH B O   1 
HETATM 4709 O  O   . HOH H 3 .   ? -20.087 0.305   137.051 1.00 68.92 ? 266 HOH B O   1 
HETATM 4710 O  O   . HOH H 3 .   ? -20.691 -22.026 137.178 1.00 86.61 ? 267 HOH B O   1 
HETATM 4711 O  O   . HOH H 3 .   ? -5.411  -20.274 126.817 1.00 55.36 ? 268 HOH B O   1 
HETATM 4712 O  O   . HOH H 3 .   ? -28.563 -10.543 135.868 1.00 63.50 ? 269 HOH B O   1 
HETATM 4713 O  O   . HOH H 3 .   ? -27.834 -16.557 134.992 1.00 85.43 ? 270 HOH B O   1 
HETATM 4714 O  O   . HOH H 3 .   ? -10.061 -46.456 118.392 1.00 83.46 ? 271 HOH B O   1 
HETATM 4715 O  O   . HOH I 3 .   ? 32.782  -31.159 126.680 1.00 31.39 ? 262 HOH C O   1 
HETATM 4716 O  O   . HOH I 3 .   ? 26.924  -8.437  134.911 1.00 28.47 ? 263 HOH C O   1 
HETATM 4717 O  O   . HOH I 3 .   ? 21.831  -16.478 139.238 1.00 78.15 ? 264 HOH C O   1 
HETATM 4718 O  O   . HOH I 3 .   ? 22.046  -9.230  134.318 1.00 69.64 ? 265 HOH C O   1 
HETATM 4719 O  O   . HOH I 3 .   ? 33.282  -29.160 133.445 1.00 45.75 ? 266 HOH C O   1 
HETATM 4720 O  O   . HOH I 3 .   ? 24.023  -16.990 117.972 1.00 52.15 ? 267 HOH C O   1 
HETATM 4721 O  O   . HOH I 3 .   ? 11.881  -18.941 136.411 1.00 77.95 ? 268 HOH C O   1 
HETATM 4722 O  O   . HOH I 3 .   ? 7.623   -23.586 127.259 1.00 17.13 ? 269 HOH C O   1 
HETATM 4723 O  O   . HOH I 3 .   ? 9.837   -23.946 124.512 1.00 26.88 ? 270 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   ARG 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   THR 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   ?   ?   ?   A . n 
A 1 7   LYS 7   7   ?   ?   ?   A . n 
A 1 8   GLN 8   8   ?   ?   ?   A . n 
A 1 9   LEU 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  GLN 11  11  ?   ?   ?   A . n 
A 1 12  ALA 12  12  ?   ?   ?   A . n 
A 1 13  ILE 13  13  ?   ?   ?   A . n 
A 1 14  GLN 14  14  ?   ?   ?   A . n 
A 1 15  ASN 15  15  ?   ?   ?   A . n 
A 1 16  THR 16  16  ?   ?   ?   A . n 
A 1 17  LEU 17  17  ?   ?   ?   A . n 
A 1 18  PRO 18  18  ?   ?   ?   A . n 
A 1 19  ASN 19  19  ?   ?   ?   A . n 
A 1 20  PRO 20  20  ?   ?   ?   A . n 
A 1 21  PRO 21  21  ?   ?   ?   A . n 
A 1 22  ARG 22  22  ?   ?   ?   A . n 
A 1 23  ARG 23  23  ?   ?   ?   A . n 
A 1 24  LYS 24  24  ?   ?   ?   A . n 
A 1 25  ARG 25  25  ?   ?   ?   A . n 
A 1 26  ARG 26  26  ?   ?   ?   A . n 
A 1 27  ALA 27  27  ?   ?   ?   A . n 
A 1 28  LYS 28  28  ?   ?   ?   A . n 
A 1 29  ARG 29  29  ?   ?   ?   A . n 
A 1 30  ARG 30  30  ?   ?   ?   A . n 
A 1 31  ALA 31  31  ?   ?   ?   A . n 
A 1 32  ALA 32  32  ?   ?   ?   A . n 
A 1 33  GLN 33  33  ?   ?   ?   A . n 
A 1 34  VAL 34  34  ?   ?   ?   A . n 
A 1 35  PRO 35  35  ?   ?   ?   A . n 
A 1 36  LYS 36  36  ?   ?   ?   A . n 
A 1 37  PRO 37  37  ?   ?   ?   A . n 
A 1 38  THR 38  38  ?   ?   ?   A . n 
A 1 39  GLN 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  GLY 41  41  ?   ?   ?   A . n 
A 1 42  VAL 42  42  ?   ?   ?   A . n 
A 1 43  SER 43  43  ?   ?   ?   A . n 
A 1 44  MET 44  44  ?   ?   ?   A . n 
A 1 45  ALA 45  45  ?   ?   ?   A . n 
A 1 46  PRO 46  46  ?   ?   ?   A . n 
A 1 47  ILE 47  47  ?   ?   ?   A . n 
A 1 48  ALA 48  48  ?   ?   ?   A . n 
A 1 49  GLN 49  49  ?   ?   ?   A . n 
A 1 50  GLY 50  50  ?   ?   ?   A . n 
A 1 51  THR 51  51  ?   ?   ?   A . n 
A 1 52  MET 52  52  ?   ?   ?   A . n 
A 1 53  VAL 53  53  ?   ?   ?   A . n 
A 1 54  LYS 54  54  ?   ?   ?   A . n 
A 1 55  LEU 55  55  ?   ?   ?   A . n 
A 1 56  ARG 56  56  ?   ?   ?   A . n 
A 1 57  PRO 57  57  ?   ?   ?   A . n 
A 1 58  PRO 58  58  ?   ?   ?   A . n 
A 1 59  MET 59  59  ?   ?   ?   A . n 
A 1 60  LEU 60  60  ?   ?   ?   A . n 
A 1 61  ARG 61  61  ?   ?   ?   A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  MET 64  64  64  MET MET A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  HIS 71  71  71  HIS HIS A . n 
A 1 72  CYS 72  72  72  CYS CYS A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  ALA 79  79  79  ALA ALA A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  THR 81  81  81  THR THR A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  VAL 91  91  91  VAL VAL A . n 
A 1 92  MET 92  92  92  MET MET A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  PHE 94  94  94  PHE PHE A . n 
A 1 95  THR 95  95  95  THR THR A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  TRP 99  99  99  TRP TRP A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 TRP 107 107 107 TRP TRP A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 PRO 121 121 121 PRO PRO A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 CYS 123 123 123 CYS CYS A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 THR 125 125 125 THR THR A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 SER 128 128 128 SER SER A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ILE 131 131 131 ILE ILE A . n 
A 1 132 HIS 132 132 132 HIS HIS A . n 
A 1 133 MET 133 133 133 MET MET A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 GLN 136 136 136 GLN GLN A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 ASN 148 148 148 ASN ASN A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 TRP 162 162 162 TRP TRP A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 GLY 164 164 164 GLY GLY A . n 
A 1 165 GLN 165 165 165 GLN GLN A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 CYS 169 169 169 CYS CYS A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ASN 172 172 172 ASN ASN A . n 
A 1 173 ASN 173 173 173 ASN ASN A . n 
A 1 174 THR 174 174 174 THR THR A . n 
A 1 175 LYS 175 175 175 LYS LYS A . n 
A 1 176 CYS 176 176 176 CYS CYS A . n 
A 1 177 PRO 177 177 177 PRO PRO A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 THR 179 179 179 THR THR A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 ALA 182 182 182 ALA ALA A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 THR 184 184 184 THR THR A . n 
A 1 185 ILE 185 185 185 ILE ILE A . n 
A 1 186 ALA 186 186 186 ALA ALA A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 VAL 192 192 192 VAL VAL A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 LYS 195 195 195 LYS LYS A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 PRO 198 198 198 PRO PRO A . n 
A 1 199 PHE 199 199 199 PHE PHE A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 TYR 205 205 205 TYR TYR A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 THR 207 207 207 THR THR A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 ASN 212 212 212 ASN ASN A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 ASN 214 214 214 ASN ASN A . n 
A 1 215 ILE 215 215 215 ILE ILE A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 ASN 217 217 217 ASN ASN A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 VAL 220 220 220 VAL VAL A . n 
A 1 221 PRO 221 221 221 PRO PRO A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ARG 223 223 223 ARG ARG A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 ALA 227 227 227 ALA ALA A . n 
A 1 228 MET 228 228 228 MET MET A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 SER 233 233 233 SER SER A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 THR 235 235 235 THR THR A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 ASN 238 238 238 ASN ASN A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 ARG 241 241 241 ARG ARG A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 TYR 243 243 243 TYR TYR A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 TYR 246 246 246 TYR TYR A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 ILE 248 248 248 ILE ILE A . n 
A 1 249 ARG 249 249 249 ARG ARG A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 GLU 252 252 252 GLU GLU A . n 
A 1 253 PRO 253 253 253 PRO PRO A . n 
A 1 254 ILE 254 254 254 ILE ILE A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 ALA 256 256 256 ALA ALA A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 ASN 259 259 259 ASN ASN A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
B 1 1   ALA 1   1   ?   ?   ?   B . n 
B 1 2   THR 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   LEU 4   4   ?   ?   ?   B . n 
B 1 5   THR 5   5   ?   ?   ?   B . n 
B 1 6   LYS 6   6   ?   ?   ?   B . n 
B 1 7   LYS 7   7   ?   ?   ?   B . n 
B 1 8   GLN 8   8   ?   ?   ?   B . n 
B 1 9   LEU 9   9   ?   ?   ?   B . n 
B 1 10  ALA 10  10  ?   ?   ?   B . n 
B 1 11  GLN 11  11  ?   ?   ?   B . n 
B 1 12  ALA 12  12  ?   ?   ?   B . n 
B 1 13  ILE 13  13  ?   ?   ?   B . n 
B 1 14  GLN 14  14  ?   ?   ?   B . n 
B 1 15  ASN 15  15  ?   ?   ?   B . n 
B 1 16  THR 16  16  ?   ?   ?   B . n 
B 1 17  LEU 17  17  ?   ?   ?   B . n 
B 1 18  PRO 18  18  ?   ?   ?   B . n 
B 1 19  ASN 19  19  ?   ?   ?   B . n 
B 1 20  PRO 20  20  ?   ?   ?   B . n 
B 1 21  PRO 21  21  ?   ?   ?   B . n 
B 1 22  ARG 22  22  ?   ?   ?   B . n 
B 1 23  ARG 23  23  ?   ?   ?   B . n 
B 1 24  LYS 24  24  ?   ?   ?   B . n 
B 1 25  ARG 25  25  ?   ?   ?   B . n 
B 1 26  ARG 26  26  ?   ?   ?   B . n 
B 1 27  ALA 27  27  ?   ?   ?   B . n 
B 1 28  LYS 28  28  ?   ?   ?   B . n 
B 1 29  ARG 29  29  ?   ?   ?   B . n 
B 1 30  ARG 30  30  ?   ?   ?   B . n 
B 1 31  ALA 31  31  ?   ?   ?   B . n 
B 1 32  ALA 32  32  ?   ?   ?   B . n 
B 1 33  GLN 33  33  ?   ?   ?   B . n 
B 1 34  VAL 34  34  ?   ?   ?   B . n 
B 1 35  PRO 35  35  ?   ?   ?   B . n 
B 1 36  LYS 36  36  ?   ?   ?   B . n 
B 1 37  PRO 37  37  ?   ?   ?   B . n 
B 1 38  THR 38  38  ?   ?   ?   B . n 
B 1 39  GLN 39  39  ?   ?   ?   B . n 
B 1 40  ALA 40  40  ?   ?   ?   B . n 
B 1 41  GLY 41  41  ?   ?   ?   B . n 
B 1 42  VAL 42  42  ?   ?   ?   B . n 
B 1 43  SER 43  43  ?   ?   ?   B . n 
B 1 44  MET 44  44  ?   ?   ?   B . n 
B 1 45  ALA 45  45  ?   ?   ?   B . n 
B 1 46  PRO 46  46  ?   ?   ?   B . n 
B 1 47  ILE 47  47  ?   ?   ?   B . n 
B 1 48  ALA 48  48  ?   ?   ?   B . n 
B 1 49  GLN 49  49  ?   ?   ?   B . n 
B 1 50  GLY 50  50  ?   ?   ?   B . n 
B 1 51  THR 51  51  ?   ?   ?   B . n 
B 1 52  MET 52  52  ?   ?   ?   B . n 
B 1 53  VAL 53  53  ?   ?   ?   B . n 
B 1 54  LYS 54  54  ?   ?   ?   B . n 
B 1 55  LEU 55  55  ?   ?   ?   B . n 
B 1 56  ARG 56  56  ?   ?   ?   B . n 
B 1 57  PRO 57  57  ?   ?   ?   B . n 
B 1 58  PRO 58  58  ?   ?   ?   B . n 
B 1 59  MET 59  59  ?   ?   ?   B . n 
B 1 60  LEU 60  60  ?   ?   ?   B . n 
B 1 61  ARG 61  61  ?   ?   ?   B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  MET 64  64  64  MET MET B . n 
B 1 65  ASP 65  65  65  ASP ASP B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  THR 67  67  67  THR THR B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  SER 70  70  70  SER SER B . n 
B 1 71  HIS 71  71  71  HIS HIS B . n 
B 1 72  CYS 72  72  72  CYS CYS B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  THR 76  76  76  THR THR B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  LEU 78  78  78  LEU LEU B . n 
B 1 79  ALA 79  79  79  ALA ALA B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  THR 81  81  81  THR THR B . n 
B 1 82  VAL 82  82  82  VAL VAL B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  ILE 84  84  84  ILE ILE B . n 
B 1 85  VAL 85  85  85  VAL VAL B . n 
B 1 86  VAL 86  86  86  VAL VAL B . n 
B 1 87  THR 87  87  87  THR THR B . n 
B 1 88  SER 88  88  88  SER SER B . n 
B 1 89  GLU 89  89  89  GLU GLU B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  VAL 91  91  91  VAL VAL B . n 
B 1 92  MET 92  92  92  MET MET B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  PHE 94  94  94  PHE PHE B . n 
B 1 95  THR 95  95  95  THR THR B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  TRP 99  99  99  TRP TRP B . n 
B 1 100 LEU 100 100 100 LEU LEU B . n 
B 1 101 ARG 101 101 101 ARG ARG B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 VAL 103 103 103 VAL VAL B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 GLN 105 105 105 GLN GLN B . n 
B 1 106 ASN 106 106 106 ASN ASN B . n 
B 1 107 TRP 107 107 107 TRP TRP B . n 
B 1 108 SER 108 108 108 SER SER B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 TRP 112 112 112 TRP TRP B . n 
B 1 113 VAL 113 113 113 VAL VAL B . n 
B 1 114 ALA 114 114 114 ALA ALA B . n 
B 1 115 ILE 115 115 115 ILE ILE B . n 
B 1 116 ARG 116 116 116 ARG ARG B . n 
B 1 117 TYR 117 117 117 TYR TYR B . n 
B 1 118 THR 118 118 118 THR THR B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 LEU 120 120 120 LEU LEU B . n 
B 1 121 PRO 121 121 121 PRO PRO B . n 
B 1 122 SER 122 122 122 SER SER B . n 
B 1 123 CYS 123 123 123 CYS CYS B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 THR 125 125 125 THR THR B . n 
B 1 126 THR 126 126 126 THR THR B . n 
B 1 127 THR 127 127 127 THR THR B . n 
B 1 128 SER 128 128 128 SER SER B . n 
B 1 129 GLY 129 129 129 GLY GLY B . n 
B 1 130 ALA 130 130 130 ALA ALA B . n 
B 1 131 ILE 131 131 131 ILE ILE B . n 
B 1 132 HIS 132 132 132 HIS HIS B . n 
B 1 133 MET 133 133 133 MET MET B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 PHE 135 135 135 PHE PHE B . n 
B 1 136 GLN 136 136 136 GLN GLN B . n 
B 1 137 TYR 137 137 137 TYR TYR B . n 
B 1 138 ASP 138 138 138 ASP ASP B . n 
B 1 139 MET 139 139 139 MET MET B . n 
B 1 140 ALA 140 140 140 ALA ALA B . n 
B 1 141 ASP 141 141 141 ASP ASP B . n 
B 1 142 THR 142 142 142 THR THR B . n 
B 1 143 LEU 143 143 143 LEU LEU B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 ASN 148 148 148 ASN ASN B . n 
B 1 149 GLN 149 149 149 GLN GLN B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 SER 151 151 151 SER SER B . n 
B 1 152 ASN 152 152 152 ASN ASN B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 LYS 154 154 154 LYS LYS B . n 
B 1 155 GLY 155 155 155 GLY GLY B . n 
B 1 156 TYR 156 156 156 TYR TYR B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 GLY 159 159 159 GLY GLY B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 TRP 162 162 162 TRP TRP B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 GLY 164 164 164 GLY GLY B . n 
B 1 165 GLN 165 165 165 GLN GLN B . n 
B 1 166 SER 166 166 166 SER SER B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 LEU 168 168 168 LEU LEU B . n 
B 1 169 CYS 169 169 169 CYS CYS B . n 
B 1 170 PHE 170 170 170 PHE PHE B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 ASN 172 172 172 ASN ASN B . n 
B 1 173 ASN 173 173 173 ASN ASN B . n 
B 1 174 THR 174 174 174 THR THR B . n 
B 1 175 LYS 175 175 175 LYS LYS B . n 
B 1 176 CYS 176 176 176 CYS CYS B . n 
B 1 177 PRO 177 177 177 PRO PRO B . n 
B 1 178 ASP 178 178 178 ASP ASP B . n 
B 1 179 THR 179 179 179 THR THR B . n 
B 1 180 SER 180 180 180 SER SER B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 ALA 182 182 182 ALA ALA B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 THR 184 184 184 THR THR B . n 
B 1 185 ILE 185 185 185 ILE ILE B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 ASP 188 188 188 ASP ASP B . n 
B 1 189 THR 189 189 189 THR THR B . n 
B 1 190 ASN 190 190 190 ASN ASN B . n 
B 1 191 GLU 191 191 191 GLU GLU B . n 
B 1 192 VAL 192 192 192 VAL VAL B . n 
B 1 193 SER 193 193 193 SER SER B . n 
B 1 194 GLU 194 194 194 GLU GLU B . n 
B 1 195 LYS 195 195 195 LYS LYS B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 TYR 197 197 197 TYR TYR B . n 
B 1 198 PRO 198 198 198 PRO PRO B . n 
B 1 199 PHE 199 199 199 PHE PHE B . n 
B 1 200 LYS 200 200 200 LYS LYS B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 THR 203 203 203 THR THR B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 TYR 205 205 205 TYR TYR B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 THR 207 207 207 THR THR B . n 
B 1 208 ALA 208 208 208 ALA ALA B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 ASN 212 212 212 ASN ASN B . n 
B 1 213 ALA 213 213 213 ALA ALA B . n 
B 1 214 ASN 214 214 214 ASN ASN B . n 
B 1 215 ILE 215 215 215 ILE ILE B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 ASN 217 217 217 ASN ASN B . n 
B 1 218 ILE 218 218 218 ILE ILE B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 VAL 220 220 220 VAL VAL B . n 
B 1 221 PRO 221 221 221 PRO PRO B . n 
B 1 222 ALA 222 222 222 ALA ALA B . n 
B 1 223 ARG 223 223 223 ARG ARG B . n 
B 1 224 LEU 224 224 224 LEU LEU B . n 
B 1 225 VAL 225 225 225 VAL VAL B . n 
B 1 226 THR 226 226 226 THR THR B . n 
B 1 227 ALA 227 227 227 ALA ALA B . n 
B 1 228 MET 228 228 228 MET MET B . n 
B 1 229 GLU 229 229 229 GLU GLU B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 GLY 231 231 231 GLY GLY B . n 
B 1 232 SER 232 232 232 SER SER B . n 
B 1 233 SER 233 233 233 SER SER B . n 
B 1 234 LYS 234 234 234 LYS LYS B . n 
B 1 235 THR 235 235 235 THR THR B . n 
B 1 236 ALA 236 236 236 ALA ALA B . n 
B 1 237 VAL 237 237 237 VAL VAL B . n 
B 1 238 ASN 238 238 238 ASN ASN B . n 
B 1 239 THR 239 239 239 THR THR B . n 
B 1 240 GLY 240 240 240 GLY GLY B . n 
B 1 241 ARG 241 241 241 ARG ARG B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 TYR 243 243 243 TYR TYR B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 SER 245 245 245 SER SER B . n 
B 1 246 TYR 246 246 246 TYR TYR B . n 
B 1 247 THR 247 247 247 THR THR B . n 
B 1 248 ILE 248 248 248 ILE ILE B . n 
B 1 249 ARG 249 249 249 ARG ARG B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 ILE 251 251 251 ILE ILE B . n 
B 1 252 GLU 252 252 252 GLU GLU B . n 
B 1 253 PRO 253 253 253 PRO PRO B . n 
B 1 254 ILE 254 254 254 ILE ILE B . n 
B 1 255 ALA 255 255 255 ALA ALA B . n 
B 1 256 ALA 256 256 256 ALA ALA B . n 
B 1 257 ALA 257 257 257 ALA ALA B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 ASN 259 259 259 ASN ASN B . n 
B 1 260 LEU 260 260 260 LEU LEU B . n 
C 1 1   ALA 1   1   ?   ?   ?   C . n 
C 1 2   THR 2   2   ?   ?   ?   C . n 
C 1 3   ARG 3   3   ?   ?   ?   C . n 
C 1 4   LEU 4   4   ?   ?   ?   C . n 
C 1 5   THR 5   5   ?   ?   ?   C . n 
C 1 6   LYS 6   6   ?   ?   ?   C . n 
C 1 7   LYS 7   7   ?   ?   ?   C . n 
C 1 8   GLN 8   8   ?   ?   ?   C . n 
C 1 9   LEU 9   9   ?   ?   ?   C . n 
C 1 10  ALA 10  10  ?   ?   ?   C . n 
C 1 11  GLN 11  11  ?   ?   ?   C . n 
C 1 12  ALA 12  12  ?   ?   ?   C . n 
C 1 13  ILE 13  13  ?   ?   ?   C . n 
C 1 14  GLN 14  14  ?   ?   ?   C . n 
C 1 15  ASN 15  15  ?   ?   ?   C . n 
C 1 16  THR 16  16  ?   ?   ?   C . n 
C 1 17  LEU 17  17  ?   ?   ?   C . n 
C 1 18  PRO 18  18  ?   ?   ?   C . n 
C 1 19  ASN 19  19  ?   ?   ?   C . n 
C 1 20  PRO 20  20  ?   ?   ?   C . n 
C 1 21  PRO 21  21  ?   ?   ?   C . n 
C 1 22  ARG 22  22  ?   ?   ?   C . n 
C 1 23  ARG 23  23  ?   ?   ?   C . n 
C 1 24  LYS 24  24  ?   ?   ?   C . n 
C 1 25  ARG 25  25  ?   ?   ?   C . n 
C 1 26  ARG 26  26  ?   ?   ?   C . n 
C 1 27  ALA 27  27  ?   ?   ?   C . n 
C 1 28  LYS 28  28  ?   ?   ?   C . n 
C 1 29  ARG 29  29  ?   ?   ?   C . n 
C 1 30  ARG 30  30  ?   ?   ?   C . n 
C 1 31  ALA 31  31  ?   ?   ?   C . n 
C 1 32  ALA 32  32  ?   ?   ?   C . n 
C 1 33  GLN 33  33  ?   ?   ?   C . n 
C 1 34  VAL 34  34  ?   ?   ?   C . n 
C 1 35  PRO 35  35  ?   ?   ?   C . n 
C 1 36  LYS 36  36  ?   ?   ?   C . n 
C 1 37  PRO 37  37  ?   ?   ?   C . n 
C 1 38  THR 38  38  ?   ?   ?   C . n 
C 1 39  GLN 39  39  39  GLN GLN C . n 
C 1 40  ALA 40  40  40  ALA ALA C . n 
C 1 41  GLY 41  41  41  GLY GLY C . n 
C 1 42  VAL 42  42  42  VAL VAL C . n 
C 1 43  SER 43  43  43  SER SER C . n 
C 1 44  MET 44  44  44  MET MET C . n 
C 1 45  ALA 45  45  45  ALA ALA C . n 
C 1 46  PRO 46  46  46  PRO PRO C . n 
C 1 47  ILE 47  47  47  ILE ILE C . n 
C 1 48  ALA 48  48  48  ALA ALA C . n 
C 1 49  GLN 49  49  49  GLN GLN C . n 
C 1 50  GLY 50  50  50  GLY GLY C . n 
C 1 51  THR 51  51  51  THR THR C . n 
C 1 52  MET 52  52  52  MET MET C . n 
C 1 53  VAL 53  53  53  VAL VAL C . n 
C 1 54  LYS 54  54  54  LYS LYS C . n 
C 1 55  LEU 55  55  55  LEU LEU C . n 
C 1 56  ARG 56  56  56  ARG ARG C . n 
C 1 57  PRO 57  57  57  PRO PRO C . n 
C 1 58  PRO 58  58  58  PRO PRO C . n 
C 1 59  MET 59  59  59  MET MET C . n 
C 1 60  LEU 60  60  60  LEU LEU C . n 
C 1 61  ARG 61  61  61  ARG ARG C . n 
C 1 62  SER 62  62  62  SER SER C . n 
C 1 63  SER 63  63  63  SER SER C . n 
C 1 64  MET 64  64  64  MET MET C . n 
C 1 65  ASP 65  65  65  ASP ASP C . n 
C 1 66  VAL 66  66  66  VAL VAL C . n 
C 1 67  THR 67  67  67  THR THR C . n 
C 1 68  ILE 68  68  68  ILE ILE C . n 
C 1 69  LEU 69  69  69  LEU LEU C . n 
C 1 70  SER 70  70  70  SER SER C . n 
C 1 71  HIS 71  71  71  HIS HIS C . n 
C 1 72  CYS 72  72  72  CYS CYS C . n 
C 1 73  GLU 73  73  73  GLU GLU C . n 
C 1 74  LEU 74  74  74  LEU LEU C . n 
C 1 75  SER 75  75  75  SER SER C . n 
C 1 76  THR 76  76  76  THR THR C . n 
C 1 77  GLU 77  77  77  GLU GLU C . n 
C 1 78  LEU 78  78  78  LEU LEU C . n 
C 1 79  ALA 79  79  79  ALA ALA C . n 
C 1 80  VAL 80  80  80  VAL VAL C . n 
C 1 81  THR 81  81  81  THR THR C . n 
C 1 82  VAL 82  82  82  VAL VAL C . n 
C 1 83  THR 83  83  83  THR THR C . n 
C 1 84  ILE 84  84  84  ILE ILE C . n 
C 1 85  VAL 85  85  85  VAL VAL C . n 
C 1 86  VAL 86  86  86  VAL VAL C . n 
C 1 87  THR 87  87  87  THR THR C . n 
C 1 88  SER 88  88  88  SER SER C . n 
C 1 89  GLU 89  89  89  GLU GLU C . n 
C 1 90  LEU 90  90  90  LEU LEU C . n 
C 1 91  VAL 91  91  91  VAL VAL C . n 
C 1 92  MET 92  92  92  MET MET C . n 
C 1 93  PRO 93  93  93  PRO PRO C . n 
C 1 94  PHE 94  94  94  PHE PHE C . n 
C 1 95  THR 95  95  95  THR THR C . n 
C 1 96  VAL 96  96  96  VAL VAL C . n 
C 1 97  GLY 97  97  97  GLY GLY C . n 
C 1 98  THR 98  98  98  THR THR C . n 
C 1 99  TRP 99  99  99  TRP TRP C . n 
C 1 100 LEU 100 100 100 LEU LEU C . n 
C 1 101 ARG 101 101 101 ARG ARG C . n 
C 1 102 GLY 102 102 102 GLY GLY C . n 
C 1 103 VAL 103 103 103 VAL VAL C . n 
C 1 104 ALA 104 104 104 ALA ALA C . n 
C 1 105 GLN 105 105 105 GLN GLN C . n 
C 1 106 ASN 106 106 106 ASN ASN C . n 
C 1 107 TRP 107 107 107 TRP TRP C . n 
C 1 108 SER 108 108 108 SER SER C . n 
C 1 109 LYS 109 109 109 LYS LYS C . n 
C 1 110 TYR 110 110 110 TYR TYR C . n 
C 1 111 ALA 111 111 111 ALA ALA C . n 
C 1 112 TRP 112 112 112 TRP TRP C . n 
C 1 113 VAL 113 113 113 VAL VAL C . n 
C 1 114 ALA 114 114 114 ALA ALA C . n 
C 1 115 ILE 115 115 115 ILE ILE C . n 
C 1 116 ARG 116 116 116 ARG ARG C . n 
C 1 117 TYR 117 117 117 TYR TYR C . n 
C 1 118 THR 118 118 118 THR THR C . n 
C 1 119 TYR 119 119 119 TYR TYR C . n 
C 1 120 LEU 120 120 120 LEU LEU C . n 
C 1 121 PRO 121 121 121 PRO PRO C . n 
C 1 122 SER 122 122 122 SER SER C . n 
C 1 123 CYS 123 123 123 CYS CYS C . n 
C 1 124 PRO 124 124 124 PRO PRO C . n 
C 1 125 THR 125 125 125 THR THR C . n 
C 1 126 THR 126 126 126 THR THR C . n 
C 1 127 THR 127 127 127 THR THR C . n 
C 1 128 SER 128 128 128 SER SER C . n 
C 1 129 GLY 129 129 129 GLY GLY C . n 
C 1 130 ALA 130 130 130 ALA ALA C . n 
C 1 131 ILE 131 131 131 ILE ILE C . n 
C 1 132 HIS 132 132 132 HIS HIS C . n 
C 1 133 MET 133 133 133 MET MET C . n 
C 1 134 GLY 134 134 134 GLY GLY C . n 
C 1 135 PHE 135 135 135 PHE PHE C . n 
C 1 136 GLN 136 136 136 GLN GLN C . n 
C 1 137 TYR 137 137 137 TYR TYR C . n 
C 1 138 ASP 138 138 138 ASP ASP C . n 
C 1 139 MET 139 139 139 MET MET C . n 
C 1 140 ALA 140 140 140 ALA ALA C . n 
C 1 141 ASP 141 141 141 ASP ASP C . n 
C 1 142 THR 142 142 142 THR THR C . n 
C 1 143 LEU 143 143 143 LEU LEU C . n 
C 1 144 PRO 144 144 144 PRO PRO C . n 
C 1 145 VAL 145 145 145 VAL VAL C . n 
C 1 146 SER 146 146 146 SER SER C . n 
C 1 147 VAL 147 147 147 VAL VAL C . n 
C 1 148 ASN 148 148 148 ASN ASN C . n 
C 1 149 GLN 149 149 149 GLN GLN C . n 
C 1 150 LEU 150 150 150 LEU LEU C . n 
C 1 151 SER 151 151 151 SER SER C . n 
C 1 152 ASN 152 152 152 ASN ASN C . n 
C 1 153 LEU 153 153 153 LEU LEU C . n 
C 1 154 LYS 154 154 154 LYS LYS C . n 
C 1 155 GLY 155 155 155 GLY GLY C . n 
C 1 156 TYR 156 156 156 TYR TYR C . n 
C 1 157 VAL 157 157 157 VAL VAL C . n 
C 1 158 THR 158 158 158 THR THR C . n 
C 1 159 GLY 159 159 159 GLY GLY C . n 
C 1 160 PRO 160 160 160 PRO PRO C . n 
C 1 161 VAL 161 161 161 VAL VAL C . n 
C 1 162 TRP 162 162 162 TRP TRP C . n 
C 1 163 GLU 163 163 163 GLU GLU C . n 
C 1 164 GLY 164 164 164 GLY GLY C . n 
C 1 165 GLN 165 165 165 GLN GLN C . n 
C 1 166 SER 166 166 166 SER SER C . n 
C 1 167 GLY 167 167 167 GLY GLY C . n 
C 1 168 LEU 168 168 168 LEU LEU C . n 
C 1 169 CYS 169 169 169 CYS CYS C . n 
C 1 170 PHE 170 170 170 PHE PHE C . n 
C 1 171 VAL 171 171 171 VAL VAL C . n 
C 1 172 ASN 172 172 172 ASN ASN C . n 
C 1 173 ASN 173 173 173 ASN ASN C . n 
C 1 174 THR 174 174 174 THR THR C . n 
C 1 175 LYS 175 175 175 LYS LYS C . n 
C 1 176 CYS 176 176 176 CYS CYS C . n 
C 1 177 PRO 177 177 177 PRO PRO C . n 
C 1 178 ASP 178 178 178 ASP ASP C . n 
C 1 179 THR 179 179 179 THR THR C . n 
C 1 180 SER 180 180 180 SER SER C . n 
C 1 181 ARG 181 181 181 ARG ARG C . n 
C 1 182 ALA 182 182 182 ALA ALA C . n 
C 1 183 ILE 183 183 183 ILE ILE C . n 
C 1 184 THR 184 184 184 THR THR C . n 
C 1 185 ILE 185 185 185 ILE ILE C . n 
C 1 186 ALA 186 186 186 ALA ALA C . n 
C 1 187 LEU 187 187 187 LEU LEU C . n 
C 1 188 ASP 188 188 188 ASP ASP C . n 
C 1 189 THR 189 189 189 THR THR C . n 
C 1 190 ASN 190 190 190 ASN ASN C . n 
C 1 191 GLU 191 191 191 GLU GLU C . n 
C 1 192 VAL 192 192 192 VAL VAL C . n 
C 1 193 SER 193 193 193 SER SER C . n 
C 1 194 GLU 194 194 194 GLU GLU C . n 
C 1 195 LYS 195 195 195 LYS LYS C . n 
C 1 196 ARG 196 196 196 ARG ARG C . n 
C 1 197 TYR 197 197 197 TYR TYR C . n 
C 1 198 PRO 198 198 198 PRO PRO C . n 
C 1 199 PHE 199 199 199 PHE PHE C . n 
C 1 200 LYS 200 200 200 LYS LYS C . n 
C 1 201 THR 201 201 201 THR THR C . n 
C 1 202 ALA 202 202 202 ALA ALA C . n 
C 1 203 THR 203 203 203 THR THR C . n 
C 1 204 ASP 204 204 204 ASP ASP C . n 
C 1 205 TYR 205 205 205 TYR TYR C . n 
C 1 206 ALA 206 206 206 ALA ALA C . n 
C 1 207 THR 207 207 207 THR THR C . n 
C 1 208 ALA 208 208 208 ALA ALA C . n 
C 1 209 VAL 209 209 209 VAL VAL C . n 
C 1 210 GLY 210 210 210 GLY GLY C . n 
C 1 211 VAL 211 211 211 VAL VAL C . n 
C 1 212 ASN 212 212 212 ASN ASN C . n 
C 1 213 ALA 213 213 213 ALA ALA C . n 
C 1 214 ASN 214 214 214 ASN ASN C . n 
C 1 215 ILE 215 215 215 ILE ILE C . n 
C 1 216 GLY 216 216 216 GLY GLY C . n 
C 1 217 ASN 217 217 217 ASN ASN C . n 
C 1 218 ILE 218 218 218 ILE ILE C . n 
C 1 219 LEU 219 219 219 LEU LEU C . n 
C 1 220 VAL 220 220 220 VAL VAL C . n 
C 1 221 PRO 221 221 221 PRO PRO C . n 
C 1 222 ALA 222 222 222 ALA ALA C . n 
C 1 223 ARG 223 223 223 ARG ARG C . n 
C 1 224 LEU 224 224 224 LEU LEU C . n 
C 1 225 VAL 225 225 225 VAL VAL C . n 
C 1 226 THR 226 226 226 THR THR C . n 
C 1 227 ALA 227 227 227 ALA ALA C . n 
C 1 228 MET 228 228 228 MET MET C . n 
C 1 229 GLU 229 229 229 GLU GLU C . n 
C 1 230 GLY 230 230 230 GLY GLY C . n 
C 1 231 GLY 231 231 231 GLY GLY C . n 
C 1 232 SER 232 232 232 SER SER C . n 
C 1 233 SER 233 233 233 SER SER C . n 
C 1 234 LYS 234 234 234 LYS LYS C . n 
C 1 235 THR 235 235 235 THR THR C . n 
C 1 236 ALA 236 236 236 ALA ALA C . n 
C 1 237 VAL 237 237 237 VAL VAL C . n 
C 1 238 ASN 238 238 238 ASN ASN C . n 
C 1 239 THR 239 239 239 THR THR C . n 
C 1 240 GLY 240 240 240 GLY GLY C . n 
C 1 241 ARG 241 241 241 ARG ARG C . n 
C 1 242 LEU 242 242 242 LEU LEU C . n 
C 1 243 TYR 243 243 243 TYR TYR C . n 
C 1 244 ALA 244 244 244 ALA ALA C . n 
C 1 245 SER 245 245 245 SER SER C . n 
C 1 246 TYR 246 246 246 TYR TYR C . n 
C 1 247 THR 247 247 247 THR THR C . n 
C 1 248 ILE 248 248 248 ILE ILE C . n 
C 1 249 ARG 249 249 249 ARG ARG C . n 
C 1 250 LEU 250 250 250 LEU LEU C . n 
C 1 251 ILE 251 251 251 ILE ILE C . n 
C 1 252 GLU 252 252 252 GLU GLU C . n 
C 1 253 PRO 253 253 253 PRO PRO C . n 
C 1 254 ILE 254 254 254 ILE ILE C . n 
C 1 255 ALA 255 255 255 ALA ALA C . n 
C 1 256 ALA 256 256 256 ALA ALA C . n 
C 1 257 ALA 257 257 257 ALA ALA C . n 
C 1 258 LEU 258 258 258 LEU LEU C . n 
C 1 259 ASN 259 259 259 ASN ASN C . n 
C 1 260 LEU 260 260 260 LEU LEU C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 CA  1  261 1  CA  CA  A . 
E 2 CA  1  261 1  CA  CA  B . 
F 2 CA  1  261 1  CA  CA  C . 
G 3 HOH 1  262 2  HOH HOH A . 
G 3 HOH 2  263 4  HOH HOH A . 
G 3 HOH 3  264 8  HOH HOH A . 
G 3 HOH 4  265 9  HOH HOH A . 
G 3 HOH 5  266 10 HOH HOH A . 
G 3 HOH 6  267 12 HOH HOH A . 
G 3 HOH 7  268 13 HOH HOH A . 
G 3 HOH 8  269 14 HOH HOH A . 
G 3 HOH 9  270 15 HOH HOH A . 
G 3 HOH 10 271 16 HOH HOH A . 
G 3 HOH 11 272 17 HOH HOH A . 
G 3 HOH 12 273 18 HOH HOH A . 
G 3 HOH 13 274 19 HOH HOH A . 
G 3 HOH 14 275 20 HOH HOH A . 
G 3 HOH 15 276 21 HOH HOH A . 
H 3 HOH 1  262 2  HOH HOH B . 
H 3 HOH 2  263 3  HOH HOH B . 
H 3 HOH 3  264 4  HOH HOH B . 
H 3 HOH 4  265 5  HOH HOH B . 
H 3 HOH 5  266 6  HOH HOH B . 
H 3 HOH 6  267 7  HOH HOH B . 
H 3 HOH 7  268 9  HOH HOH B . 
H 3 HOH 8  269 10 HOH HOH B . 
H 3 HOH 9  270 11 HOH HOH B . 
H 3 HOH 10 271 12 HOH HOH B . 
I 3 HOH 1  262 8  HOH HOH C . 
I 3 HOH 2  263 2  HOH HOH C . 
I 3 HOH 3  264 3  HOH HOH C . 
I 3 HOH 4  265 4  HOH HOH C . 
I 3 HOH 5  266 5  HOH HOH C . 
I 3 HOH 6  267 6  HOH HOH C . 
I 3 HOH 7  268 7  HOH HOH C . 
I 3 HOH 8  269 8  HOH HOH C . 
I 3 HOH 9  270 9  HOH HOH C . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'complete icosahedral assembly'                ? 180-meric      180 
2 'icosahedral asymmetric unit'                  ? trimeric       3   
3 'icosahedral pentamer'                         ? pentadecameric 15  
4 'icosahedral 23 hexamer'                       ? octadecameric  18  
5 'icosahedral asymmetric unit, std point frame' ? trimeric       3   
6 'crystal asymmetric unit, crystal frame'       ? 90-meric       90  
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-60)'                       A,B,C,D,E,F,G,H,I 
2 1                              A,B,C,D,E,F,G,H,I 
3 '(1-5)'                        A,B,C,D,E,F,G,H,I 
4 '(1,2,6,10,23,24)'             A,B,C,D,E,F,G,H,I 
5 P                              A,B,C,D,E,F,G,H,I 
6 '(X0)(1-10,21-25,31-35,41-50)' A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
P  'transform to point frame'   ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000 
X0 'transform to crystal frame' ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  -0.93417197 0.35682300  0.00000 
0.00000000  0.35682300  0.93417197  0.00000 
1  'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000 
2  'point symmetry operation'   ? ? 0.30901699  -0.80901699 -0.50000000 0.00000 0.80901699  0.50000000  -0.30901699 0.00000 
0.50000000  -0.30901699 0.80901699  0.00000 
3  'point symmetry operation'   ? ? -0.80901699 -0.50000000 -0.30901699 0.00000 0.50000000  -0.30901699 -0.80901699 0.00000 
0.30901699  -0.80901699 0.50000000  0.00000 
4  'point symmetry operation'   ? ? -0.80901699 0.50000000  0.30901699  0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 
-0.30901699 -0.80901699 0.50000000  0.00000 
5  'point symmetry operation'   ? ? 0.30901699  0.80901699  0.50000000  0.00000 -0.80901699 0.50000000  -0.30901699 0.00000 
-0.50000000 -0.30901699 0.80901699  0.00000 
6  'point symmetry operation'   ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  1.00000000  0.00000 
7  'point symmetry operation'   ? ? -0.30901699 0.80901699  0.50000000  0.00000 -0.80901699 -0.50000000 0.30901699  0.00000 
0.50000000  -0.30901699 0.80901699  0.00000 
8  'point symmetry operation'   ? ? 0.80901699  0.50000000  0.30901699  0.00000 -0.50000000 0.30901699  0.80901699  0.00000 
0.30901699  -0.80901699 0.50000000  0.00000 
9  'point symmetry operation'   ? ? 0.80901699  -0.50000000 -0.30901699 0.00000 0.50000000  0.30901699  0.80901699  0.00000 
-0.30901699 -0.80901699 0.50000000  0.00000 
10 'point symmetry operation'   ? ? -0.30901699 -0.80901699 -0.50000000 0.00000 0.80901699  -0.50000000 0.30901699  0.00000 
-0.50000000 -0.30901699 0.80901699  0.00000 
11 'point symmetry operation'   ? ? -1.00000000 0.00000000  0.00000000  0.00000 0.00000000  1.00000000  0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000 
12 'point symmetry operation'   ? ? -0.30901699 0.80901699  0.50000000  0.00000 0.80901699  0.50000000  -0.30901699 0.00000 
-0.50000000 0.30901699  -0.80901699 0.00000 
13 'point symmetry operation'   ? ? 0.80901699  0.50000000  0.30901699  0.00000 0.50000000  -0.30901699 -0.80901699 0.00000 
-0.30901699 0.80901699  -0.50000000 0.00000 
14 'point symmetry operation'   ? ? 0.80901699  -0.50000000 -0.30901699 0.00000 -0.50000000 -0.30901699 -0.80901699 0.00000 
0.30901699  0.80901699  -0.50000000 0.00000 
15 'point symmetry operation'   ? ? -0.30901699 -0.80901699 -0.50000000 0.00000 -0.80901699 0.50000000  -0.30901699 0.00000 
0.50000000  0.30901699  -0.80901699 0.00000 
16 'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000 0.00000000  -1.00000000 0.00000000  0.00000 
0.00000000  0.00000000  -1.00000000 0.00000 
17 'point symmetry operation'   ? ? 0.30901699  -0.80901699 -0.50000000 0.00000 -0.80901699 -0.50000000 0.30901699  0.00000 
-0.50000000 0.30901699  -0.80901699 0.00000 
18 'point symmetry operation'   ? ? -0.80901699 -0.50000000 -0.30901699 0.00000 -0.50000000 0.30901699  0.80901699  0.00000 
-0.30901699 0.80901699  -0.50000000 0.00000 
19 'point symmetry operation'   ? ? -0.80901699 0.50000000  0.30901699  0.00000 0.50000000  0.30901699  0.80901699  0.00000 
0.30901699  0.80901699  -0.50000000 0.00000 
20 'point symmetry operation'   ? ? 0.30901699  0.80901699  0.50000000  0.00000 0.80901699  -0.50000000 0.30901699  0.00000 
0.50000000  0.30901699  -0.80901699 0.00000 
21 'point symmetry operation'   ? ? 0.00000000  0.00000000  -1.00000000 0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000 
22 'point symmetry operation'   ? ? -0.50000000 0.30901699  -0.80901699 0.00000 0.30901699  -0.80901699 -0.50000000 0.00000 
-0.80901699 -0.50000000 0.30901699  0.00000 
23 'point symmetry operation'   ? ? -0.30901699 0.80901699  -0.50000000 0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 
-0.50000000 0.30901699  0.80901699  0.00000 
24 'point symmetry operation'   ? ? 0.30901699  0.80901699  -0.50000000 0.00000 -0.80901699 0.50000000  0.30901699  0.00000 
0.50000000  0.30901699  0.80901699  0.00000 
25 'point symmetry operation'   ? ? 0.50000000  0.30901699  -0.80901699 0.00000 0.30901699  0.80901699  0.50000000  0.00000 
0.80901699  -0.50000000 0.30901699  0.00000 
26 'point symmetry operation'   ? ? 0.00000000  0.00000000  -1.00000000 0.00000 -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000 
27 'point symmetry operation'   ? ? -0.50000000 0.30901699  -0.80901699 0.00000 -0.30901699 0.80901699  0.50000000  0.00000 
0.80901699  0.50000000  -0.30901699 0.00000 
28 'point symmetry operation'   ? ? -0.30901699 0.80901699  -0.50000000 0.00000 0.80901699  0.50000000  0.30901699  0.00000 
0.50000000  -0.30901699 -0.80901699 0.00000 
29 'point symmetry operation'   ? ? 0.30901699  0.80901699  -0.50000000 0.00000 0.80901699  -0.50000000 -0.30901699 0.00000 
-0.50000000 -0.30901699 -0.80901699 0.00000 
30 'point symmetry operation'   ? ? 0.50000000  0.30901699  -0.80901699 0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 
-0.80901699 0.50000000  -0.30901699 0.00000 
31 'point symmetry operation'   ? ? 0.00000000  0.00000000  1.00000000  0.00000 -1.00000000 0.00000000  0.00000000  0.00000 
0.00000000  -1.00000000 0.00000000  0.00000 
32 'point symmetry operation'   ? ? 0.50000000  -0.30901699 0.80901699  0.00000 -0.30901699 0.80901699  0.50000000  0.00000 
-0.80901699 -0.50000000 0.30901699  0.00000 
33 'point symmetry operation'   ? ? 0.30901699  -0.80901699 0.50000000  0.00000 0.80901699  0.50000000  0.30901699  0.00000 
-0.50000000 0.30901699  0.80901699  0.00000 
34 'point symmetry operation'   ? ? -0.30901699 -0.80901699 0.50000000  0.00000 0.80901699  -0.50000000 -0.30901699 0.00000 
0.50000000  0.30901699  0.80901699  0.00000 
35 'point symmetry operation'   ? ? -0.50000000 -0.30901699 0.80901699  0.00000 -0.30901699 -0.80901699 -0.50000000 0.00000 
0.80901699  -0.50000000 0.30901699  0.00000 
36 'point symmetry operation'   ? ? 0.00000000  0.00000000  1.00000000  0.00000 1.00000000  0.00000000  0.00000000  0.00000 
0.00000000  1.00000000  0.00000000  0.00000 
37 'point symmetry operation'   ? ? 0.50000000  -0.30901699 0.80901699  0.00000 0.30901699  -0.80901699 -0.50000000 0.00000 
0.80901699  0.50000000  -0.30901699 0.00000 
38 'point symmetry operation'   ? ? 0.30901699  -0.80901699 0.50000000  0.00000 -0.80901699 -0.50000000 -0.30901699 0.00000 
0.50000000  -0.30901699 -0.80901699 0.00000 
39 'point symmetry operation'   ? ? -0.30901699 -0.80901699 0.50000000  0.00000 -0.80901699 0.50000000  0.30901699  0.00000 
-0.50000000 -0.30901699 -0.80901699 0.00000 
40 'point symmetry operation'   ? ? -0.50000000 -0.30901699 0.80901699  0.00000 0.30901699  0.80901699  0.50000000  0.00000 
-0.80901699 0.50000000  -0.30901699 0.00000 
41 'point symmetry operation'   ? ? 0.00000000  1.00000000  0.00000000  0.00000 0.00000000  0.00000000  -1.00000000 0.00000 
-1.00000000 0.00000000  0.00000000  0.00000 
42 'point symmetry operation'   ? ? 0.80901699  0.50000000  -0.30901699 0.00000 -0.50000000 0.30901699  -0.80901699 0.00000 
-0.30901699 0.80901699  0.50000000  0.00000 
43 'point symmetry operation'   ? ? 0.50000000  -0.30901699 -0.80901699 0.00000 -0.30901699 0.80901699  -0.50000000 0.00000 
0.80901699  0.50000000  0.30901699  0.00000 
44 'point symmetry operation'   ? ? -0.50000000 -0.30901699 -0.80901699 0.00000 0.30901699  0.80901699  -0.50000000 0.00000 
0.80901699  -0.50000000 -0.30901699 0.00000 
45 'point symmetry operation'   ? ? -0.80901699 0.50000000  -0.30901699 0.00000 0.50000000  0.30901699  -0.80901699 0.00000 
-0.30901699 -0.80901699 -0.50000000 0.00000 
46 'point symmetry operation'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000 0.00000000  0.00000000  -1.00000000 0.00000 
1.00000000  0.00000000  0.00000000  0.00000 
47 'point symmetry operation'   ? ? -0.80901699 -0.50000000 0.30901699  0.00000 -0.50000000 0.30901699  -0.80901699 0.00000 
0.30901699  -0.80901699 -0.50000000 0.00000 
48 'point symmetry operation'   ? ? -0.50000000 0.30901699  0.80901699  0.00000 -0.30901699 0.80901699  -0.50000000 0.00000 
-0.80901699 -0.50000000 -0.30901699 0.00000 
49 'point symmetry operation'   ? ? 0.50000000  0.30901699  0.80901699  0.00000 0.30901699  0.80901699  -0.50000000 0.00000 
-0.80901699 0.50000000  0.30901699  0.00000 
50 'point symmetry operation'   ? ? 0.80901699  -0.50000000 0.30901699  0.00000 0.50000000  0.30901699  -0.80901699 0.00000 
0.30901699  0.80901699  0.50000000  0.00000 
51 'point symmetry operation'   ? ? 0.00000000  1.00000000  0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
1.00000000  0.00000000  0.00000000  0.00000 
52 'point symmetry operation'   ? ? 0.80901699  0.50000000  -0.30901699 0.00000 0.50000000  -0.30901699 0.80901699  0.00000 
0.30901699  -0.80901699 -0.50000000 0.00000 
53 'point symmetry operation'   ? ? 0.50000000  -0.30901699 -0.80901699 0.00000 0.30901699  -0.80901699 0.50000000  0.00000 
-0.80901699 -0.50000000 -0.30901699 0.00000 
54 'point symmetry operation'   ? ? -0.50000000 -0.30901699 -0.80901699 0.00000 -0.30901699 -0.80901699 0.50000000  0.00000 
-0.80901699 0.50000000  0.30901699  0.00000 
55 'point symmetry operation'   ? ? -0.80901699 0.50000000  -0.30901699 0.00000 -0.50000000 -0.30901699 0.80901699  0.00000 
0.30901699  0.80901699  0.50000000  0.00000 
56 'point symmetry operation'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000 0.00000000  0.00000000  1.00000000  0.00000 
-1.00000000 0.00000000  0.00000000  0.00000 
57 'point symmetry operation'   ? ? -0.80901699 -0.50000000 0.30901699  0.00000 0.50000000  -0.30901699 0.80901699  0.00000 
-0.30901699 0.80901699  0.50000000  0.00000 
58 'point symmetry operation'   ? ? -0.50000000 0.30901699  0.80901699  0.00000 0.30901699  -0.80901699 0.50000000  0.00000 
0.80901699  0.50000000  0.30901699  0.00000 
59 'point symmetry operation'   ? ? 0.50000000  0.30901699  0.80901699  0.00000 -0.30901699 -0.80901699 0.50000000  0.00000 
0.80901699  -0.50000000 -0.30901699 0.00000 
60 'point symmetry operation'   ? ? 0.80901699  -0.50000000 0.30901699  0.00000 -0.50000000 -0.30901699 0.80901699  0.00000 
-0.30901699 -0.80901699 -0.50000000 0.00000 
# 
_pdbx_point_symmetry.entry_id             4SBV 
_pdbx_point_symmetry.Schoenflies_symbol   I 
_pdbx_point_symmetry.H-M_notation         532 
_pdbx_point_symmetry.circular_symmetry    ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? B ASN 259 ? B ASN 259 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 O   ? B PHE 199 ? B PHE 199 ? 1_555 92.6  ? 
2  OD1 ? B ASN 259 ? B ASN 259 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 O   ? B LEU 260 ? B LEU 260 ? 1_555 82.7  ? 
3  O   ? B PHE 199 ? B PHE 199 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 O   ? B LEU 260 ? B LEU 260 ? 1_555 64.7  ? 
4  OD1 ? B ASN 259 ? B ASN 259 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 73.4  ? 
5  O   ? B PHE 199 ? B PHE 199 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 144.2 ? 
6  O   ? B LEU 260 ? B LEU 260 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 80.7  ? 
7  OD1 ? B ASN 259 ? B ASN 259 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 132.8 ? 
8  O   ? B PHE 199 ? B PHE 199 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 104.7 ? 
9  O   ? B LEU 260 ? B LEU 260 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 66.8  ? 
10 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 CA ? D CA . ? A CA 261 ? 1_555 OD1 ? A ASP 138 ? A ASP 138 ? 1_555 67.0  ? 
11 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 46.8  ? 
12 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 OD1 ? B ASP 138 ? B ASP 138 ? 1_555 90.8  ? 
13 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 OD1 ? B ASP 138 ? B ASP 138 ? 1_555 66.3  ? 
14 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 O   ? C PHE 199 ? C PHE 199 ? 1_555 158.3 ? 
15 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 O   ? C PHE 199 ? C PHE 199 ? 1_555 152.9 ? 
16 OD1 ? B ASP 138 ? B ASP 138 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 O   ? C PHE 199 ? C PHE 199 ? 1_555 106.6 ? 
17 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 OD1 ? C ASN 259 ? C ASN 259 ? 1_555 79.5  ? 
18 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 OD1 ? C ASN 259 ? C ASN 259 ? 1_555 86.5  ? 
19 OD1 ? B ASP 138 ? B ASP 138 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 OD1 ? C ASN 259 ? C ASN 259 ? 1_555 149.3 ? 
20 O   ? C PHE 199 ? C PHE 199 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 OD1 ? C ASN 259 ? C ASN 259 ? 1_555 91.0  ? 
21 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 O   ? C LEU 260 ? C LEU 260 ? 1_555 84.4  ? 
22 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 O   ? C LEU 260 ? C LEU 260 ? 1_555 131.0 ? 
23 OD1 ? B ASP 138 ? B ASP 138 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 O   ? C LEU 260 ? C LEU 260 ? 1_555 120.8 ? 
24 O   ? C PHE 199 ? C PHE 199 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 O   ? C LEU 260 ? C LEU 260 ? 1_555 75.7  ? 
25 OD1 ? C ASN 259 ? C ASN 259 ? 1_555 CA ? E CA . ? B CA 261 ? 1_555 O   ? C LEU 260 ? C LEU 260 ? 1_555 87.5  ? 
26 OD1 ? C ASP 138 ? C ASP 138 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 OD1 ? A ASN 259 ? A ASN 259 ? 1_555 151.4 ? 
27 OD1 ? C ASP 138 ? C ASP 138 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 O   ? A LEU 260 ? A LEU 260 ? 1_555 76.5  ? 
28 OD1 ? A ASN 259 ? A ASN 259 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 O   ? A LEU 260 ? A LEU 260 ? 1_555 77.0  ? 
29 OD1 ? C ASP 138 ? C ASP 138 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 OD1 ? C ASP 141 ? C ASP 141 ? 1_555 81.2  ? 
30 OD1 ? A ASN 259 ? A ASN 259 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 OD1 ? C ASP 141 ? C ASP 141 ? 1_555 105.4 ? 
31 O   ? A LEU 260 ? A LEU 260 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 OD1 ? C ASP 141 ? C ASP 141 ? 1_555 124.4 ? 
32 OD1 ? C ASP 138 ? C ASP 138 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 OD2 ? C ASP 141 ? C ASP 141 ? 1_555 80.9  ? 
33 OD1 ? A ASN 259 ? A ASN 259 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 OD2 ? C ASP 141 ? C ASP 141 ? 1_555 84.7  ? 
34 O   ? A LEU 260 ? A LEU 260 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 OD2 ? C ASP 141 ? C ASP 141 ? 1_555 81.3  ? 
35 OD1 ? C ASP 141 ? C ASP 141 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 OD2 ? C ASP 141 ? C ASP 141 ? 1_555 44.9  ? 
36 OD1 ? C ASP 138 ? C ASP 138 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 O   ? A PHE 199 ? A PHE 199 ? 1_555 94.3  ? 
37 OD1 ? A ASN 259 ? A ASN 259 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 O   ? A PHE 199 ? A PHE 199 ? 1_555 85.4  ? 
38 O   ? A LEU 260 ? A LEU 260 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 O   ? A PHE 199 ? A PHE 199 ? 1_555 67.6  ? 
39 OD1 ? C ASP 141 ? C ASP 141 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 O   ? A PHE 199 ? A PHE 199 ? 1_555 165.1 ? 
40 OD2 ? C ASP 141 ? C ASP 141 ? 1_555 CA ? F CA . ? C CA 261 ? 1_555 O   ? A PHE 199 ? A PHE 199 ? 1_555 148.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1985-07-17 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-03-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
# 
_pdbx_database_remark.id     285 
_pdbx_database_remark.text   
;THE ENTRY PRESENTED HERE DOES NOT CONTAIN THE COMPLETE 
CRYSTAL ASYMMETRIC UNIT. IN ADDITION, THE COORDINATES 
ARE NOT PRESENTED IN THE STANDARD CRYSTAL FRAME. 
 
IN ORDER TO GENERATE THE FULL CRYSTAL AU, APPLY THE 
FOLLOWING TRANSFORMATION MATRIX OR MATRICES AND SELECTED 
BIOMT RECORDS TO THE COORDINATES, AS SHOWN BELOW. 
X0  1   -1.000000   0.000000   0.000000    0.00000 
X0  2    0.000000  -0.934172   0.356823    0.00000 
X0  3    0.000000   0.356823   0.934172    0.00000 
CRYSTAL AU = 
(X0) * (BIOMT 1-10) * CHAINS A,B,C 
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O B VAL 103 ? ? ND2 B ASN 106 ? ? 2.11 
2 1 O C PRO 124 ? ? OG1 C THR 127 ? ? 2.14 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1    1 CG1 B ILE 185 ? ? 1_555 N   C THR 118 ? ? 3_555 0.11 
2    1 CB  B ALA 130 ? ? 1_555 N   C GLN 136 ? ? 3_555 0.18 
3    1 C   B LEU 120 ? ? 1_555 CE1 C TYR 156 ? ? 3_555 0.23 
4    1 CB  B LEU 74  ? ? 1_555 CB  C ALA 130 ? ? 3_555 0.25 
5    1 O   B PRO 160 ? ? 1_555 C   C LEU 153 ? ? 3_555 0.29 
6    1 N   C VAL 103 ? ? 1_555 CG  C ASN 106 ? ? 2_555 0.31 
7    1 C   C PRO 58  ? ? 1_555 N   C THR 67  ? ? 2_555 0.33 
8    1 CA  B ARG 241 ? ? 1_555 ND1 C HIS 132 ? ? 3_555 0.34 
9    1 CG  A PRO 253 ? ? 1_555 CE2 B TRP 162 ? ? 2_555 0.35 
10   1 CA  B GLU 73  ? ? 1_555 CB  C PRO 160 ? ? 3_555 0.37 
11   1 CB  B ALA 236 ? ? 1_555 CG1 C VAL 145 ? ? 3_555 0.38 
12   1 CA  B GLU 191 ? ? 1_555 N   C LEU 55  ? ? 3_555 0.41 
13   1 C   B LYS 154 ? ? 1_555 C   C ALA 244 ? ? 3_555 0.42 
14   1 O   B GLN 136 ? ? 1_555 CG  C LEU 74  ? ? 3_555 0.42 
15   1 C   B GLU 89  ? ? 1_555 N   C LEU 78  ? ? 3_555 0.44 
16   1 C   B VAL 80  ? ? 1_555 C   C LEU 143 ? ? 3_555 0.45 
17   1 N   B GLY 155 ? ? 1_555 N   C SER 245 ? ? 3_555 0.45 
18   1 C   B TRP 112 ? ? 1_555 CA  C THR 51  ? ? 3_555 0.47 
19   1 CB  B TYR 243 ? ? 1_555 CA  C GLY 159 ? ? 3_555 0.47 
20   1 ND2 A ASN 106 ? ? 1_555 CB  B THR 126 ? ? 2_555 0.47 
21   1 C   B GLU 73  ? ? 1_555 CA  C PRO 160 ? ? 3_555 0.48 
22   1 CB  B ARG 241 ? ? 1_555 CE1 C HIS 132 ? ? 3_555 0.48 
23   1 C   B THR 158 ? ? 1_555 CD1 C PHE 135 ? ? 3_555 0.48 
24   1 CG1 B VAL 103 ? ? 1_555 CD1 C ILE 47  ? ? 3_555 0.49 
25   1 C   B ALA 236 ? ? 1_555 CG2 C VAL 145 ? ? 3_555 0.49 
26   1 OD1 B ASN 152 ? ? 1_555 C   C PRO 93  ? ? 3_555 0.51 
27   1 N   B LEU 153 ? ? 1_555 CG1 C VAL 96  ? ? 3_555 0.51 
28   1 CA  B THR 239 ? ? 1_555 N   C LEU 150 ? ? 3_555 0.52 
29   1 CA  B TYR 119 ? ? 1_555 C   C VAL 157 ? ? 3_555 0.53 
30   1 OH  C TYR 246 ? ? 1_555 CB  C PRO 253 ? ? 2_555 0.54 
31   1 N   B VAL 147 ? ? 1_555 CB  C LEU 90  ? ? 3_555 0.55 
32   1 SD  B MET 228 ? ? 1_555 CG1 C VAL 225 ? ? 3_555 0.55 
33   1 CE1 B TYR 117 ? ? 1_555 CE2 C TYR 119 ? ? 3_555 0.55 
34   1 CB  B THR 98  ? ? 1_555 N   C SER 128 ? ? 3_555 0.58 
35   1 O   B LEU 120 ? ? 1_555 CZ  C TYR 156 ? ? 3_555 0.59 
36   1 CA  B GLU 89  ? ? 1_555 CA  C LEU 78  ? ? 3_555 0.59 
37   1 CD2 B PHE 135 ? ? 1_555 CB  C TYR 243 ? ? 3_555 0.60 
38   1 CA  B ILE 131 ? ? 1_555 O   C GLY 134 ? ? 3_555 0.60 
39   1 CD2 B LEU 150 ? ? 1_555 CG  C GLU 89  ? ? 3_555 0.61 
40   1 CA  B VAL 147 ? ? 1_555 CA  C LEU 90  ? ? 3_555 0.61 
41   1 CB  B THR 95  ? ? 1_555 N   C THR 239 ? ? 3_555 0.61 
42   1 O   B GLY 155 ? ? 1_555 C   C ARG 116 ? ? 3_555 0.62 
43   1 O   B LYS 154 ? ? 1_555 CA  C ALA 244 ? ? 3_555 0.62 
44   1 CZ3 C TRP 99  ? ? 1_555 CD2 C TRP 107 ? ? 2_555 0.62 
45   1 C   B HIS 132 ? ? 1_555 CG  C LEU 224 ? ? 3_555 0.62 
46   1 CA  B ILE 248 ? ? 1_555 N   C GLY 50  ? ? 3_555 0.63 
47   1 N   B GLN 136 ? ? 1_555 N   C SER 75  ? ? 3_555 0.63 
48   1 N   B TRP 162 ? ? 1_555 N   C LEU 153 ? ? 3_555 0.63 
49   1 CD1 B ILE 115 ? ? 1_555 N   C PRO 121 ? ? 3_555 0.63 
50   1 O   B THR 81  ? ? 1_555 C   C THR 142 ? ? 3_555 0.64 
51   1 CZ2 B TRP 112 ? ? 1_555 O   C PRO 121 ? ? 3_555 0.64 
52   1 CA  A ALA 255 ? ? 1_555 CA  B THR 127 ? ? 2_555 0.65 
53   1 CB  B VAL 80  ? ? 1_555 CD  C PRO 144 ? ? 3_555 0.65 
54   1 SD  B MET 133 ? ? 1_555 SD  C MET 133 ? ? 3_555 0.66 
55   1 CG1 A ILE 254 ? ? 1_555 C   B SER 128 ? ? 2_555 0.66 
56   1 CA  B LEU 100 ? ? 1_555 O   C PRO 124 ? ? 3_555 0.66 
57   1 N   C TRP 99  ? ? 1_555 CG2 C ILE 254 ? ? 2_555 0.67 
58   1 CG  C TRP 99  ? ? 1_555 CA  C TRP 107 ? ? 2_555 0.67 
59   1 C   B TRP 99  ? ? 1_555 N   C THR 126 ? ? 3_555 0.68 
60   1 CA  B LEU 100 ? ? 1_555 C   C PRO 124 ? ? 3_555 0.68 
61   1 N   B TRP 162 ? ? 1_555 C   C ASN 152 ? ? 3_555 0.69 
62   1 CD1 B PHE 135 ? ? 1_555 C   C LEU 242 ? ? 3_555 0.69 
63   1 O   B ASN 190 ? ? 1_555 CA  C LYS 54  ? ? 3_555 0.69 
64   1 OD1 B ASN 148 ? ? 1_555 CG1 C VAL 220 ? ? 3_555 0.70 
65   1 N   B THR 158 ? ? 1_555 CZ  C PHE 135 ? ? 3_555 0.70 
66   1 CG  B LEU 153 ? ? 1_555 O   C VAL 96  ? ? 3_555 0.70 
67   1 CA  B GLU 229 ? ? 1_555 NE  C ARG 223 ? ? 3_555 0.71 
68   1 CA  B THR 247 ? ? 1_555 NE2 C GLN 165 ? ? 3_555 0.71 
69   1 N   B SER 122 ? ? 1_555 CB  C SER 151 ? ? 3_555 0.71 
70   1 CA  B PRO 93  ? ? 1_555 C   C SER 122 ? ? 3_555 0.71 
71   1 OG1 B THR 76  ? ? 1_555 CA  C MET 228 ? ? 3_555 0.72 
72   1 CD2 B HIS 132 ? ? 1_555 C   C ARG 223 ? ? 3_555 0.72 
73   1 C   B VAL 161 ? ? 1_555 N   C LEU 153 ? ? 3_555 0.72 
74   1 CB  B GLU 89  ? ? 1_555 CB  C LEU 78  ? ? 3_555 0.72 
75   1 O   B THR 95  ? ? 1_555 CB  C THR 239 ? ? 3_555 0.73 
76   1 CD  C PRO 57  ? ? 1_555 CZ  C ARG 249 ? ? 2_555 0.74 
77   1 O   B GLU 73  ? ? 1_555 N   C PRO 160 ? ? 3_555 0.74 
78   1 N   B ASP 188 ? ? 1_555 CG1 C VAL 171 ? ? 3_555 0.75 
79   1 NE2 C HIS 71  ? ? 1_555 C   C ILE 251 ? ? 2_555 0.75 
80   1 OG1 B THR 226 ? ? 1_555 OG1 C THR 226 ? ? 3_555 0.76 
81   1 CD1 B ILE 183 ? ? 1_555 CA  C GLY 155 ? ? 3_555 0.76 
82   1 CD1 B LEU 69  ? ? 1_555 C   C PRO 46  ? ? 3_555 0.76 
83   1 C   B GLY 155 ? ? 1_555 O   C ARG 116 ? ? 3_555 0.76 
84   1 N   A ALA 255 ? ? 1_555 C   B THR 127 ? ? 2_555 0.76 
85   1 CA  B LEU 242 ? ? 1_555 O   C ILE 131 ? ? 3_555 0.76 
86   1 N   B GLU 191 ? ? 1_555 C   C LYS 54  ? ? 3_555 0.76 
87   1 N   B THR 184 ? ? 1_555 O   C THR 184 ? ? 3_555 0.76 
88   1 CD  C PRO 58  ? ? 1_555 O   C LEU 250 ? ? 2_555 0.78 
89   1 OE1 B GLU 191 ? ? 1_555 C   C LEU 55  ? ? 3_555 0.78 
90   1 CG1 B VAL 237 ? ? 1_555 CD  C GLN 149 ? ? 3_555 0.78 
91   1 ND1 B HIS 71  ? ? 1_555 CH2 C TRP 162 ? ? 3_555 0.78 
92   1 CA  B TYR 246 ? ? 1_555 NE2 C GLN 49  ? ? 3_555 0.78 
93   1 CA  B PRO 93  ? ? 1_555 N   C CYS 123 ? ? 3_555 0.79 
94   1 CD  B GLU 73  ? ? 1_555 CD1 C TRP 162 ? ? 3_555 0.80 
95   1 CD1 B PHE 135 ? ? 1_555 N   C TYR 243 ? ? 3_555 0.80 
96   1 CA  B THR 98  ? ? 1_555 C   C THR 127 ? ? 3_555 0.80 
97   1 CD1 B LEU 100 ? ? 1_555 O   C CYS 123 ? ? 3_555 0.80 
98   1 O   B ASN 190 ? ? 1_555 CB  C LYS 54  ? ? 3_555 0.80 
99   1 N   B GLU 73  ? ? 1_555 CG  C PRO 160 ? ? 3_555 0.81 
100  1 O   B PRO 93  ? ? 1_555 CB  C CYS 123 ? ? 3_555 0.81 
101  1 CE  C MET 59  ? ? 1_555 CA  C SER 63  ? ? 2_555 0.81 
102  1 CD2 B TYR 117 ? ? 1_555 CB  C TYR 119 ? ? 3_555 0.81 
103  1 C   B ARG 223 ? ? 1_555 O   C THR 76  ? ? 3_555 0.81 
104  1 O   B LEU 74  ? ? 1_555 O   C GLY 129 ? ? 3_555 0.81 
105  1 N   C THR 98  ? ? 1_555 CG1 C ILE 254 ? ? 2_555 0.82 
106  1 O   B GLN 149 ? ? 1_555 N   C VAL 96  ? ? 3_555 0.82 
107  1 CG  B ASN 152 ? ? 1_555 CA  C PRO 93  ? ? 3_555 0.82 
108  1 O   B TYR 117 ? ? 1_555 C   C ILE 183 ? ? 3_555 0.82 
109  1 N   B ASN 190 ? ? 1_555 ND2 C ASN 172 ? ? 3_555 0.82 
110  1 C   B ASN 238 ? ? 1_555 O   C SER 146 ? ? 3_555 0.82 
111  1 OG1 B THR 87  ? ? 1_555 CB  C THR 87  ? ? 3_555 0.82 
112  1 CB  B VAL 237 ? ? 1_555 OE1 C GLN 149 ? ? 3_555 0.83 
113  1 CA  B VAL 80  ? ? 1_555 N   C PRO 144 ? ? 3_555 0.83 
114  1 CG2 B ILE 115 ? ? 1_555 CB  C LEU 120 ? ? 3_555 0.83 
115  1 O   B HIS 132 ? ? 1_555 CG  C LEU 224 ? ? 3_555 0.84 
116  1 O   B ALA 244 ? ? 1_555 CB  C GLU 163 ? ? 3_555 0.84 
117  1 CA  B HIS 132 ? ? 1_555 CB  C LEU 224 ? ? 3_555 0.84 
118  1 CG  C ARG 101 ? ? 1_555 C   C ALA 255 ? ? 2_555 0.84 
119  1 CA  B VAL 161 ? ? 1_555 CB  C LEU 153 ? ? 3_555 0.84 
120  1 N   B THR 87  ? ? 1_555 OG1 C THR 87  ? ? 3_555 0.84 
121  1 CG  C ARG 101 ? ? 1_555 N   C ALA 256 ? ? 2_555 0.85 
122  1 N   B THR 76  ? ? 1_555 O   C ALA 130 ? ? 3_555 0.85 
123  1 CG  B PRO 93  ? ? 1_555 O   C SER 122 ? ? 3_555 0.85 
124  1 CZ  C TYR 246 ? ? 1_555 CG  C PRO 253 ? ? 2_555 0.85 
125  1 CG  C MET 59  ? ? 1_555 C   C SER 62  ? ? 2_555 0.85 
126  1 C   B VAL 237 ? ? 1_555 NE2 C GLN 149 ? ? 3_555 0.85 
127  1 CB  B PRO 93  ? ? 1_555 O   C SER 122 ? ? 3_555 0.85 
128  1 CD2 B TRP 99  ? ? 1_555 O   C THR 125 ? ? 3_555 0.86 
129  1 CG  B GLU 77  ? ? 1_555 CB  C GLU 229 ? ? 3_555 0.86 
130  1 CA  B GLY 97  ? ? 1_555 CG1 C VAL 161 ? ? 3_555 0.87 
131  1 C   A ILE 254 ? ? 1_555 O   B THR 127 ? ? 2_555 0.87 
132  1 O   C VAL 85  ? ? 1_555 O   B HOH 270 ? ? 2_555 0.87 
133  1 OG1 B THR 87  ? ? 1_555 CG2 C THR 87  ? ? 3_555 0.87 
134  1 O   A LEU 258 ? ? 1_555 C   B GLY 231 ? ? 2_555 0.87 
135  1 O   B THR 95  ? ? 1_555 OG1 C THR 239 ? ? 3_555 0.87 
136  1 CG  B PHE 135 ? ? 1_555 CA  C TYR 243 ? ? 3_555 0.88 
137  1 O   B GLY 230 ? ? 1_555 CB  C ASP 141 ? ? 3_555 0.88 
138  1 C   B PHE 135 ? ? 1_555 N   C SER 75  ? ? 3_555 0.88 
139  1 N   B THR 95  ? ? 1_555 O   C ASN 238 ? ? 3_555 0.88 
140  1 O   B VAL 80  ? ? 1_555 O   C LEU 143 ? ? 3_555 0.88 
141  1 C   B THR 184 ? ? 1_555 CA  C THR 184 ? ? 3_555 0.88 
142  1 CG  C MET 59  ? ? 1_555 N   C SER 63  ? ? 2_555 0.89 
143  1 CG2 B ILE 131 ? ? 1_555 CA  C GLY 134 ? ? 3_555 0.89 
144  1 O   C PRO 57  ? ? 1_555 CB  C VAL 66  ? ? 2_555 0.89 
145  1 CD  B PRO 160 ? ? 1_555 CB  C LYS 154 ? ? 3_555 0.90 
146  1 CG1 B VAL 237 ? ? 1_555 CG  C GLN 149 ? ? 3_555 0.90 
147  1 CB  B TYR 156 ? ? 1_555 CG1 C ILE 115 ? ? 3_555 0.90 
148  1 CG  B GLU 77  ? ? 1_555 CG  C GLU 229 ? ? 3_555 0.90 
149  1 O   C PRO 58  ? ? 1_555 N   C THR 67  ? ? 2_555 0.90 
150  1 CG1 B ILE 115 ? ? 1_555 CD  C PRO 121 ? ? 3_555 0.90 
151  1 O   B LEU 100 ? ? 1_555 CB  C PRO 124 ? ? 3_555 0.91 
152  1 CD2 C TRP 99  ? ? 1_555 CB  C TRP 107 ? ? 2_555 0.91 
153  1 CA  B ALA 186 ? ? 1_555 OG1 C THR 118 ? ? 3_555 0.91 
154  1 N   C THR 98  ? ? 1_555 CB  C ILE 254 ? ? 2_555 0.91 
155  1 CZ3 C TRP 99  ? ? 1_555 CE2 C TRP 107 ? ? 2_555 0.91 
156  1 CG1 B ILE 183 ? ? 1_555 CA  C GLY 155 ? ? 3_555 0.92 
157  1 CB  B THR 239 ? ? 1_555 CA  C LEU 150 ? ? 3_555 0.92 
158  1 CD1 C LEU 55  ? ? 1_555 OE1 C GLU 252 ? ? 2_555 0.92 
159  1 CA  B THR 184 ? ? 1_555 C   C THR 184 ? ? 3_555 0.92 
160  1 CD1 B LEU 224 ? ? 1_555 CG  C LEU 242 ? ? 3_555 0.92 
161  1 OE2 B GLU 73  ? ? 1_555 CG  C TRP 162 ? ? 3_555 0.92 
162  1 CB  B LEU 187 ? ? 1_555 CD1 C LEU 120 ? ? 3_555 0.92 
163  1 CG2 B VAL 147 ? ? 1_555 CD2 C LEU 90  ? ? 3_555 0.92 
164  1 N   B ALA 186 ? ? 1_555 OG1 C THR 118 ? ? 3_555 0.93 
165  1 CD1 A ILE 254 ? ? 1_555 C   B SER 128 ? ? 2_555 0.93 
166  1 N   B VAL 161 ? ? 1_555 CB  C LEU 153 ? ? 3_555 0.93 
167  1 O   B MET 133 ? ? 1_555 CG  C TYR 117 ? ? 3_555 0.94 
168  1 CA  A ILE 254 ? ? 1_555 O   B THR 127 ? ? 2_555 0.94 
169  1 C   B THR 98  ? ? 1_555 CA  C THR 127 ? ? 3_555 0.94 
170  1 CG2 B VAL 161 ? ? 1_555 CD1 C LEU 153 ? ? 3_555 0.94 
171  1 N   B ASP 188 ? ? 1_555 CB  C VAL 171 ? ? 3_555 0.94 
172  1 CG2 B ILE 248 ? ? 1_555 C   C ALA 48  ? ? 3_555 0.94 
173  1 CD1 B LEU 224 ? ? 1_555 CD1 C LEU 242 ? ? 3_555 0.94 
174  1 CB  C ARG 101 ? ? 1_555 CA  C ALA 255 ? ? 2_555 0.95 
175  1 CB  B GLU 229 ? ? 1_555 NE  C ARG 223 ? ? 3_555 0.95 
176  1 CA  B THR 184 ? ? 1_555 O   C THR 184 ? ? 3_555 0.95 
177  1 OE2 B GLU 73  ? ? 1_555 CD1 C TRP 162 ? ? 3_555 0.95 
178  1 N   B THR 81  ? ? 1_555 CA  C LEU 143 ? ? 3_555 0.96 
179  1 N   B VAL 147 ? ? 1_555 CG  C LEU 90  ? ? 3_555 0.96 
180  1 CB  B VAL 237 ? ? 1_555 CD  C GLN 149 ? ? 3_555 0.96 
181  1 CG  B PHE 135 ? ? 1_555 N   C TYR 243 ? ? 3_555 0.97 
182  1 N   B PRO 121 ? ? 1_555 CD1 C TYR 156 ? ? 3_555 0.97 
183  1 C   B LEU 90  ? ? 1_555 O   C GLY 240 ? ? 3_555 0.97 
184  1 O   B LYS 154 ? ? 1_555 N   C ALA 244 ? ? 3_555 0.97 
185  1 CB  B THR 95  ? ? 1_555 C   C ASN 238 ? ? 3_555 0.97 
186  1 C   A ILE 254 ? ? 1_555 C   B THR 127 ? ? 2_555 0.97 
187  1 C   B VAL 80  ? ? 1_555 O   C LEU 143 ? ? 3_555 0.97 
188  1 CD  B GLU 191 ? ? 1_555 N   C ARG 56  ? ? 3_555 0.97 
189  1 CB  B LYS 154 ? ? 1_555 O   C ALA 244 ? ? 3_555 0.97 
190  1 CB  B ASN 148 ? ? 1_555 SD  C MET 92  ? ? 3_555 0.97 
191  1 NE2 B HIS 132 ? ? 1_555 O   C ARG 223 ? ? 3_555 0.98 
192  1 CB  B THR 226 ? ? 1_555 OG1 C THR 226 ? ? 3_555 0.98 
193  1 C   B THR 184 ? ? 1_555 C   C THR 184 ? ? 3_555 0.98 
194  1 CB  B ALA 227 ? ? 1_555 N   C GLU 89  ? ? 3_555 0.98 
195  1 CE1 B TYR 117 ? ? 1_555 CD2 C TYR 119 ? ? 3_555 0.98 
196  1 OG1 B THR 226 ? ? 1_555 CB  C THR 226 ? ? 3_555 0.98 
197  1 C   B VAL 157 ? ? 1_555 CZ  C PHE 135 ? ? 3_555 0.98 
198  1 OG1 B THR 247 ? ? 1_555 CD  C GLN 165 ? ? 3_555 0.98 
199  1 CA  B TRP 162 ? ? 1_555 CA  C ASN 152 ? ? 3_555 0.98 
200  1 CB  B THR 247 ? ? 1_555 NE2 C GLN 165 ? ? 3_555 0.99 
201  1 O   B ALA 236 ? ? 1_555 CG2 C VAL 145 ? ? 3_555 0.99 
202  1 CA  B TRP 162 ? ? 1_555 C   C ASN 152 ? ? 3_555 0.99 
203  1 CB  B GLU 191 ? ? 1_555 CA  C LEU 55  ? ? 3_555 0.99 
204  1 CA  B ASN 238 ? ? 1_555 CA  C SER 146 ? ? 3_555 0.99 
205  1 N   C PRO 58  ? ? 1_555 O   C LEU 250 ? ? 2_555 0.99 
206  1 CE3 C TRP 99  ? ? 1_555 CG  C TRP 107 ? ? 2_555 0.99 
207  1 O   B THR 184 ? ? 1_555 N   C ILE 185 ? ? 3_555 1.00 
208  1 C   B ASN 190 ? ? 1_555 CA  C LYS 54  ? ? 3_555 1.00 
209  1 N   A ALA 255 ? ? 1_555 CA  B THR 127 ? ? 2_555 1.00 
210  1 CD  B ARG 116 ? ? 1_555 CB  C ALA 182 ? ? 3_555 1.01 
211  1 N   B ALA 186 ? ? 1_555 CB  C THR 118 ? ? 3_555 1.01 
212  1 CD  B ARG 116 ? ? 1_555 CA  C ALA 182 ? ? 3_555 1.01 
213  1 C   B GLU 229 ? ? 1_555 OE1 C GLN 136 ? ? 3_555 1.01 
214  1 CB  B ILE 131 ? ? 1_555 O   C GLY 134 ? ? 3_555 1.02 
215  1 CB  B PRO 121 ? ? 1_555 O   C SER 151 ? ? 3_555 1.02 
216  1 CB  A PRO 253 ? ? 1_555 NE1 B TRP 162 ? ? 2_555 1.02 
217  1 OE2 B GLU 89  ? ? 1_555 N   C ALA 79  ? ? 3_555 1.02 
218  1 CB  C TRP 99  ? ? 1_555 CA  C TRP 107 ? ? 2_555 1.02 
219  1 N   A ASN 259 ? ? 1_555 OG  B SER 232 ? ? 2_555 1.02 
220  1 O   B GLU 73  ? ? 1_555 CA  C PRO 160 ? ? 3_555 1.02 
221  1 CB  B ASN 238 ? ? 1_555 CA  C SER 146 ? ? 3_555 1.03 
222  1 CA  B TRP 112 ? ? 1_555 N   C THR 51  ? ? 3_555 1.03 
223  1 OD1 B ASN 152 ? ? 1_555 CA  C PRO 93  ? ? 3_555 1.03 
224  1 OE1 B GLU 191 ? ? 1_555 O   C LEU 55  ? ? 3_555 1.03 
225  1 O   B PRO 93  ? ? 1_555 CA  C CYS 123 ? ? 3_555 1.03 
226  1 CG2 B VAL 225 ? ? 1_555 OG1 C THR 76  ? ? 3_555 1.03 
227  1 N   B ARG 116 ? ? 1_555 O   C GLY 164 ? ? 3_555 1.03 
228  1 CE1 C HIS 71  ? ? 1_555 C   C ILE 251 ? ? 2_555 1.04 
229  1 N   B LEU 224 ? ? 1_555 O   C THR 76  ? ? 3_555 1.04 
230  1 CE1 C HIS 71  ? ? 1_555 O   C ILE 251 ? ? 2_555 1.04 
231  1 CD  C PRO 58  ? ? 1_555 C   C LEU 250 ? ? 2_555 1.05 
232  1 N   B GLN 136 ? ? 1_555 C   C LEU 74  ? ? 3_555 1.05 
233  1 NE  B ARG 116 ? ? 1_555 CB  C ALA 182 ? ? 3_555 1.05 
234  1 CG2 B ILE 131 ? ? 1_555 C   C GLY 134 ? ? 3_555 1.05 
235  1 O   B THR 239 ? ? 1_555 N   C SER 151 ? ? 3_555 1.06 
236  1 C   B THR 95  ? ? 1_555 CA  C THR 239 ? ? 3_555 1.06 
237  1 N   B ASN 152 ? ? 1_555 CG2 C VAL 96  ? ? 3_555 1.06 
238  1 CA  B LEU 242 ? ? 1_555 C   C ILE 131 ? ? 3_555 1.06 
239  1 CD1 B LEU 69  ? ? 1_555 CA  C PRO 46  ? ? 3_555 1.06 
240  1 CH2 C TRP 99  ? ? 1_555 CD2 C TRP 107 ? ? 2_555 1.06 
241  1 CD  B GLU 191 ? ? 1_555 C   C LEU 55  ? ? 3_555 1.07 
242  1 O   B LEU 120 ? ? 1_555 CE1 C TYR 156 ? ? 3_555 1.07 
243  1 CD1 B ILE 183 ? ? 1_555 C   C GLY 155 ? ? 3_555 1.07 
244  1 CB  C ARG 101 ? ? 1_555 C   C ALA 255 ? ? 2_555 1.07 
245  1 CG2 B THR 95  ? ? 1_555 CA  C ASN 238 ? ? 3_555 1.08 
246  1 CA  B THR 76  ? ? 1_555 O   C ALA 130 ? ? 3_555 1.08 
247  1 C   C VAL 85  ? ? 1_555 O   B HOH 270 ? ? 2_555 1.08 
248  1 CD1 B ILE 131 ? ? 1_555 CA  C MET 133 ? ? 3_555 1.08 
249  1 CA  B LYS 154 ? ? 1_555 O   C ALA 244 ? ? 3_555 1.08 
250  1 N   B ILE 185 ? ? 1_555 CA  C THR 184 ? ? 3_555 1.08 
251  1 O   B VAL 147 ? ? 1_555 O   C LEU 90  ? ? 3_555 1.08 
252  1 CG2 B VAL 237 ? ? 1_555 OE1 C GLN 149 ? ? 3_555 1.09 
253  1 CA  B TYR 119 ? ? 1_555 O   C VAL 157 ? ? 3_555 1.09 
254  1 O   B ASN 148 ? ? 1_555 C   C MET 92  ? ? 3_555 1.09 
255  1 O   B MET 133 ? ? 1_555 CD1 C TYR 117 ? ? 3_555 1.09 
256  1 O   B ASN 148 ? ? 1_555 CA  C MET 92  ? ? 3_555 1.09 
257  1 C   C ARG 56  ? ? 1_555 CD1 C ILE 251 ? ? 2_555 1.10 
258  1 CA  B ILE 248 ? ? 1_555 C   C GLN 49  ? ? 3_555 1.10 
259  1 C   B THR 87  ? ? 1_555 O   C HOH 265 ? ? 3_555 1.10 
260  1 CD2 B TYR 117 ? ? 1_555 CG  C TYR 119 ? ? 3_555 1.10 
261  1 O   B ALA 227 ? ? 1_555 O   C LEU 224 ? ? 3_555 1.10 
262  1 CD1 B TYR 246 ? ? 1_555 O   C TRP 162 ? ? 3_555 1.10 
263  1 O   B CYS 123 ? ? 1_555 OD1 C ASN 152 ? ? 3_555 1.10 
264  1 CB  B GLU 89  ? ? 1_555 CA  C LEU 78  ? ? 3_555 1.10 
265  1 CG1 B VAL 161 ? ? 1_555 CD2 C LEU 153 ? ? 3_555 1.11 
266  1 O   B ALA 114 ? ? 1_555 CB  C GLN 165 ? ? 3_555 1.11 
267  1 CB  B ALA 114 ? ? 1_555 O   C GLN 165 ? ? 3_555 1.11 
268  1 C   C THR 98  ? ? 1_555 CG2 C ILE 254 ? ? 2_555 1.11 
269  1 N   B THR 239 ? ? 1_555 O   C SER 146 ? ? 3_555 1.11 
270  1 CG  B HIS 132 ? ? 1_555 N   C LEU 224 ? ? 3_555 1.11 
271  1 C   B THR 98  ? ? 1_555 N   C THR 127 ? ? 3_555 1.11 
272  1 N   B THR 158 ? ? 1_555 CE1 C PHE 135 ? ? 3_555 1.12 
273  1 CE1 B TYR 119 ? ? 1_555 CD2 C TYR 156 ? ? 3_555 1.12 
274  1 CB  B LEU 78  ? ? 1_555 CB  C ALA 227 ? ? 3_555 1.12 
275  1 CG2 B THR 226 ? ? 1_555 CG2 C THR 226 ? ? 3_555 1.12 
276  1 NH1 C ARG 101 ? ? 1_555 CB  C LEU 258 ? ? 2_555 1.12 
277  1 CG1 B VAL 80  ? ? 1_555 CD  C PRO 144 ? ? 3_555 1.13 
278  1 CG2 B VAL 157 ? ? 1_555 O   C ILE 185 ? ? 3_555 1.13 
279  1 O   C ARG 56  ? ? 1_555 CG1 C ILE 251 ? ? 2_555 1.13 
280  1 CD  C ARG 101 ? ? 1_555 O   C ALA 255 ? ? 2_555 1.13 
281  1 CG2 B VAL 91  ? ? 1_555 CA  C ARG 241 ? ? 3_555 1.13 
282  1 O   B MET 92  ? ? 1_555 O   C THR 239 ? ? 3_555 1.13 
283  1 C   C TRP 99  ? ? 1_555 O   C ASN 106 ? ? 2_555 1.13 
284  1 CA  B GLU 89  ? ? 1_555 N   C LEU 78  ? ? 3_555 1.13 
285  1 C   B MET 92  ? ? 1_555 CB  C SER 122 ? ? 3_555 1.14 
286  1 O   B PRO 160 ? ? 1_555 N   C LYS 154 ? ? 3_555 1.14 
287  1 CG2 B VAL 192 ? ? 1_555 CB  C VAL 53  ? ? 3_555 1.15 
288  1 C   B LYS 154 ? ? 1_555 CA  C ALA 244 ? ? 3_555 1.15 
289  1 O   B TRP 112 ? ? 1_555 C   C THR 51  ? ? 3_555 1.15 
290  1 CD1 C LEU 55  ? ? 1_555 CD  C GLU 252 ? ? 2_555 1.15 
291  1 CA  B GLY 155 ? ? 1_555 O   C ARG 116 ? ? 3_555 1.15 
292  1 N   B ARG 241 ? ? 1_555 ND1 C HIS 132 ? ? 3_555 1.15 
293  1 CA  B TYR 243 ? ? 1_555 CA  C GLY 159 ? ? 3_555 1.16 
294  1 CA  B GLN 136 ? ? 1_555 O   C LEU 74  ? ? 3_555 1.16 
295  1 N   B LEU 100 ? ? 1_555 O   C PRO 124 ? ? 3_555 1.16 
296  1 CD2 B HIS 132 ? ? 1_555 O   C ARG 223 ? ? 3_555 1.16 
297  1 CA  B MET 92  ? ? 1_555 CB  C SER 122 ? ? 3_555 1.16 
298  1 CB  B GLN 149 ? ? 1_555 CA  C THR 95  ? ? 3_555 1.16 
299  1 CA  B VAL 237 ? ? 1_555 NE2 C GLN 149 ? ? 3_555 1.16 
300  1 CA  B THR 98  ? ? 1_555 CA  C THR 127 ? ? 3_555 1.16 
301  1 CG1 A ILE 254 ? ? 1_555 CA  B SER 128 ? ? 2_555 1.16 
302  1 O   B GLY 155 ? ? 1_555 O   C ARG 116 ? ? 3_555 1.17 
303  1 CE1 B TYR 137 ? ? 1_555 C   C GLU 73  ? ? 3_555 1.17 
304  1 OG  B SER 146 ? ? 1_555 CD1 C LEU 90  ? ? 3_555 1.17 
305  1 O   B GLY 97  ? ? 1_555 CB  C THR 127 ? ? 3_555 1.17 
306  1 N   C VAL 103 ? ? 1_555 ND2 C ASN 106 ? ? 2_555 1.17 
307  1 OG1 B THR 189 ? ? 1_555 CD1 C LEU 168 ? ? 3_555 1.17 
308  1 N   B THR 76  ? ? 1_555 C   C ALA 130 ? ? 3_555 1.17 
309  1 CD2 B PHE 170 ? ? 1_555 O   C THR 179 ? ? 3_555 1.17 
310  1 CE  C MET 59  ? ? 1_555 C   C SER 63  ? ? 2_555 1.17 
311  1 CG  B TYR 117 ? ? 1_555 CG  C TYR 119 ? ? 3_555 1.17 
312  1 CA  B ASN 238 ? ? 1_555 C   C SER 146 ? ? 3_555 1.18 
313  1 OE2 C GLU 73  ? ? 1_555 N   C PRO 253 ? ? 2_555 1.18 
314  1 O   B LEU 100 ? ? 1_555 CA  C PRO 124 ? ? 3_555 1.18 
315  1 CE2 B TRP 112 ? ? 1_555 O   C PRO 121 ? ? 3_555 1.18 
316  1 C   B LEU 242 ? ? 1_555 O   C ILE 131 ? ? 3_555 1.18 
317  1 CB  B VAL 103 ? ? 1_555 CD1 C ILE 47  ? ? 3_555 1.18 
318  1 N   B ASN 238 ? ? 1_555 N   C SER 146 ? ? 3_555 1.18 
319  1 C   B GLU 73  ? ? 1_555 CB  C PRO 160 ? ? 3_555 1.19 
320  1 CZ2 B TRP 112 ? ? 1_555 C   C PRO 121 ? ? 3_555 1.19 
321  1 O   B TRP 112 ? ? 1_555 CA  C THR 51  ? ? 3_555 1.19 
322  1 CG  B GLU 191 ? ? 1_555 CA  C LEU 55  ? ? 3_555 1.19 
323  1 C   B TRP 112 ? ? 1_555 N   C THR 51  ? ? 3_555 1.19 
324  1 CA  A PRO 253 ? ? 1_555 NE1 B TRP 162 ? ? 2_555 1.19 
325  1 CE1 C HIS 71  ? ? 1_555 CA  C ILE 251 ? ? 2_555 1.19 
326  1 OG1 B THR 239 ? ? 1_555 CB  C LEU 150 ? ? 3_555 1.20 
327  1 OE1 B GLU 229 ? ? 1_555 CE  C MET 139 ? ? 3_555 1.20 
328  1 CZ3 B TRP 99  ? ? 1_555 CB  C THR 125 ? ? 3_555 1.20 
329  1 O   B GLY 155 ? ? 1_555 N   C TYR 117 ? ? 3_555 1.20 
330  1 O   B LEU 100 ? ? 1_555 CG  C PRO 124 ? ? 3_555 1.20 
331  1 CA  B VAL 147 ? ? 1_555 CB  C LEU 90  ? ? 3_555 1.20 
332  1 C   B LEU 120 ? ? 1_555 CD1 C TYR 156 ? ? 3_555 1.20 
333  1 O   B PHE 170 ? ? 1_555 CB  C ARG 181 ? ? 3_555 1.20 
334  1 O   B LEU 242 ? ? 1_555 N   C ILE 131 ? ? 3_555 1.20 
335  1 NE2 B HIS 132 ? ? 1_555 C   C ARG 223 ? ? 3_555 1.20 
336  1 CB  B SER 151 ? ? 1_555 O   C VAL 91  ? ? 3_555 1.21 
337  1 O   B ALA 227 ? ? 1_555 C   C LEU 224 ? ? 3_555 1.21 
338  1 CG  C TRP 99  ? ? 1_555 N   C TRP 107 ? ? 2_555 1.21 
339  1 CA  B ARG 241 ? ? 1_555 CE1 C HIS 132 ? ? 3_555 1.21 
340  1 OH  C TYR 246 ? ? 1_555 CG  C PRO 253 ? ? 2_555 1.21 
341  1 CG1 B VAL 103 ? ? 1_555 CG1 C ILE 47  ? ? 3_555 1.21 
342  1 N   B PRO 93  ? ? 1_555 C   C SER 122 ? ? 3_555 1.21 
343  1 CG  A PRO 253 ? ? 1_555 CZ2 B TRP 162 ? ? 2_555 1.21 
344  1 OG1 B THR 247 ? ? 1_555 OE1 C GLN 165 ? ? 3_555 1.21 
345  1 CA  B ALA 236 ? ? 1_555 CG1 C VAL 145 ? ? 3_555 1.22 
346  1 CD2 B PHE 135 ? ? 1_555 CA  C TYR 243 ? ? 3_555 1.22 
347  1 C   B MET 133 ? ? 1_555 CD2 C TYR 117 ? ? 3_555 1.22 
348  1 CE1 B TYR 246 ? ? 1_555 O   C TRP 162 ? ? 3_555 1.22 
349  1 CG2 B ILE 248 ? ? 1_555 O   C ALA 48  ? ? 3_555 1.22 
350  1 CB  B LEU 242 ? ? 1_555 N   C HIS 132 ? ? 3_555 1.22 
351  1 OE2 C GLU 73  ? ? 1_555 C   C GLU 252 ? ? 2_555 1.22 
352  1 O   B GLU 229 ? ? 1_555 OE1 C GLN 136 ? ? 3_555 1.22 
353  1 CD  C GLU 73  ? ? 1_555 O   C GLU 252 ? ? 2_555 1.22 
354  1 N   B TYR 243 ? ? 1_555 N   C GLY 159 ? ? 3_555 1.22 
355  1 O   C GLY 97  ? ? 1_555 N   C ALA 255 ? ? 2_555 1.22 
356  1 CE1 B TYR 246 ? ? 1_555 C   C TRP 162 ? ? 3_555 1.22 
357  1 CE3 B TRP 99  ? ? 1_555 CB  C THR 125 ? ? 3_555 1.23 
358  1 N   B VAL 161 ? ? 1_555 CA  C LEU 153 ? ? 3_555 1.23 
359  1 CG1 B VAL 157 ? ? 1_555 C   C ILE 185 ? ? 3_555 1.23 
360  1 CB  B ILE 185 ? ? 1_555 O   C TYR 117 ? ? 3_555 1.23 
361  1 O   C PRO 57  ? ? 1_555 CA  C VAL 66  ? ? 2_555 1.23 
362  1 CA  B ARG 241 ? ? 1_555 CG  C HIS 132 ? ? 3_555 1.23 
363  1 C   B LEU 187 ? ? 1_555 CB  C VAL 171 ? ? 3_555 1.23 
364  1 OD1 B ASP 188 ? ? 1_555 CD2 C LEU 55  ? ? 3_555 1.23 
365  1 CD1 B ILE 115 ? ? 1_555 CD  C PRO 121 ? ? 3_555 1.24 
366  1 N   B MET 133 ? ? 1_555 CD2 C LEU 224 ? ? 3_555 1.24 
367  1 OG1 B THR 239 ? ? 1_555 CA  C LEU 150 ? ? 3_555 1.24 
368  1 CB  A ILE 254 ? ? 1_555 CA  B SER 128 ? ? 2_555 1.24 
369  1 C   C GLY 102 ? ? 1_555 CG  C ASN 106 ? ? 2_555 1.24 
370  1 CB  B TYR 246 ? ? 1_555 NE2 C GLN 49  ? ? 3_555 1.24 
371  1 O   B TYR 117 ? ? 1_555 O   C ILE 183 ? ? 3_555 1.24 
372  1 O   B LEU 90  ? ? 1_555 O   C GLY 240 ? ? 3_555 1.24 
373  1 CG  B PRO 221 ? ? 1_555 NH2 C ARG 241 ? ? 3_555 1.24 
374  1 N   B GLY 134 ? ? 1_555 CD2 C TYR 117 ? ? 3_555 1.25 
375  1 CB  B LEU 242 ? ? 1_555 C   C ILE 131 ? ? 3_555 1.25 
376  1 CD2 B HIS 132 ? ? 1_555 N   C LEU 224 ? ? 3_555 1.25 
377  1 CD1 B TYR 137 ? ? 1_555 N   C LEU 74  ? ? 3_555 1.25 
378  1 CB  B HIS 132 ? ? 1_555 CB  C LEU 224 ? ? 3_555 1.25 
379  1 N   B VAL 237 ? ? 1_555 CG2 C VAL 145 ? ? 3_555 1.25 
380  1 O   B TRP 99  ? ? 1_555 N   C THR 126 ? ? 3_555 1.25 
381  1 CE2 B PHE 170 ? ? 1_555 O   C THR 179 ? ? 3_555 1.26 
382  1 N   B ILE 183 ? ? 1_555 O   C HOH 267 ? ? 3_555 1.26 
383  1 O   B TYR 156 ? ? 1_555 C   C ILE 115 ? ? 3_555 1.26 
384  1 CE1 B TYR 137 ? ? 1_555 N   C LEU 74  ? ? 3_555 1.26 
385  1 N   B ARG 101 ? ? 1_555 OG1 C THR 127 ? ? 3_555 1.26 
386  1 CD1 B TYR 117 ? ? 1_555 CD2 C TYR 119 ? ? 3_555 1.27 
387  1 O   B THR 81  ? ? 1_555 CA  C THR 142 ? ? 3_555 1.27 
388  1 O   C GLY 97  ? ? 1_555 C   C ILE 254 ? ? 2_555 1.27 
389  1 N   B LEU 242 ? ? 1_555 O   C ILE 131 ? ? 3_555 1.27 
390  1 CB  B GLU 229 ? ? 1_555 CD  C ARG 223 ? ? 3_555 1.27 
391  1 CA  B THR 87  ? ? 1_555 OG1 C THR 87  ? ? 3_555 1.27 
392  1 CB  A PRO 253 ? ? 1_555 CE2 B TRP 162 ? ? 2_555 1.27 
393  1 N   B GLY 159 ? ? 1_555 CD1 C PHE 135 ? ? 3_555 1.27 
394  1 CA  B THR 158 ? ? 1_555 CE1 C PHE 135 ? ? 3_555 1.27 
395  1 C   B ALA 244 ? ? 1_555 CB  C GLU 163 ? ? 3_555 1.28 
396  1 CB  B ASN 238 ? ? 1_555 C   C SER 146 ? ? 3_555 1.28 
397  1 CB  B TRP 112 ? ? 1_555 OG1 C THR 51  ? ? 3_555 1.28 
398  1 O   B LEU 224 ? ? 1_555 CG2 C THR 76  ? ? 3_555 1.28 
399  1 CD1 B LEU 90  ? ? 1_555 OE2 C GLU 77  ? ? 3_555 1.28 
400  1 C   B SER 245 ? ? 1_555 N   C GLY 164 ? ? 3_555 1.28 
401  1 C   B HIS 132 ? ? 1_555 CD2 C LEU 224 ? ? 3_555 1.29 
402  1 CB  B VAL 80  ? ? 1_555 N   C PRO 144 ? ? 3_555 1.29 
403  1 CG1 B ILE 185 ? ? 1_555 C   C TYR 117 ? ? 3_555 1.29 
404  1 C   C GLY 97  ? ? 1_555 CG1 C ILE 254 ? ? 2_555 1.29 
405  1 C   B ASN 190 ? ? 1_555 C   C LYS 54  ? ? 3_555 1.29 
406  1 OG1 B THR 98  ? ? 1_555 N   C SER 128 ? ? 3_555 1.29 
407  1 O   C ARG 56  ? ? 1_555 CD1 C ILE 251 ? ? 2_555 1.29 
408  1 CG2 A ILE 254 ? ? 1_555 CB  B SER 128 ? ? 2_555 1.29 
409  1 N   C LEU 100 ? ? 1_555 O   C ASN 106 ? ? 2_555 1.29 
410  1 CB  B THR 239 ? ? 1_555 N   C LEU 150 ? ? 3_555 1.29 
411  1 OH  B TYR 119 ? ? 1_555 O   C LEU 150 ? ? 3_555 1.29 
412  1 OH  C TYR 246 ? ? 1_555 CA  C PRO 253 ? ? 2_555 1.29 
413  1 C   B TYR 117 ? ? 1_555 CB  C ILE 183 ? ? 3_555 1.30 
414  1 C   B THR 81  ? ? 1_555 C   C THR 142 ? ? 3_555 1.30 
415  1 C   B TYR 117 ? ? 1_555 CG2 C ILE 183 ? ? 3_555 1.30 
416  1 CA  B LEU 74  ? ? 1_555 CB  C ALA 130 ? ? 3_555 1.30 
417  1 OE2 B GLU 191 ? ? 1_555 N   C ARG 56  ? ? 3_555 1.30 
418  1 N   C PRO 57  ? ? 1_555 CD1 C ILE 251 ? ? 2_555 1.30 
419  1 CD1 B ILE 131 ? ? 1_555 C   C MET 133 ? ? 3_555 1.30 
420  1 CB  B ILE 248 ? ? 1_555 C   C GLN 49  ? ? 3_555 1.30 
421  1 ND1 C HIS 71  ? ? 1_555 O   C ILE 251 ? ? 2_555 1.30 
422  1 C   B ILE 115 ? ? 1_555 O   C GLY 164 ? ? 3_555 1.30 
423  1 O   C TRP 99  ? ? 1_555 CA  C ASN 106 ? ? 2_555 1.30 
424  1 CZ  B TYR 117 ? ? 1_555 CD2 C TYR 119 ? ? 3_555 1.30 
425  1 CG  B TYR 117 ? ? 1_555 CB  C TYR 119 ? ? 3_555 1.31 
426  1 CA  B THR 158 ? ? 1_555 CD1 C PHE 135 ? ? 3_555 1.31 
427  1 CD1 B LEU 69  ? ? 1_555 N   C ILE 47  ? ? 3_555 1.31 
428  1 ND2 B ASN 152 ? ? 1_555 CA  C PRO 93  ? ? 3_555 1.31 
429  1 O   B VAL 147 ? ? 1_555 C   C LEU 90  ? ? 3_555 1.31 
430  1 O   B GLN 136 ? ? 1_555 CD1 C LEU 74  ? ? 3_555 1.31 
431  1 N   B VAL 82  ? ? 1_555 CB  C THR 142 ? ? 3_555 1.31 
432  1 OG1 B THR 184 ? ? 1_555 N   C THR 184 ? ? 3_555 1.31 
433  1 N   B CYS 123 ? ? 1_555 OG  C SER 151 ? ? 3_555 1.32 
434  1 O   C CYS 72  ? ? 1_555 CB  C GLU 252 ? ? 2_555 1.32 
435  1 C   C PRO 58  ? ? 1_555 C   C VAL 66  ? ? 2_555 1.32 
436  1 CB  C MET 59  ? ? 1_555 O   C VAL 66  ? ? 2_555 1.32 
437  1 O   B TYR 246 ? ? 1_555 CD  C GLN 49  ? ? 3_555 1.32 
438  1 N   B TRP 99  ? ? 1_555 N   C THR 127 ? ? 3_555 1.32 
439  1 C   B VAL 147 ? ? 1_555 C   C LEU 90  ? ? 3_555 1.32 
440  1 C   B ALA 236 ? ? 1_555 CB  C VAL 145 ? ? 3_555 1.32 
441  1 CA  B GLU 73  ? ? 1_555 CG  C PRO 160 ? ? 3_555 1.32 
442  1 C   B PHE 135 ? ? 1_555 C   C LEU 74  ? ? 3_555 1.32 
443  1 CD2 B LEU 150 ? ? 1_555 CB  C GLU 89  ? ? 3_555 1.32 
444  1 CA  B THR 95  ? ? 1_555 C   C ASN 238 ? ? 3_555 1.33 
445  1 CB  B ILE 185 ? ? 1_555 C   C TYR 117 ? ? 3_555 1.33 
446  1 N   B TYR 119 ? ? 1_555 CB  C VAL 157 ? ? 3_555 1.33 
447  1 CB  B GLN 149 ? ? 1_555 N   C THR 95  ? ? 3_555 1.33 
448  1 C   B PRO 160 ? ? 1_555 CA  C LEU 153 ? ? 3_555 1.33 
449  1 CA  B THR 98  ? ? 1_555 N   C SER 128 ? ? 3_555 1.33 
450  1 NE2 C HIS 71  ? ? 1_555 CA  C ILE 251 ? ? 2_555 1.33 
451  1 CA  B LYS 154 ? ? 1_555 C   C ALA 244 ? ? 3_555 1.33 
452  1 N   B GLY 155 ? ? 1_555 C   C ALA 244 ? ? 3_555 1.33 
453  1 CA  B ALA 130 ? ? 1_555 C   C PHE 135 ? ? 3_555 1.33 
454  1 CA  B TYR 243 ? ? 1_555 N   C GLY 159 ? ? 3_555 1.34 
455  1 N   B THR 98  ? ? 1_555 C   C THR 127 ? ? 3_555 1.34 
456  1 CZ  C TYR 246 ? ? 1_555 CB  C PRO 253 ? ? 2_555 1.34 
457  1 CA  B ASN 148 ? ? 1_555 CB  C MET 92  ? ? 3_555 1.34 
458  1 N   B THR 81  ? ? 1_555 C   C LEU 143 ? ? 3_555 1.34 
459  1 O   B SER 245 ? ? 1_555 N   C GLN 165 ? ? 3_555 1.35 
460  1 C   C GLY 97  ? ? 1_555 CB  C ILE 254 ? ? 2_555 1.35 
461  1 O   B THR 98  ? ? 1_555 C   C THR 126 ? ? 3_555 1.35 
462  1 CG  B LEU 78  ? ? 1_555 CB  C ALA 227 ? ? 3_555 1.35 
463  1 CD1 B ILE 115 ? ? 1_555 C   C LEU 120 ? ? 3_555 1.35 
464  1 CA  B TYR 119 ? ? 1_555 CA  C VAL 157 ? ? 3_555 1.35 
465  1 CG  B LYS 154 ? ? 1_555 CB  C CYS 72  ? ? 3_555 1.35 
466  1 N   B VAL 80  ? ? 1_555 C   C PRO 144 ? ? 3_555 1.36 
467  1 C   C GLY 102 ? ? 1_555 OD1 C ASN 106 ? ? 2_555 1.36 
468  1 CE  C MET 59  ? ? 1_555 CB  C SER 63  ? ? 2_555 1.36 
469  1 CD2 C TRP 99  ? ? 1_555 CG  C TRP 107 ? ? 2_555 1.36 
470  1 N   B SER 88  ? ? 1_555 O   C HOH 265 ? ? 3_555 1.36 
471  1 CG  B PRO 221 ? ? 1_555 CZ  C ARG 241 ? ? 3_555 1.36 
472  1 CB  B ILE 183 ? ? 1_555 O   C GLY 155 ? ? 3_555 1.36 
473  1 N   B THR 118 ? ? 1_555 CG2 C ILE 183 ? ? 3_555 1.36 
474  1 ND2 B ASN 152 ? ? 1_555 N   C PRO 93  ? ? 3_555 1.36 
475  1 O   B THR 81  ? ? 1_555 N   C LEU 143 ? ? 3_555 1.36 
476  1 O   B ASN 238 ? ? 1_555 N   C GLN 149 ? ? 3_555 1.37 
477  1 CG1 B VAL 157 ? ? 1_555 N   C ALA 186 ? ? 3_555 1.37 
478  1 SD  C MET 59  ? ? 1_555 CA  C SER 63  ? ? 2_555 1.37 
479  1 C   B SER 146 ? ? 1_555 CB  C LEU 90  ? ? 3_555 1.37 
480  1 N   B VAL 113 ? ? 1_555 O   C GLY 50  ? ? 3_555 1.37 
481  1 O   A LEU 258 ? ? 1_555 O   B GLY 231 ? ? 2_555 1.37 
482  1 OG1 B THR 76  ? ? 1_555 CB  C MET 228 ? ? 3_555 1.37 
483  1 C   B LEU 100 ? ? 1_555 O   C PRO 124 ? ? 3_555 1.37 
484  1 C   B THR 81  ? ? 1_555 CA  C THR 142 ? ? 3_555 1.37 
485  1 C   B TYR 119 ? ? 1_555 C   C VAL 157 ? ? 3_555 1.37 
486  1 O   C PRO 58  ? ? 1_555 CA  C THR 67  ? ? 2_555 1.37 
487  1 O   C LEU 60  ? ? 1_555 N   C SER 62  ? ? 2_555 1.37 
488  1 OG1 B THR 98  ? ? 1_555 CA  C SER 128 ? ? 3_555 1.37 
489  1 C   B ALA 227 ? ? 1_555 O   C LEU 224 ? ? 3_555 1.37 
490  1 O   B TRP 112 ? ? 1_555 N   C MET 52  ? ? 3_555 1.38 
491  1 N   B VAL 80  ? ? 1_555 O   C PRO 144 ? ? 3_555 1.38 
492  1 C   B CYS 123 ? ? 1_555 OD1 C ASN 152 ? ? 3_555 1.38 
493  1 O   B PRO 160 ? ? 1_555 O   C LEU 153 ? ? 3_555 1.38 
494  1 C   B HIS 132 ? ? 1_555 CB  C LEU 224 ? ? 3_555 1.39 
495  1 NH2 C ARG 101 ? ? 1_555 N   C LEU 258 ? ? 2_555 1.39 
496  1 CB  C TRP 99  ? ? 1_555 C   C TRP 107 ? ? 2_555 1.39 
497  1 N   B HIS 132 ? ? 1_555 CA  C LEU 224 ? ? 3_555 1.39 
498  1 O   B VAL 85  ? ? 1_555 N   C SER 88  ? ? 3_555 1.39 
499  1 CA  B TYR 117 ? ? 1_555 CG2 C ILE 183 ? ? 3_555 1.39 
500  1 CA  B SER 245 ? ? 1_555 CG  C GLU 163 ? ? 3_555 1.39 
501  1 CB  B GLU 191 ? ? 1_555 CB  C LEU 55  ? ? 3_555 1.39 
502  1 CB  B ASP 188 ? ? 1_555 O   C VAL 171 ? ? 3_555 1.39 
503  1 CE1 B HIS 132 ? ? 1_555 N   C ARG 223 ? ? 3_555 1.39 
504  1 CD1 B ILE 185 ? ? 1_555 N   C THR 118 ? ? 3_555 1.39 
505  1 C   B PRO 160 ? ? 1_555 C   C LEU 153 ? ? 3_555 1.39 
506  1 O   B TYR 119 ? ? 1_555 CA  C VAL 157 ? ? 3_555 1.39 
507  1 CG  C TRP 99  ? ? 1_555 CB  C TRP 107 ? ? 2_555 1.39 
508  1 NH1 C ARG 101 ? ? 1_555 CG  C LEU 258 ? ? 2_555 1.39 
509  1 N   C VAL 103 ? ? 1_555 OD1 C ASN 106 ? ? 2_555 1.39 
510  1 CA  B THR 95  ? ? 1_555 N   C THR 239 ? ? 3_555 1.39 
511  1 CA  B LEU 153 ? ? 1_555 CG1 C VAL 96  ? ? 3_555 1.39 
512  1 CB  B ALA 130 ? ? 1_555 CA  C GLN 136 ? ? 3_555 1.39 
513  1 CG1 C VAL 103 ? ? 1_555 CB  C ASN 106 ? ? 2_555 1.40 
514  1 C   C GLY 97  ? ? 1_555 CA  C ILE 254 ? ? 2_555 1.40 
515  1 O   B GLU 89  ? ? 1_555 N   C LEU 78  ? ? 3_555 1.40 
516  1 CB  B THR 87  ? ? 1_555 CG2 C THR 87  ? ? 3_555 1.40 
517  1 C   B GLY 155 ? ? 1_555 C   C ARG 116 ? ? 3_555 1.40 
518  1 CG2 B VAL 86  ? ? 1_555 O   C SER 88  ? ? 3_555 1.40 
519  1 CA  B ASN 238 ? ? 1_555 N   C SER 146 ? ? 3_555 1.40 
520  1 C   B LYS 154 ? ? 1_555 N   C SER 245 ? ? 3_555 1.40 
521  1 C   B THR 95  ? ? 1_555 CB  C THR 239 ? ? 3_555 1.40 
522  1 OE2 C GLU 73  ? ? 1_555 O   C GLU 252 ? ? 2_555 1.40 
523  1 CZ  B TYR 117 ? ? 1_555 CE2 C TYR 119 ? ? 3_555 1.40 
524  1 CA  B THR 158 ? ? 1_555 CZ  C PHE 135 ? ? 3_555 1.40 
525  1 CB  B TRP 162 ? ? 1_555 CB  C ASN 152 ? ? 3_555 1.40 
526  1 N   B PRO 93  ? ? 1_555 CA  C SER 122 ? ? 3_555 1.40 
527  1 CG  B GLN 149 ? ? 1_555 OG1 C THR 95  ? ? 3_555 1.41 
528  1 NE2 C HIS 71  ? ? 1_555 N   C GLU 252 ? ? 2_555 1.41 
529  1 CA  B VAL 96  ? ? 1_555 CG2 C THR 239 ? ? 3_555 1.41 
530  1 N   B GLU 191 ? ? 1_555 N   C LEU 55  ? ? 3_555 1.41 
531  1 O   B TYR 156 ? ? 1_555 O   C ILE 115 ? ? 3_555 1.41 
532  1 CG  A ASN 106 ? ? 1_555 CG2 B THR 126 ? ? 2_555 1.41 
533  1 OE2 B GLU 89  ? ? 1_555 CA  C ALA 79  ? ? 3_555 1.41 
534  1 N   C MET 59  ? ? 1_555 C   C VAL 66  ? ? 2_555 1.41 
535  1 C   B ASN 190 ? ? 1_555 N   C LYS 54  ? ? 3_555 1.41 
536  1 CA  C MET 59  ? ? 1_555 O   C VAL 66  ? ? 2_555 1.41 
537  1 CE3 C TRP 99  ? ? 1_555 CD2 C TRP 107 ? ? 2_555 1.41 
538  1 C   B ALA 79  ? ? 1_555 O   C PRO 144 ? ? 3_555 1.41 
539  1 O   B VAL 237 ? ? 1_555 NE2 C GLN 149 ? ? 3_555 1.41 
540  1 C   B THR 81  ? ? 1_555 N   C LEU 143 ? ? 3_555 1.41 
541  1 CA  B MET 133 ? ? 1_555 CD2 C LEU 224 ? ? 3_555 1.42 
542  1 O   B ASN 148 ? ? 1_555 O   C MET 92  ? ? 3_555 1.42 
543  1 CB  B ALA 130 ? ? 1_555 C   C PHE 135 ? ? 3_555 1.42 
544  1 CB  B PRO 93  ? ? 1_555 C   C SER 122 ? ? 3_555 1.42 
545  1 C   C TRP 99  ? ? 1_555 C   C ASN 106 ? ? 2_555 1.42 
546  1 CG  B TRP 99  ? ? 1_555 O   C THR 125 ? ? 3_555 1.42 
547  1 C   B PRO 160 ? ? 1_555 N   C LYS 154 ? ? 3_555 1.42 
548  1 CG  A PRO 253 ? ? 1_555 NE1 B TRP 162 ? ? 2_555 1.42 
549  1 OD1 B ASN 152 ? ? 1_555 O   C PRO 93  ? ? 3_555 1.42 
550  1 CB  B TYR 243 ? ? 1_555 N   C GLY 159 ? ? 3_555 1.42 
551  1 N   B PRO 93  ? ? 1_555 CB  C SER 122 ? ? 3_555 1.43 
552  1 CE1 C TYR 205 ? ? 1_555 O   B HOH 266 ? ? 2_555 1.43 
553  1 CG  B ARG 223 ? ? 1_555 C   C THR 76  ? ? 3_555 1.43 
554  1 CG1 B ILE 185 ? ? 1_555 CA  C THR 118 ? ? 3_555 1.43 
555  1 O   B THR 98  ? ? 1_555 N   C THR 127 ? ? 3_555 1.43 
556  1 O   B MET 133 ? ? 1_555 CD2 C TYR 117 ? ? 3_555 1.43 
557  1 CB  B ILE 131 ? ? 1_555 C   C GLY 134 ? ? 3_555 1.43 
558  1 CG2 B VAL 91  ? ? 1_555 CB  C ARG 241 ? ? 3_555 1.43 
559  1 CB  B VAL 225 ? ? 1_555 OG1 C THR 76  ? ? 3_555 1.43 
560  1 CD  C PRO 57  ? ? 1_555 NH1 C ARG 249 ? ? 2_555 1.43 
561  1 CG  B TRP 162 ? ? 1_555 O   C ASN 152 ? ? 3_555 1.43 
562  1 SD  C MET 59  ? ? 1_555 O   C SER 63  ? ? 2_555 1.43 
563  1 N   B VAL 80  ? ? 1_555 CA  C PRO 144 ? ? 3_555 1.43 
564  1 C   B GLN 136 ? ? 1_555 CG  C LEU 74  ? ? 3_555 1.43 
565  1 CZ3 B TRP 99  ? ? 1_555 OG1 C THR 125 ? ? 3_555 1.43 
566  1 ND2 A ASN 106 ? ? 1_555 CG2 B THR 126 ? ? 2_555 1.43 
567  1 C   B PRO 93  ? ? 1_555 CA  C CYS 123 ? ? 3_555 1.44 
568  1 CB  B GLN 149 ? ? 1_555 CB  C THR 95  ? ? 3_555 1.44 
569  1 CG  B ARG 116 ? ? 1_555 N   C ILE 183 ? ? 3_555 1.44 
570  1 CA  B GLU 191 ? ? 1_555 C   C LYS 54  ? ? 3_555 1.44 
571  1 CD  A PRO 253 ? ? 1_555 CZ2 B TRP 162 ? ? 2_555 1.44 
572  1 C   B MET 133 ? ? 1_555 CG  C TYR 117 ? ? 3_555 1.44 
573  1 CA  B VAL 80  ? ? 1_555 C   C LEU 143 ? ? 3_555 1.44 
574  1 CB  B VAL 161 ? ? 1_555 CD1 C LEU 153 ? ? 3_555 1.44 
575  1 CZ  C ARG 101 ? ? 1_555 N   C LEU 258 ? ? 2_555 1.44 
576  1 O   A ILE 254 ? ? 1_555 C   B THR 126 ? ? 2_555 1.44 
577  1 C   B ILE 183 ? ? 1_555 O   C THR 184 ? ? 3_555 1.44 
578  1 CG1 B VAL 237 ? ? 1_555 OE1 C GLN 149 ? ? 3_555 1.44 
579  1 C   A LEU 258 ? ? 1_555 OG  B SER 232 ? ? 2_555 1.44 
580  1 O   B CYS 72  ? ? 1_555 CZ2 C TRP 162 ? ? 3_555 1.44 
581  1 CG  B ARG 241 ? ? 1_555 CE1 C HIS 132 ? ? 3_555 1.44 
582  1 CB  B THR 247 ? ? 1_555 CD  C GLN 165 ? ? 3_555 1.44 
583  1 N   B ALA 130 ? ? 1_555 CG  C GLN 136 ? ? 3_555 1.45 
584  1 N   B LEU 242 ? ? 1_555 C   C ILE 131 ? ? 3_555 1.45 
585  1 CB  C PRO 57  ? ? 1_555 CG  C ARG 249 ? ? 2_555 1.45 
586  1 CA  B TRP 99  ? ? 1_555 CA  C THR 126 ? ? 3_555 1.45 
587  1 CA  B GLN 136 ? ? 1_555 C   C LEU 74  ? ? 3_555 1.45 
588  1 N   B PHE 170 ? ? 1_555 O   C SER 180 ? ? 3_555 1.45 
589  1 N   B TYR 119 ? ? 1_555 CA  C VAL 157 ? ? 3_555 1.45 
590  1 NH1 B ARG 101 ? ? 1_555 CG1 C VAL 237 ? ? 3_555 1.45 
591  1 N   B THR 81  ? ? 1_555 N   C LEU 143 ? ? 3_555 1.45 
592  1 CE3 B TRP 99  ? ? 1_555 O   C THR 125 ? ? 3_555 1.45 
593  1 CA  B THR 184 ? ? 1_555 CA  C THR 184 ? ? 3_555 1.46 
594  1 CA  B THR 95  ? ? 1_555 O   C ASN 238 ? ? 3_555 1.46 
595  1 CD1 A ILE 254 ? ? 1_555 N   B GLY 129 ? ? 2_555 1.46 
596  1 OE2 C GLU 73  ? ? 1_555 CA  C PRO 253 ? ? 2_555 1.46 
597  1 CB  B GLN 149 ? ? 1_555 OG1 C THR 95  ? ? 3_555 1.46 
598  1 C   B ALA 182 ? ? 1_555 O   C HOH 267 ? ? 3_555 1.47 
599  1 N   B ALA 114 ? ? 1_555 CG2 C THR 51  ? ? 3_555 1.47 
600  1 CE2 B TYR 156 ? ? 1_555 CG2 C VAL 91  ? ? 3_555 1.47 
601  1 CG  B ASN 148 ? ? 1_555 SD  C MET 92  ? ? 3_555 1.47 
602  1 CH2 C TRP 99  ? ? 1_555 CE3 C TRP 107 ? ? 2_555 1.47 
603  1 CG2 B THR 158 ? ? 1_555 CD2 C PHE 135 ? ? 3_555 1.47 
604  1 C   C GLY 102 ? ? 1_555 ND2 C ASN 106 ? ? 2_555 1.47 
605  1 CD1 A ILE 254 ? ? 1_555 O   B SER 128 ? ? 2_555 1.48 
606  1 N   B GLY 240 ? ? 1_555 CB  C LEU 150 ? ? 3_555 1.48 
607  1 CB  B SER 151 ? ? 1_555 C   C VAL 91  ? ? 3_555 1.48 
608  1 C   B LEU 74  ? ? 1_555 CA  C ALA 130 ? ? 3_555 1.48 
609  1 O   B SER 245 ? ? 1_555 C   C GLY 164 ? ? 3_555 1.48 
610  1 CD1 B ILE 131 ? ? 1_555 N   C GLY 134 ? ? 3_555 1.48 
611  1 C   B THR 95  ? ? 1_555 OG1 C THR 239 ? ? 3_555 1.48 
612  1 O   A LEU 258 ? ? 1_555 N   B SER 232 ? ? 2_555 1.48 
613  1 CG  C PRO 58  ? ? 1_555 C   C LEU 250 ? ? 2_555 1.48 
614  1 O   B TYR 243 ? ? 1_555 CD1 C ILE 183 ? ? 3_555 1.48 
615  1 ND2 A ASN 106 ? ? 1_555 OG1 B THR 126 ? ? 2_555 1.48 
616  1 N   B GLY 159 ? ? 1_555 CG  C PHE 135 ? ? 3_555 1.48 
617  1 CA  B PHE 170 ? ? 1_555 CA  C ARG 181 ? ? 3_555 1.48 
618  1 CA  B THR 158 ? ? 1_555 CG  C PHE 135 ? ? 3_555 1.48 
619  1 CB  C ARG 101 ? ? 1_555 CB  C ALA 255 ? ? 2_555 1.48 
620  1 CA  B THR 239 ? ? 1_555 CA  C LEU 150 ? ? 3_555 1.48 
621  1 O   B TYR 246 ? ? 1_555 OE1 C GLN 49  ? ? 3_555 1.48 
622  1 CD2 B TYR 117 ? ? 1_555 CA  C TYR 119 ? ? 3_555 1.48 
623  1 CG2 B ILE 183 ? ? 1_555 CG1 C ILE 185 ? ? 3_555 1.48 
624  1 CA  B TRP 112 ? ? 1_555 CA  C THR 51  ? ? 3_555 1.48 
625  1 CA  B TRP 99  ? ? 1_555 N   C THR 126 ? ? 3_555 1.48 
626  1 CA  C THR 98  ? ? 1_555 CG1 C ILE 254 ? ? 2_555 1.49 
627  1 CG  B LEU 100 ? ? 1_555 O   C CYS 123 ? ? 3_555 1.49 
628  1 C   B VAL 80  ? ? 1_555 N   C PRO 144 ? ? 3_555 1.49 
629  1 O   B LEU 74  ? ? 1_555 C   C GLY 129 ? ? 3_555 1.49 
630  1 CG  B LYS 154 ? ? 1_555 CA  C CYS 72  ? ? 3_555 1.49 
631  1 CA  B ASN 238 ? ? 1_555 O   C SER 146 ? ? 3_555 1.49 
632  1 OE1 B GLU 191 ? ? 1_555 N   C ARG 56  ? ? 3_555 1.49 
633  1 CD2 B LEU 78  ? ? 1_555 N   C ALA 227 ? ? 3_555 1.49 
634  1 O   B THR 189 ? ? 1_555 C   C VAL 53  ? ? 3_555 1.50 
635  1 O   B VAL 80  ? ? 1_555 C   C LEU 143 ? ? 3_555 1.50 
636  1 C   B THR 98  ? ? 1_555 C   C THR 127 ? ? 3_555 1.50 
637  1 O   B ALA 227 ? ? 1_555 N   C VAL 225 ? ? 3_555 1.50 
638  1 O   B VAL 91  ? ? 1_555 NH1 C ARG 241 ? ? 3_555 1.50 
639  1 CB  B GLU 229 ? ? 1_555 CZ  C ARG 223 ? ? 3_555 1.50 
640  1 CZ3 C TRP 99  ? ? 1_555 CG  C TRP 107 ? ? 2_555 1.50 
641  1 O   B HOH 262 ? ? 1_555 O   C HOH 263 ? ? 3_555 1.50 
642  1 O   B THR 87  ? ? 1_555 O   C HOH 265 ? ? 3_555 1.50 
643  1 OG1 B THR 189 ? ? 1_555 CG  C LEU 168 ? ? 3_555 1.50 
644  1 O   B LEU 120 ? ? 1_555 OH  C TYR 156 ? ? 3_555 1.50 
645  1 CA  B TRP 99  ? ? 1_555 C   C THR 126 ? ? 3_555 1.50 
646  1 N   B LEU 153 ? ? 1_555 CB  C VAL 96  ? ? 3_555 1.50 
647  1 CB  B GLU 191 ? ? 1_555 N   C LEU 55  ? ? 3_555 1.50 
648  1 OG1 B THR 118 ? ? 1_555 O   C ALA 182 ? ? 3_555 1.50 
649  1 CB  B TYR 119 ? ? 1_555 N   C VAL 157 ? ? 3_555 1.51 
650  1 O   B GLU 229 ? ? 1_555 CD  C GLN 136 ? ? 3_555 1.51 
651  1 CG  B ASN 238 ? ? 1_555 CA  C SER 146 ? ? 3_555 1.51 
652  1 CG2 A ILE 254 ? ? 1_555 CA  B SER 128 ? ? 2_555 1.51 
653  1 O   B THR 98  ? ? 1_555 O   C THR 126 ? ? 3_555 1.51 
654  1 CB  B ILE 248 ? ? 1_555 N   C GLN 49  ? ? 3_555 1.51 
655  1 CG  B ARG 241 ? ? 1_555 NE2 C HIS 132 ? ? 3_555 1.51 
656  1 N   B MET 228 ? ? 1_555 CB  C SER 88  ? ? 3_555 1.51 
657  1 O   B THR 247 ? ? 1_555 O   C GLY 50  ? ? 3_555 1.51 
658  1 O   B MET 228 ? ? 1_555 CD2 C LEU 143 ? ? 3_555 1.51 
659  1 C   B TYR 119 ? ? 1_555 CA  C VAL 157 ? ? 3_555 1.51 
660  1 CA  B TYR 117 ? ? 1_555 CB  C ILE 183 ? ? 3_555 1.51 
661  1 N   B VAL 82  ? ? 1_555 CA  C THR 142 ? ? 3_555 1.51 
662  1 C   B LEU 100 ? ? 1_555 C   C PRO 124 ? ? 3_555 1.51 
663  1 CA  B VAL 80  ? ? 1_555 CD  C PRO 144 ? ? 3_555 1.52 
664  1 N   B GLU 191 ? ? 1_555 O   C LYS 54  ? ? 3_555 1.52 
665  1 CD1 B ILE 183 ? ? 1_555 N   C GLY 155 ? ? 3_555 1.52 
666  1 O   B PRO 124 ? ? 1_555 ND2 C ASN 152 ? ? 3_555 1.52 
667  1 C   B TYR 117 ? ? 1_555 CA  C ILE 183 ? ? 3_555 1.52 
668  1 N   B ASN 238 ? ? 1_555 CB  C SER 146 ? ? 3_555 1.52 
669  1 O   B ALA 222 ? ? 1_555 CD  C ARG 241 ? ? 3_555 1.52 
670  1 N   B THR 184 ? ? 1_555 C   C THR 184 ? ? 3_555 1.52 
671  1 CG  B LEU 69  ? ? 1_555 CB  C PRO 46  ? ? 3_555 1.52 
672  1 CG2 B VAL 91  ? ? 1_555 N   C ARG 241 ? ? 3_555 1.52 
673  1 CD1 B LEU 242 ? ? 1_555 CD1 C ILE 131 ? ? 3_555 1.52 
674  1 CE2 B PHE 170 ? ? 1_555 C   C THR 179 ? ? 3_555 1.52 
675  1 SD  B MET 228 ? ? 1_555 CB  C VAL 225 ? ? 3_555 1.52 
676  1 CD2 B LEU 153 ? ? 1_555 O   C VAL 96  ? ? 3_555 1.52 
677  1 CZ  B TYR 156 ? ? 1_555 CG1 C VAL 91  ? ? 3_555 1.52 
678  1 CB  B VAL 192 ? ? 1_555 O   C VAL 53  ? ? 3_555 1.53 
679  1 CA  B THR 81  ? ? 1_555 N   C LEU 143 ? ? 3_555 1.53 
680  1 CB  B ASP 188 ? ? 1_555 C   C VAL 171 ? ? 3_555 1.53 
681  1 CB  B ILE 248 ? ? 1_555 CA  C GLN 49  ? ? 3_555 1.53 
682  1 CA  B GLN 149 ? ? 1_555 N   C THR 95  ? ? 3_555 1.53 
683  1 N   B PRO 121 ? ? 1_555 CE1 C TYR 156 ? ? 3_555 1.53 
684  1 N   B TYR 119 ? ? 1_555 C   C VAL 157 ? ? 3_555 1.53 
685  1 C   B GLU 89  ? ? 1_555 C   C GLU 77  ? ? 3_555 1.53 
686  1 CA  B VAL 161 ? ? 1_555 CA  C LEU 153 ? ? 3_555 1.53 
687  1 CB  B THR 158 ? ? 1_555 CD2 C PHE 135 ? ? 3_555 1.53 
688  1 CB  B THR 87  ? ? 1_555 CB  C THR 87  ? ? 3_555 1.53 
689  1 C   B PRO 93  ? ? 1_555 N   C CYS 123 ? ? 3_555 1.54 
690  1 N   C MET 59  ? ? 1_555 N   C THR 67  ? ? 2_555 1.54 
691  1 O   B LYS 154 ? ? 1_555 C   C ALA 244 ? ? 3_555 1.54 
692  1 CA  B LEU 120 ? ? 1_555 CE1 C TYR 156 ? ? 3_555 1.54 
693  1 C   B LYS 154 ? ? 1_555 O   C ALA 244 ? ? 3_555 1.54 
694  1 CA  B GLN 149 ? ? 1_555 CB  C THR 95  ? ? 3_555 1.54 
695  1 N   B GLY 230 ? ? 1_555 OE1 C GLN 136 ? ? 3_555 1.54 
696  1 O   C TRP 99  ? ? 1_555 C   C ASN 106 ? ? 2_555 1.54 
697  1 C   B GLU 73  ? ? 1_555 N   C PRO 160 ? ? 3_555 1.54 
698  1 N   B PRO 160 ? ? 1_555 CB  C LYS 154 ? ? 3_555 1.54 
699  1 OG1 B THR 239 ? ? 1_555 CG  C LEU 150 ? ? 3_555 1.54 
700  1 CE2 B TYR 117 ? ? 1_555 CG  C TYR 119 ? ? 3_555 1.54 
701  1 O   B VAL 161 ? ? 1_555 O   C LEU 150 ? ? 3_555 1.55 
702  1 CE1 B TYR 117 ? ? 1_555 CZ  C TYR 119 ? ? 3_555 1.55 
703  1 N   B GLN 136 ? ? 1_555 CA  C SER 75  ? ? 3_555 1.55 
704  1 CB  B LEU 74  ? ? 1_555 CA  C ALA 130 ? ? 3_555 1.55 
705  1 O   B VAL 96  ? ? 1_555 CG2 C VAL 161 ? ? 3_555 1.55 
706  1 N   B TYR 246 ? ? 1_555 NE2 C GLN 49  ? ? 3_555 1.55 
707  1 CA  C ARG 101 ? ? 1_555 CA  C ALA 255 ? ? 2_555 1.55 
708  1 C   B VAL 147 ? ? 1_555 O   C LEU 90  ? ? 3_555 1.55 
709  1 SD  C MET 59  ? ? 1_555 N   C SER 63  ? ? 2_555 1.55 
710  1 CE1 B HIS 71  ? ? 1_555 CZ2 C TRP 162 ? ? 3_555 1.55 
711  1 CB  B PHE 135 ? ? 1_555 CA  C TYR 243 ? ? 3_555 1.55 
712  1 N   A ALA 255 ? ? 1_555 O   B THR 127 ? ? 2_555 1.55 
713  1 O   B THR 184 ? ? 1_555 C   C THR 184 ? ? 3_555 1.55 
714  1 CA  B PRO 93  ? ? 1_555 O   C SER 122 ? ? 3_555 1.55 
715  1 C   B THR 158 ? ? 1_555 CE1 C PHE 135 ? ? 3_555 1.55 
716  1 CG  C PRO 58  ? ? 1_555 CA  C LEU 250 ? ? 2_555 1.55 
717  1 O   B VAL 96  ? ? 1_555 CB  C VAL 161 ? ? 3_555 1.55 
718  1 NH2 B ARG 101 ? ? 1_555 CG2 C VAL 237 ? ? 3_555 1.56 
719  1 CG2 B THR 184 ? ? 1_555 CG2 C THR 184 ? ? 3_555 1.56 
720  1 CA  B GLY 134 ? ? 1_555 CD2 C TYR 117 ? ? 3_555 1.56 
721  1 CD  C PRO 57  ? ? 1_555 NE  C ARG 249 ? ? 2_555 1.56 
722  1 N   B LEU 74  ? ? 1_555 CA  C PRO 160 ? ? 3_555 1.56 
723  1 OG  B SER 151 ? ? 1_555 O   C VAL 91  ? ? 3_555 1.56 
724  1 CG  C ARG 101 ? ? 1_555 O   C ALA 255 ? ? 2_555 1.56 
725  1 N   B GLU 89  ? ? 1_555 O   C GLU 77  ? ? 3_555 1.56 
726  1 C   B ILE 185 ? ? 1_555 CB  C THR 118 ? ? 3_555 1.56 
727  1 O   B GLY 159 ? ? 1_555 N   C PHE 135 ? ? 3_555 1.56 
728  1 N   B SER 122 ? ? 1_555 OG  C SER 151 ? ? 3_555 1.56 
729  1 C   B THR 184 ? ? 1_555 N   C ILE 185 ? ? 3_555 1.56 
730  1 C   B LEU 120 ? ? 1_555 CZ  C TYR 156 ? ? 3_555 1.56 
731  1 CG  B HIS 132 ? ? 1_555 C   C ARG 223 ? ? 3_555 1.56 
732  1 CG  B MET 228 ? ? 1_555 CG1 C VAL 225 ? ? 3_555 1.56 
733  1 O   B TYR 117 ? ? 1_555 CA  C ILE 183 ? ? 3_555 1.56 
734  1 O   B GLU 73  ? ? 1_555 C   C GLY 159 ? ? 3_555 1.56 
735  1 CH2 B TRP 112 ? ? 1_555 O   C PRO 121 ? ? 3_555 1.56 
736  1 CH2 B TRP 112 ? ? 1_555 C   C PRO 121 ? ? 3_555 1.57 
737  1 CA  B THR 158 ? ? 1_555 CE2 C PHE 135 ? ? 3_555 1.57 
738  1 CB  B THR 98  ? ? 1_555 CA  C SER 128 ? ? 3_555 1.57 
739  1 CE2 B TYR 137 ? ? 1_555 CD2 C TYR 243 ? ? 3_555 1.57 
740  1 CB  B ILE 185 ? ? 1_555 N   C THR 118 ? ? 3_555 1.57 
741  1 C   C PRO 58  ? ? 1_555 CA  C THR 67  ? ? 2_555 1.57 
742  1 N   B SER 245 ? ? 1_555 N   C GLY 164 ? ? 3_555 1.57 
743  1 C   B SER 146 ? ? 1_555 CG  C LEU 90  ? ? 3_555 1.57 
744  1 ND2 B ASN 190 ? ? 1_555 CB  C ASN 172 ? ? 3_555 1.57 
745  1 OG1 B THR 239 ? ? 1_555 CD2 C LEU 150 ? ? 3_555 1.58 
746  1 CG2 B ILE 248 ? ? 1_555 N   C GLN 49  ? ? 3_555 1.58 
747  1 CB  B ILE 131 ? ? 1_555 N   C GLY 134 ? ? 3_555 1.58 
748  1 CB  B TYR 156 ? ? 1_555 CD1 C ILE 115 ? ? 3_555 1.58 
749  1 CD  B PRO 93  ? ? 1_555 O   C SER 122 ? ? 3_555 1.58 
750  1 CA  C THR 98  ? ? 1_555 CD1 C ILE 254 ? ? 2_555 1.58 
751  1 CA  B VAL 147 ? ? 1_555 C   C LEU 90  ? ? 3_555 1.58 
752  1 CB  C THR 98  ? ? 1_555 CD1 C ILE 254 ? ? 2_555 1.58 
753  1 CB  B ARG 241 ? ? 1_555 ND1 C HIS 132 ? ? 3_555 1.58 
754  1 CG1 A ILE 254 ? ? 1_555 N   B GLY 129 ? ? 2_555 1.58 
755  1 N   B ILE 131 ? ? 1_555 O   C GLY 134 ? ? 3_555 1.58 
756  1 N   B ASN 190 ? ? 1_555 CG  C ASN 172 ? ? 3_555 1.58 
757  1 CE3 B TRP 99  ? ? 1_555 CA  C THR 125 ? ? 3_555 1.58 
758  1 CD2 B PHE 170 ? ? 1_555 C   C SER 180 ? ? 3_555 1.58 
759  1 CD1 B LEU 242 ? ? 1_555 CG1 C ILE 131 ? ? 3_555 1.58 
760  1 C   B TYR 246 ? ? 1_555 CD  C GLN 49  ? ? 3_555 1.59 
761  1 CG2 B ILE 115 ? ? 1_555 CG  C LEU 120 ? ? 3_555 1.59 
762  1 O   B HIS 132 ? ? 1_555 CD2 C LEU 224 ? ? 3_555 1.59 
763  1 CB  B TRP 162 ? ? 1_555 CA  C ASN 152 ? ? 3_555 1.59 
764  1 C   B TYR 246 ? ? 1_555 NE2 C GLN 49  ? ? 3_555 1.59 
765  1 CZ  B PHE 135 ? ? 1_555 O   C THR 118 ? ? 3_555 1.59 
766  1 CA  A LEU 258 ? ? 1_555 CB  B SER 232 ? ? 2_555 1.59 
767  1 NE  C ARG 101 ? ? 1_555 N   C LEU 258 ? ? 2_555 1.59 
768  1 O   B VAL 85  ? ? 1_555 CA  C SER 88  ? ? 3_555 1.59 
769  1 O   B GLU 73  ? ? 1_555 C   C PRO 160 ? ? 3_555 1.59 
770  1 C   B ILE 248 ? ? 1_555 N   C GLY 50  ? ? 3_555 1.59 
771  1 CA  B TYR 243 ? ? 1_555 C   C GLY 159 ? ? 3_555 1.59 
772  1 CB  B TRP 162 ? ? 1_555 O   C ASN 152 ? ? 3_555 1.59 
773  1 N   C ARG 101 ? ? 1_555 O   C ILE 254 ? ? 2_555 1.60 
774  1 OG1 B THR 247 ? ? 1_555 NE2 C GLN 165 ? ? 3_555 1.60 
775  1 O   B TYR 156 ? ? 1_555 N   C ARG 116 ? ? 3_555 1.60 
776  1 C   B ASN 148 ? ? 1_555 CB  C MET 92  ? ? 3_555 1.60 
777  1 O   B VAL 157 ? ? 1_555 CZ  C PHE 135 ? ? 3_555 1.60 
778  1 O   C PRO 58  ? ? 1_555 C   C THR 67  ? ? 2_555 1.60 
779  1 CB  B THR 226 ? ? 1_555 CB  C THR 226 ? ? 3_555 1.60 
780  1 N   B VAL 113 ? ? 1_555 C   C GLY 50  ? ? 3_555 1.60 
781  1 N   B ILE 248 ? ? 1_555 CA  C GLN 49  ? ? 3_555 1.60 
782  1 CA  B ALA 130 ? ? 1_555 N   C GLN 136 ? ? 3_555 1.60 
783  1 OE2 B GLU 89  ? ? 1_555 C   C ALA 79  ? ? 3_555 1.60 
784  1 O   B SER 151 ? ? 1_555 CZ2 C TRP 112 ? ? 3_555 1.60 
785  1 N   B GLY 102 ? ? 1_555 OG1 C THR 126 ? ? 3_555 1.61 
786  1 CB  B THR 98  ? ? 1_555 C   C THR 127 ? ? 3_555 1.61 
787  1 O   B SER 151 ? ? 1_555 CH2 C TRP 112 ? ? 3_555 1.61 
788  1 CA  C VAL 103 ? ? 1_555 CG  C ASN 106 ? ? 2_555 1.61 
789  1 O   C MET 64  ? ? 1_555 CB  C SER 70  ? ? 3_555 1.61 
790  1 CA  B THR 158 ? ? 1_555 CD2 C PHE 135 ? ? 3_555 1.61 
791  1 N   B TRP 99  ? ? 1_555 O   C THR 127 ? ? 3_555 1.61 
792  1 CA  B SER 245 ? ? 1_555 N   C GLY 164 ? ? 3_555 1.61 
793  1 O   B ALA 114 ? ? 1_555 CA  C GLN 165 ? ? 3_555 1.61 
794  1 CG1 B VAL 96  ? ? 1_555 O   C VAL 161 ? ? 3_555 1.61 
795  1 CA  B ALA 130 ? ? 1_555 O   C PHE 135 ? ? 3_555 1.61 
796  1 O   B THR 158 ? ? 1_555 CD1 C PHE 135 ? ? 3_555 1.61 
797  1 CB  B CYS 123 ? ? 1_555 O   C ASN 148 ? ? 3_555 1.61 
798  1 O   B SER 245 ? ? 1_555 CA  C GLY 164 ? ? 3_555 1.61 
799  1 CD1 C LEU 55  ? ? 1_555 OE2 C GLU 252 ? ? 2_555 1.61 
800  1 SD  C MET 59  ? ? 1_555 C   C SER 63  ? ? 2_555 1.61 
801  1 CG1 B ILE 131 ? ? 1_555 N   C GLY 134 ? ? 3_555 1.62 
802  1 OG1 B THR 95  ? ? 1_555 C   C ASN 238 ? ? 3_555 1.62 
803  1 N   B ASN 238 ? ? 1_555 CA  C SER 146 ? ? 3_555 1.62 
804  1 N   B THR 118 ? ? 1_555 CB  C ILE 183 ? ? 3_555 1.62 
805  1 CD  B GLU 77  ? ? 1_555 OE1 C GLU 229 ? ? 3_555 1.62 
806  1 C   B ILE 183 ? ? 1_555 O   C HOH 267 ? ? 3_555 1.62 
807  1 O   B PRO 160 ? ? 1_555 CA  C LEU 153 ? ? 3_555 1.62 
808  1 CG  A ASN 106 ? ? 1_555 CB  B THR 126 ? ? 2_555 1.62 
809  1 CB  B VAL 147 ? ? 1_555 CA  C LEU 90  ? ? 3_555 1.62 
810  1 CD1 B TYR 117 ? ? 1_555 CG  C TYR 119 ? ? 3_555 1.62 
811  1 O   B GLY 97  ? ? 1_555 CG2 C THR 127 ? ? 3_555 1.62 
812  1 CA  B LEU 78  ? ? 1_555 CB  C ALA 227 ? ? 3_555 1.62 
813  1 OG1 B THR 98  ? ? 1_555 O   C SER 128 ? ? 3_555 1.63 
814  1 CE1 B PHE 135 ? ? 1_555 CA  C LEU 242 ? ? 3_555 1.63 
815  1 CE2 C TRP 99  ? ? 1_555 CB  C TRP 107 ? ? 2_555 1.63 
816  1 N   B LEU 90  ? ? 1_555 N   C LEU 78  ? ? 3_555 1.63 
817  1 C   B SER 122 ? ? 1_555 OG  C SER 151 ? ? 3_555 1.63 
818  1 O   B ASN 148 ? ? 1_555 N   C MET 92  ? ? 3_555 1.63 
819  1 N   B VAL 113 ? ? 1_555 CA  C THR 51  ? ? 3_555 1.63 
820  1 C   B ALA 186 ? ? 1_555 OG1 C THR 118 ? ? 3_555 1.63 
821  1 N   C VAL 103 ? ? 1_555 CB  C ASN 106 ? ? 2_555 1.63 
822  1 CA  B THR 118 ? ? 1_555 CG2 C VAL 157 ? ? 3_555 1.63 
823  1 O   C GLY 102 ? ? 1_555 OD1 C ASN 106 ? ? 2_555 1.63 
824  1 CD2 C TRP 99  ? ? 1_555 CA  C TRP 107 ? ? 2_555 1.63 
825  1 CG2 B VAL 192 ? ? 1_555 CA  C VAL 53  ? ? 3_555 1.63 
826  1 CD  C PRO 57  ? ? 1_555 NH2 C ARG 249 ? ? 2_555 1.63 
827  1 CA  B ILE 183 ? ? 1_555 O   C HOH 267 ? ? 3_555 1.63 
828  1 C   B ASN 238 ? ? 1_555 C   C SER 146 ? ? 3_555 1.63 
829  1 CE2 B TYR 137 ? ? 1_555 CE2 C TYR 243 ? ? 3_555 1.64 
830  1 CA  B THR 95  ? ? 1_555 CA  C THR 239 ? ? 3_555 1.64 
831  1 O   B THR 189 ? ? 1_555 CA  C VAL 53  ? ? 3_555 1.64 
832  1 CB  B ASN 238 ? ? 1_555 N   C VAL 147 ? ? 3_555 1.64 
833  1 N   B VAL 80  ? ? 1_555 N   C PRO 144 ? ? 3_555 1.64 
834  1 CE1 C TYR 246 ? ? 1_555 CG  C PRO 253 ? ? 2_555 1.64 
835  1 O   B LEU 224 ? ? 1_555 CB  C THR 76  ? ? 3_555 1.64 
836  1 CG2 B THR 158 ? ? 1_555 CG  C PHE 135 ? ? 3_555 1.65 
837  1 O   B VAL 85  ? ? 1_555 CB  C SER 88  ? ? 3_555 1.65 
838  1 N   B THR 81  ? ? 1_555 O   C LEU 143 ? ? 3_555 1.65 
839  1 N   B VAL 113 ? ? 1_555 N   C THR 51  ? ? 3_555 1.65 
840  1 C   B THR 158 ? ? 1_555 CG  C PHE 135 ? ? 3_555 1.65 
841  1 N   B ARG 116 ? ? 1_555 C   C GLY 164 ? ? 3_555 1.65 
842  1 CH2 C TRP 99  ? ? 1_555 CE2 C TRP 107 ? ? 2_555 1.65 
843  1 CE1 B PHE 135 ? ? 1_555 N   C TYR 243 ? ? 3_555 1.65 
844  1 O   B GLN 136 ? ? 1_555 CB  C LEU 74  ? ? 3_555 1.65 
845  1 CA  B ASN 190 ? ? 1_555 ND2 C ASN 172 ? ? 3_555 1.65 
846  1 OH  B TYR 119 ? ? 1_555 CD1 C LEU 150 ? ? 3_555 1.65 
847  1 CG1 A ILE 254 ? ? 1_555 O   B SER 128 ? ? 2_555 1.65 
848  1 O   A ILE 254 ? ? 1_555 N   B THR 127 ? ? 2_555 1.65 
849  1 SD  B MET 133 ? ? 1_555 CG  C MET 133 ? ? 3_555 1.66 
850  1 C   B LEU 100 ? ? 1_555 CA  C PRO 124 ? ? 3_555 1.66 
851  1 CG  B GLU 77  ? ? 1_555 CD  C GLU 229 ? ? 3_555 1.66 
852  1 CG  C MET 59  ? ? 1_555 CA  C SER 62  ? ? 2_555 1.66 
853  1 C   B HIS 132 ? ? 1_555 CD1 C LEU 224 ? ? 3_555 1.66 
854  1 C   B ARG 241 ? ? 1_555 ND1 C HIS 132 ? ? 3_555 1.66 
855  1 N   B GLY 159 ? ? 1_555 CB  C PHE 135 ? ? 3_555 1.66 
856  1 CD  C PRO 58  ? ? 1_555 CA  C LEU 250 ? ? 2_555 1.66 
857  1 CA  B LEU 100 ? ? 1_555 N   C THR 125 ? ? 3_555 1.66 
858  1 CB  B ILE 185 ? ? 1_555 CA  C THR 118 ? ? 3_555 1.66 
859  1 CB  B VAL 237 ? ? 1_555 NE2 C GLN 149 ? ? 3_555 1.66 
860  1 CE3 B TRP 99  ? ? 1_555 C   C THR 125 ? ? 3_555 1.66 
861  1 O   B GLN 149 ? ? 1_555 C   C THR 95  ? ? 3_555 1.66 
862  1 CB  B TYR 119 ? ? 1_555 O   C VAL 157 ? ? 3_555 1.66 
863  1 CG2 B THR 95  ? ? 1_555 C   C ASN 238 ? ? 3_555 1.66 
864  1 C   B THR 98  ? ? 1_555 C   C THR 126 ? ? 3_555 1.67 
865  1 N   B THR 81  ? ? 1_555 CB  C LEU 143 ? ? 3_555 1.67 
866  1 N   B LEU 150 ? ? 1_555 CG2 C THR 95  ? ? 3_555 1.67 
867  1 CB  B HIS 132 ? ? 1_555 CA  C LEU 224 ? ? 3_555 1.67 
868  1 N   B TYR 119 ? ? 1_555 CG2 C VAL 157 ? ? 3_555 1.67 
869  1 CG  B TYR 156 ? ? 1_555 CG1 C ILE 115 ? ? 3_555 1.67 
870  1 N   B THR 247 ? ? 1_555 CG  C GLN 165 ? ? 3_555 1.67 
871  1 CZ  B ARG 101 ? ? 1_555 CG1 C VAL 237 ? ? 3_555 1.67 
872  1 CB  B VAL 161 ? ? 1_555 CG  C LEU 153 ? ? 3_555 1.67 
873  1 CG  A PRO 253 ? ? 1_555 CD2 B TRP 162 ? ? 2_555 1.67 
874  1 NH2 C ARG 101 ? ? 1_555 CA  C LEU 258 ? ? 2_555 1.67 
875  1 CA  B PRO 160 ? ? 1_555 N   C LYS 154 ? ? 3_555 1.67 
876  1 N   B ILE 248 ? ? 1_555 C   C GLN 49  ? ? 3_555 1.67 
877  1 CD  B PRO 160 ? ? 1_555 CA  C LYS 154 ? ? 3_555 1.67 
878  1 CA  B HIS 132 ? ? 1_555 CA  C LEU 224 ? ? 3_555 1.67 
879  1 CA  A ALA 255 ? ? 1_555 CB  B THR 127 ? ? 2_555 1.67 
880  1 CB  B ASN 190 ? ? 1_555 CE  C LYS 54  ? ? 3_555 1.67 
881  1 CD1 B LEU 224 ? ? 1_555 CB  C LEU 242 ? ? 3_555 1.67 
882  1 CA  B GLY 102 ? ? 1_555 OG1 C THR 126 ? ? 3_555 1.67 
883  1 N   B SER 245 ? ? 1_555 C   C GLU 163 ? ? 3_555 1.67 
884  1 CE2 B PHE 135 ? ? 1_555 CB  C TYR 243 ? ? 3_555 1.67 
885  1 CZ  B ARG 116 ? ? 1_555 CB  C ALA 182 ? ? 3_555 1.67 
886  1 CD1 B PHE 135 ? ? 1_555 CA  C LEU 242 ? ? 3_555 1.67 
887  1 N   B GLY 97  ? ? 1_555 CG1 C VAL 161 ? ? 3_555 1.67 
888  1 C   B ILE 185 ? ? 1_555 CA  C THR 118 ? ? 3_555 1.67 
889  1 N   B GLU 191 ? ? 1_555 CA  C LYS 54  ? ? 3_555 1.67 
890  1 CE1 B TYR 243 ? ? 1_555 CG2 C THR 158 ? ? 3_555 1.67 
891  1 C   B THR 239 ? ? 1_555 O   C VAL 147 ? ? 3_555 1.68 
892  1 CD  B GLU 77  ? ? 1_555 CD  C GLU 229 ? ? 3_555 1.68 
893  1 CG  C ARG 101 ? ? 1_555 CA  C ALA 256 ? ? 2_555 1.68 
894  1 CB  B GLU 73  ? ? 1_555 CB  C PRO 160 ? ? 3_555 1.68 
895  1 CG  C PRO 58  ? ? 1_555 CB  C LEU 250 ? ? 2_555 1.68 
896  1 CG  C TRP 99  ? ? 1_555 C   C TRP 107 ? ? 2_555 1.68 
897  1 OG1 B THR 226 ? ? 1_555 CA  C THR 226 ? ? 3_555 1.68 
898  1 N   B ARG 223 ? ? 1_555 CD1 C LEU 74  ? ? 3_555 1.68 
899  1 CA  C VAL 103 ? ? 1_555 OD1 C ASN 106 ? ? 2_555 1.68 
900  1 NE1 C TRP 99  ? ? 1_555 O   C ALA 104 ? ? 2_555 1.68 
901  1 CD  C GLU 73  ? ? 1_555 C   C PRO 253 ? ? 2_555 1.68 
902  1 C   B ALA 114 ? ? 1_555 CA  C GLN 165 ? ? 3_555 1.69 
903  1 CB  B ASN 238 ? ? 1_555 CB  C SER 146 ? ? 3_555 1.69 
904  1 N   C LEU 100 ? ? 1_555 O   C ILE 254 ? ? 2_555 1.69 
905  1 OE2 B GLU 73  ? ? 1_555 CB  C TRP 162 ? ? 3_555 1.69 
906  1 N   B CYS 123 ? ? 1_555 O   C ASN 148 ? ? 3_555 1.69 
907  1 O   B VAL 147 ? ? 1_555 N   C VAL 91  ? ? 3_555 1.69 
908  1 C   B THR 239 ? ? 1_555 N   C SER 151 ? ? 3_555 1.69 
909  1 CB  B PRO 221 ? ? 1_555 NH2 C ARG 241 ? ? 3_555 1.69 
910  1 N   B GLU 89  ? ? 1_555 CD1 C LEU 78  ? ? 3_555 1.69 
911  1 CD  B PRO 160 ? ? 1_555 CG  C LYS 154 ? ? 3_555 1.69 
912  1 CB  B THR 158 ? ? 1_555 CG  C PHE 135 ? ? 3_555 1.69 
913  1 CA  B ARG 223 ? ? 1_555 O   C THR 76  ? ? 3_555 1.69 
914  1 CA  B GLU 73  ? ? 1_555 CA  C PRO 160 ? ? 3_555 1.69 
915  1 CG1 C VAL 86  ? ? 1_555 O   B HOH 269 ? ? 2_555 1.69 
916  1 N   B VAL 161 ? ? 1_555 CG  C LEU 153 ? ? 3_555 1.69 
917  1 CG  B LEU 187 ? ? 1_555 CD1 C LEU 120 ? ? 3_555 1.69 
918  1 CD2 B LEU 69  ? ? 1_555 N   C ALA 48  ? ? 3_555 1.69 
919  1 OG1 B THR 98  ? ? 1_555 C   C SER 128 ? ? 3_555 1.70 
920  1 CZ2 C TRP 99  ? ? 1_555 CE3 C TRP 107 ? ? 2_555 1.70 
921  1 OE1 B GLU 77  ? ? 1_555 OE1 C GLU 229 ? ? 3_555 1.70 
922  1 CD1 B TYR 246 ? ? 1_555 C   C TRP 162 ? ? 3_555 1.70 
923  1 CG  B HIS 71  ? ? 1_555 CZ3 C TRP 162 ? ? 3_555 1.70 
924  1 CG1 B VAL 161 ? ? 1_555 CG  C LEU 153 ? ? 3_555 1.70 
925  1 CA  B VAL 82  ? ? 1_555 CG2 C THR 142 ? ? 3_555 1.70 
926  1 CZ3 C TRP 99  ? ? 1_555 NE1 C TRP 107 ? ? 2_555 1.70 
927  1 CB  B ARG 241 ? ? 1_555 NE2 C HIS 132 ? ? 3_555 1.70 
928  1 CB  C ARG 101 ? ? 1_555 N   C ALA 256 ? ? 2_555 1.70 
929  1 OD1 B ASN 152 ? ? 1_555 N   C PHE 94  ? ? 3_555 1.70 
930  1 CD  B LYS 154 ? ? 1_555 CB  C CYS 72  ? ? 3_555 1.70 
931  1 O   B TRP 99  ? ? 1_555 CA  C THR 126 ? ? 3_555 1.70 
932  1 C   B TRP 99  ? ? 1_555 CA  C THR 126 ? ? 3_555 1.70 
933  1 CG1 B VAL 91  ? ? 1_555 O   C LEU 120 ? ? 3_555 1.70 
934  1 C   B LEU 224 ? ? 1_555 CB  C THR 76  ? ? 3_555 1.70 
935  1 CD  C ARG 101 ? ? 1_555 C   C ALA 255 ? ? 2_555 1.70 
936  1 N   B TRP 162 ? ? 1_555 O   C ASN 152 ? ? 3_555 1.71 
937  1 O   B PHE 135 ? ? 1_555 C   C LEU 74  ? ? 3_555 1.71 
938  1 C   B SER 88  ? ? 1_555 O   C GLU 77  ? ? 3_555 1.71 
939  1 N   B ILE 248 ? ? 1_555 N   C GLY 50  ? ? 3_555 1.71 
940  1 N   B VAL 96  ? ? 1_555 CA  C THR 239 ? ? 3_555 1.71 
941  1 OH  B TYR 246 ? ? 1_555 CE3 C TRP 162 ? ? 3_555 1.71 
942  1 CG  B ASN 152 ? ? 1_555 C   C PRO 93  ? ? 3_555 1.71 
943  1 CA  C PRO 58  ? ? 1_555 N   C THR 67  ? ? 2_555 1.71 
944  1 ND1 B HIS 71  ? ? 1_555 CZ3 C TRP 162 ? ? 3_555 1.71 
945  1 OE1 B GLU 73  ? ? 1_555 CD1 C TRP 162 ? ? 3_555 1.71 
946  1 O   C GLY 97  ? ? 1_555 CA  C ILE 254 ? ? 2_555 1.71 
947  1 NE2 B GLN 149 ? ? 1_555 CD2 C PHE 94  ? ? 3_555 1.71 
948  1 CD1 C TRP 99  ? ? 1_555 O   C TRP 107 ? ? 2_555 1.71 
949  1 ND2 B ASN 190 ? ? 1_555 CG  C ASN 172 ? ? 3_555 1.71 
950  1 N   B ILE 131 ? ? 1_555 CA  C PHE 135 ? ? 3_555 1.71 
951  1 OH  B TYR 246 ? ? 1_555 CD2 C TRP 162 ? ? 3_555 1.71 
952  1 N   B PRO 160 ? ? 1_555 N   C LYS 154 ? ? 3_555 1.71 
953  1 C   B VAL 237 ? ? 1_555 N   C SER 146 ? ? 3_555 1.71 
954  1 O   B ALA 111 ? ? 1_555 CA  C GLY 50  ? ? 3_555 1.71 
955  1 C   B PHE 94  ? ? 1_555 O   C ASN 238 ? ? 3_555 1.71 
956  1 CA  B GLY 230 ? ? 1_555 CD  C GLN 136 ? ? 3_555 1.72 
957  1 CG  B LEU 74  ? ? 1_555 CB  C ALA 130 ? ? 3_555 1.72 
958  1 CD1 B ILE 183 ? ? 1_555 N   C TYR 156 ? ? 3_555 1.72 
959  1 CA  B ALA 227 ? ? 1_555 N   C GLU 89  ? ? 3_555 1.72 
960  1 N   B VAL 91  ? ? 1_555 O   C GLY 240 ? ? 3_555 1.72 
961  1 C   B ASN 148 ? ? 1_555 CG  C MET 92  ? ? 3_555 1.72 
962  1 O   B MET 133 ? ? 1_555 CE1 C TYR 117 ? ? 3_555 1.72 
963  1 CG  B LEU 153 ? ? 1_555 C   C VAL 96  ? ? 3_555 1.72 
964  1 O   C LEU 60  ? ? 1_555 C   C ARG 61  ? ? 2_555 1.72 
965  1 OE2 C GLU 73  ? ? 1_555 C   C PRO 253 ? ? 2_555 1.72 
966  1 O   B VAL 237 ? ? 1_555 N   C VAL 145 ? ? 3_555 1.72 
967  1 CA  B GLU 191 ? ? 1_555 CA  C LEU 55  ? ? 3_555 1.72 
968  1 CA  B PHE 135 ? ? 1_555 N   C SER 75  ? ? 3_555 1.72 
969  1 CA  B VAL 82  ? ? 1_555 CB  C THR 142 ? ? 3_555 1.72 
970  1 ND1 B HIS 71  ? ? 1_555 CZ2 C TRP 162 ? ? 3_555 1.72 
971  1 N   A ALA 255 ? ? 1_555 CB  B THR 127 ? ? 2_555 1.72 
972  1 O   B ALA 130 ? ? 1_555 CG2 C VAL 225 ? ? 3_555 1.72 
973  1 N   B THR 247 ? ? 1_555 NE2 C GLN 165 ? ? 3_555 1.72 
974  1 CG  B TYR 243 ? ? 1_555 CA  C GLY 159 ? ? 3_555 1.72 
975  1 O   B ILE 131 ? ? 1_555 CD2 C PHE 135 ? ? 3_555 1.72 
976  1 C   B ARG 241 ? ? 1_555 CG  C HIS 132 ? ? 3_555 1.72 
977  1 CA  B HIS 132 ? ? 1_555 CG  C LEU 224 ? ? 3_555 1.72 
978  1 C   B ASN 190 ? ? 1_555 O   C LYS 54  ? ? 3_555 1.72 
979  1 CE1 B TYR 119 ? ? 1_555 CG  C TYR 156 ? ? 3_555 1.72 
980  1 CB  B ASN 148 ? ? 1_555 CG  C MET 92  ? ? 3_555 1.73 
981  1 O   B SER 245 ? ? 1_555 N   C GLY 164 ? ? 3_555 1.73 
982  1 CG2 B ILE 131 ? ? 1_555 N   C GLY 134 ? ? 3_555 1.73 
983  1 CE1 B HIS 71  ? ? 1_555 CH2 C TRP 162 ? ? 3_555 1.73 
984  1 CB  C TRP 99  ? ? 1_555 N   C TRP 107 ? ? 2_555 1.73 
985  1 C   A LEU 258 ? ? 1_555 N   B SER 232 ? ? 2_555 1.73 
986  1 CB  B ALA 79  ? ? 1_555 CA  C VAL 145 ? ? 3_555 1.73 
987  1 CA  B CYS 123 ? ? 1_555 O   C ASN 148 ? ? 3_555 1.73 
988  1 C   B TRP 112 ? ? 1_555 C   C THR 51  ? ? 3_555 1.73 
989  1 O   B THR 98  ? ? 1_555 CA  C THR 127 ? ? 3_555 1.73 
990  1 N   B GLU 89  ? ? 1_555 C   C GLU 77  ? ? 3_555 1.73 
991  1 C   B PRO 121 ? ? 1_555 CB  C SER 151 ? ? 3_555 1.73 
992  1 O   B ARG 223 ? ? 1_555 N   C THR 76  ? ? 3_555 1.73 
993  1 O   B THR 189 ? ? 1_555 N   C LYS 54  ? ? 3_555 1.73 
994  1 N   B ALA 104 ? ? 1_555 CB  C PRO 124 ? ? 3_555 1.74 
995  1 CB  C MET 59  ? ? 1_555 N   C SER 63  ? ? 2_555 1.74 
996  1 O   B GLY 230 ? ? 1_555 CG  C ASP 141 ? ? 3_555 1.74 
997  1 CA  B GLY 231 ? ? 1_555 O   C THR 142 ? ? 3_555 1.74 
998  1 O   B THR 81  ? ? 1_555 O   C THR 142 ? ? 3_555 1.74 
999  1 CD  B GLU 77  ? ? 1_555 CB  C GLU 229 ? ? 3_555 1.74 
1000 1 CA  B ASP 188 ? ? 1_555 C   C VAL 171 ? ? 3_555 1.74 
1001 1 C   B SER 88  ? ? 1_555 CD1 C LEU 78  ? ? 3_555 1.74 
1002 1 ND2 B ASN 148 ? ? 1_555 SD  C MET 92  ? ? 3_555 1.74 
1003 1 CE  B LYS 154 ? ? 1_555 CB  C CYS 72  ? ? 3_555 1.74 
1004 1 N   C MET 59  ? ? 1_555 O   C VAL 66  ? ? 2_555 1.74 
1005 1 CB  B HIS 132 ? ? 1_555 N   C LEU 224 ? ? 3_555 1.74 
1006 1 O   B ALA 227 ? ? 1_555 CA  C VAL 225 ? ? 3_555 1.74 
1007 1 CG1 B ILE 183 ? ? 1_555 C   C GLY 155 ? ? 3_555 1.74 
1008 1 CD2 B PHE 135 ? ? 1_555 CG  C TYR 243 ? ? 3_555 1.74 
1009 1 NE2 B HIS 132 ? ? 1_555 N   C ARG 223 ? ? 3_555 1.74 
1010 1 O   B ILE 183 ? ? 1_555 CG1 C VAL 157 ? ? 3_555 1.74 
1011 1 CA  B VAL 237 ? ? 1_555 CD  C GLN 149 ? ? 3_555 1.74 
1012 1 O   C LEU 60  ? ? 1_555 CA  C ARG 61  ? ? 2_555 1.74 
1013 1 CD1 B TYR 119 ? ? 1_555 CD2 C TYR 156 ? ? 3_555 1.75 
1014 1 CA  B LEU 187 ? ? 1_555 CG2 C VAL 171 ? ? 3_555 1.75 
1015 1 NE2 B HIS 132 ? ? 1_555 CA  C ARG 223 ? ? 3_555 1.75 
1016 1 N   B GLY 230 ? ? 1_555 NH2 C ARG 223 ? ? 3_555 1.75 
1017 1 SD  C MET 59  ? ? 1_555 C   C SER 62  ? ? 2_555 1.75 
1018 1 CD  B PRO 121 ? ? 1_555 CD1 C TYR 156 ? ? 3_555 1.75 
1019 1 O   B ILE 115 ? ? 1_555 CD2 C LEU 120 ? ? 3_555 1.75 
1020 1 O   B ALA 222 ? ? 1_555 CG  C ARG 241 ? ? 3_555 1.75 
1021 1 O   B SER 88  ? ? 1_555 O   C HOH 263 ? ? 3_555 1.75 
1022 1 CG  B TYR 243 ? ? 1_555 N   C GLY 159 ? ? 3_555 1.75 
1023 1 CD  B ARG 241 ? ? 1_555 OE2 C GLU 229 ? ? 3_555 1.75 
1024 1 CG  B TYR 117 ? ? 1_555 CD2 C TYR 119 ? ? 3_555 1.75 
1025 1 N   B ILE 131 ? ? 1_555 C   C GLY 134 ? ? 3_555 1.75 
1026 1 CB  A ALA 255 ? ? 1_555 CG2 B THR 127 ? ? 2_555 1.75 
1027 1 CB  B GLU 77  ? ? 1_555 CB  C GLU 229 ? ? 3_555 1.75 
1028 1 CG  B PHE 135 ? ? 1_555 C   C LEU 242 ? ? 3_555 1.75 
1029 1 O   A ALA 255 ? ? 1_555 N   B SER 128 ? ? 2_555 1.75 
1030 1 CG  B GLU 229 ? ? 1_555 CG  C ARG 223 ? ? 3_555 1.75 
1031 1 C   B PHE 135 ? ? 1_555 CA  C SER 75  ? ? 3_555 1.76 
1032 1 CE2 B TYR 156 ? ? 1_555 CG1 C VAL 91  ? ? 3_555 1.76 
1033 1 O   B ARG 241 ? ? 1_555 CB  C THR 158 ? ? 3_555 1.76 
1034 1 CG  B TYR 119 ? ? 1_555 O   C MET 133 ? ? 3_555 1.76 
1035 1 CG  B PRO 144 ? ? 1_555 OE1 C GLU 89  ? ? 3_555 1.76 
1036 1 C   B GLU 89  ? ? 1_555 CA  C LEU 78  ? ? 3_555 1.76 
1037 1 SD  B MET 133 ? ? 1_555 CE  C MET 133 ? ? 3_555 1.76 
1038 1 CB  A ALA 255 ? ? 1_555 CB  B THR 127 ? ? 2_555 1.76 
1039 1 O   B GLU 229 ? ? 1_555 CG  C GLN 136 ? ? 3_555 1.76 
1040 1 C   B TYR 246 ? ? 1_555 CG  C GLN 165 ? ? 3_555 1.76 
1041 1 CA  B CYS 72  ? ? 1_555 OE2 C GLU 163 ? ? 3_555 1.76 
1042 1 CG  B TYR 246 ? ? 1_555 O   C TRP 162 ? ? 3_555 1.76 
1043 1 CB  B GLU 191 ? ? 1_555 CG  C LEU 55  ? ? 3_555 1.76 
1044 1 CD1 B LEU 187 ? ? 1_555 CE1 C TYR 243 ? ? 3_555 1.76 
1045 1 N   A LEU 258 ? ? 1_555 CB  B SER 232 ? ? 2_555 1.76 
1046 1 CA  B ASP 188 ? ? 1_555 CG1 C VAL 171 ? ? 3_555 1.76 
1047 1 CG2 B VAL 91  ? ? 1_555 C   C ARG 241 ? ? 3_555 1.77 
1048 1 O   B LEU 242 ? ? 1_555 CA  C ILE 131 ? ? 3_555 1.77 
1049 1 CB  B SER 146 ? ? 1_555 CD1 C LEU 90  ? ? 3_555 1.77 
1050 1 CB  B GLU 229 ? ? 1_555 CG  C ARG 223 ? ? 3_555 1.77 
1051 1 O   B ALA 236 ? ? 1_555 CB  C VAL 145 ? ? 3_555 1.77 
1052 1 N   B CYS 72  ? ? 1_555 CZ3 C TRP 162 ? ? 3_555 1.77 
1053 1 O   B THR 239 ? ? 1_555 O   C VAL 147 ? ? 3_555 1.77 
1054 1 OE2 B GLU 89  ? ? 1_555 O   C ALA 79  ? ? 3_555 1.77 
1055 1 CD  B GLU 191 ? ? 1_555 CA  C LEU 55  ? ? 3_555 1.77 
1056 1 C   B ASN 152 ? ? 1_555 CG1 C VAL 96  ? ? 3_555 1.77 
1057 1 N   C THR 98  ? ? 1_555 CD1 C ILE 254 ? ? 2_555 1.77 
1058 1 CE2 B TYR 119 ? ? 1_555 CD1 C LEU 150 ? ? 3_555 1.77 
1059 1 O   B THR 158 ? ? 1_555 CE1 C PHE 135 ? ? 3_555 1.77 
1060 1 C   B VAL 161 ? ? 1_555 CA  C LEU 153 ? ? 3_555 1.77 
1061 1 CD2 B TYR 119 ? ? 1_555 O   C MET 133 ? ? 3_555 1.77 
1062 1 CG  B ARG 223 ? ? 1_555 N   C GLU 77  ? ? 3_555 1.77 
1063 1 O   A ALA 257 ? ? 1_555 CB  B SER 232 ? ? 2_555 1.77 
1064 1 CA  B THR 226 ? ? 1_555 OG1 C THR 226 ? ? 3_555 1.77 
1065 1 O   B THR 95  ? ? 1_555 CA  C THR 239 ? ? 3_555 1.77 
1066 1 N   B HIS 132 ? ? 1_555 CB  C LEU 224 ? ? 3_555 1.77 
1067 1 CA  B GLU 89  ? ? 1_555 CB  C LEU 78  ? ? 3_555 1.77 
1068 1 ND2 B ASN 238 ? ? 1_555 O   C VAL 145 ? ? 3_555 1.77 
1069 1 CE2 B TYR 156 ? ? 1_555 CB  C VAL 91  ? ? 3_555 1.77 
1070 1 CD1 B TYR 119 ? ? 1_555 CA  C TYR 156 ? ? 3_555 1.77 
1071 1 C   B CYS 72  ? ? 1_555 CG  C PRO 160 ? ? 3_555 1.77 
1072 1 CA  B THR 239 ? ? 1_555 C   C GLN 149 ? ? 3_555 1.77 
1073 1 CB  B VAL 157 ? ? 1_555 O   C ILE 185 ? ? 3_555 1.77 
1074 1 CZ  C ARG 101 ? ? 1_555 CB  C LEU 258 ? ? 2_555 1.77 
1075 1 CA  B MET 92  ? ? 1_555 OG  C SER 122 ? ? 3_555 1.77 
1076 1 CA  A LEU 258 ? ? 1_555 OG  B SER 232 ? ? 2_555 1.78 
1077 1 CG  B TYR 246 ? ? 1_555 NE2 C GLN 49  ? ? 3_555 1.78 
1078 1 CD1 B ILE 84  ? ? 1_555 O   C HOH 268 ? ? 3_555 1.78 
1079 1 C   B ASN 152 ? ? 1_555 CB  C VAL 96  ? ? 3_555 1.78 
1080 1 CG  B ASN 148 ? ? 1_555 CG1 C VAL 220 ? ? 3_555 1.78 
1081 1 N   B MET 133 ? ? 1_555 CG  C LEU 224 ? ? 3_555 1.78 
1082 1 OG1 B THR 76  ? ? 1_555 N   C MET 228 ? ? 3_555 1.78 
1083 1 CB  A PRO 253 ? ? 1_555 CD1 B TRP 162 ? ? 2_555 1.78 
1084 1 C   B VAL 80  ? ? 1_555 CA  C LEU 143 ? ? 3_555 1.78 
1085 1 CD1 B PHE 135 ? ? 1_555 O   C LEU 242 ? ? 3_555 1.78 
1086 1 CA  B VAL 82  ? ? 1_555 CA  C THR 142 ? ? 3_555 1.78 
1087 1 CB  B TRP 162 ? ? 1_555 C   C ASN 152 ? ? 3_555 1.78 
1088 1 CA  B TRP 162 ? ? 1_555 O   C ASN 152 ? ? 3_555 1.78 
1089 1 CA  C THR 98  ? ? 1_555 CG2 C ILE 254 ? ? 2_555 1.78 
1090 1 O   B ASP 188 ? ? 1_555 CG1 C VAL 53  ? ? 3_555 1.78 
1091 1 C   B THR 118 ? ? 1_555 CG2 C VAL 157 ? ? 3_555 1.78 
1092 1 CA  B GLU 229 ? ? 1_555 CZ  C ARG 223 ? ? 3_555 1.78 
1093 1 CZ  B TYR 119 ? ? 1_555 CD2 C TYR 156 ? ? 3_555 1.78 
1094 1 CZ  B TYR 156 ? ? 1_555 CB  C VAL 91  ? ? 3_555 1.78 
1095 1 CG2 B VAL 91  ? ? 1_555 CG  C ARG 241 ? ? 3_555 1.78 
1096 1 O   B TYR 243 ? ? 1_555 CG1 C ILE 183 ? ? 3_555 1.78 
1097 1 CZ  C ARG 101 ? ? 1_555 CG  C LEU 258 ? ? 2_555 1.78 
1098 1 CG1 B VAL 161 ? ? 1_555 CD1 C LEU 153 ? ? 3_555 1.78 
1099 1 CB  B THR 189 ? ? 1_555 CD1 C LEU 168 ? ? 3_555 1.79 
1100 1 N   B LEU 78  ? ? 1_555 CB  C ALA 227 ? ? 3_555 1.79 
1101 1 CA  B ILE 131 ? ? 1_555 C   C GLY 134 ? ? 3_555 1.79 
1102 1 CB  B ALA 227 ? ? 1_555 CA  C GLU 89  ? ? 3_555 1.79 
1103 1 C   A ALA 255 ? ? 1_555 CA  B THR 127 ? ? 2_555 1.79 
1104 1 CA  A ALA 255 ? ? 1_555 N   B THR 127 ? ? 2_555 1.79 
1105 1 CA  B VAL 161 ? ? 1_555 CG  C LEU 153 ? ? 3_555 1.79 
1106 1 CA  B ALA 227 ? ? 1_555 O   C LEU 224 ? ? 3_555 1.79 
1107 1 N   B TRP 99  ? ? 1_555 C   C THR 126 ? ? 3_555 1.79 
1108 1 O   B LEU 100 ? ? 1_555 N   C PRO 124 ? ? 3_555 1.79 
1109 1 CB  B ALA 236 ? ? 1_555 CB  C VAL 145 ? ? 3_555 1.79 
1110 1 N   B PRO 93  ? ? 1_555 O   C SER 122 ? ? 3_555 1.79 
1111 1 CA  B ILE 185 ? ? 1_555 O   C TYR 117 ? ? 3_555 1.79 
1112 1 N   B THR 98  ? ? 1_555 O   C THR 127 ? ? 3_555 1.79 
1113 1 O   C TRP 99  ? ? 1_555 O   C ASN 106 ? ? 2_555 1.79 
1114 1 CB  B HIS 71  ? ? 1_555 CZ3 C TRP 162 ? ? 3_555 1.79 
1115 1 CD2 B PHE 135 ? ? 1_555 N   C TYR 243 ? ? 3_555 1.79 
1116 1 N   B LEU 100 ? ? 1_555 N   C THR 126 ? ? 3_555 1.79 
1117 1 O   B GLU 163 ? ? 1_555 CB  C TYR 156 ? ? 3_555 1.79 
1118 1 CA  C PRO 57  ? ? 1_555 CD1 C ILE 251 ? ? 2_555 1.79 
1119 1 CA  B TRP 99  ? ? 1_555 N   C THR 127 ? ? 3_555 1.79 
1120 1 N   C LEU 100 ? ? 1_555 N   C ILE 254 ? ? 2_555 1.80 
1121 1 CB  B GLU 89  ? ? 1_555 CG  C LEU 78  ? ? 3_555 1.80 
1122 1 CB  B THR 184 ? ? 1_555 N   C THR 184 ? ? 3_555 1.80 
1123 1 CG2 B THR 158 ? ? 1_555 CB  C PHE 135 ? ? 3_555 1.80 
1124 1 C   B LEU 100 ? ? 1_555 CG  C PRO 124 ? ? 3_555 1.80 
1125 1 N   B VAL 192 ? ? 1_555 O   C VAL 53  ? ? 3_555 1.80 
1126 1 CZ  C PHE 94  ? ? 1_555 CB  C ALA 257 ? ? 2_555 1.80 
1127 1 CA  B PHE 170 ? ? 1_555 O   C SER 180 ? ? 3_555 1.80 
1128 1 CG2 B VAL 80  ? ? 1_555 N   C PRO 144 ? ? 3_555 1.80 
1129 1 CG  C PRO 57  ? ? 1_555 CD  C ARG 249 ? ? 2_555 1.80 
1130 1 N   C LEU 60  ? ? 1_555 CA  C SER 62  ? ? 2_555 1.80 
1131 1 N   B THR 239 ? ? 1_555 N   C LEU 150 ? ? 3_555 1.80 
1132 1 CA  B PRO 93  ? ? 1_555 CA  C CYS 123 ? ? 3_555 1.80 
1133 1 CB  B ILE 131 ? ? 1_555 CA  C GLY 134 ? ? 3_555 1.80 
1134 1 C   A ILE 254 ? ? 1_555 CA  B THR 127 ? ? 2_555 1.80 
1135 1 C   B SER 75  ? ? 1_555 O   C ALA 130 ? ? 3_555 1.80 
1136 1 CG2 B ILE 115 ? ? 1_555 CA  C LEU 120 ? ? 3_555 1.80 
1137 1 C   B ASN 148 ? ? 1_555 CA  C MET 92  ? ? 3_555 1.80 
1138 1 OG1 B THR 118 ? ? 1_555 CA  C ILE 183 ? ? 3_555 1.80 
1139 1 CG  B ARG 223 ? ? 1_555 CA  C THR 76  ? ? 3_555 1.80 
1140 1 NH2 B ARG 101 ? ? 1_555 CB  C VAL 237 ? ? 3_555 1.80 
1141 1 CA  B GLN 149 ? ? 1_555 CA  C THR 95  ? ? 3_555 1.80 
1142 1 O   B HIS 132 ? ? 1_555 CB  C LEU 224 ? ? 3_555 1.81 
1143 1 CG2 B VAL 80  ? ? 1_555 CD  C PRO 144 ? ? 3_555 1.81 
1144 1 CE3 C TRP 99  ? ? 1_555 CD1 C TRP 107 ? ? 2_555 1.81 
1145 1 CG  C PRO 57  ? ? 1_555 NE  C ARG 249 ? ? 2_555 1.81 
1146 1 OD1 B ASN 190 ? ? 1_555 O   C ASN 172 ? ? 3_555 1.81 
1147 1 CB  B LEU 100 ? ? 1_555 O   C PRO 124 ? ? 3_555 1.81 
1148 1 N   B SER 245 ? ? 1_555 CG  C GLU 163 ? ? 3_555 1.81 
1149 1 N   B VAL 147 ? ? 1_555 CA  C LEU 90  ? ? 3_555 1.81 
1150 1 CB  B THR 87  ? ? 1_555 OG1 C THR 87  ? ? 3_555 1.81 
1151 1 CG2 B ILE 183 ? ? 1_555 CB  C ILE 185 ? ? 3_555 1.81 
1152 1 N   B VAL 225 ? ? 1_555 CD2 C LEU 242 ? ? 3_555 1.81 
1153 1 O   B TRP 99  ? ? 1_555 OG1 C THR 126 ? ? 3_555 1.81 
1154 1 N   B PRO 160 ? ? 1_555 CA  C LYS 154 ? ? 3_555 1.81 
1155 1 CA  B ALA 227 ? ? 1_555 CA  C SER 88  ? ? 3_555 1.81 
1156 1 CD  B GLU 73  ? ? 1_555 NE1 C TRP 162 ? ? 3_555 1.81 
1157 1 N   A PRO 253 ? ? 1_555 NE1 B TRP 162 ? ? 2_555 1.81 
1158 1 SD  C MET 59  ? ? 1_555 O   C SER 62  ? ? 2_555 1.81 
1159 1 CG  B LEU 69  ? ? 1_555 C   C PRO 46  ? ? 3_555 1.82 
1160 1 CA  B LEU 69  ? ? 1_555 CB  C PRO 46  ? ? 3_555 1.82 
1161 1 OG1 B THR 87  ? ? 1_555 CA  C THR 87  ? ? 3_555 1.82 
1162 1 CE  C MET 59  ? ? 1_555 N   C MET 64  ? ? 2_555 1.82 
1163 1 CD  B ARG 116 ? ? 1_555 C   C ALA 182 ? ? 3_555 1.82 
1164 1 N   B ILE 131 ? ? 1_555 N   C PHE 135 ? ? 3_555 1.82 
1165 1 CA  B ALA 236 ? ? 1_555 CB  C VAL 145 ? ? 3_555 1.82 
1166 1 CG  C PRO 57  ? ? 1_555 NH1 C ARG 249 ? ? 2_555 1.82 
1167 1 CD  C PRO 58  ? ? 1_555 N   C LEU 250 ? ? 2_555 1.82 
1168 1 O   B VAL 157 ? ? 1_555 CE2 C PHE 135 ? ? 3_555 1.82 
1169 1 N   B THR 95  ? ? 1_555 C   C ASN 238 ? ? 3_555 1.82 
1170 1 C   B GLY 230 ? ? 1_555 CB  C ASP 141 ? ? 3_555 1.82 
1171 1 CG1 B ILE 131 ? ? 1_555 O   C VAL 225 ? ? 3_555 1.82 
1172 1 CG  B PHE 135 ? ? 1_555 CB  C TYR 243 ? ? 3_555 1.82 
1173 1 N   B GLU 73  ? ? 1_555 CB  C PRO 160 ? ? 3_555 1.82 
1174 1 CA  B VAL 225 ? ? 1_555 OG1 C THR 76  ? ? 3_555 1.82 
1175 1 CE2 B TYR 117 ? ? 1_555 CD2 C TYR 119 ? ? 3_555 1.83 
1176 1 O   B LEU 150 ? ? 1_555 OH  C TYR 117 ? ? 3_555 1.83 
1177 1 CD  A PRO 253 ? ? 1_555 CE2 B TRP 162 ? ? 2_555 1.83 
1178 1 CA  B SER 122 ? ? 1_555 OG  C SER 151 ? ? 3_555 1.83 
1179 1 CA  B GLY 230 ? ? 1_555 NE2 C GLN 136 ? ? 3_555 1.83 
1180 1 C   B THR 239 ? ? 1_555 CA  C LEU 150 ? ? 3_555 1.83 
1181 1 C   B THR 189 ? ? 1_555 CA  C VAL 53  ? ? 3_555 1.83 
1182 1 O   A ILE 254 ? ? 1_555 O   B THR 126 ? ? 2_555 1.83 
1183 1 O   C PRO 58  ? ? 1_555 O   C THR 67  ? ? 2_555 1.83 
1184 1 N   B TRP 162 ? ? 1_555 CA  C LEU 153 ? ? 3_555 1.83 
1185 1 CA  B VAL 192 ? ? 1_555 O   C VAL 53  ? ? 3_555 1.83 
1186 1 CA  B TYR 119 ? ? 1_555 N   C THR 158 ? ? 3_555 1.83 
1187 1 CA  B TYR 243 ? ? 1_555 O   C GLY 159 ? ? 3_555 1.83 
1188 1 C   B ASN 190 ? ? 1_555 CB  C LYS 54  ? ? 3_555 1.83 
1189 1 O   B LEU 120 ? ? 1_555 CE2 C TYR 156 ? ? 3_555 1.83 
1190 1 O   B VAL 96  ? ? 1_555 CA  C VAL 161 ? ? 3_555 1.83 
1191 1 CG2 B VAL 85  ? ? 1_555 O   C VAL 86  ? ? 3_555 1.83 
1192 1 CG2 B THR 226 ? ? 1_555 CB  C THR 226 ? ? 3_555 1.83 
1193 1 CB  B PHE 170 ? ? 1_555 CA  C ARG 181 ? ? 3_555 1.83 
1194 1 N   B GLU 229 ? ? 1_555 NE  C ARG 223 ? ? 3_555 1.84 
1195 1 CD2 B PHE 170 ? ? 1_555 O   C SER 180 ? ? 3_555 1.84 
1196 1 O   B THR 76  ? ? 1_555 CD2 C HIS 132 ? ? 3_555 1.84 
1197 1 O   C PRO 58  ? ? 1_555 C   C VAL 66  ? ? 2_555 1.84 
1198 1 CG  C PRO 58  ? ? 1_555 O   C LEU 250 ? ? 2_555 1.84 
1199 1 OH  C TYR 246 ? ? 1_555 N   C PRO 253 ? ? 2_555 1.84 
1200 1 CG  B HIS 71  ? ? 1_555 CH2 C TRP 162 ? ? 3_555 1.84 
1201 1 CA  B GLU 89  ? ? 1_555 C   C GLU 77  ? ? 3_555 1.84 
1202 1 CG  C PRO 57  ? ? 1_555 CG  C ARG 249 ? ? 2_555 1.84 
1203 1 OE1 C GLU 73  ? ? 1_555 N   C ILE 254 ? ? 2_555 1.84 
1204 1 CE1 B TYR 246 ? ? 1_555 N   C GLU 163 ? ? 3_555 1.84 
1205 1 CA  B GLY 155 ? ? 1_555 N   C SER 245 ? ? 3_555 1.84 
1206 1 C   B GLN 136 ? ? 1_555 CB  C LEU 74  ? ? 3_555 1.84 
1207 1 CG  B LYS 154 ? ? 1_555 O   C ALA 244 ? ? 3_555 1.84 
1208 1 C   B GLY 102 ? ? 1_555 OG1 C THR 126 ? ? 3_555 1.84 
1209 1 C   B ILE 131 ? ? 1_555 O   C GLY 134 ? ? 3_555 1.84 
1210 1 C   B TRP 99  ? ? 1_555 C   C THR 125 ? ? 3_555 1.85 
1211 1 CG  B LEU 78  ? ? 1_555 CA  C ALA 227 ? ? 3_555 1.85 
1212 1 CD1 B TYR 243 ? ? 1_555 C   C THR 158 ? ? 3_555 1.85 
1213 1 C   B VAL 85  ? ? 1_555 N   C SER 88  ? ? 3_555 1.85 
1214 1 CA  B LEU 74  ? ? 1_555 CA  C ALA 130 ? ? 3_555 1.85 
1215 1 N   B VAL 103 ? ? 1_555 OG1 C THR 126 ? ? 3_555 1.85 
1216 1 O   B VAL 161 ? ? 1_555 N   C LEU 153 ? ? 3_555 1.85 
1217 1 C   C ARG 101 ? ? 1_555 N   C ALA 256 ? ? 2_555 1.85 
1218 1 CD  B GLU 89  ? ? 1_555 N   C ALA 79  ? ? 3_555 1.85 
1219 1 CG2 C THR 98  ? ? 1_555 CD1 C ILE 254 ? ? 2_555 1.85 
1220 1 CA  C THR 98  ? ? 1_555 CB  C ILE 254 ? ? 2_555 1.85 
1221 1 CB  B VAL 85  ? ? 1_555 O   C HOH 264 ? ? 3_555 1.85 
1222 1 CD2 C HIS 71  ? ? 1_555 C   C ILE 251 ? ? 2_555 1.85 
1223 1 OE1 B GLU 89  ? ? 1_555 O   C ALA 79  ? ? 3_555 1.85 
1224 1 C   B THR 239 ? ? 1_555 N   C LEU 150 ? ? 3_555 1.85 
1225 1 N   B ARG 101 ? ? 1_555 O   C PRO 124 ? ? 3_555 1.85 
1226 1 N   B SER 245 ? ? 1_555 CB  C GLU 163 ? ? 3_555 1.86 
1227 1 O   B ASN 190 ? ? 1_555 N   C LYS 54  ? ? 3_555 1.86 
1228 1 O   B ALA 222 ? ? 1_555 CB  C ARG 241 ? ? 3_555 1.86 
1229 1 CG2 B THR 184 ? ? 1_555 CB  C THR 184 ? ? 3_555 1.86 
1230 1 N   B GLN 136 ? ? 1_555 O   C LEU 74  ? ? 3_555 1.86 
1231 1 N   B THR 76  ? ? 1_555 N   C ILE 131 ? ? 3_555 1.86 
1232 1 O   B ASN 238 ? ? 1_555 CB  C GLN 149 ? ? 3_555 1.86 
1233 1 CA  B THR 184 ? ? 1_555 N   C THR 184 ? ? 3_555 1.86 
1234 1 CG2 B THR 98  ? ? 1_555 OG  C SER 128 ? ? 3_555 1.86 
1235 1 CA  B PHE 170 ? ? 1_555 N   C ARG 181 ? ? 3_555 1.86 
1236 1 CD  C GLU 73  ? ? 1_555 O   C PRO 253 ? ? 2_555 1.86 
1237 1 CG  B HIS 132 ? ? 1_555 CA  C LEU 224 ? ? 3_555 1.86 
1238 1 CA  B ALA 114 ? ? 1_555 CG2 C THR 51  ? ? 3_555 1.86 
1239 1 OH  C TYR 246 ? ? 1_555 CD  C PRO 253 ? ? 2_555 1.86 
1240 1 CG2 B THR 95  ? ? 1_555 N   C THR 239 ? ? 3_555 1.86 
1241 1 O   B ASN 148 ? ? 1_555 CB  C MET 92  ? ? 3_555 1.86 
1242 1 CB  B LEU 100 ? ? 1_555 C   C PRO 124 ? ? 3_555 1.87 
1243 1 CD2 B TYR 246 ? ? 1_555 CG  C GLN 49  ? ? 3_555 1.87 
1244 1 C   B GLN 149 ? ? 1_555 N   C VAL 96  ? ? 3_555 1.87 
1245 1 N   B SER 70  ? ? 1_555 CG  C PRO 46  ? ? 3_555 1.87 
1246 1 CG  C PRO 57  ? ? 1_555 CZ  C ARG 249 ? ? 2_555 1.87 
1247 1 CG  B TRP 112 ? ? 1_555 OG1 C THR 51  ? ? 3_555 1.87 
1248 1 OE1 B GLU 73  ? ? 1_555 O   C THR 127 ? ? 3_555 1.87 
1249 1 C   B ARG 101 ? ? 1_555 CG  C PRO 124 ? ? 3_555 1.87 
1250 1 CB  B TYR 117 ? ? 1_555 CB  C TYR 119 ? ? 3_555 1.87 
1251 1 N   A ALA 255 ? ? 1_555 N   B SER 128 ? ? 2_555 1.87 
1252 1 CD  C ARG 101 ? ? 1_555 C   C ALA 256 ? ? 2_555 1.87 
1253 1 CA  B THR 247 ? ? 1_555 CD  C GLN 165 ? ? 3_555 1.87 
1254 1 CA  B LEU 242 ? ? 1_555 N   C HIS 132 ? ? 3_555 1.87 
1255 1 O   B ARG 101 ? ? 1_555 CG  C PRO 124 ? ? 3_555 1.87 
1256 1 SG  B CYS 123 ? ? 1_555 O   C GLN 149 ? ? 3_555 1.87 
1257 1 CZ2 C TRP 99  ? ? 1_555 CD2 C TRP 107 ? ? 2_555 1.87 
1258 1 C   B PRO 160 ? ? 1_555 CB  C LEU 153 ? ? 3_555 1.87 
1259 1 CG  B PHE 170 ? ? 1_555 O   C SER 180 ? ? 3_555 1.87 
1260 1 O   C PRO 57  ? ? 1_555 CG1 C VAL 66  ? ? 2_555 1.87 
1261 1 O   B VAL 147 ? ? 1_555 N   C MET 92  ? ? 3_555 1.88 
1262 1 C   B LEU 100 ? ? 1_555 N   C PRO 124 ? ? 3_555 1.88 
1263 1 C   A ALA 257 ? ? 1_555 CB  B SER 232 ? ? 2_555 1.88 
1264 1 CA  C GLY 97  ? ? 1_555 CA  C ILE 254 ? ? 2_555 1.88 
1265 1 O   B ARG 223 ? ? 1_555 O   C THR 76  ? ? 3_555 1.88 
1266 1 CA  B THR 189 ? ? 1_555 CA  C VAL 53  ? ? 3_555 1.88 
1267 1 N   B LEU 242 ? ? 1_555 N   C HIS 132 ? ? 3_555 1.88 
1268 1 C   B GLN 149 ? ? 1_555 C   C THR 95  ? ? 3_555 1.88 
1269 1 O   B LEU 90  ? ? 1_555 C   C GLY 240 ? ? 3_555 1.88 
1270 1 N   C ARG 101 ? ? 1_555 CA  C ALA 255 ? ? 2_555 1.88 
1271 1 CA  B VAL 161 ? ? 1_555 N   C LEU 153 ? ? 3_555 1.88 
1272 1 CG  B GLU 73  ? ? 1_555 CD1 C TRP 162 ? ? 3_555 1.88 
1273 1 CE1 B TYR 137 ? ? 1_555 CA  C GLU 73  ? ? 3_555 1.88 
1274 1 CZ  B TYR 117 ? ? 1_555 CG  C TYR 119 ? ? 3_555 1.88 
1275 1 CE1 B HIS 132 ? ? 1_555 CA  C ARG 223 ? ? 3_555 1.88 
1276 1 C   B GLU 191 ? ? 1_555 N   C LEU 55  ? ? 3_555 1.88 
1277 1 O   B SER 70  ? ? 1_555 CD  C PRO 46  ? ? 3_555 1.88 
1278 1 C   C TRP 99  ? ? 1_555 O   C ILE 254 ? ? 2_555 1.88 
1279 1 CB  B LEU 69  ? ? 1_555 CB  C PRO 46  ? ? 3_555 1.89 
1280 1 C   B GLY 97  ? ? 1_555 CB  C THR 127 ? ? 3_555 1.89 
1281 1 C   B THR 184 ? ? 1_555 CB  C THR 184 ? ? 3_555 1.89 
1282 1 CD1 B TRP 162 ? ? 1_555 O   C ASN 152 ? ? 3_555 1.89 
1283 1 CD1 B ILE 185 ? ? 1_555 O   C TYR 243 ? ? 3_555 1.89 
1284 1 CG2 B VAL 80  ? ? 1_555 CB  C PRO 144 ? ? 3_555 1.89 
1285 1 CG2 B THR 118 ? ? 1_555 CG2 C VAL 157 ? ? 3_555 1.89 
1286 1 CA  B TYR 246 ? ? 1_555 CD  C GLN 49  ? ? 3_555 1.89 
1287 1 OE2 B GLU 191 ? ? 1_555 CA  C ARG 56  ? ? 3_555 1.89 
1288 1 N   B SER 75  ? ? 1_555 CA  C ALA 130 ? ? 3_555 1.89 
1289 1 CA  B ASN 238 ? ? 1_555 CB  C SER 146 ? ? 3_555 1.89 
1290 1 CG  B LEU 78  ? ? 1_555 N   C ALA 227 ? ? 3_555 1.89 
1291 1 CG2 B ILE 183 ? ? 1_555 CD1 C ILE 185 ? ? 3_555 1.89 
1292 1 C   B TYR 117 ? ? 1_555 C   C ILE 183 ? ? 3_555 1.89 
1293 1 N   B TRP 99  ? ? 1_555 C   C THR 127 ? ? 3_555 1.89 
1294 1 CZ3 C TRP 99  ? ? 1_555 CE3 C TRP 107 ? ? 2_555 1.89 
1295 1 C   B LEU 74  ? ? 1_555 O   C GLY 129 ? ? 3_555 1.89 
1296 1 CA  B ARG 241 ? ? 1_555 NE2 C HIS 132 ? ? 3_555 1.89 
1297 1 N   B GLY 231 ? ? 1_555 O   C THR 142 ? ? 3_555 1.89 
1298 1 C   B LEU 242 ? ? 1_555 C   C ILE 131 ? ? 3_555 1.89 
1299 1 CD1 B TYR 119 ? ? 1_555 CG  C TYR 156 ? ? 3_555 1.89 
1300 1 CA  B ASP 188 ? ? 1_555 N   C ASN 172 ? ? 3_555 1.90 
1301 1 CG2 B ILE 131 ? ? 1_555 O   C GLY 134 ? ? 3_555 1.90 
1302 1 C   C LEU 100 ? ? 1_555 O   C ILE 254 ? ? 2_555 1.90 
1303 1 CA  B LEU 120 ? ? 1_555 CD1 C TYR 156 ? ? 3_555 1.90 
1304 1 CZ2 B TRP 112 ? ? 1_555 N   C SER 122 ? ? 3_555 1.90 
1305 1 N   A LEU 258 ? ? 1_555 OG  B SER 232 ? ? 2_555 1.90 
1306 1 C   B TYR 119 ? ? 1_555 N   C THR 158 ? ? 3_555 1.90 
1307 1 CE1 B HIS 132 ? ? 1_555 C   C ALA 222 ? ? 3_555 1.90 
1308 1 CG  C GLU 73  ? ? 1_555 O   C GLU 252 ? ? 2_555 1.90 
1309 1 CE2 B TYR 117 ? ? 1_555 N   C LEU 120 ? ? 3_555 1.90 
1310 1 O   B CYS 72  ? ? 1_555 CH2 C TRP 162 ? ? 3_555 1.90 
1311 1 OG1 B THR 87  ? ? 1_555 OG1 C THR 87  ? ? 3_555 1.90 
1312 1 CD  B LYS 154 ? ? 1_555 SG  C CYS 72  ? ? 3_555 1.90 
1313 1 CA  B VAL 91  ? ? 1_555 C   C GLY 240 ? ? 3_555 1.90 
1314 1 CG  B LEU 69  ? ? 1_555 CA  C PRO 46  ? ? 3_555 1.90 
1315 1 CZ  B TYR 246 ? ? 1_555 O   C TRP 162 ? ? 3_555 1.90 
1316 1 C   B VAL 147 ? ? 1_555 CA  C LEU 90  ? ? 3_555 1.90 
1317 1 N   B GLY 155 ? ? 1_555 CA  C SER 245 ? ? 3_555 1.90 
1318 1 CE1 B PHE 135 ? ? 1_555 C   C LEU 242 ? ? 3_555 1.90 
1319 1 O   B ALA 186 ? ? 1_555 CG2 C VAL 171 ? ? 3_555 1.90 
1320 1 CB  B VAL 82  ? ? 1_555 CG2 C THR 142 ? ? 3_555 1.90 
1321 1 N   B ALA 222 ? ? 1_555 NE  C ARG 241 ? ? 3_555 1.90 
1322 1 CA  B ILE 185 ? ? 1_555 CA  C THR 118 ? ? 3_555 1.91 
1323 1 CB  B TRP 112 ? ? 1_555 O   C THR 51  ? ? 3_555 1.91 
1324 1 CD1 B LEU 224 ? ? 1_555 CD2 C LEU 242 ? ? 3_555 1.91 
1325 1 C   A PRO 253 ? ? 1_555 CD1 B TRP 162 ? ? 2_555 1.91 
1326 1 C   B PRO 93  ? ? 1_555 CB  C CYS 123 ? ? 3_555 1.91 
1327 1 CB  B ALA 79  ? ? 1_555 N   C VAL 145 ? ? 3_555 1.91 
1328 1 C   B VAL 161 ? ? 1_555 C   C ASN 152 ? ? 3_555 1.91 
1329 1 OH  B TYR 246 ? ? 1_555 CG  C TRP 162 ? ? 3_555 1.91 
1330 1 C   B GLN 149 ? ? 1_555 CB  C THR 95  ? ? 3_555 1.91 
1331 1 N   B TYR 243 ? ? 1_555 C   C THR 158 ? ? 3_555 1.91 
1332 1 CA  A LEU 258 ? ? 1_555 N   B SER 232 ? ? 2_555 1.91 
1333 1 CD1 B TYR 243 ? ? 1_555 OG1 C THR 158 ? ? 3_555 1.91 
1334 1 O   B ASN 190 ? ? 1_555 CG  C LYS 54  ? ? 3_555 1.91 
1335 1 CG1 B VAL 80  ? ? 1_555 CG  C PRO 144 ? ? 3_555 1.91 
1336 1 CB  B THR 247 ? ? 1_555 OE1 C GLN 165 ? ? 3_555 1.91 
1337 1 CD1 B LEU 90  ? ? 1_555 CD  C GLU 77  ? ? 3_555 1.91 
1338 1 OE1 B GLU 77  ? ? 1_555 CD  C GLU 229 ? ? 3_555 1.91 
1339 1 CZ  B TYR 119 ? ? 1_555 CD1 C LEU 150 ? ? 3_555 1.91 
1340 1 N   A ALA 256 ? ? 1_555 O   B THR 126 ? ? 2_555 1.91 
1341 1 CB  B VAL 91  ? ? 1_555 CG  C ARG 241 ? ? 3_555 1.91 
1342 1 O   C GLY 97  ? ? 1_555 CG1 C ILE 254 ? ? 2_555 1.91 
1343 1 O   B GLN 136 ? ? 1_555 CD2 C LEU 74  ? ? 3_555 1.91 
1344 1 C   B LEU 153 ? ? 1_555 CB  C ALA 244 ? ? 3_555 1.91 
1345 1 CD  B PRO 93  ? ? 1_555 CB  C SER 122 ? ? 3_555 1.91 
1346 1 OH  B TYR 156 ? ? 1_555 CB  C VAL 91  ? ? 3_555 1.91 
1347 1 N   B GLU 163 ? ? 1_555 O   C LEU 153 ? ? 3_555 1.92 
1348 1 C   B SER 151 ? ? 1_555 CG2 C VAL 96  ? ? 3_555 1.92 
1349 1 CZ3 C TRP 99  ? ? 1_555 CD1 C TRP 107 ? ? 2_555 1.92 
1350 1 CD2 C TRP 99  ? ? 1_555 N   C TRP 107 ? ? 2_555 1.92 
1351 1 CA  B SER 122 ? ? 1_555 CB  C SER 151 ? ? 3_555 1.92 
1352 1 CD2 B PHE 170 ? ? 1_555 C   C THR 179 ? ? 3_555 1.92 
1353 1 ND2 B ASN 238 ? ? 1_555 CA  C SER 146 ? ? 3_555 1.92 
1354 1 CA  B ALA 244 ? ? 1_555 CD1 C ILE 183 ? ? 3_555 1.92 
1355 1 CE1 B TYR 156 ? ? 1_555 CG1 C VAL 91  ? ? 3_555 1.92 
1356 1 CG1 B ILE 248 ? ? 1_555 O   C GLN 49  ? ? 3_555 1.92 
1357 1 N   B TRP 99  ? ? 1_555 CA  C THR 127 ? ? 3_555 1.92 
1358 1 N   B THR 247 ? ? 1_555 CB  C GLN 165 ? ? 3_555 1.92 
1359 1 CD1 B TYR 117 ? ? 1_555 CE2 C TYR 119 ? ? 3_555 1.92 
1360 1 OG  B SER 245 ? ? 1_555 CG  C GLU 163 ? ? 3_555 1.92 
1361 1 CE3 C TRP 99  ? ? 1_555 CB  C TRP 107 ? ? 2_555 1.92 
1362 1 NE2 C HIS 71  ? ? 1_555 O   C ILE 251 ? ? 2_555 1.92 
1363 1 N   B THR 158 ? ? 1_555 CE2 C PHE 135 ? ? 3_555 1.92 
1364 1 O   B MET 133 ? ? 1_555 CE2 C TYR 117 ? ? 3_555 1.92 
1365 1 CE1 B PHE 135 ? ? 1_555 O   C THR 118 ? ? 3_555 1.92 
1366 1 CD  B PRO 93  ? ? 1_555 C   C SER 122 ? ? 3_555 1.92 
1367 1 C   B ILE 185 ? ? 1_555 OG1 C THR 118 ? ? 3_555 1.92 
1368 1 CB  B GLU 77  ? ? 1_555 CG  C GLU 229 ? ? 3_555 1.92 
1369 1 CB  B THR 118 ? ? 1_555 CG2 C VAL 157 ? ? 3_555 1.92 
1370 1 C   B GLN 149 ? ? 1_555 CA  C THR 95  ? ? 3_555 1.92 
1371 1 CD2 C HIS 71  ? ? 1_555 N   C GLU 252 ? ? 2_555 1.93 
1372 1 N   B THR 247 ? ? 1_555 CD  C GLN 165 ? ? 3_555 1.93 
1373 1 O   B ASN 238 ? ? 1_555 CA  C GLN 149 ? ? 3_555 1.93 
1374 1 NH2 C ARG 101 ? ? 1_555 CG  C LEU 258 ? ? 2_555 1.93 
1375 1 OG  B SER 151 ? ? 1_555 C   C VAL 91  ? ? 3_555 1.93 
1376 1 CG  B PHE 170 ? ? 1_555 O   C THR 179 ? ? 3_555 1.93 
1377 1 N   B TRP 112 ? ? 1_555 O   C THR 51  ? ? 3_555 1.93 
1378 1 N   B MET 133 ? ? 1_555 CD1 C LEU 224 ? ? 3_555 1.93 
1379 1 CA  B ARG 241 ? ? 1_555 CD2 C HIS 132 ? ? 3_555 1.93 
1380 1 CG  B LEU 150 ? ? 1_555 CG  C GLU 89  ? ? 3_555 1.93 
1381 1 CA  B SER 146 ? ? 1_555 CD1 C LEU 90  ? ? 3_555 1.93 
1382 1 OE2 B GLU 191 ? ? 1_555 CB  C ARG 56  ? ? 3_555 1.93 
1383 1 NE2 B GLN 149 ? ? 1_555 CE2 C PHE 94  ? ? 3_555 1.93 
1384 1 CE2 C TYR 246 ? ? 1_555 CG  C PRO 253 ? ? 2_555 1.93 
1385 1 C   B TRP 99  ? ? 1_555 N   C THR 127 ? ? 3_555 1.93 
1386 1 C   B ARG 223 ? ? 1_555 C   C THR 76  ? ? 3_555 1.93 
1387 1 N   C GLY 102 ? ? 1_555 N   C ALA 256 ? ? 2_555 1.93 
1388 1 O   B LEU 90  ? ? 1_555 N   C GLY 240 ? ? 3_555 1.93 
1389 1 CG  C GLU 73  ? ? 1_555 O   C PRO 253 ? ? 2_555 1.93 
1390 1 OG1 C THR 98  ? ? 1_555 CD1 C ILE 254 ? ? 2_555 1.94 
1391 1 O   B GLU 89  ? ? 1_555 C   C GLU 77  ? ? 3_555 1.94 
1392 1 N   B TYR 119 ? ? 1_555 CG1 C VAL 157 ? ? 3_555 1.94 
1393 1 CB  B THR 95  ? ? 1_555 CA  C ASN 238 ? ? 3_555 1.94 
1394 1 O   B LEU 242 ? ? 1_555 O   C ILE 131 ? ? 3_555 1.94 
1395 1 CB  B VAL 147 ? ? 1_555 CD2 C LEU 90  ? ? 3_555 1.94 
1396 1 C   C PRO 57  ? ? 1_555 CB  C VAL 66  ? ? 2_555 1.94 
1397 1 C   A PRO 253 ? ? 1_555 NE1 B TRP 162 ? ? 2_555 1.94 
1398 1 O   C LEU 55  ? ? 1_555 NH1 C ARG 196 ? ? 2_555 1.94 
1399 1 CD  B PRO 93  ? ? 1_555 CA  C SER 122 ? ? 3_555 1.94 
1400 1 CD1 B LEU 150 ? ? 1_555 OH  C TYR 117 ? ? 3_555 1.94 
1401 1 O   B HIS 71  ? ? 1_555 CD  C GLU 163 ? ? 3_555 1.94 
1402 1 CG  B GLU 191 ? ? 1_555 C   C LEU 55  ? ? 3_555 1.94 
1403 1 C   B GLN 149 ? ? 1_555 O   C MET 92  ? ? 3_555 1.94 
1404 1 CE1 B TYR 117 ? ? 1_555 CG  C TYR 119 ? ? 3_555 1.94 
1405 1 CB  B THR 95  ? ? 1_555 CA  C THR 239 ? ? 3_555 1.94 
1406 1 N   B LEU 150 ? ? 1_555 CB  C THR 95  ? ? 3_555 1.94 
1407 1 C   B MET 92  ? ? 1_555 CA  C SER 122 ? ? 3_555 1.94 
1408 1 CE  B MET 228 ? ? 1_555 CG1 C VAL 225 ? ? 3_555 1.94 
1409 1 CA  B THR 87  ? ? 1_555 CB  C THR 87  ? ? 3_555 1.94 
1410 1 CA  B THR 81  ? ? 1_555 O   C LEU 143 ? ? 3_555 1.94 
1411 1 CD2 B LEU 150 ? ? 1_555 CD  C GLU 89  ? ? 3_555 1.94 
1412 1 OH  B TYR 119 ? ? 1_555 C   C LEU 150 ? ? 3_555 1.94 
1413 1 CB  B TRP 112 ? ? 1_555 CB  C THR 51  ? ? 3_555 1.94 
1414 1 O   B ILE 183 ? ? 1_555 O   C THR 184 ? ? 3_555 1.94 
1415 1 O   B LYS 154 ? ? 1_555 CB  C ALA 244 ? ? 3_555 1.94 
1416 1 O   B LEU 100 ? ? 1_555 CD  C PRO 124 ? ? 3_555 1.94 
1417 1 CG2 B THR 189 ? ? 1_555 CD1 C LEU 168 ? ? 3_555 1.94 
1418 1 CA  B GLY 134 ? ? 1_555 CE2 C TYR 117 ? ? 3_555 1.95 
1419 1 CA  B GLU 229 ? ? 1_555 CD  C ARG 223 ? ? 3_555 1.95 
1420 1 CG1 B VAL 225 ? ? 1_555 OE2 C GLU 89  ? ? 3_555 1.95 
1421 1 CG2 B VAL 85  ? ? 1_555 O   C HOH 264 ? ? 3_555 1.95 
1422 1 CB  B ILE 248 ? ? 1_555 O   C GLN 49  ? ? 3_555 1.95 
1423 1 O   B ASN 190 ? ? 1_555 C   C LYS 54  ? ? 3_555 1.95 
1424 1 CG2 B VAL 225 ? ? 1_555 CB  C THR 76  ? ? 3_555 1.95 
1425 1 CD2 B LEU 78  ? ? 1_555 C   C THR 226 ? ? 3_555 1.95 
1426 1 CB  B TYR 119 ? ? 1_555 CA  C VAL 157 ? ? 3_555 1.95 
1427 1 CG  B GLU 89  ? ? 1_555 CG  C LEU 78  ? ? 3_555 1.95 
1428 1 N   B THR 98  ? ? 1_555 N   C SER 128 ? ? 3_555 1.95 
1429 1 C   B PHE 170 ? ? 1_555 CA  C ARG 181 ? ? 3_555 1.95 
1430 1 O   B VAL 147 ? ? 1_555 CA  C VAL 91  ? ? 3_555 1.95 
1431 1 N   B GLU 191 ? ? 1_555 N   C LYS 54  ? ? 3_555 1.95 
1432 1 O   B SER 233 ? ? 1_555 OG1 C THR 142 ? ? 3_555 1.95 
1433 1 CA  B SER 88  ? ? 1_555 O   C HOH 265 ? ? 3_555 1.95 
1434 1 CG  B LYS 154 ? ? 1_555 SG  C CYS 72  ? ? 3_555 1.95 
1435 1 CG1 B VAL 82  ? ? 1_555 CG2 C THR 142 ? ? 3_555 1.95 
1436 1 CB  B TYR 243 ? ? 1_555 C   C GLY 159 ? ? 3_555 1.95 
1437 1 CB  B ALA 222 ? ? 1_555 CZ  C TYR 243 ? ? 3_555 1.95 
1438 1 CD2 B HIS 132 ? ? 1_555 CA  C LEU 224 ? ? 3_555 1.95 
1439 1 CD1 C TRP 99  ? ? 1_555 N   C TRP 107 ? ? 2_555 1.95 
1440 1 CB  B LYS 154 ? ? 1_555 N   C GLU 73  ? ? 3_555 1.95 
1441 1 CB  B LEU 153 ? ? 1_555 O   C VAL 96  ? ? 3_555 1.95 
1442 1 CD1 B LEU 100 ? ? 1_555 C   C CYS 123 ? ? 3_555 1.95 
1443 1 O   B LEU 100 ? ? 1_555 C   C PRO 124 ? ? 3_555 1.95 
1444 1 CB  B LEU 78  ? ? 1_555 CA  C ALA 227 ? ? 3_555 1.95 
1445 1 C   B LEU 90  ? ? 1_555 C   C GLY 240 ? ? 3_555 1.96 
1446 1 OG1 B THR 95  ? ? 1_555 N   C THR 239 ? ? 3_555 1.96 
1447 1 CB  B PRO 93  ? ? 1_555 N   C CYS 123 ? ? 3_555 1.96 
1448 1 CD1 B TYR 156 ? ? 1_555 CG2 C ILE 115 ? ? 3_555 1.96 
1449 1 N   B VAL 225 ? ? 1_555 CB  C THR 76  ? ? 3_555 1.96 
1450 1 CD2 B TRP 99  ? ? 1_555 C   C THR 125 ? ? 3_555 1.96 
1451 1 CD1 A ILE 254 ? ? 1_555 CA  B SER 128 ? ? 2_555 1.96 
1452 1 C   B TYR 243 ? ? 1_555 CD1 C ILE 183 ? ? 3_555 1.96 
1453 1 CD1 B ILE 131 ? ? 1_555 CB  C MET 133 ? ? 3_555 1.96 
1454 1 CA  B VAL 80  ? ? 1_555 CA  C PRO 144 ? ? 3_555 1.96 
1455 1 CA  C LEU 100 ? ? 1_555 O   C ILE 254 ? ? 2_555 1.96 
1456 1 N   B ALA 244 ? ? 1_555 O   C PRO 160 ? ? 3_555 1.96 
1457 1 C   B TYR 119 ? ? 1_555 N   C VAL 157 ? ? 3_555 1.96 
1458 1 CD  C GLU 73  ? ? 1_555 C   C GLU 252 ? ? 2_555 1.96 
1459 1 CG  B GLU 89  ? ? 1_555 CB  C LEU 78  ? ? 3_555 1.96 
1460 1 CZ  B TYR 156 ? ? 1_555 CG2 C VAL 91  ? ? 3_555 1.96 
1461 1 C   B GLU 229 ? ? 1_555 NE  C ARG 223 ? ? 3_555 1.96 
1462 1 CB  B ASN 190 ? ? 1_555 O   C LYS 54  ? ? 3_555 1.96 
1463 1 C   B TRP 112 ? ? 1_555 CB  C THR 51  ? ? 3_555 1.96 
1464 1 CE  C MET 59  ? ? 1_555 N   C SER 63  ? ? 2_555 1.96 
1465 1 OG1 B THR 95  ? ? 1_555 O   C ASN 238 ? ? 3_555 1.97 
1466 1 CA  C TRP 99  ? ? 1_555 N   C TRP 107 ? ? 2_555 1.97 
1467 1 O   A LEU 258 ? ? 1_555 CA  B GLY 231 ? ? 2_555 1.97 
1468 1 CA  C ARG 56  ? ? 1_555 NH2 C ARG 249 ? ? 2_555 1.97 
1469 1 CA  B TRP 162 ? ? 1_555 N   C LEU 153 ? ? 3_555 1.97 
1470 1 CG  B PHE 170 ? ? 1_555 N   C ALA 182 ? ? 3_555 1.97 
1471 1 O   B TYR 117 ? ? 1_555 N   C THR 184 ? ? 3_555 1.97 
1472 1 CA  C TRP 99  ? ? 1_555 C   C ASN 106 ? ? 2_555 1.97 
1473 1 C   B VAL 147 ? ? 1_555 CB  C LEU 90  ? ? 3_555 1.97 
1474 1 N   B GLU 73  ? ? 1_555 CD  C PRO 160 ? ? 3_555 1.97 
1475 1 N   C TRP 99  ? ? 1_555 CB  C ILE 254 ? ? 2_555 1.97 
1476 1 N   B THR 87  ? ? 1_555 CB  C THR 87  ? ? 3_555 1.97 
1477 1 N   B HIS 132 ? ? 1_555 C   C LEU 224 ? ? 3_555 1.97 
1478 1 CA  B ASP 188 ? ? 1_555 CB  C VAL 171 ? ? 3_555 1.97 
1479 1 C   B LEU 187 ? ? 1_555 CG1 C VAL 171 ? ? 3_555 1.97 
1480 1 CA  B LEU 100 ? ? 1_555 CA  C PRO 124 ? ? 3_555 1.97 
1481 1 C   B GLU 73  ? ? 1_555 C   C PRO 160 ? ? 3_555 1.97 
1482 1 CB  B VAL 157 ? ? 1_555 C   C ILE 185 ? ? 3_555 1.97 
1483 1 CA  B VAL 147 ? ? 1_555 N   C LEU 90  ? ? 3_555 1.97 
1484 1 N   B THR 118 ? ? 1_555 CA  C ILE 183 ? ? 3_555 1.97 
1485 1 CD1 B ILE 115 ? ? 1_555 CA  C PRO 121 ? ? 3_555 1.97 
1486 1 O   A ILE 254 ? ? 1_555 O   B THR 127 ? ? 2_555 1.97 
1487 1 C   B LEU 187 ? ? 1_555 CG2 C VAL 171 ? ? 3_555 1.98 
1488 1 CD2 B TYR 119 ? ? 1_555 N   C MET 133 ? ? 3_555 1.98 
1489 1 O   B GLU 73  ? ? 1_555 CD  C PRO 160 ? ? 3_555 1.98 
1490 1 CA  A ILE 254 ? ? 1_555 C   B THR 127 ? ? 2_555 1.98 
1491 1 CD1 B LEU 69  ? ? 1_555 O   C PRO 46  ? ? 3_555 1.98 
1492 1 CA  B GLU 89  ? ? 1_555 C   C LEU 78  ? ? 3_555 1.98 
1493 1 O   B ALA 244 ? ? 1_555 CG  C GLU 163 ? ? 3_555 1.98 
1494 1 N   B TRP 112 ? ? 1_555 N   C THR 51  ? ? 3_555 1.98 
1495 1 O   B GLU 73  ? ? 1_555 O   C PRO 160 ? ? 3_555 1.98 
1496 1 CG2 B ILE 115 ? ? 1_555 CD2 C LEU 120 ? ? 3_555 1.98 
1497 1 CG1 B ILE 115 ? ? 1_555 N   C PRO 121 ? ? 3_555 1.98 
1498 1 N   B GLU 77  ? ? 1_555 N   C GLU 229 ? ? 3_555 1.98 
1499 1 N   B LEU 100 ? ? 1_555 C   C PRO 124 ? ? 3_555 1.98 
1500 1 CD2 B TYR 117 ? ? 1_555 CD2 C TYR 119 ? ? 3_555 1.98 
1501 1 CA  B TYR 119 ? ? 1_555 N   C VAL 157 ? ? 3_555 1.98 
1502 1 CB  B LEU 242 ? ? 1_555 CA  C ILE 131 ? ? 3_555 1.98 
1503 1 CA  B MET 228 ? ? 1_555 CG2 C VAL 225 ? ? 3_555 1.98 
1504 1 CB  B CYS 72  ? ? 1_555 OE2 C GLU 163 ? ? 3_555 1.98 
1505 1 C   B THR 81  ? ? 1_555 CB  C THR 142 ? ? 3_555 1.98 
1506 1 O   B PHE 170 ? ? 1_555 CA  C ARG 181 ? ? 3_555 1.98 
1507 1 OE2 B GLU 229 ? ? 1_555 N   C ARG 223 ? ? 3_555 1.98 
1508 1 CB  B PHE 170 ? ? 1_555 O   C SER 180 ? ? 3_555 1.98 
1509 1 CB  B GLU 89  ? ? 1_555 C   C LEU 78  ? ? 3_555 1.99 
1510 1 CB  B ALA 244 ? ? 1_555 O   C GLU 163 ? ? 3_555 1.99 
1511 1 CA  C VAL 85  ? ? 1_555 O   B HOH 270 ? ? 2_555 1.99 
1512 1 CB  B LEU 153 ? ? 1_555 CG1 C VAL 96  ? ? 3_555 1.99 
1513 1 CB  B LEU 100 ? ? 1_555 O   C CYS 123 ? ? 3_555 1.99 
1514 1 C   C MET 59  ? ? 1_555 OG1 C THR 67  ? ? 2_555 1.99 
1515 1 OE1 C GLU 73  ? ? 1_555 O   C GLU 252 ? ? 2_555 1.99 
1516 1 CD  B GLU 73  ? ? 1_555 CG  C TRP 162 ? ? 3_555 1.99 
1517 1 CG  B ARG 116 ? ? 1_555 C   C ALA 182 ? ? 3_555 1.99 
1518 1 CD1 B LEU 69  ? ? 1_555 CB  C PRO 46  ? ? 3_555 1.99 
1519 1 N   B VAL 91  ? ? 1_555 C   C GLY 240 ? ? 3_555 1.99 
1520 1 N   B VAL 237 ? ? 1_555 N   C VAL 145 ? ? 3_555 1.99 
1521 1 O   A ILE 254 ? ? 1_555 C   B THR 127 ? ? 2_555 1.99 
1522 1 O   B TRP 99  ? ? 1_555 CB  C THR 126 ? ? 3_555 1.99 
1523 1 N   B TRP 162 ? ? 1_555 CA  C ASN 152 ? ? 3_555 1.99 
1524 1 CZ  B TYR 117 ? ? 1_555 CZ  C TYR 119 ? ? 3_555 1.99 
1525 1 CD1 C TRP 99  ? ? 1_555 CA  C TRP 107 ? ? 2_555 1.99 
1526 1 CA  B PHE 170 ? ? 1_555 C   C SER 180 ? ? 3_555 1.99 
1527 1 CA  B ILE 248 ? ? 1_555 CA  C GLN 49  ? ? 3_555 1.99 
1528 1 CG2 B VAL 80  ? ? 1_555 CA  C PRO 144 ? ? 3_555 1.99 
1529 1 O   B TYR 246 ? ? 1_555 CG  C GLN 49  ? ? 3_555 1.99 
1530 1 O   B ILE 183 ? ? 1_555 CB  C VAL 157 ? ? 3_555 1.99 
1531 1 C   B HIS 71  ? ? 1_555 CZ3 C TRP 162 ? ? 3_555 1.99 
1532 1 C   B THR 95  ? ? 1_555 N   C THR 239 ? ? 3_555 1.99 
1533 1 C   B THR 98  ? ? 1_555 O   C THR 126 ? ? 3_555 1.99 
1534 1 CB  A ALA 255 ? ? 1_555 CA  B THR 127 ? ? 2_555 1.99 
1535 1 CB  B ASN 148 ? ? 1_555 CB  C MET 92  ? ? 3_555 1.99 
1536 1 N   B GLU 89  ? ? 1_555 N   C LEU 78  ? ? 3_555 1.99 
1537 1 O   B GLN 149 ? ? 1_555 CA  C VAL 96  ? ? 3_555 1.99 
1538 1 CE1 B TYR 243 ? ? 1_555 OG1 C THR 158 ? ? 3_555 1.99 
1539 1 CG1 B VAL 237 ? ? 1_555 NE2 C GLN 149 ? ? 3_555 1.99 
1540 1 CA  C PRO 58  ? ? 1_555 O   C LEU 250 ? ? 2_555 2.00 
1541 1 CG1 B VAL 85  ? ? 1_555 CD1 C LEU 143 ? ? 3_555 2.00 
1542 1 CD  B GLN 149 ? ? 1_555 OG1 C THR 95  ? ? 3_555 2.00 
1543 1 CA  B ALA 222 ? ? 1_555 CD2 C LEU 74  ? ? 3_555 2.00 
1544 1 CD1 B LEU 153 ? ? 1_555 O   C VAL 96  ? ? 3_555 2.00 
1545 1 C   B THR 239 ? ? 1_555 CB  C LEU 150 ? ? 3_555 2.00 
1546 1 N   B PHE 135 ? ? 1_555 CB  C SER 75  ? ? 3_555 2.00 
1547 1 NH1 B ARG 116 ? ? 1_555 CB  C ALA 182 ? ? 3_555 2.00 
1548 1 CA  C LEU 100 ? ? 1_555 O   C ASN 106 ? ? 2_555 2.00 
1549 1 CG  B ASN 152 ? ? 1_555 N   C PRO 93  ? ? 3_555 2.00 
1550 1 O   B MET 228 ? ? 1_555 CD1 C LEU 143 ? ? 3_555 2.00 
1551 1 C   B SER 75  ? ? 1_555 C   C ALA 130 ? ? 3_555 2.00 
1552 1 N   B GLN 149 ? ? 1_555 CB  C THR 95  ? ? 3_555 2.00 
1553 1 CE1 B HIS 132 ? ? 1_555 C   C ARG 223 ? ? 3_555 2.00 
1554 1 CD2 B TYR 246 ? ? 1_555 CB  C GLN 49  ? ? 3_555 2.00 
1555 1 N   B VAL 80  ? ? 1_555 CG  C PRO 144 ? ? 3_555 2.00 
1556 1 CB  B VAL 91  ? ? 1_555 N   C ARG 241 ? ? 3_555 2.00 
1557 1 CA  A ALA 255 ? ? 1_555 C   B THR 127 ? ? 2_555 2.00 
1558 1 CD2 B LEU 187 ? ? 1_555 CD1 C LEU 120 ? ? 3_555 2.00 
1559 1 C   C CYS 72  ? ? 1_555 CB  C GLU 252 ? ? 2_555 2.00 
1560 1 CB  B THR 226 ? ? 1_555 CG2 C THR 226 ? ? 3_555 2.01 
1561 1 N   B VAL 147 ? ? 1_555 CD2 C LEU 90  ? ? 3_555 2.01 
1562 1 OG1 B THR 118 ? ? 1_555 C   C ALA 182 ? ? 3_555 2.01 
1563 1 O   B PRO 93  ? ? 1_555 N   C CYS 123 ? ? 3_555 2.01 
1564 1 CB  A ILE 254 ? ? 1_555 C   B SER 128 ? ? 2_555 2.01 
1565 1 CB  B ALA 227 ? ? 1_555 O   C LEU 224 ? ? 3_555 2.01 
1566 1 CB  B VAL 86  ? ? 1_555 O   C SER 88  ? ? 3_555 2.01 
1567 1 O   B GLY 155 ? ? 1_555 CA  C TYR 117 ? ? 3_555 2.01 
1568 1 CD1 B LEU 187 ? ? 1_555 CD1 C TYR 243 ? ? 3_555 2.01 
1569 1 N   B PRO 121 ? ? 1_555 CG  C TYR 156 ? ? 3_555 2.01 
1570 1 C   A LEU 258 ? ? 1_555 CA  B SER 232 ? ? 2_555 2.01 
1571 1 CG2 B ILE 131 ? ? 1_555 N   C PHE 135 ? ? 3_555 2.01 
1572 1 CZ  C ARG 101 ? ? 1_555 CA  C LEU 258 ? ? 2_555 2.01 
1573 1 NH2 C ARG 101 ? ? 1_555 CB  C LEU 258 ? ? 2_555 2.01 
1574 1 C   C LEU 60  ? ? 1_555 N   C SER 62  ? ? 2_555 2.01 
1575 1 CD1 B TYR 243 ? ? 1_555 CG2 C THR 158 ? ? 3_555 2.01 
1576 1 CG  B TYR 137 ? ? 1_555 CB  C LEU 74  ? ? 3_555 2.01 
1577 1 N   B ASN 190 ? ? 1_555 OD1 C ASN 172 ? ? 3_555 2.01 
1578 1 CA  B ALA 227 ? ? 1_555 C   C SER 88  ? ? 3_555 2.01 
1579 1 N   B THR 184 ? ? 1_555 O   C HOH 267 ? ? 3_555 2.02 
1580 1 CZ  B PHE 170 ? ? 1_555 O   C THR 179 ? ? 3_555 2.02 
1581 1 N   B GLU 89  ? ? 1_555 CA  C LEU 78  ? ? 3_555 2.02 
1582 1 CA  B TRP 112 ? ? 1_555 C   C THR 51  ? ? 3_555 2.02 
1583 1 O   B SER 146 ? ? 1_555 CB  C LEU 90  ? ? 3_555 2.02 
1584 1 CA  B GLY 230 ? ? 1_555 OE1 C GLN 136 ? ? 3_555 2.02 
1585 1 O   B PHE 135 ? ? 1_555 N   C SER 75  ? ? 3_555 2.02 
1586 1 C   B THR 76  ? ? 1_555 O   C ALA 130 ? ? 3_555 2.02 
1587 1 O   A PRO 253 ? ? 1_555 CD1 B TRP 162 ? ? 2_555 2.02 
1588 1 CH2 B TRP 99  ? ? 1_555 O   C PRO 46  ? ? 3_555 2.02 
1589 1 CG  B PRO 221 ? ? 1_555 NE  C ARG 241 ? ? 3_555 2.02 
1590 1 N   B ASN 238 ? ? 1_555 NE2 C GLN 149 ? ? 3_555 2.02 
1591 1 CG  B ASN 152 ? ? 1_555 CB  C PRO 93  ? ? 3_555 2.02 
1592 1 C   A LEU 258 ? ? 1_555 C   B GLY 231 ? ? 2_555 2.02 
1593 1 C   B THR 239 ? ? 1_555 C   C LEU 150 ? ? 3_555 2.02 
1594 1 C   A LEU 258 ? ? 1_555 CB  B SER 232 ? ? 2_555 2.02 
1595 1 C   C PRO 57  ? ? 1_555 O   C LEU 250 ? ? 2_555 2.02 
1596 1 O   B VAL 161 ? ? 1_555 N   C ASN 152 ? ? 3_555 2.02 
1597 1 CA  B ARG 101 ? ? 1_555 CG  C PRO 124 ? ? 3_555 2.02 
1598 1 CG1 B VAL 225 ? ? 1_555 OE1 C GLU 89  ? ? 3_555 2.02 
1599 1 C   B GLU 229 ? ? 1_555 CD  C GLN 136 ? ? 3_555 2.02 
1600 1 N   B ASN 152 ? ? 1_555 CB  C VAL 96  ? ? 3_555 2.02 
1601 1 C   B THR 189 ? ? 1_555 N   C LYS 54  ? ? 3_555 2.02 
1602 1 CA  B ALA 236 ? ? 1_555 CG2 C VAL 145 ? ? 3_555 2.02 
1603 1 CB  B VAL 80  ? ? 1_555 CG  C PRO 144 ? ? 3_555 2.02 
1604 1 O   B GLY 159 ? ? 1_555 O   C PHE 135 ? ? 3_555 2.02 
1605 1 O   B CYS 72  ? ? 1_555 CE2 C TRP 162 ? ? 3_555 2.03 
1606 1 N   B CYS 72  ? ? 1_555 CH2 C TRP 162 ? ? 3_555 2.03 
1607 1 C   B LEU 150 ? ? 1_555 CG2 C VAL 96  ? ? 3_555 2.03 
1608 1 CG  B TYR 119 ? ? 1_555 N   C VAL 157 ? ? 3_555 2.03 
1609 1 N   B ILE 185 ? ? 1_555 CB  C THR 184 ? ? 3_555 2.03 
1610 1 CD1 B ILE 115 ? ? 1_555 CA  C LEU 120 ? ? 3_555 2.03 
1611 1 O   B GLY 159 ? ? 1_555 CA  C PHE 135 ? ? 3_555 2.03 
1612 1 C   B VAL 96  ? ? 1_555 O   C VAL 161 ? ? 3_555 2.03 
1613 1 OE1 C GLU 73  ? ? 1_555 C   C PRO 253 ? ? 2_555 2.03 
1614 1 N   B THR 98  ? ? 1_555 CA  C THR 127 ? ? 3_555 2.03 
1615 1 CE2 C TRP 99  ? ? 1_555 CG  C TRP 107 ? ? 2_555 2.03 
1616 1 CG  B GLN 136 ? ? 1_555 O   C SER 75  ? ? 3_555 2.03 
1617 1 C   B VAL 157 ? ? 1_555 CE2 C PHE 135 ? ? 3_555 2.03 
1618 1 O   B PHE 135 ? ? 1_555 O   C LEU 74  ? ? 3_555 2.03 
1619 1 O   B PRO 124 ? ? 1_555 CG  C ASN 152 ? ? 3_555 2.03 
1620 1 CG1 B VAL 103 ? ? 1_555 CB  C ILE 47  ? ? 3_555 2.03 
1621 1 OH  B TYR 156 ? ? 1_555 CG2 C VAL 91  ? ? 3_555 2.03 
1622 1 CD1 C TRP 99  ? ? 1_555 O   C ALA 104 ? ? 2_555 2.03 
1623 1 ND2 A ASN 106 ? ? 1_555 CA  B THR 126 ? ? 2_555 2.03 
1624 1 CA  C GLY 102 ? ? 1_555 CB  C ALA 256 ? ? 2_555 2.03 
1625 1 CD1 C LEU 60  ? ? 1_555 OG1 C THR 67  ? ? 2_555 2.03 
1626 1 CG  B ASN 190 ? ? 1_555 ND2 C ASN 172 ? ? 3_555 2.03 
1627 1 NZ  B LYS 154 ? ? 1_555 CB  C SER 245 ? ? 3_555 2.03 
1628 1 CA  B ASN 148 ? ? 1_555 CG  C MET 92  ? ? 3_555 2.04 
1629 1 ND1 C HIS 71  ? ? 1_555 C   C ILE 251 ? ? 2_555 2.04 
1630 1 CB  A ASN 106 ? ? 1_555 CG2 B THR 126 ? ? 2_555 2.04 
1631 1 CG1 B VAL 157 ? ? 1_555 O   C ILE 185 ? ? 3_555 2.04 
1632 1 CB  B THR 95  ? ? 1_555 O   C ASN 238 ? ? 3_555 2.04 
1633 1 CG  B MET 133 ? ? 1_555 SD  C MET 133 ? ? 3_555 2.04 
1634 1 OG1 B THR 76  ? ? 1_555 CG  C MET 228 ? ? 3_555 2.04 
1635 1 CB  B SER 245 ? ? 1_555 CG  C GLU 163 ? ? 3_555 2.04 
1636 1 N   B ARG 249 ? ? 1_555 CA  C GLY 50  ? ? 3_555 2.04 
1637 1 CG2 B VAL 225 ? ? 1_555 O   C SER 75  ? ? 3_555 2.04 
1638 1 O   B ASN 238 ? ? 1_555 O   C SER 146 ? ? 3_555 2.04 
1639 1 CA  B ASN 190 ? ? 1_555 CG  C LYS 54  ? ? 3_555 2.04 
1640 1 O   B THR 239 ? ? 1_555 CA  C SER 151 ? ? 3_555 2.04 
1641 1 CB  B TYR 119 ? ? 1_555 C   C VAL 157 ? ? 3_555 2.04 
1642 1 CE1 B TYR 137 ? ? 1_555 O   C GLU 73  ? ? 3_555 2.04 
1643 1 CB  B VAL 161 ? ? 1_555 CB  C LEU 153 ? ? 3_555 2.04 
1644 1 CA  B VAL 103 ? ? 1_555 CD1 C ILE 47  ? ? 3_555 2.04 
1645 1 N   B VAL 237 ? ? 1_555 CB  C VAL 145 ? ? 3_555 2.04 
1646 1 O   B LYS 154 ? ? 1_555 C   C TYR 243 ? ? 3_555 2.04 
1647 1 CG  B ARG 241 ? ? 1_555 OE2 C GLU 229 ? ? 3_555 2.04 
1648 1 N   B ARG 241 ? ? 1_555 CG  C HIS 132 ? ? 3_555 2.04 
1649 1 CB  B ALA 222 ? ? 1_555 OH  C TYR 243 ? ? 3_555 2.04 
1650 1 N   C MET 59  ? ? 1_555 CA  C THR 67  ? ? 2_555 2.04 
1651 1 C   B PHE 170 ? ? 1_555 CB  C ARG 181 ? ? 3_555 2.04 
1652 1 C   B ASN 148 ? ? 1_555 N   C MET 92  ? ? 3_555 2.04 
1653 1 CG  C MET 59  ? ? 1_555 O   C SER 62  ? ? 2_555 2.04 
1654 1 O   B VAL 85  ? ? 1_555 C   C THR 87  ? ? 3_555 2.04 
1655 1 CA  B PRO 121 ? ? 1_555 O   C SER 151 ? ? 3_555 2.04 
1656 1 C   A ILE 254 ? ? 1_555 N   B THR 127 ? ? 2_555 2.04 
1657 1 CA  B THR 98  ? ? 1_555 O   C THR 127 ? ? 3_555 2.04 
1658 1 OD1 B ASN 152 ? ? 1_555 CB  C PRO 93  ? ? 3_555 2.04 
1659 1 O   B HIS 71  ? ? 1_555 OE1 C GLU 163 ? ? 3_555 2.05 
1660 1 CB  B ALA 186 ? ? 1_555 CA  C GLY 167 ? ? 3_555 2.05 
1661 1 CA  C MET 59  ? ? 1_555 C   C VAL 66  ? ? 2_555 2.05 
1662 1 O   B MET 133 ? ? 1_555 CZ  C TYR 117 ? ? 3_555 2.05 
1663 1 O   B VAL 80  ? ? 1_555 N   C PRO 144 ? ? 3_555 2.05 
1664 1 C   B GLY 134 ? ? 1_555 CB  C SER 75  ? ? 3_555 2.05 
1665 1 N   B GLY 155 ? ? 1_555 CA  C ALA 244 ? ? 3_555 2.05 
1666 1 CG  B LEU 242 ? ? 1_555 CG1 C ILE 131 ? ? 3_555 2.05 
1667 1 CB  B TYR 117 ? ? 1_555 CG2 C ILE 183 ? ? 3_555 2.05 
1668 1 N   B TYR 156 ? ? 1_555 O   C ARG 116 ? ? 3_555 2.05 
1669 1 OH  B TYR 246 ? ? 1_555 CB  C TRP 162 ? ? 3_555 2.05 
1670 1 N   B LEU 242 ? ? 1_555 CG  C HIS 132 ? ? 3_555 2.05 
1671 1 CD2 B LEU 100 ? ? 1_555 CA  C PRO 124 ? ? 3_555 2.05 
1672 1 CD1 C TRP 99  ? ? 1_555 CB  C TRP 107 ? ? 2_555 2.05 
1673 1 CD2 C TRP 99  ? ? 1_555 CD2 C TRP 107 ? ? 2_555 2.05 
1674 1 NH2 C ARG 101 ? ? 1_555 C   C ALA 257 ? ? 2_555 2.05 
1675 1 C   B ALA 114 ? ? 1_555 CB  C GLN 165 ? ? 3_555 2.05 
1676 1 CB  B PHE 170 ? ? 1_555 N   C ALA 182 ? ? 3_555 2.05 
1677 1 OG1 B THR 226 ? ? 1_555 N   C THR 226 ? ? 3_555 2.05 
1678 1 O   B GLU 77  ? ? 1_555 N   C MET 228 ? ? 3_555 2.05 
1679 1 C   B ALA 244 ? ? 1_555 CG  C GLU 163 ? ? 3_555 2.05 
1680 1 CG  B GLU 191 ? ? 1_555 N   C ARG 56  ? ? 3_555 2.05 
1681 1 CA  B TRP 112 ? ? 1_555 O   C THR 51  ? ? 3_555 2.05 
1682 1 CA  B ILE 248 ? ? 1_555 CA  C GLY 50  ? ? 3_555 2.06 
1683 1 CB  A ALA 255 ? ? 1_555 OG1 B THR 127 ? ? 2_555 2.06 
1684 1 CB  B ILE 183 ? ? 1_555 C   C GLY 155 ? ? 3_555 2.06 
1685 1 N   B GLY 134 ? ? 1_555 CE2 C TYR 117 ? ? 3_555 2.06 
1686 1 C   B THR 189 ? ? 1_555 ND2 C ASN 172 ? ? 3_555 2.06 
1687 1 O   B GLY 155 ? ? 1_555 CA  C ARG 116 ? ? 3_555 2.06 
1688 1 N   B VAL 80  ? ? 1_555 CB  C PRO 144 ? ? 3_555 2.06 
1689 1 CG  B LEU 69  ? ? 1_555 N   C ILE 47  ? ? 3_555 2.06 
1690 1 C   B MET 133 ? ? 1_555 CE2 C TYR 117 ? ? 3_555 2.06 
1691 1 C   B VAL 96  ? ? 1_555 CG2 C THR 239 ? ? 3_555 2.06 
1692 1 C   A ILE 254 ? ? 1_555 N   B SER 128 ? ? 2_555 2.06 
1693 1 CB  B LEU 242 ? ? 1_555 CG1 C ILE 131 ? ? 3_555 2.06 
1694 1 CG2 B VAL 91  ? ? 1_555 O   C ARG 241 ? ? 3_555 2.06 
1695 1 C   B VAL 237 ? ? 1_555 CD  C GLN 149 ? ? 3_555 2.06 
1696 1 CG2 B VAL 192 ? ? 1_555 N   C VAL 53  ? ? 3_555 2.06 
1697 1 CG1 A ILE 254 ? ? 1_555 N   B SER 128 ? ? 2_555 2.06 
1698 1 CA  B ASN 190 ? ? 1_555 N   C LYS 54  ? ? 3_555 2.06 
1699 1 CA  B GLY 159 ? ? 1_555 CB  C LYS 154 ? ? 3_555 2.06 
1700 1 CG  B PRO 93  ? ? 1_555 C   C SER 122 ? ? 3_555 2.06 
1701 1 N   C LEU 60  ? ? 1_555 CB  C SER 62  ? ? 2_555 2.07 
1702 1 CG2 B THR 98  ? ? 1_555 N   C SER 128 ? ? 3_555 2.07 
1703 1 CD1 B TYR 243 ? ? 1_555 CB  C THR 158 ? ? 3_555 2.07 
1704 1 N   B ALA 130 ? ? 1_555 CB  C GLN 136 ? ? 3_555 2.07 
1705 1 N   C THR 98  ? ? 1_555 CG2 C ILE 254 ? ? 2_555 2.07 
1706 1 CB  B PHE 170 ? ? 1_555 C   C ARG 181 ? ? 3_555 2.07 
1707 1 CA  C ARG 101 ? ? 1_555 N   C ALA 256 ? ? 2_555 2.07 
1708 1 CG2 B VAL 96  ? ? 1_555 OH  C TYR 119 ? ? 3_555 2.07 
1709 1 C   B ALA 244 ? ? 1_555 CA  C GLU 163 ? ? 3_555 2.07 
1710 1 CG  B TYR 246 ? ? 1_555 CD  C GLN 49  ? ? 3_555 2.07 
1711 1 O   B THR 189 ? ? 1_555 O   C MET 52  ? ? 3_555 2.07 
1712 1 CA  C LEU 60  ? ? 1_555 CB  C SER 62  ? ? 2_555 2.07 
1713 1 CA  B VAL 86  ? ? 1_555 N   C SER 88  ? ? 3_555 2.07 
1714 1 CE2 B TYR 117 ? ? 1_555 CA  C TYR 119 ? ? 3_555 2.07 
1715 1 CA  B ARG 116 ? ? 1_555 O   C GLY 164 ? ? 3_555 2.07 
1716 1 CB  A PRO 253 ? ? 1_555 CD2 B TRP 162 ? ? 2_555 2.07 
1717 1 C   B TRP 99  ? ? 1_555 O   C PRO 124 ? ? 3_555 2.07 
1718 1 N   B VAL 192 ? ? 1_555 C   C VAL 53  ? ? 3_555 2.07 
1719 1 N   B ARG 116 ? ? 1_555 CA  C GLY 164 ? ? 3_555 2.07 
1720 1 C   B VAL 86  ? ? 1_555 OG1 C THR 87  ? ? 3_555 2.07 
1721 1 CB  B ALA 79  ? ? 1_555 C   C PRO 144 ? ? 3_555 2.07 
1722 1 CB  B LEU 187 ? ? 1_555 CG  C LEU 120 ? ? 3_555 2.07 
1723 1 N   B LEU 224 ? ? 1_555 C   C THR 76  ? ? 3_555 2.07 
1724 1 CD2 B LEU 78  ? ? 1_555 O   C HIS 132 ? ? 3_555 2.07 
1725 1 CA  B GLN 136 ? ? 1_555 N   C SER 75  ? ? 3_555 2.07 
1726 1 O   B ALA 182 ? ? 1_555 O   C HOH 267 ? ? 3_555 2.08 
1727 1 C   B VAL 157 ? ? 1_555 CE1 C PHE 135 ? ? 3_555 2.08 
1728 1 N   C GLY 102 ? ? 1_555 ND2 C ASN 106 ? ? 2_555 2.08 
1729 1 CE2 B TRP 99  ? ? 1_555 O   C THR 125 ? ? 3_555 2.08 
1730 1 CB  B ILE 248 ? ? 1_555 N   C GLY 50  ? ? 3_555 2.08 
1731 1 O   B THR 184 ? ? 1_555 CA  C THR 184 ? ? 3_555 2.08 
1732 1 O   B LEU 187 ? ? 1_555 O   C LEU 168 ? ? 3_555 2.08 
1733 1 CB  C GLU 73  ? ? 1_555 O   C GLU 252 ? ? 2_555 2.08 
1734 1 C   B SER 151 ? ? 1_555 CZ2 C TRP 112 ? ? 3_555 2.08 
1735 1 CG1 B VAL 225 ? ? 1_555 CD  C GLU 89  ? ? 3_555 2.08 
1736 1 N   C LEU 60  ? ? 1_555 OG1 C THR 67  ? ? 2_555 2.08 
1737 1 OE2 B GLU 229 ? ? 1_555 O   C GLN 136 ? ? 3_555 2.08 
1738 1 CD1 B TYR 243 ? ? 1_555 N   C GLY 159 ? ? 3_555 2.08 
1739 1 C   C GLY 97  ? ? 1_555 C   C ILE 254 ? ? 2_555 2.08 
1740 1 CB  B VAL 161 ? ? 1_555 CD2 C LEU 153 ? ? 3_555 2.08 
1741 1 CD1 B LEU 78  ? ? 1_555 CB  C HIS 132 ? ? 3_555 2.08 
1742 1 C   B LEU 224 ? ? 1_555 CD2 C LEU 242 ? ? 3_555 2.08 
1743 1 C   B GLY 159 ? ? 1_555 CB  C LYS 154 ? ? 3_555 2.08 
1744 1 O   B GLU 229 ? ? 1_555 CB  C GLN 136 ? ? 3_555 2.08 
1745 1 OG1 B THR 98  ? ? 1_555 CB  C SER 128 ? ? 3_555 2.08 
1746 1 CE2 B TYR 117 ? ? 1_555 C   C TYR 119 ? ? 3_555 2.08 
1747 1 CB  B ARG 223 ? ? 1_555 C   C THR 76  ? ? 3_555 2.08 
1748 1 N   C ARG 101 ? ? 1_555 C   C ILE 254 ? ? 2_555 2.08 
1749 1 CB  B THR 239 ? ? 1_555 C   C GLN 149 ? ? 3_555 2.08 
1750 1 CE2 C TYR 246 ? ? 1_555 CB  C PRO 253 ? ? 2_555 2.08 
1751 1 O   C ASP 65  ? ? 1_555 O   C SER 70  ? ? 3_555 2.08 
1752 1 O   B MET 228 ? ? 1_555 CG  C LEU 143 ? ? 3_555 2.09 
1753 1 CD  A PRO 253 ? ? 1_555 NE1 B TRP 162 ? ? 2_555 2.09 
1754 1 N   B PRO 93  ? ? 1_555 N   C CYS 123 ? ? 3_555 2.09 
1755 1 O   B THR 95  ? ? 1_555 CG2 C THR 239 ? ? 3_555 2.09 
1756 1 CA  B PHE 135 ? ? 1_555 CB  C SER 75  ? ? 3_555 2.09 
1757 1 CB  C TRP 99  ? ? 1_555 N   C SER 108 ? ? 2_555 2.09 
1758 1 CG1 B ILE 183 ? ? 1_555 O   C GLY 155 ? ? 3_555 2.09 
1759 1 N   B THR 184 ? ? 1_555 N   C ILE 185 ? ? 3_555 2.09 
1760 1 C   B ALA 79  ? ? 1_555 C   C PRO 144 ? ? 3_555 2.09 
1761 1 OE1 B GLN 149 ? ? 1_555 OG1 C THR 95  ? ? 3_555 2.09 
1762 1 OG1 B THR 87  ? ? 1_555 N   C THR 87  ? ? 3_555 2.09 
1763 1 OH  B TYR 117 ? ? 1_555 CE2 C TYR 119 ? ? 3_555 2.09 
1764 1 CB  B THR 158 ? ? 1_555 CE2 C PHE 135 ? ? 3_555 2.09 
1765 1 N   B PRO 124 ? ? 1_555 OD1 C ASN 152 ? ? 3_555 2.09 
1766 1 N   B LEU 242 ? ? 1_555 CA  C HIS 132 ? ? 3_555 2.09 
1767 1 CD1 B TYR 246 ? ? 1_555 N   C GLU 163 ? ? 3_555 2.09 
1768 1 N   B LEU 150 ? ? 1_555 O   C LEU 90  ? ? 3_555 2.09 
1769 1 O   B VAL 96  ? ? 1_555 O   C VAL 161 ? ? 3_555 2.10 
1770 1 CB  B ALA 79  ? ? 1_555 O   C PRO 144 ? ? 3_555 2.10 
1771 1 OG1 B THR 189 ? ? 1_555 CD2 C LEU 168 ? ? 3_555 2.10 
1772 1 N   B VAL 147 ? ? 1_555 CD1 C LEU 90  ? ? 3_555 2.10 
1773 1 N   B ARG 241 ? ? 1_555 OH  C TYR 156 ? ? 3_555 2.10 
1774 1 CA  C ARG 101 ? ? 1_555 C   C ALA 255 ? ? 2_555 2.10 
1775 1 N   B HIS 132 ? ? 1_555 N   C VAL 225 ? ? 3_555 2.10 
1776 1 CA  A LEU 258 ? ? 1_555 CA  B SER 232 ? ? 2_555 2.10 
1777 1 OD1 B ASN 190 ? ? 1_555 C   C ASN 172 ? ? 3_555 2.10 
1778 1 CA  B LEU 224 ? ? 1_555 CD2 C LEU 242 ? ? 3_555 2.10 
1779 1 CD  B GLU 229 ? ? 1_555 CE  C MET 139 ? ? 3_555 2.10 
1780 1 N   B MET 92  ? ? 1_555 CB  C SER 122 ? ? 3_555 2.10 
1781 1 CD1 B LEU 90  ? ? 1_555 CB  C GLU 77  ? ? 3_555 2.10 
1782 1 CA  B PRO 93  ? ? 1_555 CA  C SER 122 ? ? 3_555 2.10 
1783 1 CG  B MET 133 ? ? 1_555 CD1 C LEU 224 ? ? 3_555 2.10 
1784 1 C   B VAL 147 ? ? 1_555 N   C VAL 91  ? ? 3_555 2.10 
1785 1 CB  B THR 184 ? ? 1_555 O   C THR 184 ? ? 3_555 2.10 
1786 1 CA  B VAL 237 ? ? 1_555 OE1 C GLN 149 ? ? 3_555 2.10 
1787 1 ND2 B ASN 152 ? ? 1_555 CB  C PRO 93  ? ? 3_555 2.10 
1788 1 OD2 B ASP 188 ? ? 1_555 CG1 C VAL 171 ? ? 3_555 2.10 
1789 1 CA  B ILE 185 ? ? 1_555 CB  C THR 118 ? ? 3_555 2.10 
1790 1 N   B LYS 154 ? ? 1_555 CB  C ALA 244 ? ? 3_555 2.10 
1791 1 SG  B CYS 123 ? ? 1_555 N   C ASN 152 ? ? 3_555 2.11 
1792 1 C   B VAL 96  ? ? 1_555 CG1 C VAL 161 ? ? 3_555 2.11 
1793 1 O   B GLY 134 ? ? 1_555 CB  C SER 75  ? ? 3_555 2.11 
1794 1 CG1 B VAL 157 ? ? 1_555 CA  C ILE 185 ? ? 3_555 2.11 
1795 1 CD1 B PHE 135 ? ? 1_555 CA  C TYR 243 ? ? 3_555 2.11 
1796 1 O   B LEU 153 ? ? 1_555 CB  C ALA 244 ? ? 3_555 2.11 
1797 1 CD1 B TYR 246 ? ? 1_555 CA  C GLU 163 ? ? 3_555 2.11 
1798 1 C   B ALA 114 ? ? 1_555 CG2 C THR 51  ? ? 3_555 2.11 
1799 1 O   B LEU 242 ? ? 1_555 C   C ILE 131 ? ? 3_555 2.11 
1800 1 CG2 B THR 95  ? ? 1_555 CB  C ASN 238 ? ? 3_555 2.11 
1801 1 C   B VAL 237 ? ? 1_555 N   C VAL 145 ? ? 3_555 2.11 
1802 1 CE  B MET 133 ? ? 1_555 CE  C MET 133 ? ? 3_555 2.11 
1803 1 N   B GLN 149 ? ? 1_555 CG  C MET 92  ? ? 3_555 2.11 
1804 1 CA  B LEU 90  ? ? 1_555 O   C GLY 240 ? ? 3_555 2.11 
1805 1 CD1 B TYR 119 ? ? 1_555 N   C VAL 157 ? ? 3_555 2.11 
1806 1 OG1 B THR 127 ? ? 1_555 ND2 C ASN 152 ? ? 3_555 2.11 
1807 1 CA  A PRO 253 ? ? 1_555 CD1 B TRP 162 ? ? 2_555 2.11 
1808 1 OG  B SER 151 ? ? 1_555 N   C MET 92  ? ? 3_555 2.11 
1809 1 CG2 B THR 87  ? ? 1_555 CG2 C THR 87  ? ? 3_555 2.11 
1810 1 CB  C ARG 101 ? ? 1_555 O   C ALA 255 ? ? 2_555 2.11 
1811 1 CG  C TRP 99  ? ? 1_555 O   C TRP 107 ? ? 2_555 2.11 
1812 1 CA  B ASP 188 ? ? 1_555 CA  C VAL 171 ? ? 3_555 2.11 
1813 1 CD  C ARG 101 ? ? 1_555 O   C ALA 256 ? ? 2_555 2.11 
1814 1 C   C LEU 60  ? ? 1_555 CB  C SER 62  ? ? 2_555 2.11 
1815 1 O   B LEU 150 ? ? 1_555 CG2 C VAL 96  ? ? 3_555 2.11 
1816 1 CA  B THR 239 ? ? 1_555 CB  C LEU 150 ? ? 3_555 2.11 
1817 1 CB  B THR 184 ? ? 1_555 CA  C THR 184 ? ? 3_555 2.11 
1818 1 CB  B THR 76  ? ? 1_555 CA  C MET 228 ? ? 3_555 2.11 
1819 1 N   B ASN 190 ? ? 1_555 N   C LYS 54  ? ? 3_555 2.12 
1820 1 CA  B SER 146 ? ? 1_555 CG  C LEU 90  ? ? 3_555 2.12 
1821 1 CG  B LEU 69  ? ? 1_555 CG  C PRO 46  ? ? 3_555 2.12 
1822 1 NE2 C HIS 71  ? ? 1_555 N   C ILE 251 ? ? 2_555 2.12 
1823 1 CA  B TYR 156 ? ? 1_555 CG1 C ILE 115 ? ? 3_555 2.12 
1824 1 O   B ILE 185 ? ? 1_555 O   C ILE 183 ? ? 3_555 2.12 
1825 1 CA  B VAL 91  ? ? 1_555 N   C ARG 241 ? ? 3_555 2.12 
1826 1 CG1 B VAL 147 ? ? 1_555 CA  C ARG 223 ? ? 3_555 2.12 
1827 1 CZ  B TYR 246 ? ? 1_555 CE3 C TRP 162 ? ? 3_555 2.12 
1828 1 O   B LEU 242 ? ? 1_555 O   C GLY 159 ? ? 3_555 2.12 
1829 1 ND1 B HIS 132 ? ? 1_555 C   C ARG 223 ? ? 3_555 2.12 
1830 1 C   B TRP 112 ? ? 1_555 C   C GLY 50  ? ? 3_555 2.12 
1831 1 CA  C GLY 102 ? ? 1_555 ND2 C ASN 106 ? ? 2_555 2.12 
1832 1 CB  B PRO 121 ? ? 1_555 C   C SER 151 ? ? 3_555 2.12 
1833 1 C   A ALA 255 ? ? 1_555 O   B THR 126 ? ? 2_555 2.12 
1834 1 C   B THR 189 ? ? 1_555 OD1 C ASN 172 ? ? 3_555 2.12 
1835 1 O   B TYR 119 ? ? 1_555 N   C VAL 157 ? ? 3_555 2.12 
1836 1 CH2 C TRP 99  ? ? 1_555 CG  C TRP 107 ? ? 2_555 2.12 
1837 1 CD1 B TYR 156 ? ? 1_555 CG1 C ILE 115 ? ? 3_555 2.12 
1838 1 C   B LYS 154 ? ? 1_555 CB  C ALA 244 ? ? 3_555 2.12 
1839 1 CB  B MET 228 ? ? 1_555 CG1 C VAL 225 ? ? 3_555 2.12 
1840 1 CH2 C TRP 99  ? ? 1_555 CZ3 C TRP 107 ? ? 2_555 2.12 
1841 1 N   B ASP 188 ? ? 1_555 CA  C VAL 171 ? ? 3_555 2.12 
1842 1 C   B TYR 117 ? ? 1_555 O   C ILE 183 ? ? 3_555 2.12 
1843 1 NH2 B ARG 116 ? ? 1_555 CE1 C PHE 170 ? ? 3_555 2.12 
1844 1 CA  B GLY 155 ? ? 1_555 OG  C SER 245 ? ? 3_555 2.12 
1845 1 CA  B PHE 135 ? ? 1_555 O   C LEU 242 ? ? 3_555 2.12 
1846 1 CE1 B TYR 119 ? ? 1_555 CB  C TYR 156 ? ? 3_555 2.12 
1847 1 OG  B SER 88  ? ? 1_555 O   C GLU 77  ? ? 3_555 2.12 
1848 1 N   C PRO 57  ? ? 1_555 CZ  C ARG 249 ? ? 2_555 2.12 
1849 1 C   B VAL 113 ? ? 1_555 CG2 C THR 51  ? ? 3_555 2.12 
1850 1 OE2 B GLU 77  ? ? 1_555 CB  C GLU 229 ? ? 3_555 2.12 
1851 1 O   B TYR 156 ? ? 1_555 CA  C ARG 116 ? ? 3_555 2.12 
1852 1 CD  B GLU 89  ? ? 1_555 O   C ALA 79  ? ? 3_555 2.12 
1853 1 CG  B MET 228 ? ? 1_555 N   C THR 226 ? ? 3_555 2.12 
1854 1 CG  B GLU 73  ? ? 1_555 NE1 C TRP 162 ? ? 3_555 2.12 
1855 1 NH2 B ARG 101 ? ? 1_555 CG1 C VAL 237 ? ? 3_555 2.12 
1856 1 OG1 B THR 158 ? ? 1_555 CE2 C PHE 135 ? ? 3_555 2.13 
1857 1 CE2 B PHE 170 ? ? 1_555 N   C SER 180 ? ? 3_555 2.13 
1858 1 CB  B TYR 243 ? ? 1_555 C   C THR 158 ? ? 3_555 2.13 
1859 1 CB  C HIS 71  ? ? 1_555 CD  C PRO 253 ? ? 2_555 2.13 
1860 1 N   B SER 151 ? ? 1_555 CG2 C VAL 96  ? ? 3_555 2.13 
1861 1 O   B LEU 187 ? ? 1_555 CB  C VAL 171 ? ? 3_555 2.13 
1862 1 CG  C ARG 101 ? ? 1_555 C   C ALA 256 ? ? 2_555 2.13 
1863 1 N   B VAL 86  ? ? 1_555 N   C SER 88  ? ? 3_555 2.13 
1864 1 N   B TYR 246 ? ? 1_555 CD  C GLN 49  ? ? 3_555 2.13 
1865 1 CG  B PRO 160 ? ? 1_555 CA  C LYS 154 ? ? 3_555 2.13 
1866 1 CA  B VAL 86  ? ? 1_555 O   C SER 88  ? ? 3_555 2.13 
1867 1 CA  C TRP 99  ? ? 1_555 CG2 C ILE 254 ? ? 2_555 2.13 
1868 1 C   B LEU 100 ? ? 1_555 CB  C PRO 124 ? ? 3_555 2.13 
1869 1 CE1 C HIS 71  ? ? 1_555 CB  C ILE 251 ? ? 2_555 2.13 
1870 1 O   B LEU 74  ? ? 1_555 N   C ALA 130 ? ? 3_555 2.13 
1871 1 CD2 B TYR 156 ? ? 1_555 OH  C TYR 117 ? ? 3_555 2.13 
1872 1 CB  B LEU 224 ? ? 1_555 N   C LEU 242 ? ? 3_555 2.13 
1873 1 N   A ILE 254 ? ? 1_555 O   B THR 127 ? ? 2_555 2.13 
1874 1 CD  B GLU 77  ? ? 1_555 CG  C GLU 229 ? ? 3_555 2.13 
1875 1 CD1 B TYR 137 ? ? 1_555 C   C GLU 73  ? ? 3_555 2.13 
1876 1 CA  B VAL 225 ? ? 1_555 CB  C THR 76  ? ? 3_555 2.13 
1877 1 CA  B ILE 115 ? ? 1_555 O   C GLY 164 ? ? 3_555 2.13 
1878 1 CZ2 C TRP 99  ? ? 1_555 CD2 C LEU 250 ? ? 2_555 2.13 
1879 1 CB  B VAL 80  ? ? 1_555 C   C LEU 143 ? ? 3_555 2.13 
1880 1 OG  B SER 151 ? ? 1_555 CA  C MET 92  ? ? 3_555 2.13 
1881 1 CB  B ILE 248 ? ? 1_555 C   C ALA 48  ? ? 3_555 2.13 
1882 1 CA  C PHE 94  ? ? 1_555 CB  C ALA 255 ? ? 2_555 2.14 
1883 1 O   B MET 92  ? ? 1_555 C   C THR 239 ? ? 3_555 2.14 
1884 1 O   B SER 70  ? ? 1_555 CG  C PRO 46  ? ? 3_555 2.14 
1885 1 O   B GLY 134 ? ? 1_555 CD2 C LEU 242 ? ? 3_555 2.14 
1886 1 ND2 B ASN 152 ? ? 1_555 CD  C PRO 93  ? ? 3_555 2.14 
1887 1 CD  B GLU 191 ? ? 1_555 O   C LEU 55  ? ? 3_555 2.14 
1888 1 C   B THR 98  ? ? 1_555 O   C THR 127 ? ? 3_555 2.14 
1889 1 O   B LEU 74  ? ? 1_555 CA  C ALA 130 ? ? 3_555 2.14 
1890 1 CB  B LYS 154 ? ? 1_555 C   C ALA 244 ? ? 3_555 2.14 
1891 1 O   B GLU 73  ? ? 1_555 CB  C PRO 160 ? ? 3_555 2.14 
1892 1 N   B ALA 244 ? ? 1_555 CD1 C ILE 183 ? ? 3_555 2.14 
1893 1 CA  B ILE 185 ? ? 1_555 OG1 C THR 184 ? ? 3_555 2.14 
1894 1 CB  B LEU 224 ? ? 1_555 CB  C LEU 242 ? ? 3_555 2.14 
1895 1 C   C ARG 56  ? ? 1_555 CG1 C ILE 251 ? ? 2_555 2.14 
1896 1 OE2 C GLU 73  ? ? 1_555 O   C PRO 253 ? ? 2_555 2.14 
1897 1 O   B GLY 230 ? ? 1_555 OD1 C ASP 141 ? ? 3_555 2.14 
1898 1 CA  B LEU 224 ? ? 1_555 N   C LEU 242 ? ? 3_555 2.14 
1899 1 CB  B THR 239 ? ? 1_555 CB  C LEU 150 ? ? 3_555 2.14 
1900 1 O   C MET 59  ? ? 1_555 OG  C SER 62  ? ? 2_555 2.15 
1901 1 N   B GLU 229 ? ? 1_555 CD  C ARG 223 ? ? 3_555 2.15 
1902 1 N   B PHE 170 ? ? 1_555 C   C SER 180 ? ? 3_555 2.15 
1903 1 OE1 C GLU 73  ? ? 1_555 CB  C ILE 254 ? ? 2_555 2.15 
1904 1 CG2 B VAL 192 ? ? 1_555 C   C VAL 53  ? ? 3_555 2.15 
1905 1 C   B ALA 236 ? ? 1_555 CG1 C VAL 145 ? ? 3_555 2.15 
1906 1 CB  B LEU 242 ? ? 1_555 O   C ILE 131 ? ? 3_555 2.15 
1907 1 N   B CYS 72  ? ? 1_555 OE2 C GLU 163 ? ? 3_555 2.15 
1908 1 N   B ILE 115 ? ? 1_555 CA  C GLN 165 ? ? 3_555 2.15 
1909 1 N   B TYR 119 ? ? 1_555 N   C THR 158 ? ? 3_555 2.15 
1910 1 OH  B TYR 246 ? ? 1_555 CG2 C THR 125 ? ? 3_555 2.15 
1911 1 CZ3 C TRP 99  ? ? 1_555 CZ2 C TRP 107 ? ? 2_555 2.15 
1912 1 CB  B TRP 112 ? ? 1_555 CA  C THR 51  ? ? 3_555 2.15 
1913 1 CG2 B VAL 157 ? ? 1_555 N   C TYR 117 ? ? 3_555 2.15 
1914 1 CG2 B VAL 157 ? ? 1_555 C   C ILE 185 ? ? 3_555 2.15 
1915 1 O   B VAL 96  ? ? 1_555 C   C VAL 161 ? ? 3_555 2.15 
1916 1 CD2 B TYR 137 ? ? 1_555 CE2 C TYR 243 ? ? 3_555 2.15 
1917 1 O   B GLN 149 ? ? 1_555 O   C MET 92  ? ? 3_555 2.15 
1918 1 C   B THR 247 ? ? 1_555 NE2 C GLN 165 ? ? 3_555 2.15 
1919 1 NH1 B ARG 181 ? ? 1_555 O   A HOH 272 ? ? 3_555 2.15 
1920 1 CG2 B VAL 96  ? ? 1_555 CA  C GLY 240 ? ? 3_555 2.15 
1921 1 N   B ILE 185 ? ? 1_555 N   C THR 184 ? ? 3_555 2.15 
1922 1 C   B GLY 240 ? ? 1_555 ND1 C HIS 132 ? ? 3_555 2.15 
1923 1 CA  B VAL 237 ? ? 1_555 CG2 C VAL 145 ? ? 3_555 2.15 
1924 1 N   B SER 75  ? ? 1_555 C   C ALA 130 ? ? 3_555 2.15 
1925 1 OE1 B GLU 191 ? ? 1_555 CA  C LEU 55  ? ? 3_555 2.15 
1926 1 CB  B ALA 79  ? ? 1_555 C   C VAL 145 ? ? 3_555 2.15 
1927 1 C   C MET 59  ? ? 1_555 CA  C SER 62  ? ? 2_555 2.15 
1928 1 CA  B TRP 162 ? ? 1_555 N   C ASN 152 ? ? 3_555 2.15 
1929 1 CD2 B TYR 117 ? ? 1_555 C   C TYR 119 ? ? 3_555 2.15 
1930 1 CD2 B TRP 112 ? ? 1_555 O   C PRO 121 ? ? 3_555 2.15 
1931 1 CA  B TRP 112 ? ? 1_555 OG1 C THR 51  ? ? 3_555 2.15 
1932 1 CA  B ASN 152 ? ? 1_555 CB  C VAL 96  ? ? 3_555 2.15 
1933 1 CD1 B LEU 90  ? ? 1_555 CG  C GLU 77  ? ? 3_555 2.16 
1934 1 C   B GLN 136 ? ? 1_555 C   C LEU 74  ? ? 3_555 2.16 
1935 1 N   B GLY 240 ? ? 1_555 O   C VAL 147 ? ? 3_555 2.16 
1936 1 CG2 B VAL 80  ? ? 1_555 CG  C PRO 144 ? ? 3_555 2.16 
1937 1 O   C CYS 72  ? ? 1_555 CA  C GLU 252 ? ? 2_555 2.16 
1938 1 O   C GLY 97  ? ? 1_555 CB  C ILE 254 ? ? 2_555 2.16 
1939 1 O   B LYS 154 ? ? 1_555 O   C ALA 244 ? ? 3_555 2.16 
1940 1 N   A ALA 255 ? ? 1_555 N   B THR 127 ? ? 2_555 2.16 
1941 1 N   B LEU 224 ? ? 1_555 N   C LEU 242 ? ? 3_555 2.16 
1942 1 ND2 B ASN 152 ? ? 1_555 C   C MET 92  ? ? 3_555 2.16 
1943 1 CG2 B VAL 192 ? ? 1_555 O   C VAL 53  ? ? 3_555 2.16 
1944 1 N   B VAL 157 ? ? 1_555 CD1 C TYR 117 ? ? 3_555 2.16 
1945 1 O   B VAL 96  ? ? 1_555 CG2 C THR 239 ? ? 3_555 2.16 
1946 1 CA  B SER 75  ? ? 1_555 CG2 C VAL 161 ? ? 3_555 2.16 
1947 1 O   C CYS 72  ? ? 1_555 CG  C GLU 252 ? ? 2_555 2.16 
1948 1 CE1 C PHE 94  ? ? 1_555 CB  C ALA 257 ? ? 2_555 2.16 
1949 1 NH2 C ARG 101 ? ? 1_555 CD2 C LEU 258 ? ? 2_555 2.16 
1950 1 CB  B ALA 227 ? ? 1_555 C   C SER 88  ? ? 3_555 2.16 
1951 1 CG  B LEU 224 ? ? 1_555 CG  C LEU 242 ? ? 3_555 2.16 
1952 1 CD2 B LEU 74  ? ? 1_555 N   C ALA 130 ? ? 3_555 2.16 
1953 1 CA  B THR 81  ? ? 1_555 C   C THR 142 ? ? 3_555 2.16 
1954 1 O   B ARG 223 ? ? 1_555 CD1 C LEU 74  ? ? 3_555 2.16 
1955 1 C   B TYR 243 ? ? 1_555 CA  C GLY 159 ? ? 3_555 2.16 
1956 1 CG2 B VAL 103 ? ? 1_555 CD1 C ILE 47  ? ? 3_555 2.17 
1957 1 CD1 C TRP 99  ? ? 1_555 C   C TRP 107 ? ? 2_555 2.17 
1958 1 O   B ALA 111 ? ? 1_555 C   C GLY 50  ? ? 3_555 2.17 
1959 1 CB  B GLU 229 ? ? 1_555 NH1 C ARG 223 ? ? 3_555 2.17 
1960 1 CD2 B LEU 250 ? ? 1_555 CB  C ALA 48  ? ? 3_555 2.17 
1961 1 CB  B GLU 191 ? ? 1_555 CD2 C LEU 55  ? ? 3_555 2.17 
1962 1 C   B ALA 244 ? ? 1_555 C   C GLU 163 ? ? 3_555 2.17 
1963 1 C   C PRO 57  ? ? 1_555 CA  C VAL 66  ? ? 2_555 2.17 
1964 1 CB  B LEU 69  ? ? 1_555 O   C ALA 48  ? ? 3_555 2.17 
1965 1 N   B MET 228 ? ? 1_555 CA  C SER 88  ? ? 3_555 2.17 
1966 1 C   B ASN 148 ? ? 1_555 C   C MET 92  ? ? 3_555 2.17 
1967 1 N   B VAL 96  ? ? 1_555 CB  C THR 239 ? ? 3_555 2.17 
1968 1 N   B LEU 74  ? ? 1_555 CB  C PRO 160 ? ? 3_555 2.17 
1969 1 C   B TRP 99  ? ? 1_555 C   C THR 126 ? ? 3_555 2.17 
1970 1 ND2 B ASN 238 ? ? 1_555 C   C VAL 145 ? ? 3_555 2.17 
1971 1 CD2 C LEU 55  ? ? 1_555 OE2 C GLU 252 ? ? 2_555 2.17 
1972 1 OG1 B THR 76  ? ? 1_555 C   C MET 228 ? ? 3_555 2.17 
1973 1 C   B GLU 73  ? ? 1_555 CG  C PRO 160 ? ? 3_555 2.17 
1974 1 CA  B ALA 114 ? ? 1_555 O   C GLN 165 ? ? 3_555 2.17 
1975 1 O   B VAL 96  ? ? 1_555 CG1 C VAL 161 ? ? 3_555 2.17 
1976 1 C   B ALA 130 ? ? 1_555 C   C PHE 135 ? ? 3_555 2.17 
1977 1 C   B ILE 115 ? ? 1_555 C   C GLY 164 ? ? 3_555 2.17 
1978 1 N   B ILE 185 ? ? 1_555 C   C THR 184 ? ? 3_555 2.17 
1979 1 CG2 B THR 239 ? ? 1_555 CB  C PRO 144 ? ? 3_555 2.17 
1980 1 C   B MET 92  ? ? 1_555 O   C THR 239 ? ? 3_555 2.17 
1981 1 N   B ALA 186 ? ? 1_555 CA  C THR 118 ? ? 3_555 2.17 
1982 1 C   B GLU 77  ? ? 1_555 CB  C ALA 227 ? ? 3_555 2.17 
1983 1 NE1 C TRP 99  ? ? 1_555 CB  C TRP 107 ? ? 2_555 2.18 
1984 1 CA  B ALA 130 ? ? 1_555 CA  C GLN 136 ? ? 3_555 2.18 
1985 1 N   B TYR 117 ? ? 1_555 CB  C ILE 183 ? ? 3_555 2.18 
1986 1 N   B SER 245 ? ? 1_555 CA  C GLU 163 ? ? 3_555 2.18 
1987 1 O   B LEU 90  ? ? 1_555 CA  C GLY 240 ? ? 3_555 2.18 
1988 1 NE  B ARG 116 ? ? 1_555 CA  C ALA 182 ? ? 3_555 2.18 
1989 1 C   B THR 189 ? ? 1_555 C   C VAL 53  ? ? 3_555 2.18 
1990 1 CA  B ALA 79  ? ? 1_555 O   C PRO 144 ? ? 3_555 2.18 
1991 1 N   B ILE 185 ? ? 1_555 OG1 C THR 184 ? ? 3_555 2.18 
1992 1 CG  B LYS 154 ? ? 1_555 C   C CYS 72  ? ? 3_555 2.18 
1993 1 C   B THR 184 ? ? 1_555 O   C THR 184 ? ? 3_555 2.18 
1994 1 O   B THR 239 ? ? 1_555 C   C LEU 150 ? ? 3_555 2.18 
1995 1 CG1 B VAL 237 ? ? 1_555 CB  C GLN 149 ? ? 3_555 2.18 
1996 1 CG2 B VAL 96  ? ? 1_555 N   C GLY 240 ? ? 3_555 2.18 
1997 1 N   B VAL 80  ? ? 1_555 CD  C PRO 144 ? ? 3_555 2.18 
1998 1 CG  B MET 228 ? ? 1_555 CA  C VAL 225 ? ? 3_555 2.18 
1999 1 CD1 B LEU 153 ? ? 1_555 CA  C VAL 96  ? ? 3_555 2.18 
2000 1 CG  B ASN 152 ? ? 1_555 O   C PRO 93  ? ? 3_555 2.18 
2001 1 CZ  B TYR 137 ? ? 1_555 C   C GLU 73  ? ? 3_555 2.18 
2002 1 C   B PHE 135 ? ? 1_555 O   C LEU 74  ? ? 3_555 2.18 
2003 1 CA  B THR 184 ? ? 1_555 N   C ILE 185 ? ? 3_555 2.18 
2004 1 CD  B PRO 93  ? ? 1_555 OG  C SER 122 ? ? 3_555 2.18 
2005 1 N   B VAL 96  ? ? 1_555 SG  C CYS 123 ? ? 3_555 2.18 
2006 1 O   B GLU 89  ? ? 1_555 CA  C GLU 77  ? ? 3_555 2.18 
2007 1 C   B LYS 154 ? ? 1_555 N   C ALA 244 ? ? 3_555 2.18 
2008 1 N   B HIS 71  ? ? 1_555 OE1 C GLN 49  ? ? 3_555 2.18 
2009 1 CG2 B VAL 161 ? ? 1_555 CG  C LEU 153 ? ? 3_555 2.18 
2010 1 O   B VAL 147 ? ? 1_555 C   C VAL 91  ? ? 3_555 2.18 
2011 1 CD1 B ILE 185 ? ? 1_555 C   C TYR 117 ? ? 3_555 2.18 
2012 1 CG  B LEU 224 ? ? 1_555 CB  C LEU 242 ? ? 3_555 2.18 
2013 1 O   B SER 146 ? ? 1_555 CG2 C THR 95  ? ? 3_555 2.18 
2014 1 CG2 B THR 247 ? ? 1_555 NE2 C GLN 165 ? ? 3_555 2.18 
2015 1 O   B ALA 79  ? ? 1_555 O   C PRO 144 ? ? 3_555 2.19 
2016 1 N   B TYR 246 ? ? 1_555 OE1 C GLN 49  ? ? 3_555 2.19 
2017 1 C   B GLN 136 ? ? 1_555 O   C LEU 74  ? ? 3_555 2.19 
2018 1 CZ  B TYR 137 ? ? 1_555 CD2 C TYR 243 ? ? 3_555 2.19 
2019 1 CB  B ILE 115 ? ? 1_555 CD  C PRO 121 ? ? 3_555 2.19 
2020 1 OD1 B ASP 188 ? ? 1_555 CG  C LEU 55  ? ? 3_555 2.19 
2021 1 CB  B ASN 190 ? ? 1_555 ND2 C ASN 172 ? ? 3_555 2.19 
2022 1 N   B TYR 246 ? ? 1_555 N   C GLY 164 ? ? 3_555 2.19 
2023 1 CB  C VAL 103 ? ? 1_555 CB  C ASN 106 ? ? 2_555 2.19 
2024 1 OG1 B THR 118 ? ? 1_555 N   C ILE 183 ? ? 3_555 2.19 
2025 1 O   B VAL 80  ? ? 1_555 CA  C PRO 144 ? ? 3_555 2.19 
2026 1 N   B VAL 237 ? ? 1_555 NE2 C GLN 149 ? ? 3_555 2.19 
2027 1 CB  B PHE 135 ? ? 1_555 O   C LEU 242 ? ? 3_555 2.19 
2028 1 N   B HIS 132 ? ? 1_555 CG  C LEU 224 ? ? 3_555 2.19 
2029 1 CD2 B PHE 170 ? ? 1_555 CA  C SER 180 ? ? 3_555 2.19 
2030 1 O   B HIS 71  ? ? 1_555 OE2 C GLU 163 ? ? 3_555 2.19 
2031 1 CG  B ARG 116 ? ? 1_555 CA  C ALA 182 ? ? 3_555 2.19 
2032 1 CB  A ILE 254 ? ? 1_555 O   B THR 127 ? ? 2_555 2.19 
2033 1 N   C THR 98  ? ? 1_555 CA  C ILE 254 ? ? 2_555 2.19 
2034 1 C   B VAL 161 ? ? 1_555 CB  C LEU 153 ? ? 3_555 2.19 
2035 1 CG1 B ILE 248 ? ? 1_555 C   C GLN 49  ? ? 3_555 2.19 
2036 1 OE1 B GLU 191 ? ? 1_555 CA  C ARG 56  ? ? 3_555 2.19 
2037 1 CG  B TYR 243 ? ? 1_555 C   C THR 158 ? ? 3_555 2.19 
2038 1 CA  B TRP 162 ? ? 1_555 CB  C ASN 152 ? ? 3_555 2.19 
2039 1 CA  B PRO 121 ? ? 1_555 CD1 C TYR 156 ? ? 3_555 2.19 
2040 1 N   C PRO 58  ? ? 1_555 C   C LEU 250 ? ? 2_555 2.19 
2041 1 CG  B LEU 224 ? ? 1_555 CD1 C LEU 242 ? ? 3_555 2.19 
2042 1 CG2 B ILE 248 ? ? 1_555 CA  C ALA 48  ? ? 3_555 2.19 
2043 1 C   B PRO 93  ? ? 1_555 C   C SER 122 ? ? 3_555 2.19 
2044 1 NE  C ARG 101 ? ? 1_555 O   C ALA 255 ? ? 2_555 2.19 
2045 1 CE2 B TYR 117 ? ? 1_555 CB  C TYR 119 ? ? 3_555 2.19 
2046 1 CB  B SER 151 ? ? 1_555 CG1 C VAL 91  ? ? 3_555 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 N  A GLY 155 ? ? CA A GLY 155 ? ? 1.569 1.456 0.113  0.015 N 
2  1 CA A CYS 169 ? ? CB A CYS 169 ? ? 1.428 1.526 -0.098 0.013 N 
3  1 CB A GLU 194 ? ? CG A GLU 194 ? ? 1.636 1.517 0.119  0.019 N 
4  1 N  A GLY 230 ? ? CA A GLY 230 ? ? 1.581 1.456 0.125  0.015 N 
5  1 N  A GLU 252 ? ? CA A GLU 252 ? ? 1.598 1.459 0.139  0.020 N 
6  1 N  B GLY 231 ? ? CA B GLY 231 ? ? 1.323 1.456 -0.133 0.015 N 
7  1 C  B ILE 251 ? ? O  B ILE 251 ? ? 1.355 1.229 0.126  0.019 N 
8  1 N  C GLY 155 ? ? CA C GLY 155 ? ? 1.593 1.456 0.137  0.015 N 
9  1 N  C GLY 231 ? ? CA C GLY 231 ? ? 1.324 1.456 -0.132 0.015 N 
10 1 CA C GLY 231 ? ? C  C GLY 231 ? ? 1.408 1.514 -0.106 0.016 N 
11 1 C  C GLY 231 ? ? O  C GLY 231 ? ? 1.329 1.232 0.097  0.016 N 
12 1 C  C ILE 251 ? ? O  C ILE 251 ? ? 1.357 1.229 0.128  0.019 N 
13 1 N  C GLU 252 ? ? CA C GLU 252 ? ? 1.664 1.459 0.205  0.020 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 CA  A LEU 69  ? ? C   A LEU 69  ? ? N   A SER 70  ? ? 103.47 117.20 -13.73 2.20 Y 
2   1 O   A LEU 69  ? ? C   A LEU 69  ? ? N   A SER 70  ? ? 136.18 122.70 13.48  1.60 Y 
3   1 CA  A CYS 72  ? ? CB  A CYS 72  ? ? SG  A CYS 72  ? ? 102.94 114.00 -11.06 1.80 N 
4   1 O   A LEU 78  ? ? C   A LEU 78  ? ? N   A ALA 79  ? ? 132.72 122.70 10.02  1.60 Y 
5   1 CB  A VAL 80  ? ? CA  A VAL 80  ? ? C   A VAL 80  ? ? 96.25  111.40 -15.15 1.90 N 
6   1 CD  A ARG 101 ? ? NE  A ARG 101 ? ? CZ  A ARG 101 ? ? 133.68 123.60 10.08  1.40 N 
7   1 NE  A ARG 101 ? ? CZ  A ARG 101 ? ? NH1 A ARG 101 ? ? 125.90 120.30 5.60   0.50 N 
8   1 CA  A LYS 109 ? ? CB  A LYS 109 ? ? CG  A LYS 109 ? ? 169.98 113.40 56.58  2.20 N 
9   1 N   A ALA 111 ? ? CA  A ALA 111 ? ? CB  A ALA 111 ? ? 120.36 110.10 10.26  1.40 N 
10  1 NE  A ARG 116 ? ? CZ  A ARG 116 ? ? NH2 A ARG 116 ? ? 117.09 120.30 -3.21  0.50 N 
11  1 CB  A CYS 123 ? ? CA  A CYS 123 ? ? C   A CYS 123 ? ? 93.13  110.40 -17.27 2.00 N 
12  1 CB  A THR 125 ? ? CA  A THR 125 ? ? C   A THR 125 ? ? 94.75  111.60 -16.85 2.70 N 
13  1 N   A THR 125 ? ? CA  A THR 125 ? ? CB  A THR 125 ? ? 144.08 110.30 33.78  1.90 N 
14  1 O   A MET 133 ? ? C   A MET 133 ? ? N   A GLY 134 ? ? 133.72 123.20 10.52  1.70 Y 
15  1 CB  A GLN 136 ? ? CA  A GLN 136 ? ? C   A GLN 136 ? ? 123.78 110.40 13.38  2.00 N 
16  1 CB  A TYR 137 ? ? CG  A TYR 137 ? ? CD2 A TYR 137 ? ? 117.36 121.00 -3.64  0.60 N 
17  1 CB  A ASP 138 ? ? CG  A ASP 138 ? ? OD2 A ASP 138 ? ? 110.73 118.30 -7.57  0.90 N 
18  1 N   A SER 146 ? ? CA  A SER 146 ? ? CB  A SER 146 ? ? 97.97  110.50 -12.53 1.50 N 
19  1 CB  A LEU 153 ? ? CA  A LEU 153 ? ? C   A LEU 153 ? ? 122.98 110.20 12.78  1.90 N 
20  1 CA  A LYS 154 ? ? C   A LYS 154 ? ? N   A GLY 155 ? ? 128.93 116.20 12.73  2.00 Y 
21  1 CA  A LEU 168 ? ? CB  A LEU 168 ? ? CG  A LEU 168 ? ? 131.01 115.30 15.71  2.30 N 
22  1 CA  A LEU 168 ? ? C   A LEU 168 ? ? O   A LEU 168 ? ? 99.01  120.10 -21.09 2.10 N 
23  1 CA  A LEU 168 ? ? C   A LEU 168 ? ? N   A CYS 169 ? ? 140.53 117.20 23.33  2.20 Y 
24  1 CA  A CYS 169 ? ? CB  A CYS 169 ? ? SG  A CYS 169 ? ? 131.83 114.20 17.63  1.10 N 
25  1 O   A CYS 169 ? ? C   A CYS 169 ? ? N   A PHE 170 ? ? 132.44 122.70 9.74   1.60 Y 
26  1 CB  A PHE 170 ? ? CA  A PHE 170 ? ? C   A PHE 170 ? ? 124.24 110.40 13.84  2.00 N 
27  1 CA  A THR 174 ? ? CB  A THR 174 ? ? CG2 A THR 174 ? ? 120.87 112.40 8.47   1.40 N 
28  1 N   A LYS 175 ? ? CA  A LYS 175 ? ? CB  A LYS 175 ? ? 123.65 110.60 13.05  1.80 N 
29  1 CA  A CYS 176 ? ? CB  A CYS 176 ? ? SG  A CYS 176 ? ? 132.53 114.20 18.33  1.10 N 
30  1 CB  A ASP 178 ? ? CA  A ASP 178 ? ? C   A ASP 178 ? ? 127.37 110.40 16.97  2.00 N 
31  1 CA  A ASP 178 ? ? CB  A ASP 178 ? ? CG  A ASP 178 ? ? 127.33 113.40 13.93  2.20 N 
32  1 CA  A ASP 178 ? ? C   A ASP 178 ? ? O   A ASP 178 ? ? 134.16 120.10 14.06  2.10 N 
33  1 C   A ASP 178 ? ? N   A THR 179 ? ? CA  A THR 179 ? ? 147.16 121.70 25.46  2.50 Y 
34  1 CA  A THR 179 ? ? C   A THR 179 ? ? N   A SER 180 ? ? 101.83 117.20 -15.37 2.20 Y 
35  1 NE  A ARG 181 ? ? CZ  A ARG 181 ? ? NH1 A ARG 181 ? ? 126.03 120.30 5.73   0.50 N 
36  1 NE  A ARG 181 ? ? CZ  A ARG 181 ? ? NH2 A ARG 181 ? ? 115.87 120.30 -4.43  0.50 N 
37  1 O   A ALA 182 ? ? C   A ALA 182 ? ? N   A ILE 183 ? ? 132.33 122.70 9.63   1.60 Y 
38  1 CB  A ASN 190 ? ? CA  A ASN 190 ? ? C   A ASN 190 ? ? 94.82  110.40 -15.58 2.00 N 
39  1 CA  A GLU 191 ? ? CB  A GLU 191 ? ? CG  A GLU 191 ? ? 135.19 113.40 21.79  2.20 N 
40  1 CG  A GLU 194 ? ? CD  A GLU 194 ? ? OE2 A GLU 194 ? ? 105.49 118.30 -12.81 2.00 N 
41  1 CD  A ARG 196 ? ? NE  A ARG 196 ? ? CZ  A ARG 196 ? ? 141.25 123.60 17.65  1.40 N 
42  1 NE  A ARG 196 ? ? CZ  A ARG 196 ? ? NH1 A ARG 196 ? ? 135.95 120.30 15.65  0.50 N 
43  1 NE  A ARG 196 ? ? CZ  A ARG 196 ? ? NH2 A ARG 196 ? ? 110.87 120.30 -9.43  0.50 N 
44  1 CB  A ASP 204 ? ? CG  A ASP 204 ? ? OD1 A ASP 204 ? ? 125.84 118.30 7.54   0.90 N 
45  1 CB  A ILE 218 ? ? CA  A ILE 218 ? ? C   A ILE 218 ? ? 95.00  111.60 -16.60 2.00 N 
46  1 CD  A ARG 223 ? ? NE  A ARG 223 ? ? CZ  A ARG 223 ? ? 106.06 123.60 -17.54 1.40 N 
47  1 CA  A THR 235 ? ? CB  A THR 235 ? ? OG1 A THR 235 ? ? 96.37  109.00 -12.63 2.10 N 
48  1 NE  A ARG 241 ? ? CZ  A ARG 241 ? ? NH1 A ARG 241 ? ? 115.46 120.30 -4.84  0.50 N 
49  1 NE  A ARG 249 ? ? CZ  A ARG 249 ? ? NH1 A ARG 249 ? ? 117.06 120.30 -3.24  0.50 N 
50  1 NE  A ARG 249 ? ? CZ  A ARG 249 ? ? NH2 A ARG 249 ? ? 124.49 120.30 4.19   0.50 N 
51  1 CA  A ILE 251 ? ? C   A ILE 251 ? ? O   A ILE 251 ? ? 105.58 120.10 -14.52 2.10 N 
52  1 CA  A ILE 251 ? ? C   A ILE 251 ? ? N   A GLU 252 ? ? 134.21 117.20 17.01  2.20 Y 
53  1 CB  A GLU 252 ? ? CA  A GLU 252 ? ? C   A GLU 252 ? ? 124.65 110.40 14.25  2.00 N 
54  1 CG  A GLU 252 ? ? CD  A GLU 252 ? ? OE1 A GLU 252 ? ? 131.82 118.30 13.52  2.00 N 
55  1 N   A LEU 258 ? ? CA  A LEU 258 ? ? CB  A LEU 258 ? ? 97.04  110.40 -13.36 2.00 N 
56  1 O   B ILE 68  ? ? C   B ILE 68  ? ? N   B LEU 69  ? ? 132.66 122.70 9.96   1.60 Y 
57  1 CA  B CYS 72  ? ? CB  B CYS 72  ? ? SG  B CYS 72  ? ? 96.44  114.00 -17.56 1.80 N 
58  1 N   B LEU 74  ? ? CA  B LEU 74  ? ? CB  B LEU 74  ? ? 131.90 110.40 21.50  2.00 N 
59  1 O   B LEU 74  ? ? C   B LEU 74  ? ? N   B SER 75  ? ? 137.53 122.70 14.83  1.60 Y 
60  1 OE1 B GLU 89  ? ? CD  B GLU 89  ? ? OE2 B GLU 89  ? ? 115.87 123.30 -7.43  1.20 N 
61  1 CA  B LEU 90  ? ? CB  B LEU 90  ? ? CG  B LEU 90  ? ? 137.88 115.30 22.58  2.30 N 
62  1 CA  B MET 92  ? ? CB  B MET 92  ? ? CG  B MET 92  ? ? 124.96 113.30 11.66  1.70 N 
63  1 CB  B VAL 96  ? ? CA  B VAL 96  ? ? C   B VAL 96  ? ? 123.07 111.40 11.67  1.90 N 
64  1 CA  B VAL 96  ? ? CB  B VAL 96  ? ? CG1 B VAL 96  ? ? 120.58 110.90 9.68   1.50 N 
65  1 CG  B ARG 101 ? ? CD  B ARG 101 ? ? NE  B ARG 101 ? ? 131.37 111.80 19.57  2.10 N 
66  1 CA  B GLN 105 ? ? CB  B GLN 105 ? ? CG  B GLN 105 ? ? 127.77 113.40 14.37  2.20 N 
67  1 CA  B ILE 115 ? ? CB  B ILE 115 ? ? CG1 B ILE 115 ? ? 98.17  111.00 -12.83 1.90 N 
68  1 CB  B TYR 117 ? ? CG  B TYR 117 ? ? CD2 B TYR 117 ? ? 117.23 121.00 -3.77  0.60 N 
69  1 CB  B ALA 130 ? ? CA  B ALA 130 ? ? C   B ALA 130 ? ? 99.99  110.10 -10.11 1.50 N 
70  1 CA  B ASP 138 ? ? CB  B ASP 138 ? ? CG  B ASP 138 ? ? 127.20 113.40 13.80  2.20 N 
71  1 N   B ASP 138 ? ? CA  B ASP 138 ? ? C   B ASP 138 ? ? 93.65  111.00 -17.35 2.70 N 
72  1 O   B ASP 138 ? ? C   B ASP 138 ? ? N   B MET 139 ? ? 136.95 122.70 14.25  1.60 Y 
73  1 CA  B MET 139 ? ? CB  B MET 139 ? ? CG  B MET 139 ? ? 101.30 113.30 -12.00 1.70 N 
74  1 CB  B ASP 141 ? ? CA  B ASP 141 ? ? C   B ASP 141 ? ? 124.45 110.40 14.05  2.00 N 
75  1 C   B VAL 145 ? ? N   B SER 146 ? ? CA  B SER 146 ? ? 137.71 121.70 16.01  2.50 Y 
76  1 CA  B LEU 150 ? ? CB  B LEU 150 ? ? CG  B LEU 150 ? ? 131.34 115.30 16.04  2.30 N 
77  1 O   B THR 158 ? ? C   B THR 158 ? ? N   B GLY 159 ? ? 135.88 123.20 12.68  1.70 Y 
78  1 CG  B GLU 163 ? ? CD  B GLU 163 ? ? OE2 B GLU 163 ? ? 101.78 118.30 -16.52 2.00 N 
79  1 CA  B GLN 165 ? ? CB  B GLN 165 ? ? CG  B GLN 165 ? ? 96.20  113.40 -17.20 2.20 N 
80  1 O   B SER 166 ? ? C   B SER 166 ? ? N   B GLY 167 ? ? 133.78 123.20 10.58  1.70 Y 
81  1 CA  B LEU 168 ? ? CB  B LEU 168 ? ? CG  B LEU 168 ? ? 129.94 115.30 14.64  2.30 N 
82  1 CA  B CYS 169 ? ? CB  B CYS 169 ? ? SG  B CYS 169 ? ? 101.88 114.00 -12.12 1.80 N 
83  1 CA  B CYS 176 ? ? CB  B CYS 176 ? ? SG  B CYS 176 ? ? 99.51  114.00 -14.49 1.80 N 
84  1 CB  B ILE 185 ? ? CG1 B ILE 185 ? ? CD1 B ILE 185 ? ? 132.91 113.90 19.01  2.80 N 
85  1 CG  B GLU 191 ? ? CD  B GLU 191 ? ? OE1 B GLU 191 ? ? 131.96 118.30 13.66  2.00 N 
86  1 CD  B LYS 195 ? ? CE  B LYS 195 ? ? NZ  B LYS 195 ? ? 126.16 111.70 14.46  2.30 N 
87  1 NE  B ARG 196 ? ? CZ  B ARG 196 ? ? NH1 B ARG 196 ? ? 124.17 120.30 3.87   0.50 N 
88  1 NH1 B ARG 223 ? ? CZ  B ARG 223 ? ? NH2 B ARG 223 ? ? 128.16 119.40 8.76   1.10 N 
89  1 NE  B ARG 223 ? ? CZ  B ARG 223 ? ? NH1 B ARG 223 ? ? 116.25 120.30 -4.05  0.50 N 
90  1 NE  B ARG 223 ? ? CZ  B ARG 223 ? ? NH2 B ARG 223 ? ? 115.59 120.30 -4.71  0.50 N 
91  1 C   B GLY 230 ? ? N   B GLY 231 ? ? CA  B GLY 231 ? ? 139.19 122.30 16.89  2.10 Y 
92  1 N   B GLY 231 ? ? CA  B GLY 231 ? ? C   B GLY 231 ? ? 145.43 113.10 32.33  2.50 N 
93  1 CD  B ARG 241 ? ? NE  B ARG 241 ? ? CZ  B ARG 241 ? ? 113.79 123.60 -9.81  1.40 N 
94  1 NE  B ARG 241 ? ? CZ  B ARG 241 ? ? NH1 B ARG 241 ? ? 123.82 120.30 3.52   0.50 N 
95  1 NE  B ARG 241 ? ? CZ  B ARG 241 ? ? NH2 B ARG 241 ? ? 111.56 120.30 -8.74  0.50 N 
96  1 CB  B TYR 243 ? ? CG  B TYR 243 ? ? CD2 B TYR 243 ? ? 116.91 121.00 -4.09  0.60 N 
97  1 CB  B TYR 246 ? ? CG  B TYR 246 ? ? CD2 B TYR 246 ? ? 125.75 121.00 4.75   0.60 N 
98  1 CB  B TYR 246 ? ? CG  B TYR 246 ? ? CD1 B TYR 246 ? ? 116.87 121.00 -4.13  0.60 N 
99  1 CA  B ILE 251 ? ? CB  B ILE 251 ? ? CG1 B ILE 251 ? ? 99.19  111.00 -11.81 1.90 N 
100 1 N   B ILE 251 ? ? CA  B ILE 251 ? ? C   B ILE 251 ? ? 131.91 111.00 20.91  2.70 N 
101 1 CA  B ILE 251 ? ? C   B ILE 251 ? ? O   B ILE 251 ? ? 98.52  120.10 -21.58 2.10 N 
102 1 CA  B ILE 251 ? ? C   B ILE 251 ? ? N   B GLU 252 ? ? 142.15 117.20 24.95  2.20 Y 
103 1 CA  B GLU 252 ? ? CB  B GLU 252 ? ? CG  B GLU 252 ? ? 129.46 113.40 16.06  2.20 N 
104 1 OE1 B GLU 252 ? ? CD  B GLU 252 ? ? OE2 B GLU 252 ? ? 109.36 123.30 -13.94 1.20 N 
105 1 CG  B GLU 252 ? ? CD  B GLU 252 ? ? OE1 B GLU 252 ? ? 134.20 118.30 15.90  2.00 N 
106 1 N   B GLU 252 ? ? CA  B GLU 252 ? ? C   B GLU 252 ? ? 92.60  111.00 -18.40 2.70 N 
107 1 CD  C ARG 56  ? ? NE  C ARG 56  ? ? CZ  C ARG 56  ? ? 133.20 123.60 9.60   1.40 N 
108 1 NE  C ARG 56  ? ? CZ  C ARG 56  ? ? NH1 C ARG 56  ? ? 126.90 120.30 6.60   0.50 N 
109 1 NE  C ARG 56  ? ? CZ  C ARG 56  ? ? NH2 C ARG 56  ? ? 117.09 120.30 -3.21  0.50 N 
110 1 CA  C MET 59  ? ? CB  C MET 59  ? ? CG  C MET 59  ? ? 97.87  113.30 -15.43 1.70 N 
111 1 CA  C ARG 61  ? ? CB  C ARG 61  ? ? CG  C ARG 61  ? ? 128.68 113.40 15.28  2.20 N 
112 1 N   C SER 62  ? ? CA  C SER 62  ? ? CB  C SER 62  ? ? 100.20 110.50 -10.30 1.50 N 
113 1 CA  C MET 64  ? ? CB  C MET 64  ? ? CG  C MET 64  ? ? 125.19 113.30 11.89  1.70 N 
114 1 CB  C ASP 65  ? ? CG  C ASP 65  ? ? OD2 C ASP 65  ? ? 111.53 118.30 -6.77  0.90 N 
115 1 CA  C CYS 72  ? ? CB  C CYS 72  ? ? SG  C CYS 72  ? ? 120.99 114.20 6.79   1.10 N 
116 1 CA  C GLU 73  ? ? CB  C GLU 73  ? ? CG  C GLU 73  ? ? 133.65 113.40 20.25  2.20 N 
117 1 CG  C GLU 73  ? ? CD  C GLU 73  ? ? OE1 C GLU 73  ? ? 131.84 118.30 13.54  2.00 N 
118 1 CG  C GLU 73  ? ? CD  C GLU 73  ? ? OE2 C GLU 73  ? ? 105.43 118.30 -12.87 2.00 N 
119 1 N   C GLU 77  ? ? CA  C GLU 77  ? ? CB  C GLU 77  ? ? 121.78 110.60 11.18  1.80 N 
120 1 CA  C PHE 94  ? ? C   C PHE 94  ? ? N   C THR 95  ? ? 103.78 117.20 -13.42 2.20 Y 
121 1 CA  C THR 95  ? ? CB  C THR 95  ? ? OG1 C THR 95  ? ? 93.48  109.00 -15.52 2.10 N 
122 1 NE  C ARG 101 ? ? CZ  C ARG 101 ? ? NH1 C ARG 101 ? ? 133.32 120.30 13.02  0.50 N 
123 1 NE  C ARG 101 ? ? CZ  C ARG 101 ? ? NH2 C ARG 101 ? ? 112.04 120.30 -8.26  0.50 N 
124 1 CB  C TYR 110 ? ? CG  C TYR 110 ? ? CD1 C TYR 110 ? ? 125.65 121.00 4.65   0.60 N 
125 1 CB  C MET 133 ? ? CA  C MET 133 ? ? C   C MET 133 ? ? 124.34 110.40 13.94  2.00 N 
126 1 CA  C MET 133 ? ? CB  C MET 133 ? ? CG  C MET 133 ? ? 129.94 113.30 16.64  1.70 N 
127 1 N   C SER 146 ? ? CA  C SER 146 ? ? CB  C SER 146 ? ? 100.68 110.50 -9.82  1.50 N 
128 1 CA  C LEU 153 ? ? CB  C LEU 153 ? ? CG  C LEU 153 ? ? 138.45 115.30 23.15  2.30 N 
129 1 CA  C LYS 154 ? ? C   C LYS 154 ? ? O   C LYS 154 ? ? 104.99 120.10 -15.11 2.10 N 
130 1 CA  C LYS 154 ? ? C   C LYS 154 ? ? N   C GLY 155 ? ? 133.35 116.20 17.15  2.00 Y 
131 1 CA  C ASN 173 ? ? CB  C ASN 173 ? ? CG  C ASN 173 ? ? 126.64 113.40 13.24  2.20 N 
132 1 C   C ASN 173 ? ? N   C THR 174 ? ? CA  C THR 174 ? ? 152.02 121.70 30.32  2.50 Y 
133 1 CB  C ASP 178 ? ? CG  C ASP 178 ? ? OD1 C ASP 178 ? ? 126.91 118.30 8.61   0.90 N 
134 1 CB  C ASP 188 ? ? CA  C ASP 188 ? ? C   C ASP 188 ? ? 123.21 110.40 12.81  2.00 N 
135 1 N   C ASP 188 ? ? CA  C ASP 188 ? ? C   C ASP 188 ? ? 94.30  111.00 -16.70 2.70 N 
136 1 N   C ARG 196 ? ? CA  C ARG 196 ? ? CB  C ARG 196 ? ? 125.27 110.60 14.67  1.80 N 
137 1 CA  C ARG 196 ? ? CB  C ARG 196 ? ? CG  C ARG 196 ? ? 128.83 113.40 15.43  2.20 N 
138 1 NE  C ARG 196 ? ? CZ  C ARG 196 ? ? NH1 C ARG 196 ? ? 123.37 120.30 3.07   0.50 N 
139 1 NE  C ARG 196 ? ? CZ  C ARG 196 ? ? NH2 C ARG 196 ? ? 112.62 120.30 -7.68  0.50 N 
140 1 N   C ASP 204 ? ? CA  C ASP 204 ? ? CB  C ASP 204 ? ? 121.77 110.60 11.17  1.80 N 
141 1 N   C ALA 206 ? ? CA  C ALA 206 ? ? CB  C ALA 206 ? ? 101.39 110.10 -8.71  1.40 N 
142 1 C   C ALA 213 ? ? N   C ASN 214 ? ? CA  C ASN 214 ? ? 104.74 121.70 -16.96 2.50 Y 
143 1 CB  C ASN 214 ? ? CA  C ASN 214 ? ? C   C ASN 214 ? ? 130.09 110.40 19.69  2.00 N 
144 1 N   C ASN 214 ? ? CA  C ASN 214 ? ? CB  C ASN 214 ? ? 96.68  110.60 -13.92 1.80 N 
145 1 CA  C ILE 215 ? ? C   C ILE 215 ? ? O   C ILE 215 ? ? 132.96 120.10 12.86  2.10 N 
146 1 CA  C ASN 217 ? ? C   C ASN 217 ? ? O   C ASN 217 ? ? 105.74 120.10 -14.36 2.10 N 
147 1 N   C GLY 230 ? ? CA  C GLY 230 ? ? C   C GLY 230 ? ? 130.87 113.10 17.77  2.50 N 
148 1 N   C GLY 231 ? ? CA  C GLY 231 ? ? C   C GLY 231 ? ? 154.87 113.10 41.77  2.50 N 
149 1 NE  C ARG 241 ? ? CZ  C ARG 241 ? ? NH1 C ARG 241 ? ? 113.48 120.30 -6.82  0.50 N 
150 1 NE  C ARG 241 ? ? CZ  C ARG 241 ? ? NH2 C ARG 241 ? ? 125.80 120.30 5.50   0.50 N 
151 1 CB  C LEU 242 ? ? CA  C LEU 242 ? ? C   C LEU 242 ? ? 122.42 110.20 12.22  1.90 N 
152 1 N   C ILE 248 ? ? CA  C ILE 248 ? ? CB  C ILE 248 ? ? 93.92  110.80 -16.88 2.30 N 
153 1 NE  C ARG 249 ? ? CZ  C ARG 249 ? ? NH1 C ARG 249 ? ? 124.52 120.30 4.22   0.50 N 
154 1 NE  C ARG 249 ? ? CZ  C ARG 249 ? ? NH2 C ARG 249 ? ? 114.79 120.30 -5.51  0.50 N 
155 1 CA  C ILE 251 ? ? CB  C ILE 251 ? ? CG1 C ILE 251 ? ? 98.96  111.00 -12.04 1.90 N 
156 1 CA  C ILE 251 ? ? C   C ILE 251 ? ? O   C ILE 251 ? ? 102.00 120.10 -18.10 2.10 N 
157 1 CA  C ILE 251 ? ? C   C ILE 251 ? ? N   C GLU 252 ? ? 140.91 117.20 23.71  2.20 Y 
158 1 CB  C GLU 252 ? ? CA  C GLU 252 ? ? C   C GLU 252 ? ? 131.99 110.40 21.59  2.00 N 
159 1 CA  C GLU 252 ? ? CB  C GLU 252 ? ? CG  C GLU 252 ? ? 147.32 113.40 33.92  2.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 63  ? ? -160.88 109.69  
2  1 MET A 64  ? ? -130.34 -90.43  
3  1 THR A 76  ? ? 179.66  165.20  
4  1 THR A 81  ? ? -121.58 -164.79 
5  1 PHE A 94  ? ? -50.69  -75.01  
6  1 THR A 95  ? ? -62.40  7.30    
7  1 ALA A 114 ? ? -172.73 146.83  
8  1 MET A 139 ? ? -46.11  -10.18  
9  1 TYR A 156 ? ? -31.51  127.09  
10 1 VAL A 161 ? ? -47.29  -5.18   
11 1 SER A 166 ? ? -62.68  48.83   
12 1 CYS A 169 ? ? 140.30  -46.43  
13 1 ASN A 173 ? ? 76.48   48.12   
14 1 PRO A 177 ? ? -63.74  35.92   
15 1 ASP A 178 ? ? -163.25 116.60  
16 1 SER A 180 ? ? -25.75  -54.72  
17 1 ALA A 182 ? ? 176.05  117.95  
18 1 THR A 189 ? ? -51.13  20.37   
19 1 ALA A 202 ? ? -20.30  -69.82  
20 1 ALA A 213 ? ? -76.52  44.69   
21 1 ASN A 214 ? ? -141.92 -8.25   
22 1 ILE A 251 ? ? -145.00 -20.95  
23 1 ALA A 257 ? ? -49.34  -17.81  
24 1 VAL B 103 ? ? -91.53  -63.43  
25 1 GLN B 105 ? ? -36.29  -36.76  
26 1 THR B 125 ? ? -61.64  4.11    
27 1 GLN B 165 ? ? -83.12  32.21   
28 1 ASN B 172 ? ? -80.21  -70.57  
29 1 ASN B 173 ? ? 93.06   96.52   
30 1 THR B 174 ? ? -133.18 -155.45 
31 1 CYS B 176 ? ? -48.24  103.14  
32 1 ARG B 181 ? ? -160.34 41.46   
33 1 GLU B 191 ? ? -63.76  7.69    
34 1 ALA B 206 ? ? -44.60  -70.87  
35 1 ASN B 212 ? ? -161.36 99.13   
36 1 ALA B 213 ? ? -27.75  -47.94  
37 1 ASN B 214 ? ? -36.11  -37.15  
38 1 ALA B 256 ? ? -23.10  -60.65  
39 1 SER C 63  ? ? -96.11  -124.26 
40 1 MET C 64  ? ? -88.20  -75.23  
41 1 ALA C 114 ? ? -171.18 136.67  
42 1 THR C 125 ? ? -68.60  42.38   
43 1 MET C 139 ? ? -55.62  -6.13   
44 1 ASN C 173 ? ? 62.84   93.97   
45 1 THR C 174 ? ? -120.32 -169.05 
46 1 PRO C 177 ? ? -68.38  -78.75  
47 1 SER C 180 ? ? -25.78  -60.04  
48 1 ARG C 181 ? ? -98.75  57.40   
49 1 ILE C 183 ? ? -118.60 75.68   
50 1 ASP C 188 ? ? -104.28 67.72   
51 1 TYR C 205 ? ? -44.65  -73.39  
52 1 ALA C 213 ? ? -47.82  -18.64  
53 1 ASN C 217 ? ? -48.23  -17.56  
54 1 ILE C 218 ? ? -87.65  -72.95  
55 1 LEU C 219 ? ? -26.20  -33.13  
56 1 ALA C 222 ? ? 178.26  157.49  
57 1 GLU C 229 ? ? -117.02 -138.69 
58 1 SER C 232 ? ? 69.71   -61.03  
59 1 THR C 239 ? ? -106.78 -76.75  
60 1 ILE C 251 ? ? -150.55 -9.17   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1 ARG A 116 ? ? 0.121 'SIDE CHAIN' 
2  1 ARG A 223 ? ? 0.146 'SIDE CHAIN' 
3  1 ARG A 249 ? ? 0.092 'SIDE CHAIN' 
4  1 ARG B 101 ? ? 0.173 'SIDE CHAIN' 
5  1 ARG B 241 ? ? 0.196 'SIDE CHAIN' 
6  1 ARG B 249 ? ? 0.086 'SIDE CHAIN' 
7  1 ARG C 101 ? ? 0.263 'SIDE CHAIN' 
8  1 ARG C 181 ? ? 0.109 'SIDE CHAIN' 
9  1 ARG C 196 ? ? 0.132 'SIDE CHAIN' 
10 1 ARG C 223 ? ? 0.126 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A ALA 1  ? A ALA 1  
2   1 Y 1 A THR 2  ? A THR 2  
3   1 Y 1 A ARG 3  ? A ARG 3  
4   1 Y 1 A LEU 4  ? A LEU 4  
5   1 Y 1 A THR 5  ? A THR 5  
6   1 Y 1 A LYS 6  ? A LYS 6  
7   1 Y 1 A LYS 7  ? A LYS 7  
8   1 Y 1 A GLN 8  ? A GLN 8  
9   1 Y 1 A LEU 9  ? A LEU 9  
10  1 Y 1 A ALA 10 ? A ALA 10 
11  1 Y 1 A GLN 11 ? A GLN 11 
12  1 Y 1 A ALA 12 ? A ALA 12 
13  1 Y 1 A ILE 13 ? A ILE 13 
14  1 Y 1 A GLN 14 ? A GLN 14 
15  1 Y 1 A ASN 15 ? A ASN 15 
16  1 Y 1 A THR 16 ? A THR 16 
17  1 Y 1 A LEU 17 ? A LEU 17 
18  1 Y 1 A PRO 18 ? A PRO 18 
19  1 Y 1 A ASN 19 ? A ASN 19 
20  1 Y 1 A PRO 20 ? A PRO 20 
21  1 Y 1 A PRO 21 ? A PRO 21 
22  1 Y 1 A ARG 22 ? A ARG 22 
23  1 Y 1 A ARG 23 ? A ARG 23 
24  1 Y 1 A LYS 24 ? A LYS 24 
25  1 Y 1 A ARG 25 ? A ARG 25 
26  1 Y 1 A ARG 26 ? A ARG 26 
27  1 Y 1 A ALA 27 ? A ALA 27 
28  1 Y 1 A LYS 28 ? A LYS 28 
29  1 Y 1 A ARG 29 ? A ARG 29 
30  1 Y 1 A ARG 30 ? A ARG 30 
31  1 Y 1 A ALA 31 ? A ALA 31 
32  1 Y 1 A ALA 32 ? A ALA 32 
33  1 Y 1 A GLN 33 ? A GLN 33 
34  1 Y 1 A VAL 34 ? A VAL 34 
35  1 Y 1 A PRO 35 ? A PRO 35 
36  1 Y 1 A LYS 36 ? A LYS 36 
37  1 Y 1 A PRO 37 ? A PRO 37 
38  1 Y 1 A THR 38 ? A THR 38 
39  1 Y 1 A GLN 39 ? A GLN 39 
40  1 Y 1 A ALA 40 ? A ALA 40 
41  1 Y 1 A GLY 41 ? A GLY 41 
42  1 Y 1 A VAL 42 ? A VAL 42 
43  1 Y 1 A SER 43 ? A SER 43 
44  1 Y 1 A MET 44 ? A MET 44 
45  1 Y 1 A ALA 45 ? A ALA 45 
46  1 Y 1 A PRO 46 ? A PRO 46 
47  1 Y 1 A ILE 47 ? A ILE 47 
48  1 Y 1 A ALA 48 ? A ALA 48 
49  1 Y 1 A GLN 49 ? A GLN 49 
50  1 Y 1 A GLY 50 ? A GLY 50 
51  1 Y 1 A THR 51 ? A THR 51 
52  1 Y 1 A MET 52 ? A MET 52 
53  1 Y 1 A VAL 53 ? A VAL 53 
54  1 Y 1 A LYS 54 ? A LYS 54 
55  1 Y 1 A LEU 55 ? A LEU 55 
56  1 Y 1 A ARG 56 ? A ARG 56 
57  1 Y 1 A PRO 57 ? A PRO 57 
58  1 Y 1 A PRO 58 ? A PRO 58 
59  1 Y 1 A MET 59 ? A MET 59 
60  1 Y 1 A LEU 60 ? A LEU 60 
61  1 Y 1 A ARG 61 ? A ARG 61 
62  1 Y 1 B ALA 1  ? B ALA 1  
63  1 Y 1 B THR 2  ? B THR 2  
64  1 Y 1 B ARG 3  ? B ARG 3  
65  1 Y 1 B LEU 4  ? B LEU 4  
66  1 Y 1 B THR 5  ? B THR 5  
67  1 Y 1 B LYS 6  ? B LYS 6  
68  1 Y 1 B LYS 7  ? B LYS 7  
69  1 Y 1 B GLN 8  ? B GLN 8  
70  1 Y 1 B LEU 9  ? B LEU 9  
71  1 Y 1 B ALA 10 ? B ALA 10 
72  1 Y 1 B GLN 11 ? B GLN 11 
73  1 Y 1 B ALA 12 ? B ALA 12 
74  1 Y 1 B ILE 13 ? B ILE 13 
75  1 Y 1 B GLN 14 ? B GLN 14 
76  1 Y 1 B ASN 15 ? B ASN 15 
77  1 Y 1 B THR 16 ? B THR 16 
78  1 Y 1 B LEU 17 ? B LEU 17 
79  1 Y 1 B PRO 18 ? B PRO 18 
80  1 Y 1 B ASN 19 ? B ASN 19 
81  1 Y 1 B PRO 20 ? B PRO 20 
82  1 Y 1 B PRO 21 ? B PRO 21 
83  1 Y 1 B ARG 22 ? B ARG 22 
84  1 Y 1 B ARG 23 ? B ARG 23 
85  1 Y 1 B LYS 24 ? B LYS 24 
86  1 Y 1 B ARG 25 ? B ARG 25 
87  1 Y 1 B ARG 26 ? B ARG 26 
88  1 Y 1 B ALA 27 ? B ALA 27 
89  1 Y 1 B LYS 28 ? B LYS 28 
90  1 Y 1 B ARG 29 ? B ARG 29 
91  1 Y 1 B ARG 30 ? B ARG 30 
92  1 Y 1 B ALA 31 ? B ALA 31 
93  1 Y 1 B ALA 32 ? B ALA 32 
94  1 Y 1 B GLN 33 ? B GLN 33 
95  1 Y 1 B VAL 34 ? B VAL 34 
96  1 Y 1 B PRO 35 ? B PRO 35 
97  1 Y 1 B LYS 36 ? B LYS 36 
98  1 Y 1 B PRO 37 ? B PRO 37 
99  1 Y 1 B THR 38 ? B THR 38 
100 1 Y 1 B GLN 39 ? B GLN 39 
101 1 Y 1 B ALA 40 ? B ALA 40 
102 1 Y 1 B GLY 41 ? B GLY 41 
103 1 Y 1 B VAL 42 ? B VAL 42 
104 1 Y 1 B SER 43 ? B SER 43 
105 1 Y 1 B MET 44 ? B MET 44 
106 1 Y 1 B ALA 45 ? B ALA 45 
107 1 Y 1 B PRO 46 ? B PRO 46 
108 1 Y 1 B ILE 47 ? B ILE 47 
109 1 Y 1 B ALA 48 ? B ALA 48 
110 1 Y 1 B GLN 49 ? B GLN 49 
111 1 Y 1 B GLY 50 ? B GLY 50 
112 1 Y 1 B THR 51 ? B THR 51 
113 1 Y 1 B MET 52 ? B MET 52 
114 1 Y 1 B VAL 53 ? B VAL 53 
115 1 Y 1 B LYS 54 ? B LYS 54 
116 1 Y 1 B LEU 55 ? B LEU 55 
117 1 Y 1 B ARG 56 ? B ARG 56 
118 1 Y 1 B PRO 57 ? B PRO 57 
119 1 Y 1 B PRO 58 ? B PRO 58 
120 1 Y 1 B MET 59 ? B MET 59 
121 1 Y 1 B LEU 60 ? B LEU 60 
122 1 Y 1 B ARG 61 ? B ARG 61 
123 1 Y 1 C ALA 1  ? C ALA 1  
124 1 Y 1 C THR 2  ? C THR 2  
125 1 Y 1 C ARG 3  ? C ARG 3  
126 1 Y 1 C LEU 4  ? C LEU 4  
127 1 Y 1 C THR 5  ? C THR 5  
128 1 Y 1 C LYS 6  ? C LYS 6  
129 1 Y 1 C LYS 7  ? C LYS 7  
130 1 Y 1 C GLN 8  ? C GLN 8  
131 1 Y 1 C LEU 9  ? C LEU 9  
132 1 Y 1 C ALA 10 ? C ALA 10 
133 1 Y 1 C GLN 11 ? C GLN 11 
134 1 Y 1 C ALA 12 ? C ALA 12 
135 1 Y 1 C ILE 13 ? C ILE 13 
136 1 Y 1 C GLN 14 ? C GLN 14 
137 1 Y 1 C ASN 15 ? C ASN 15 
138 1 Y 1 C THR 16 ? C THR 16 
139 1 Y 1 C LEU 17 ? C LEU 17 
140 1 Y 1 C PRO 18 ? C PRO 18 
141 1 Y 1 C ASN 19 ? C ASN 19 
142 1 Y 1 C PRO 20 ? C PRO 20 
143 1 Y 1 C PRO 21 ? C PRO 21 
144 1 Y 1 C ARG 22 ? C ARG 22 
145 1 Y 1 C ARG 23 ? C ARG 23 
146 1 Y 1 C LYS 24 ? C LYS 24 
147 1 Y 1 C ARG 25 ? C ARG 25 
148 1 Y 1 C ARG 26 ? C ARG 26 
149 1 Y 1 C ALA 27 ? C ALA 27 
150 1 Y 1 C LYS 28 ? C LYS 28 
151 1 Y 1 C ARG 29 ? C ARG 29 
152 1 Y 1 C ARG 30 ? C ARG 30 
153 1 Y 1 C ALA 31 ? C ALA 31 
154 1 Y 1 C ALA 32 ? C ALA 32 
155 1 Y 1 C GLN 33 ? C GLN 33 
156 1 Y 1 C VAL 34 ? C VAL 34 
157 1 Y 1 C PRO 35 ? C PRO 35 
158 1 Y 1 C LYS 36 ? C LYS 36 
159 1 Y 1 C PRO 37 ? C PRO 37 
160 1 Y 1 C THR 38 ? C THR 38 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 water         HOH 
#