data_4TKR
# 
_entry.id   4TKR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TKR         
WWPDB D_1000201676 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TKR 
_pdbx_database_status.recvd_initial_deposition_date   2014-05-27 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, Y.'                                                     1 
'Liu, Q.'                                                     2 
'Hendrickson, W.A.'                                           3 
'New York Consortium on Membrane Protein Structure (NYCOMPS)' 4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_id_ASTM           ABCRE6 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1399-0047 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            70 
_citation.language                  ? 
_citation.page_first                2544 
_citation.page_last                 2557 
_citation.title                     'Multi-crystal native SAD analysis at 6 keV.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1107/S1399004714013376 
_citation.pdbx_database_id_PubMed   25286840 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Liu, Q.'           1 ? 
primary 'Guo, Y.'           2 ? 
primary 'Chang, Y.'         3 ? 
primary 'Cai, Z.'           4 ? 
primary 'Assur, Z.'         5 ? 
primary 'Mancia, F.'        6 ? 
primary 'Greene, M.I.'      7 ? 
primary 'Hendrickson, W.A.' 8 ? 
# 
_cell.entry_id           4TKR 
_cell.length_a           95.647 
_cell.length_b           95.647 
_cell.length_c           125.027 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TKR 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Thiamine transporter thia'    24079.342 2  ? ? ? ? 
2 non-polymer syn 'THIAMINE DIPHOSPHATE'         425.314   2  ? ? ? ? 
3 non-polymer syn 2-O-octyl-beta-D-glucopyranose 292.369   15 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDYKDDDDKHHHHHHHHHHENLYFQSYVMQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFW
AAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGVARYFWHY
VAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDYKDDDDKHHHHHHHHHHENLYFQSYVMQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFW
AAGFAGLLWGLLHFLTGKAYILMPSQAIIEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGVARYFWHY
VAGVLFWGAYAFQGWGAQLFSIVMNGASCLGTVLVSGIIISILLKTSPKLFLPK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   TYR n 
1 4   LYS n 
1 5   ASP n 
1 6   ASP n 
1 7   ASP n 
1 8   ASP n 
1 9   LYS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  HIS n 
1 14  HIS n 
1 15  HIS n 
1 16  HIS n 
1 17  HIS n 
1 18  HIS n 
1 19  HIS n 
1 20  GLU n 
1 21  ASN n 
1 22  LEU n 
1 23  TYR n 
1 24  PHE n 
1 25  GLN n 
1 26  SER n 
1 27  TYR n 
1 28  VAL n 
1 29  MET n 
1 30  GLN n 
1 31  ASN n 
1 32  LYS n 
1 33  ARG n 
1 34  LEU n 
1 35  ILE n 
1 36  ILE n 
1 37  LEU n 
1 38  LEU n 
1 39  GLU n 
1 40  CYS n 
1 41  ALA n 
1 42  ILE n 
1 43  PHE n 
1 44  ALA n 
1 45  ALA n 
1 46  VAL n 
1 47  ALA n 
1 48  MET n 
1 49  VAL n 
1 50  LEU n 
1 51  SER n 
1 52  PHE n 
1 53  ILE n 
1 54  PRO n 
1 55  LEU n 
1 56  ASP n 
1 57  ILE n 
1 58  GLY n 
1 59  SER n 
1 60  SER n 
1 61  PHE n 
1 62  SER n 
1 63  ILE n 
1 64  SER n 
1 65  LEU n 
1 66  GLY n 
1 67  MET n 
1 68  ILE n 
1 69  PRO n 
1 70  MET n 
1 71  TYR n 
1 72  VAL n 
1 73  ILE n 
1 74  ALA n 
1 75  ILE n 
1 76  ARG n 
1 77  ARG n 
1 78  GLY n 
1 79  PHE n 
1 80  TRP n 
1 81  ALA n 
1 82  ALA n 
1 83  GLY n 
1 84  PHE n 
1 85  ALA n 
1 86  GLY n 
1 87  LEU n 
1 88  LEU n 
1 89  TRP n 
1 90  GLY n 
1 91  LEU n 
1 92  LEU n 
1 93  HIS n 
1 94  PHE n 
1 95  LEU n 
1 96  THR n 
1 97  GLY n 
1 98  LYS n 
1 99  ALA n 
1 100 TYR n 
1 101 ILE n 
1 102 LEU n 
1 103 MET n 
1 104 PRO n 
1 105 SER n 
1 106 GLN n 
1 107 ALA n 
1 108 ILE n 
1 109 ILE n 
1 110 GLU n 
1 111 TYR n 
1 112 ILE n 
1 113 LEU n 
1 114 ALA n 
1 115 PHE n 
1 116 SER n 
1 117 PHE n 
1 118 ILE n 
1 119 ALA n 
1 120 PHE n 
1 121 SER n 
1 122 GLY n 
1 123 VAL n 
1 124 PHE n 
1 125 SER n 
1 126 LYS n 
1 127 GLN n 
1 128 VAL n 
1 129 ARG n 
1 130 SER n 
1 131 ASN n 
1 132 LEU n 
1 133 ALA n 
1 134 ALA n 
1 135 ASN n 
1 136 GLN n 
1 137 LEU n 
1 138 LYS n 
1 139 LYS n 
1 140 ALA n 
1 141 ILE n 
1 142 GLU n 
1 143 TRP n 
1 144 ALA n 
1 145 TRP n 
1 146 GLY n 
1 147 THR n 
1 148 MET n 
1 149 ILE n 
1 150 ILE n 
1 151 GLY n 
1 152 GLY n 
1 153 VAL n 
1 154 ALA n 
1 155 ARG n 
1 156 TYR n 
1 157 PHE n 
1 158 TRP n 
1 159 HIS n 
1 160 TYR n 
1 161 VAL n 
1 162 ALA n 
1 163 GLY n 
1 164 VAL n 
1 165 LEU n 
1 166 PHE n 
1 167 TRP n 
1 168 GLY n 
1 169 ALA n 
1 170 TYR n 
1 171 ALA n 
1 172 PHE n 
1 173 GLN n 
1 174 GLY n 
1 175 TRP n 
1 176 GLY n 
1 177 ALA n 
1 178 GLN n 
1 179 LEU n 
1 180 PHE n 
1 181 SER n 
1 182 ILE n 
1 183 VAL n 
1 184 MET n 
1 185 ASN n 
1 186 GLY n 
1 187 ALA n 
1 188 SER n 
1 189 CYS n 
1 190 LEU n 
1 191 GLY n 
1 192 THR n 
1 193 VAL n 
1 194 LEU n 
1 195 VAL n 
1 196 SER n 
1 197 GLY n 
1 198 ILE n 
1 199 ILE n 
1 200 ILE n 
1 201 SER n 
1 202 ILE n 
1 203 LEU n 
1 204 LEU n 
1 205 LYS n 
1 206 THR n 
1 207 SER n 
1 208 PRO n 
1 209 LYS n 
1 210 LEU n 
1 211 PHE n 
1 212 LEU n 
1 213 PRO n 
1 214 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   214 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 
'M637_10125, M638_09860, M640_06115, M641_06335, M643_01630, M644_08810, M645_06650' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Listeria monocytogenes' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1639 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S5L6I0_LISMN 
_struct_ref.pdbx_db_accession          S5L6I0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MQNKRLIILLECAIFAAVAMVLSFIPLDIGSSFSISLGMIPMYVIAIRRGFWAAGFAGLLWGLLHFLTGKAYILMPSQAI
IEYILAFSFIAFSGVFSKQVRSNLAANQLKKAIEWAWGTMIIGGVARYFWHYVAGVLFWGAYAFQGWGAQLFSIVMNGAS
CLGTVLVSGIIISILLKTSPKLFLPK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4TKR A 29 ? 214 ? S5L6I0 1 ? 186 ? 1 186 
2 1 4TKR B 29 ? 214 ? S5L6I0 1 ? 186 ? 1 186 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4TKR MET A 1  ? UNP S5L6I0 ? ? 'initiating methionine' -27 1  
1 4TKR ASP A 2  ? UNP S5L6I0 ? ? 'expression tag'        -26 2  
1 4TKR TYR A 3  ? UNP S5L6I0 ? ? 'expression tag'        -25 3  
1 4TKR LYS A 4  ? UNP S5L6I0 ? ? 'expression tag'        -24 4  
1 4TKR ASP A 5  ? UNP S5L6I0 ? ? 'expression tag'        -23 5  
1 4TKR ASP A 6  ? UNP S5L6I0 ? ? 'expression tag'        -22 6  
1 4TKR ASP A 7  ? UNP S5L6I0 ? ? 'expression tag'        -21 7  
1 4TKR ASP A 8  ? UNP S5L6I0 ? ? 'expression tag'        -20 8  
1 4TKR LYS A 9  ? UNP S5L6I0 ? ? 'expression tag'        -19 9  
1 4TKR HIS A 10 ? UNP S5L6I0 ? ? 'expression tag'        -18 10 
1 4TKR HIS A 11 ? UNP S5L6I0 ? ? 'expression tag'        -17 11 
1 4TKR HIS A 12 ? UNP S5L6I0 ? ? 'expression tag'        -16 12 
1 4TKR HIS A 13 ? UNP S5L6I0 ? ? 'expression tag'        -15 13 
1 4TKR HIS A 14 ? UNP S5L6I0 ? ? 'expression tag'        -14 14 
1 4TKR HIS A 15 ? UNP S5L6I0 ? ? 'expression tag'        -13 15 
1 4TKR HIS A 16 ? UNP S5L6I0 ? ? 'expression tag'        -12 16 
1 4TKR HIS A 17 ? UNP S5L6I0 ? ? 'expression tag'        -11 17 
1 4TKR HIS A 18 ? UNP S5L6I0 ? ? 'expression tag'        -10 18 
1 4TKR HIS A 19 ? UNP S5L6I0 ? ? 'expression tag'        -9  19 
1 4TKR GLU A 20 ? UNP S5L6I0 ? ? 'expression tag'        -8  20 
1 4TKR ASN A 21 ? UNP S5L6I0 ? ? 'expression tag'        -7  21 
1 4TKR LEU A 22 ? UNP S5L6I0 ? ? 'expression tag'        -6  22 
1 4TKR TYR A 23 ? UNP S5L6I0 ? ? 'expression tag'        -5  23 
1 4TKR PHE A 24 ? UNP S5L6I0 ? ? 'expression tag'        -4  24 
1 4TKR GLN A 25 ? UNP S5L6I0 ? ? 'expression tag'        -3  25 
1 4TKR SER A 26 ? UNP S5L6I0 ? ? 'expression tag'        -2  26 
1 4TKR TYR A 27 ? UNP S5L6I0 ? ? 'expression tag'        -1  27 
1 4TKR VAL A 28 ? UNP S5L6I0 ? ? 'expression tag'        0   28 
2 4TKR MET B 1  ? UNP S5L6I0 ? ? 'initiating methionine' -27 29 
2 4TKR ASP B 2  ? UNP S5L6I0 ? ? 'expression tag'        -26 30 
2 4TKR TYR B 3  ? UNP S5L6I0 ? ? 'expression tag'        -25 31 
2 4TKR LYS B 4  ? UNP S5L6I0 ? ? 'expression tag'        -24 32 
2 4TKR ASP B 5  ? UNP S5L6I0 ? ? 'expression tag'        -23 33 
2 4TKR ASP B 6  ? UNP S5L6I0 ? ? 'expression tag'        -22 34 
2 4TKR ASP B 7  ? UNP S5L6I0 ? ? 'expression tag'        -21 35 
2 4TKR ASP B 8  ? UNP S5L6I0 ? ? 'expression tag'        -20 36 
2 4TKR LYS B 9  ? UNP S5L6I0 ? ? 'expression tag'        -19 37 
2 4TKR HIS B 10 ? UNP S5L6I0 ? ? 'expression tag'        -18 38 
2 4TKR HIS B 11 ? UNP S5L6I0 ? ? 'expression tag'        -17 39 
2 4TKR HIS B 12 ? UNP S5L6I0 ? ? 'expression tag'        -16 40 
2 4TKR HIS B 13 ? UNP S5L6I0 ? ? 'expression tag'        -15 41 
2 4TKR HIS B 14 ? UNP S5L6I0 ? ? 'expression tag'        -14 42 
2 4TKR HIS B 15 ? UNP S5L6I0 ? ? 'expression tag'        -13 43 
2 4TKR HIS B 16 ? UNP S5L6I0 ? ? 'expression tag'        -12 44 
2 4TKR HIS B 17 ? UNP S5L6I0 ? ? 'expression tag'        -11 45 
2 4TKR HIS B 18 ? UNP S5L6I0 ? ? 'expression tag'        -10 46 
2 4TKR HIS B 19 ? UNP S5L6I0 ? ? 'expression tag'        -9  47 
2 4TKR GLU B 20 ? UNP S5L6I0 ? ? 'expression tag'        -8  48 
2 4TKR ASN B 21 ? UNP S5L6I0 ? ? 'expression tag'        -7  49 
2 4TKR LEU B 22 ? UNP S5L6I0 ? ? 'expression tag'        -6  50 
2 4TKR TYR B 23 ? UNP S5L6I0 ? ? 'expression tag'        -5  51 
2 4TKR PHE B 24 ? UNP S5L6I0 ? ? 'expression tag'        -4  52 
2 4TKR GLN B 25 ? UNP S5L6I0 ? ? 'expression tag'        -3  53 
2 4TKR SER B 26 ? UNP S5L6I0 ? ? 'expression tag'        -2  54 
2 4TKR TYR B 27 ? UNP S5L6I0 ? ? 'expression tag'        -1  55 
2 4TKR VAL B 28 ? UNP S5L6I0 ? ? 'expression tag'        0   56 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                        ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking'          y ARGININE                       ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking'          y ASPARAGINE                     ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                ? 'C4 H7 N O4'           133.103 
BGL 'D-saccharide, beta linking' n 2-O-octyl-beta-D-glucopyranose ? 'C14 H28 O6'           292.369 
CYS 'L-peptide linking'          y CYSTEINE                       ? 'C3 H7 N O2 S'         121.158 
GLN 'L-peptide linking'          y GLUTAMINE                      ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'            y GLYCINE                        ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking'          y HISTIDINE                      ? 'C6 H10 N3 O2 1'       156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                     ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking'          y LEUCINE                        ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking'          y LYSINE                         ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking'          y METHIONINE                     ? 'C5 H11 N O2 S'        149.211 
PHE 'L-peptide linking'          y PHENYLALANINE                  ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking'          y PROLINE                        ? 'C5 H9 N O2'           115.130 
SER 'L-peptide linking'          y SERINE                         ? 'C3 H7 N O3'           105.093 
THR 'L-peptide linking'          y THREONINE                      ? 'C4 H9 N O3'           119.119 
TPP non-polymer                  . 'THIAMINE DIPHOSPHATE'         ? 'C12 H19 N4 O7 P2 S 1' 425.314 
TRP 'L-peptide linking'          y TRYPTOPHAN                     ? 'C11 H12 N2 O2'        204.225 
TYR 'L-peptide linking'          y TYROSINE                       ? 'C9 H11 N O3'          181.189 
VAL 'L-peptide linking'          y VALINE                         ? 'C5 H11 N O2'          117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TKR 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.43 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.12 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.2 M ammonium acetate, 0.1 M tri-sodium citrate dihydrate, pH 5.6, 30% w/v polyethylene glycol (PEG) 4000, 3% glycerol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 4r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-08-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   2.07366 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        2.07366 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4TKR 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.0 
_reflns.d_resolution_low                 40.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       13687 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  140.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            39.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4TKR 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.0023 
_refine.ls_d_res_low                             39.315 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     25496 
_refine.ls_number_reflns_R_free                  1267 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.79 
_refine.ls_percent_reflns_R_free                 4.97 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1997 
_refine.ls_R_factor_R_free                       0.2343 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1978 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.72 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.37 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2830 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         342 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3172 
_refine_hist.d_res_high                       3.0023 
_refine_hist.d_res_low                        39.315 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 3255 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.660  ? 4400 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.362 ? 1082 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.041  ? 527  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 476  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 3.0023 3.1225  . . 144 2651 99.00  . . . 0.3182 . 0.2514 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1225 3.2645  . . 130 2716 100.00 . . . 0.3025 . 0.2339 . . . . . . . . 
'X-RAY DIFFRACTION' 3.2645 3.4365  . . 145 2688 100.00 . . . 0.2318 . 0.1909 . . . . . . . . 
'X-RAY DIFFRACTION' 3.4365 3.6517  . . 134 2703 100.00 . . . 0.3124 . 0.1947 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6517 3.9334  . . 135 2682 100.00 . . . 0.1889 . 0.1887 . . . . . . . . 
'X-RAY DIFFRACTION' 3.9334 4.3288  . . 148 2693 100.00 . . . 0.2035 . 0.1780 . . . . . . . . 
'X-RAY DIFFRACTION' 4.3288 4.9541  . . 150 2704 100.00 . . . 0.2282 . 0.1745 . . . . . . . . 
'X-RAY DIFFRACTION' 4.9541 6.2376  . . 143 2686 100.00 . . . 0.1955 . 0.1924 . . . . . . . . 
'X-RAY DIFFRACTION' 6.2376 39.3187 . . 138 2706 100.00 . . . 0.2469 . 0.2263 . . . . . . . . 
# 
_struct.entry_id                     4TKR 
_struct.title                        'Native-SAD phasing for ThiT from Listeria monocytogenes serovar.' 
_struct.pdbx_descriptor              'Thiamine transporter' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TKR 
_struct_keywords.text            
;membrane protein, transporter, native-SAD phasing, multiple crystals, low energy, Structural Genomics, PSI-Biology, New York Consortium on Membrane Protein Structure, NYCOMPS
;
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 2 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 3 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 31  ? SER A 51  ? ASN A 3   SER A 23  1 ? 21 
HELX_P HELX_P2  AA2 GLY A 66  ? GLY A 78  ? GLY A 38  GLY A 50  1 ? 13 
HELX_P HELX_P3  AA3 GLY A 78  ? THR A 96  ? GLY A 50  THR A 68  1 ? 19 
HELX_P HELX_P4  AA4 MET A 103 ? ILE A 112 ? MET A 75  ILE A 84  1 ? 10 
HELX_P HELX_P5  AA5 ILE A 112 ? PHE A 117 ? ILE A 84  PHE A 89  1 ? 6  
HELX_P HELX_P6  AA6 ILE A 118 ? VAL A 123 ? ILE A 90  VAL A 95  5 ? 6  
HELX_P HELX_P7  AA7 PHE A 124 ? ALA A 134 ? PHE A 96  ALA A 106 1 ? 11 
HELX_P HELX_P8  AA8 GLN A 136 ? TRP A 167 ? GLN A 108 TRP A 139 1 ? 32 
HELX_P HELX_P9  AA9 GLY A 168 ? ALA A 171 ? GLY A 140 ALA A 143 5 ? 4  
HELX_P HELX_P10 AB1 GLY A 176 ? SER A 207 ? GLY A 148 SER A 179 1 ? 32 
HELX_P HELX_P11 AB2 PRO A 208 ? PHE A 211 ? PRO A 180 PHE A 183 5 ? 4  
HELX_P HELX_P12 AB3 ASN B 31  ? SER B 51  ? ASN B 3   SER B 23  1 ? 21 
HELX_P HELX_P13 AB4 GLY B 66  ? GLY B 78  ? GLY B 38  GLY B 50  1 ? 13 
HELX_P HELX_P14 AB5 GLY B 78  ? THR B 96  ? GLY B 50  THR B 68  1 ? 19 
HELX_P HELX_P15 AB6 MET B 103 ? ILE B 112 ? MET B 75  ILE B 84  1 ? 10 
HELX_P HELX_P16 AB7 ILE B 112 ? PHE B 117 ? ILE B 84  PHE B 89  1 ? 6  
HELX_P HELX_P17 AB8 ILE B 118 ? VAL B 123 ? ILE B 90  VAL B 95  5 ? 6  
HELX_P HELX_P18 AB9 PHE B 124 ? ALA B 134 ? PHE B 96  ALA B 106 1 ? 11 
HELX_P HELX_P19 AC1 GLN B 136 ? PHE B 166 ? GLN B 108 PHE B 138 1 ? 31 
HELX_P HELX_P20 AC2 TRP B 167 ? ALA B 171 ? TRP B 139 ALA B 143 5 ? 5  
HELX_P HELX_P21 AC3 GLY B 176 ? SER B 207 ? GLY B 148 SER B 179 1 ? 32 
HELX_P HELX_P22 AC4 PRO B 208 ? PHE B 211 ? PRO B 180 PHE B 183 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    4TKR 
_atom_sites.fract_transf_matrix[1][1]   0.010455 
_atom_sites.fract_transf_matrix[1][2]   0.006036 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012073 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007998 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ASN A 1 31  ? -8.191  24.334 19.333 1.00 95.62  ? 3   ASN A N     1 
ATOM   2    C CA    . ASN A 1 31  ? -7.387  25.296 18.588 1.00 94.32  ? 3   ASN A CA    1 
ATOM   3    C C     . ASN A 1 31  ? -6.563  26.211 19.491 1.00 92.20  ? 3   ASN A C     1 
ATOM   4    O O     . ASN A 1 31  ? -5.614  25.766 20.135 1.00 93.12  ? 3   ASN A O     1 
ATOM   5    C CB    . ASN A 1 31  ? -8.267  26.129 17.652 1.00 96.09  ? 3   ASN A CB    1 
ATOM   6    C CG    . ASN A 1 31  ? -8.719  25.351 16.431 1.00 100.90 ? 3   ASN A CG    1 
ATOM   7    O OD1   . ASN A 1 31  ? -9.913  25.121 16.233 1.00 102.14 ? 3   ASN A OD1   1 
ATOM   8    N ND2   . ASN A 1 31  ? -7.764  24.944 15.604 1.00 100.30 ? 3   ASN A ND2   1 
ATOM   9    N N     . LYS A 1 32  ? -6.940  27.487 19.535 1.00 81.14  ? 4   LYS A N     1 
ATOM   10   C CA    . LYS A 1 32  ? -6.176  28.504 20.254 1.00 72.56  ? 4   LYS A CA    1 
ATOM   11   C C     . LYS A 1 32  ? -5.986  28.196 21.738 1.00 77.22  ? 4   LYS A C     1 
ATOM   12   O O     . LYS A 1 32  ? -4.901  28.400 22.282 1.00 77.02  ? 4   LYS A O     1 
ATOM   13   C CB    . LYS A 1 32  ? -6.822  29.881 20.082 1.00 53.22  ? 4   LYS A CB    1 
ATOM   14   N N     . ARG A 1 33  ? -7.037  27.705 22.387 1.00 80.35  ? 5   ARG A N     1 
ATOM   15   C CA    . ARG A 1 33  ? -6.968  27.369 23.807 1.00 74.56  ? 5   ARG A CA    1 
ATOM   16   C C     . ARG A 1 33  ? -5.941  26.274 24.077 1.00 84.50  ? 5   ARG A C     1 
ATOM   17   O O     . ARG A 1 33  ? -5.153  26.368 25.016 1.00 85.76  ? 5   ARG A O     1 
ATOM   18   C CB    . ARG A 1 33  ? -8.341  26.944 24.329 1.00 70.68  ? 5   ARG A CB    1 
ATOM   19   C CG    . ARG A 1 33  ? -9.349  28.076 24.397 1.00 73.53  ? 5   ARG A CG    1 
ATOM   20   C CD    . ARG A 1 33  ? -10.724 27.576 24.809 1.00 65.52  ? 5   ARG A CD    1 
ATOM   21   N NE    . ARG A 1 33  ? -11.678 28.673 24.940 1.00 63.66  ? 5   ARG A NE    1 
ATOM   22   C CZ    . ARG A 1 33  ? -12.358 29.197 23.926 1.00 76.77  ? 5   ARG A CZ    1 
ATOM   23   N NH1   . ARG A 1 33  ? -12.191 28.726 22.698 1.00 87.06  ? 5   ARG A NH1   1 
ATOM   24   N NH2   . ARG A 1 33  ? -13.205 30.196 24.140 1.00 73.50  ? 5   ARG A NH2   1 
ATOM   25   N N     . LEU A 1 34  ? -5.954  25.238 23.246 1.00 90.05  ? 6   LEU A N     1 
ATOM   26   C CA    . LEU A 1 34  ? -4.999  24.146 23.377 1.00 91.76  ? 6   LEU A CA    1 
ATOM   27   C C     . LEU A 1 34  ? -3.585  24.624 23.061 1.00 88.74  ? 6   LEU A C     1 
ATOM   28   O O     . LEU A 1 34  ? -2.633  24.262 23.750 1.00 88.79  ? 6   LEU A O     1 
ATOM   29   C CB    . LEU A 1 34  ? -5.381  22.984 22.458 1.00 103.29 ? 6   LEU A CB    1 
ATOM   30   C CG    . LEU A 1 34  ? -6.740  22.330 22.719 1.00 109.33 ? 6   LEU A CG    1 
ATOM   31   C CD1   . LEU A 1 34  ? -7.020  21.237 21.696 1.00 111.81 ? 6   LEU A CD1   1 
ATOM   32   C CD2   . LEU A 1 34  ? -6.807  21.775 24.135 1.00 105.76 ? 6   LEU A CD2   1 
ATOM   33   N N     . ILE A 1 35  ? -3.459  25.445 22.022 1.00 84.76  ? 7   ILE A N     1 
ATOM   34   C CA    . ILE A 1 35  ? -2.155  25.940 21.584 1.00 78.56  ? 7   ILE A CA    1 
ATOM   35   C C     . ILE A 1 35  ? -1.467  26.797 22.645 1.00 72.22  ? 7   ILE A C     1 
ATOM   36   O O     . ILE A 1 35  ? -0.298  26.578 22.963 1.00 69.41  ? 7   ILE A O     1 
ATOM   37   C CB    . ILE A 1 35  ? -2.260  26.735 20.264 1.00 68.10  ? 7   ILE A CB    1 
ATOM   38   C CG1   . ILE A 1 35  ? -2.656  25.808 19.112 1.00 61.73  ? 7   ILE A CG1   1 
ATOM   39   C CG2   . ILE A 1 35  ? -0.943  27.427 19.949 1.00 61.80  ? 7   ILE A CG2   1 
ATOM   40   C CD1   . ILE A 1 35  ? -1.688  24.668 18.883 1.00 62.68  ? 7   ILE A CD1   1 
ATOM   41   N N     . ILE A 1 36  ? -2.195  27.767 23.190 1.00 69.09  ? 8   ILE A N     1 
ATOM   42   C CA    . ILE A 1 36  ? -1.644  28.656 24.210 1.00 63.34  ? 8   ILE A CA    1 
ATOM   43   C C     . ILE A 1 36  ? -1.252  27.887 25.472 1.00 56.08  ? 8   ILE A C     1 
ATOM   44   O O     . ILE A 1 36  ? -0.200  28.141 26.061 1.00 52.16  ? 8   ILE A O     1 
ATOM   45   C CB    . ILE A 1 36  ? -2.626  29.792 24.568 1.00 59.49  ? 8   ILE A CB    1 
ATOM   46   C CG1   . ILE A 1 36  ? -2.925  30.645 23.333 1.00 58.22  ? 8   ILE A CG1   1 
ATOM   47   C CG2   . ILE A 1 36  ? -2.058  30.664 25.677 1.00 52.42  ? 8   ILE A CG2   1 
ATOM   48   C CD1   . ILE A 1 36  ? -3.932  31.745 23.579 1.00 46.38  ? 8   ILE A CD1   1 
ATOM   49   N N     . LEU A 1 37  ? -2.094  26.942 25.877 1.00 55.60  ? 9   LEU A N     1 
ATOM   50   C CA    . LEU A 1 37  ? -1.792  26.102 27.031 1.00 57.93  ? 9   LEU A CA    1 
ATOM   51   C C     . LEU A 1 37  ? -0.556  25.238 26.786 1.00 60.94  ? 9   LEU A C     1 
ATOM   52   O O     . LEU A 1 37  ? 0.290   25.090 27.668 1.00 61.02  ? 9   LEU A O     1 
ATOM   53   C CB    . LEU A 1 37  ? -2.993  25.225 27.397 1.00 57.05  ? 9   LEU A CB    1 
ATOM   54   C CG    . LEU A 1 37  ? -4.170  25.932 28.074 1.00 59.14  ? 9   LEU A CG    1 
ATOM   55   C CD1   . LEU A 1 37  ? -5.277  24.945 28.399 1.00 45.00  ? 9   LEU A CD1   1 
ATOM   56   C CD2   . LEU A 1 37  ? -3.711  26.657 29.330 1.00 58.12  ? 9   LEU A CD2   1 
ATOM   57   N N     . LEU A 1 38  ? -0.456  24.674 25.585 1.00 60.10  ? 10  LEU A N     1 
ATOM   58   C CA    . LEU A 1 38  ? 0.694   23.852 25.217 1.00 58.47  ? 10  LEU A CA    1 
ATOM   59   C C     . LEU A 1 38  ? 1.990   24.656 25.210 1.00 63.27  ? 10  LEU A C     1 
ATOM   60   O O     . LEU A 1 38  ? 3.024   24.176 25.672 1.00 67.86  ? 10  LEU A O     1 
ATOM   61   C CB    . LEU A 1 38  ? 0.481   23.187 23.855 1.00 62.78  ? 10  LEU A CB    1 
ATOM   62   C CG    . LEU A 1 38  ? -0.419  21.950 23.829 1.00 72.98  ? 10  LEU A CG    1 
ATOM   63   C CD1   . LEU A 1 38  ? -0.534  21.400 22.416 1.00 76.46  ? 10  LEU A CD1   1 
ATOM   64   C CD2   . LEU A 1 38  ? 0.101   20.885 24.783 1.00 73.79  ? 10  LEU A CD2   1 
ATOM   65   N N     . GLU A 1 39  ? 1.929   25.876 24.683 1.00 63.23  ? 11  GLU A N     1 
ATOM   66   C CA    . GLU A 1 39  ? 3.095   26.756 24.658 1.00 60.20  ? 11  GLU A CA    1 
ATOM   67   C C     . GLU A 1 39  ? 3.590   27.042 26.071 1.00 64.67  ? 11  GLU A C     1 
ATOM   68   O O     . GLU A 1 39  ? 4.795   27.090 26.316 1.00 69.74  ? 11  GLU A O     1 
ATOM   69   C CB    . GLU A 1 39  ? 2.779   28.066 23.933 1.00 56.29  ? 11  GLU A CB    1 
ATOM   70   C CG    . GLU A 1 39  ? 2.586   27.919 22.433 1.00 61.28  ? 11  GLU A CG    1 
ATOM   71   C CD    . GLU A 1 39  ? 2.411   29.254 21.737 1.00 67.00  ? 11  GLU A CD    1 
ATOM   72   O OE1   . GLU A 1 39  ? 2.696   30.294 22.367 1.00 74.00  ? 11  GLU A OE1   1 
ATOM   73   O OE2   . GLU A 1 39  ? 1.989   29.265 20.561 1.00 67.94  ? 11  GLU A OE2   1 
ATOM   74   N N     . CYS A 1 40  ? 2.654   27.228 26.996 1.00 56.56  ? 12  CYS A N     1 
ATOM   75   C CA    . CYS A 1 40  ? 2.996   27.411 28.400 1.00 49.29  ? 12  CYS A CA    1 
ATOM   76   C C     . CYS A 1 40  ? 3.733   26.187 28.925 1.00 59.07  ? 12  CYS A C     1 
ATOM   77   O O     . CYS A 1 40  ? 4.740   26.308 29.620 1.00 65.10  ? 12  CYS A O     1 
ATOM   78   C CB    . CYS A 1 40  ? 1.739   27.659 29.235 1.00 41.29  ? 12  CYS A CB    1 
ATOM   79   S SG    . CYS A 1 40  ? 0.954   29.262 28.965 1.00 57.22  ? 12  CYS A SG    1 
ATOM   80   N N     . ALA A 1 41  ? 3.226   25.008 28.577 1.00 56.87  ? 13  ALA A N     1 
ATOM   81   C CA    . ALA A 1 41  ? 3.817   23.750 29.020 1.00 53.18  ? 13  ALA A CA    1 
ATOM   82   C C     . ALA A 1 41  ? 5.197   23.519 28.408 1.00 50.21  ? 13  ALA A C     1 
ATOM   83   O O     . ALA A 1 41  ? 6.097   23.004 29.069 1.00 48.07  ? 13  ALA A O     1 
ATOM   84   C CB    . ALA A 1 41  ? 2.889   22.588 28.700 1.00 43.83  ? 13  ALA A CB    1 
ATOM   85   N N     . ILE A 1 42  ? 5.360   23.899 27.144 1.00 52.81  ? 14  ILE A N     1 
ATOM   86   C CA    . ILE A 1 42  ? 6.639   23.730 26.462 1.00 60.62  ? 14  ILE A CA    1 
ATOM   87   C C     . ILE A 1 42  ? 7.712   24.632 27.065 1.00 64.78  ? 14  ILE A C     1 
ATOM   88   O O     . ILE A 1 42  ? 8.796   24.167 27.415 1.00 70.07  ? 14  ILE A O     1 
ATOM   89   C CB    . ILE A 1 42  ? 6.526   23.999 24.946 1.00 57.33  ? 14  ILE A CB    1 
ATOM   90   C CG1   . ILE A 1 42  ? 5.591   22.981 24.292 1.00 54.72  ? 14  ILE A CG1   1 
ATOM   91   C CG2   . ILE A 1 42  ? 7.898   23.940 24.289 1.00 49.05  ? 14  ILE A CG2   1 
ATOM   92   C CD1   . ILE A 1 42  ? 5.426   23.174 22.799 1.00 58.16  ? 14  ILE A CD1   1 
ATOM   93   N N     . PHE A 1 43  ? 7.402   25.919 27.192 1.00 61.26  ? 15  PHE A N     1 
ATOM   94   C CA    . PHE A 1 43  ? 8.341   26.873 27.778 1.00 61.86  ? 15  PHE A CA    1 
ATOM   95   C C     . PHE A 1 43  ? 8.621   26.562 29.246 1.00 57.54  ? 15  PHE A C     1 
ATOM   96   O O     . PHE A 1 43  ? 9.671   26.923 29.776 1.00 57.66  ? 15  PHE A O     1 
ATOM   97   C CB    . PHE A 1 43  ? 7.841   28.311 27.612 1.00 40.05  ? 15  PHE A CB    1 
ATOM   98   C CG    . PHE A 1 43  ? 8.033   28.861 26.228 1.00 57.28  ? 15  PHE A CG    1 
ATOM   99   C CD1   . PHE A 1 43  ? 9.294   29.223 25.782 1.00 52.32  ? 15  PHE A CD1   1 
ATOM   100  C CD2   . PHE A 1 43  ? 6.956   29.019 25.372 1.00 57.77  ? 15  PHE A CD2   1 
ATOM   101  C CE1   . PHE A 1 43  ? 9.476   29.727 24.506 1.00 48.84  ? 15  PHE A CE1   1 
ATOM   102  C CE2   . PHE A 1 43  ? 7.131   29.524 24.097 1.00 55.50  ? 15  PHE A CE2   1 
ATOM   103  C CZ    . PHE A 1 43  ? 8.394   29.879 23.664 1.00 50.71  ? 15  PHE A CZ    1 
ATOM   104  N N     . ALA A 1 44  ? 7.678   25.887 29.898 1.00 56.68  ? 16  ALA A N     1 
ATOM   105  C CA    . ALA A 1 44  ? 7.881   25.426 31.265 1.00 54.76  ? 16  ALA A CA    1 
ATOM   106  C C     . ALA A 1 44  ? 8.886   24.280 31.281 1.00 60.88  ? 16  ALA A C     1 
ATOM   107  O O     . ALA A 1 44  ? 9.750   24.209 32.156 1.00 63.46  ? 16  ALA A O     1 
ATOM   108  C CB    . ALA A 1 44  ? 6.563   24.987 31.881 1.00 45.61  ? 16  ALA A CB    1 
ATOM   109  N N     . ALA A 1 45  ? 8.765   23.386 30.304 1.00 54.47  ? 17  ALA A N     1 
ATOM   110  C CA    . ALA A 1 45  ? 9.667   22.248 30.185 1.00 54.93  ? 17  ALA A CA    1 
ATOM   111  C C     . ALA A 1 45  ? 11.079  22.703 29.830 1.00 61.15  ? 17  ALA A C     1 
ATOM   112  O O     . ALA A 1 45  ? 12.060  22.187 30.367 1.00 42.76  ? 17  ALA A O     1 
ATOM   113  C CB    . ALA A 1 45  ? 9.145   21.266 29.148 1.00 44.29  ? 17  ALA A CB    1 
ATOM   114  N N     . VAL A 1 46  ? 11.174  23.671 28.923 1.00 57.65  ? 18  VAL A N     1 
ATOM   115  C CA    . VAL A 1 46  ? 12.463  24.231 28.532 1.00 56.36  ? 18  VAL A CA    1 
ATOM   116  C C     . VAL A 1 46  ? 13.131  24.911 29.724 1.00 63.56  ? 18  VAL A C     1 
ATOM   117  O O     . VAL A 1 46  ? 14.337  24.773 29.935 1.00 69.54  ? 18  VAL A O     1 
ATOM   118  C CB    . VAL A 1 46  ? 12.314  25.236 27.372 1.00 49.47  ? 18  VAL A CB    1 
ATOM   119  C CG1   . VAL A 1 46  ? 13.651  25.882 27.045 1.00 42.45  ? 18  VAL A CG1   1 
ATOM   120  C CG2   . VAL A 1 46  ? 11.741  24.546 26.146 1.00 46.63  ? 18  VAL A CG2   1 
ATOM   121  N N     . ALA A 1 47  ? 12.336  25.636 30.507 1.00 58.55  ? 19  ALA A N     1 
ATOM   122  C CA    . ALA A 1 47  ? 12.838  26.296 31.709 1.00 49.98  ? 19  ALA A CA    1 
ATOM   123  C C     . ALA A 1 47  ? 13.356  25.273 32.713 1.00 50.04  ? 19  ALA A C     1 
ATOM   124  O O     . ALA A 1 47  ? 14.376  25.491 33.366 1.00 59.94  ? 19  ALA A O     1 
ATOM   125  C CB    . ALA A 1 47  ? 11.751  27.157 32.337 1.00 38.24  ? 19  ALA A CB    1 
ATOM   126  N N     . MET A 1 48  ? 12.649  24.153 32.825 1.00 45.35  ? 20  MET A N     1 
ATOM   127  C CA    . MET A 1 48  ? 13.038  23.085 33.737 1.00 50.88  ? 20  MET A CA    1 
ATOM   128  C C     . MET A 1 48  ? 14.329  22.414 33.275 1.00 55.25  ? 20  MET A C     1 
ATOM   129  O O     . MET A 1 48  ? 15.137  21.974 34.094 1.00 51.88  ? 20  MET A O     1 
ATOM   130  C CB    . MET A 1 48  ? 11.915  22.051 33.857 1.00 53.84  ? 20  MET A CB    1 
ATOM   131  C CG    . MET A 1 48  ? 12.093  21.059 34.996 1.00 48.61  ? 20  MET A CG    1 
ATOM   132  S SD    . MET A 1 48  ? 12.116  21.856 36.614 1.00 48.12  ? 20  MET A SD    1 
ATOM   133  C CE    . MET A 1 48  ? 13.810  21.564 37.115 1.00 52.10  ? 20  MET A CE    1 
ATOM   134  N N     . VAL A 1 49  ? 14.517  22.336 31.961 1.00 56.78  ? 21  VAL A N     1 
ATOM   135  C CA    . VAL A 1 49  ? 15.737  21.773 31.393 1.00 54.88  ? 21  VAL A CA    1 
ATOM   136  C C     . VAL A 1 49  ? 16.928  22.675 31.700 1.00 57.86  ? 21  VAL A C     1 
ATOM   137  O O     . VAL A 1 49  ? 17.994  22.200 32.099 1.00 61.17  ? 21  VAL A O     1 
ATOM   138  C CB    . VAL A 1 49  ? 15.614  21.568 29.866 1.00 56.44  ? 21  VAL A CB    1 
ATOM   139  C CG1   . VAL A 1 49  ? 16.970  21.264 29.251 1.00 45.63  ? 21  VAL A CG1   1 
ATOM   140  C CG2   . VAL A 1 49  ? 14.628  20.453 29.558 1.00 45.64  ? 21  VAL A CG2   1 
ATOM   141  N N     . LEU A 1 50  ? 16.734  23.979 31.530 1.00 54.25  ? 22  LEU A N     1 
ATOM   142  C CA    . LEU A 1 50  ? 17.786  24.955 31.799 1.00 55.99  ? 22  LEU A CA    1 
ATOM   143  C C     . LEU A 1 50  ? 18.172  24.973 33.276 1.00 53.60  ? 22  LEU A C     1 
ATOM   144  O O     . LEU A 1 50  ? 19.277  25.379 33.634 1.00 58.13  ? 22  LEU A O     1 
ATOM   145  C CB    . LEU A 1 50  ? 17.354  26.354 31.345 1.00 47.28  ? 22  LEU A CB    1 
ATOM   146  C CG    . LEU A 1 50  ? 17.108  26.537 29.844 1.00 46.39  ? 22  LEU A CG    1 
ATOM   147  C CD1   . LEU A 1 50  ? 16.708  27.969 29.529 1.00 40.88  ? 22  LEU A CD1   1 
ATOM   148  C CD2   . LEU A 1 50  ? 18.336  26.136 29.041 1.00 41.66  ? 22  LEU A CD2   1 
ATOM   149  N N     . SER A 1 51  ? 17.257  24.521 34.128 1.00 47.41  ? 23  SER A N     1 
ATOM   150  C CA    . SER A 1 51  ? 17.498  24.471 35.566 1.00 50.41  ? 23  SER A CA    1 
ATOM   151  C C     . SER A 1 51  ? 18.546  23.425 35.933 1.00 57.22  ? 23  SER A C     1 
ATOM   152  O O     . SER A 1 51  ? 19.076  23.432 37.044 1.00 62.99  ? 23  SER A O     1 
ATOM   153  C CB    . SER A 1 51  ? 16.197  24.192 36.318 1.00 55.76  ? 23  SER A CB    1 
ATOM   154  O OG    . SER A 1 51  ? 15.283  25.265 36.168 1.00 63.99  ? 23  SER A OG    1 
ATOM   155  N N     . PHE A 1 52  ? 18.837  22.526 34.999 1.00 61.64  ? 24  PHE A N     1 
ATOM   156  C CA    . PHE A 1 52  ? 19.867  21.514 35.208 1.00 62.76  ? 24  PHE A CA    1 
ATOM   157  C C     . PHE A 1 52  ? 21.244  22.034 34.806 1.00 65.60  ? 24  PHE A C     1 
ATOM   158  O O     . PHE A 1 52  ? 22.226  21.293 34.814 1.00 63.11  ? 24  PHE A O     1 
ATOM   159  C CB    . PHE A 1 52  ? 19.527  20.227 34.454 1.00 55.33  ? 24  PHE A CB    1 
ATOM   160  C CG    . PHE A 1 52  ? 18.498  19.381 35.144 1.00 59.12  ? 24  PHE A CG    1 
ATOM   161  C CD1   . PHE A 1 52  ? 17.148  19.647 34.994 1.00 68.41  ? 24  PHE A CD1   1 
ATOM   162  C CD2   . PHE A 1 52  ? 18.882  18.323 35.951 1.00 63.34  ? 24  PHE A CD2   1 
ATOM   163  C CE1   . PHE A 1 52  ? 16.197  18.870 35.632 1.00 72.12  ? 24  PHE A CE1   1 
ATOM   164  C CE2   . PHE A 1 52  ? 17.939  17.542 36.592 1.00 70.34  ? 24  PHE A CE2   1 
ATOM   165  C CZ    . PHE A 1 52  ? 16.594  17.817 36.432 1.00 73.43  ? 24  PHE A CZ    1 
ATOM   166  N N     . ILE A 1 53  ? 21.300  23.313 34.449 1.00 65.55  ? 25  ILE A N     1 
ATOM   167  C CA    . ILE A 1 53  ? 22.563  23.990 34.193 1.00 65.84  ? 25  ILE A CA    1 
ATOM   168  C C     . ILE A 1 53  ? 22.909  24.841 35.409 1.00 68.27  ? 25  ILE A C     1 
ATOM   169  O O     . ILE A 1 53  ? 22.377  25.938 35.575 1.00 73.89  ? 25  ILE A O     1 
ATOM   170  C CB    . ILE A 1 53  ? 22.487  24.876 32.936 1.00 59.15  ? 25  ILE A CB    1 
ATOM   171  C CG1   . ILE A 1 53  ? 22.128  24.031 31.712 1.00 49.65  ? 25  ILE A CG1   1 
ATOM   172  C CG2   . ILE A 1 53  ? 23.803  25.603 32.711 1.00 55.58  ? 25  ILE A CG2   1 
ATOM   173  C CD1   . ILE A 1 53  ? 22.053  24.821 30.424 1.00 48.47  ? 25  ILE A CD1   1 
ATOM   174  N N     . PRO A 1 54  ? 23.798  24.327 36.271 1.00 71.25  ? 26  PRO A N     1 
ATOM   175  C CA    . PRO A 1 54  ? 24.101  24.949 37.565 1.00 72.47  ? 26  PRO A CA    1 
ATOM   176  C C     . PRO A 1 54  ? 24.937  26.224 37.462 1.00 67.96  ? 26  PRO A C     1 
ATOM   177  O O     . PRO A 1 54  ? 26.088  26.183 37.027 1.00 79.09  ? 26  PRO A O     1 
ATOM   178  C CB    . PRO A 1 54  ? 24.890  23.860 38.295 1.00 72.62  ? 26  PRO A CB    1 
ATOM   179  C CG    . PRO A 1 54  ? 25.539  23.081 37.207 1.00 70.52  ? 26  PRO A CG    1 
ATOM   180  C CD    . PRO A 1 54  ? 24.572  23.091 36.056 1.00 70.62  ? 26  PRO A CD    1 
ATOM   181  N N     . LEU A 1 55  ? 24.348  27.347 37.859 1.00 50.33  ? 27  LEU A N     1 
ATOM   182  C CA    . LEU A 1 55  ? 25.085  28.597 38.001 1.00 55.08  ? 27  LEU A CA    1 
ATOM   183  C C     . LEU A 1 55  ? 24.936  29.085 39.436 1.00 60.21  ? 27  LEU A C     1 
ATOM   184  O O     . LEU A 1 55  ? 24.462  30.194 39.683 1.00 55.67  ? 27  LEU A O     1 
ATOM   185  C CB    . LEU A 1 55  ? 24.581  29.657 37.018 1.00 50.08  ? 27  LEU A CB    1 
ATOM   186  C CG    . LEU A 1 55  ? 25.196  29.679 35.613 1.00 45.77  ? 27  LEU A CG    1 
ATOM   187  C CD1   . LEU A 1 55  ? 24.839  28.432 34.824 1.00 47.88  ? 27  LEU A CD1   1 
ATOM   188  C CD2   . LEU A 1 55  ? 24.765  30.926 34.857 1.00 46.34  ? 27  LEU A CD2   1 
ATOM   189  N N     . ASP A 1 56  ? 25.346  28.242 40.379 1.00 62.32  ? 28  ASP A N     1 
ATOM   190  C CA    . ASP A 1 56  ? 25.119  28.499 41.795 1.00 55.23  ? 28  ASP A CA    1 
ATOM   191  C C     . ASP A 1 56  ? 26.412  28.789 42.546 1.00 54.88  ? 28  ASP A C     1 
ATOM   192  O O     . ASP A 1 56  ? 27.461  28.228 42.238 1.00 52.85  ? 28  ASP A O     1 
ATOM   193  C CB    . ASP A 1 56  ? 24.428  27.295 42.442 1.00 56.89  ? 28  ASP A CB    1 
ATOM   194  C CG    . ASP A 1 56  ? 23.332  26.709 41.572 1.00 62.30  ? 28  ASP A CG    1 
ATOM   195  O OD1   . ASP A 1 56  ? 22.600  27.485 40.923 1.00 75.20  ? 28  ASP A OD1   1 
ATOM   196  O OD2   . ASP A 1 56  ? 23.206  25.467 41.535 1.00 55.53  ? 28  ASP A OD2   1 
ATOM   197  N N     . ILE A 1 57  ? 26.325  29.673 43.534 1.00 64.79  ? 29  ILE A N     1 
ATOM   198  C CA    . ILE A 1 57  ? 27.411  29.882 44.483 1.00 62.25  ? 29  ILE A CA    1 
ATOM   199  C C     . ILE A 1 57  ? 26.859  29.681 45.888 1.00 68.12  ? 29  ILE A C     1 
ATOM   200  O O     . ILE A 1 57  ? 26.371  30.621 46.517 1.00 76.16  ? 29  ILE A O     1 
ATOM   201  C CB    . ILE A 1 57  ? 28.024  31.290 44.366 1.00 55.19  ? 29  ILE A CB    1 
ATOM   202  C CG1   . ILE A 1 57  ? 28.461  31.567 42.928 1.00 52.95  ? 29  ILE A CG1   1 
ATOM   203  C CG2   . ILE A 1 57  ? 29.207  31.435 45.311 1.00 39.74  ? 29  ILE A CG2   1 
ATOM   204  C CD1   . ILE A 1 57  ? 29.055  32.944 42.726 1.00 57.65  ? 29  ILE A CD1   1 
ATOM   205  N N     . GLY A 1 58  ? 26.925  28.445 46.369 1.00 63.94  ? 30  GLY A N     1 
ATOM   206  C CA    . GLY A 1 58  ? 26.344  28.098 47.651 1.00 60.97  ? 30  GLY A CA    1 
ATOM   207  C C     . GLY A 1 58  ? 24.889  27.705 47.496 1.00 68.92  ? 30  GLY A C     1 
ATOM   208  O O     . GLY A 1 58  ? 24.482  27.212 46.444 1.00 72.26  ? 30  GLY A O     1 
ATOM   209  N N     . SER A 1 59  ? 24.099  27.931 48.540 1.00 75.93  ? 31  SER A N     1 
ATOM   210  C CA    . SER A 1 59  ? 22.686  27.569 48.519 1.00 75.14  ? 31  SER A CA    1 
ATOM   211  C C     . SER A 1 59  ? 21.791  28.799 48.433 1.00 68.29  ? 31  SER A C     1 
ATOM   212  O O     . SER A 1 59  ? 20.570  28.680 48.338 1.00 64.60  ? 31  SER A O     1 
ATOM   213  C CB    . SER A 1 59  ? 22.326  26.761 49.766 1.00 71.53  ? 31  SER A CB    1 
ATOM   214  O OG    . SER A 1 59  ? 22.483  27.544 50.938 1.00 65.46  ? 31  SER A OG    1 
ATOM   215  N N     . SER A 1 60  ? 22.401  29.980 48.462 1.00 61.57  ? 32  SER A N     1 
ATOM   216  C CA    . SER A 1 60  ? 21.639  31.222 48.526 1.00 51.39  ? 32  SER A CA    1 
ATOM   217  C C     . SER A 1 60  ? 21.833  32.115 47.303 1.00 47.89  ? 32  SER A C     1 
ATOM   218  O O     . SER A 1 60  ? 21.121  33.105 47.135 1.00 55.61  ? 32  SER A O     1 
ATOM   219  C CB    . SER A 1 60  ? 21.979  31.987 49.806 1.00 47.62  ? 32  SER A CB    1 
ATOM   220  O OG    . SER A 1 60  ? 21.698  31.198 50.949 1.00 45.11  ? 32  SER A OG    1 
ATOM   221  N N     . PHE A 1 61  ? 22.798  31.771 46.456 1.00 38.21  ? 33  PHE A N     1 
ATOM   222  C CA    . PHE A 1 61  ? 22.978  32.485 45.196 1.00 42.82  ? 33  PHE A CA    1 
ATOM   223  C C     . PHE A 1 61  ? 22.869  31.546 44.003 1.00 45.38  ? 33  PHE A C     1 
ATOM   224  O O     . PHE A 1 61  ? 23.448  30.460 43.998 1.00 47.76  ? 33  PHE A O     1 
ATOM   225  C CB    . PHE A 1 61  ? 24.314  33.232 45.151 1.00 56.60  ? 33  PHE A CB    1 
ATOM   226  C CG    . PHE A 1 61  ? 24.521  34.016 43.881 1.00 48.35  ? 33  PHE A CG    1 
ATOM   227  C CD1   . PHE A 1 61  ? 24.028  35.306 43.760 1.00 42.38  ? 33  PHE A CD1   1 
ATOM   228  C CD2   . PHE A 1 61  ? 25.197  33.459 42.806 1.00 38.85  ? 33  PHE A CD2   1 
ATOM   229  C CE1   . PHE A 1 61  ? 24.208  36.026 42.594 1.00 40.21  ? 33  PHE A CE1   1 
ATOM   230  C CE2   . PHE A 1 61  ? 25.378  34.173 41.637 1.00 37.95  ? 33  PHE A CE2   1 
ATOM   231  C CZ    . PHE A 1 61  ? 24.885  35.459 41.532 1.00 43.57  ? 33  PHE A CZ    1 
ATOM   232  N N     . SER A 1 62  ? 22.131  31.983 42.989 1.00 45.44  ? 34  SER A N     1 
ATOM   233  C CA    . SER A 1 62  ? 21.930  31.192 41.784 1.00 45.53  ? 34  SER A CA    1 
ATOM   234  C C     . SER A 1 62  ? 21.380  32.052 40.655 1.00 49.02  ? 34  SER A C     1 
ATOM   235  O O     . SER A 1 62  ? 20.488  32.875 40.862 1.00 55.05  ? 34  SER A O     1 
ATOM   236  C CB    . SER A 1 62  ? 20.972  30.031 42.058 1.00 54.17  ? 34  SER A CB    1 
ATOM   237  O OG    . SER A 1 62  ? 20.728  29.281 40.879 1.00 57.47  ? 34  SER A OG    1 
ATOM   238  N N     . ILE A 1 63  ? 21.920  31.856 39.458 1.00 50.83  ? 35  ILE A N     1 
ATOM   239  C CA    . ILE A 1 63  ? 21.398  32.513 38.270 1.00 51.82  ? 35  ILE A CA    1 
ATOM   240  C C     . ILE A 1 63  ? 20.386  31.600 37.583 1.00 48.25  ? 35  ILE A C     1 
ATOM   241  O O     . ILE A 1 63  ? 20.737  30.533 37.080 1.00 47.65  ? 35  ILE A O     1 
ATOM   242  C CB    . ILE A 1 63  ? 22.522  32.876 37.291 1.00 57.20  ? 35  ILE A CB    1 
ATOM   243  C CG1   . ILE A 1 63  ? 23.422  33.956 37.897 1.00 54.58  ? 35  ILE A CG1   1 
ATOM   244  C CG2   . ILE A 1 63  ? 21.940  33.346 35.977 1.00 34.69  ? 35  ILE A CG2   1 
ATOM   245  C CD1   . ILE A 1 63  ? 24.550  34.396 36.989 1.00 51.36  ? 35  ILE A CD1   1 
ATOM   246  N N     . SER A 1 64  ? 19.126  32.020 37.578 1.00 33.87  ? 36  SER A N     1 
ATOM   247  C CA    . SER A 1 64  ? 18.052  31.201 37.033 1.00 34.09  ? 36  SER A CA    1 
ATOM   248  C C     . SER A 1 64  ? 17.892  31.411 35.530 1.00 50.32  ? 36  SER A C     1 
ATOM   249  O O     . SER A 1 64  ? 17.187  32.320 35.091 1.00 50.78  ? 36  SER A O     1 
ATOM   250  C CB    . SER A 1 64  ? 16.737  31.504 37.755 1.00 38.59  ? 36  SER A CB    1 
ATOM   251  O OG    . SER A 1 64  ? 15.698  30.654 37.303 1.00 48.00  ? 36  SER A OG    1 
ATOM   252  N N     . LEU A 1 65  ? 18.546  30.559 34.746 1.00 49.85  ? 37  LEU A N     1 
ATOM   253  C CA    . LEU A 1 65  ? 18.470  30.638 33.291 1.00 53.83  ? 37  LEU A CA    1 
ATOM   254  C C     . LEU A 1 65  ? 17.077  30.283 32.779 1.00 56.72  ? 37  LEU A C     1 
ATOM   255  O O     . LEU A 1 65  ? 16.743  30.555 31.626 1.00 67.81  ? 37  LEU A O     1 
ATOM   256  C CB    . LEU A 1 65  ? 19.509  29.718 32.646 1.00 49.83  ? 37  LEU A CB    1 
ATOM   257  C CG    . LEU A 1 65  ? 20.978  30.011 32.955 1.00 53.22  ? 37  LEU A CG    1 
ATOM   258  C CD1   . LEU A 1 65  ? 21.880  29.045 32.205 1.00 48.22  ? 37  LEU A CD1   1 
ATOM   259  C CD2   . LEU A 1 65  ? 21.324  31.452 32.610 1.00 60.76  ? 37  LEU A CD2   1 
ATOM   260  N N     . GLY A 1 66  ? 16.268  29.676 33.643 1.00 46.55  ? 38  GLY A N     1 
ATOM   261  C CA    . GLY A 1 66  ? 14.926  29.266 33.278 1.00 47.23  ? 38  GLY A CA    1 
ATOM   262  C C     . GLY A 1 66  ? 13.957  30.425 33.133 1.00 54.16  ? 38  GLY A C     1 
ATOM   263  O O     . GLY A 1 66  ? 12.815  30.239 32.714 1.00 60.92  ? 38  GLY A O     1 
ATOM   264  N N     . MET A 1 67  ? 14.409  31.624 33.486 1.00 47.66  ? 39  MET A N     1 
ATOM   265  C CA    . MET A 1 67  ? 13.587  32.818 33.335 1.00 47.73  ? 39  MET A CA    1 
ATOM   266  C C     . MET A 1 67  ? 13.546  33.266 31.877 1.00 49.52  ? 39  MET A C     1 
ATOM   267  O O     . MET A 1 67  ? 12.653  34.009 31.471 1.00 46.75  ? 39  MET A O     1 
ATOM   268  C CB    . MET A 1 67  ? 14.104  33.949 34.227 1.00 46.19  ? 39  MET A CB    1 
ATOM   269  C CG    . MET A 1 67  ? 13.967  33.673 35.715 1.00 48.29  ? 39  MET A CG    1 
ATOM   270  S SD    . MET A 1 67  ? 12.252  33.524 36.251 1.00 49.13  ? 39  MET A SD    1 
ATOM   271  C CE    . MET A 1 67  ? 11.635  35.165 35.882 1.00 31.95  ? 39  MET A CE    1 
ATOM   272  N N     . ILE A 1 68  ? 14.518  32.808 31.094 1.00 49.59  ? 40  ILE A N     1 
ATOM   273  C CA    . ILE A 1 68  ? 14.554  33.116 29.666 1.00 43.76  ? 40  ILE A CA    1 
ATOM   274  C C     . ILE A 1 68  ? 13.335  32.566 28.908 1.00 42.74  ? 40  ILE A C     1 
ATOM   275  O O     . ILE A 1 68  ? 12.698  33.309 28.162 1.00 48.45  ? 40  ILE A O     1 
ATOM   276  C CB    . ILE A 1 68  ? 15.885  32.674 28.999 1.00 44.97  ? 40  ILE A CB    1 
ATOM   277  C CG1   . ILE A 1 68  ? 17.071  33.393 29.651 1.00 46.70  ? 40  ILE A CG1   1 
ATOM   278  C CG2   . ILE A 1 68  ? 15.847  32.931 27.499 1.00 38.48  ? 40  ILE A CG2   1 
ATOM   279  C CD1   . ILE A 1 68  ? 18.421  32.985 29.100 1.00 37.62  ? 40  ILE A CD1   1 
ATOM   280  N N     . PRO A 1 69  ? 12.996  31.273 29.097 1.00 45.61  ? 41  PRO A N     1 
ATOM   281  C CA    . PRO A 1 69  ? 11.749  30.816 28.473 1.00 51.84  ? 41  PRO A CA    1 
ATOM   282  C C     . PRO A 1 69  ? 10.521  31.475 29.098 1.00 58.62  ? 41  PRO A C     1 
ATOM   283  O O     . PRO A 1 69  ? 9.495   31.617 28.434 1.00 64.86  ? 41  PRO A O     1 
ATOM   284  C CB    . PRO A 1 69  ? 11.737  29.313 28.767 1.00 54.35  ? 41  PRO A CB    1 
ATOM   285  C CG    . PRO A 1 69  ? 13.159  28.959 29.000 1.00 53.13  ? 41  PRO A CG    1 
ATOM   286  C CD    . PRO A 1 69  ? 13.746  30.148 29.686 1.00 45.16  ? 41  PRO A CD    1 
ATOM   287  N N     . MET A 1 70  ? 10.629  31.868 30.363 1.00 54.18  ? 42  MET A N     1 
ATOM   288  C CA    . MET A 1 70  ? 9.530   32.540 31.045 1.00 45.90  ? 42  MET A CA    1 
ATOM   289  C C     . MET A 1 70  ? 9.289   33.929 30.468 1.00 45.14  ? 42  MET A C     1 
ATOM   290  O O     . MET A 1 70  ? 8.150   34.378 30.369 1.00 50.92  ? 42  MET A O     1 
ATOM   291  C CB    . MET A 1 70  ? 9.805   32.640 32.546 1.00 47.80  ? 42  MET A CB    1 
ATOM   292  C CG    . MET A 1 70  ? 9.743   31.315 33.289 1.00 60.96  ? 42  MET A CG    1 
ATOM   293  S SD    . MET A 1 70  ? 8.126   30.518 33.194 1.00 44.23  ? 42  MET A SD    1 
ATOM   294  C CE    . MET A 1 70  ? 8.447   29.228 31.993 1.00 38.32  ? 42  MET A CE    1 
ATOM   295  N N     . TYR A 1 71  ? 10.367  34.606 30.090 1.00 49.10  ? 43  TYR A N     1 
ATOM   296  C CA    . TYR A 1 71  ? 10.268  35.965 29.572 1.00 51.73  ? 43  TYR A CA    1 
ATOM   297  C C     . TYR A 1 71  ? 9.630   36.027 28.187 1.00 51.50  ? 43  TYR A C     1 
ATOM   298  O O     . TYR A 1 71  ? 8.801   36.897 27.921 1.00 50.77  ? 43  TYR A O     1 
ATOM   299  C CB    . TYR A 1 71  ? 11.639  36.645 29.568 1.00 52.08  ? 43  TYR A CB    1 
ATOM   300  C CG    . TYR A 1 71  ? 12.072  37.121 30.935 1.00 55.18  ? 43  TYR A CG    1 
ATOM   301  C CD1   . TYR A 1 71  ? 11.134  37.385 31.924 1.00 53.23  ? 43  TYR A CD1   1 
ATOM   302  C CD2   . TYR A 1 71  ? 13.415  37.304 31.239 1.00 58.92  ? 43  TYR A CD2   1 
ATOM   303  C CE1   . TYR A 1 71  ? 11.519  37.820 33.176 1.00 48.55  ? 43  TYR A CE1   1 
ATOM   304  C CE2   . TYR A 1 71  ? 13.811  37.741 32.490 1.00 33.33  ? 43  TYR A CE2   1 
ATOM   305  C CZ    . TYR A 1 71  ? 12.857  37.997 33.454 1.00 46.25  ? 43  TYR A CZ    1 
ATOM   306  O OH    . TYR A 1 71  ? 13.239  38.430 34.702 1.00 46.96  ? 43  TYR A OH    1 
ATOM   307  N N     . VAL A 1 72  ? 10.013  35.109 27.306 1.00 48.90  ? 44  VAL A N     1 
ATOM   308  C CA    . VAL A 1 72  ? 9.449   35.089 25.961 1.00 53.56  ? 44  VAL A CA    1 
ATOM   309  C C     . VAL A 1 72  ? 7.958   34.750 25.980 1.00 52.98  ? 44  VAL A C     1 
ATOM   310  O O     . VAL A 1 72  ? 7.158   35.438 25.348 1.00 58.61  ? 44  VAL A O     1 
ATOM   311  C CB    . VAL A 1 72  ? 10.226  34.146 25.007 1.00 58.01  ? 44  VAL A CB    1 
ATOM   312  C CG1   . VAL A 1 72  ? 10.605  32.859 25.707 1.00 65.48  ? 44  VAL A CG1   1 
ATOM   313  C CG2   . VAL A 1 72  ? 9.418   33.866 23.746 1.00 54.03  ? 44  VAL A CG2   1 
ATOM   314  N N     . ILE A 1 73  ? 7.583   33.711 26.723 1.00 47.01  ? 45  ILE A N     1 
ATOM   315  C CA    . ILE A 1 73  ? 6.177   33.320 26.823 1.00 52.42  ? 45  ILE A CA    1 
ATOM   316  C C     . ILE A 1 73  ? 5.332   34.417 27.481 1.00 51.97  ? 45  ILE A C     1 
ATOM   317  O O     . ILE A 1 73  ? 4.148   34.566 27.178 1.00 46.82  ? 45  ILE A O     1 
ATOM   318  C CB    . ILE A 1 73  ? 5.997   31.966 27.564 1.00 41.07  ? 45  ILE A CB    1 
ATOM   319  C CG1   . ILE A 1 73  ? 4.567   31.446 27.404 1.00 42.93  ? 45  ILE A CG1   1 
ATOM   320  C CG2   . ILE A 1 73  ? 6.354   32.091 29.035 1.00 45.32  ? 45  ILE A CG2   1 
ATOM   321  C CD1   . ILE A 1 73  ? 4.167   31.192 25.970 1.00 49.39  ? 45  ILE A CD1   1 
ATOM   322  N N     . ALA A 1 74  ? 5.953   35.192 28.366 1.00 55.10  ? 46  ALA A N     1 
ATOM   323  C CA    . ALA A 1 74  ? 5.282   36.313 29.013 1.00 44.94  ? 46  ALA A CA    1 
ATOM   324  C C     . ALA A 1 74  ? 5.015   37.417 28.002 1.00 46.75  ? 46  ALA A C     1 
ATOM   325  O O     . ALA A 1 74  ? 3.970   38.062 28.034 1.00 48.94  ? 46  ALA A O     1 
ATOM   326  C CB    . ALA A 1 74  ? 6.122   36.843 30.162 1.00 39.84  ? 46  ALA A CB    1 
ATOM   327  N N     . ILE A 1 75  ? 5.973   37.632 27.108 1.00 49.75  ? 47  ILE A N     1 
ATOM   328  C CA    . ILE A 1 75  ? 5.838   38.631 26.057 1.00 51.37  ? 47  ILE A CA    1 
ATOM   329  C C     . ILE A 1 75  ? 4.926   38.117 24.950 1.00 53.08  ? 47  ILE A C     1 
ATOM   330  O O     . ILE A 1 75  ? 4.052   38.834 24.461 1.00 59.27  ? 47  ILE A O     1 
ATOM   331  C CB    . ILE A 1 75  ? 7.214   38.994 25.461 1.00 52.36  ? 47  ILE A CB    1 
ATOM   332  C CG1   . ILE A 1 75  ? 8.094   39.659 26.522 1.00 45.38  ? 47  ILE A CG1   1 
ATOM   333  C CG2   . ILE A 1 75  ? 7.058   39.903 24.250 1.00 52.68  ? 47  ILE A CG2   1 
ATOM   334  C CD1   . ILE A 1 75  ? 9.509   39.926 26.065 1.00 41.02  ? 47  ILE A CD1   1 
ATOM   335  N N     . ARG A 1 76  ? 5.128   36.859 24.574 1.00 51.82  ? 48  ARG A N     1 
ATOM   336  C CA    . ARG A 1 76  ? 4.395   36.247 23.472 1.00 58.73  ? 48  ARG A CA    1 
ATOM   337  C C     . ARG A 1 76  ? 2.902   36.084 23.760 1.00 66.16  ? 48  ARG A C     1 
ATOM   338  O O     . ARG A 1 76  ? 2.070   36.269 22.870 1.00 72.40  ? 48  ARG A O     1 
ATOM   339  C CB    . ARG A 1 76  ? 5.019   34.891 23.125 1.00 61.53  ? 48  ARG A CB    1 
ATOM   340  C CG    . ARG A 1 76  ? 4.293   34.110 22.046 1.00 69.05  ? 48  ARG A CG    1 
ATOM   341  C CD    . ARG A 1 76  ? 4.990   32.787 21.769 1.00 65.94  ? 48  ARG A CD    1 
ATOM   342  N NE    . ARG A 1 76  ? 4.248   31.974 20.810 1.00 69.99  ? 48  ARG A NE    1 
ATOM   343  C CZ    . ARG A 1 76  ? 4.396   32.052 19.492 1.00 65.33  ? 48  ARG A CZ    1 
ATOM   344  N NH1   . ARG A 1 76  ? 5.264   32.908 18.970 1.00 60.58  ? 48  ARG A NH1   1 
ATOM   345  N NH2   . ARG A 1 76  ? 3.676   31.274 18.696 1.00 67.69  ? 48  ARG A NH2   1 
ATOM   346  N N     . ARG A 1 77  ? 2.561   35.747 25.001 1.00 60.24  ? 49  ARG A N     1 
ATOM   347  C CA    . ARG A 1 77  ? 1.176   35.415 25.329 1.00 54.86  ? 49  ARG A CA    1 
ATOM   348  C C     . ARG A 1 77  ? 0.532   36.308 26.393 1.00 53.69  ? 49  ARG A C     1 
ATOM   349  O O     . ARG A 1 77  ? -0.686  36.488 26.399 1.00 57.53  ? 49  ARG A O     1 
ATOM   350  C CB    . ARG A 1 77  ? 1.059   33.939 25.718 1.00 54.35  ? 49  ARG A CB    1 
ATOM   351  C CG    . ARG A 1 77  ? 1.322   32.977 24.570 1.00 56.08  ? 49  ARG A CG    1 
ATOM   352  C CD    . ARG A 1 77  ? 0.344   33.204 23.429 1.00 63.59  ? 49  ARG A CD    1 
ATOM   353  N NE    . ARG A 1 77  ? 0.600   32.316 22.299 1.00 66.64  ? 49  ARG A NE    1 
ATOM   354  C CZ    . ARG A 1 77  ? -0.142  32.275 21.197 1.00 64.13  ? 49  ARG A CZ    1 
ATOM   355  N NH1   . ARG A 1 77  ? -1.193  33.073 21.074 1.00 56.49  ? 49  ARG A NH1   1 
ATOM   356  N NH2   . ARG A 1 77  ? 0.166   31.435 20.218 1.00 65.38  ? 49  ARG A NH2   1 
ATOM   357  N N     . GLY A 1 78  ? 1.337   36.859 27.295 1.00 46.14  ? 50  GLY A N     1 
ATOM   358  C CA    . GLY A 1 78  ? 0.821   37.814 28.261 1.00 49.92  ? 50  GLY A CA    1 
ATOM   359  C C     . GLY A 1 78  ? 0.880   37.406 29.723 1.00 46.68  ? 50  GLY A C     1 
ATOM   360  O O     . GLY A 1 78  ? 1.524   36.424 30.089 1.00 36.79  ? 50  GLY A O     1 
ATOM   361  N N     . PHE A 1 79  ? 0.182   38.178 30.552 1.00 47.73  ? 51  PHE A N     1 
ATOM   362  C CA    . PHE A 1 79  ? 0.211   38.036 32.008 1.00 48.83  ? 51  PHE A CA    1 
ATOM   363  C C     . PHE A 1 79  ? -0.206  36.652 32.512 1.00 49.90  ? 51  PHE A C     1 
ATOM   364  O O     . PHE A 1 79  ? 0.571   35.982 33.194 1.00 40.08  ? 51  PHE A O     1 
ATOM   365  C CB    . PHE A 1 79  ? -0.672  39.114 32.649 1.00 45.90  ? 51  PHE A CB    1 
ATOM   366  C CG    . PHE A 1 79  ? -0.585  39.170 34.148 1.00 39.47  ? 51  PHE A CG    1 
ATOM   367  C CD1   . PHE A 1 79  ? -1.452  38.430 34.936 1.00 43.32  ? 51  PHE A CD1   1 
ATOM   368  C CD2   . PHE A 1 79  ? 0.350   39.981 34.770 1.00 44.51  ? 51  PHE A CD2   1 
ATOM   369  C CE1   . PHE A 1 79  ? -1.377  38.484 36.316 1.00 48.90  ? 51  PHE A CE1   1 
ATOM   370  C CE2   . PHE A 1 79  ? 0.431   40.040 36.151 1.00 42.43  ? 51  PHE A CE2   1 
ATOM   371  C CZ    . PHE A 1 79  ? -0.434  39.292 36.924 1.00 46.59  ? 51  PHE A CZ    1 
ATOM   372  N N     . TRP A 1 80  ? -1.427  36.233 32.185 1.00 50.30  ? 52  TRP A N     1 
ATOM   373  C CA    . TRP A 1 80  ? -1.969  34.985 32.723 1.00 47.70  ? 52  TRP A CA    1 
ATOM   374  C C     . TRP A 1 80  ? -1.181  33.758 32.272 1.00 48.36  ? 52  TRP A C     1 
ATOM   375  O O     . TRP A 1 80  ? -1.029  32.797 33.026 1.00 43.52  ? 52  TRP A O     1 
ATOM   376  C CB    . TRP A 1 80  ? -3.461  34.825 32.390 1.00 49.88  ? 52  TRP A CB    1 
ATOM   377  C CG    . TRP A 1 80  ? -3.758  34.424 30.970 1.00 51.41  ? 52  TRP A CG    1 
ATOM   378  C CD1   . TRP A 1 80  ? -4.114  35.249 29.943 1.00 53.58  ? 52  TRP A CD1   1 
ATOM   379  C CD2   . TRP A 1 80  ? -3.740  33.096 30.427 1.00 48.06  ? 52  TRP A CD2   1 
ATOM   380  N NE1   . TRP A 1 80  ? -4.312  34.520 28.795 1.00 43.91  ? 52  TRP A NE1   1 
ATOM   381  C CE2   . TRP A 1 80  ? -4.087  33.195 29.066 1.00 45.12  ? 52  TRP A CE2   1 
ATOM   382  C CE3   . TRP A 1 80  ? -3.458  31.832 30.959 1.00 53.78  ? 52  TRP A CE3   1 
ATOM   383  C CZ2   . TRP A 1 80  ? -4.161  32.083 28.230 1.00 49.53  ? 52  TRP A CZ2   1 
ATOM   384  C CZ3   . TRP A 1 80  ? -3.529  30.729 30.127 1.00 39.87  ? 52  TRP A CZ3   1 
ATOM   385  C CH2   . TRP A 1 80  ? -3.879  30.862 28.779 1.00 48.81  ? 52  TRP A CH2   1 
ATOM   386  N N     . ALA A 1 81  ? -0.685  33.796 31.041 1.00 55.70  ? 53  ALA A N     1 
ATOM   387  C CA    . ALA A 1 81  ? 0.083   32.683 30.500 1.00 56.33  ? 53  ALA A CA    1 
ATOM   388  C C     . ALA A 1 81  ? 1.417   32.536 31.225 1.00 52.66  ? 53  ALA A C     1 
ATOM   389  O O     . ALA A 1 81  ? 1.884   31.422 31.464 1.00 51.56  ? 53  ALA A O     1 
ATOM   390  C CB    . ALA A 1 81  ? 0.304   32.869 29.011 1.00 51.20  ? 53  ALA A CB    1 
ATOM   391  N N     . ALA A 1 82  ? 2.021   33.666 31.578 1.00 47.33  ? 54  ALA A N     1 
ATOM   392  C CA    . ALA A 1 82  ? 3.297   33.668 32.283 1.00 45.09  ? 54  ALA A CA    1 
ATOM   393  C C     . ALA A 1 82  ? 3.154   33.070 33.677 1.00 46.03  ? 54  ALA A C     1 
ATOM   394  O O     . ALA A 1 82  ? 4.093   32.477 34.207 1.00 49.55  ? 54  ALA A O     1 
ATOM   395  C CB    . ALA A 1 82  ? 3.852   35.079 32.365 1.00 34.59  ? 54  ALA A CB    1 
ATOM   396  N N     . GLY A 1 83  ? 1.974   33.233 34.266 1.00 48.33  ? 55  GLY A N     1 
ATOM   397  C CA    . GLY A 1 83  ? 1.698   32.685 35.581 1.00 51.32  ? 55  GLY A CA    1 
ATOM   398  C C     . GLY A 1 83  ? 1.482   31.187 35.530 1.00 48.59  ? 55  GLY A C     1 
ATOM   399  O O     . GLY A 1 83  ? 2.034   30.441 36.340 1.00 45.92  ? 55  GLY A O     1 
ATOM   400  N N     . PHE A 1 84  ? 0.673   30.748 34.571 1.00 45.88  ? 56  PHE A N     1 
ATOM   401  C CA    . PHE A 1 84  ? 0.404   29.329 34.380 1.00 45.33  ? 56  PHE A CA    1 
ATOM   402  C C     . PHE A 1 84  ? 1.680   28.572 34.023 1.00 44.80  ? 56  PHE A C     1 
ATOM   403  O O     . PHE A 1 84  ? 1.983   27.537 34.615 1.00 42.06  ? 56  PHE A O     1 
ATOM   404  C CB    . PHE A 1 84  ? -0.656  29.128 33.295 1.00 46.51  ? 56  PHE A CB    1 
ATOM   405  C CG    . PHE A 1 84  ? -0.969  27.687 33.013 1.00 46.29  ? 56  PHE A CG    1 
ATOM   406  C CD1   . PHE A 1 84  ? -1.567  26.892 33.976 1.00 48.19  ? 56  PHE A CD1   1 
ATOM   407  C CD2   . PHE A 1 84  ? -0.674  27.130 31.781 1.00 45.29  ? 56  PHE A CD2   1 
ATOM   408  C CE1   . PHE A 1 84  ? -1.857  25.567 33.719 1.00 48.18  ? 56  PHE A CE1   1 
ATOM   409  C CE2   . PHE A 1 84  ? -0.963  25.806 31.518 1.00 47.24  ? 56  PHE A CE2   1 
ATOM   410  C CZ    . PHE A 1 84  ? -1.555  25.023 32.488 1.00 48.54  ? 56  PHE A CZ    1 
ATOM   411  N N     . ALA A 1 85  ? 2.425   29.101 33.056 1.00 44.60  ? 57  ALA A N     1 
ATOM   412  C CA    . ALA A 1 85  ? 3.686   28.497 32.640 1.00 43.46  ? 57  ALA A CA    1 
ATOM   413  C C     . ALA A 1 85  ? 4.699   28.528 33.775 1.00 45.03  ? 57  ALA A C     1 
ATOM   414  O O     . ALA A 1 85  ? 5.476   27.590 33.953 1.00 55.37  ? 57  ALA A O     1 
ATOM   415  C CB    . ALA A 1 85  ? 4.241   29.211 31.418 1.00 49.73  ? 57  ALA A CB    1 
ATOM   416  N N     . GLY A 1 86  ? 4.684   29.615 34.540 1.00 45.06  ? 58  GLY A N     1 
ATOM   417  C CA    . GLY A 1 86  ? 5.585   29.765 35.668 1.00 49.18  ? 58  GLY A CA    1 
ATOM   418  C C     . GLY A 1 86  ? 5.306   28.745 36.753 1.00 46.50  ? 58  GLY A C     1 
ATOM   419  O O     . GLY A 1 86  ? 6.225   28.123 37.284 1.00 37.90  ? 58  GLY A O     1 
ATOM   420  N N     . LEU A 1 87  ? 4.029   28.571 37.078 1.00 45.67  ? 59  LEU A N     1 
ATOM   421  C CA    . LEU A 1 87  ? 3.625   27.613 38.098 1.00 47.33  ? 59  LEU A CA    1 
ATOM   422  C C     . LEU A 1 87  ? 3.936   26.183 37.670 1.00 58.09  ? 59  LEU A C     1 
ATOM   423  O O     . LEU A 1 87  ? 4.356   25.363 38.487 1.00 66.03  ? 59  LEU A O     1 
ATOM   424  C CB    . LEU A 1 87  ? 2.137   27.761 38.412 1.00 51.09  ? 59  LEU A CB    1 
ATOM   425  C CG    . LEU A 1 87  ? 1.571   26.801 39.457 1.00 47.61  ? 59  LEU A CG    1 
ATOM   426  C CD1   . LEU A 1 87  ? 2.412   26.824 40.724 1.00 43.74  ? 59  LEU A CD1   1 
ATOM   427  C CD2   . LEU A 1 87  ? 0.135   27.173 39.762 1.00 42.95  ? 59  LEU A CD2   1 
ATOM   428  N N     . LEU A 1 88  ? 3.727   25.889 36.389 1.00 57.39  ? 60  LEU A N     1 
ATOM   429  C CA    . LEU A 1 88  ? 4.072   24.583 35.837 1.00 52.68  ? 60  LEU A CA    1 
ATOM   430  C C     . LEU A 1 88  ? 5.557   24.301 36.027 1.00 57.81  ? 60  LEU A C     1 
ATOM   431  O O     . LEU A 1 88  ? 5.946   23.193 36.393 1.00 58.31  ? 60  LEU A O     1 
ATOM   432  C CB    . LEU A 1 88  ? 3.712   24.506 34.352 1.00 45.60  ? 60  LEU A CB    1 
ATOM   433  C CG    . LEU A 1 88  ? 2.234   24.322 34.007 1.00 46.24  ? 60  LEU A CG    1 
ATOM   434  C CD1   . LEU A 1 88  ? 2.042   24.279 32.500 1.00 39.99  ? 60  LEU A CD1   1 
ATOM   435  C CD2   . LEU A 1 88  ? 1.692   23.058 34.655 1.00 42.21  ? 60  LEU A CD2   1 
ATOM   436  N N     . TRP A 1 89  ? 6.378   25.318 35.780 1.00 57.90  ? 61  TRP A N     1 
ATOM   437  C CA    . TRP A 1 89  ? 7.818   25.217 35.975 1.00 58.41  ? 61  TRP A CA    1 
ATOM   438  C C     . TRP A 1 89  ? 8.145   24.909 37.434 1.00 57.03  ? 61  TRP A C     1 
ATOM   439  O O     . TRP A 1 89  ? 8.963   24.036 37.725 1.00 57.25  ? 61  TRP A O     1 
ATOM   440  C CB    . TRP A 1 89  ? 8.499   26.518 35.545 1.00 55.14  ? 61  TRP A CB    1 
ATOM   441  C CG    . TRP A 1 89  ? 9.988   26.522 35.719 1.00 52.48  ? 61  TRP A CG    1 
ATOM   442  C CD1   . TRP A 1 89  ? 10.817  25.437 35.764 1.00 44.22  ? 61  TRP A CD1   1 
ATOM   443  C CD2   . TRP A 1 89  ? 10.827  27.673 35.879 1.00 47.70  ? 61  TRP A CD2   1 
ATOM   444  N NE1   . TRP A 1 89  ? 12.118  25.842 35.939 1.00 41.98  ? 61  TRP A NE1   1 
ATOM   445  C CE2   . TRP A 1 89  ? 12.150  27.210 36.012 1.00 45.89  ? 61  TRP A CE2   1 
ATOM   446  C CE3   . TRP A 1 89  ? 10.586  29.050 35.921 1.00 43.44  ? 61  TRP A CE3   1 
ATOM   447  C CZ2   . TRP A 1 89  ? 13.229  28.075 36.184 1.00 44.81  ? 61  TRP A CZ2   1 
ATOM   448  C CZ3   . TRP A 1 89  ? 11.657  29.906 36.092 1.00 38.29  ? 61  TRP A CZ3   1 
ATOM   449  C CH2   . TRP A 1 89  ? 12.962  29.416 36.223 1.00 37.02  ? 61  TRP A CH2   1 
ATOM   450  N N     . GLY A 1 90  ? 7.499   25.628 38.346 1.00 54.81  ? 62  GLY A N     1 
ATOM   451  C CA    . GLY A 1 90  ? 7.706   25.418 39.766 1.00 52.66  ? 62  GLY A CA    1 
ATOM   452  C C     . GLY A 1 90  ? 7.281   24.031 40.206 1.00 56.82  ? 62  GLY A C     1 
ATOM   453  O O     . GLY A 1 90  ? 7.962   23.385 41.003 1.00 51.78  ? 62  GLY A O     1 
ATOM   454  N N     . LEU A 1 91  ? 6.152   23.569 39.679 1.00 57.13  ? 63  LEU A N     1 
ATOM   455  C CA    . LEU A 1 91  ? 5.633   22.250 40.020 1.00 51.94  ? 63  LEU A CA    1 
ATOM   456  C C     . LEU A 1 91  ? 6.507   21.135 39.452 1.00 50.04  ? 63  LEU A C     1 
ATOM   457  O O     . LEU A 1 91  ? 6.525   20.022 39.980 1.00 46.93  ? 63  LEU A O     1 
ATOM   458  C CB    . LEU A 1 91  ? 4.189   22.095 39.536 1.00 39.43  ? 63  LEU A CB    1 
ATOM   459  C CG    . LEU A 1 91  ? 3.131   22.943 40.246 1.00 56.51  ? 63  LEU A CG    1 
ATOM   460  C CD1   . LEU A 1 91  ? 1.748   22.659 39.679 1.00 39.27  ? 63  LEU A CD1   1 
ATOM   461  C CD2   . LEU A 1 91  ? 3.159   22.702 41.748 1.00 51.73  ? 63  LEU A CD2   1 
ATOM   462  N N     . LEU A 1 92  ? 7.232   21.437 38.379 1.00 40.01  ? 64  LEU A N     1 
ATOM   463  C CA    . LEU A 1 92  ? 8.118   20.456 37.760 1.00 50.74  ? 64  LEU A CA    1 
ATOM   464  C C     . LEU A 1 92  ? 9.372   20.203 38.593 1.00 51.02  ? 64  LEU A C     1 
ATOM   465  O O     . LEU A 1 92  ? 10.055  19.199 38.401 1.00 56.79  ? 64  LEU A O     1 
ATOM   466  C CB    . LEU A 1 92  ? 8.500   20.878 36.339 1.00 41.00  ? 64  LEU A CB    1 
ATOM   467  C CG    . LEU A 1 92  ? 7.444   20.638 35.259 1.00 41.55  ? 64  LEU A CG    1 
ATOM   468  C CD1   . LEU A 1 92  ? 7.931   21.138 33.908 1.00 47.62  ? 64  LEU A CD1   1 
ATOM   469  C CD2   . LEU A 1 92  ? 7.078   19.165 35.191 1.00 43.21  ? 64  LEU A CD2   1 
ATOM   470  N N     . HIS A 1 93  ? 9.674   21.115 39.514 1.00 49.99  ? 65  HIS A N     1 
ATOM   471  C CA    . HIS A 1 93  ? 10.806  20.931 40.417 1.00 54.87  ? 65  HIS A CA    1 
ATOM   472  C C     . HIS A 1 93  ? 10.566  19.730 41.323 1.00 56.75  ? 65  HIS A C     1 
ATOM   473  O O     . HIS A 1 93  ? 11.484  18.958 41.602 1.00 46.86  ? 65  HIS A O     1 
ATOM   474  C CB    . HIS A 1 93  ? 11.047  22.185 41.260 1.00 55.08  ? 65  HIS A CB    1 
ATOM   475  C CG    . HIS A 1 93  ? 11.664  23.317 40.499 1.00 50.17  ? 65  HIS A CG    1 
ATOM   476  N ND1   . HIS A 1 93  ? 11.009  23.976 39.482 1.00 53.58  ? 65  HIS A ND1   1 
ATOM   477  C CD2   . HIS A 1 93  ? 12.879  23.906 40.608 1.00 43.84  ? 65  HIS A CD2   1 
ATOM   478  C CE1   . HIS A 1 93  ? 11.793  24.923 38.997 1.00 48.63  ? 65  HIS A CE1   1 
ATOM   479  N NE2   . HIS A 1 93  ? 12.933  24.901 39.663 1.00 43.75  ? 65  HIS A NE2   1 
ATOM   480  N N     . PHE A 1 94  ? 9.324   19.580 41.774 1.00 61.16  ? 66  PHE A N     1 
ATOM   481  C CA    . PHE A 1 94  ? 8.939   18.457 42.621 1.00 60.91  ? 66  PHE A CA    1 
ATOM   482  C C     . PHE A 1 94  ? 9.068   17.136 41.870 1.00 67.08  ? 66  PHE A C     1 
ATOM   483  O O     . PHE A 1 94  ? 9.619   16.165 42.391 1.00 68.73  ? 66  PHE A O     1 
ATOM   484  C CB    . PHE A 1 94  ? 7.500   18.622 43.118 1.00 53.57  ? 66  PHE A CB    1 
ATOM   485  C CG    . PHE A 1 94  ? 7.307   19.778 44.059 1.00 57.22  ? 66  PHE A CG    1 
ATOM   486  C CD1   . PHE A 1 94  ? 7.746   19.702 45.371 1.00 55.64  ? 66  PHE A CD1   1 
ATOM   487  C CD2   . PHE A 1 94  ? 6.668   20.934 43.638 1.00 59.32  ? 66  PHE A CD2   1 
ATOM   488  C CE1   . PHE A 1 94  ? 7.564   20.761 46.242 1.00 52.28  ? 66  PHE A CE1   1 
ATOM   489  C CE2   . PHE A 1 94  ? 6.483   21.997 44.505 1.00 54.89  ? 66  PHE A CE2   1 
ATOM   490  C CZ    . PHE A 1 94  ? 6.931   21.909 45.808 1.00 50.79  ? 66  PHE A CZ    1 
ATOM   491  N N     . LEU A 1 95  ? 8.559   17.110 40.642 1.00 66.31  ? 67  LEU A N     1 
ATOM   492  C CA    . LEU A 1 95  ? 8.533   15.891 39.841 1.00 67.55  ? 67  LEU A CA    1 
ATOM   493  C C     . LEU A 1 95  ? 9.915   15.482 39.339 1.00 65.89  ? 67  LEU A C     1 
ATOM   494  O O     . LEU A 1 95  ? 10.160  14.306 39.070 1.00 77.88  ? 67  LEU A O     1 
ATOM   495  C CB    . LEU A 1 95  ? 7.576   16.050 38.659 1.00 66.89  ? 67  LEU A CB    1 
ATOM   496  C CG    . LEU A 1 95  ? 6.126   16.386 39.010 1.00 68.95  ? 67  LEU A CG    1 
ATOM   497  C CD1   . LEU A 1 95  ? 5.283   16.507 37.750 1.00 70.34  ? 67  LEU A CD1   1 
ATOM   498  C CD2   . LEU A 1 95  ? 5.546   15.342 39.953 1.00 67.56  ? 67  LEU A CD2   1 
ATOM   499  N N     . THR A 1 96  ? 10.815  16.452 39.210 1.00 57.35  ? 68  THR A N     1 
ATOM   500  C CA    . THR A 1 96  ? 12.157  16.180 38.704 1.00 62.84  ? 68  THR A CA    1 
ATOM   501  C C     . THR A 1 96  ? 13.189  16.101 39.826 1.00 68.34  ? 68  THR A C     1 
ATOM   502  O O     . THR A 1 96  ? 14.362  15.818 39.581 1.00 47.94  ? 68  THR A O     1 
ATOM   503  C CB    . THR A 1 96  ? 12.601  17.236 37.675 1.00 57.56  ? 68  THR A CB    1 
ATOM   504  O OG1   . THR A 1 96  ? 12.531  18.540 38.265 1.00 59.94  ? 68  THR A OG1   1 
ATOM   505  C CG2   . THR A 1 96  ? 11.706  17.189 36.446 1.00 49.65  ? 68  THR A CG2   1 
ATOM   506  N N     . GLY A 1 97  ? 12.745  16.356 41.053 1.00 64.26  ? 69  GLY A N     1 
ATOM   507  C CA    . GLY A 1 97  ? 13.607  16.248 42.217 1.00 56.70  ? 69  GLY A CA    1 
ATOM   508  C C     . GLY A 1 97  ? 14.623  17.368 42.351 1.00 57.55  ? 69  GLY A C     1 
ATOM   509  O O     . GLY A 1 97  ? 15.654  17.199 43.001 1.00 59.99  ? 69  GLY A O     1 
ATOM   510  N N     . LYS A 1 98  ? 14.335  18.511 41.738 1.00 66.58  ? 70  LYS A N     1 
ATOM   511  C CA    . LYS A 1 98  ? 15.219  19.671 41.829 1.00 69.82  ? 70  LYS A CA    1 
ATOM   512  C C     . LYS A 1 98  ? 14.717  20.670 42.867 1.00 66.89  ? 70  LYS A C     1 
ATOM   513  O O     . LYS A 1 98  ? 15.212  21.795 42.950 1.00 59.64  ? 70  LYS A O     1 
ATOM   514  C CB    . LYS A 1 98  ? 15.358  20.356 40.468 1.00 71.76  ? 70  LYS A CB    1 
ATOM   515  C CG    . LYS A 1 98  ? 16.232  19.603 39.476 1.00 80.04  ? 70  LYS A CG    1 
ATOM   516  C CD    . LYS A 1 98  ? 17.685  19.515 39.936 1.00 82.53  ? 70  LYS A CD    1 
ATOM   517  C CE    . LYS A 1 98  ? 18.453  20.810 39.684 1.00 80.43  ? 70  LYS A CE    1 
ATOM   518  N NZ    . LYS A 1 98  ? 18.124  21.898 40.649 1.00 79.74  ? 70  LYS A NZ    1 
ATOM   519  N N     . ALA A 1 99  ? 13.734  20.251 43.656 1.00 67.16  ? 71  ALA A N     1 
ATOM   520  C CA    . ALA A 1 99  ? 13.148  21.118 44.669 1.00 62.69  ? 71  ALA A CA    1 
ATOM   521  C C     . ALA A 1 99  ? 13.780  20.897 46.039 1.00 70.10  ? 71  ALA A C     1 
ATOM   522  O O     . ALA A 1 99  ? 13.611  19.841 46.647 1.00 79.54  ? 71  ALA A O     1 
ATOM   523  C CB    . ALA A 1 99  ? 11.642  20.909 44.740 1.00 54.26  ? 71  ALA A CB    1 
ATOM   524  N N     . TYR A 1 100 ? 14.512  21.899 46.516 1.00 65.00  ? 72  TYR A N     1 
ATOM   525  C CA    . TYR A 1 100 ? 15.056  21.870 47.867 1.00 67.58  ? 72  TYR A CA    1 
ATOM   526  C C     . TYR A 1 100 ? 13.908  22.009 48.856 1.00 66.65  ? 72  TYR A C     1 
ATOM   527  O O     . TYR A 1 100 ? 13.150  22.976 48.797 1.00 75.63  ? 72  TYR A O     1 
ATOM   528  C CB    . TYR A 1 100 ? 16.053  23.012 48.071 1.00 77.02  ? 72  TYR A CB    1 
ATOM   529  C CG    . TYR A 1 100 ? 17.215  23.010 47.103 1.00 87.94  ? 72  TYR A CG    1 
ATOM   530  C CD1   . TYR A 1 100 ? 17.699  21.823 46.566 1.00 97.96  ? 72  TYR A CD1   1 
ATOM   531  C CD2   . TYR A 1 100 ? 17.828  24.197 46.724 1.00 92.33  ? 72  TYR A CD2   1 
ATOM   532  C CE1   . TYR A 1 100 ? 18.762  21.819 45.680 1.00 106.05 ? 72  TYR A CE1   1 
ATOM   533  C CE2   . TYR A 1 100 ? 18.891  24.204 45.839 1.00 103.76 ? 72  TYR A CE2   1 
ATOM   534  C CZ    . TYR A 1 100 ? 19.353  23.013 45.321 1.00 109.23 ? 72  TYR A CZ    1 
ATOM   535  O OH    . TYR A 1 100 ? 20.411  23.016 44.440 1.00 109.19 ? 72  TYR A OH    1 
ATOM   536  N N     . ILE A 1 101 ? 13.772  21.043 49.759 1.00 57.49  ? 73  ILE A N     1 
ATOM   537  C CA    . ILE A 1 101 ? 12.681  21.069 50.729 1.00 54.51  ? 73  ILE A CA    1 
ATOM   538  C C     . ILE A 1 101 ? 13.171  21.017 52.176 1.00 52.32  ? 73  ILE A C     1 
ATOM   539  O O     . ILE A 1 101 ? 13.551  19.960 52.680 1.00 52.77  ? 73  ILE A O     1 
ATOM   540  C CB    . ILE A 1 101 ? 11.672  19.926 50.484 1.00 56.38  ? 73  ILE A CB    1 
ATOM   541  C CG1   . ILE A 1 101 ? 11.087  20.023 49.074 1.00 59.69  ? 73  ILE A CG1   1 
ATOM   542  C CG2   . ILE A 1 101 ? 10.558  19.964 51.521 1.00 50.15  ? 73  ILE A CG2   1 
ATOM   543  C CD1   . ILE A 1 101 ? 10.017  18.993 48.783 1.00 64.81  ? 73  ILE A CD1   1 
ATOM   544  N N     . LEU A 1 102 ? 13.162  22.171 52.836 1.00 52.58  ? 74  LEU A N     1 
ATOM   545  C CA    . LEU A 1 102 ? 13.493  22.245 54.252 1.00 54.54  ? 74  LEU A CA    1 
ATOM   546  C C     . LEU A 1 102 ? 12.265  21.872 55.067 1.00 64.58  ? 74  LEU A C     1 
ATOM   547  O O     . LEU A 1 102 ? 12.328  21.034 55.967 1.00 78.33  ? 74  LEU A O     1 
ATOM   548  C CB    . LEU A 1 102 ? 13.952  23.656 54.626 1.00 47.49  ? 74  LEU A CB    1 
ATOM   549  C CG    . LEU A 1 102 ? 15.203  24.203 53.936 1.00 46.41  ? 74  LEU A CG    1 
ATOM   550  C CD1   . LEU A 1 102 ? 15.457  25.639 54.365 1.00 44.66  ? 74  LEU A CD1   1 
ATOM   551  C CD2   . LEU A 1 102 ? 16.414  23.334 54.233 1.00 46.47  ? 74  LEU A CD2   1 
ATOM   552  N N     . MET A 1 103 ? 11.145  22.508 54.738 1.00 65.85  ? 75  MET A N     1 
ATOM   553  C CA    . MET A 1 103 ? 9.871   22.254 55.399 1.00 68.14  ? 75  MET A CA    1 
ATOM   554  C C     . MET A 1 103 ? 8.747   22.321 54.367 1.00 71.32  ? 75  MET A C     1 
ATOM   555  O O     . MET A 1 103 ? 8.915   22.934 53.313 1.00 74.28  ? 75  MET A O     1 
ATOM   556  C CB    . MET A 1 103 ? 9.642   23.272 56.520 1.00 58.43  ? 75  MET A CB    1 
ATOM   557  C CG    . MET A 1 103 ? 10.495  23.029 57.757 1.00 54.09  ? 75  MET A CG    1 
ATOM   558  S SD    . MET A 1 103 ? 10.219  24.243 59.057 1.00 76.72  ? 75  MET A SD    1 
ATOM   559  C CE    . MET A 1 103 ? 8.460   24.052 59.331 1.00 194.67 ? 75  MET A CE    1 
ATOM   560  N N     . PRO A 1 104 ? 7.604   21.672 54.653 1.00 66.04  ? 76  PRO A N     1 
ATOM   561  C CA    . PRO A 1 104 ? 6.461   21.703 53.732 1.00 64.58  ? 76  PRO A CA    1 
ATOM   562  C C     . PRO A 1 104 ? 6.009   23.126 53.408 1.00 58.37  ? 76  PRO A C     1 
ATOM   563  O O     . PRO A 1 104 ? 5.689   23.420 52.258 1.00 43.07  ? 76  PRO A O     1 
ATOM   564  C CB    . PRO A 1 104 ? 5.368   20.971 54.512 1.00 47.79  ? 76  PRO A CB    1 
ATOM   565  C CG    . PRO A 1 104 ? 6.109   20.045 55.398 1.00 64.25  ? 76  PRO A CG    1 
ATOM   566  C CD    . PRO A 1 104 ? 7.356   20.779 55.799 1.00 62.76  ? 76  PRO A CD    1 
ATOM   567  N N     . SER A 1 105 ? 5.992   23.992 54.416 1.00 56.93  ? 77  SER A N     1 
ATOM   568  C CA    . SER A 1 105 ? 5.575   25.377 54.234 1.00 51.65  ? 77  SER A CA    1 
ATOM   569  C C     . SER A 1 105 ? 6.475   26.111 53.247 1.00 63.26  ? 77  SER A C     1 
ATOM   570  O O     . SER A 1 105 ? 5.995   26.859 52.395 1.00 69.61  ? 77  SER A O     1 
ATOM   571  C CB    . SER A 1 105 ? 5.580   26.112 55.575 1.00 50.33  ? 77  SER A CB    1 
ATOM   572  O OG    . SER A 1 105 ? 4.909   25.358 56.567 1.00 73.87  ? 77  SER A OG    1 
ATOM   573  N N     . GLN A 1 106 ? 7.780   25.889 53.362 1.00 61.19  ? 78  GLN A N     1 
ATOM   574  C CA    . GLN A 1 106 ? 8.748   26.615 52.546 1.00 58.39  ? 78  GLN A CA    1 
ATOM   575  C C     . GLN A 1 106 ? 8.706   26.196 51.075 1.00 59.83  ? 78  GLN A C     1 
ATOM   576  O O     . GLN A 1 106 ? 8.960   27.010 50.187 1.00 56.89  ? 78  GLN A O     1 
ATOM   577  C CB    . GLN A 1 106 ? 10.162  26.475 53.128 1.00 52.66  ? 78  GLN A CB    1 
ATOM   578  C CG    . GLN A 1 106 ? 10.942  25.254 52.675 1.00 50.65  ? 78  GLN A CG    1 
ATOM   579  C CD    . GLN A 1 106 ? 11.865  25.559 51.515 1.00 54.56  ? 78  GLN A CD    1 
ATOM   580  O OE1   . GLN A 1 106 ? 12.284  24.661 50.787 1.00 51.52  ? 78  GLN A OE1   1 
ATOM   581  N NE2   . GLN A 1 106 ? 12.190  26.833 51.338 1.00 59.94  ? 78  GLN A NE2   1 
ATOM   582  N N     . ALA A 1 107 ? 8.376   24.933 50.819 1.00 55.09  ? 79  ALA A N     1 
ATOM   583  C CA    . ALA A 1 107 ? 8.291   24.434 49.451 1.00 49.41  ? 79  ALA A CA    1 
ATOM   584  C C     . ALA A 1 107 ? 7.061   25.014 48.766 1.00 55.79  ? 79  ALA A C     1 
ATOM   585  O O     . ALA A 1 107 ? 7.053   25.240 47.555 1.00 55.78  ? 79  ALA A O     1 
ATOM   586  C CB    . ALA A 1 107 ? 8.244   22.916 49.441 1.00 45.55  ? 79  ALA A CB    1 
ATOM   587  N N     . ILE A 1 108 ? 6.024   25.251 49.562 1.00 59.84  ? 80  ILE A N     1 
ATOM   588  C CA    . ILE A 1 108 ? 4.790   25.860 49.088 1.00 51.70  ? 80  ILE A CA    1 
ATOM   589  C C     . ILE A 1 108 ? 5.033   27.314 48.685 1.00 46.77  ? 80  ILE A C     1 
ATOM   590  O O     . ILE A 1 108 ? 4.543   27.779 47.655 1.00 39.07  ? 80  ILE A O     1 
ATOM   591  C CB    . ILE A 1 108 ? 3.695   25.787 50.178 1.00 46.70  ? 80  ILE A CB    1 
ATOM   592  C CG1   . ILE A 1 108 ? 3.273   24.336 50.414 1.00 47.47  ? 80  ILE A CG1   1 
ATOM   593  C CG2   . ILE A 1 108 ? 2.492   26.626 49.805 1.00 43.57  ? 80  ILE A CG2   1 
ATOM   594  C CD1   . ILE A 1 108 ? 2.824   23.619 49.163 1.00 52.95  ? 80  ILE A CD1   1 
ATOM   595  N N     . ILE A 1 109 ? 5.810   28.022 49.498 1.00 44.73  ? 81  ILE A N     1 
ATOM   596  C CA    . ILE A 1 109 ? 6.104   29.431 49.258 1.00 44.75  ? 81  ILE A CA    1 
ATOM   597  C C     . ILE A 1 109 ? 7.094   29.640 48.106 1.00 51.74  ? 81  ILE A C     1 
ATOM   598  O O     . ILE A 1 109 ? 6.962   30.584 47.325 1.00 47.26  ? 81  ILE A O     1 
ATOM   599  C CB    . ILE A 1 109 ? 6.638   30.112 50.542 1.00 40.37  ? 81  ILE A CB    1 
ATOM   600  C CG1   . ILE A 1 109 ? 5.613   29.986 51.672 1.00 38.71  ? 81  ILE A CG1   1 
ATOM   601  C CG2   . ILE A 1 109 ? 6.977   31.573 50.285 1.00 35.49  ? 81  ILE A CG2   1 
ATOM   602  C CD1   . ILE A 1 109 ? 6.028   30.658 52.963 1.00 38.07  ? 81  ILE A CD1   1 
ATOM   603  N N     . GLU A 1 110 ? 8.074   28.749 47.990 1.00 48.62  ? 82  GLU A N     1 
ATOM   604  C CA    . GLU A 1 110 ? 9.155   28.941 47.024 1.00 43.45  ? 82  GLU A CA    1 
ATOM   605  C C     . GLU A 1 110 ? 8.918   28.311 45.653 1.00 50.06  ? 82  GLU A C     1 
ATOM   606  O O     . GLU A 1 110 ? 9.305   28.881 44.636 1.00 49.52  ? 82  GLU A O     1 
ATOM   607  C CB    . GLU A 1 110 ? 10.487  28.454 47.598 1.00 46.87  ? 82  GLU A CB    1 
ATOM   608  C CG    . GLU A 1 110 ? 10.919  29.197 48.845 1.00 46.75  ? 82  GLU A CG    1 
ATOM   609  C CD    . GLU A 1 110 ? 12.422  29.205 49.031 1.00 42.56  ? 82  GLU A CD    1 
ATOM   610  O OE1   . GLU A 1 110 ? 12.945  28.294 49.706 1.00 44.18  ? 82  GLU A OE1   1 
ATOM   611  O OE2   . GLU A 1 110 ? 13.080  30.124 48.501 1.00 43.33  ? 82  GLU A OE2   1 
ATOM   612  N N     . TYR A 1 111 ? 8.293   27.139 45.621 1.00 62.39  ? 83  TYR A N     1 
ATOM   613  C CA    . TYR A 1 111 ? 8.113   26.428 44.357 1.00 56.14  ? 83  TYR A CA    1 
ATOM   614  C C     . TYR A 1 111 ? 6.696   26.532 43.799 1.00 48.13  ? 83  TYR A C     1 
ATOM   615  O O     . TYR A 1 111 ? 6.397   25.982 42.740 1.00 49.94  ? 83  TYR A O     1 
ATOM   616  C CB    . TYR A 1 111 ? 8.549   24.967 44.490 1.00 47.88  ? 83  TYR A CB    1 
ATOM   617  C CG    . TYR A 1 111 ? 10.032  24.819 44.740 1.00 47.67  ? 83  TYR A CG    1 
ATOM   618  C CD1   . TYR A 1 111 ? 10.945  24.943 43.701 1.00 47.26  ? 83  TYR A CD1   1 
ATOM   619  C CD2   . TYR A 1 111 ? 10.521  24.570 46.016 1.00 53.44  ? 83  TYR A CD2   1 
ATOM   620  C CE1   . TYR A 1 111 ? 12.302  24.817 43.925 1.00 50.52  ? 83  TYR A CE1   1 
ATOM   621  C CE2   . TYR A 1 111 ? 11.877  24.441 46.249 1.00 49.54  ? 83  TYR A CE2   1 
ATOM   622  C CZ    . TYR A 1 111 ? 12.763  24.567 45.200 1.00 50.08  ? 83  TYR A CZ    1 
ATOM   623  O OH    . TYR A 1 111 ? 14.114  24.439 45.426 1.00 56.40  ? 83  TYR A OH    1 
ATOM   624  N N     . ILE A 1 112 ? 5.830   27.246 44.508 1.00 44.50  ? 84  ILE A N     1 
ATOM   625  C CA    . ILE A 1 112 ? 4.476   27.481 44.026 1.00 45.85  ? 84  ILE A CA    1 
ATOM   626  C C     . ILE A 1 112 ? 4.143   28.972 43.983 1.00 45.79  ? 84  ILE A C     1 
ATOM   627  O O     . ILE A 1 112 ? 3.791   29.502 42.931 1.00 52.93  ? 84  ILE A O     1 
ATOM   628  C CB    . ILE A 1 112 ? 3.425   26.734 44.867 1.00 44.54  ? 84  ILE A CB    1 
ATOM   629  C CG1   . ILE A 1 112 ? 3.640   25.221 44.771 1.00 47.86  ? 84  ILE A CG1   1 
ATOM   630  C CG2   . ILE A 1 112 ? 2.035   27.089 44.398 1.00 40.65  ? 84  ILE A CG2   1 
ATOM   631  C CD1   . ILE A 1 112 ? 2.599   24.405 45.509 1.00 38.46  ? 84  ILE A CD1   1 
ATOM   632  N N     . LEU A 1 113 ? 4.260   29.644 45.124 1.00 41.14  ? 85  LEU A N     1 
ATOM   633  C CA    . LEU A 1 113 ? 3.981   31.076 45.205 1.00 44.65  ? 85  LEU A CA    1 
ATOM   634  C C     . LEU A 1 113 ? 4.934   31.906 44.350 1.00 50.13  ? 85  LEU A C     1 
ATOM   635  O O     . LEU A 1 113 ? 4.499   32.710 43.525 1.00 58.48  ? 85  LEU A O     1 
ATOM   636  C CB    . LEU A 1 113 ? 4.035   31.560 46.657 1.00 42.18  ? 85  LEU A CB    1 
ATOM   637  C CG    . LEU A 1 113 ? 2.767   31.382 47.490 1.00 40.76  ? 85  LEU A CG    1 
ATOM   638  C CD1   . LEU A 1 113 ? 3.019   31.725 48.949 1.00 35.19  ? 85  LEU A CD1   1 
ATOM   639  C CD2   . LEU A 1 113 ? 1.649   32.238 46.923 1.00 42.55  ? 85  LEU A CD2   1 
ATOM   640  N N     . ALA A 1 114 ? 6.233   31.708 44.555 1.00 44.91  ? 86  ALA A N     1 
ATOM   641  C CA    . ALA A 1 114 ? 7.255   32.481 43.858 1.00 45.05  ? 86  ALA A CA    1 
ATOM   642  C C     . ALA A 1 114 ? 7.180   32.319 42.341 1.00 50.61  ? 86  ALA A C     1 
ATOM   643  O O     . ALA A 1 114 ? 7.310   33.292 41.600 1.00 47.49  ? 86  ALA A O     1 
ATOM   644  C CB    . ALA A 1 114 ? 8.640   32.106 44.365 1.00 39.99  ? 86  ALA A CB    1 
ATOM   645  N N     . PHE A 1 115 ? 6.966   31.087 41.887 1.00 51.86  ? 87  PHE A N     1 
ATOM   646  C CA    . PHE A 1 115 ? 6.889   30.801 40.458 1.00 46.51  ? 87  PHE A CA    1 
ATOM   647  C C     . PHE A 1 115 ? 5.547   31.207 39.848 1.00 51.43  ? 87  PHE A C     1 
ATOM   648  O O     . PHE A 1 115 ? 5.412   31.290 38.628 1.00 59.89  ? 87  PHE A O     1 
ATOM   649  C CB    . PHE A 1 115 ? 7.168   29.321 40.187 1.00 44.70  ? 87  PHE A CB    1 
ATOM   650  C CG    . PHE A 1 115 ? 8.614   28.942 40.329 1.00 49.70  ? 87  PHE A CG    1 
ATOM   651  C CD1   . PHE A 1 115 ? 9.141   28.615 41.568 1.00 47.79  ? 87  PHE A CD1   1 
ATOM   652  C CD2   . PHE A 1 115 ? 9.448   28.910 39.222 1.00 49.73  ? 87  PHE A CD2   1 
ATOM   653  C CE1   . PHE A 1 115 ? 10.473  28.265 41.701 1.00 42.23  ? 87  PHE A CE1   1 
ATOM   654  C CE2   . PHE A 1 115 ? 10.780  28.560 39.348 1.00 38.84  ? 87  PHE A CE2   1 
ATOM   655  C CZ    . PHE A 1 115 ? 11.294  28.238 40.589 1.00 38.31  ? 87  PHE A CZ    1 
ATOM   656  N N     . SER A 1 116 ? 4.555   31.456 40.696 1.00 52.52  ? 88  SER A N     1 
ATOM   657  C CA    . SER A 1 116 ? 3.255   31.915 40.220 1.00 50.05  ? 88  SER A CA    1 
ATOM   658  C C     . SER A 1 116 ? 3.297   33.404 39.900 1.00 53.17  ? 88  SER A C     1 
ATOM   659  O O     . SER A 1 116 ? 2.552   33.887 39.045 1.00 51.67  ? 88  SER A O     1 
ATOM   660  C CB    . SER A 1 116 ? 2.167   31.631 41.258 1.00 43.01  ? 88  SER A CB    1 
ATOM   661  O OG    . SER A 1 116 ? 1.961   30.238 41.412 1.00 42.51  ? 88  SER A OG    1 
ATOM   662  N N     . PHE A 1 117 ? 4.177   34.125 40.587 1.00 50.23  ? 89  PHE A N     1 
ATOM   663  C CA    . PHE A 1 117 ? 4.294   35.569 40.410 1.00 46.61  ? 89  PHE A CA    1 
ATOM   664  C C     . PHE A 1 117 ? 5.209   35.942 39.247 1.00 45.01  ? 89  PHE A C     1 
ATOM   665  O O     . PHE A 1 117 ? 5.575   37.105 39.080 1.00 48.23  ? 89  PHE A O     1 
ATOM   666  C CB    . PHE A 1 117 ? 4.751   36.240 41.708 1.00 44.63  ? 89  PHE A CB    1 
ATOM   667  C CG    . PHE A 1 117 ? 3.629   36.517 42.669 1.00 47.77  ? 89  PHE A CG    1 
ATOM   668  C CD1   . PHE A 1 117 ? 2.946   35.476 43.277 1.00 51.42  ? 89  PHE A CD1   1 
ATOM   669  C CD2   . PHE A 1 117 ? 3.254   37.818 42.961 1.00 44.34  ? 89  PHE A CD2   1 
ATOM   670  C CE1   . PHE A 1 117 ? 1.913   35.727 44.160 1.00 32.47  ? 89  PHE A CE1   1 
ATOM   671  C CE2   . PHE A 1 117 ? 2.221   38.075 43.843 1.00 45.10  ? 89  PHE A CE2   1 
ATOM   672  C CZ    . PHE A 1 117 ? 1.549   37.028 44.443 1.00 32.48  ? 89  PHE A CZ    1 
ATOM   673  N N     . ILE A 1 118 ? 5.565   34.946 38.441 1.00 42.42  ? 90  ILE A N     1 
ATOM   674  C CA    . ILE A 1 118 ? 6.266   35.184 37.186 1.00 38.25  ? 90  ILE A CA    1 
ATOM   675  C C     . ILE A 1 118 ? 5.266   35.761 36.178 1.00 41.09  ? 90  ILE A C     1 
ATOM   676  O O     . ILE A 1 118 ? 5.640   36.254 35.115 1.00 44.40  ? 90  ILE A O     1 
ATOM   677  C CB    . ILE A 1 118 ? 6.919   33.885 36.654 1.00 34.26  ? 90  ILE A CB    1 
ATOM   678  C CG1   . ILE A 1 118 ? 7.762   33.232 37.750 1.00 36.46  ? 90  ILE A CG1   1 
ATOM   679  C CG2   . ILE A 1 118 ? 7.797   34.158 35.438 1.00 36.24  ? 90  ILE A CG2   1 
ATOM   680  C CD1   . ILE A 1 118 ? 8.473   31.969 37.307 1.00 39.13  ? 90  ILE A CD1   1 
ATOM   681  N N     . ALA A 1 119 ? 3.987   35.711 36.542 1.00 43.71  ? 91  ALA A N     1 
ATOM   682  C CA    . ALA A 1 119 ? 2.919   36.318 35.755 1.00 40.27  ? 91  ALA A CA    1 
ATOM   683  C C     . ALA A 1 119 ? 3.195   37.793 35.483 1.00 40.45  ? 91  ALA A C     1 
ATOM   684  O O     . ALA A 1 119 ? 2.853   38.309 34.421 1.00 53.89  ? 91  ALA A O     1 
ATOM   685  C CB    . ALA A 1 119 ? 1.584   36.160 36.469 1.00 33.12  ? 91  ALA A CB    1 
ATOM   686  N N     . PHE A 1 120 ? 3.829   38.461 36.442 1.00 45.20  ? 92  PHE A N     1 
ATOM   687  C CA    . PHE A 1 120 ? 4.118   39.888 36.326 1.00 49.40  ? 92  PHE A CA    1 
ATOM   688  C C     . PHE A 1 120 ? 5.212   40.207 35.309 1.00 54.53  ? 92  PHE A C     1 
ATOM   689  O O     . PHE A 1 120 ? 5.518   41.374 35.064 1.00 61.00  ? 92  PHE A O     1 
ATOM   690  C CB    . PHE A 1 120 ? 4.454   40.487 37.695 1.00 43.07  ? 92  PHE A CB    1 
ATOM   691  C CG    . PHE A 1 120 ? 3.247   40.760 38.541 1.00 41.22  ? 92  PHE A CG    1 
ATOM   692  C CD1   . PHE A 1 120 ? 2.727   39.779 39.370 1.00 39.83  ? 92  PHE A CD1   1 
ATOM   693  C CD2   . PHE A 1 120 ? 2.621   41.995 38.495 1.00 36.31  ? 92  PHE A CD2   1 
ATOM   694  C CE1   . PHE A 1 120 ? 1.608   40.029 40.144 1.00 36.36  ? 92  PHE A CE1   1 
ATOM   695  C CE2   . PHE A 1 120 ? 1.504   42.250 39.265 1.00 39.97  ? 92  PHE A CE2   1 
ATOM   696  C CZ    . PHE A 1 120 ? 0.996   41.265 40.089 1.00 32.77  ? 92  PHE A CZ    1 
ATOM   697  N N     . SER A 1 121 ? 5.790   39.170 34.710 1.00 49.43  ? 93  SER A N     1 
ATOM   698  C CA    . SER A 1 121 ? 6.751   39.359 33.631 1.00 49.56  ? 93  SER A CA    1 
ATOM   699  C C     . SER A 1 121 ? 6.036   39.797 32.358 1.00 48.92  ? 93  SER A C     1 
ATOM   700  O O     . SER A 1 121 ? 6.673   40.211 31.390 1.00 51.39  ? 93  SER A O     1 
ATOM   701  C CB    . SER A 1 121 ? 7.533   38.072 33.370 1.00 46.26  ? 93  SER A CB    1 
ATOM   702  O OG    . SER A 1 121 ? 8.163   37.609 34.551 1.00 47.83  ? 93  SER A OG    1 
ATOM   703  N N     . GLY A 1 122 ? 4.709   39.708 32.368 1.00 34.32  ? 94  GLY A N     1 
ATOM   704  C CA    . GLY A 1 122 ? 3.912   40.042 31.204 1.00 35.39  ? 94  GLY A CA    1 
ATOM   705  C C     . GLY A 1 122 ? 3.069   41.296 31.345 1.00 47.01  ? 94  GLY A C     1 
ATOM   706  O O     . GLY A 1 122 ? 2.090   41.471 30.623 1.00 54.48  ? 94  GLY A O     1 
ATOM   707  N N     . VAL A 1 123 ? 3.449   42.176 32.266 1.00 46.16  ? 95  VAL A N     1 
ATOM   708  C CA    . VAL A 1 123 ? 2.703   43.411 32.492 1.00 49.01  ? 95  VAL A CA    1 
ATOM   709  C C     . VAL A 1 123 ? 2.841   44.401 31.335 1.00 57.20  ? 95  VAL A C     1 
ATOM   710  O O     . VAL A 1 123 ? 1.991   45.272 31.152 1.00 63.22  ? 95  VAL A O     1 
ATOM   711  C CB    . VAL A 1 123 ? 3.119   44.103 33.811 1.00 42.14  ? 95  VAL A CB    1 
ATOM   712  C CG1   . VAL A 1 123 ? 2.706   43.259 35.006 1.00 38.10  ? 95  VAL A CG1   1 
ATOM   713  C CG2   . VAL A 1 123 ? 4.618   44.371 33.829 1.00 39.42  ? 95  VAL A CG2   1 
ATOM   714  N N     . PHE A 1 124 ? 3.910   44.265 30.555 1.00 61.49  ? 96  PHE A N     1 
ATOM   715  C CA    . PHE A 1 124 ? 4.155   45.159 29.427 1.00 62.52  ? 96  PHE A CA    1 
ATOM   716  C C     . PHE A 1 124 ? 4.250   44.394 28.110 1.00 66.83  ? 96  PHE A C     1 
ATOM   717  O O     . PHE A 1 124 ? 4.857   44.873 27.152 1.00 40.24  ? 96  PHE A O     1 
ATOM   718  C CB    . PHE A 1 124 ? 5.441   45.961 29.643 1.00 54.55  ? 96  PHE A CB    1 
ATOM   719  C CG    . PHE A 1 124 ? 5.389   46.891 30.821 1.00 54.97  ? 96  PHE A CG    1 
ATOM   720  C CD1   . PHE A 1 124 ? 4.214   47.539 31.160 1.00 57.71  ? 96  PHE A CD1   1 
ATOM   721  C CD2   . PHE A 1 124 ? 6.519   47.117 31.589 1.00 46.89  ? 96  PHE A CD2   1 
ATOM   722  C CE1   . PHE A 1 124 ? 4.166   48.397 32.245 1.00 52.51  ? 96  PHE A CE1   1 
ATOM   723  C CE2   . PHE A 1 124 ? 6.478   47.972 32.675 1.00 44.35  ? 96  PHE A CE2   1 
ATOM   724  C CZ    . PHE A 1 124 ? 5.300   48.613 33.002 1.00 43.00  ? 96  PHE A CZ    1 
ATOM   725  N N     . SER A 1 125 ? 3.648   43.208 28.068 1.00 60.66  ? 97  SER A N     1 
ATOM   726  C CA    . SER A 1 125 ? 3.705   42.349 26.888 1.00 59.45  ? 97  SER A CA    1 
ATOM   727  C C     . SER A 1 125 ? 3.130   43.013 25.642 1.00 64.01  ? 97  SER A C     1 
ATOM   728  O O     . SER A 1 125 ? 3.688   42.891 24.550 1.00 63.75  ? 97  SER A O     1 
ATOM   729  C CB    . SER A 1 125 ? 2.970   41.035 27.149 1.00 62.26  ? 97  SER A CB    1 
ATOM   730  O OG    . SER A 1 125 ? 3.643   40.267 28.127 1.00 65.99  ? 97  SER A OG    1 
ATOM   731  N N     . LYS A 1 126 ? 2.011   43.709 25.811 1.00 61.67  ? 98  LYS A N     1 
ATOM   732  C CA    . LYS A 1 126 ? 1.359   44.385 24.697 1.00 53.22  ? 98  LYS A CA    1 
ATOM   733  C C     . LYS A 1 126 ? 2.251   45.483 24.132 1.00 53.96  ? 98  LYS A C     1 
ATOM   734  O O     . LYS A 1 126 ? 2.363   45.634 22.918 1.00 68.92  ? 98  LYS A O     1 
ATOM   735  C CB    . LYS A 1 126 ? 0.009   44.965 25.128 1.00 56.65  ? 98  LYS A CB    1 
ATOM   736  N N     . GLN A 1 127 ? 2.889   46.242 25.018 1.00 52.78  ? 99  GLN A N     1 
ATOM   737  C CA    . GLN A 1 127 ? 3.781   47.320 24.602 1.00 56.06  ? 99  GLN A CA    1 
ATOM   738  C C     . GLN A 1 127 ? 4.980   46.791 23.819 1.00 51.54  ? 99  GLN A C     1 
ATOM   739  O O     . GLN A 1 127 ? 5.338   47.338 22.776 1.00 47.52  ? 99  GLN A O     1 
ATOM   740  C CB    . GLN A 1 127 ? 4.262   48.130 25.810 1.00 55.94  ? 99  GLN A CB    1 
ATOM   741  C CG    . GLN A 1 127 ? 3.178   48.947 26.504 1.00 49.88  ? 99  GLN A CG    1 
ATOM   742  C CD    . GLN A 1 127 ? 2.391   48.144 27.524 1.00 54.32  ? 99  GLN A CD    1 
ATOM   743  O OE1   . GLN A 1 127 ? 2.201   46.936 27.373 1.00 52.32  ? 99  GLN A OE1   1 
ATOM   744  N NE2   . GLN A 1 127 ? 1.933   48.815 28.575 1.00 55.44  ? 99  GLN A NE2   1 
ATOM   745  N N     . VAL A 1 128 ? 5.597   45.728 24.329 1.00 51.93  ? 100 VAL A N     1 
ATOM   746  C CA    . VAL A 1 128 ? 6.745   45.115 23.669 1.00 54.19  ? 100 VAL A CA    1 
ATOM   747  C C     . VAL A 1 128 ? 6.366   44.609 22.282 1.00 65.12  ? 100 VAL A C     1 
ATOM   748  O O     . VAL A 1 128 ? 7.038   44.916 21.298 1.00 71.15  ? 100 VAL A O     1 
ATOM   749  C CB    . VAL A 1 128 ? 7.317   43.940 24.489 1.00 51.18  ? 100 VAL A CB    1 
ATOM   750  C CG1   . VAL A 1 128 ? 8.467   43.280 23.739 1.00 47.12  ? 100 VAL A CG1   1 
ATOM   751  C CG2   . VAL A 1 128 ? 7.772   44.416 25.859 1.00 45.17  ? 100 VAL A CG2   1 
ATOM   752  N N     . ARG A 1 129 ? 5.282   43.840 22.213 1.00 66.19  ? 101 ARG A N     1 
ATOM   753  C CA    . ARG A 1 129 ? 4.802   43.298 20.946 1.00 61.37  ? 101 ARG A CA    1 
ATOM   754  C C     . ARG A 1 129 ? 4.374   44.394 19.972 1.00 61.33  ? 101 ARG A C     1 
ATOM   755  O O     . ARG A 1 129 ? 4.570   44.268 18.764 1.00 60.98  ? 101 ARG A O     1 
ATOM   756  C CB    . ARG A 1 129 ? 3.650   42.314 21.178 1.00 55.15  ? 101 ARG A CB    1 
ATOM   757  C CG    . ARG A 1 129 ? 4.098   40.927 21.604 1.00 48.77  ? 101 ARG A CG    1 
ATOM   758  C CD    . ARG A 1 129 ? 2.943   39.934 21.601 1.00 52.04  ? 101 ARG A CD    1 
ATOM   759  N NE    . ARG A 1 129 ? 2.201   39.936 22.860 1.00 63.17  ? 101 ARG A NE    1 
ATOM   760  C CZ    . ARG A 1 129 ? 1.048   40.569 23.052 1.00 64.43  ? 101 ARG A CZ    1 
ATOM   761  N NH1   . ARG A 1 129 ? 0.494   41.259 22.065 1.00 72.26  ? 101 ARG A NH1   1 
ATOM   762  N NH2   . ARG A 1 129 ? 0.448   40.510 24.233 1.00 61.41  ? 101 ARG A NH2   1 
ATOM   763  N N     . SER A 1 130 ? 3.792   45.466 20.504 1.00 59.37  ? 102 SER A N     1 
ATOM   764  C CA    . SER A 1 130 ? 3.354   46.590 19.683 1.00 63.87  ? 102 SER A CA    1 
ATOM   765  C C     . SER A 1 130 ? 4.528   47.258 18.977 1.00 77.54  ? 102 SER A C     1 
ATOM   766  O O     . SER A 1 130 ? 4.490   47.481 17.767 1.00 91.36  ? 102 SER A O     1 
ATOM   767  C CB    . SER A 1 130 ? 2.606   47.619 20.533 1.00 65.50  ? 102 SER A CB    1 
ATOM   768  O OG    . SER A 1 130 ? 2.285   48.771 19.773 1.00 81.70  ? 102 SER A OG    1 
ATOM   769  N N     . ASN A 1 131 ? 5.569   47.576 19.740 1.00 70.39  ? 103 ASN A N     1 
ATOM   770  C CA    . ASN A 1 131 ? 6.753   48.218 19.183 1.00 66.99  ? 103 ASN A CA    1 
ATOM   771  C C     . ASN A 1 131 ? 7.566   47.276 18.302 1.00 72.45  ? 103 ASN A C     1 
ATOM   772  O O     . ASN A 1 131 ? 8.183   47.703 17.327 1.00 77.59  ? 103 ASN A O     1 
ATOM   773  C CB    . ASN A 1 131 ? 7.632   48.787 20.298 1.00 59.54  ? 103 ASN A CB    1 
ATOM   774  C CG    . ASN A 1 131 ? 6.960   49.918 21.051 1.00 58.67  ? 103 ASN A CG    1 
ATOM   775  O OD1   . ASN A 1 131 ? 7.022   51.076 20.639 1.00 55.83  ? 103 ASN A OD1   1 
ATOM   776  N ND2   . ASN A 1 131 ? 6.314   49.587 22.163 1.00 48.88  ? 103 ASN A ND2   1 
ATOM   777  N N     . LEU A 1 132 ? 7.561   45.992 18.648 1.00 67.60  ? 104 LEU A N     1 
ATOM   778  C CA    . LEU A 1 132 ? 8.338   45.001 17.912 1.00 65.14  ? 104 LEU A CA    1 
ATOM   779  C C     . LEU A 1 132 ? 7.782   44.792 16.507 1.00 68.37  ? 104 LEU A C     1 
ATOM   780  O O     . LEU A 1 132 ? 8.536   44.617 15.551 1.00 73.28  ? 104 LEU A O     1 
ATOM   781  C CB    . LEU A 1 132 ? 8.372   43.673 18.670 1.00 60.07  ? 104 LEU A CB    1 
ATOM   782  C CG    . LEU A 1 132 ? 9.423   42.660 18.214 1.00 63.41  ? 104 LEU A CG    1 
ATOM   783  C CD1   . LEU A 1 132 ? 10.824  43.210 18.436 1.00 58.11  ? 104 LEU A CD1   1 
ATOM   784  C CD2   . LEU A 1 132 ? 9.243   41.336 18.938 1.00 70.28  ? 104 LEU A CD2   1 
ATOM   785  N N     . ALA A 1 133 ? 6.458   44.815 16.390 1.00 65.50  ? 105 ALA A N     1 
ATOM   786  C CA    . ALA A 1 133 ? 5.798   44.625 15.104 1.00 63.44  ? 105 ALA A CA    1 
ATOM   787  C C     . ALA A 1 133 ? 5.904   45.873 14.233 1.00 65.40  ? 105 ALA A C     1 
ATOM   788  O O     . ALA A 1 133 ? 5.798   45.798 13.009 1.00 68.13  ? 105 ALA A O     1 
ATOM   789  C CB    . ALA A 1 133 ? 4.341   44.241 15.308 1.00 67.01  ? 105 ALA A CB    1 
ATOM   790  N N     . ALA A 1 134 ? 6.113   47.020 14.873 1.00 65.73  ? 106 ALA A N     1 
ATOM   791  C CA    . ALA A 1 134 ? 6.241   48.285 14.157 1.00 72.68  ? 106 ALA A CA    1 
ATOM   792  C C     . ALA A 1 134 ? 7.707   48.648 13.933 1.00 86.49  ? 106 ALA A C     1 
ATOM   793  O O     . ALA A 1 134 ? 8.035   49.806 13.667 1.00 90.89  ? 106 ALA A O     1 
ATOM   794  C CB    . ALA A 1 134 ? 5.527   49.396 14.914 1.00 61.23  ? 106 ALA A CB    1 
ATOM   795  N N     . ASN A 1 135 ? 8.577   47.647 14.043 1.00 86.59  ? 107 ASN A N     1 
ATOM   796  C CA    . ASN A 1 135 ? 10.021  47.829 13.892 1.00 85.84  ? 107 ASN A CA    1 
ATOM   797  C C     . ASN A 1 135 ? 10.619  48.902 14.802 1.00 84.25  ? 107 ASN A C     1 
ATOM   798  O O     . ASN A 1 135 ? 11.606  49.550 14.452 1.00 88.81  ? 107 ASN A O     1 
ATOM   799  C CB    . ASN A 1 135 ? 10.392  48.089 12.430 1.00 94.49  ? 107 ASN A CB    1 
ATOM   800  C CG    . ASN A 1 135 ? 10.213  46.861 11.560 1.00 106.75 ? 107 ASN A CG    1 
ATOM   801  O OD1   . ASN A 1 135 ? 11.079  45.988 11.516 1.00 112.13 ? 107 ASN A OD1   1 
ATOM   802  N ND2   . ASN A 1 135 ? 9.086   46.789 10.862 1.00 111.79 ? 107 ASN A ND2   1 
ATOM   803  N N     . GLN A 1 136 ? 10.010  49.081 15.970 1.00 79.48  ? 108 GLN A N     1 
ATOM   804  C CA    . GLN A 1 136 ? 10.546  49.968 16.993 1.00 77.45  ? 108 GLN A CA    1 
ATOM   805  C C     . GLN A 1 136 ? 11.310  49.120 18.001 1.00 68.43  ? 108 GLN A C     1 
ATOM   806  O O     . GLN A 1 136 ? 10.871  48.948 19.138 1.00 68.34  ? 108 GLN A O     1 
ATOM   807  C CB    . GLN A 1 136 ? 9.412   50.716 17.696 1.00 80.43  ? 108 GLN A CB    1 
ATOM   808  C CG    . GLN A 1 136 ? 8.500   51.504 16.766 1.00 75.84  ? 108 GLN A CG    1 
ATOM   809  C CD    . GLN A 1 136 ? 9.038   52.884 16.445 1.00 78.77  ? 108 GLN A CD    1 
ATOM   810  O OE1   . GLN A 1 136 ? 9.985   53.357 17.074 1.00 82.89  ? 108 GLN A OE1   1 
ATOM   811  N NE2   . GLN A 1 136 ? 8.430   53.542 15.464 1.00 83.33  ? 108 GLN A NE2   1 
ATOM   812  N N     . LEU A 1 137 ? 12.451  48.587 17.574 1.00 68.64  ? 109 LEU A N     1 
ATOM   813  C CA    . LEU A 1 137 ? 13.206  47.630 18.378 1.00 65.92  ? 109 LEU A CA    1 
ATOM   814  C C     . LEU A 1 137 ? 13.749  48.218 19.678 1.00 57.75  ? 109 LEU A C     1 
ATOM   815  O O     . LEU A 1 137 ? 13.704  47.567 20.721 1.00 55.61  ? 109 LEU A O     1 
ATOM   816  C CB    . LEU A 1 137 ? 14.344  47.017 17.559 1.00 53.09  ? 109 LEU A CB    1 
ATOM   817  C CG    . LEU A 1 137 ? 15.187  45.966 18.282 1.00 51.31  ? 109 LEU A CG    1 
ATOM   818  C CD1   . LEU A 1 137 ? 14.303  44.873 18.859 1.00 49.85  ? 109 LEU A CD1   1 
ATOM   819  C CD2   . LEU A 1 137 ? 16.216  45.378 17.338 1.00 52.67  ? 109 LEU A CD2   1 
ATOM   820  N N     . LYS A 1 138 ? 14.265  49.442 19.614 1.00 58.03  ? 110 LYS A N     1 
ATOM   821  C CA    . LYS A 1 138 ? 14.786  50.107 20.803 1.00 60.01  ? 110 LYS A CA    1 
ATOM   822  C C     . LYS A 1 138 ? 13.691  50.270 21.852 1.00 62.17  ? 110 LYS A C     1 
ATOM   823  O O     . LYS A 1 138 ? 13.882  49.932 23.020 1.00 64.36  ? 110 LYS A O     1 
ATOM   824  C CB    . LYS A 1 138 ? 15.382  51.472 20.450 1.00 62.65  ? 110 LYS A CB    1 
ATOM   825  C CG    . LYS A 1 138 ? 15.917  52.236 21.650 1.00 50.28  ? 110 LYS A CG    1 
ATOM   826  C CD    . LYS A 1 138 ? 16.399  53.622 21.260 1.00 78.64  ? 110 LYS A CD    1 
ATOM   827  C CE    . LYS A 1 138 ? 16.882  54.399 22.476 1.00 79.27  ? 110 LYS A CE    1 
ATOM   828  N NZ    . LYS A 1 138 ? 17.299  55.785 22.128 1.00 86.55  ? 110 LYS A NZ    1 
ATOM   829  N N     . LYS A 1 139 ? 12.542  50.780 21.422 1.00 64.30  ? 111 LYS A N     1 
ATOM   830  C CA    . LYS A 1 139 ? 11.405  50.974 22.312 1.00 57.99  ? 111 LYS A CA    1 
ATOM   831  C C     . LYS A 1 139 ? 10.912  49.634 22.846 1.00 58.01  ? 111 LYS A C     1 
ATOM   832  O O     . LYS A 1 139 ? 10.484  49.534 23.996 1.00 64.47  ? 111 LYS A O     1 
ATOM   833  C CB    . LYS A 1 139 ? 10.273  51.694 21.578 1.00 62.64  ? 111 LYS A CB    1 
ATOM   834  C CG    . LYS A 1 139 ? 9.663   52.849 22.355 1.00 72.94  ? 111 LYS A CG    1 
ATOM   835  C CD    . LYS A 1 139 ? 10.702  53.918 22.650 1.00 87.09  ? 111 LYS A CD    1 
ATOM   836  C CE    . LYS A 1 139 ? 10.076  55.133 23.313 1.00 91.30  ? 111 LYS A CE    1 
ATOM   837  N NZ    . LYS A 1 139 ? 11.092  56.168 23.651 1.00 91.33  ? 111 LYS A NZ    1 
ATOM   838  N N     . ALA A 1 140 ? 10.982  48.607 22.006 1.00 54.33  ? 112 ALA A N     1 
ATOM   839  C CA    . ALA A 1 140 ? 10.540  47.269 22.384 1.00 52.87  ? 112 ALA A CA    1 
ATOM   840  C C     . ALA A 1 140 ? 11.442  46.664 23.456 1.00 57.13  ? 112 ALA A C     1 
ATOM   841  O O     . ALA A 1 140 ? 10.964  46.017 24.387 1.00 59.22  ? 112 ALA A O     1 
ATOM   842  C CB    . ALA A 1 140 ? 10.482  46.365 21.164 1.00 51.71  ? 112 ALA A CB    1 
ATOM   843  N N     . ILE A 1 141 ? 12.747  46.877 23.318 1.00 53.47  ? 113 ILE A N     1 
ATOM   844  C CA    . ILE A 1 141 ? 13.713  46.377 24.290 1.00 51.14  ? 113 ILE A CA    1 
ATOM   845  C C     . ILE A 1 141 ? 13.568  47.108 25.624 1.00 56.06  ? 113 ILE A C     1 
ATOM   846  O O     . ILE A 1 141 ? 13.651  46.497 26.691 1.00 53.53  ? 113 ILE A O     1 
ATOM   847  C CB    . ILE A 1 141 ? 15.160  46.500 23.763 1.00 48.47  ? 113 ILE A CB    1 
ATOM   848  C CG1   . ILE A 1 141 ? 15.376  45.550 22.584 1.00 55.04  ? 113 ILE A CG1   1 
ATOM   849  C CG2   . ILE A 1 141 ? 16.168  46.200 24.862 1.00 42.06  ? 113 ILE A CG2   1 
ATOM   850  C CD1   . ILE A 1 141 ? 16.760  45.628 21.976 1.00 45.59  ? 113 ILE A CD1   1 
ATOM   851  N N     . GLU A 1 142 ? 13.336  48.415 25.557 1.00 52.17  ? 114 GLU A N     1 
ATOM   852  C CA    . GLU A 1 142 ? 13.145  49.221 26.758 1.00 53.15  ? 114 GLU A CA    1 
ATOM   853  C C     . GLU A 1 142 ? 11.924  48.763 27.555 1.00 55.85  ? 114 GLU A C     1 
ATOM   854  O O     . GLU A 1 142 ? 11.988  48.626 28.778 1.00 58.58  ? 114 GLU A O     1 
ATOM   855  C CB    . GLU A 1 142 ? 13.032  50.704 26.400 1.00 57.41  ? 114 GLU A CB    1 
ATOM   856  C CG    . GLU A 1 142 ? 14.322  51.300 25.862 1.00 66.60  ? 114 GLU A CG    1 
ATOM   857  C CD    . GLU A 1 142 ? 14.160  52.736 25.407 1.00 78.48  ? 114 GLU A CD    1 
ATOM   858  O OE1   . GLU A 1 142 ? 13.014  53.233 25.391 1.00 84.24  ? 114 GLU A OE1   1 
ATOM   859  O OE2   . GLU A 1 142 ? 15.183  53.368 25.067 1.00 76.14  ? 114 GLU A OE2   1 
ATOM   860  N N     . TRP A 1 143 ? 10.816  48.525 26.861 1.00 49.57  ? 115 TRP A N     1 
ATOM   861  C CA    . TRP A 1 143 ? 9.623   47.989 27.504 1.00 51.71  ? 115 TRP A CA    1 
ATOM   862  C C     . TRP A 1 143 ? 9.900   46.593 28.048 1.00 58.63  ? 115 TRP A C     1 
ATOM   863  O O     . TRP A 1 143 ? 9.402   46.218 29.111 1.00 58.97  ? 115 TRP A O     1 
ATOM   864  C CB    . TRP A 1 143 ? 8.445   47.939 26.526 1.00 59.64  ? 115 TRP A CB    1 
ATOM   865  C CG    . TRP A 1 143 ? 7.717   49.239 26.368 1.00 64.17  ? 115 TRP A CG    1 
ATOM   866  C CD1   . TRP A 1 143 ? 7.703   50.042 25.265 1.00 67.86  ? 115 TRP A CD1   1 
ATOM   867  C CD2   . TRP A 1 143 ? 6.891   49.886 27.345 1.00 61.84  ? 115 TRP A CD2   1 
ATOM   868  N NE1   . TRP A 1 143 ? 6.921   51.148 25.495 1.00 68.37  ? 115 TRP A NE1   1 
ATOM   869  C CE2   . TRP A 1 143 ? 6.411   51.077 26.764 1.00 63.13  ? 115 TRP A CE2   1 
ATOM   870  C CE3   . TRP A 1 143 ? 6.512   49.574 28.655 1.00 59.87  ? 115 TRP A CE3   1 
ATOM   871  C CZ2   . TRP A 1 143 ? 5.573   51.956 27.447 1.00 44.48  ? 115 TRP A CZ2   1 
ATOM   872  C CZ3   . TRP A 1 143 ? 5.679   50.449 29.332 1.00 55.83  ? 115 TRP A CZ3   1 
ATOM   873  C CH2   . TRP A 1 143 ? 5.219   51.626 28.726 1.00 43.01  ? 115 TRP A CH2   1 
ATOM   874  N N     . ALA A 1 144 ? 10.699  45.829 27.310 1.00 62.04  ? 116 ALA A N     1 
ATOM   875  C CA    . ALA A 1 144 ? 11.031  44.463 27.697 1.00 63.71  ? 116 ALA A CA    1 
ATOM   876  C C     . ALA A 1 144 ? 11.776  44.421 29.027 1.00 68.23  ? 116 ALA A C     1 
ATOM   877  O O     . ALA A 1 144 ? 11.473  43.598 29.888 1.00 72.65  ? 116 ALA A O     1 
ATOM   878  C CB    . ALA A 1 144 ? 11.845  43.782 26.605 1.00 58.86  ? 116 ALA A CB    1 
ATOM   879  N N     . TRP A 1 145 ? 12.748  45.311 29.194 1.00 62.52  ? 117 TRP A N     1 
ATOM   880  C CA    . TRP A 1 145 ? 13.510  45.374 30.436 1.00 52.37  ? 117 TRP A CA    1 
ATOM   881  C C     . TRP A 1 145 ? 12.637  45.801 31.610 1.00 48.66  ? 117 TRP A C     1 
ATOM   882  O O     . TRP A 1 145 ? 12.848  45.367 32.742 1.00 42.57  ? 117 TRP A O     1 
ATOM   883  C CB    . TRP A 1 145 ? 14.716  46.303 30.290 1.00 36.57  ? 117 TRP A CB    1 
ATOM   884  C CG    . TRP A 1 145 ? 15.905  45.625 29.687 1.00 47.81  ? 117 TRP A CG    1 
ATOM   885  C CD1   . TRP A 1 145 ? 16.241  45.578 28.366 1.00 48.74  ? 117 TRP A CD1   1 
ATOM   886  C CD2   . TRP A 1 145 ? 16.913  44.882 30.384 1.00 48.79  ? 117 TRP A CD2   1 
ATOM   887  N NE1   . TRP A 1 145 ? 17.399  44.856 28.197 1.00 46.23  ? 117 TRP A NE1   1 
ATOM   888  C CE2   . TRP A 1 145 ? 17.831  44.419 29.422 1.00 44.49  ? 117 TRP A CE2   1 
ATOM   889  C CE3   . TRP A 1 145 ? 17.129  44.567 31.730 1.00 51.29  ? 117 TRP A CE3   1 
ATOM   890  C CZ2   . TRP A 1 145 ? 18.947  43.659 29.762 1.00 36.53  ? 117 TRP A CZ2   1 
ATOM   891  C CZ3   . TRP A 1 145 ? 18.237  43.812 32.064 1.00 47.80  ? 117 TRP A CZ3   1 
ATOM   892  C CH2   . TRP A 1 145 ? 19.131  43.365 31.084 1.00 44.89  ? 117 TRP A CH2   1 
ATOM   893  N N     . GLY A 1 146 ? 11.651  46.646 31.333 1.00 47.86  ? 118 GLY A N     1 
ATOM   894  C CA    . GLY A 1 146 ? 10.714  47.072 32.353 1.00 44.94  ? 118 GLY A CA    1 
ATOM   895  C C     . GLY A 1 146 ? 9.876   45.917 32.869 1.00 45.95  ? 118 GLY A C     1 
ATOM   896  O O     . GLY A 1 146 ? 9.634   45.804 34.070 1.00 48.94  ? 118 GLY A O     1 
ATOM   897  N N     . THR A 1 147 ? 9.440   45.050 31.960 1.00 43.96  ? 119 THR A N     1 
ATOM   898  C CA    . THR A 1 147 ? 8.576   43.933 32.331 1.00 46.03  ? 119 THR A CA    1 
ATOM   899  C C     . THR A 1 147 ? 9.375   42.747 32.879 1.00 48.25  ? 119 THR A C     1 
ATOM   900  O O     . THR A 1 147 ? 8.846   41.929 33.632 1.00 49.61  ? 119 THR A O     1 
ATOM   901  C CB    . THR A 1 147 ? 7.669   43.489 31.152 1.00 44.80  ? 119 THR A CB    1 
ATOM   902  O OG1   . THR A 1 147 ? 6.595   42.680 31.646 1.00 34.98  ? 119 THR A OG1   1 
ATOM   903  C CG2   . THR A 1 147 ? 8.454   42.703 30.117 1.00 35.81  ? 119 THR A CG2   1 
ATOM   904  N N     . MET A 1 148 ? 10.650  42.667 32.510 1.00 52.89  ? 120 MET A N     1 
ATOM   905  C CA    . MET A 1 148 ? 11.523  41.606 33.006 1.00 52.68  ? 120 MET A CA    1 
ATOM   906  C C     . MET A 1 148 ? 11.996  41.889 34.430 1.00 49.89  ? 120 MET A C     1 
ATOM   907  O O     . MET A 1 148 ? 12.213  40.967 35.218 1.00 47.42  ? 120 MET A O     1 
ATOM   908  C CB    . MET A 1 148 ? 12.721  41.402 32.073 1.00 49.81  ? 120 MET A CB    1 
ATOM   909  C CG    . MET A 1 148 ? 12.377  40.700 30.767 1.00 54.44  ? 120 MET A CG    1 
ATOM   910  S SD    . MET A 1 148 ? 13.815  40.375 29.726 1.00 54.65  ? 120 MET A SD    1 
ATOM   911  C CE    . MET A 1 148 ? 14.314  42.037 29.291 1.00 36.01  ? 120 MET A CE    1 
ATOM   912  N N     . ILE A 1 149 ? 12.155  43.168 34.753 1.00 44.03  ? 121 ILE A N     1 
ATOM   913  C CA    . ILE A 1 149 ? 12.534  43.570 36.101 1.00 39.88  ? 121 ILE A CA    1 
ATOM   914  C C     . ILE A 1 149 ? 11.370  43.383 37.072 1.00 44.47  ? 121 ILE A C     1 
ATOM   915  O O     . ILE A 1 149 ? 11.539  42.806 38.146 1.00 51.09  ? 121 ILE A O     1 
ATOM   916  C CB    . ILE A 1 149 ? 13.033  45.030 36.142 1.00 41.91  ? 121 ILE A CB    1 
ATOM   917  C CG1   . ILE A 1 149 ? 14.414  45.135 35.490 1.00 32.80  ? 121 ILE A CG1   1 
ATOM   918  C CG2   . ILE A 1 149 ? 13.091  45.539 37.574 1.00 32.14  ? 121 ILE A CG2   1 
ATOM   919  C CD1   . ILE A 1 149 ? 14.950  46.544 35.414 1.00 33.40  ? 121 ILE A CD1   1 
ATOM   920  N N     . ILE A 1 150 ? 10.191  43.863 36.685 1.00 46.49  ? 122 ILE A N     1 
ATOM   921  C CA    . ILE A 1 150 ? 8.995   43.710 37.509 1.00 31.85  ? 122 ILE A CA    1 
ATOM   922  C C     . ILE A 1 150 ? 8.684   42.238 37.766 1.00 35.57  ? 122 ILE A C     1 
ATOM   923  O O     . ILE A 1 150 ? 8.440   41.838 38.903 1.00 32.72  ? 122 ILE A O     1 
ATOM   924  C CB    . ILE A 1 150 ? 7.766   44.392 36.872 1.00 50.09  ? 122 ILE A CB    1 
ATOM   925  C CG1   . ILE A 1 150 ? 7.939   45.913 36.875 1.00 45.29  ? 122 ILE A CG1   1 
ATOM   926  C CG2   . ILE A 1 150 ? 6.492   44.005 37.612 1.00 32.36  ? 122 ILE A CG2   1 
ATOM   927  C CD1   . ILE A 1 150 ? 6.761   46.663 36.289 1.00 45.42  ? 122 ILE A CD1   1 
ATOM   928  N N     . GLY A 1 151 ? 8.705   41.436 36.705 1.00 38.55  ? 123 GLY A N     1 
ATOM   929  C CA    . GLY A 1 151 ? 8.462   40.009 36.819 1.00 40.93  ? 123 GLY A CA    1 
ATOM   930  C C     . GLY A 1 151 ? 9.522   39.301 37.641 1.00 43.87  ? 123 GLY A C     1 
ATOM   931  O O     . GLY A 1 151 ? 9.234   38.325 38.337 1.00 41.66  ? 123 GLY A O     1 
ATOM   932  N N     . GLY A 1 152 ? 10.755  39.794 37.561 1.00 38.68  ? 124 GLY A N     1 
ATOM   933  C CA    . GLY A 1 152 ? 11.853  39.238 38.330 1.00 34.73  ? 124 GLY A CA    1 
ATOM   934  C C     . GLY A 1 152 ? 11.716  39.541 39.809 1.00 42.23  ? 124 GLY A C     1 
ATOM   935  O O     . GLY A 1 152 ? 11.830  38.647 40.647 1.00 44.64  ? 124 GLY A O     1 
ATOM   936  N N     . VAL A 1 153 ? 11.470  40.807 40.128 0.55 30.56  ? 125 VAL A N     1 
ATOM   937  C CA    . VAL A 1 153 ? 11.298  41.232 41.512 0.55 30.53  ? 125 VAL A CA    1 
ATOM   938  C C     . VAL A 1 153 ? 10.065  40.574 42.131 0.55 30.54  ? 125 VAL A C     1 
ATOM   939  O O     . VAL A 1 153 ? 10.072  40.200 43.303 0.55 30.61  ? 125 VAL A O     1 
ATOM   940  C CB    . VAL A 1 153 ? 11.203  42.770 41.613 1.00 43.68  ? 125 VAL A CB    1 
ATOM   941  C CG1   . VAL A 1 153 ? 10.799  43.208 43.011 1.00 30.94  ? 125 VAL A CG1   1 
ATOM   942  C CG2   . VAL A 1 153 ? 12.530  43.408 41.220 1.00 35.28  ? 125 VAL A CG2   1 
ATOM   943  N N     . ALA A 1 154 ? 9.017   40.419 41.326 1.00 45.29  ? 126 ALA A N     1 
ATOM   944  C CA    . ALA A 1 154 ? 7.776   39.783 41.768 1.00 36.24  ? 126 ALA A CA    1 
ATOM   945  C C     . ALA A 1 154 ? 7.997   38.348 42.244 1.00 40.54  ? 126 ALA A C     1 
ATOM   946  O O     . ALA A 1 154 ? 7.366   37.899 43.199 1.00 40.28  ? 126 ALA A O     1 
ATOM   947  C CB    . ALA A 1 154 ? 6.744   39.813 40.655 1.00 30.90  ? 126 ALA A CB    1 
ATOM   948  N N     . ARG A 1 155 ? 8.895   37.633 41.574 1.00 39.99  ? 127 ARG A N     1 
ATOM   949  C CA    . ARG A 1 155 ? 9.204   36.257 41.946 1.00 39.22  ? 127 ARG A CA    1 
ATOM   950  C C     . ARG A 1 155 ? 10.098  36.181 43.179 1.00 39.21  ? 127 ARG A C     1 
ATOM   951  O O     . ARG A 1 155 ? 9.794   35.472 44.139 1.00 38.31  ? 127 ARG A O     1 
ATOM   952  C CB    . ARG A 1 155 ? 9.880   35.520 40.789 1.00 30.91  ? 127 ARG A CB    1 
ATOM   953  C CG    . ARG A 1 155 ? 10.464  34.178 41.196 1.00 36.35  ? 127 ARG A CG    1 
ATOM   954  C CD    . ARG A 1 155 ? 11.383  33.604 40.133 1.00 42.22  ? 127 ARG A CD    1 
ATOM   955  N NE    . ARG A 1 155 ? 12.119  32.452 40.644 1.00 46.52  ? 127 ARG A NE    1 
ATOM   956  C CZ    . ARG A 1 155 ? 13.000  31.752 39.939 1.00 51.75  ? 127 ARG A CZ    1 
ATOM   957  N NH1   . ARG A 1 155 ? 13.261  32.083 38.682 1.00 51.90  ? 127 ARG A NH1   1 
ATOM   958  N NH2   . ARG A 1 155 ? 13.622  30.719 40.493 1.00 55.60  ? 127 ARG A NH2   1 
ATOM   959  N N     . TYR A 1 156 ? 11.207  36.913 43.144 1.00 43.83  ? 128 TYR A N     1 
ATOM   960  C CA    . TYR A 1 156 ? 12.210  36.835 44.201 1.00 41.69  ? 128 TYR A CA    1 
ATOM   961  C C     . TYR A 1 156 ? 11.768  37.477 45.514 1.00 50.46  ? 128 TYR A C     1 
ATOM   962  O O     . TYR A 1 156 ? 12.430  37.317 46.541 1.00 55.50  ? 128 TYR A O     1 
ATOM   963  C CB    . TYR A 1 156 ? 13.546  37.415 43.724 1.00 36.49  ? 128 TYR A CB    1 
ATOM   964  C CG    . TYR A 1 156 ? 14.295  36.479 42.804 1.00 47.14  ? 128 TYR A CG    1 
ATOM   965  C CD1   . TYR A 1 156 ? 13.977  36.396 41.454 1.00 51.67  ? 128 TYR A CD1   1 
ATOM   966  C CD2   . TYR A 1 156 ? 15.310  35.663 43.289 1.00 47.78  ? 128 TYR A CD2   1 
ATOM   967  C CE1   . TYR A 1 156 ? 14.653  35.534 40.611 1.00 49.99  ? 128 TYR A CE1   1 
ATOM   968  C CE2   . TYR A 1 156 ? 15.991  34.799 42.455 1.00 53.75  ? 128 TYR A CE2   1 
ATOM   969  C CZ    . TYR A 1 156 ? 15.659  34.738 41.117 1.00 57.95  ? 128 TYR A CZ    1 
ATOM   970  O OH    . TYR A 1 156 ? 16.334  33.878 40.282 1.00 69.65  ? 128 TYR A OH    1 
ATOM   971  N N     . PHE A 1 157 ? 10.652  38.199 45.479 1.00 31.09  ? 129 PHE A N     1 
ATOM   972  C CA    . PHE A 1 157 ? 10.060  38.731 46.700 1.00 41.83  ? 129 PHE A CA    1 
ATOM   973  C C     . PHE A 1 157 ? 9.717   37.577 47.630 1.00 44.16  ? 129 PHE A C     1 
ATOM   974  O O     . PHE A 1 157 ? 10.003  37.623 48.826 1.00 44.57  ? 129 PHE A O     1 
ATOM   975  C CB    . PHE A 1 157 ? 8.802   39.546 46.389 1.00 31.41  ? 129 PHE A CB    1 
ATOM   976  C CG    . PHE A 1 157 ? 7.950   39.831 47.598 1.00 31.96  ? 129 PHE A CG    1 
ATOM   977  C CD1   . PHE A 1 157 ? 8.272   40.865 48.462 1.00 32.36  ? 129 PHE A CD1   1 
ATOM   978  C CD2   . PHE A 1 157 ? 6.827   39.062 47.869 1.00 32.24  ? 129 PHE A CD2   1 
ATOM   979  C CE1   . PHE A 1 157 ? 7.493   41.126 49.575 1.00 33.06  ? 129 PHE A CE1   1 
ATOM   980  C CE2   . PHE A 1 157 ? 6.045   39.317 48.981 1.00 32.90  ? 129 PHE A CE2   1 
ATOM   981  C CZ    . PHE A 1 157 ? 6.378   40.351 49.835 1.00 45.37  ? 129 PHE A CZ    1 
ATOM   982  N N     . TRP A 1 158 ? 9.110   36.537 47.063 1.00 46.36  ? 130 TRP A N     1 
ATOM   983  C CA    . TRP A 1 158 ? 8.713   35.360 47.827 1.00 47.61  ? 130 TRP A CA    1 
ATOM   984  C C     . TRP A 1 158 ? 9.914   34.521 48.260 1.00 47.49  ? 130 TRP A C     1 
ATOM   985  O O     . TRP A 1 158 ? 9.867   33.844 49.286 1.00 53.28  ? 130 TRP A O     1 
ATOM   986  C CB    . TRP A 1 158 ? 7.727   34.511 47.026 1.00 46.23  ? 130 TRP A CB    1 
ATOM   987  C CG    . TRP A 1 158 ? 6.423   35.201 46.768 1.00 43.71  ? 130 TRP A CG    1 
ATOM   988  C CD1   . TRP A 1 158 ? 6.052   35.853 45.629 1.00 42.81  ? 130 TRP A CD1   1 
ATOM   989  C CD2   . TRP A 1 158 ? 5.317   35.311 47.672 1.00 47.18  ? 130 TRP A CD2   1 
ATOM   990  N NE1   . TRP A 1 158 ? 4.782   36.360 45.766 1.00 42.67  ? 130 TRP A NE1   1 
ATOM   991  C CE2   . TRP A 1 158 ? 4.308   36.040 47.011 1.00 44.63  ? 130 TRP A CE2   1 
ATOM   992  C CE3   . TRP A 1 158 ? 5.080   34.862 48.975 1.00 42.78  ? 130 TRP A CE3   1 
ATOM   993  C CZ2   . TRP A 1 158 ? 3.083   36.330 47.608 1.00 41.89  ? 130 TRP A CZ2   1 
ATOM   994  C CZ3   . TRP A 1 158 ? 3.864   35.152 49.567 1.00 41.52  ? 130 TRP A CZ3   1 
ATOM   995  C CH2   . TRP A 1 158 ? 2.881   35.878 48.883 1.00 41.20  ? 130 TRP A CH2   1 
ATOM   996  N N     . HIS A 1 159 ? 10.985  34.565 47.474 1.00 41.69  ? 131 HIS A N     1 
ATOM   997  C CA    . HIS A 1 159 ? 12.234  33.919 47.863 1.00 45.47  ? 131 HIS A CA    1 
ATOM   998  C C     . HIS A 1 159 ? 12.856  34.666 49.036 1.00 51.06  ? 131 HIS A C     1 
ATOM   999  O O     . HIS A 1 159 ? 13.428  34.056 49.942 1.00 53.39  ? 131 HIS A O     1 
ATOM   1000 C CB    . HIS A 1 159 ? 13.210  33.860 46.687 1.00 44.32  ? 131 HIS A CB    1 
ATOM   1001 C CG    . HIS A 1 159 ? 12.815  32.882 45.625 1.00 50.33  ? 131 HIS A CG    1 
ATOM   1002 N ND1   . HIS A 1 159 ? 12.211  31.677 45.914 1.00 45.19  ? 131 HIS A ND1   1 
ATOM   1003 C CD2   . HIS A 1 159 ? 12.930  32.932 44.277 1.00 54.70  ? 131 HIS A CD2   1 
ATOM   1004 C CE1   . HIS A 1 159 ? 11.972  31.026 44.788 1.00 44.08  ? 131 HIS A CE1   1 
ATOM   1005 N NE2   . HIS A 1 159 ? 12.400  31.766 43.781 1.00 49.77  ? 131 HIS A NE2   1 
ATOM   1006 N N     . TYR A 1 160 ? 12.737  35.990 49.013 1.00 43.45  ? 132 TYR A N     1 
ATOM   1007 C CA    . TYR A 1 160 ? 13.197  36.818 50.119 1.00 50.27  ? 132 TYR A CA    1 
ATOM   1008 C C     . TYR A 1 160 ? 12.399  36.525 51.388 1.00 50.59  ? 132 TYR A C     1 
ATOM   1009 O O     . TYR A 1 160 ? 12.959  36.473 52.485 1.00 47.28  ? 132 TYR A O     1 
ATOM   1010 C CB    . TYR A 1 160 ? 13.101  38.303 49.763 1.00 33.04  ? 132 TYR A CB    1 
ATOM   1011 C CG    . TYR A 1 160 ? 12.985  39.208 50.968 1.00 43.79  ? 132 TYR A CG    1 
ATOM   1012 C CD1   . TYR A 1 160 ? 14.080  39.453 51.787 1.00 40.99  ? 132 TYR A CD1   1 
ATOM   1013 C CD2   . TYR A 1 160 ? 11.776  39.816 51.290 1.00 41.38  ? 132 TYR A CD2   1 
ATOM   1014 C CE1   . TYR A 1 160 ? 13.975  40.277 52.894 1.00 44.96  ? 132 TYR A CE1   1 
ATOM   1015 C CE2   . TYR A 1 160 ? 11.662  40.642 52.394 1.00 36.86  ? 132 TYR A CE2   1 
ATOM   1016 C CZ    . TYR A 1 160 ? 12.764  40.869 53.191 1.00 43.89  ? 132 TYR A CZ    1 
ATOM   1017 O OH    . TYR A 1 160 ? 12.652  41.690 54.290 1.00 36.23  ? 132 TYR A OH    1 
ATOM   1018 N N     . VAL A 1 161 ? 11.092  36.334 51.229 1.00 44.36  ? 133 VAL A N     1 
ATOM   1019 C CA    . VAL A 1 161 ? 10.217  36.023 52.354 1.00 47.28  ? 133 VAL A CA    1 
ATOM   1020 C C     . VAL A 1 161 ? 10.617  34.707 53.014 1.00 49.87  ? 133 VAL A C     1 
ATOM   1021 O O     . VAL A 1 161 ? 10.789  34.638 54.233 1.00 45.85  ? 133 VAL A O     1 
ATOM   1022 C CB    . VAL A 1 161 ? 8.737   35.952 51.919 1.00 42.37  ? 133 VAL A CB    1 
ATOM   1023 C CG1   . VAL A 1 161 ? 7.875   35.377 53.036 1.00 35.99  ? 133 VAL A CG1   1 
ATOM   1024 C CG2   . VAL A 1 161 ? 8.239   37.328 51.510 1.00 40.68  ? 133 VAL A CG2   1 
ATOM   1025 N N     . ALA A 1 162 ? 10.776  33.670 52.200 1.00 46.47  ? 134 ALA A N     1 
ATOM   1026 C CA    . ALA A 1 162 ? 11.143  32.351 52.700 1.00 51.66  ? 134 ALA A CA    1 
ATOM   1027 C C     . ALA A 1 162 ? 12.562  32.333 53.259 1.00 53.73  ? 134 ALA A C     1 
ATOM   1028 O O     . ALA A 1 162 ? 12.882  31.534 54.141 1.00 48.62  ? 134 ALA A O     1 
ATOM   1029 C CB    . ALA A 1 162 ? 10.996  31.319 51.606 1.00 36.53  ? 134 ALA A CB    1 
ATOM   1030 N N     . GLY A 1 163 ? 13.412  33.212 52.737 1.00 49.11  ? 135 GLY A N     1 
ATOM   1031 C CA    . GLY A 1 163 ? 14.775  33.322 53.216 1.00 37.29  ? 135 GLY A CA    1 
ATOM   1032 C C     . GLY A 1 163 ? 14.823  33.739 54.673 1.00 48.20  ? 135 GLY A C     1 
ATOM   1033 O O     . GLY A 1 163 ? 15.609  33.207 55.457 1.00 56.44  ? 135 GLY A O     1 
ATOM   1034 N N     . VAL A 1 164 ? 13.973  34.696 55.031 1.00 42.76  ? 136 VAL A N     1 
ATOM   1035 C CA    . VAL A 1 164 ? 13.888  35.179 56.404 1.00 47.22  ? 136 VAL A CA    1 
ATOM   1036 C C     . VAL A 1 164 ? 13.258  34.119 57.301 1.00 49.07  ? 136 VAL A C     1 
ATOM   1037 O O     . VAL A 1 164 ? 13.680  33.920 58.440 1.00 55.16  ? 136 VAL A O     1 
ATOM   1038 C CB    . VAL A 1 164 ? 13.055  36.476 56.492 1.00 43.12  ? 136 VAL A CB    1 
ATOM   1039 C CG1   . VAL A 1 164 ? 13.053  37.019 57.914 1.00 40.50  ? 136 VAL A CG1   1 
ATOM   1040 C CG2   . VAL A 1 164 ? 13.591  37.518 55.523 1.00 39.61  ? 136 VAL A CG2   1 
ATOM   1041 N N     . LEU A 1 165 ? 12.253  33.432 56.771 1.00 40.41  ? 137 LEU A N     1 
ATOM   1042 C CA    . LEU A 1 165 ? 11.508  32.441 57.537 1.00 41.70  ? 137 LEU A CA    1 
ATOM   1043 C C     . LEU A 1 165 ? 12.242  31.112 57.711 1.00 47.87  ? 137 LEU A C     1 
ATOM   1044 O O     . LEU A 1 165 ? 12.151  30.486 58.767 1.00 52.16  ? 137 LEU A O     1 
ATOM   1045 C CB    . LEU A 1 165 ? 10.146  32.184 56.885 1.00 45.22  ? 137 LEU A CB    1 
ATOM   1046 C CG    . LEU A 1 165 ? 9.083   33.280 56.959 1.00 50.80  ? 137 LEU A CG    1 
ATOM   1047 C CD1   . LEU A 1 165 ? 7.936   32.966 56.012 1.00 39.68  ? 137 LEU A CD1   1 
ATOM   1048 C CD2   . LEU A 1 165 ? 8.576   33.431 58.383 1.00 42.15  ? 137 LEU A CD2   1 
ATOM   1049 N N     . PHE A 1 166 ? 12.969  30.679 56.685 1.00 48.86  ? 138 PHE A N     1 
ATOM   1050 C CA    . PHE A 1 166 ? 13.473  29.309 56.666 1.00 42.90  ? 138 PHE A CA    1 
ATOM   1051 C C     . PHE A 1 166 ? 14.983  29.145 56.480 1.00 45.31  ? 138 PHE A C     1 
ATOM   1052 O O     . PHE A 1 166 ? 15.545  28.126 56.879 1.00 54.52  ? 138 PHE A O     1 
ATOM   1053 C CB    . PHE A 1 166 ? 12.740  28.501 55.591 1.00 58.30  ? 138 PHE A CB    1 
ATOM   1054 C CG    . PHE A 1 166 ? 11.244  28.619 55.659 1.00 55.82  ? 138 PHE A CG    1 
ATOM   1055 C CD1   . PHE A 1 166 ? 10.522  27.920 56.614 1.00 56.70  ? 138 PHE A CD1   1 
ATOM   1056 C CD2   . PHE A 1 166 ? 10.558  29.423 54.763 1.00 50.51  ? 138 PHE A CD2   1 
ATOM   1057 C CE1   . PHE A 1 166 ? 9.146   28.024 56.677 1.00 51.31  ? 138 PHE A CE1   1 
ATOM   1058 C CE2   . PHE A 1 166 ? 9.181   29.529 54.819 1.00 48.72  ? 138 PHE A CE2   1 
ATOM   1059 C CZ    . PHE A 1 166 ? 8.474   28.829 55.779 1.00 50.58  ? 138 PHE A CZ    1 
ATOM   1060 N N     . TRP A 1 167 ? 15.639  30.132 55.876 1.00 48.27  ? 139 TRP A N     1 
ATOM   1061 C CA    . TRP A 1 167 ? 17.038  29.968 55.472 1.00 55.70  ? 139 TRP A CA    1 
ATOM   1062 C C     . TRP A 1 167 ? 18.057  30.690 56.352 1.00 55.50  ? 139 TRP A C     1 
ATOM   1063 O O     . TRP A 1 167 ? 19.184  30.936 55.925 1.00 53.48  ? 139 TRP A O     1 
ATOM   1064 C CB    . TRP A 1 167 ? 17.219  30.383 54.010 1.00 40.27  ? 139 TRP A CB    1 
ATOM   1065 C CG    . TRP A 1 167 ? 16.550  29.448 53.060 1.00 48.55  ? 139 TRP A CG    1 
ATOM   1066 C CD1   . TRP A 1 167 ? 15.267  29.521 52.604 1.00 45.04  ? 139 TRP A CD1   1 
ATOM   1067 C CD2   . TRP A 1 167 ? 17.125  28.282 52.460 1.00 51.00  ? 139 TRP A CD2   1 
ATOM   1068 N NE1   . TRP A 1 167 ? 15.009  28.476 51.750 1.00 49.01  ? 139 TRP A NE1   1 
ATOM   1069 C CE2   . TRP A 1 167 ? 16.133  27.700 51.646 1.00 51.38  ? 139 TRP A CE2   1 
ATOM   1070 C CE3   . TRP A 1 167 ? 18.382  27.676 52.528 1.00 53.84  ? 139 TRP A CE3   1 
ATOM   1071 C CZ2   . TRP A 1 167 ? 16.360  26.542 50.906 1.00 55.85  ? 139 TRP A CZ2   1 
ATOM   1072 C CZ3   . TRP A 1 167 ? 18.605  26.527 51.794 1.00 62.20  ? 139 TRP A CZ3   1 
ATOM   1073 C CH2   . TRP A 1 167 ? 17.599  25.972 50.993 1.00 64.23  ? 139 TRP A CH2   1 
ATOM   1074 N N     . GLY A 1 168 ? 17.666  31.010 57.581 1.00 57.77  ? 140 GLY A N     1 
ATOM   1075 C CA    . GLY A 1 168 ? 18.531  31.746 58.484 1.00 57.22  ? 140 GLY A CA    1 
ATOM   1076 C C     . GLY A 1 168 ? 19.815  31.024 58.851 1.00 62.24  ? 140 GLY A C     1 
ATOM   1077 O O     . GLY A 1 168 ? 20.864  31.650 59.002 1.00 46.32  ? 140 GLY A O     1 
ATOM   1078 N N     . ALA A 1 169 ? 19.738  29.703 58.984 1.00 67.03  ? 141 ALA A N     1 
ATOM   1079 C CA    . ALA A 1 169 ? 20.874  28.907 59.442 1.00 62.86  ? 141 ALA A CA    1 
ATOM   1080 C C     . ALA A 1 169 ? 21.937  28.700 58.364 1.00 70.61  ? 141 ALA A C     1 
ATOM   1081 O O     . ALA A 1 169 ? 22.927  28.004 58.587 1.00 79.71  ? 141 ALA A O     1 
ATOM   1082 C CB    . ALA A 1 169 ? 20.398  27.564 59.981 1.00 57.25  ? 141 ALA A CB    1 
ATOM   1083 N N     . TYR A 1 170 ? 21.726  29.303 57.199 1.00 68.76  ? 142 TYR A N     1 
ATOM   1084 C CA    . TYR A 1 170 ? 22.679  29.200 56.100 1.00 56.81  ? 142 TYR A CA    1 
ATOM   1085 C C     . TYR A 1 170 ? 23.421  30.517 55.908 1.00 48.09  ? 142 TYR A C     1 
ATOM   1086 O O     . TYR A 1 170 ? 24.203  30.670 54.970 1.00 47.00  ? 142 TYR A O     1 
ATOM   1087 C CB    . TYR A 1 170 ? 21.963  28.806 54.806 1.00 44.03  ? 142 TYR A CB    1 
ATOM   1088 C CG    . TYR A 1 170 ? 21.417  27.395 54.806 1.00 53.41  ? 142 TYR A CG    1 
ATOM   1089 C CD1   . TYR A 1 170 ? 20.182  27.107 55.372 1.00 50.62  ? 142 TYR A CD1   1 
ATOM   1090 C CD2   . TYR A 1 170 ? 22.134  26.353 54.234 1.00 45.71  ? 142 TYR A CD2   1 
ATOM   1091 C CE1   . TYR A 1 170 ? 19.678  25.819 55.372 1.00 55.88  ? 142 TYR A CE1   1 
ATOM   1092 C CE2   . TYR A 1 170 ? 21.639  25.063 54.228 1.00 65.38  ? 142 TYR A CE2   1 
ATOM   1093 C CZ    . TYR A 1 170 ? 20.411  24.801 54.798 1.00 63.34  ? 142 TYR A CZ    1 
ATOM   1094 O OH    . TYR A 1 170 ? 19.917  23.515 54.795 1.00 62.42  ? 142 TYR A OH    1 
ATOM   1095 N N     . ALA A 1 171 ? 23.176  31.462 56.810 1.00 45.16  ? 143 ALA A N     1 
ATOM   1096 C CA    . ALA A 1 171 ? 23.739  32.803 56.698 1.00 44.59  ? 143 ALA A CA    1 
ATOM   1097 C C     . ALA A 1 171 ? 25.239  32.833 56.961 1.00 47.02  ? 143 ALA A C     1 
ATOM   1098 O O     . ALA A 1 171 ? 25.808  31.872 57.478 1.00 49.16  ? 143 ALA A O     1 
ATOM   1099 C CB    . ALA A 1 171 ? 23.020  33.755 57.644 1.00 44.32  ? 143 ALA A CB    1 
ATOM   1100 N N     . PHE A 1 172 ? 25.872  33.946 56.601 1.00 44.48  ? 144 PHE A N     1 
ATOM   1101 C CA    . PHE A 1 172 ? 27.271  34.170 56.938 1.00 45.57  ? 144 PHE A CA    1 
ATOM   1102 C C     . PHE A 1 172 ? 27.406  34.277 58.451 1.00 47.41  ? 144 PHE A C     1 
ATOM   1103 O O     . PHE A 1 172 ? 26.410  34.377 59.167 1.00 47.67  ? 144 PHE A O     1 
ATOM   1104 C CB    . PHE A 1 172 ? 27.794  35.457 56.292 1.00 53.46  ? 144 PHE A CB    1 
ATOM   1105 C CG    . PHE A 1 172 ? 27.690  35.477 54.793 1.00 51.44  ? 144 PHE A CG    1 
ATOM   1106 C CD1   . PHE A 1 172 ? 28.619  34.813 54.011 1.00 43.01  ? 144 PHE A CD1   1 
ATOM   1107 C CD2   . PHE A 1 172 ? 26.673  36.177 54.166 1.00 50.85  ? 144 PHE A CD2   1 
ATOM   1108 C CE1   . PHE A 1 172 ? 28.528  34.837 52.632 1.00 59.89  ? 144 PHE A CE1   1 
ATOM   1109 C CE2   . PHE A 1 172 ? 26.577  36.205 52.787 1.00 46.23  ? 144 PHE A CE2   1 
ATOM   1110 C CZ    . PHE A 1 172 ? 27.504  35.534 52.020 1.00 48.22  ? 144 PHE A CZ    1 
ATOM   1111 N N     . GLN A 1 173 ? 28.640  34.260 58.940 1.00 48.83  ? 145 GLN A N     1 
ATOM   1112 C CA    . GLN A 1 173 ? 28.875  34.402 60.369 1.00 50.83  ? 145 GLN A CA    1 
ATOM   1113 C C     . GLN A 1 173 ? 28.546  35.823 60.813 1.00 69.21  ? 145 GLN A C     1 
ATOM   1114 O O     . GLN A 1 173 ? 29.130  36.787 60.320 1.00 73.07  ? 145 GLN A O     1 
ATOM   1115 C CB    . GLN A 1 173 ? 30.322  34.055 60.718 1.00 52.53  ? 145 GLN A CB    1 
ATOM   1116 C CG    . GLN A 1 173 ? 30.585  33.912 62.206 1.00 69.16  ? 145 GLN A CG    1 
ATOM   1117 C CD    . GLN A 1 173 ? 32.040  33.626 62.513 1.00 89.96  ? 145 GLN A CD    1 
ATOM   1118 O OE1   . GLN A 1 173 ? 32.933  34.010 61.757 1.00 92.05  ? 145 GLN A OE1   1 
ATOM   1119 N NE2   . GLN A 1 173 ? 32.289  32.945 63.627 1.00 107.02 ? 145 GLN A NE2   1 
ATOM   1120 N N     . GLY A 1 174 ? 27.595  35.948 61.734 1.00 68.02  ? 146 GLY A N     1 
ATOM   1121 C CA    . GLY A 1 174 ? 27.222  37.243 62.269 1.00 62.66  ? 146 GLY A CA    1 
ATOM   1122 C C     . GLY A 1 174 ? 26.147  37.952 61.468 1.00 58.72  ? 146 GLY A C     1 
ATOM   1123 O O     . GLY A 1 174 ? 25.927  39.150 61.645 1.00 58.02  ? 146 GLY A O     1 
ATOM   1124 N N     . TRP A 1 175 ? 25.477  37.218 60.584 1.00 60.08  ? 147 TRP A N     1 
ATOM   1125 C CA    . TRP A 1 175 ? 24.395  37.786 59.786 1.00 56.50  ? 147 TRP A CA    1 
ATOM   1126 C C     . TRP A 1 175 ? 23.026  37.324 60.272 1.00 55.57  ? 147 TRP A C     1 
ATOM   1127 O O     . TRP A 1 175 ? 22.846  36.163 60.642 1.00 52.94  ? 147 TRP A O     1 
ATOM   1128 C CB    . TRP A 1 175 ? 24.555  37.429 58.305 1.00 46.64  ? 147 TRP A CB    1 
ATOM   1129 C CG    . TRP A 1 175 ? 25.602  38.224 57.589 1.00 47.71  ? 147 TRP A CG    1 
ATOM   1130 C CD1   . TRP A 1 175 ? 26.813  38.620 58.079 1.00 50.70  ? 147 TRP A CD1   1 
ATOM   1131 C CD2   . TRP A 1 175 ? 25.525  38.731 56.252 1.00 46.03  ? 147 TRP A CD2   1 
ATOM   1132 N NE1   . TRP A 1 175 ? 27.497  39.336 57.126 1.00 51.63  ? 147 TRP A NE1   1 
ATOM   1133 C CE2   . TRP A 1 175 ? 26.728  39.419 55.996 1.00 45.15  ? 147 TRP A CE2   1 
ATOM   1134 C CE3   . TRP A 1 175 ? 24.556  38.667 55.245 1.00 40.49  ? 147 TRP A CE3   1 
ATOM   1135 C CZ2   . TRP A 1 175 ? 26.988  40.038 54.775 1.00 41.20  ? 147 TRP A CZ2   1 
ATOM   1136 C CZ3   . TRP A 1 175 ? 24.816  39.282 54.034 1.00 47.52  ? 147 TRP A CZ3   1 
ATOM   1137 C CH2   . TRP A 1 175 ? 26.022  39.959 53.809 1.00 47.98  ? 147 TRP A CH2   1 
ATOM   1138 N N     . GLY A 1 176 ? 22.064  38.240 60.265 1.00 53.44  ? 148 GLY A N     1 
ATOM   1139 C CA    . GLY A 1 176 ? 20.693  37.908 60.605 1.00 59.46  ? 148 GLY A CA    1 
ATOM   1140 C C     . GLY A 1 176 ? 19.981  37.286 59.420 1.00 62.69  ? 148 GLY A C     1 
ATOM   1141 O O     . GLY A 1 176 ? 20.484  37.330 58.297 1.00 64.71  ? 148 GLY A O     1 
ATOM   1142 N N     . ALA A 1 177 ? 18.810  36.708 59.666 1.00 62.62  ? 149 ALA A N     1 
ATOM   1143 C CA    . ALA A 1 177 ? 18.047  36.045 58.614 1.00 55.83  ? 149 ALA A CA    1 
ATOM   1144 C C     . ALA A 1 177 ? 17.564  37.026 57.550 1.00 50.22  ? 149 ALA A C     1 
ATOM   1145 O O     . ALA A 1 177 ? 17.634  36.739 56.355 1.00 49.05  ? 149 ALA A O     1 
ATOM   1146 C CB    . ALA A 1 177 ? 16.872  35.283 59.207 1.00 43.33  ? 149 ALA A CB    1 
ATOM   1147 N N     . GLN A 1 178 ? 17.078  38.182 57.991 1.00 49.80  ? 150 GLN A N     1 
ATOM   1148 C CA    . GLN A 1 178 ? 16.566  39.202 57.080 1.00 39.62  ? 150 GLN A CA    1 
ATOM   1149 C C     . GLN A 1 178 ? 17.685  39.777 56.214 1.00 40.28  ? 150 GLN A C     1 
ATOM   1150 O O     . GLN A 1 178 ? 17.533  39.917 55.001 1.00 37.58  ? 150 GLN A O     1 
ATOM   1151 C CB    . GLN A 1 178 ? 15.862  40.317 57.865 1.00 50.24  ? 150 GLN A CB    1 
ATOM   1152 C CG    . GLN A 1 178 ? 15.042  41.285 57.017 1.00 46.60  ? 150 GLN A CG    1 
ATOM   1153 C CD    . GLN A 1 178 ? 15.884  42.366 56.362 1.00 63.22  ? 150 GLN A CD    1 
ATOM   1154 O OE1   . GLN A 1 178 ? 16.981  42.684 56.825 1.00 75.30  ? 150 GLN A OE1   1 
ATOM   1155 N NE2   . GLN A 1 178 ? 15.374  42.936 55.275 1.00 58.78  ? 150 GLN A NE2   1 
ATOM   1156 N N     . LEU A 1 179 ? 18.806  40.110 56.848 1.00 39.88  ? 151 LEU A N     1 
ATOM   1157 C CA    . LEU A 1 179 ? 19.954  40.663 56.140 1.00 43.93  ? 151 LEU A CA    1 
ATOM   1158 C C     . LEU A 1 179 ? 20.478  39.687 55.093 1.00 44.72  ? 151 LEU A C     1 
ATOM   1159 O O     . LEU A 1 179 ? 20.708  40.058 53.943 1.00 49.30  ? 151 LEU A O     1 
ATOM   1160 C CB    . LEU A 1 179 ? 21.072  41.015 57.124 1.00 40.67  ? 151 LEU A CB    1 
ATOM   1161 C CG    . LEU A 1 179 ? 22.345  41.574 56.486 1.00 40.40  ? 151 LEU A CG    1 
ATOM   1162 C CD1   . LEU A 1 179 ? 22.043  42.875 55.768 1.00 39.53  ? 151 LEU A CD1   1 
ATOM   1163 C CD2   . LEU A 1 179 ? 23.444  41.768 57.520 1.00 41.96  ? 151 LEU A CD2   1 
ATOM   1164 N N     . PHE A 1 180 ? 20.658  38.437 55.501 1.00 44.19  ? 152 PHE A N     1 
ATOM   1165 C CA    . PHE A 1 180 ? 21.174  37.404 54.614 1.00 38.78  ? 152 PHE A CA    1 
ATOM   1166 C C     . PHE A 1 180 ? 20.213  37.118 53.466 1.00 58.30  ? 152 PHE A C     1 
ATOM   1167 O O     . PHE A 1 180 ? 20.633  36.731 52.377 1.00 59.23  ? 152 PHE A O     1 
ATOM   1168 C CB    . PHE A 1 180 ? 21.445  36.126 55.405 1.00 40.08  ? 152 PHE A CB    1 
ATOM   1169 C CG    . PHE A 1 180 ? 22.020  35.012 54.582 1.00 54.97  ? 152 PHE A CG    1 
ATOM   1170 C CD1   . PHE A 1 180 ? 23.300  35.108 54.059 1.00 53.96  ? 152 PHE A CD1   1 
ATOM   1171 C CD2   . PHE A 1 180 ? 21.290  33.858 54.348 1.00 39.96  ? 152 PHE A CD2   1 
ATOM   1172 C CE1   . PHE A 1 180 ? 23.835  34.080 53.308 1.00 53.40  ? 152 PHE A CE1   1 
ATOM   1173 C CE2   . PHE A 1 180 ? 21.820  32.828 53.598 1.00 40.03  ? 152 PHE A CE2   1 
ATOM   1174 C CZ    . PHE A 1 180 ? 23.095  32.940 53.077 1.00 40.07  ? 152 PHE A CZ    1 
ATOM   1175 N N     . SER A 1 181 ? 18.922  37.316 53.713 1.00 51.15  ? 153 SER A N     1 
ATOM   1176 C CA    . SER A 1 181 ? 17.904  37.034 52.708 1.00 48.01  ? 153 SER A CA    1 
ATOM   1177 C C     . SER A 1 181 ? 17.826  38.121 51.639 1.00 54.66  ? 153 SER A C     1 
ATOM   1178 O O     . SER A 1 181 ? 17.810  37.822 50.447 1.00 50.34  ? 153 SER A O     1 
ATOM   1179 C CB    . SER A 1 181 ? 16.537  36.843 53.364 1.00 36.45  ? 153 SER A CB    1 
ATOM   1180 O OG    . SER A 1 181 ? 15.567  36.454 52.408 1.00 41.29  ? 153 SER A OG    1 
ATOM   1181 N N     . ILE A 1 182 ? 17.778  39.379 52.067 1.00 49.59  ? 154 ILE A N     1 
ATOM   1182 C CA    . ILE A 1 182 ? 17.650  40.495 51.133 1.00 43.86  ? 154 ILE A CA    1 
ATOM   1183 C C     . ILE A 1 182 ? 18.884  40.649 50.241 1.00 50.43  ? 154 ILE A C     1 
ATOM   1184 O O     . ILE A 1 182 ? 18.771  40.998 49.064 1.00 43.31  ? 154 ILE A O     1 
ATOM   1185 C CB    . ILE A 1 182 ? 17.339  41.827 51.864 1.00 41.32  ? 154 ILE A CB    1 
ATOM   1186 C CG1   . ILE A 1 182 ? 17.085  42.951 50.857 1.00 45.78  ? 154 ILE A CG1   1 
ATOM   1187 C CG2   . ILE A 1 182 ? 18.459  42.199 52.827 1.00 41.14  ? 154 ILE A CG2   1 
ATOM   1188 C CD1   . ILE A 1 182 ? 15.922  42.685 49.927 1.00 33.37  ? 154 ILE A CD1   1 
ATOM   1189 N N     . VAL A 1 183 ? 20.059  40.368 50.798 1.00 47.24  ? 155 VAL A N     1 
ATOM   1190 C CA    . VAL A 1 183 ? 21.306  40.488 50.052 1.00 40.78  ? 155 VAL A CA    1 
ATOM   1191 C C     . VAL A 1 183 ? 21.461  39.356 49.040 1.00 49.78  ? 155 VAL A C     1 
ATOM   1192 O O     . VAL A 1 183 ? 21.742  39.596 47.865 1.00 51.54  ? 155 VAL A O     1 
ATOM   1193 C CB    . VAL A 1 183 ? 22.529  40.516 50.991 1.00 43.41  ? 155 VAL A CB    1 
ATOM   1194 C CG1   . VAL A 1 183 ? 23.820  40.475 50.190 1.00 35.73  ? 155 VAL A CG1   1 
ATOM   1195 C CG2   . VAL A 1 183 ? 22.489  41.752 51.874 1.00 52.93  ? 155 VAL A CG2   1 
ATOM   1196 N N     . MET A 1 184 ? 21.268  38.123 49.499 1.00 47.85  ? 156 MET A N     1 
ATOM   1197 C CA    . MET A 1 184 ? 21.437  36.955 48.640 1.00 46.58  ? 156 MET A CA    1 
ATOM   1198 C C     . MET A 1 184 ? 20.350  36.841 47.576 1.00 38.89  ? 156 MET A C     1 
ATOM   1199 O O     . MET A 1 184 ? 20.642  36.572 46.412 1.00 39.54  ? 156 MET A O     1 
ATOM   1200 C CB    . MET A 1 184 ? 21.506  35.675 49.474 1.00 55.55  ? 156 MET A CB    1 
ATOM   1201 C CG    . MET A 1 184 ? 22.792  35.528 50.275 1.00 58.53  ? 156 MET A CG    1 
ATOM   1202 S SD    . MET A 1 184 ? 24.266  35.451 49.237 1.00 58.49  ? 156 MET A SD    1 
ATOM   1203 C CE    . MET A 1 184 ? 24.956  37.084 49.490 1.00 36.51  ? 156 MET A CE    1 
ATOM   1204 N N     . ASN A 1 185 ? 19.098  37.041 47.974 1.00 39.87  ? 157 ASN A N     1 
ATOM   1205 C CA    . ASN A 1 185 ? 17.995  37.005 47.018 1.00 51.96  ? 157 ASN A CA    1 
ATOM   1206 C C     . ASN A 1 185 ? 18.002  38.226 46.106 1.00 47.45  ? 157 ASN A C     1 
ATOM   1207 O O     . ASN A 1 185 ? 17.529  38.167 44.973 1.00 49.75  ? 157 ASN A O     1 
ATOM   1208 C CB    . ASN A 1 185 ? 16.649  36.867 47.731 1.00 32.72  ? 157 ASN A CB    1 
ATOM   1209 C CG    . ASN A 1 185 ? 16.504  35.538 48.442 1.00 48.84  ? 157 ASN A CG    1 
ATOM   1210 O OD1   . ASN A 1 185 ? 16.391  35.483 49.667 1.00 56.79  ? 157 ASN A OD1   1 
ATOM   1211 N ND2   . ASN A 1 185 ? 16.512  34.454 47.675 1.00 42.14  ? 157 ASN A ND2   1 
ATOM   1212 N N     . GLY A 1 186 ? 18.544  39.330 46.607 1.00 43.18  ? 158 GLY A N     1 
ATOM   1213 C CA    . GLY A 1 186 ? 18.719  40.520 45.797 1.00 31.95  ? 158 GLY A CA    1 
ATOM   1214 C C     . GLY A 1 186 ? 19.767  40.276 44.730 1.00 42.95  ? 158 GLY A C     1 
ATOM   1215 O O     . GLY A 1 186 ? 19.589  40.653 43.573 1.00 45.30  ? 158 GLY A O     1 
ATOM   1216 N N     . ALA A 1 187 ? 20.860  39.631 45.124 1.00 32.41  ? 159 ALA A N     1 
ATOM   1217 C CA    . ALA A 1 187 ? 21.944  39.314 44.201 1.00 41.17  ? 159 ALA A CA    1 
ATOM   1218 C C     . ALA A 1 187 ? 21.500  38.294 43.158 1.00 40.16  ? 159 ALA A C     1 
ATOM   1219 O O     . ALA A 1 187 ? 21.784  38.443 41.969 1.00 32.34  ? 159 ALA A O     1 
ATOM   1220 C CB    . ALA A 1 187 ? 23.156  38.800 44.963 1.00 39.70  ? 159 ALA A CB    1 
ATOM   1221 N N     . SER A 1 188 ? 20.806  37.257 43.612 1.00 38.42  ? 160 SER A N     1 
ATOM   1222 C CA    . SER A 1 188 ? 20.285  36.235 42.712 1.00 43.92  ? 160 SER A CA    1 
ATOM   1223 C C     . SER A 1 188 ? 19.307  36.838 41.712 1.00 46.97  ? 160 SER A C     1 
ATOM   1224 O O     . SER A 1 188 ? 19.314  36.482 40.536 1.00 40.87  ? 160 SER A O     1 
ATOM   1225 C CB    . SER A 1 188 ? 19.607  35.117 43.503 1.00 43.27  ? 160 SER A CB    1 
ATOM   1226 O OG    . SER A 1 188 ? 20.548  34.422 44.300 1.00 41.55  ? 160 SER A OG    1 
ATOM   1227 N N     . CYS A 1 189 ? 18.471  37.756 42.187 1.00 49.95  ? 161 CYS A N     1 
ATOM   1228 C CA    . CYS A 1 189 ? 17.513  38.438 41.325 1.00 44.57  ? 161 CYS A CA    1 
ATOM   1229 C C     . CYS A 1 189 ? 18.230  39.342 40.330 1.00 44.42  ? 161 CYS A C     1 
ATOM   1230 O O     . CYS A 1 189 ? 17.913  39.341 39.140 1.00 42.83  ? 161 CYS A O     1 
ATOM   1231 C CB    . CYS A 1 189 ? 16.525  39.256 42.159 1.00 42.79  ? 161 CYS A CB    1 
ATOM   1232 S SG    . CYS A 1 189 ? 15.262  40.117 41.194 1.00 42.78  ? 161 CYS A SG    1 
ATOM   1233 N N     . LEU A 1 190 ? 19.197  40.110 40.824 1.00 35.98  ? 162 LEU A N     1 
ATOM   1234 C CA    . LEU A 1 190 ? 19.967  41.019 39.981 1.00 34.48  ? 162 LEU A CA    1 
ATOM   1235 C C     . LEU A 1 190 ? 20.698  40.273 38.867 1.00 43.30  ? 162 LEU A C     1 
ATOM   1236 O O     . LEU A 1 190 ? 20.622  40.655 37.699 1.00 45.43  ? 162 LEU A O     1 
ATOM   1237 C CB    . LEU A 1 190 ? 20.971  41.814 40.819 1.00 35.35  ? 162 LEU A CB    1 
ATOM   1238 C CG    . LEU A 1 190 ? 21.926  42.713 40.027 1.00 43.27  ? 162 LEU A CG    1 
ATOM   1239 C CD1   . LEU A 1 190 ? 21.160  43.806 39.293 1.00 32.36  ? 162 LEU A CD1   1 
ATOM   1240 C CD2   . LEU A 1 190 ? 22.992  43.312 40.933 1.00 42.36  ? 162 LEU A CD2   1 
ATOM   1241 N N     . GLY A 1 191 ? 21.397  39.205 39.236 1.00 41.96  ? 163 GLY A N     1 
ATOM   1242 C CA    . GLY A 1 191 ? 22.155  38.424 38.277 1.00 44.97  ? 163 GLY A CA    1 
ATOM   1243 C C     . GLY A 1 191 ? 21.282  37.691 37.277 1.00 44.05  ? 163 GLY A C     1 
ATOM   1244 O O     . GLY A 1 191 ? 21.658  37.527 36.116 1.00 45.86  ? 163 GLY A O     1 
ATOM   1245 N N     . THR A 1 192 ? 20.111  37.252 37.728 1.00 43.80  ? 164 THR A N     1 
ATOM   1246 C CA    . THR A 1 192 ? 19.198  36.495 36.879 1.00 49.61  ? 164 THR A CA    1 
ATOM   1247 C C     . THR A 1 192 ? 18.534  37.374 35.822 1.00 49.16  ? 164 THR A C     1 
ATOM   1248 O O     . THR A 1 192 ? 18.494  37.018 34.644 1.00 51.31  ? 164 THR A O     1 
ATOM   1249 C CB    . THR A 1 192 ? 18.118  35.782 37.714 1.00 49.48  ? 164 THR A CB    1 
ATOM   1250 O OG1   . THR A 1 192 ? 18.733  34.761 38.510 1.00 50.24  ? 164 THR A OG1   1 
ATOM   1251 C CG2   . THR A 1 192 ? 17.070  35.150 36.815 1.00 47.16  ? 164 THR A CG2   1 
ATOM   1252 N N     . VAL A 1 193 ? 18.020  38.523 36.246 1.00 39.78  ? 165 VAL A N     1 
ATOM   1253 C CA    . VAL A 1 193 ? 17.368  39.453 35.330 1.00 42.87  ? 165 VAL A CA    1 
ATOM   1254 C C     . VAL A 1 193 ? 18.370  40.016 34.320 1.00 50.83  ? 165 VAL A C     1 
ATOM   1255 O O     . VAL A 1 193 ? 18.031  40.248 33.157 1.00 48.70  ? 165 VAL A O     1 
ATOM   1256 C CB    . VAL A 1 193 ? 16.663  40.602 36.095 1.00 47.00  ? 165 VAL A CB    1 
ATOM   1257 C CG1   . VAL A 1 193 ? 16.047  41.601 35.130 1.00 32.24  ? 165 VAL A CG1   1 
ATOM   1258 C CG2   . VAL A 1 193 ? 15.596  40.044 37.024 1.00 31.36  ? 165 VAL A CG2   1 
ATOM   1259 N N     . LEU A 1 194 ? 19.610  40.211 34.764 1.00 53.61  ? 166 LEU A N     1 
ATOM   1260 C CA    . LEU A 1 194 ? 20.660  40.753 33.902 1.00 46.18  ? 166 LEU A CA    1 
ATOM   1261 C C     . LEU A 1 194 ? 21.022  39.840 32.732 1.00 50.72  ? 166 LEU A C     1 
ATOM   1262 O O     . LEU A 1 194 ? 20.991  40.268 31.579 1.00 53.30  ? 166 LEU A O     1 
ATOM   1263 C CB    . LEU A 1 194 ? 21.916  41.088 34.712 1.00 38.77  ? 166 LEU A CB    1 
ATOM   1264 C CG    . LEU A 1 194 ? 21.955  42.477 35.352 1.00 42.05  ? 166 LEU A CG    1 
ATOM   1265 C CD1   . LEU A 1 194 ? 23.238  42.669 36.146 1.00 39.78  ? 166 LEU A CD1   1 
ATOM   1266 C CD2   . LEU A 1 194 ? 21.814  43.554 34.292 1.00 34.18  ? 166 LEU A CD2   1 
ATOM   1267 N N     . VAL A 1 195 ? 21.365  38.590 33.023 1.00 34.45  ? 167 VAL A N     1 
ATOM   1268 C CA    . VAL A 1 195 ? 21.783  37.666 31.971 1.00 52.67  ? 167 VAL A CA    1 
ATOM   1269 C C     . VAL A 1 195 ? 20.615  37.230 31.088 1.00 54.68  ? 167 VAL A C     1 
ATOM   1270 O O     . VAL A 1 195 ? 20.799  36.934 29.907 1.00 63.40  ? 167 VAL A O     1 
ATOM   1271 C CB    . VAL A 1 195 ? 22.505  36.423 32.537 1.00 49.31  ? 167 VAL A CB    1 
ATOM   1272 C CG1   . VAL A 1 195 ? 23.642  36.840 33.452 1.00 55.60  ? 167 VAL A CG1   1 
ATOM   1273 C CG2   . VAL A 1 195 ? 21.531  35.530 33.273 1.00 57.28  ? 167 VAL A CG2   1 
ATOM   1274 N N     . SER A 1 196 ? 19.415  37.197 31.661 1.00 48.56  ? 168 SER A N     1 
ATOM   1275 C CA    . SER A 1 196 ? 18.225  36.818 30.911 1.00 53.14  ? 168 SER A CA    1 
ATOM   1276 C C     . SER A 1 196 ? 17.753  37.991 30.067 1.00 54.82  ? 168 SER A C     1 
ATOM   1277 O O     . SER A 1 196 ? 17.299  37.813 28.939 1.00 64.04  ? 168 SER A O     1 
ATOM   1278 C CB    . SER A 1 196 ? 17.110  36.367 31.856 1.00 54.75  ? 168 SER A CB    1 
ATOM   1279 O OG    . SER A 1 196 ? 17.529  35.272 32.652 1.00 57.75  ? 168 SER A OG    1 
ATOM   1280 N N     . GLY A 1 197 ? 17.870  39.192 30.623 1.00 44.01  ? 169 GLY A N     1 
ATOM   1281 C CA    . GLY A 1 197 ? 17.484  40.400 29.920 1.00 42.10  ? 169 GLY A CA    1 
ATOM   1282 C C     . GLY A 1 197 ? 18.300  40.629 28.663 1.00 50.50  ? 169 GLY A C     1 
ATOM   1283 O O     . GLY A 1 197 ? 17.758  40.993 27.620 1.00 52.43  ? 169 GLY A O     1 
ATOM   1284 N N     . ILE A 1 198 ? 19.609  40.417 28.765 1.00 59.73  ? 170 ILE A N     1 
ATOM   1285 C CA    . ILE A 1 198 ? 20.506  40.602 27.630 1.00 59.55  ? 170 ILE A CA    1 
ATOM   1286 C C     . ILE A 1 198 ? 20.178  39.625 26.506 1.00 66.09  ? 170 ILE A C     1 
ATOM   1287 O O     . ILE A 1 198 ? 20.091  40.013 25.342 1.00 73.36  ? 170 ILE A O     1 
ATOM   1288 C CB    . ILE A 1 198 ? 21.985  40.444 28.041 1.00 49.36  ? 170 ILE A CB    1 
ATOM   1289 C CG1   . ILE A 1 198 ? 22.382  41.544 29.025 1.00 42.83  ? 170 ILE A CG1   1 
ATOM   1290 C CG2   . ILE A 1 198 ? 22.892  40.483 26.819 1.00 39.84  ? 170 ILE A CG2   1 
ATOM   1291 C CD1   . ILE A 1 198 ? 23.832  41.487 29.449 1.00 47.52  ? 170 ILE A CD1   1 
ATOM   1292 N N     . ILE A 1 199 ? 19.984  38.360 26.862 1.00 60.61  ? 171 ILE A N     1 
ATOM   1293 C CA    . ILE A 1 199 ? 19.653  37.335 25.878 1.00 59.94  ? 171 ILE A CA    1 
ATOM   1294 C C     . ILE A 1 199 ? 18.291  37.598 25.233 1.00 56.24  ? 171 ILE A C     1 
ATOM   1295 O O     . ILE A 1 199 ? 18.135  37.453 24.020 1.00 62.44  ? 171 ILE A O     1 
ATOM   1296 C CB    . ILE A 1 199 ? 19.716  35.918 26.486 1.00 49.40  ? 171 ILE A CB    1 
ATOM   1297 C CG1   . ILE A 1 199 ? 21.157  35.589 26.886 1.00 46.44  ? 171 ILE A CG1   1 
ATOM   1298 C CG2   . ILE A 1 199 ? 19.190  34.882 25.503 1.00 40.93  ? 171 ILE A CG2   1 
ATOM   1299 C CD1   . ILE A 1 199 ? 21.361  34.169 27.358 1.00 50.43  ? 171 ILE A CD1   1 
ATOM   1300 N N     . ILE A 1 200 ? 17.315  37.999 26.044 1.00 43.70  ? 172 ILE A N     1 
ATOM   1301 C CA    . ILE A 1 200 ? 16.002  38.379 25.528 1.00 50.71  ? 172 ILE A CA    1 
ATOM   1302 C C     . ILE A 1 200 ? 16.121  39.544 24.545 1.00 55.75  ? 172 ILE A C     1 
ATOM   1303 O O     . ILE A 1 200 ? 15.491  39.541 23.485 1.00 60.96  ? 172 ILE A O     1 
ATOM   1304 C CB    . ILE A 1 200 ? 15.021  38.744 26.666 1.00 49.53  ? 172 ILE A CB    1 
ATOM   1305 C CG1   . ILE A 1 200 ? 14.562  37.482 27.399 1.00 49.11  ? 172 ILE A CG1   1 
ATOM   1306 C CG2   . ILE A 1 200 ? 13.807  39.485 26.121 1.00 50.34  ? 172 ILE A CG2   1 
ATOM   1307 C CD1   . ILE A 1 200 ? 13.771  36.526 26.534 1.00 51.18  ? 172 ILE A CD1   1 
ATOM   1308 N N     . SER A 1 201 ? 16.945  40.528 24.896 1.00 48.58  ? 173 SER A N     1 
ATOM   1309 C CA    . SER A 1 201 ? 17.178  41.686 24.038 1.00 49.85  ? 173 SER A CA    1 
ATOM   1310 C C     . SER A 1 201 ? 17.723  41.265 22.677 1.00 54.63  ? 173 SER A C     1 
ATOM   1311 O O     . SER A 1 201 ? 17.297  41.776 21.641 1.00 57.22  ? 173 SER A O     1 
ATOM   1312 C CB    . SER A 1 201 ? 18.149  42.663 24.706 1.00 41.24  ? 173 SER A CB    1 
ATOM   1313 O OG    . SER A 1 201 ? 17.654  43.104 25.958 1.00 47.88  ? 173 SER A OG    1 
ATOM   1314 N N     . ILE A 1 202 ? 18.666  40.329 22.690 1.00 55.59  ? 174 ILE A N     1 
ATOM   1315 C CA    . ILE A 1 202 ? 19.240  39.800 21.459 1.00 57.99  ? 174 ILE A CA    1 
ATOM   1316 C C     . ILE A 1 202 ? 18.182  39.043 20.668 1.00 59.99  ? 174 ILE A C     1 
ATOM   1317 O O     . ILE A 1 202 ? 18.087  39.178 19.448 1.00 65.55  ? 174 ILE A O     1 
ATOM   1318 C CB    . ILE A 1 202 ? 20.418  38.854 21.754 1.00 57.21  ? 174 ILE A CB    1 
ATOM   1319 C CG1   . ILE A 1 202 ? 21.501  39.586 22.544 1.00 49.92  ? 174 ILE A CG1   1 
ATOM   1320 C CG2   . ILE A 1 202 ? 20.992  38.289 20.463 1.00 47.04  ? 174 ILE A CG2   1 
ATOM   1321 C CD1   . ILE A 1 202 ? 22.532  38.667 23.139 1.00 43.89  ? 174 ILE A CD1   1 
ATOM   1322 N N     . LEU A 1 203 ? 17.383  38.250 21.375 1.00 54.50  ? 175 LEU A N     1 
ATOM   1323 C CA    . LEU A 1 203 ? 16.326  37.469 20.745 1.00 59.22  ? 175 LEU A CA    1 
ATOM   1324 C C     . LEU A 1 203 ? 15.258  38.362 20.118 1.00 63.15  ? 175 LEU A C     1 
ATOM   1325 O O     . LEU A 1 203 ? 14.618  37.979 19.140 1.00 60.05  ? 175 LEU A O     1 
ATOM   1326 C CB    . LEU A 1 203 ? 15.702  36.498 21.750 1.00 55.16  ? 175 LEU A CB    1 
ATOM   1327 C CG    . LEU A 1 203 ? 16.607  35.341 22.177 1.00 49.61  ? 175 LEU A CG    1 
ATOM   1328 C CD1   . LEU A 1 203 ? 15.918  34.457 23.204 1.00 53.65  ? 175 LEU A CD1   1 
ATOM   1329 C CD2   . LEU A 1 203 ? 17.039  34.528 20.967 1.00 47.90  ? 175 LEU A CD2   1 
ATOM   1330 N N     . LEU A 1 204 ? 15.069  39.551 20.681 1.00 62.28  ? 176 LEU A N     1 
ATOM   1331 C CA    . LEU A 1 204 ? 14.156  40.529 20.101 1.00 59.43  ? 176 LEU A CA    1 
ATOM   1332 C C     . LEU A 1 204 ? 14.714  41.041 18.778 1.00 62.79  ? 176 LEU A C     1 
ATOM   1333 O O     . LEU A 1 204 ? 13.965  41.350 17.851 1.00 74.74  ? 176 LEU A O     1 
ATOM   1334 C CB    . LEU A 1 204 ? 13.929  41.697 21.063 1.00 59.41  ? 176 LEU A CB    1 
ATOM   1335 C CG    . LEU A 1 204 ? 13.107  41.409 22.321 1.00 56.64  ? 176 LEU A CG    1 
ATOM   1336 C CD1   . LEU A 1 204 ? 13.074  42.629 23.227 1.00 59.97  ? 176 LEU A CD1   1 
ATOM   1337 C CD2   . LEU A 1 204 ? 11.697  40.974 21.954 1.00 51.75  ? 176 LEU A CD2   1 
ATOM   1338 N N     . LYS A 1 205 ? 16.038  41.122 18.701 1.00 60.87  ? 177 LYS A N     1 
ATOM   1339 C CA    . LYS A 1 205 ? 16.722  41.555 17.489 1.00 64.37  ? 177 LYS A CA    1 
ATOM   1340 C C     . LYS A 1 205 ? 16.784  40.439 16.448 1.00 70.13  ? 177 LYS A C     1 
ATOM   1341 O O     . LYS A 1 205 ? 16.450  40.647 15.281 1.00 78.27  ? 177 LYS A O     1 
ATOM   1342 C CB    . LYS A 1 205 ? 18.137  42.033 17.827 1.00 65.10  ? 177 LYS A CB    1 
ATOM   1343 C CG    . LYS A 1 205 ? 19.069  42.164 16.631 1.00 75.36  ? 177 LYS A CG    1 
ATOM   1344 C CD    . LYS A 1 205 ? 18.640  43.284 15.699 1.00 88.33  ? 177 LYS A CD    1 
ATOM   1345 C CE    . LYS A 1 205 ? 19.625  43.459 14.555 1.00 95.19  ? 177 LYS A CE    1 
ATOM   1346 N NZ    . LYS A 1 205 ? 19.250  44.595 13.670 1.00 100.09 ? 177 LYS A NZ    1 
ATOM   1347 N N     . THR A 1 206 ? 17.204  39.255 16.882 1.00 63.61  ? 178 THR A N     1 
ATOM   1348 C CA    . THR A 1 206 ? 17.437  38.139 15.970 1.00 61.71  ? 178 THR A CA    1 
ATOM   1349 C C     . THR A 1 206 ? 16.168  37.373 15.599 1.00 69.00  ? 178 THR A C     1 
ATOM   1350 O O     . THR A 1 206 ? 16.011  36.943 14.457 1.00 76.22  ? 178 THR A O     1 
ATOM   1351 C CB    . THR A 1 206 ? 18.463  37.146 16.552 1.00 62.90  ? 178 THR A CB    1 
ATOM   1352 O OG1   . THR A 1 206 ? 17.959  36.598 17.776 1.00 71.35  ? 178 THR A OG1   1 
ATOM   1353 C CG2   . THR A 1 206 ? 19.788  37.845 16.819 1.00 52.49  ? 178 THR A CG2   1 
ATOM   1354 N N     . SER A 1 207 ? 15.266  37.201 16.561 1.00 63.34  ? 179 SER A N     1 
ATOM   1355 C CA    . SER A 1 207 ? 14.060  36.411 16.332 1.00 67.25  ? 179 SER A CA    1 
ATOM   1356 C C     . SER A 1 207 ? 12.799  37.112 16.832 1.00 78.80  ? 179 SER A C     1 
ATOM   1357 O O     . SER A 1 207 ? 12.267  36.758 17.884 1.00 86.35  ? 179 SER A O     1 
ATOM   1358 C CB    . SER A 1 207 ? 14.190  35.044 17.007 1.00 68.15  ? 179 SER A CB    1 
ATOM   1359 O OG    . SER A 1 207 ? 15.412  34.415 16.658 1.00 66.65  ? 179 SER A OG    1 
ATOM   1360 N N     . PRO A 1 208 ? 12.315  38.109 16.075 1.00 80.24  ? 180 PRO A N     1 
ATOM   1361 C CA    . PRO A 1 208 ? 11.120  38.866 16.467 1.00 72.21  ? 180 PRO A CA    1 
ATOM   1362 C C     . PRO A 1 208 ? 9.852   38.017 16.424 1.00 78.54  ? 180 PRO A C     1 
ATOM   1363 O O     . PRO A 1 208 ? 8.974   38.185 17.269 1.00 81.18  ? 180 PRO A O     1 
ATOM   1364 C CB    . PRO A 1 208 ? 11.042  39.973 15.407 1.00 69.57  ? 180 PRO A CB    1 
ATOM   1365 C CG    . PRO A 1 208 ? 12.411  40.050 14.818 1.00 77.59  ? 180 PRO A CG    1 
ATOM   1366 C CD    . PRO A 1 208 ? 12.920  38.646 14.846 1.00 84.34  ? 180 PRO A CD    1 
ATOM   1367 N N     . LYS A 1 209 ? 9.765   37.115 15.450 1.00 81.11  ? 181 LYS A N     1 
ATOM   1368 C CA    . LYS A 1 209 ? 8.573   36.291 15.268 1.00 74.13  ? 181 LYS A CA    1 
ATOM   1369 C C     . LYS A 1 209 ? 8.351   35.316 16.423 1.00 73.61  ? 181 LYS A C     1 
ATOM   1370 O O     . LYS A 1 209 ? 7.252   34.792 16.601 1.00 87.00  ? 181 LYS A O     1 
ATOM   1371 C CB    . LYS A 1 209 ? 8.641   35.531 13.941 1.00 69.23  ? 181 LYS A CB    1 
ATOM   1372 C CG    . LYS A 1 209 ? 8.646   36.425 12.712 1.00 59.50  ? 181 LYS A CG    1 
ATOM   1373 C CD    . LYS A 1 209 ? 8.705   35.602 11.435 1.00 65.71  ? 181 LYS A CD    1 
ATOM   1374 C CE    . LYS A 1 209 ? 8.756   36.489 10.202 1.00 65.96  ? 181 LYS A CE    1 
ATOM   1375 N NZ    . LYS A 1 209 ? 8.846   35.690 8.949  1.00 75.16  ? 181 LYS A NZ    1 
ATOM   1376 N N     . LEU A 1 210 ? 9.400   35.074 17.203 1.00 66.11  ? 182 LEU A N     1 
ATOM   1377 C CA    . LEU A 1 210 ? 9.310   34.200 18.365 1.00 66.44  ? 182 LEU A CA    1 
ATOM   1378 C C     . LEU A 1 210 ? 8.420   34.832 19.431 1.00 74.04  ? 182 LEU A C     1 
ATOM   1379 O O     . LEU A 1 210 ? 7.769   34.133 20.209 1.00 77.46  ? 182 LEU A O     1 
ATOM   1380 C CB    . LEU A 1 210 ? 10.705  33.929 18.934 1.00 67.76  ? 182 LEU A CB    1 
ATOM   1381 C CG    . LEU A 1 210 ? 10.830  32.953 20.106 1.00 62.36  ? 182 LEU A CG    1 
ATOM   1382 C CD1   . LEU A 1 210 ? 10.443  31.544 19.686 1.00 48.00  ? 182 LEU A CD1   1 
ATOM   1383 C CD2   . LEU A 1 210 ? 12.243  32.977 20.667 1.00 46.14  ? 182 LEU A CD2   1 
ATOM   1384 N N     . PHE A 1 211 ? 8.392   36.161 19.451 1.00 77.60  ? 183 PHE A N     1 
ATOM   1385 C CA    . PHE A 1 211 ? 7.599   36.906 20.421 1.00 69.25  ? 183 PHE A CA    1 
ATOM   1386 C C     . PHE A 1 211 ? 6.270   37.350 19.818 1.00 66.38  ? 183 PHE A C     1 
ATOM   1387 O O     . PHE A 1 211 ? 5.412   37.891 20.515 1.00 64.99  ? 183 PHE A O     1 
ATOM   1388 C CB    . PHE A 1 211 ? 8.375   38.129 20.916 1.00 63.81  ? 183 PHE A CB    1 
ATOM   1389 C CG    . PHE A 1 211 ? 9.724   37.802 21.491 1.00 61.06  ? 183 PHE A CG    1 
ATOM   1390 C CD1   . PHE A 1 211 ? 10.845  37.742 20.676 1.00 58.82  ? 183 PHE A CD1   1 
ATOM   1391 C CD2   . PHE A 1 211 ? 9.874   37.560 22.846 1.00 64.15  ? 183 PHE A CD2   1 
ATOM   1392 C CE1   . PHE A 1 211 ? 12.088  37.442 21.203 1.00 66.96  ? 183 PHE A CE1   1 
ATOM   1393 C CE2   . PHE A 1 211 ? 11.115  37.261 23.380 1.00 71.04  ? 183 PHE A CE2   1 
ATOM   1394 C CZ    . PHE A 1 211 ? 12.223  37.201 22.557 1.00 73.48  ? 183 PHE A CZ    1 
ATOM   1395 N N     . LEU A 1 212 ? 6.110   37.122 18.518 1.00 65.61  ? 184 LEU A N     1 
ATOM   1396 C CA    . LEU A 1 212 ? 4.903   37.532 17.807 1.00 68.08  ? 184 LEU A CA    1 
ATOM   1397 C C     . LEU A 1 212 ? 4.180   36.326 17.213 1.00 68.80  ? 184 LEU A C     1 
ATOM   1398 O O     . LEU A 1 212 ? 4.555   35.836 16.148 1.00 78.58  ? 184 LEU A O     1 
ATOM   1399 C CB    . LEU A 1 212 ? 5.253   38.531 16.702 1.00 72.81  ? 184 LEU A CB    1 
ATOM   1400 C CG    . LEU A 1 212 ? 5.986   39.806 17.128 1.00 52.12  ? 184 LEU A CG    1 
ATOM   1401 C CD1   . LEU A 1 212 ? 6.439   40.596 15.913 1.00 54.34  ? 184 LEU A CD1   1 
ATOM   1402 C CD2   . LEU A 1 212 ? 5.107   40.663 18.024 1.00 51.03  ? 184 LEU A CD2   1 
ATOM   1403 N N     . PRO A 1 213 ? 3.137   35.844 17.905 1.00 64.88  ? 185 PRO A N     1 
ATOM   1404 C CA    . PRO A 1 213 ? 2.371   34.673 17.464 1.00 68.05  ? 185 PRO A CA    1 
ATOM   1405 C C     . PRO A 1 213 ? 1.375   35.009 16.355 1.00 65.35  ? 185 PRO A C     1 
ATOM   1406 O O     . PRO A 1 213 ? 1.005   36.173 16.205 1.00 63.74  ? 185 PRO A O     1 
ATOM   1407 C CB    . PRO A 1 213 ? 1.628   34.253 18.733 1.00 61.87  ? 185 PRO A CB    1 
ATOM   1408 C CG    . PRO A 1 213 ? 1.440   35.523 19.480 1.00 61.01  ? 185 PRO A CG    1 
ATOM   1409 C CD    . PRO A 1 213 ? 2.665   36.354 19.204 1.00 61.63  ? 185 PRO A CD    1 
ATOM   1410 N N     . VAL B 1 28  ? 7.121   29.590 73.061 1.00 98.48  ? 0   VAL B N     1 
ATOM   1411 C CA    . VAL B 1 28  ? 6.472   29.276 71.793 1.00 96.17  ? 0   VAL B CA    1 
ATOM   1412 C C     . VAL B 1 28  ? 5.801   30.510 71.200 1.00 98.77  ? 0   VAL B C     1 
ATOM   1413 O O     . VAL B 1 28  ? 5.771   30.687 69.982 1.00 95.66  ? 0   VAL B O     1 
ATOM   1414 C CB    . VAL B 1 28  ? 5.461   28.154 71.976 1.00 95.24  ? 0   VAL B CB    1 
ATOM   1415 N N     . MET B 1 29  ? 5.264   31.361 72.068 1.00 103.85 ? 1   MET B N     1 
ATOM   1416 C CA    . MET B 1 29  ? 4.635   32.604 71.635 1.00 92.80  ? 1   MET B CA    1 
ATOM   1417 C C     . MET B 1 29  ? 5.676   33.699 71.417 1.00 90.73  ? 1   MET B C     1 
ATOM   1418 O O     . MET B 1 29  ? 5.344   34.813 71.014 1.00 88.24  ? 1   MET B O     1 
ATOM   1419 C CB    . MET B 1 29  ? 3.590   33.066 72.654 1.00 86.00  ? 1   MET B CB    1 
ATOM   1420 C CG    . MET B 1 29  ? 2.349   32.191 72.716 1.00 82.51  ? 1   MET B CG    1 
ATOM   1421 S SD    . MET B 1 29  ? 1.360   32.269 71.208 1.00 130.70 ? 1   MET B SD    1 
ATOM   1422 C CE    . MET B 1 29  ? 0.875   33.993 71.202 1.00 51.36  ? 1   MET B CE    1 
ATOM   1423 N N     . GLN B 1 30  ? 6.935   33.374 71.689 1.00 87.80  ? 2   GLN B N     1 
ATOM   1424 C CA    . GLN B 1 30  ? 8.028   34.317 71.490 1.00 75.66  ? 2   GLN B CA    1 
ATOM   1425 C C     . GLN B 1 30  ? 8.627   34.166 70.094 1.00 72.45  ? 2   GLN B C     1 
ATOM   1426 O O     . GLN B 1 30  ? 9.409   35.007 69.649 1.00 72.70  ? 2   GLN B O     1 
ATOM   1427 C CB    . GLN B 1 30  ? 9.106   34.122 72.558 1.00 65.02  ? 2   GLN B CB    1 
ATOM   1428 N N     . ASN B 1 31  ? 8.257   33.088 69.409 1.00 66.89  ? 3   ASN B N     1 
ATOM   1429 C CA    . ASN B 1 31  ? 8.712   32.854 68.044 1.00 66.15  ? 3   ASN B CA    1 
ATOM   1430 C C     . ASN B 1 31  ? 7.728   33.440 67.039 1.00 72.02  ? 3   ASN B C     1 
ATOM   1431 O O     . ASN B 1 31  ? 6.780   32.773 66.626 1.00 78.40  ? 3   ASN B O     1 
ATOM   1432 C CB    . ASN B 1 31  ? 8.908   31.358 67.788 1.00 66.03  ? 3   ASN B CB    1 
ATOM   1433 C CG    . ASN B 1 31  ? 9.541   31.074 66.436 1.00 72.85  ? 3   ASN B CG    1 
ATOM   1434 O OD1   . ASN B 1 31  ? 10.002  31.984 65.748 1.00 75.88  ? 3   ASN B OD1   1 
ATOM   1435 N ND2   . ASN B 1 31  ? 9.572   29.803 66.055 1.00 79.79  ? 3   ASN B ND2   1 
ATOM   1436 N N     . LYS B 1 32  ? 7.967   34.688 66.650 1.00 72.47  ? 4   LYS B N     1 
ATOM   1437 C CA    . LYS B 1 32  ? 7.054   35.422 65.780 1.00 68.91  ? 4   LYS B CA    1 
ATOM   1438 C C     . LYS B 1 32  ? 6.836   34.732 64.435 1.00 71.17  ? 4   LYS B C     1 
ATOM   1439 O O     . LYS B 1 32  ? 5.731   34.749 63.896 1.00 72.37  ? 4   LYS B O     1 
ATOM   1440 C CB    . LYS B 1 32  ? 7.555   36.854 65.570 1.00 73.56  ? 4   LYS B CB    1 
ATOM   1441 C CG    . LYS B 1 32  ? 6.566   37.768 64.861 1.00 89.55  ? 4   LYS B CG    1 
ATOM   1442 C CD    . LYS B 1 32  ? 7.103   39.189 64.757 1.00 95.83  ? 4   LYS B CD    1 
ATOM   1443 C CE    . LYS B 1 32  ? 6.122   40.103 64.039 1.00 92.24  ? 4   LYS B CE    1 
ATOM   1444 N NZ    . LYS B 1 32  ? 4.817   40.193 64.751 1.00 93.42  ? 4   LYS B NZ    1 
ATOM   1445 N N     . ARG B 1 33  ? 7.888   34.116 63.903 1.00 74.32  ? 5   ARG B N     1 
ATOM   1446 C CA    . ARG B 1 33  ? 7.817   33.461 62.599 1.00 68.78  ? 5   ARG B CA    1 
ATOM   1447 C C     . ARG B 1 33  ? 6.875   32.259 62.588 1.00 74.46  ? 5   ARG B C     1 
ATOM   1448 O O     . ARG B 1 33  ? 6.109   32.074 61.642 1.00 76.51  ? 5   ARG B O     1 
ATOM   1449 C CB    . ARG B 1 33  ? 9.213   33.048 62.131 1.00 69.01  ? 5   ARG B CB    1 
ATOM   1450 C CG    . ARG B 1 33  ? 10.122  34.228 61.839 1.00 78.47  ? 5   ARG B CG    1 
ATOM   1451 C CD    . ARG B 1 33  ? 11.574  33.809 61.692 1.00 74.86  ? 5   ARG B CD    1 
ATOM   1452 N NE    . ARG B 1 33  ? 12.443  34.970 61.532 1.00 70.37  ? 5   ARG B NE    1 
ATOM   1453 C CZ    . ARG B 1 33  ? 13.770  34.921 61.542 1.00 76.81  ? 5   ARG B CZ    1 
ATOM   1454 N NH1   . ARG B 1 33  ? 14.392  33.762 61.708 1.00 87.99  ? 5   ARG B NH1   1 
ATOM   1455 N NH2   . ARG B 1 33  ? 14.475  36.033 61.389 1.00 80.53  ? 5   ARG B NH2   1 
ATOM   1456 N N     . LEU B 1 34  ? 6.933   31.445 63.637 1.00 78.48  ? 6   LEU B N     1 
ATOM   1457 C CA    . LEU B 1 34  ? 6.067   30.275 63.740 1.00 75.68  ? 6   LEU B CA    1 
ATOM   1458 C C     . LEU B 1 34  ? 4.609   30.687 63.922 1.00 68.96  ? 6   LEU B C     1 
ATOM   1459 O O     . LEU B 1 34  ? 3.706   30.074 63.352 1.00 72.23  ? 6   LEU B O     1 
ATOM   1460 C CB    . LEU B 1 34  ? 6.508   29.370 64.893 1.00 45.97  ? 6   LEU B CB    1 
ATOM   1461 N N     . ILE B 1 35  ? 4.391   31.732 64.715 1.00 57.27  ? 7   ILE B N     1 
ATOM   1462 C CA    . ILE B 1 35  ? 3.044   32.214 65.003 1.00 56.85  ? 7   ILE B CA    1 
ATOM   1463 C C     . ILE B 1 35  ? 2.322   32.679 63.743 1.00 53.87  ? 7   ILE B C     1 
ATOM   1464 O O     . ILE B 1 35  ? 1.183   32.283 63.491 1.00 55.97  ? 7   ILE B O     1 
ATOM   1465 C CB    . ILE B 1 35  ? 3.064   33.364 66.025 1.00 52.44  ? 7   ILE B CB    1 
ATOM   1466 C CG1   . ILE B 1 35  ? 3.628   32.879 67.359 1.00 57.86  ? 7   ILE B CG1   1 
ATOM   1467 C CG2   . ILE B 1 35  ? 1.666   33.932 66.223 1.00 44.21  ? 7   ILE B CG2   1 
ATOM   1468 C CD1   . ILE B 1 35  ? 3.703   33.962 68.404 1.00 72.98  ? 7   ILE B CD1   1 
ATOM   1469 N N     . ILE B 1 36  ? 2.993   33.517 62.958 1.00 53.53  ? 8   ILE B N     1 
ATOM   1470 C CA    . ILE B 1 36  ? 2.423   34.045 61.722 1.00 60.15  ? 8   ILE B CA    1 
ATOM   1471 C C     . ILE B 1 36  ? 2.033   32.915 60.770 1.00 58.67  ? 8   ILE B C     1 
ATOM   1472 O O     . ILE B 1 36  ? 0.969   32.953 60.150 1.00 47.01  ? 8   ILE B O     1 
ATOM   1473 C CB    . ILE B 1 36  ? 3.398   35.011 61.017 1.00 51.49  ? 8   ILE B CB    1 
ATOM   1474 C CG1   . ILE B 1 36  ? 3.722   36.196 61.929 1.00 49.63  ? 8   ILE B CG1   1 
ATOM   1475 C CG2   . ILE B 1 36  ? 2.807   35.507 59.709 1.00 43.49  ? 8   ILE B CG2   1 
ATOM   1476 C CD1   . ILE B 1 36  ? 4.829   37.087 61.407 1.00 40.25  ? 8   ILE B CD1   1 
ATOM   1477 N N     . LEU B 1 37  ? 2.893   31.906 60.672 1.00 54.93  ? 9   LEU B N     1 
ATOM   1478 C CA    . LEU B 1 37  ? 2.606   30.730 59.858 1.00 53.95  ? 9   LEU B CA    1 
ATOM   1479 C C     . LEU B 1 37  ? 1.385   29.985 60.387 1.00 59.19  ? 9   LEU B C     1 
ATOM   1480 O O     . LEU B 1 37  ? 0.518   29.575 59.615 1.00 52.72  ? 9   LEU B O     1 
ATOM   1481 C CB    . LEU B 1 37  ? 3.816   29.795 59.816 1.00 47.57  ? 9   LEU B CB    1 
ATOM   1482 C CG    . LEU B 1 37  ? 5.040   30.317 59.064 1.00 41.16  ? 9   LEU B CG    1 
ATOM   1483 C CD1   . LEU B 1 37  ? 6.179   29.315 59.139 1.00 39.81  ? 9   LEU B CD1   1 
ATOM   1484 C CD2   . LEU B 1 37  ? 4.683   30.624 57.617 1.00 42.43  ? 9   LEU B CD2   1 
ATOM   1485 N N     . LEU B 1 38  ? 1.324   29.813 61.706 1.00 63.17  ? 10  LEU B N     1 
ATOM   1486 C CA    . LEU B 1 38  ? 0.186   29.158 62.342 1.00 64.65  ? 10  LEU B CA    1 
ATOM   1487 C C     . LEU B 1 38  ? -1.104  29.938 62.112 1.00 62.06  ? 10  LEU B C     1 
ATOM   1488 O O     . LEU B 1 38  ? -2.150  29.350 61.840 1.00 67.06  ? 10  LEU B O     1 
ATOM   1489 C CB    . LEU B 1 38  ? 0.426   28.974 63.842 1.00 63.80  ? 10  LEU B CB    1 
ATOM   1490 C CG    . LEU B 1 38  ? 1.406   27.875 64.254 1.00 68.27  ? 10  LEU B CG    1 
ATOM   1491 C CD1   . LEU B 1 38  ? 1.509   27.793 65.769 1.00 67.82  ? 10  LEU B CD1   1 
ATOM   1492 C CD2   . LEU B 1 38  ? 0.987   26.535 63.669 1.00 68.47  ? 10  LEU B CD2   1 
ATOM   1493 N N     . GLU B 1 39  ? -1.022  31.261 62.223 1.00 50.91  ? 11  GLU B N     1 
ATOM   1494 C CA    . GLU B 1 39  ? -2.178  32.120 61.995 1.00 53.43  ? 11  GLU B CA    1 
ATOM   1495 C C     . GLU B 1 39  ? -2.703  31.966 60.574 1.00 56.72  ? 11  GLU B C     1 
ATOM   1496 O O     . GLU B 1 39  ? -3.913  31.922 60.354 1.00 57.22  ? 11  GLU B O     1 
ATOM   1497 C CB    . GLU B 1 39  ? -1.836  33.584 62.273 1.00 59.80  ? 11  GLU B CB    1 
ATOM   1498 C CG    . GLU B 1 39  ? -1.633  33.912 63.743 1.00 60.19  ? 11  GLU B CG    1 
ATOM   1499 C CD    . GLU B 1 39  ? -1.518  35.402 63.992 1.00 57.48  ? 11  GLU B CD    1 
ATOM   1500 O OE1   . GLU B 1 39  ? -1.768  36.180 63.050 1.00 63.62  ? 11  GLU B OE1   1 
ATOM   1501 O OE2   . GLU B 1 39  ? -1.177  35.795 65.127 1.00 53.95  ? 11  GLU B OE2   1 
ATOM   1502 N N     . CYS B 1 40  ? -1.787  31.883 59.615 1.00 61.51  ? 12  CYS B N     1 
ATOM   1503 C CA    . CYS B 1 40  ? -2.156  31.670 58.220 1.00 64.24  ? 12  CYS B CA    1 
ATOM   1504 C C     . CYS B 1 40  ? -2.882  30.341 58.054 1.00 62.06  ? 12  CYS B C     1 
ATOM   1505 O O     . CYS B 1 40  ? -3.866  30.250 57.323 1.00 64.47  ? 12  CYS B O     1 
ATOM   1506 C CB    . CYS B 1 40  ? -0.918  31.706 57.320 1.00 65.55  ? 12  CYS B CB    1 
ATOM   1507 S SG    . CYS B 1 40  ? -0.109  33.318 57.210 1.00 49.70  ? 12  CYS B SG    1 
ATOM   1508 N N     . ALA B 1 41  ? -2.392  29.315 58.743 1.00 54.32  ? 13  ALA B N     1 
ATOM   1509 C CA    . ALA B 1 41  ? -2.997  27.990 58.686 1.00 45.12  ? 13  ALA B CA    1 
ATOM   1510 C C     . ALA B 1 41  ? -4.383  27.994 59.321 1.00 44.80  ? 13  ALA B C     1 
ATOM   1511 O O     . ALA B 1 41  ? -5.310  27.359 58.815 1.00 40.30  ? 13  ALA B O     1 
ATOM   1512 C CB    . ALA B 1 41  ? -2.102  26.970 59.371 1.00 38.22  ? 13  ALA B CB    1 
ATOM   1513 N N     . ILE B 1 42  ? -4.515  28.713 60.431 1.00 54.38  ? 14  ILE B N     1 
ATOM   1514 C CA    . ILE B 1 42  ? -5.781  28.793 61.152 1.00 55.67  ? 14  ILE B CA    1 
ATOM   1515 C C     . ILE B 1 42  ? -6.867  29.455 60.310 1.00 61.56  ? 14  ILE B C     1 
ATOM   1516 O O     . ILE B 1 42  ? -7.950  28.898 60.136 1.00 65.57  ? 14  ILE B O     1 
ATOM   1517 C CB    . ILE B 1 42  ? -5.626  29.551 62.486 1.00 48.95  ? 14  ILE B CB    1 
ATOM   1518 C CG1   . ILE B 1 42  ? -4.803  28.723 63.475 1.00 41.04  ? 14  ILE B CG1   1 
ATOM   1519 C CG2   . ILE B 1 42  ? -6.988  29.873 63.081 1.00 40.11  ? 14  ILE B CG2   1 
ATOM   1520 C CD1   . ILE B 1 42  ? -4.575  29.406 64.804 1.00 42.24  ? 14  ILE B CD1   1 
ATOM   1521 N N     . PHE B 1 43  ? -6.569  30.639 59.784 1.00 54.17  ? 15  PHE B N     1 
ATOM   1522 C CA    . PHE B 1 43  ? -7.529  31.368 58.961 1.00 48.67  ? 15  PHE B CA    1 
ATOM   1523 C C     . PHE B 1 43  ? -7.834  30.647 57.649 1.00 49.57  ? 15  PHE B C     1 
ATOM   1524 O O     . PHE B 1 43  ? -8.931  30.773 57.105 1.00 58.89  ? 15  PHE B O     1 
ATOM   1525 C CB    . PHE B 1 43  ? -7.047  32.797 58.697 1.00 48.18  ? 15  PHE B CB    1 
ATOM   1526 C CG    . PHE B 1 43  ? -7.194  33.714 59.881 1.00 54.31  ? 15  PHE B CG    1 
ATOM   1527 C CD1   . PHE B 1 43  ? -8.427  34.262 60.198 1.00 54.81  ? 15  PHE B CD1   1 
ATOM   1528 C CD2   . PHE B 1 43  ? -6.103  34.029 60.673 1.00 50.61  ? 15  PHE B CD2   1 
ATOM   1529 C CE1   . PHE B 1 43  ? -8.568  35.106 61.285 1.00 51.68  ? 15  PHE B CE1   1 
ATOM   1530 C CE2   . PHE B 1 43  ? -6.237  34.872 61.761 1.00 48.55  ? 15  PHE B CE2   1 
ATOM   1531 C CZ    . PHE B 1 43  ? -7.471  35.412 62.067 1.00 49.75  ? 15  PHE B CZ    1 
ATOM   1532 N N     . ALA B 1 44  ? -6.864  29.888 57.146 1.00 46.75  ? 16  ALA B N     1 
ATOM   1533 C CA    . ALA B 1 44  ? -7.072  29.083 55.947 1.00 45.23  ? 16  ALA B CA    1 
ATOM   1534 C C     . ALA B 1 44  ? -8.031  27.938 56.243 1.00 49.39  ? 16  ALA B C     1 
ATOM   1535 O O     . ALA B 1 44  ? -8.838  27.556 55.396 1.00 49.38  ? 16  ALA B O     1 
ATOM   1536 C CB    . ALA B 1 44  ? -5.750  28.545 55.425 1.00 41.40  ? 16  ALA B CB    1 
ATOM   1537 N N     . ALA B 1 45  ? -7.932  27.395 57.452 1.00 50.21  ? 17  ALA B N     1 
ATOM   1538 C CA    . ALA B 1 45  ? -8.813  26.321 57.889 1.00 50.79  ? 17  ALA B CA    1 
ATOM   1539 C C     . ALA B 1 45  ? -10.230 26.839 58.114 1.00 55.57  ? 17  ALA B C     1 
ATOM   1540 O O     . ALA B 1 45  ? -11.205 26.171 57.772 1.00 38.75  ? 17  ALA B O     1 
ATOM   1541 C CB    . ALA B 1 45  ? -8.272  25.677 59.154 1.00 39.30  ? 17  ALA B CB    1 
ATOM   1542 N N     . VAL B 1 46  ? -10.336 28.033 58.691 1.00 57.25  ? 18  VAL B N     1 
ATOM   1543 C CA    . VAL B 1 46  ? -11.631 28.660 58.938 1.00 51.34  ? 18  VAL B CA    1 
ATOM   1544 C C     . VAL B 1 46  ? -12.326 28.996 57.621 1.00 46.53  ? 18  VAL B C     1 
ATOM   1545 O O     . VAL B 1 46  ? -13.537 28.826 57.485 1.00 47.74  ? 18  VAL B O     1 
ATOM   1546 C CB    . VAL B 1 46  ? -11.488 29.938 59.794 1.00 47.95  ? 18  VAL B CB    1 
ATOM   1547 C CG1   . VAL B 1 46  ? -12.832 30.635 59.950 1.00 42.84  ? 18  VAL B CG1   1 
ATOM   1548 C CG2   . VAL B 1 46  ? -10.903 29.601 61.157 1.00 39.08  ? 18  VAL B CG2   1 
ATOM   1549 N N     . ALA B 1 47  ? -11.548 29.462 56.650 1.00 46.20  ? 19  ALA B N     1 
ATOM   1550 C CA    . ALA B 1 47  ? -12.079 29.778 55.329 1.00 43.24  ? 19  ALA B CA    1 
ATOM   1551 C C     . ALA B 1 47  ? -12.574 28.520 54.619 1.00 45.80  ? 19  ALA B C     1 
ATOM   1552 O O     . ALA B 1 47  ? -13.570 28.556 53.897 1.00 50.24  ? 19  ALA B O     1 
ATOM   1553 C CB    . ALA B 1 47  ? -11.028 30.485 54.488 1.00 36.58  ? 19  ALA B CB    1 
ATOM   1554 N N     . MET B 1 48  ? -11.874 27.410 54.830 1.00 50.48  ? 20  MET B N     1 
ATOM   1555 C CA    . MET B 1 48  ? -12.254 26.138 54.225 1.00 50.71  ? 20  MET B CA    1 
ATOM   1556 C C     . MET B 1 48  ? -13.563 25.620 54.816 1.00 55.22  ? 20  MET B C     1 
ATOM   1557 O O     . MET B 1 48  ? -14.360 24.989 54.122 1.00 60.43  ? 20  MET B O     1 
ATOM   1558 C CB    . MET B 1 48  ? -11.146 25.102 54.410 1.00 44.12  ? 20  MET B CB    1 
ATOM   1559 C CG    . MET B 1 48  ? -11.355 23.817 53.622 1.00 44.03  ? 20  MET B CG    1 
ATOM   1560 S SD    . MET B 1 48  ? -11.295 24.073 51.838 1.00 62.76  ? 20  MET B SD    1 
ATOM   1561 C CE    . MET B 1 48  ? -12.964 23.625 51.368 1.00 38.80  ? 20  MET B CE    1 
ATOM   1562 N N     . VAL B 1 49  ? -13.777 25.885 56.101 1.00 52.01  ? 21  VAL B N     1 
ATOM   1563 C CA    . VAL B 1 49  ? -15.024 25.513 56.760 1.00 56.26  ? 21  VAL B CA    1 
ATOM   1564 C C     . VAL B 1 49  ? -16.181 26.335 56.196 1.00 52.98  ? 21  VAL B C     1 
ATOM   1565 O O     . VAL B 1 49  ? -17.264 25.809 55.943 1.00 50.42  ? 21  VAL B O     1 
ATOM   1566 C CB    . VAL B 1 49  ? -14.939 25.706 58.290 1.00 61.08  ? 21  VAL B CB    1 
ATOM   1567 C CG1   . VAL B 1 49  ? -16.294 25.467 58.940 1.00 42.87  ? 21  VAL B CG1   1 
ATOM   1568 C CG2   . VAL B 1 49  ? -13.892 24.779 58.883 1.00 42.02  ? 21  VAL B CG2   1 
ATOM   1569 N N     . LEU B 1 50  ? -15.936 27.626 55.987 1.00 52.13  ? 22  LEU B N     1 
ATOM   1570 C CA    . LEU B 1 50  ? -16.940 28.514 55.413 1.00 56.05  ? 22  LEU B CA    1 
ATOM   1571 C C     . LEU B 1 50  ? -17.239 28.154 53.961 1.00 62.39  ? 22  LEU B C     1 
ATOM   1572 O O     . LEU B 1 50  ? -18.292 28.506 53.429 1.00 74.34  ? 22  LEU B O     1 
ATOM   1573 C CB    . LEU B 1 50  ? -16.494 29.975 55.514 1.00 55.91  ? 22  LEU B CB    1 
ATOM   1574 C CG    . LEU B 1 50  ? -16.442 30.569 56.923 1.00 58.34  ? 22  LEU B CG    1 
ATOM   1575 C CD1   . LEU B 1 50  ? -15.989 32.019 56.880 1.00 56.14  ? 22  LEU B CD1   1 
ATOM   1576 C CD2   . LEU B 1 50  ? -17.796 30.450 57.606 1.00 54.63  ? 22  LEU B CD2   1 
ATOM   1577 N N     . SER B 1 51  ? -16.308 27.448 53.324 1.00 54.04  ? 23  SER B N     1 
ATOM   1578 C CA    . SER B 1 51  ? -16.501 26.991 51.953 1.00 47.46  ? 23  SER B CA    1 
ATOM   1579 C C     . SER B 1 51  ? -17.530 25.867 51.893 1.00 48.61  ? 23  SER B C     1 
ATOM   1580 O O     . SER B 1 51  ? -18.019 25.520 50.818 1.00 49.50  ? 23  SER B O     1 
ATOM   1581 C CB    . SER B 1 51  ? -15.176 26.525 51.344 1.00 47.31  ? 23  SER B CB    1 
ATOM   1582 O OG    . SER B 1 51  ? -14.257 27.598 51.235 1.00 47.33  ? 23  SER B OG    1 
ATOM   1583 N N     . PHE B 1 52  ? -17.850 25.300 53.053 1.00 52.65  ? 24  PHE B N     1 
ATOM   1584 C CA    . PHE B 1 52  ? -18.882 24.273 53.149 1.00 55.00  ? 24  PHE B CA    1 
ATOM   1585 C C     . PHE B 1 52  ? -20.254 24.891 53.399 1.00 54.64  ? 24  PHE B C     1 
ATOM   1586 O O     . PHE B 1 52  ? -21.234 24.180 53.626 1.00 61.17  ? 24  PHE B O     1 
ATOM   1587 C CB    . PHE B 1 52  ? -18.540 23.253 54.238 1.00 43.94  ? 24  PHE B CB    1 
ATOM   1588 C CG    . PHE B 1 52  ? -17.544 22.216 53.803 1.00 56.61  ? 24  PHE B CG    1 
ATOM   1589 C CD1   . PHE B 1 52  ? -16.184 22.468 53.870 1.00 60.05  ? 24  PHE B CD1   1 
ATOM   1590 C CD2   . PHE B 1 52  ? -17.968 20.989 53.321 1.00 58.18  ? 24  PHE B CD2   1 
ATOM   1591 C CE1   . PHE B 1 52  ? -15.265 21.516 53.467 1.00 60.57  ? 24  PHE B CE1   1 
ATOM   1592 C CE2   . PHE B 1 52  ? -17.055 20.032 52.917 1.00 58.50  ? 24  PHE B CE2   1 
ATOM   1593 C CZ    . PHE B 1 52  ? -15.701 20.296 52.990 1.00 59.69  ? 24  PHE B CZ    1 
ATOM   1594 N N     . ILE B 1 53  ? -20.313 26.219 53.360 1.00 46.54  ? 25  ILE B N     1 
ATOM   1595 C CA    . ILE B 1 53  ? -21.580 26.938 53.418 1.00 52.95  ? 25  ILE B CA    1 
ATOM   1596 C C     . ILE B 1 53  ? -21.973 27.374 52.010 1.00 63.41  ? 25  ILE B C     1 
ATOM   1597 O O     . ILE B 1 53  ? -21.416 28.331 51.471 1.00 64.31  ? 25  ILE B O     1 
ATOM   1598 C CB    . ILE B 1 53  ? -21.501 28.168 54.343 1.00 48.61  ? 25  ILE B CB    1 
ATOM   1599 C CG1   . ILE B 1 53  ? -21.176 27.737 55.775 1.00 49.40  ? 25  ILE B CG1   1 
ATOM   1600 C CG2   . ILE B 1 53  ? -22.806 28.947 54.309 1.00 43.60  ? 25  ILE B CG2   1 
ATOM   1601 C CD1   . ILE B 1 53  ? -21.157 28.878 56.767 1.00 47.52  ? 25  ILE B CD1   1 
ATOM   1602 N N     . PRO B 1 54  ? -22.935 26.660 51.406 1.00 67.63  ? 26  PRO B N     1 
ATOM   1603 C CA    . PRO B 1 54  ? -23.313 26.861 50.003 1.00 68.17  ? 26  PRO B CA    1 
ATOM   1604 C C     . PRO B 1 54  ? -24.133 28.126 49.752 1.00 75.59  ? 26  PRO B C     1 
ATOM   1605 O O     . PRO B 1 54  ? -25.315 28.185 50.092 1.00 80.83  ? 26  PRO B O     1 
ATOM   1606 C CB    . PRO B 1 54  ? -24.150 25.618 49.691 1.00 64.07  ? 26  PRO B CB    1 
ATOM   1607 C CG    . PRO B 1 54  ? -24.737 25.229 51.002 1.00 63.26  ? 26  PRO B CG    1 
ATOM   1608 C CD    . PRO B 1 54  ? -23.708 25.576 52.040 1.00 63.76  ? 26  PRO B CD    1 
ATOM   1609 N N     . LEU B 1 55  ? -23.496 29.129 49.158 1.00 65.05  ? 27  LEU B N     1 
ATOM   1610 C CA    . LEU B 1 55  ? -24.200 30.310 48.674 1.00 57.28  ? 27  LEU B CA    1 
ATOM   1611 C C     . LEU B 1 55  ? -24.015 30.409 47.166 1.00 63.67  ? 27  LEU B C     1 
ATOM   1612 O O     . LEU B 1 55  ? -23.546 31.423 46.647 1.00 39.43  ? 27  LEU B O     1 
ATOM   1613 C CB    . LEU B 1 55  ? -23.687 31.576 49.361 1.00 47.93  ? 27  LEU B CB    1 
ATOM   1614 C CG    . LEU B 1 55  ? -24.064 31.744 50.834 1.00 46.29  ? 27  LEU B CG    1 
ATOM   1615 C CD1   . LEU B 1 55  ? -23.561 33.077 51.364 1.00 40.55  ? 27  LEU B CD1   1 
ATOM   1616 C CD2   . LEU B 1 55  ? -25.569 31.622 51.020 1.00 41.85  ? 27  LEU B CD2   1 
ATOM   1617 N N     . ASP B 1 56  ? -24.388 29.338 46.471 1.00 63.37  ? 28  ASP B N     1 
ATOM   1618 C CA    . ASP B 1 56  ? -24.166 29.232 45.035 1.00 58.64  ? 28  ASP B CA    1 
ATOM   1619 C C     . ASP B 1 56  ? -25.476 29.256 44.257 1.00 58.87  ? 28  ASP B C     1 
ATOM   1620 O O     . ASP B 1 56  ? -26.509 28.793 44.740 1.00 57.49  ? 28  ASP B O     1 
ATOM   1621 C CB    . ASP B 1 56  ? -23.420 27.935 44.712 1.00 64.93  ? 28  ASP B CB    1 
ATOM   1622 C CG    . ASP B 1 56  ? -22.371 27.588 45.751 1.00 79.02  ? 28  ASP B CG    1 
ATOM   1623 O OD1   . ASP B 1 56  ? -21.693 28.510 46.250 1.00 86.78  ? 28  ASP B OD1   1 
ATOM   1624 O OD2   . ASP B 1 56  ? -22.229 26.389 46.072 1.00 82.34  ? 28  ASP B OD2   1 
ATOM   1625 N N     . ILE B 1 57  ? -25.423 29.801 43.047 1.00 60.78  ? 29  ILE B N     1 
ATOM   1626 C CA    . ILE B 1 57  ? -26.536 29.715 42.112 1.00 59.47  ? 29  ILE B CA    1 
ATOM   1627 C C     . ILE B 1 57  ? -26.011 29.132 40.807 1.00 63.00  ? 29  ILE B C     1 
ATOM   1628 O O     . ILE B 1 57  ? -25.496 29.854 39.954 1.00 76.11  ? 29  ILE B O     1 
ATOM   1629 C CB    . ILE B 1 57  ? -27.172 31.088 41.844 1.00 60.28  ? 29  ILE B CB    1 
ATOM   1630 C CG1   . ILE B 1 57  ? -27.598 31.746 43.158 1.00 61.85  ? 29  ILE B CG1   1 
ATOM   1631 C CG2   . ILE B 1 57  ? -28.363 30.947 40.908 1.00 46.54  ? 29  ILE B CG2   1 
ATOM   1632 C CD1   . ILE B 1 57  ? -28.156 33.140 42.988 1.00 61.16  ? 29  ILE B CD1   1 
ATOM   1633 N N     . GLY B 1 58  ? -26.132 27.817 40.664 1.00 60.73  ? 30  GLY B N     1 
ATOM   1634 C CA    . GLY B 1 58  ? -25.537 27.121 39.540 1.00 66.84  ? 30  GLY B CA    1 
ATOM   1635 C C     . GLY B 1 58  ? -24.092 26.780 39.849 1.00 75.28  ? 30  GLY B C     1 
ATOM   1636 O O     . GLY B 1 58  ? -23.724 26.610 41.011 1.00 79.69  ? 30  GLY B O     1 
ATOM   1637 N N     . SER B 1 59  ? -23.268 26.685 38.812 1.00 76.52  ? 31  SER B N     1 
ATOM   1638 C CA    . SER B 1 59  ? -21.859 26.354 38.992 1.00 73.75  ? 31  SER B CA    1 
ATOM   1639 C C     . SER B 1 59  ? -20.956 27.537 38.656 1.00 71.47  ? 31  SER B C     1 
ATOM   1640 O O     . SER B 1 59  ? -19.732 27.445 38.758 1.00 64.23  ? 31  SER B O     1 
ATOM   1641 C CB    . SER B 1 59  ? -21.482 25.143 38.135 1.00 71.02  ? 31  SER B CB    1 
ATOM   1642 O OG    . SER B 1 59  ? -21.738 25.393 36.764 1.00 78.49  ? 31  SER B OG    1 
ATOM   1643 N N     . SER B 1 60  ? -21.565 28.651 38.264 1.00 70.59  ? 32  SER B N     1 
ATOM   1644 C CA    . SER B 1 60  ? -20.808 29.815 37.821 1.00 41.08  ? 32  SER B CA    1 
ATOM   1645 C C     . SER B 1 60  ? -20.997 31.023 38.734 1.00 56.54  ? 32  SER B C     1 
ATOM   1646 O O     . SER B 1 60  ? -20.313 32.035 38.582 1.00 66.71  ? 32  SER B O     1 
ATOM   1647 C CB    . SER B 1 60  ? -21.179 30.176 36.381 1.00 61.68  ? 32  SER B CB    1 
ATOM   1648 O OG    . SER B 1 60  ? -20.878 29.107 35.500 1.00 57.87  ? 32  SER B OG    1 
ATOM   1649 N N     . PHE B 1 61  ? -21.926 30.918 39.678 1.00 43.65  ? 33  PHE B N     1 
ATOM   1650 C CA    . PHE B 1 61  ? -22.105 31.970 40.674 1.00 42.69  ? 33  PHE B CA    1 
ATOM   1651 C C     . PHE B 1 61  ? -21.975 31.422 42.089 1.00 49.65  ? 33  PHE B C     1 
ATOM   1652 O O     . PHE B 1 61  ? -22.524 30.368 42.410 1.00 57.05  ? 33  PHE B O     1 
ATOM   1653 C CB    . PHE B 1 61  ? -23.454 32.677 40.511 1.00 45.17  ? 33  PHE B CB    1 
ATOM   1654 C CG    . PHE B 1 61  ? -23.664 33.800 41.490 1.00 45.85  ? 33  PHE B CG    1 
ATOM   1655 C CD1   . PHE B 1 61  ? -23.179 35.070 41.221 1.00 41.80  ? 33  PHE B CD1   1 
ATOM   1656 C CD2   . PHE B 1 61  ? -24.333 33.584 42.685 1.00 48.24  ? 33  PHE B CD2   1 
ATOM   1657 C CE1   . PHE B 1 61  ? -23.361 36.102 42.122 1.00 41.03  ? 33  PHE B CE1   1 
ATOM   1658 C CE2   . PHE B 1 61  ? -24.518 34.611 43.590 1.00 45.14  ? 33  PHE B CE2   1 
ATOM   1659 C CZ    . PHE B 1 61  ? -24.031 35.873 43.308 1.00 45.77  ? 33  PHE B CZ    1 
ATOM   1660 N N     . SER B 1 62  ? -21.254 32.154 42.931 1.00 48.21  ? 34  SER B N     1 
ATOM   1661 C CA    . SER B 1 62  ? -21.064 31.763 44.321 1.00 50.99  ? 34  SER B CA    1 
ATOM   1662 C C     . SER B 1 62  ? -20.534 32.929 45.146 1.00 56.19  ? 34  SER B C     1 
ATOM   1663 O O     . SER B 1 62  ? -19.644 33.658 44.708 1.00 61.66  ? 34  SER B O     1 
ATOM   1664 C CB    . SER B 1 62  ? -20.097 30.581 44.417 1.00 52.81  ? 34  SER B CB    1 
ATOM   1665 O OG    . SER B 1 62  ? -19.938 30.158 45.760 1.00 55.99  ? 34  SER B OG    1 
ATOM   1666 N N     . ILE B 1 63  ? -21.091 33.106 46.339 1.00 53.25  ? 35  ILE B N     1 
ATOM   1667 C CA    . ILE B 1 63  ? -20.565 34.080 47.285 1.00 53.15  ? 35  ILE B CA    1 
ATOM   1668 C C     . ILE B 1 63  ? -19.603 33.381 48.236 1.00 50.38  ? 35  ILE B C     1 
ATOM   1669 O O     . ILE B 1 63  ? -20.020 32.616 49.104 1.00 56.05  ? 35  ILE B O     1 
ATOM   1670 C CB    . ILE B 1 63  ? -21.683 34.761 48.093 1.00 57.88  ? 35  ILE B CB    1 
ATOM   1671 C CG1   . ILE B 1 63  ? -22.623 35.527 47.159 1.00 60.39  ? 35  ILE B CG1   1 
ATOM   1672 C CG2   . ILE B 1 63  ? -21.090 35.696 49.135 1.00 50.77  ? 35  ILE B CG2   1 
ATOM   1673 C CD1   . ILE B 1 63  ? -23.736 36.260 47.877 1.00 53.67  ? 35  ILE B CD1   1 
ATOM   1674 N N     . SER B 1 64  ? -18.312 33.640 48.056 1.00 49.63  ? 36  SER B N     1 
ATOM   1675 C CA    . SER B 1 64  ? -17.279 32.982 48.844 1.00 33.56  ? 36  SER B CA    1 
ATOM   1676 C C     . SER B 1 64  ? -17.134 33.624 50.219 1.00 52.49  ? 36  SER B C     1 
ATOM   1677 O O     . SER B 1 64  ? -16.479 34.656 50.368 1.00 59.82  ? 36  SER B O     1 
ATOM   1678 C CB    . SER B 1 64  ? -15.943 33.019 48.100 1.00 45.33  ? 36  SER B CB    1 
ATOM   1679 O OG    . SER B 1 64  ? -14.940 32.317 48.813 1.00 47.08  ? 36  SER B OG    1 
ATOM   1680 N N     . LEU B 1 65  ? -17.746 33.007 51.223 1.00 46.61  ? 37  LEU B N     1 
ATOM   1681 C CA    . LEU B 1 65  ? -17.672 33.511 52.589 1.00 49.52  ? 37  LEU B CA    1 
ATOM   1682 C C     . LEU B 1 65  ? -16.274 33.324 53.173 1.00 51.28  ? 37  LEU B C     1 
ATOM   1683 O O     . LEU B 1 65  ? -15.934 33.917 54.196 1.00 56.40  ? 37  LEU B O     1 
ATOM   1684 C CB    . LEU B 1 65  ? -18.712 32.820 53.473 1.00 35.90  ? 37  LEU B CB    1 
ATOM   1685 C CG    . LEU B 1 65  ? -20.177 33.042 53.092 1.00 62.55  ? 37  LEU B CG    1 
ATOM   1686 C CD1   . LEU B 1 65  ? -21.101 32.286 54.037 1.00 38.26  ? 37  LEU B CD1   1 
ATOM   1687 C CD2   . LEU B 1 65  ? -20.509 34.526 53.085 1.00 36.23  ? 37  LEU B CD2   1 
ATOM   1688 N N     . GLY B 1 66  ? -15.467 32.502 52.511 1.00 50.22  ? 38  GLY B N     1 
ATOM   1689 C CA    . GLY B 1 66  ? -14.119 32.217 52.967 1.00 52.14  ? 38  GLY B CA    1 
ATOM   1690 C C     . GLY B 1 66  ? -13.158 33.381 52.814 1.00 46.26  ? 38  GLY B C     1 
ATOM   1691 O O     . GLY B 1 66  ? -12.028 33.326 53.298 1.00 46.72  ? 38  GLY B O     1 
ATOM   1692 N N     . MET B 1 67  ? -13.598 34.435 52.136 1.00 43.94  ? 39  MET B N     1 
ATOM   1693 C CA    . MET B 1 67  ? -12.770 35.624 51.967 1.00 48.97  ? 39  MET B CA    1 
ATOM   1694 C C     . MET B 1 67  ? -12.742 36.466 53.239 1.00 53.73  ? 39  MET B C     1 
ATOM   1695 O O     . MET B 1 67  ? -11.870 37.319 53.409 1.00 47.85  ? 39  MET B O     1 
ATOM   1696 C CB    . MET B 1 67  ? -13.256 36.463 50.782 1.00 41.78  ? 39  MET B CB    1 
ATOM   1697 C CG    . MET B 1 67  ? -12.974 35.840 49.425 1.00 40.64  ? 39  MET B CG    1 
ATOM   1698 S SD    . MET B 1 67  ? -11.214 35.715 49.049 1.00 42.48  ? 39  MET B SD    1 
ATOM   1699 C CE    . MET B 1 67  ? -10.760 37.445 48.943 1.00 75.84  ? 39  MET B CE    1 
ATOM   1700 N N     . ILE B 1 68  ? -13.698 36.222 54.130 1.00 52.02  ? 40  ILE B N     1 
ATOM   1701 C CA    . ILE B 1 68  ? -13.751 36.935 55.404 1.00 51.13  ? 40  ILE B CA    1 
ATOM   1702 C C     . ILE B 1 68  ? -12.539 36.636 56.302 1.00 49.68  ? 40  ILE B C     1 
ATOM   1703 O O     . ILE B 1 68  ? -11.903 37.567 56.794 1.00 46.85  ? 40  ILE B O     1 
ATOM   1704 C CB    . ILE B 1 68  ? -15.089 36.703 56.160 1.00 52.61  ? 40  ILE B CB    1 
ATOM   1705 C CG1   . ILE B 1 68  ? -16.277 37.077 55.271 1.00 55.83  ? 40  ILE B CG1   1 
ATOM   1706 C CG2   . ILE B 1 68  ? -15.117 37.494 57.461 1.00 41.79  ? 40  ILE B CG2   1 
ATOM   1707 C CD1   . ILE B 1 68  ? -17.625 36.873 55.929 1.00 50.78  ? 40  ILE B CD1   1 
ATOM   1708 N N     . PRO B 1 69  ? -12.208 35.345 56.517 1.00 52.85  ? 41  PRO B N     1 
ATOM   1709 C CA    . PRO B 1 69  ? -10.974 35.100 57.273 1.00 55.49  ? 41  PRO B CA    1 
ATOM   1710 C C     . PRO B 1 69  ? -9.736  35.530 56.490 1.00 54.09  ? 41  PRO B C     1 
ATOM   1711 O O     . PRO B 1 69  ? -8.739  35.933 57.089 1.00 56.99  ? 41  PRO B O     1 
ATOM   1712 C CB    . PRO B 1 69  ? -10.969 33.578 57.455 1.00 55.50  ? 41  PRO B CB    1 
ATOM   1713 C CG    . PRO B 1 69  ? -12.384 33.163 57.277 1.00 56.35  ? 41  PRO B CG    1 
ATOM   1714 C CD    . PRO B 1 69  ? -12.931 34.090 56.246 1.00 52.69  ? 41  PRO B CD    1 
ATOM   1715 N N     . MET B 1 70  ? -9.806  35.440 55.166 1.00 49.67  ? 42  MET B N     1 
ATOM   1716 C CA    . MET B 1 70  ? -8.696  35.848 54.312 1.00 54.41  ? 42  MET B CA    1 
ATOM   1717 C C     . MET B 1 70  ? -8.433  37.346 54.416 1.00 57.58  ? 42  MET B C     1 
ATOM   1718 O O     . MET B 1 70  ? -7.292  37.791 54.319 1.00 56.74  ? 42  MET B O     1 
ATOM   1719 C CB    . MET B 1 70  ? -8.962  35.464 52.855 1.00 52.96  ? 42  MET B CB    1 
ATOM   1720 C CG    . MET B 1 70  ? -8.950  33.967 52.584 1.00 56.14  ? 42  MET B CG    1 
ATOM   1721 S SD    . MET B 1 70  ? -7.342  33.194 52.856 1.00 45.32  ? 42  MET B SD    1 
ATOM   1722 C CE    . MET B 1 70  ? -7.587  32.431 54.459 1.00 105.68 ? 42  MET B CE    1 
ATOM   1723 N N     . TYR B 1 71  ? -9.495  38.119 54.613 1.00 58.15  ? 43  TYR B N     1 
ATOM   1724 C CA    . TYR B 1 71  ? -9.367  39.564 54.754 1.00 55.77  ? 43  TYR B CA    1 
ATOM   1725 C C     . TYR B 1 71  ? -8.802  39.945 56.118 1.00 53.94  ? 43  TYR B C     1 
ATOM   1726 O O     . TYR B 1 71  ? -8.051  40.912 56.236 1.00 48.81  ? 43  TYR B O     1 
ATOM   1727 C CB    . TYR B 1 71  ? -10.715 40.251 54.524 1.00 51.59  ? 43  TYR B CB    1 
ATOM   1728 C CG    . TYR B 1 71  ? -11.104 40.358 53.067 1.00 48.51  ? 43  TYR B CG    1 
ATOM   1729 C CD1   . TYR B 1 71  ? -10.136 40.437 52.074 1.00 30.15  ? 43  TYR B CD1   1 
ATOM   1730 C CD2   . TYR B 1 71  ? -12.440 40.381 52.685 1.00 40.53  ? 43  TYR B CD2   1 
ATOM   1731 C CE1   . TYR B 1 71  ? -10.486 40.537 50.740 1.00 53.39  ? 43  TYR B CE1   1 
ATOM   1732 C CE2   . TYR B 1 71  ? -12.801 40.481 51.353 1.00 40.81  ? 43  TYR B CE2   1 
ATOM   1733 C CZ    . TYR B 1 71  ? -11.821 40.559 50.385 1.00 51.18  ? 43  TYR B CZ    1 
ATOM   1734 O OH    . TYR B 1 71  ? -12.178 40.656 49.060 1.00 47.47  ? 43  TYR B OH    1 
ATOM   1735 N N     . VAL B 1 72  ? -9.168  39.182 57.144 1.00 51.74  ? 44  VAL B N     1 
ATOM   1736 C CA    . VAL B 1 72  ? -8.674  39.430 58.493 1.00 44.39  ? 44  VAL B CA    1 
ATOM   1737 C C     . VAL B 1 72  ? -7.166  39.234 58.551 1.00 44.21  ? 44  VAL B C     1 
ATOM   1738 O O     . VAL B 1 72  ? -6.433  40.128 58.973 1.00 50.56  ? 44  VAL B O     1 
ATOM   1739 C CB    . VAL B 1 72  ? -9.338  38.503 59.531 1.00 42.62  ? 44  VAL B CB    1 
ATOM   1740 C CG1   . VAL B 1 72  ? -8.699  38.697 60.897 1.00 40.68  ? 44  VAL B CG1   1 
ATOM   1741 C CG2   . VAL B 1 72  ? -10.833 38.761 59.600 1.00 40.10  ? 44  VAL B CG2   1 
ATOM   1742 N N     . ILE B 1 73  ? -6.712  38.063 58.114 1.00 39.78  ? 45  ILE B N     1 
ATOM   1743 C CA    . ILE B 1 73  ? -5.289  37.734 58.119 1.00 35.71  ? 45  ILE B CA    1 
ATOM   1744 C C     . ILE B 1 73  ? -4.486  38.672 57.210 1.00 35.79  ? 45  ILE B C     1 
ATOM   1745 O O     . ILE B 1 73  ? -3.345  39.018 57.517 1.00 33.49  ? 45  ILE B O     1 
ATOM   1746 C CB    . ILE B 1 73  ? -5.047  36.247 57.738 1.00 38.71  ? 45  ILE B CB    1 
ATOM   1747 C CG1   . ILE B 1 73  ? -3.569  35.875 57.889 1.00 42.55  ? 45  ILE B CG1   1 
ATOM   1748 C CG2   . ILE B 1 73  ? -5.545  35.948 56.330 1.00 35.69  ? 45  ILE B CG2   1 
ATOM   1749 C CD1   . ILE B 1 73  ? -3.088  35.863 59.320 1.00 47.99  ? 45  ILE B CD1   1 
ATOM   1750 N N     . ALA B 1 74  ? -5.095  39.097 56.105 1.00 42.24  ? 46  ALA B N     1 
ATOM   1751 C CA    . ALA B 1 74  ? -4.452  40.019 55.174 1.00 41.37  ? 46  ALA B CA    1 
ATOM   1752 C C     . ALA B 1 74  ? -4.167  41.355 55.844 1.00 32.54  ? 46  ALA B C     1 
ATOM   1753 O O     . ALA B 1 74  ? -3.092  41.924 55.681 1.00 37.90  ? 46  ALA B O     1 
ATOM   1754 C CB    . ALA B 1 74  ? -5.323  40.225 53.945 1.00 34.51  ? 46  ALA B CB    1 
ATOM   1755 N N     . ILE B 1 75  ? -5.143  41.852 56.594 1.00 47.46  ? 47  ILE B N     1 
ATOM   1756 C CA    . ILE B 1 75  ? -4.995  43.100 57.330 1.00 45.88  ? 47  ILE B CA    1 
ATOM   1757 C C     . ILE B 1 75  ? -4.066  42.904 58.521 1.00 42.19  ? 47  ILE B C     1 
ATOM   1758 O O     . ILE B 1 75  ? -3.212  43.745 58.807 1.00 43.40  ? 47  ILE B O     1 
ATOM   1759 C CB    . ILE B 1 75  ? -6.359  43.607 57.836 1.00 49.87  ? 47  ILE B CB    1 
ATOM   1760 C CG1   . ILE B 1 75  ? -7.249  44.006 56.656 1.00 50.57  ? 47  ILE B CG1   1 
ATOM   1761 C CG2   . ILE B 1 75  ? -6.179  44.775 58.791 1.00 50.78  ? 47  ILE B CG2   1 
ATOM   1762 C CD1   . ILE B 1 75  ? -8.651  44.412 57.055 1.00 33.86  ? 47  ILE B CD1   1 
ATOM   1763 N N     . ARG B 1 76  ? -4.232  41.774 59.198 1.00 41.77  ? 48  ARG B N     1 
ATOM   1764 C CA    . ARG B 1 76  ? -3.488  41.477 60.416 1.00 54.32  ? 48  ARG B CA    1 
ATOM   1765 C C     . ARG B 1 76  ? -1.989  41.264 60.181 1.00 57.18  ? 48  ARG B C     1 
ATOM   1766 O O     . ARG B 1 76  ? -1.160  41.742 60.958 1.00 51.28  ? 48  ARG B O     1 
ATOM   1767 C CB    . ARG B 1 76  ? -4.093  40.252 61.110 1.00 50.46  ? 48  ARG B CB    1 
ATOM   1768 C CG    . ARG B 1 76  ? -3.373  39.826 62.372 1.00 49.92  ? 48  ARG B CG    1 
ATOM   1769 C CD    . ARG B 1 76  ? -4.010  38.591 62.988 1.00 42.46  ? 48  ARG B CD    1 
ATOM   1770 N NE    . ARG B 1 76  ? -3.231  38.105 64.123 1.00 46.16  ? 48  ARG B NE    1 
ATOM   1771 C CZ    . ARG B 1 76  ? -3.408  38.505 65.377 1.00 45.32  ? 48  ARG B CZ    1 
ATOM   1772 N NH1   . ARG B 1 76  ? -4.347  39.397 65.664 1.00 47.25  ? 48  ARG B NH1   1 
ATOM   1773 N NH2   . ARG B 1 76  ? -2.647  38.012 66.345 1.00 46.42  ? 48  ARG B NH2   1 
ATOM   1774 N N     . ARG B 1 77  ? -1.642  40.556 59.110 1.00 56.87  ? 49  ARG B N     1 
ATOM   1775 C CA    . ARG B 1 77  ? -0.255  40.146 58.898 1.00 56.93  ? 49  ARG B CA    1 
ATOM   1776 C C     . ARG B 1 77  ? 0.384   40.655 57.602 1.00 51.58  ? 49  ARG B C     1 
ATOM   1777 O O     . ARG B 1 77  ? 1.610   40.712 57.492 1.00 41.96  ? 49  ARG B O     1 
ATOM   1778 C CB    . ARG B 1 77  ? -0.132  38.625 58.996 1.00 50.84  ? 49  ARG B CB    1 
ATOM   1779 C CG    . ARG B 1 77  ? -0.432  38.072 60.378 1.00 44.58  ? 49  ARG B CG    1 
ATOM   1780 C CD    . ARG B 1 77  ? 0.526   38.634 61.414 1.00 54.54  ? 49  ARG B CD    1 
ATOM   1781 N NE    . ARG B 1 77  ? 0.353   37.994 62.715 1.00 64.16  ? 49  ARG B NE    1 
ATOM   1782 C CZ    . ARG B 1 77  ? 1.096   38.259 63.784 1.00 65.81  ? 49  ARG B CZ    1 
ATOM   1783 N NH1   . ARG B 1 77  ? 2.070   39.155 63.714 1.00 64.25  ? 49  ARG B NH1   1 
ATOM   1784 N NH2   . ARG B 1 77  ? 0.864   37.625 64.926 1.00 68.98  ? 49  ARG B NH2   1 
ATOM   1785 N N     . GLY B 1 78  ? -0.436  41.013 56.620 1.00 49.74  ? 50  GLY B N     1 
ATOM   1786 C CA    . GLY B 1 78  ? 0.079   41.662 55.427 1.00 55.15  ? 50  GLY B CA    1 
ATOM   1787 C C     . GLY B 1 78  ? 0.007   40.879 54.129 1.00 51.18  ? 50  GLY B C     1 
ATOM   1788 O O     . GLY B 1 78  ? -0.682  39.865 54.026 1.00 52.10  ? 50  GLY B O     1 
ATOM   1789 N N     . PHE B 1 79  ? 0.744   41.371 53.137 1.00 52.50  ? 51  PHE B N     1 
ATOM   1790 C CA    . PHE B 1 79  ? 0.724   40.842 51.776 1.00 31.86  ? 51  PHE B CA    1 
ATOM   1791 C C     . PHE B 1 79  ? 1.114   39.368 51.681 1.00 46.87  ? 51  PHE B C     1 
ATOM   1792 O O     . PHE B 1 79  ? 0.326   38.547 51.215 1.00 46.35  ? 51  PHE B O     1 
ATOM   1793 C CB    . PHE B 1 79  ? 1.641   41.688 50.886 1.00 38.19  ? 51  PHE B CB    1 
ATOM   1794 C CG    . PHE B 1 79  ? 1.590   41.325 49.427 1.00 41.02  ? 51  PHE B CG    1 
ATOM   1795 C CD1   . PHE B 1 79  ? 0.665   41.921 48.584 1.00 42.78  ? 51  PHE B CD1   1 
ATOM   1796 C CD2   . PHE B 1 79  ? 2.483   40.408 48.893 1.00 40.93  ? 51  PHE B CD2   1 
ATOM   1797 C CE1   . PHE B 1 79  ? 0.620   41.596 47.241 1.00 47.33  ? 51  PHE B CE1   1 
ATOM   1798 C CE2   . PHE B 1 79  ? 2.444   40.079 47.553 1.00 31.43  ? 51  PHE B CE2   1 
ATOM   1799 C CZ    . PHE B 1 79  ? 1.511   40.674 46.725 1.00 54.60  ? 51  PHE B CZ    1 
ATOM   1800 N N     . TRP B 1 80  ? 2.327   39.035 52.115 1.00 54.45  ? 52  TRP B N     1 
ATOM   1801 C CA    . TRP B 1 80  ? 2.843   37.676 51.944 1.00 54.01  ? 52  TRP B CA    1 
ATOM   1802 C C     . TRP B 1 80  ? 2.042   36.635 52.719 1.00 55.03  ? 52  TRP B C     1 
ATOM   1803 O O     . TRP B 1 80  ? 1.879   35.503 52.263 1.00 62.68  ? 52  TRP B O     1 
ATOM   1804 C CB    . TRP B 1 80  ? 4.336   37.589 52.297 1.00 51.02  ? 52  TRP B CB    1 
ATOM   1805 C CG    . TRP B 1 80  ? 4.653   37.572 53.771 1.00 51.46  ? 52  TRP B CG    1 
ATOM   1806 C CD1   . TRP B 1 80  ? 5.038   38.634 54.539 1.00 52.38  ? 52  TRP B CD1   1 
ATOM   1807 C CD2   . TRP B 1 80  ? 4.631   36.434 54.644 1.00 51.09  ? 52  TRP B CD2   1 
ATOM   1808 N NE1   . TRP B 1 80  ? 5.250   38.229 55.836 1.00 41.92  ? 52  TRP B NE1   1 
ATOM   1809 C CE2   . TRP B 1 80  ? 5.006   36.883 55.927 1.00 43.08  ? 52  TRP B CE2   1 
ATOM   1810 C CE3   . TRP B 1 80  ? 4.326   35.079 54.468 1.00 53.81  ? 52  TRP B CE3   1 
ATOM   1811 C CZ2   . TRP B 1 80  ? 5.085   36.029 57.025 1.00 40.48  ? 52  TRP B CZ2   1 
ATOM   1812 C CZ3   . TRP B 1 80  ? 4.403   34.233 55.560 1.00 35.07  ? 52  TRP B CZ3   1 
ATOM   1813 C CH2   . TRP B 1 80  ? 4.780   34.710 56.821 1.00 43.20  ? 52  TRP B CH2   1 
ATOM   1814 N N     . ALA B 1 81  ? 1.544   37.022 53.888 1.00 50.86  ? 53  ALA B N     1 
ATOM   1815 C CA    . ALA B 1 81  ? 0.768   36.114 54.722 1.00 47.55  ? 53  ALA B CA    1 
ATOM   1816 C C     . ALA B 1 81  ? -0.578  35.796 54.082 1.00 46.90  ? 53  ALA B C     1 
ATOM   1817 O O     . ALA B 1 81  ? -1.064  34.669 54.166 1.00 44.03  ? 53  ALA B O     1 
ATOM   1818 C CB    . ALA B 1 81  ? 0.572   36.705 56.104 1.00 44.54  ? 53  ALA B CB    1 
ATOM   1819 N N     . ALA B 1 82  ? -1.173  36.797 53.440 1.00 49.85  ? 54  ALA B N     1 
ATOM   1820 C CA    . ALA B 1 82  ? -2.448  36.622 52.756 1.00 44.05  ? 54  ALA B CA    1 
ATOM   1821 C C     . ALA B 1 82  ? -2.318  35.633 51.602 1.00 46.40  ? 54  ALA B C     1 
ATOM   1822 O O     . ALA B 1 82  ? -3.212  34.820 51.365 1.00 50.03  ? 54  ALA B O     1 
ATOM   1823 C CB    . ALA B 1 82  ? -2.966  37.960 52.252 1.00 33.03  ? 54  ALA B CB    1 
ATOM   1824 N N     . GLY B 1 83  ? -1.197  35.706 50.890 1.00 43.14  ? 55  GLY B N     1 
ATOM   1825 C CA    . GLY B 1 83  ? -0.935  34.807 49.782 1.00 42.87  ? 55  GLY B CA    1 
ATOM   1826 C C     . GLY B 1 83  ? -0.674  33.387 50.243 1.00 48.27  ? 55  GLY B C     1 
ATOM   1827 O O     . GLY B 1 83  ? -1.141  32.427 49.628 1.00 50.51  ? 55  GLY B O     1 
ATOM   1828 N N     . PHE B 1 84  ? 0.078   33.253 51.331 1.00 36.25  ? 56  PHE B N     1 
ATOM   1829 C CA    . PHE B 1 84  ? 0.367   31.942 51.896 1.00 35.06  ? 56  PHE B CA    1 
ATOM   1830 C C     . PHE B 1 84  ? -0.899  31.298 52.450 1.00 41.70  ? 56  PHE B C     1 
ATOM   1831 O O     . PHE B 1 84  ? -1.164  30.121 52.203 1.00 40.41  ? 56  PHE B O     1 
ATOM   1832 C CB    . PHE B 1 84  ? 1.431   32.045 52.989 1.00 32.72  ? 56  PHE B CB    1 
ATOM   1833 C CG    . PHE B 1 84  ? 1.745   30.736 53.654 1.00 43.84  ? 56  PHE B CG    1 
ATOM   1834 C CD1   . PHE B 1 84  ? 2.316   29.699 52.935 1.00 41.14  ? 56  PHE B CD1   1 
ATOM   1835 C CD2   . PHE B 1 84  ? 1.477   30.543 54.998 1.00 54.79  ? 56  PHE B CD2   1 
ATOM   1836 C CE1   . PHE B 1 84  ? 2.609   28.493 53.543 1.00 54.82  ? 56  PHE B CE1   1 
ATOM   1837 C CE2   . PHE B 1 84  ? 1.768   29.340 55.614 1.00 59.45  ? 56  PHE B CE2   1 
ATOM   1838 C CZ    . PHE B 1 84  ? 2.335   28.313 54.885 1.00 60.81  ? 56  PHE B CZ    1 
ATOM   1839 N N     . ALA B 1 85  ? -1.678  32.077 53.194 1.00 44.80  ? 57  ALA B N     1 
ATOM   1840 C CA    . ALA B 1 85  ? -2.924  31.586 53.771 1.00 44.64  ? 57  ALA B CA    1 
ATOM   1841 C C     . ALA B 1 85  ? -3.936  31.272 52.677 1.00 40.62  ? 57  ALA B C     1 
ATOM   1842 O O     . ALA B 1 85  ? -4.653  30.272 52.750 1.00 39.08  ? 57  ALA B O     1 
ATOM   1843 C CB    . ALA B 1 85  ? -3.494  32.596 54.751 1.00 32.25  ? 57  ALA B CB    1 
ATOM   1844 N N     . GLY B 1 86  ? -3.987  32.131 51.664 1.00 36.97  ? 58  GLY B N     1 
ATOM   1845 C CA    . GLY B 1 86  ? -4.874  31.927 50.535 1.00 38.72  ? 58  GLY B CA    1 
ATOM   1846 C C     . GLY B 1 86  ? -4.554  30.641 49.798 1.00 40.63  ? 58  GLY B C     1 
ATOM   1847 O O     . GLY B 1 86  ? -5.450  29.866 49.467 1.00 44.90  ? 58  GLY B O     1 
ATOM   1848 N N     . LEU B 1 87  ? -3.269  30.413 49.549 1.00 38.33  ? 59  LEU B N     1 
ATOM   1849 C CA    . LEU B 1 87  ? -2.825  29.209 48.855 1.00 39.69  ? 59  LEU B CA    1 
ATOM   1850 C C     . LEU B 1 87  ? -3.108  27.949 49.671 1.00 46.84  ? 59  LEU B C     1 
ATOM   1851 O O     . LEU B 1 87  ? -3.457  26.908 49.114 1.00 40.62  ? 59  LEU B O     1 
ATOM   1852 C CB    . LEU B 1 87  ? -1.338  29.305 48.512 1.00 39.31  ? 59  LEU B CB    1 
ATOM   1853 C CG    . LEU B 1 87  ? -0.714  28.105 47.800 1.00 32.53  ? 59  LEU B CG    1 
ATOM   1854 C CD1   . LEU B 1 87  ? -1.534  27.695 46.591 1.00 33.33  ? 59  LEU B CD1   1 
ATOM   1855 C CD2   . LEU B 1 87  ? 0.695   28.447 47.382 1.00 59.55  ? 59  LEU B CD2   1 
ATOM   1856 N N     . LEU B 1 88  ? -2.955  28.048 50.989 1.00 57.60  ? 60  LEU B N     1 
ATOM   1857 C CA    . LEU B 1 88  ? -3.297  26.942 51.878 1.00 57.93  ? 60  LEU B CA    1 
ATOM   1858 C C     . LEU B 1 88  ? -4.782  26.628 51.762 1.00 63.24  ? 60  LEU B C     1 
ATOM   1859 O O     . LEU B 1 88  ? -5.177  25.464 51.700 1.00 60.17  ? 60  LEU B O     1 
ATOM   1860 C CB    . LEU B 1 88  ? -2.943  27.275 53.329 1.00 47.32  ? 60  LEU B CB    1 
ATOM   1861 C CG    . LEU B 1 88  ? -1.460  27.239 53.702 1.00 46.69  ? 60  LEU B CG    1 
ATOM   1862 C CD1   . LEU B 1 88  ? -1.273  27.552 55.179 1.00 42.63  ? 60  LEU B CD1   1 
ATOM   1863 C CD2   . LEU B 1 88  ? -0.850  25.889 53.354 1.00 40.21  ? 60  LEU B CD2   1 
ATOM   1864 N N     . TRP B 1 89  ? -5.594  27.680 51.728 1.00 63.54  ? 61  TRP B N     1 
ATOM   1865 C CA    . TRP B 1 89  ? -7.034  27.548 51.548 1.00 55.69  ? 61  TRP B CA    1 
ATOM   1866 C C     . TRP B 1 89  ? -7.336  26.898 50.203 1.00 53.27  ? 61  TRP B C     1 
ATOM   1867 O O     . TRP B 1 89  ? -8.216  26.044 50.098 1.00 58.50  ? 61  TRP B O     1 
ATOM   1868 C CB    . TRP B 1 89  ? -7.699  28.923 51.632 1.00 47.44  ? 61  TRP B CB    1 
ATOM   1869 C CG    . TRP B 1 89  ? -9.186  28.910 51.442 1.00 45.90  ? 61  TRP B CG    1 
ATOM   1870 C CD1   . TRP B 1 89  ? -10.043 27.881 51.712 1.00 43.29  ? 61  TRP B CD1   1 
ATOM   1871 C CD2   . TRP B 1 89  ? -9.992  29.979 50.933 1.00 48.49  ? 61  TRP B CD2   1 
ATOM   1872 N NE1   . TRP B 1 89  ? -11.332 28.246 51.406 1.00 42.39  ? 61  TRP B NE1   1 
ATOM   1873 C CE2   . TRP B 1 89  ? -11.328 29.529 50.925 1.00 44.77  ? 61  TRP B CE2   1 
ATOM   1874 C CE3   . TRP B 1 89  ? -9.714  31.275 50.485 1.00 31.47  ? 61  TRP B CE3   1 
ATOM   1875 C CZ2   . TRP B 1 89  ? -12.383 30.328 50.486 1.00 39.80  ? 61  TRP B CZ2   1 
ATOM   1876 C CZ3   . TRP B 1 89  ? -10.763 32.067 50.049 1.00 37.74  ? 61  TRP B CZ3   1 
ATOM   1877 C CH2   . TRP B 1 89  ? -12.081 31.591 50.053 1.00 36.63  ? 61  TRP B CH2   1 
ATOM   1878 N N     . GLY B 1 90  ? -6.593  27.304 49.178 1.00 44.11  ? 62  GLY B N     1 
ATOM   1879 C CA    . GLY B 1 90  ? -6.765  26.760 47.844 1.00 45.35  ? 62  GLY B CA    1 
ATOM   1880 C C     . GLY B 1 90  ? -6.403  25.289 47.764 1.00 57.57  ? 62  GLY B C     1 
ATOM   1881 O O     . GLY B 1 90  ? -7.106  24.502 47.130 1.00 61.25  ? 62  GLY B O     1 
ATOM   1882 N N     . LEU B 1 91  ? -5.304  24.916 48.411 1.00 57.67  ? 63  LEU B N     1 
ATOM   1883 C CA    . LEU B 1 91  ? -4.852  23.529 48.413 1.00 54.29  ? 63  LEU B CA    1 
ATOM   1884 C C     . LEU B 1 91  ? -5.796  22.626 49.204 1.00 59.13  ? 63  LEU B C     1 
ATOM   1885 O O     . LEU B 1 91  ? -5.964  21.452 48.872 1.00 68.15  ? 63  LEU B O     1 
ATOM   1886 C CB    . LEU B 1 91  ? -3.429  23.422 48.967 1.00 49.62  ? 63  LEU B CB    1 
ATOM   1887 C CG    . LEU B 1 91  ? -2.307  24.027 48.121 1.00 47.64  ? 63  LEU B CG    1 
ATOM   1888 C CD1   . LEU B 1 91  ? -0.971  23.885 48.831 1.00 44.33  ? 63  LEU B CD1   1 
ATOM   1889 C CD2   . LEU B 1 91  ? -2.255  23.380 46.743 1.00 49.08  ? 63  LEU B CD2   1 
ATOM   1890 N N     . LEU B 1 92  ? -6.412  23.179 50.246 1.00 55.38  ? 64  LEU B N     1 
ATOM   1891 C CA    . LEU B 1 92  ? -7.336  22.421 51.087 1.00 53.32  ? 64  LEU B CA    1 
ATOM   1892 C C     . LEU B 1 92  ? -8.564  21.940 50.318 1.00 58.02  ? 64  LEU B C     1 
ATOM   1893 O O     . LEU B 1 92  ? -9.241  21.004 50.744 1.00 61.50  ? 64  LEU B O     1 
ATOM   1894 C CB    . LEU B 1 92  ? -7.771  23.245 52.304 1.00 51.72  ? 64  LEU B CB    1 
ATOM   1895 C CG    . LEU B 1 92  ? -6.790  23.361 53.475 1.00 48.09  ? 64  LEU B CG    1 
ATOM   1896 C CD1   . LEU B 1 92  ? -7.380  24.218 54.583 1.00 37.38  ? 64  LEU B CD1   1 
ATOM   1897 C CD2   . LEU B 1 92  ? -6.411  21.987 54.004 1.00 39.06  ? 64  LEU B CD2   1 
ATOM   1898 N N     . HIS B 1 93  ? -8.849  22.584 49.190 1.00 61.97  ? 65  HIS B N     1 
ATOM   1899 C CA    . HIS B 1 93  ? -9.967  22.184 48.340 1.00 64.33  ? 65  HIS B CA    1 
ATOM   1900 C C     . HIS B 1 93  ? -9.759  20.782 47.770 1.00 62.77  ? 65  HIS B C     1 
ATOM   1901 O O     . HIS B 1 93  ? -10.720 20.040 47.561 1.00 58.95  ? 65  HIS B O     1 
ATOM   1902 C CB    . HIS B 1 93  ? -10.176 23.191 47.205 1.00 60.40  ? 65  HIS B CB    1 
ATOM   1903 C CG    . HIS B 1 93  ? -10.803 24.477 47.645 1.00 61.71  ? 65  HIS B CG    1 
ATOM   1904 N ND1   . HIS B 1 93  ? -10.099 25.464 48.305 1.00 63.43  ? 65  HIS B ND1   1 
ATOM   1905 C CD2   . HIS B 1 93  ? -12.069 24.940 47.522 1.00 58.40  ? 65  HIS B CD2   1 
ATOM   1906 C CE1   . HIS B 1 93  ? -10.904 26.476 48.566 1.00 57.05  ? 65  HIS B CE1   1 
ATOM   1907 N NE2   . HIS B 1 93  ? -12.107 26.184 48.102 1.00 51.55  ? 65  HIS B NE2   1 
ATOM   1908 N N     . PHE B 1 94  ? -8.502  20.425 47.522 1.00 57.21  ? 66  PHE B N     1 
ATOM   1909 C CA    . PHE B 1 94  ? -8.170  19.097 47.019 1.00 52.89  ? 66  PHE B CA    1 
ATOM   1910 C C     . PHE B 1 94  ? -8.303  18.049 48.119 1.00 59.68  ? 66  PHE B C     1 
ATOM   1911 O O     . PHE B 1 94  ? -8.891  16.988 47.911 1.00 67.48  ? 66  PHE B O     1 
ATOM   1912 C CB    . PHE B 1 94  ? -6.749  19.070 46.452 1.00 44.98  ? 66  PHE B CB    1 
ATOM   1913 C CG    . PHE B 1 94  ? -6.561  19.934 45.237 1.00 49.21  ? 66  PHE B CG    1 
ATOM   1914 C CD1   . PHE B 1 94  ? -7.093  19.557 44.013 1.00 45.94  ? 66  PHE B CD1   1 
ATOM   1915 C CD2   . PHE B 1 94  ? -5.839  21.114 45.313 1.00 54.33  ? 66  PHE B CD2   1 
ATOM   1916 C CE1   . PHE B 1 94  ? -6.918  20.347 42.891 1.00 50.89  ? 66  PHE B CE1   1 
ATOM   1917 C CE2   . PHE B 1 94  ? -5.659  21.909 44.193 1.00 55.36  ? 66  PHE B CE2   1 
ATOM   1918 C CZ    . PHE B 1 94  ? -6.199  21.524 42.981 1.00 53.83  ? 66  PHE B CZ    1 
ATOM   1919 N N     . LEU B 1 95  ? -7.753  18.358 49.289 1.00 59.30  ? 67  LEU B N     1 
ATOM   1920 C CA    . LEU B 1 95  ? -7.765  17.434 50.419 1.00 64.86  ? 67  LEU B CA    1 
ATOM   1921 C C     . LEU B 1 95  ? -9.178  17.150 50.923 1.00 67.77  ? 67  LEU B C     1 
ATOM   1922 O O     . LEU B 1 95  ? -9.477  16.038 51.360 1.00 80.65  ? 67  LEU B O     1 
ATOM   1923 C CB    . LEU B 1 95  ? -6.899  17.969 51.565 1.00 66.98  ? 67  LEU B CB    1 
ATOM   1924 C CG    . LEU B 1 95  ? -5.389  17.714 51.521 1.00 74.26  ? 67  LEU B CG    1 
ATOM   1925 C CD1   . LEU B 1 95  ? -4.718  18.419 50.349 1.00 68.82  ? 67  LEU B CD1   1 
ATOM   1926 C CD2   . LEU B 1 95  ? -4.748  18.133 52.835 1.00 81.43  ? 67  LEU B CD2   1 
ATOM   1927 N N     . THR B 1 96  ? -10.044 18.156 50.862 1.00 59.40  ? 68  THR B N     1 
ATOM   1928 C CA    . THR B 1 96  ? -11.415 18.013 51.340 1.00 58.96  ? 68  THR B CA    1 
ATOM   1929 C C     . THR B 1 96  ? -12.381 17.657 50.213 1.00 61.30  ? 68  THR B C     1 
ATOM   1930 O O     . THR B 1 96  ? -13.585 17.536 50.434 1.00 63.20  ? 68  THR B O     1 
ATOM   1931 C CB    . THR B 1 96  ? -11.906 19.293 52.042 1.00 55.44  ? 68  THR B CB    1 
ATOM   1932 O OG1   . THR B 1 96  ? -11.788 20.406 51.146 1.00 50.42  ? 68  THR B OG1   1 
ATOM   1933 C CG2   . THR B 1 96  ? -11.083 19.563 53.295 1.00 43.10  ? 68  THR B CG2   1 
ATOM   1934 N N     . GLY B 1 97  ? -11.845 17.494 49.007 1.00 60.76  ? 69  GLY B N     1 
ATOM   1935 C CA    . GLY B 1 97  ? -12.648 17.127 47.853 1.00 61.11  ? 69  GLY B CA    1 
ATOM   1936 C C     . GLY B 1 97  ? -13.691 18.163 47.478 1.00 61.54  ? 69  GLY B C     1 
ATOM   1937 O O     . GLY B 1 97  ? -14.749 17.825 46.950 1.00 64.42  ? 69  GLY B O     1 
ATOM   1938 N N     . LYS B 1 98  ? -13.390 19.429 47.747 1.00 65.13  ? 70  LYS B N     1 
ATOM   1939 C CA    . LYS B 1 98  ? -14.318 20.516 47.456 1.00 66.99  ? 70  LYS B CA    1 
ATOM   1940 C C     . LYS B 1 98  ? -13.951 21.196 46.138 1.00 64.90  ? 70  LYS B C     1 
ATOM   1941 O O     . LYS B 1 98  ? -14.616 22.136 45.701 1.00 59.36  ? 70  LYS B O     1 
ATOM   1942 C CB    . LYS B 1 98  ? -14.313 21.535 48.599 1.00 66.96  ? 70  LYS B CB    1 
ATOM   1943 C CG    . LYS B 1 98  ? -15.570 22.388 48.695 1.00 66.95  ? 70  LYS B CG    1 
ATOM   1944 C CD    . LYS B 1 98  ? -16.775 21.555 49.100 1.00 70.89  ? 70  LYS B CD    1 
ATOM   1945 C CE    . LYS B 1 98  ? -18.020 22.417 49.239 1.00 78.19  ? 70  LYS B CE    1 
ATOM   1946 N NZ    . LYS B 1 98  ? -18.395 23.063 47.951 1.00 82.71  ? 70  LYS B NZ    1 
ATOM   1947 N N     . ALA B 1 99  ? -12.888 20.711 45.505 1.00 60.59  ? 71  ALA B N     1 
ATOM   1948 C CA    . ALA B 1 99  ? -12.415 21.290 44.253 1.00 55.61  ? 71  ALA B CA    1 
ATOM   1949 C C     . ALA B 1 99  ? -13.121 20.688 43.042 1.00 65.13  ? 71  ALA B C     1 
ATOM   1950 O O     . ALA B 1 99  ? -13.067 19.479 42.817 1.00 70.36  ? 71  ALA B O     1 
ATOM   1951 C CB    . ALA B 1 99  ? -10.909 21.119 44.128 1.00 53.52  ? 71  ALA B CB    1 
ATOM   1952 N N     . TYR B 1 100 ? -13.784 21.540 42.267 1.00 64.41  ? 72  TYR B N     1 
ATOM   1953 C CA    . TYR B 1 100 ? -14.427 21.110 41.031 1.00 57.32  ? 72  TYR B CA    1 
ATOM   1954 C C     . TYR B 1 100 ? -13.395 21.055 39.912 1.00 55.53  ? 72  TYR B C     1 
ATOM   1955 O O     . TYR B 1 100 ? -13.006 22.087 39.366 1.00 55.33  ? 72  TYR B O     1 
ATOM   1956 C CB    . TYR B 1 100 ? -15.564 22.063 40.656 1.00 54.44  ? 72  TYR B CB    1 
ATOM   1957 N N     . ILE B 1 101 ? -12.956 19.846 39.577 1.00 58.55  ? 73  ILE B N     1 
ATOM   1958 C CA    . ILE B 1 101 ? -11.886 19.662 38.602 1.00 45.16  ? 73  ILE B CA    1 
ATOM   1959 C C     . ILE B 1 101 ? -12.405 19.231 37.234 1.00 50.40  ? 73  ILE B C     1 
ATOM   1960 O O     . ILE B 1 101 ? -12.873 18.105 37.065 1.00 54.95  ? 73  ILE B O     1 
ATOM   1961 C CB    . ILE B 1 101 ? -10.857 18.626 39.092 1.00 45.73  ? 73  ILE B CB    1 
ATOM   1962 C CG1   . ILE B 1 101 ? -10.347 18.998 40.486 1.00 44.23  ? 73  ILE B CG1   1 
ATOM   1963 C CG2   . ILE B 1 101 ? -9.704  18.514 38.107 1.00 45.94  ? 73  ILE B CG2   1 
ATOM   1964 C CD1   . ILE B 1 101 ? -9.399  17.978 41.082 1.00 44.91  ? 73  ILE B CD1   1 
ATOM   1965 N N     . LEU B 1 102 ? -12.320 20.133 36.261 1.00 53.41  ? 74  LEU B N     1 
ATOM   1966 C CA    . LEU B 1 102 ? -12.682 19.811 34.886 1.00 63.64  ? 74  LEU B CA    1 
ATOM   1967 C C     . LEU B 1 102 ? -11.470 19.244 34.156 1.00 67.90  ? 74  LEU B C     1 
ATOM   1968 O O     . LEU B 1 102 ? -11.536 18.178 33.546 1.00 69.08  ? 74  LEU B O     1 
ATOM   1969 C CB    . LEU B 1 102 ? -13.193 21.056 34.157 1.00 58.87  ? 74  LEU B CB    1 
ATOM   1970 C CG    . LEU B 1 102 ? -14.496 21.680 34.661 1.00 59.37  ? 74  LEU B CG    1 
ATOM   1971 C CD1   . LEU B 1 102 ? -14.898 22.855 33.782 1.00 61.51  ? 74  LEU B CD1   1 
ATOM   1972 C CD2   . LEU B 1 102 ? -15.607 20.643 34.712 1.00 49.13  ? 74  LEU B CD2   1 
ATOM   1973 N N     . MET B 1 103 ? -10.365 19.977 34.227 1.00 65.81  ? 75  MET B N     1 
ATOM   1974 C CA    . MET B 1 103 ? -9.102  19.558 33.638 1.00 59.75  ? 75  MET B CA    1 
ATOM   1975 C C     . MET B 1 103 ? -7.982  19.808 34.642 1.00 64.71  ? 75  MET B C     1 
ATOM   1976 O O     . MET B 1 103 ? -8.117  20.662 35.519 1.00 60.32  ? 75  MET B O     1 
ATOM   1977 C CB    . MET B 1 103 ? -8.834  20.335 32.347 1.00 56.37  ? 75  MET B CB    1 
ATOM   1978 C CG    . MET B 1 103 ? -9.803  20.029 31.218 1.00 59.22  ? 75  MET B CG    1 
ATOM   1979 S SD    . MET B 1 103 ? -9.450  20.991 29.735 1.00 98.60  ? 75  MET B SD    1 
ATOM   1980 C CE    . MET B 1 103 ? -7.747  20.530 29.429 1.00 125.65 ? 75  MET B CE    1 
ATOM   1981 N N     . PRO B 1 104 ? -6.877  19.055 34.530 1.00 70.14  ? 76  PRO B N     1 
ATOM   1982 C CA    . PRO B 1 104 ? -5.730  19.274 35.418 1.00 64.81  ? 76  PRO B CA    1 
ATOM   1983 C C     . PRO B 1 104 ? -5.204  20.707 35.342 1.00 53.85  ? 76  PRO B C     1 
ATOM   1984 O O     . PRO B 1 104 ? -4.736  21.242 36.347 1.00 50.17  ? 76  PRO B O     1 
ATOM   1985 C CB    . PRO B 1 104 ? -4.683  18.297 34.877 1.00 59.87  ? 76  PRO B CB    1 
ATOM   1986 C CG    . PRO B 1 104 ? -5.486  17.200 34.270 1.00 61.01  ? 76  PRO B CG    1 
ATOM   1987 C CD    . PRO B 1 104 ? -6.690  17.871 33.671 1.00 66.17  ? 76  PRO B CD    1 
ATOM   1988 N N     . SER B 1 105 ? -5.294  21.321 34.167 1.00 51.28  ? 77  SER B N     1 
ATOM   1989 C CA    . SER B 1 105 ? -4.783  22.673 33.975 1.00 48.30  ? 77  SER B CA    1 
ATOM   1990 C C     . SER B 1 105 ? -5.686  23.740 34.593 1.00 54.16  ? 77  SER B C     1 
ATOM   1991 O O     . SER B 1 105 ? -5.208  24.795 35.005 1.00 58.36  ? 77  SER B O     1 
ATOM   1992 C CB    . SER B 1 105 ? -4.551  22.960 32.489 1.00 54.93  ? 77  SER B CB    1 
ATOM   1993 O OG    . SER B 1 105 ? -5.729  22.744 31.734 1.00 73.71  ? 77  SER B OG    1 
ATOM   1994 N N     . GLN B 1 106 ? -6.986  23.471 34.662 1.00 52.34  ? 78  GLN B N     1 
ATOM   1995 C CA    . GLN B 1 106 ? -7.914  24.432 35.257 1.00 48.71  ? 78  GLN B CA    1 
ATOM   1996 C C     . GLN B 1 106 ? -7.921  24.336 36.781 1.00 46.94  ? 78  GLN B C     1 
ATOM   1997 O O     . GLN B 1 106 ? -8.137  25.332 37.471 1.00 48.31  ? 78  GLN B O     1 
ATOM   1998 C CB    . GLN B 1 106 ? -9.330  24.284 34.680 1.00 45.01  ? 78  GLN B CB    1 
ATOM   1999 C CG    . GLN B 1 106 ? -10.118 23.081 35.169 1.00 54.06  ? 78  GLN B CG    1 
ATOM   2000 C CD    . GLN B 1 106 ? -10.883 23.356 36.449 1.00 56.81  ? 78  GLN B CD    1 
ATOM   2001 O OE1   . GLN B 1 106 ? -11.033 22.477 37.295 1.00 63.31  ? 78  GLN B OE1   1 
ATOM   2002 N NE2   . GLN B 1 106 ? -11.373 24.582 36.596 1.00 52.53  ? 78  GLN B NE2   1 
ATOM   2003 N N     . ALA B 1 107 ? -7.688  23.134 37.302 1.00 46.04  ? 79  ALA B N     1 
ATOM   2004 C CA    . ALA B 1 107 ? -7.585  22.936 38.742 1.00 43.63  ? 79  ALA B CA    1 
ATOM   2005 C C     . ALA B 1 107 ? -6.375  23.698 39.259 1.00 43.62  ? 79  ALA B C     1 
ATOM   2006 O O     . ALA B 1 107 ? -6.402  24.272 40.348 1.00 41.62  ? 79  ALA B O     1 
ATOM   2007 C CB    . ALA B 1 107 ? -7.461  21.459 39.068 1.00 46.76  ? 79  ALA B CB    1 
ATOM   2008 N N     . ILE B 1 108 ? -5.317  23.697 38.456 1.00 48.94  ? 80  ILE B N     1 
ATOM   2009 C CA    . ILE B 1 108 ? -4.105  24.449 38.749 1.00 50.12  ? 80  ILE B CA    1 
ATOM   2010 C C     . ILE B 1 108 ? -4.392  25.948 38.798 1.00 51.26  ? 80  ILE B C     1 
ATOM   2011 O O     . ILE B 1 108 ? -4.061  26.622 39.772 1.00 51.53  ? 80  ILE B O     1 
ATOM   2012 C CB    . ILE B 1 108 ? -3.016  24.159 37.693 1.00 53.59  ? 80  ILE B CB    1 
ATOM   2013 C CG1   . ILE B 1 108 ? -2.354  22.808 37.966 1.00 48.47  ? 80  ILE B CG1   1 
ATOM   2014 C CG2   . ILE B 1 108 ? -1.968  25.255 37.672 1.00 57.57  ? 80  ILE B CG2   1 
ATOM   2015 C CD1   . ILE B 1 108 ? -1.268  22.454 36.976 1.00 50.02  ? 80  ILE B CD1   1 
ATOM   2016 N N     . ILE B 1 109 ? -5.023  26.461 37.747 1.00 45.90  ? 81  ILE B N     1 
ATOM   2017 C CA    . ILE B 1 109 ? -5.312  27.887 37.641 1.00 44.70  ? 81  ILE B CA    1 
ATOM   2018 C C     . ILE B 1 109 ? -6.287  28.375 38.715 1.00 49.01  ? 81  ILE B C     1 
ATOM   2019 O O     . ILE B 1 109 ? -6.089  29.438 39.305 1.00 43.32  ? 81  ILE B O     1 
ATOM   2020 C CB    . ILE B 1 109 ? -5.865  28.239 36.241 1.00 46.25  ? 81  ILE B CB    1 
ATOM   2021 C CG1   . ILE B 1 109 ? -4.817  27.937 35.167 1.00 53.80  ? 81  ILE B CG1   1 
ATOM   2022 C CG2   . ILE B 1 109 ? -6.281  29.700 36.175 1.00 38.59  ? 81  ILE B CG2   1 
ATOM   2023 C CD1   . ILE B 1 109 ? -5.319  28.115 33.751 1.00 50.67  ? 81  ILE B CD1   1 
ATOM   2024 N N     . GLU B 1 110 ? -7.325  27.588 38.981 1.00 54.38  ? 82  GLU B N     1 
ATOM   2025 C CA    . GLU B 1 110 ? -8.410  28.034 39.854 1.00 51.95  ? 82  GLU B CA    1 
ATOM   2026 C C     . GLU B 1 110 ? -8.178  27.810 41.346 1.00 42.27  ? 82  GLU B C     1 
ATOM   2027 O O     . GLU B 1 110 ? -8.644  28.594 42.170 1.00 43.72  ? 82  GLU B O     1 
ATOM   2028 C CB    . GLU B 1 110 ? -9.736  27.396 39.437 1.00 54.71  ? 82  GLU B CB    1 
ATOM   2029 C CG    . GLU B 1 110 ? -10.160 27.741 38.025 1.00 53.75  ? 82  GLU B CG    1 
ATOM   2030 C CD    . GLU B 1 110 ? -11.658 27.907 37.891 1.00 47.30  ? 82  GLU B CD    1 
ATOM   2031 O OE1   . GLU B 1 110 ? -12.326 26.960 37.427 1.00 46.63  ? 82  GLU B OE1   1 
ATOM   2032 O OE2   . GLU B 1 110 ? -12.167 28.990 38.248 1.00 45.50  ? 82  GLU B OE2   1 
ATOM   2033 N N     . TYR B 1 111 ? -7.469  26.744 41.699 1.00 38.39  ? 83  TYR B N     1 
ATOM   2034 C CA    . TYR B 1 111 ? -7.296  26.408 43.109 1.00 42.92  ? 83  TYR B CA    1 
ATOM   2035 C C     . TYR B 1 111 ? -5.880  26.643 43.625 1.00 40.31  ? 83  TYR B C     1 
ATOM   2036 O O     . TYR B 1 111 ? -5.587  26.390 44.793 1.00 38.85  ? 83  TYR B O     1 
ATOM   2037 C CB    . TYR B 1 111 ? -7.756  24.974 43.386 1.00 49.23  ? 83  TYR B CB    1 
ATOM   2038 C CG    . TYR B 1 111 ? -9.251  24.801 43.242 1.00 53.82  ? 83  TYR B CG    1 
ATOM   2039 C CD1   . TYR B 1 111 ? -10.118 25.268 44.219 1.00 56.29  ? 83  TYR B CD1   1 
ATOM   2040 C CD2   . TYR B 1 111 ? -9.796  24.182 42.124 1.00 55.16  ? 83  TYR B CD2   1 
ATOM   2041 C CE1   . TYR B 1 111 ? -11.484 25.121 44.092 1.00 67.95  ? 83  TYR B CE1   1 
ATOM   2042 C CE2   . TYR B 1 111 ? -11.163 24.029 41.988 1.00 56.83  ? 83  TYR B CE2   1 
ATOM   2043 C CZ    . TYR B 1 111 ? -12.003 24.502 42.975 1.00 68.20  ? 83  TYR B CZ    1 
ATOM   2044 O OH    . TYR B 1 111 ? -13.365 24.354 42.851 1.00 75.44  ? 83  TYR B OH    1 
ATOM   2045 N N     . ILE B 1 112 ? -5.005  27.135 42.756 1.00 47.20  ? 84  ILE B N     1 
ATOM   2046 C CA    . ILE B 1 112 ? -3.648  27.470 43.167 1.00 49.25  ? 84  ILE B CA    1 
ATOM   2047 C C     . ILE B 1 112 ? -3.283  28.903 42.783 1.00 52.71  ? 84  ILE B C     1 
ATOM   2048 O O     . ILE B 1 112 ? -2.900  29.698 43.638 1.00 62.50  ? 84  ILE B O     1 
ATOM   2049 C CB    . ILE B 1 112 ? -2.609  26.492 42.585 1.00 43.66  ? 84  ILE B CB    1 
ATOM   2050 C CG1   . ILE B 1 112 ? -2.916  25.058 43.023 1.00 40.31  ? 84  ILE B CG1   1 
ATOM   2051 C CG2   . ILE B 1 112 ? -1.218  26.883 43.029 1.00 37.49  ? 84  ILE B CG2   1 
ATOM   2052 C CD1   . ILE B 1 112 ? -1.918  24.041 42.519 1.00 38.53  ? 84  ILE B CD1   1 
ATOM   2053 N N     . LEU B 1 113 ? -3.407  29.228 41.500 1.00 45.40  ? 85  LEU B N     1 
ATOM   2054 C CA    . LEU B 1 113 ? -3.098  30.573 41.021 1.00 50.79  ? 85  LEU B CA    1 
ATOM   2055 C C     . LEU B 1 113 ? -4.051  31.619 41.594 1.00 49.04  ? 85  LEU B C     1 
ATOM   2056 O O     . LEU B 1 113 ? -3.617  32.651 42.106 1.00 54.60  ? 85  LEU B O     1 
ATOM   2057 C CB    . LEU B 1 113 ? -3.127  30.627 39.490 1.00 54.43  ? 85  LEU B CB    1 
ATOM   2058 C CG    . LEU B 1 113 ? -1.922  30.055 38.741 1.00 58.24  ? 85  LEU B CG    1 
ATOM   2059 C CD1   . LEU B 1 113 ? -2.146  30.101 37.238 1.00 61.16  ? 85  LEU B CD1   1 
ATOM   2060 C CD2   . LEU B 1 113 ? -0.662  30.812 39.114 1.00 58.92  ? 85  LEU B CD2   1 
ATOM   2061 N N     . ALA B 1 114 ? -5.348  31.343 41.505 1.00 44.05  ? 86  ALA B N     1 
ATOM   2062 C CA    . ALA B 1 114 ? -6.369  32.289 41.941 1.00 42.19  ? 86  ALA B CA    1 
ATOM   2063 C C     . ALA B 1 114 ? -6.310  32.560 43.442 1.00 40.72  ? 86  ALA B C     1 
ATOM   2064 O O     . ALA B 1 114 ? -6.423  33.705 43.879 1.00 41.52  ? 86  ALA B O     1 
ATOM   2065 C CB    . ALA B 1 114 ? -7.751  31.793 41.544 1.00 31.30  ? 86  ALA B CB    1 
ATOM   2066 N N     . PHE B 1 115 ? -6.128  31.503 44.226 1.00 43.98  ? 87  PHE B N     1 
ATOM   2067 C CA    . PHE B 1 115 ? -6.079  31.626 45.679 1.00 46.97  ? 87  PHE B CA    1 
ATOM   2068 C C     . PHE B 1 115 ? -4.753  32.205 46.173 1.00 53.36  ? 87  PHE B C     1 
ATOM   2069 O O     . PHE B 1 115 ? -4.661  32.683 47.303 1.00 54.32  ? 87  PHE B O     1 
ATOM   2070 C CB    . PHE B 1 115 ? -6.353  30.274 46.341 1.00 45.92  ? 87  PHE B CB    1 
ATOM   2071 C CG    . PHE B 1 115 ? -7.802  29.876 46.325 1.00 45.82  ? 87  PHE B CG    1 
ATOM   2072 C CD1   . PHE B 1 115 ? -8.384  29.371 45.175 1.00 51.27  ? 87  PHE B CD1   1 
ATOM   2073 C CD2   . PHE B 1 115 ? -8.581  30.004 47.463 1.00 42.10  ? 87  PHE B CD2   1 
ATOM   2074 C CE1   . PHE B 1 115 ? -9.717  29.003 45.157 1.00 47.29  ? 87  PHE B CE1   1 
ATOM   2075 C CE2   . PHE B 1 115 ? -9.916  29.637 47.452 1.00 41.73  ? 87  PHE B CE2   1 
ATOM   2076 C CZ    . PHE B 1 115 ? -10.484 29.137 46.299 1.00 43.79  ? 87  PHE B CZ    1 
ATOM   2077 N N     . SER B 1 116 ? -3.729  32.159 45.328 1.00 56.77  ? 88  SER B N     1 
ATOM   2078 C CA    . SER B 1 116 ? -2.436  32.735 45.680 1.00 51.53  ? 88  SER B CA    1 
ATOM   2079 C C     . SER B 1 116 ? -2.471  34.254 45.570 1.00 49.81  ? 88  SER B C     1 
ATOM   2080 O O     . SER B 1 116 ? -1.743  34.954 46.274 1.00 54.22  ? 88  SER B O     1 
ATOM   2081 C CB    . SER B 1 116 ? -1.328  32.172 44.788 1.00 49.58  ? 88  SER B CB    1 
ATOM   2082 O OG    . SER B 1 116 ? -1.118  30.794 45.043 1.00 48.88  ? 88  SER B OG    1 
ATOM   2083 N N     . PHE B 1 117 ? -3.327  34.758 44.687 1.00 47.69  ? 89  PHE B N     1 
ATOM   2084 C CA    . PHE B 1 117 ? -3.430  36.195 44.457 1.00 49.73  ? 89  PHE B CA    1 
ATOM   2085 C C     . PHE B 1 117 ? -4.347  36.892 45.459 1.00 44.59  ? 89  PHE B C     1 
ATOM   2086 O O     . PHE B 1 117 ? -4.706  38.054 45.282 1.00 38.95  ? 89  PHE B O     1 
ATOM   2087 C CB    . PHE B 1 117 ? -3.867  36.483 43.019 1.00 47.25  ? 89  PHE B CB    1 
ATOM   2088 C CG    . PHE B 1 117 ? -2.725  36.546 42.046 1.00 45.61  ? 89  PHE B CG    1 
ATOM   2089 C CD1   . PHE B 1 117 ? -1.975  35.416 41.765 1.00 44.04  ? 89  PHE B CD1   1 
ATOM   2090 C CD2   . PHE B 1 117 ? -2.398  37.736 41.417 1.00 44.25  ? 89  PHE B CD2   1 
ATOM   2091 C CE1   . PHE B 1 117 ? -0.920  35.471 40.873 1.00 42.50  ? 89  PHE B CE1   1 
ATOM   2092 C CE2   . PHE B 1 117 ? -1.346  37.797 40.524 1.00 45.33  ? 89  PHE B CE2   1 
ATOM   2093 C CZ    . PHE B 1 117 ? -0.606  36.663 40.253 1.00 44.48  ? 89  PHE B CZ    1 
ATOM   2094 N N     . ILE B 1 118 ? -4.709  36.177 46.520 1.00 48.03  ? 90  ILE B N     1 
ATOM   2095 C CA    . ILE B 1 118 ? -5.427  36.774 47.639 1.00 51.58  ? 90  ILE B CA    1 
ATOM   2096 C C     . ILE B 1 118 ? -4.432  37.615 48.445 1.00 49.04  ? 90  ILE B C     1 
ATOM   2097 O O     . ILE B 1 118 ? -4.811  38.376 49.334 1.00 46.96  ? 90  ILE B O     1 
ATOM   2098 C CB    . ILE B 1 118 ? -6.107  35.689 48.515 1.00 40.50  ? 90  ILE B CB    1 
ATOM   2099 C CG1   . ILE B 1 118 ? -6.997  34.796 47.649 1.00 32.64  ? 90  ILE B CG1   1 
ATOM   2100 C CG2   . ILE B 1 118 ? -6.951  36.307 49.624 1.00 34.47  ? 90  ILE B CG2   1 
ATOM   2101 C CD1   . ILE B 1 118 ? -7.724  33.722 48.426 1.00 33.44  ? 90  ILE B CD1   1 
ATOM   2102 N N     . ALA B 1 119 ? -3.153  37.483 48.102 1.00 53.43  ? 91  ALA B N     1 
ATOM   2103 C CA    . ALA B 1 119 ? -2.088  38.285 48.699 1.00 45.42  ? 91  ALA B CA    1 
ATOM   2104 C C     . ALA B 1 119 ? -2.365  39.777 48.562 1.00 42.05  ? 91  ALA B C     1 
ATOM   2105 O O     . ALA B 1 119 ? -2.032  40.563 49.448 1.00 52.33  ? 91  ALA B O     1 
ATOM   2106 C CB    . ALA B 1 119 ? -0.750  37.941 48.061 1.00 38.13  ? 91  ALA B CB    1 
ATOM   2107 N N     . PHE B 1 120 ? -2.988  40.160 47.452 1.00 42.66  ? 92  PHE B N     1 
ATOM   2108 C CA    . PHE B 1 120 ? -3.289  41.563 47.180 1.00 44.70  ? 92  PHE B CA    1 
ATOM   2109 C C     . PHE B 1 120 ? -4.412  42.113 48.052 1.00 45.55  ? 92  PHE B C     1 
ATOM   2110 O O     . PHE B 1 120 ? -4.792  43.276 47.924 1.00 57.04  ? 92  PHE B O     1 
ATOM   2111 C CB    . PHE B 1 120 ? -3.604  41.770 45.697 1.00 40.53  ? 92  PHE B CB    1 
ATOM   2112 C CG    . PHE B 1 120 ? -2.400  41.670 44.813 1.00 37.97  ? 92  PHE B CG    1 
ATOM   2113 C CD1   . PHE B 1 120 ? -1.957  40.440 44.360 1.00 41.38  ? 92  PHE B CD1   1 
ATOM   2114 C CD2   . PHE B 1 120 ? -1.698  42.806 44.450 1.00 35.71  ? 92  PHE B CD2   1 
ATOM   2115 C CE1   . PHE B 1 120 ? -0.841  40.345 43.554 1.00 46.01  ? 92  PHE B CE1   1 
ATOM   2116 C CE2   . PHE B 1 120 ? -0.583  42.718 43.644 1.00 37.64  ? 92  PHE B CE2   1 
ATOM   2117 C CZ    . PHE B 1 120 ? -0.154  41.486 43.197 1.00 36.67  ? 92  PHE B CZ    1 
ATOM   2118 N N     . SER B 1 121 ? -4.937  41.276 48.939 1.00 39.03  ? 93  SER B N     1 
ATOM   2119 C CA    . SER B 1 121 ? -5.896  41.735 49.932 1.00 42.65  ? 93  SER B CA    1 
ATOM   2120 C C     . SER B 1 121 ? -5.156  42.500 51.021 1.00 45.16  ? 93  SER B C     1 
ATOM   2121 O O     . SER B 1 121 ? -5.769  43.168 51.853 1.00 49.15  ? 93  SER B O     1 
ATOM   2122 C CB    . SER B 1 121 ? -6.649  40.555 50.543 1.00 42.55  ? 93  SER B CB    1 
ATOM   2123 O OG    . SER B 1 121 ? -7.158  39.699 49.536 1.00 42.11  ? 93  SER B OG    1 
ATOM   2124 N N     . GLY B 1 122 ? -3.830  42.399 51.004 1.00 46.00  ? 94  GLY B N     1 
ATOM   2125 C CA    . GLY B 1 122 ? -3.001  43.031 52.011 1.00 31.25  ? 94  GLY B CA    1 
ATOM   2126 C C     . GLY B 1 122 ? -2.120  44.152 51.492 1.00 36.84  ? 94  GLY B C     1 
ATOM   2127 O O     . GLY B 1 122 ? -1.124  44.500 52.122 1.00 37.92  ? 94  GLY B O     1 
ATOM   2128 N N     . VAL B 1 123 ? -2.483  44.723 50.348 1.00 45.47  ? 95  VAL B N     1 
ATOM   2129 C CA    . VAL B 1 123 ? -1.707  45.817 49.768 1.00 40.40  ? 95  VAL B CA    1 
ATOM   2130 C C     . VAL B 1 123 ? -1.819  47.089 50.600 1.00 45.19  ? 95  VAL B C     1 
ATOM   2131 O O     . VAL B 1 123 ? -0.940  47.947 50.552 1.00 53.90  ? 95  VAL B O     1 
ATOM   2132 C CB    . VAL B 1 123 ? -2.135  46.125 48.317 1.00 36.36  ? 95  VAL B CB    1 
ATOM   2133 C CG1   . VAL B 1 123 ? -1.737  44.987 47.394 1.00 34.65  ? 95  VAL B CG1   1 
ATOM   2134 C CG2   . VAL B 1 123 ? -3.633  46.386 48.242 1.00 39.19  ? 95  VAL B CG2   1 
ATOM   2135 N N     . PHE B 1 124 ? -2.904  47.206 51.360 1.00 54.07  ? 96  PHE B N     1 
ATOM   2136 C CA    . PHE B 1 124 ? -3.124  48.374 52.206 1.00 60.32  ? 96  PHE B CA    1 
ATOM   2137 C C     . PHE B 1 124 ? -3.276  47.981 53.677 1.00 56.45  ? 96  PHE B C     1 
ATOM   2138 O O     . PHE B 1 124 ? -3.969  48.657 54.436 1.00 54.32  ? 96  PHE B O     1 
ATOM   2139 C CB    . PHE B 1 124 ? -4.363  49.151 51.746 1.00 61.65  ? 96  PHE B CB    1 
ATOM   2140 C CG    . PHE B 1 124 ? -4.240  49.742 50.365 1.00 63.23  ? 96  PHE B CG    1 
ATOM   2141 C CD1   . PHE B 1 124 ? -3.012  50.151 49.872 1.00 63.64  ? 96  PHE B CD1   1 
ATOM   2142 C CD2   . PHE B 1 124 ? -5.361  49.891 49.562 1.00 59.57  ? 96  PHE B CD2   1 
ATOM   2143 C CE1   . PHE B 1 124 ? -2.903  50.694 48.601 1.00 58.76  ? 96  PHE B CE1   1 
ATOM   2144 C CE2   . PHE B 1 124 ? -5.259  50.434 48.292 1.00 49.88  ? 96  PHE B CE2   1 
ATOM   2145 C CZ    . PHE B 1 124 ? -4.029  50.836 47.812 1.00 49.39  ? 96  PHE B CZ    1 
ATOM   2146 N N     . SER B 1 125 ? -2.624  46.891 54.074 1.00 44.25  ? 97  SER B N     1 
ATOM   2147 C CA    . SER B 1 125 ? -2.714  46.398 55.447 1.00 44.31  ? 97  SER B CA    1 
ATOM   2148 C C     . SER B 1 125 ? -2.163  47.388 56.466 1.00 52.66  ? 97  SER B C     1 
ATOM   2149 O O     . SER B 1 125 ? -2.764  47.603 57.521 1.00 57.92  ? 97  SER B O     1 
ATOM   2150 C CB    . SER B 1 125 ? -1.996  45.055 55.590 1.00 47.62  ? 97  SER B CB    1 
ATOM   2151 O OG    . SER B 1 125 ? -2.725  44.023 54.954 1.00 50.86  ? 97  SER B OG    1 
ATOM   2152 N N     . LYS B 1 126 ? -1.016  47.983 56.149 1.00 48.47  ? 98  LYS B N     1 
ATOM   2153 C CA    . LYS B 1 126 ? -0.390  48.953 57.040 1.00 50.38  ? 98  LYS B CA    1 
ATOM   2154 C C     . LYS B 1 126 ? -1.322  50.131 57.308 1.00 49.23  ? 98  LYS B C     1 
ATOM   2155 O O     . LYS B 1 126 ? -1.497  50.538 58.453 1.00 51.01  ? 98  LYS B O     1 
ATOM   2156 C CB    . LYS B 1 126 ? 0.938   49.447 56.459 1.00 45.74  ? 98  LYS B CB    1 
ATOM   2157 N N     . GLN B 1 127 ? -1.926  50.658 56.248 1.00 49.93  ? 99  GLN B N     1 
ATOM   2158 C CA    . GLN B 1 127 ? -2.846  51.787 56.359 1.00 46.19  ? 99  GLN B CA    1 
ATOM   2159 C C     . GLN B 1 127 ? -4.048  51.483 57.252 1.00 48.69  ? 99  GLN B C     1 
ATOM   2160 O O     . GLN B 1 127 ? -4.465  52.324 58.050 1.00 51.94  ? 99  GLN B O     1 
ATOM   2161 C CB    . GLN B 1 127 ? -3.328  52.225 54.973 1.00 46.40  ? 99  GLN B CB    1 
ATOM   2162 C CG    . GLN B 1 127 ? -2.261  52.872 54.098 1.00 52.57  ? 99  GLN B CG    1 
ATOM   2163 C CD    . GLN B 1 127 ? -1.393  51.861 53.371 1.00 51.68  ? 99  GLN B CD    1 
ATOM   2164 O OE1   . GLN B 1 127 ? -1.366  50.680 53.717 1.00 48.23  ? 99  GLN B OE1   1 
ATOM   2165 N NE2   . GLN B 1 127 ? -0.680  52.323 52.349 1.00 58.21  ? 99  GLN B NE2   1 
ATOM   2166 N N     . VAL B 1 128 ? -4.604  50.283 57.113 1.00 48.50  ? 100 VAL B N     1 
ATOM   2167 C CA    . VAL B 1 128 ? -5.748  49.877 57.924 1.00 50.98  ? 100 VAL B CA    1 
ATOM   2168 C C     . VAL B 1 128 ? -5.366  49.808 59.398 1.00 57.51  ? 100 VAL B C     1 
ATOM   2169 O O     . VAL B 1 128 ? -6.025  50.412 60.246 1.00 53.83  ? 100 VAL B O     1 
ATOM   2170 C CB    . VAL B 1 128 ? -6.312  48.509 57.489 1.00 46.53  ? 100 VAL B CB    1 
ATOM   2171 C CG1   . VAL B 1 128 ? -7.464  48.103 58.394 1.00 36.92  ? 100 VAL B CG1   1 
ATOM   2172 C CG2   . VAL B 1 128 ? -6.765  48.553 56.039 1.00 40.97  ? 100 VAL B CG2   1 
ATOM   2173 N N     . ARG B 1 129 ? -4.295  49.075 59.692 1.00 57.47  ? 101 ARG B N     1 
ATOM   2174 C CA    . ARG B 1 129 ? -3.812  48.925 61.061 1.00 51.34  ? 101 ARG B CA    1 
ATOM   2175 C C     . ARG B 1 129 ? -3.360  50.251 61.673 1.00 54.46  ? 101 ARG B C     1 
ATOM   2176 O O     . ARG B 1 129 ? -3.585  50.501 62.858 1.00 49.37  ? 101 ARG B O     1 
ATOM   2177 C CB    . ARG B 1 129 ? -2.679  47.895 61.127 1.00 43.04  ? 101 ARG B CB    1 
ATOM   2178 C CG    . ARG B 1 129 ? -3.152  46.450 61.113 1.00 42.80  ? 101 ARG B CG    1 
ATOM   2179 C CD    . ARG B 1 129 ? -2.011  45.470 61.367 1.00 44.58  ? 101 ARG B CD    1 
ATOM   2180 N NE    . ARG B 1 129 ? -1.167  45.270 60.191 1.00 53.21  ? 101 ARG B NE    1 
ATOM   2181 C CZ    . ARG B 1 129 ? 0.004   45.867 59.995 1.00 57.08  ? 101 ARG B CZ    1 
ATOM   2182 N NH1   . ARG B 1 129 ? 0.700   45.620 58.893 1.00 53.75  ? 101 ARG B NH1   1 
ATOM   2183 N NH2   . ARG B 1 129 ? 0.482   46.709 60.901 1.00 64.14  ? 101 ARG B NH2   1 
ATOM   2184 N N     . SER B 1 130 ? -2.726  51.096 60.864 1.00 56.81  ? 102 SER B N     1 
ATOM   2185 C CA    . SER B 1 130 ? -2.244  52.391 61.337 1.00 64.04  ? 102 SER B CA    1 
ATOM   2186 C C     . SER B 1 130 ? -3.401  53.295 61.756 1.00 69.73  ? 102 SER B C     1 
ATOM   2187 O O     . SER B 1 130 ? -3.331  53.973 62.782 1.00 70.70  ? 102 SER B O     1 
ATOM   2188 C CB    . SER B 1 130 ? -1.395  53.080 60.265 1.00 44.94  ? 102 SER B CB    1 
ATOM   2189 O OG    . SER B 1 130 ? -0.845  54.292 60.750 1.00 84.74  ? 102 SER B OG    1 
ATOM   2190 N N     . ASN B 1 131 ? -4.464  53.298 60.959 1.00 70.97  ? 103 ASN B N     1 
ATOM   2191 C CA    . ASN B 1 131 ? -5.646  54.095 61.269 1.00 71.71  ? 103 ASN B CA    1 
ATOM   2192 C C     . ASN B 1 131 ? -6.487  53.485 62.386 1.00 63.81  ? 103 ASN B C     1 
ATOM   2193 O O     . ASN B 1 131 ? -7.081  54.204 63.189 1.00 62.03  ? 103 ASN B O     1 
ATOM   2194 C CB    . ASN B 1 131 ? -6.505  54.303 60.019 1.00 62.72  ? 103 ASN B CB    1 
ATOM   2195 C CG    . ASN B 1 131 ? -5.932  55.353 59.087 1.00 55.55  ? 103 ASN B CG    1 
ATOM   2196 O OD1   . ASN B 1 131 ? -6.217  56.542 59.226 1.00 52.87  ? 103 ASN B OD1   1 
ATOM   2197 N ND2   . ASN B 1 131 ? -5.122  54.918 58.129 1.00 53.46  ? 103 ASN B ND2   1 
ATOM   2198 N N     . LEU B 1 132 ? -6.534  52.157 62.430 1.00 60.18  ? 104 LEU B N     1 
ATOM   2199 C CA    . LEU B 1 132 ? -7.310  51.456 63.445 1.00 60.26  ? 104 LEU B CA    1 
ATOM   2200 C C     . LEU B 1 132 ? -6.706  51.674 64.828 1.00 69.17  ? 104 LEU B C     1 
ATOM   2201 O O     . LEU B 1 132 ? -7.427  51.836 65.813 1.00 71.88  ? 104 LEU B O     1 
ATOM   2202 C CB    . LEU B 1 132 ? -7.384  49.962 63.127 1.00 54.40  ? 104 LEU B CB    1 
ATOM   2203 C CG    . LEU B 1 132 ? -8.352  49.131 63.972 1.00 60.31  ? 104 LEU B CG    1 
ATOM   2204 C CD1   . LEU B 1 132 ? -9.784  49.593 63.753 1.00 57.29  ? 104 LEU B CD1   1 
ATOM   2205 C CD2   . LEU B 1 132 ? -8.209  47.648 63.664 1.00 62.79  ? 104 LEU B CD2   1 
ATOM   2206 N N     . ALA B 1 133 ? -5.378  51.682 64.893 1.00 70.97  ? 105 ALA B N     1 
ATOM   2207 C CA    . ALA B 1 133 ? -4.672  51.891 66.153 1.00 66.85  ? 105 ALA B CA    1 
ATOM   2208 C C     . ALA B 1 133 ? -4.769  53.344 66.609 1.00 67.42  ? 105 ALA B C     1 
ATOM   2209 O O     . ALA B 1 133 ? -4.757  53.630 67.806 1.00 69.81  ? 105 ALA B O     1 
ATOM   2210 C CB    . ALA B 1 133 ? -3.217  51.468 66.023 1.00 60.74  ? 105 ALA B CB    1 
ATOM   2211 N N     . ALA B 1 134 ? -4.868  54.258 65.649 1.00 64.30  ? 106 ALA B N     1 
ATOM   2212 C CA    . ALA B 1 134 ? -4.998  55.679 65.952 1.00 62.61  ? 106 ALA B CA    1 
ATOM   2213 C C     . ALA B 1 134 ? -6.456  56.049 66.200 1.00 71.64  ? 106 ALA B C     1 
ATOM   2214 O O     . ALA B 1 134 ? -6.800  57.229 66.292 1.00 76.44  ? 106 ALA B O     1 
ATOM   2215 C CB    . ALA B 1 134 ? -4.422  56.518 64.824 1.00 52.85  ? 106 ALA B CB    1 
ATOM   2216 N N     . ASN B 1 135 ? -7.302  55.026 66.301 1.00 76.17  ? 107 ASN B N     1 
ATOM   2217 C CA    . ASN B 1 135 ? -8.736  55.189 66.528 1.00 79.83  ? 107 ASN B CA    1 
ATOM   2218 C C     . ASN B 1 135 ? -9.437  55.978 65.421 1.00 79.28  ? 107 ASN B C     1 
ATOM   2219 O O     . ASN B 1 135 ? -10.487 56.581 65.641 1.00 87.09  ? 107 ASN B O     1 
ATOM   2220 C CB    . ASN B 1 135 ? -9.011  55.806 67.903 1.00 85.74  ? 107 ASN B CB    1 
ATOM   2221 C CG    . ASN B 1 135 ? -10.355 55.391 68.469 1.00 93.04  ? 107 ASN B CG    1 
ATOM   2222 O OD1   . ASN B 1 135 ? -10.466 54.367 69.143 1.00 92.60  ? 107 ASN B OD1   1 
ATOM   2223 N ND2   . ASN B 1 135 ? -11.384 56.184 68.195 1.00 98.17  ? 107 ASN B ND2   1 
ATOM   2224 N N     . GLN B 1 136 ? -8.845  55.965 64.231 1.00 70.91  ? 108 GLN B N     1 
ATOM   2225 C CA    . GLN B 1 136 ? -9.450  56.584 63.061 1.00 71.06  ? 108 GLN B CA    1 
ATOM   2226 C C     . GLN B 1 136 ? -10.260 55.529 62.317 1.00 63.83  ? 108 GLN B C     1 
ATOM   2227 O O     . GLN B 1 136 ? -9.847  55.051 61.260 1.00 55.87  ? 108 GLN B O     1 
ATOM   2228 C CB    . GLN B 1 136 ? -8.369  57.153 62.142 1.00 75.50  ? 108 GLN B CB    1 
ATOM   2229 C CG    . GLN B 1 136 ? -7.284  57.938 62.861 1.00 80.34  ? 108 GLN B CG    1 
ATOM   2230 C CD    . GLN B 1 136 ? -7.330  59.421 62.552 1.00 91.29  ? 108 GLN B CD    1 
ATOM   2231 O OE1   . GLN B 1 136 ? -8.374  59.959 62.182 1.00 94.33  ? 108 GLN B OE1   1 
ATOM   2232 N NE2   . GLN B 1 136 ? -6.191  60.090 62.697 1.00 94.33  ? 108 GLN B NE2   1 
ATOM   2233 N N     . LEU B 1 137 ? -11.410 55.167 62.878 1.00 65.13  ? 109 LEU B N     1 
ATOM   2234 C CA    . LEU B 1 137 ? -12.208 54.058 62.362 1.00 67.95  ? 109 LEU B CA    1 
ATOM   2235 C C     . LEU B 1 137 ? -12.715 54.273 60.939 1.00 66.84  ? 109 LEU B C     1 
ATOM   2236 O O     . LEU B 1 137 ? -12.700 53.349 60.127 1.00 59.87  ? 109 LEU B O     1 
ATOM   2237 C CB    . LEU B 1 137 ? -13.387 53.764 63.291 1.00 63.11  ? 109 LEU B CB    1 
ATOM   2238 C CG    . LEU B 1 137 ? -14.276 52.604 62.846 1.00 53.16  ? 109 LEU B CG    1 
ATOM   2239 C CD1   . LEU B 1 137 ? -13.463 51.322 62.740 1.00 46.85  ? 109 LEU B CD1   1 
ATOM   2240 C CD2   . LEU B 1 137 ? -15.440 52.430 63.799 1.00 46.10  ? 109 LEU B CD2   1 
ATOM   2241 N N     . LYS B 1 138 ? -13.168 55.487 60.642 1.00 66.43  ? 110 LYS B N     1 
ATOM   2242 C CA    . LYS B 1 138 ? -13.685 55.794 59.313 1.00 57.74  ? 110 LYS B CA    1 
ATOM   2243 C C     . LYS B 1 138 ? -12.622 55.587 58.237 1.00 55.94  ? 110 LYS B C     1 
ATOM   2244 O O     . LYS B 1 138 ? -12.874 54.929 57.228 1.00 55.05  ? 110 LYS B O     1 
ATOM   2245 C CB    . LYS B 1 138 ? -14.225 57.223 59.249 1.00 51.45  ? 110 LYS B CB    1 
ATOM   2246 C CG    . LYS B 1 138 ? -14.795 57.596 57.888 1.00 49.92  ? 110 LYS B CG    1 
ATOM   2247 C CD    . LYS B 1 138 ? -15.208 59.056 57.831 1.00 64.06  ? 110 LYS B CD    1 
ATOM   2248 C CE    . LYS B 1 138 ? -15.695 59.432 56.441 1.00 73.81  ? 110 LYS B CE    1 
ATOM   2249 N NZ    . LYS B 1 138 ? -16.014 60.882 56.332 1.00 86.89  ? 110 LYS B NZ    1 
ATOM   2250 N N     . LYS B 1 139 ? -11.435 56.144 58.461 1.00 54.55  ? 111 LYS B N     1 
ATOM   2251 C CA    . LYS B 1 139 ? -10.336 56.001 57.513 1.00 57.96  ? 111 LYS B CA    1 
ATOM   2252 C C     . LYS B 1 139 ? -9.845  54.558 57.427 1.00 53.85  ? 111 LYS B C     1 
ATOM   2253 O O     . LYS B 1 139 ? -9.414  54.104 56.368 1.00 51.96  ? 111 LYS B O     1 
ATOM   2254 C CB    . LYS B 1 139 ? -9.172  56.927 57.877 1.00 67.00  ? 111 LYS B CB    1 
ATOM   2255 C CG    . LYS B 1 139 ? -9.465  58.408 57.700 1.00 81.98  ? 111 LYS B CG    1 
ATOM   2256 C CD    . LYS B 1 139 ? -8.209  59.161 57.282 1.00 92.49  ? 111 LYS B CD    1 
ATOM   2257 C CE    . LYS B 1 139 ? -8.429  60.665 57.265 1.00 95.42  ? 111 LYS B CE    1 
ATOM   2258 N NZ    . LYS B 1 139 ? -8.563  61.224 58.640 1.00 95.66  ? 111 LYS B NZ    1 
ATOM   2259 N N     . ALA B 1 140 ? -9.911  53.844 58.547 1.00 51.80  ? 112 ALA B N     1 
ATOM   2260 C CA    . ALA B 1 140 ? -9.486  52.450 58.589 1.00 46.18  ? 112 ALA B CA    1 
ATOM   2261 C C     . ALA B 1 140 ? -10.375 51.590 57.699 1.00 42.94  ? 112 ALA B C     1 
ATOM   2262 O O     . ALA B 1 140 ? -9.892  50.710 56.987 1.00 43.09  ? 112 ALA B O     1 
ATOM   2263 C CB    . ALA B 1 140 ? -9.503  51.932 60.019 1.00 41.09  ? 112 ALA B CB    1 
ATOM   2264 N N     . ILE B 1 141 ? -11.676 51.858 57.742 1.00 46.84  ? 113 ILE B N     1 
ATOM   2265 C CA    . ILE B 1 141 ? -12.647 51.129 56.933 1.00 49.12  ? 113 ILE B CA    1 
ATOM   2266 C C     . ILE B 1 141 ? -12.491 51.468 55.449 1.00 53.77  ? 113 ILE B C     1 
ATOM   2267 O O     . ILE B 1 141 ? -12.636 50.602 54.585 1.00 58.55  ? 113 ILE B O     1 
ATOM   2268 C CB    . ILE B 1 141 ? -14.091 51.413 57.410 1.00 53.09  ? 113 ILE B CB    1 
ATOM   2269 C CG1   . ILE B 1 141 ? -14.280 50.904 58.841 1.00 55.04  ? 113 ILE B CG1   1 
ATOM   2270 C CG2   . ILE B 1 141 ? -15.110 50.763 56.488 1.00 57.08  ? 113 ILE B CG2   1 
ATOM   2271 C CD1   . ILE B 1 141 ? -15.650 51.178 59.417 1.00 40.43  ? 113 ILE B CD1   1 
ATOM   2272 N N     . GLU B 1 142 ? -12.176 52.728 55.162 1.00 44.78  ? 114 GLU B N     1 
ATOM   2273 C CA    . GLU B 1 142 ? -11.972 53.177 53.788 1.00 42.82  ? 114 GLU B CA    1 
ATOM   2274 C C     . GLU B 1 142 ? -10.782 52.483 53.129 1.00 51.52  ? 114 GLU B C     1 
ATOM   2275 O O     . GLU B 1 142 ? -10.861 52.064 51.973 1.00 59.23  ? 114 GLU B O     1 
ATOM   2276 C CB    . GLU B 1 142 ? -11.795 54.695 53.737 1.00 51.37  ? 114 GLU B CB    1 
ATOM   2277 C CG    . GLU B 1 142 ? -13.043 55.471 54.117 1.00 53.90  ? 114 GLU B CG    1 
ATOM   2278 C CD    . GLU B 1 142 ? -12.848 56.969 54.025 1.00 56.50  ? 114 GLU B CD    1 
ATOM   2279 O OE1   . GLU B 1 142 ? -11.717 57.404 53.727 1.00 62.71  ? 114 GLU B OE1   1 
ATOM   2280 O OE2   . GLU B 1 142 ? -13.828 57.709 54.248 1.00 62.73  ? 114 GLU B OE2   1 
ATOM   2281 N N     . TRP B 1 143 ? -9.680  52.370 53.864 1.00 50.15  ? 115 TRP B N     1 
ATOM   2282 C CA    . TRP B 1 143 ? -8.519  51.634 53.381 1.00 49.58  ? 115 TRP B CA    1 
ATOM   2283 C C     . TRP B 1 143 ? -8.848  50.150 53.266 1.00 48.15  ? 115 TRP B C     1 
ATOM   2284 O O     . TRP B 1 143 ? -8.401  49.474 52.338 1.00 47.57  ? 115 TRP B O     1 
ATOM   2285 C CB    . TRP B 1 143 ? -7.321  51.824 54.314 1.00 56.73  ? 115 TRP B CB    1 
ATOM   2286 C CG    . TRP B 1 143 ? -6.612  53.134 54.153 1.00 58.50  ? 115 TRP B CG    1 
ATOM   2287 C CD1   . TRP B 1 143 ? -6.615  54.182 55.027 1.00 61.22  ? 115 TRP B CD1   1 
ATOM   2288 C CD2   . TRP B 1 143 ? -5.790  53.535 53.049 1.00 54.12  ? 115 TRP B CD2   1 
ATOM   2289 N NE1   . TRP B 1 143 ? -5.846  55.209 54.537 1.00 59.34  ? 115 TRP B NE1   1 
ATOM   2290 C CE2   . TRP B 1 143 ? -5.328  54.837 53.324 1.00 54.27  ? 115 TRP B CE2   1 
ATOM   2291 C CE3   . TRP B 1 143 ? -5.400  52.918 51.857 1.00 52.22  ? 115 TRP B CE3   1 
ATOM   2292 C CZ2   . TRP B 1 143 ? -4.498  55.535 52.449 1.00 40.19  ? 115 TRP B CZ2   1 
ATOM   2293 C CZ3   . TRP B 1 143 ? -4.574  53.613 50.989 1.00 49.69  ? 115 TRP B CZ3   1 
ATOM   2294 C CH2   . TRP B 1 143 ? -4.133  54.907 51.291 1.00 39.10  ? 115 TRP B CH2   1 
ATOM   2295 N N     . ALA B 1 144 ? -9.633  49.653 54.218 1.00 47.06  ? 116 ALA B N     1 
ATOM   2296 C CA    . ALA B 1 144 ? -10.021 48.248 54.245 1.00 47.86  ? 116 ALA B CA    1 
ATOM   2297 C C     . ALA B 1 144 ? -10.808 47.863 52.999 1.00 50.71  ? 116 ALA B C     1 
ATOM   2298 O O     . ALA B 1 144 ? -10.588 46.801 52.423 1.00 54.96  ? 116 ALA B O     1 
ATOM   2299 C CB    . ALA B 1 144 ? -10.826 47.941 55.498 1.00 45.84  ? 116 ALA B CB    1 
ATOM   2300 N N     . TRP B 1 145 ? -11.724 48.730 52.582 1.00 53.50  ? 117 TRP B N     1 
ATOM   2301 C CA    . TRP B 1 145 ? -12.513 48.472 51.384 1.00 47.86  ? 117 TRP B CA    1 
ATOM   2302 C C     . TRP B 1 145 ? -11.645 48.470 50.134 1.00 50.10  ? 117 TRP B C     1 
ATOM   2303 O O     . TRP B 1 145 ? -11.849 47.663 49.230 1.00 52.14  ? 117 TRP B O     1 
ATOM   2304 C CB    . TRP B 1 145 ? -13.653 49.480 51.252 1.00 41.46  ? 117 TRP B CB    1 
ATOM   2305 C CG    . TRP B 1 145 ? -14.867 49.072 52.019 1.00 47.97  ? 117 TRP B CG    1 
ATOM   2306 C CD1   . TRP B 1 145 ? -15.250 49.520 53.248 1.00 42.37  ? 117 TRP B CD1   1 
ATOM   2307 C CD2   . TRP B 1 145 ? -15.850 48.113 51.615 1.00 47.21  ? 117 TRP B CD2   1 
ATOM   2308 N NE1   . TRP B 1 145 ? -16.418 48.906 53.631 1.00 43.83  ? 117 TRP B NE1   1 
ATOM   2309 C CE2   . TRP B 1 145 ? -16.807 48.037 52.645 1.00 46.42  ? 117 TRP B CE2   1 
ATOM   2310 C CE3   . TRP B 1 145 ? -16.018 47.316 50.478 1.00 40.88  ? 117 TRP B CE3   1 
ATOM   2311 C CZ2   . TRP B 1 145 ? -17.914 47.197 52.574 1.00 48.93  ? 117 TRP B CZ2   1 
ATOM   2312 C CZ3   . TRP B 1 145 ? -17.118 46.481 50.409 1.00 39.18  ? 117 TRP B CZ3   1 
ATOM   2313 C CH2   . TRP B 1 145 ? -18.052 46.428 51.450 1.00 41.08  ? 117 TRP B CH2   1 
ATOM   2314 N N     . GLY B 1 146 ? -10.671 49.371 50.096 1.00 53.53  ? 118 GLY B N     1 
ATOM   2315 C CA    . GLY B 1 146 ? -9.733  49.425 48.992 1.00 47.12  ? 118 GLY B CA    1 
ATOM   2316 C C     . GLY B 1 146 ? -8.904  48.159 48.898 1.00 46.28  ? 118 GLY B C     1 
ATOM   2317 O O     . GLY B 1 146 ? -8.708  47.616 47.811 1.00 48.31  ? 118 GLY B O     1 
ATOM   2318 N N     . THR B 1 147 ? -8.426  47.679 50.043 1.00 44.23  ? 119 THR B N     1 
ATOM   2319 C CA    . THR B 1 147 ? -7.580  46.491 50.071 1.00 46.62  ? 119 THR B CA    1 
ATOM   2320 C C     . THR B 1 147 ? -8.395  45.214 49.851 1.00 41.28  ? 119 THR B C     1 
ATOM   2321 O O     . THR B 1 147 ? -7.858  44.190 49.429 1.00 32.65  ? 119 THR B O     1 
ATOM   2322 C CB    . THR B 1 147 ? -6.754  46.395 51.382 1.00 34.96  ? 119 THR B CB    1 
ATOM   2323 O OG1   . THR B 1 147 ? -5.608  45.560 51.174 1.00 36.80  ? 119 THR B OG1   1 
ATOM   2324 C CG2   . THR B 1 147 ? -7.589  45.831 52.520 1.00 35.23  ? 119 THR B CG2   1 
ATOM   2325 N N     . MET B 1 148 ? -9.695  45.281 50.122 1.00 38.35  ? 120 MET B N     1 
ATOM   2326 C CA    . MET B 1 148 ? -10.569 44.131 49.909 1.00 43.76  ? 120 MET B CA    1 
ATOM   2327 C C     . MET B 1 148 ? -11.000 44.019 48.449 1.00 42.44  ? 120 MET B C     1 
ATOM   2328 O O     . MET B 1 148 ? -11.111 42.917 47.910 1.00 36.06  ? 120 MET B O     1 
ATOM   2329 C CB    . MET B 1 148 ? -11.789 44.186 50.835 1.00 30.64  ? 120 MET B CB    1 
ATOM   2330 C CG    . MET B 1 148 ? -11.483 43.792 52.273 1.00 43.98  ? 120 MET B CG    1 
ATOM   2331 S SD    . MET B 1 148 ? -12.929 43.769 53.352 1.00 40.41  ? 120 MET B SD    1 
ATOM   2332 C CE    . MET B 1 148 ? -13.356 45.507 53.410 1.00 63.95  ? 120 MET B CE    1 
ATOM   2333 N N     . ILE B 1 149 ? -11.235 45.162 47.813 1.00 37.30  ? 121 ILE B N     1 
ATOM   2334 C CA    . ILE B 1 149 ? -11.600 45.186 46.400 1.00 38.57  ? 121 ILE B CA    1 
ATOM   2335 C C     . ILE B 1 149 ? -10.448 44.687 45.532 1.00 44.05  ? 121 ILE B C     1 
ATOM   2336 O O     . ILE B 1 149 ? -10.635 43.809 44.689 1.00 43.47  ? 121 ILE B O     1 
ATOM   2337 C CB    . ILE B 1 149 ? -12.026 46.596 45.940 1.00 37.36  ? 121 ILE B CB    1 
ATOM   2338 C CG1   . ILE B 1 149 ? -13.368 46.976 46.566 1.00 31.13  ? 121 ILE B CG1   1 
ATOM   2339 C CG2   . ILE B 1 149 ? -12.129 46.655 44.425 1.00 30.80  ? 121 ILE B CG2   1 
ATOM   2340 C CD1   . ILE B 1 149 ? -13.831 48.372 46.214 1.00 31.86  ? 121 ILE B CD1   1 
ATOM   2341 N N     . ILE B 1 150 ? -9.259  45.246 45.750 1.00 39.16  ? 122 ILE B N     1 
ATOM   2342 C CA    . ILE B 1 150 ? -8.067  44.852 45.003 1.00 36.79  ? 122 ILE B CA    1 
ATOM   2343 C C     . ILE B 1 150 ? -7.772  43.358 45.134 1.00 40.68  ? 122 ILE B C     1 
ATOM   2344 O O     . ILE B 1 150 ? -7.535  42.675 44.137 1.00 38.72  ? 122 ILE B O     1 
ATOM   2345 C CB    . ILE B 1 150 ? -6.828  45.663 45.443 1.00 36.96  ? 122 ILE B CB    1 
ATOM   2346 C CG1   . ILE B 1 150 ? -6.946  47.114 44.973 1.00 32.26  ? 122 ILE B CG1   1 
ATOM   2347 C CG2   . ILE B 1 150 ? -5.551  45.038 44.899 1.00 30.13  ? 122 ILE B CG2   1 
ATOM   2348 C CD1   . ILE B 1 150 ? -5.750  47.971 45.335 1.00 34.76  ? 122 ILE B CD1   1 
ATOM   2349 N N     . GLY B 1 151 ? -7.798  42.858 46.366 1.00 41.68  ? 123 GLY B N     1 
ATOM   2350 C CA    . GLY B 1 151 ? -7.550  41.451 46.625 1.00 42.84  ? 123 GLY B CA    1 
ATOM   2351 C C     . GLY B 1 151 ? -8.567  40.542 45.961 1.00 45.80  ? 123 GLY B C     1 
ATOM   2352 O O     . GLY B 1 151 ? -8.217  39.491 45.423 1.00 43.53  ? 123 GLY B O     1 
ATOM   2353 N N     . GLY B 1 152 ? -9.832  40.950 45.998 1.00 42.44  ? 124 GLY B N     1 
ATOM   2354 C CA    . GLY B 1 152 ? -10.901 40.187 45.381 1.00 39.69  ? 124 GLY B CA    1 
ATOM   2355 C C     . GLY B 1 152 ? -10.754 40.112 43.875 1.00 45.19  ? 124 GLY B C     1 
ATOM   2356 O O     . GLY B 1 152 ? -10.898 39.043 43.280 1.00 50.99  ? 124 GLY B O     1 
ATOM   2357 N N     . VAL B 1 153 ? -10.466 41.254 43.257 1.00 37.21  ? 125 VAL B N     1 
ATOM   2358 C CA    . VAL B 1 153 ? -10.258 41.318 41.816 0.54 38.43  ? 125 VAL B CA    1 
ATOM   2359 C C     . VAL B 1 153 ? -9.034  40.498 41.415 1.00 48.85  ? 125 VAL B C     1 
ATOM   2360 O O     . VAL B 1 153 ? -9.031  39.831 40.380 1.00 58.73  ? 125 VAL B O     1 
ATOM   2361 C CB    . VAL B 1 153 ? -10.101 42.778 41.337 1.00 29.99  ? 125 VAL B CB    1 
ATOM   2362 C CG1   . VAL B 1 153 ? -9.706  42.833 39.868 1.00 30.49  ? 125 VAL B CG1   1 
ATOM   2363 C CG2   . VAL B 1 153 ? -11.389 43.550 41.568 1.00 30.25  ? 125 VAL B CG2   1 
ATOM   2364 N N     . ALA B 1 154 ? -8.002  40.540 42.252 1.00 45.41  ? 126 ALA B N     1 
ATOM   2365 C CA    . ALA B 1 154 ? -6.765  39.809 41.995 1.00 35.36  ? 126 ALA B CA    1 
ATOM   2366 C C     . ALA B 1 154 ? -6.997  38.300 41.914 1.00 38.08  ? 126 ALA B C     1 
ATOM   2367 O O     . ALA B 1 154 ? -6.361  37.609 41.118 1.00 44.28  ? 126 ALA B O     1 
ATOM   2368 C CB    . ALA B 1 154 ? -5.731  40.133 43.061 1.00 33.88  ? 126 ALA B CB    1 
ATOM   2369 N N     . ARG B 1 155 ? -7.907  37.794 42.739 1.00 37.88  ? 127 ARG B N     1 
ATOM   2370 C CA    . ARG B 1 155 ? -8.249  36.376 42.713 1.00 38.76  ? 127 ARG B CA    1 
ATOM   2371 C C     . ARG B 1 155 ? -9.157  36.039 41.536 1.00 40.40  ? 127 ARG B C     1 
ATOM   2372 O O     . ARG B 1 155 ? -8.865  35.135 40.751 1.00 41.34  ? 127 ARG B O     1 
ATOM   2373 C CB    . ARG B 1 155 ? -8.932  35.953 44.015 1.00 35.45  ? 127 ARG B CB    1 
ATOM   2374 C CG    . ARG B 1 155 ? -9.601  34.587 43.928 1.00 37.91  ? 127 ARG B CG    1 
ATOM   2375 C CD    . ARG B 1 155 ? -10.488 34.302 45.129 1.00 44.42  ? 127 ARG B CD    1 
ATOM   2376 N NE    . ARG B 1 155 ? -11.295 33.104 44.919 1.00 46.66  ? 127 ARG B NE    1 
ATOM   2377 C CZ    . ARG B 1 155 ? -12.204 32.652 45.775 1.00 49.35  ? 127 ARG B CZ    1 
ATOM   2378 N NH1   . ARG B 1 155 ? -12.428 33.299 46.910 1.00 58.86  ? 127 ARG B NH1   1 
ATOM   2379 N NH2   . ARG B 1 155 ? -12.891 31.552 45.495 1.00 43.39  ? 127 ARG B NH2   1 
ATOM   2380 N N     . TYR B 1 156 ? -10.258 36.774 41.418 1.00 40.60  ? 128 TYR B N     1 
ATOM   2381 C CA    . TYR B 1 156 ? -11.276 36.481 40.412 1.00 39.19  ? 128 TYR B CA    1 
ATOM   2382 C C     . TYR B 1 156 ? -10.828 36.770 38.982 1.00 41.84  ? 128 TYR B C     1 
ATOM   2383 O O     . TYR B 1 156 ? -11.559 36.493 38.031 1.00 44.77  ? 128 TYR B O     1 
ATOM   2384 C CB    . TYR B 1 156 ? -12.583 37.211 40.733 1.00 36.13  ? 128 TYR B CB    1 
ATOM   2385 C CG    . TYR B 1 156 ? -13.411 36.512 41.789 1.00 44.76  ? 128 TYR B CG    1 
ATOM   2386 C CD1   . TYR B 1 156 ? -13.161 36.708 43.141 1.00 41.76  ? 128 TYR B CD1   1 
ATOM   2387 C CD2   . TYR B 1 156 ? -14.438 35.646 41.432 1.00 50.11  ? 128 TYR B CD2   1 
ATOM   2388 C CE1   . TYR B 1 156 ? -13.913 36.066 44.106 1.00 46.46  ? 128 TYR B CE1   1 
ATOM   2389 C CE2   . TYR B 1 156 ? -15.194 35.002 42.390 1.00 47.57  ? 128 TYR B CE2   1 
ATOM   2390 C CZ    . TYR B 1 156 ? -14.929 35.214 43.724 1.00 52.18  ? 128 TYR B CZ    1 
ATOM   2391 O OH    . TYR B 1 156 ? -15.683 34.571 44.680 1.00 63.57  ? 128 TYR B OH    1 
ATOM   2392 N N     . PHE B 1 157 ? -9.630  37.326 38.835 1.00 44.05  ? 129 PHE B N     1 
ATOM   2393 C CA    . PHE B 1 157 ? -9.034  37.492 37.517 1.00 45.36  ? 129 PHE B CA    1 
ATOM   2394 C C     . PHE B 1 157 ? -8.763  36.124 36.910 1.00 46.68  ? 129 PHE B C     1 
ATOM   2395 O O     . PHE B 1 157 ? -9.033  35.888 35.734 1.00 45.27  ? 129 PHE B O     1 
ATOM   2396 C CB    . PHE B 1 157 ? -7.730  38.287 37.604 1.00 40.54  ? 129 PHE B CB    1 
ATOM   2397 C CG    . PHE B 1 157 ? -6.896  38.212 36.358 1.00 32.00  ? 129 PHE B CG    1 
ATOM   2398 C CD1   . PHE B 1 157 ? -7.238  38.946 35.234 1.00 35.05  ? 129 PHE B CD1   1 
ATOM   2399 C CD2   . PHE B 1 157 ? -5.772  37.402 36.307 1.00 35.97  ? 129 PHE B CD2   1 
ATOM   2400 C CE1   . PHE B 1 157 ? -6.476  38.875 34.084 1.00 33.62  ? 129 PHE B CE1   1 
ATOM   2401 C CE2   . PHE B 1 157 ? -5.005  37.327 35.161 1.00 32.98  ? 129 PHE B CE2   1 
ATOM   2402 C CZ    . PHE B 1 157 ? -5.356  38.065 34.048 1.00 46.55  ? 129 PHE B CZ    1 
ATOM   2403 N N     . TRP B 1 158 ? -8.231  35.222 37.728 1.00 49.55  ? 130 TRP B N     1 
ATOM   2404 C CA    . TRP B 1 158 ? -7.879  33.885 37.272 1.00 47.54  ? 130 TRP B CA    1 
ATOM   2405 C C     . TRP B 1 158 ? -9.113  33.008 37.095 1.00 51.69  ? 130 TRP B C     1 
ATOM   2406 O O     . TRP B 1 158 ? -9.113  32.083 36.283 1.00 61.31  ? 130 TRP B O     1 
ATOM   2407 C CB    . TRP B 1 158 ? -6.886  33.239 38.238 1.00 43.21  ? 130 TRP B CB    1 
ATOM   2408 C CG    . TRP B 1 158 ? -5.598  33.994 38.337 1.00 44.17  ? 130 TRP B CG    1 
ATOM   2409 C CD1   . TRP B 1 158 ? -5.266  34.930 39.273 1.00 49.47  ? 130 TRP B CD1   1 
ATOM   2410 C CD2   . TRP B 1 158 ? -4.473  33.889 37.457 1.00 43.11  ? 130 TRP B CD2   1 
ATOM   2411 N NE1   . TRP B 1 158 ? -4.000  35.410 39.034 1.00 31.00  ? 130 TRP B NE1   1 
ATOM   2412 C CE2   . TRP B 1 158 ? -3.492  34.787 37.926 1.00 43.44  ? 130 TRP B CE2   1 
ATOM   2413 C CE3   . TRP B 1 158 ? -4.199  33.122 36.321 1.00 40.14  ? 130 TRP B CE3   1 
ATOM   2414 C CZ2   . TRP B 1 158 ? -2.257  34.936 37.298 1.00 39.20  ? 130 TRP B CZ2   1 
ATOM   2415 C CZ3   . TRP B 1 158 ? -2.971  33.271 35.699 1.00 42.44  ? 130 TRP B CZ3   1 
ATOM   2416 C CH2   . TRP B 1 158 ? -2.016  34.171 36.190 1.00 38.54  ? 130 TRP B CH2   1 
ATOM   2417 N N     . HIS B 1 159 ? -10.162 33.304 37.856 1.00 53.00  ? 131 HIS B N     1 
ATOM   2418 C CA    . HIS B 1 159 ? -11.440 32.623 37.683 1.00 50.48  ? 131 HIS B CA    1 
ATOM   2419 C C     . HIS B 1 159 ? -12.079 33.055 36.370 1.00 48.45  ? 131 HIS B C     1 
ATOM   2420 O O     . HIS B 1 159 ? -12.724 32.257 35.687 1.00 42.57  ? 131 HIS B O     1 
ATOM   2421 C CB    . HIS B 1 159 ? -12.378 32.915 38.855 1.00 39.33  ? 131 HIS B CB    1 
ATOM   2422 C CG    . HIS B 1 159 ? -11.969 32.254 40.133 1.00 42.95  ? 131 HIS B CG    1 
ATOM   2423 N ND1   . HIS B 1 159 ? -11.261 31.071 40.164 1.00 44.19  ? 131 HIS B ND1   1 
ATOM   2424 C CD2   . HIS B 1 159 ? -12.160 32.612 41.425 1.00 43.39  ? 131 HIS B CD2   1 
ATOM   2425 C CE1   . HIS B 1 159 ? -11.036 30.729 41.420 1.00 46.31  ? 131 HIS B CE1   1 
ATOM   2426 N NE2   . HIS B 1 159 ? -11.572 31.646 42.204 1.00 44.32  ? 131 HIS B NE2   1 
ATOM   2427 N N     . TYR B 1 160 ? -11.891 34.324 36.022 1.00 45.44  ? 132 TYR B N     1 
ATOM   2428 C CA    . TYR B 1 160 ? -12.350 34.840 34.740 1.00 46.54  ? 132 TYR B CA    1 
ATOM   2429 C C     . TYR B 1 160 ? -11.562 34.215 33.595 1.00 51.73  ? 132 TYR B C     1 
ATOM   2430 O O     . TYR B 1 160 ? -12.127 33.877 32.556 1.00 57.01  ? 132 TYR B O     1 
ATOM   2431 C CB    . TYR B 1 160 ? -12.234 36.365 34.689 1.00 34.50  ? 132 TYR B CB    1 
ATOM   2432 C CG    . TYR B 1 160 ? -12.078 36.906 33.286 1.00 40.86  ? 132 TYR B CG    1 
ATOM   2433 C CD1   . TYR B 1 160 ? -13.166 36.987 32.427 1.00 42.22  ? 132 TYR B CD1   1 
ATOM   2434 C CD2   . TYR B 1 160 ? -10.841 37.330 32.818 1.00 41.01  ? 132 TYR B CD2   1 
ATOM   2435 C CE1   . TYR B 1 160 ? -13.026 37.475 31.142 1.00 45.53  ? 132 TYR B CE1   1 
ATOM   2436 C CE2   . TYR B 1 160 ? -10.691 37.818 31.536 1.00 43.03  ? 132 TYR B CE2   1 
ATOM   2437 C CZ    . TYR B 1 160 ? -11.786 37.889 30.703 1.00 47.33  ? 132 TYR B CZ    1 
ATOM   2438 O OH    . TYR B 1 160 ? -11.636 38.378 29.426 1.00 51.80  ? 132 TYR B OH    1 
ATOM   2439 N N     . VAL B 1 161 ? -10.255 34.071 33.792 1.00 48.22  ? 133 VAL B N     1 
ATOM   2440 C CA    . VAL B 1 161 ? -9.389  33.463 32.789 1.00 45.11  ? 133 VAL B CA    1 
ATOM   2441 C C     . VAL B 1 161 ? -9.797  32.017 32.529 1.00 49.02  ? 133 VAL B C     1 
ATOM   2442 O O     . VAL B 1 161 ? -9.974  31.609 31.380 1.00 50.72  ? 133 VAL B O     1 
ATOM   2443 C CB    . VAL B 1 161 ? -7.906  33.517 33.210 1.00 40.63  ? 133 VAL B CB    1 
ATOM   2444 C CG1   . VAL B 1 161 ? -7.065  32.590 32.341 1.00 39.76  ? 133 VAL B CG1   1 
ATOM   2445 C CG2   . VAL B 1 161 ? -7.388  34.942 33.134 1.00 35.21  ? 133 VAL B CG2   1 
ATOM   2446 N N     . ALA B 1 162 ? -9.959  31.251 33.603 1.00 44.17  ? 134 ALA B N     1 
ATOM   2447 C CA    . ALA B 1 162 ? -10.367 29.857 33.488 1.00 51.14  ? 134 ALA B CA    1 
ATOM   2448 C C     . ALA B 1 162 ? -11.783 29.744 32.937 1.00 59.37  ? 134 ALA B C     1 
ATOM   2449 O O     . ALA B 1 162 ? -12.113 28.781 32.242 1.00 60.52  ? 134 ALA B O     1 
ATOM   2450 C CB    . ALA B 1 162 ? -10.265 29.165 34.830 1.00 46.17  ? 134 ALA B CB    1 
ATOM   2451 N N     . GLY B 1 163 ? -12.615 30.732 33.252 1.00 56.74  ? 135 GLY B N     1 
ATOM   2452 C CA    . GLY B 1 163 ? -13.974 30.775 32.747 1.00 53.20  ? 135 GLY B CA    1 
ATOM   2453 C C     . GLY B 1 163 ? -14.006 30.852 31.233 1.00 58.87  ? 135 GLY B C     1 
ATOM   2454 O O     . GLY B 1 163 ? -14.840 30.219 30.587 1.00 68.12  ? 135 GLY B O     1 
ATOM   2455 N N     . VAL B 1 164 ? -13.089 31.631 30.667 1.00 49.12  ? 136 VAL B N     1 
ATOM   2456 C CA    . VAL B 1 164 ? -12.980 31.759 29.220 1.00 50.92  ? 136 VAL B CA    1 
ATOM   2457 C C     . VAL B 1 164 ? -12.366 30.501 28.617 1.00 57.54  ? 136 VAL B C     1 
ATOM   2458 O O     . VAL B 1 164 ? -12.834 29.997 27.594 1.00 60.81  ? 136 VAL B O     1 
ATOM   2459 C CB    . VAL B 1 164 ? -12.117 32.975 28.824 1.00 47.39  ? 136 VAL B CB    1 
ATOM   2460 C CG1   . VAL B 1 164 ? -12.009 33.082 27.310 1.00 43.52  ? 136 VAL B CG1   1 
ATOM   2461 C CG2   . VAL B 1 164 ? -12.696 34.251 29.407 1.00 45.79  ? 136 VAL B CG2   1 
ATOM   2462 N N     . LEU B 1 165 ? -11.323 29.993 29.267 1.00 53.25  ? 137 LEU B N     1 
ATOM   2463 C CA    . LEU B 1 165 ? -10.579 28.842 28.763 1.00 51.77  ? 137 LEU B CA    1 
ATOM   2464 C C     . LEU B 1 165 ? -11.327 27.514 28.880 1.00 55.97  ? 137 LEU B C     1 
ATOM   2465 O O     . LEU B 1 165 ? -11.164 26.635 28.032 1.00 49.01  ? 137 LEU B O     1 
ATOM   2466 C CB    . LEU B 1 165 ? -9.231  28.721 29.481 1.00 52.56  ? 137 LEU B CB    1 
ATOM   2467 C CG    . LEU B 1 165 ? -8.096  29.677 29.109 1.00 63.90  ? 137 LEU B CG    1 
ATOM   2468 C CD1   . LEU B 1 165 ? -6.944  29.521 30.090 1.00 40.94  ? 137 LEU B CD1   1 
ATOM   2469 C CD2   . LEU B 1 165 ? -7.625  29.425 27.686 1.00 44.03  ? 137 LEU B CD2   1 
ATOM   2470 N N     . PHE B 1 166 ? -12.141 27.364 29.922 1.00 61.51  ? 138 PHE B N     1 
ATOM   2471 C CA    . PHE B 1 166 ? -12.720 26.058 30.236 1.00 58.01  ? 138 PHE B CA    1 
ATOM   2472 C C     . PHE B 1 166 ? -14.242 26.025 30.383 1.00 55.30  ? 138 PHE B C     1 
ATOM   2473 O O     . PHE B 1 166 ? -14.884 25.060 29.970 1.00 63.48  ? 138 PHE B O     1 
ATOM   2474 C CB    . PHE B 1 166 ? -12.075 25.490 31.504 1.00 56.15  ? 138 PHE B CB    1 
ATOM   2475 C CG    . PHE B 1 166 ? -10.574 25.476 31.468 1.00 56.51  ? 138 PHE B CG    1 
ATOM   2476 C CD1   . PHE B 1 166 ? -9.892  24.457 30.823 1.00 55.95  ? 138 PHE B CD1   1 
ATOM   2477 C CD2   . PHE B 1 166 ? -9.844  26.479 32.086 1.00 60.39  ? 138 PHE B CD2   1 
ATOM   2478 C CE1   . PHE B 1 166 ? -8.510  24.440 30.791 1.00 60.84  ? 138 PHE B CE1   1 
ATOM   2479 C CE2   . PHE B 1 166 ? -8.461  26.467 32.059 1.00 62.39  ? 138 PHE B CE2   1 
ATOM   2480 C CZ    . PHE B 1 166 ? -7.794  25.446 31.410 1.00 64.83  ? 138 PHE B CZ    1 
ATOM   2481 N N     . TRP B 1 167 ? -14.817 27.068 30.974 1.00 59.65  ? 139 TRP B N     1 
ATOM   2482 C CA    . TRP B 1 167 ? -16.233 27.050 31.343 1.00 66.88  ? 139 TRP B CA    1 
ATOM   2483 C C     . TRP B 1 167 ? -17.174 27.607 30.274 1.00 73.93  ? 139 TRP B C     1 
ATOM   2484 O O     . TRP B 1 167 ? -18.251 28.111 30.590 1.00 77.43  ? 139 TRP B O     1 
ATOM   2485 C CB    . TRP B 1 167 ? -16.443 27.796 32.664 1.00 43.58  ? 139 TRP B CB    1 
ATOM   2486 C CG    . TRP B 1 167 ? -15.762 27.140 33.823 1.00 46.93  ? 139 TRP B CG    1 
ATOM   2487 C CD1   . TRP B 1 167 ? -14.466 27.307 34.214 1.00 41.33  ? 139 TRP B CD1   1 
ATOM   2488 C CD2   . TRP B 1 167 ? -16.340 26.205 34.741 1.00 48.36  ? 139 TRP B CD2   1 
ATOM   2489 N NE1   . TRP B 1 167 ? -14.202 26.536 35.320 1.00 40.97  ? 139 TRP B NE1   1 
ATOM   2490 C CE2   . TRP B 1 167 ? -15.336 25.850 35.662 1.00 48.24  ? 139 TRP B CE2   1 
ATOM   2491 C CE3   . TRP B 1 167 ? -17.610 25.635 34.872 1.00 44.53  ? 139 TRP B CE3   1 
ATOM   2492 C CZ2   . TRP B 1 167 ? -15.563 24.949 36.702 1.00 42.35  ? 139 TRP B CZ2   1 
ATOM   2493 C CZ3   . TRP B 1 167 ? -17.832 24.742 35.905 1.00 47.81  ? 139 TRP B CZ3   1 
ATOM   2494 C CH2   . TRP B 1 167 ? -16.814 24.409 36.807 1.00 43.74  ? 139 TRP B CH2   1 
ATOM   2495 N N     . GLY B 1 168 ? -16.773 27.499 29.013 1.00 77.67  ? 140 GLY B N     1 
ATOM   2496 C CA    . GLY B 1 168 ? -17.557 28.044 27.919 1.00 78.42  ? 140 GLY B CA    1 
ATOM   2497 C C     . GLY B 1 168 ? -18.791 27.234 27.563 1.00 81.54  ? 140 GLY B C     1 
ATOM   2498 O O     . GLY B 1 168 ? -19.683 27.728 26.872 1.00 82.60  ? 140 GLY B O     1 
ATOM   2499 N N     . ALA B 1 169 ? -18.847 25.992 28.034 1.00 74.63  ? 141 ALA B N     1 
ATOM   2500 C CA    . ALA B 1 169 ? -19.959 25.102 27.708 1.00 63.36  ? 141 ALA B CA    1 
ATOM   2501 C C     . ALA B 1 169 ? -21.107 25.216 28.707 1.00 62.89  ? 141 ALA B C     1 
ATOM   2502 O O     . ALA B 1 169 ? -22.188 24.673 28.486 1.00 69.85  ? 141 ALA B O     1 
ATOM   2503 C CB    . ALA B 1 169 ? -19.477 23.662 27.616 1.00 56.31  ? 141 ALA B CB    1 
ATOM   2504 N N     . TYR B 1 170 ? -20.867 25.923 29.807 1.00 67.10  ? 142 TYR B N     1 
ATOM   2505 C CA    . TYR B 1 170 ? -21.885 26.115 30.834 1.00 64.88  ? 142 TYR B CA    1 
ATOM   2506 C C     . TYR B 1 170 ? -22.593 27.455 30.656 1.00 64.48  ? 142 TYR B C     1 
ATOM   2507 O O     . TYR B 1 170 ? -23.411 27.854 31.486 1.00 58.16  ? 142 TYR B O     1 
ATOM   2508 C CB    . TYR B 1 170 ? -21.261 26.031 32.229 1.00 64.22  ? 142 TYR B CB    1 
ATOM   2509 C CG    . TYR B 1 170 ? -20.717 24.664 32.578 1.00 70.47  ? 142 TYR B CG    1 
ATOM   2510 C CD1   . TYR B 1 170 ? -19.466 24.257 32.133 1.00 79.29  ? 142 TYR B CD1   1 
ATOM   2511 C CD2   . TYR B 1 170 ? -21.452 23.782 33.359 1.00 74.68  ? 142 TYR B CD2   1 
ATOM   2512 C CE1   . TYR B 1 170 ? -18.965 23.008 32.450 1.00 84.33  ? 142 TYR B CE1   1 
ATOM   2513 C CE2   . TYR B 1 170 ? -20.959 22.531 33.682 1.00 80.27  ? 142 TYR B CE2   1 
ATOM   2514 C CZ    . TYR B 1 170 ? -19.715 22.149 33.225 1.00 85.31  ? 142 TYR B CZ    1 
ATOM   2515 O OH    . TYR B 1 170 ? -19.219 20.905 33.543 1.00 86.93  ? 142 TYR B OH    1 
ATOM   2516 N N     . ALA B 1 171 ? -22.276 28.140 29.563 1.00 65.92  ? 143 ALA B N     1 
ATOM   2517 C CA    . ALA B 1 171 ? -22.808 29.472 29.304 1.00 51.09  ? 143 ALA B CA    1 
ATOM   2518 C C     . ALA B 1 171 ? -24.286 29.444 28.930 1.00 57.89  ? 143 ALA B C     1 
ATOM   2519 O O     . ALA B 1 171 ? -24.835 28.390 28.609 1.00 64.68  ? 143 ALA B O     1 
ATOM   2520 C CB    . ALA B 1 171 ? -22.001 30.152 28.208 1.00 51.06  ? 143 ALA B CB    1 
ATOM   2521 N N     . PHE B 1 172 ? -24.923 30.611 28.977 1.00 53.25  ? 144 PHE B N     1 
ATOM   2522 C CA    . PHE B 1 172 ? -26.290 30.757 28.495 1.00 54.72  ? 144 PHE B CA    1 
ATOM   2523 C C     . PHE B 1 172 ? -26.314 30.530 26.989 1.00 68.37  ? 144 PHE B C     1 
ATOM   2524 O O     . PHE B 1 172 ? -25.269 30.541 26.338 1.00 66.59  ? 144 PHE B O     1 
ATOM   2525 C CB    . PHE B 1 172 ? -26.828 32.157 28.800 1.00 53.79  ? 144 PHE B CB    1 
ATOM   2526 C CG    . PHE B 1 172 ? -26.825 32.512 30.261 1.00 61.94  ? 144 PHE B CG    1 
ATOM   2527 C CD1   . PHE B 1 172 ? -27.855 32.101 31.089 1.00 66.00  ? 144 PHE B CD1   1 
ATOM   2528 C CD2   . PHE B 1 172 ? -25.802 33.274 30.800 1.00 58.67  ? 144 PHE B CD2   1 
ATOM   2529 C CE1   . PHE B 1 172 ? -27.858 32.432 32.433 1.00 59.37  ? 144 PHE B CE1   1 
ATOM   2530 C CE2   . PHE B 1 172 ? -25.800 33.609 32.142 1.00 57.17  ? 144 PHE B CE2   1 
ATOM   2531 C CZ    . PHE B 1 172 ? -26.829 33.187 32.959 1.00 53.55  ? 144 PHE B CZ    1 
ATOM   2532 N N     . GLN B 1 173 ? -27.503 30.331 26.432 1.00 75.71  ? 145 GLN B N     1 
ATOM   2533 C CA    . GLN B 1 173 ? -27.628 30.187 24.988 1.00 84.73  ? 145 GLN B CA    1 
ATOM   2534 C C     . GLN B 1 173 ? -27.351 31.520 24.297 1.00 74.17  ? 145 GLN B C     1 
ATOM   2535 O O     . GLN B 1 173 ? -27.942 32.545 24.638 1.00 66.64  ? 145 GLN B O     1 
ATOM   2536 C CB    . GLN B 1 173 ? -29.003 29.631 24.594 1.00 102.66 ? 145 GLN B CB    1 
ATOM   2537 C CG    . GLN B 1 173 ? -30.201 30.417 25.117 1.00 122.43 ? 145 GLN B CG    1 
ATOM   2538 C CD    . GLN B 1 173 ? -30.572 30.059 26.546 1.00 134.89 ? 145 GLN B CD    1 
ATOM   2539 O OE1   . GLN B 1 173 ? -29.711 29.958 27.420 1.00 138.28 ? 145 GLN B OE1   1 
ATOM   2540 N NE2   . GLN B 1 173 ? -31.864 29.863 26.788 1.00 133.35 ? 145 GLN B NE2   1 
ATOM   2541 N N     . GLY B 1 174 ? -26.429 31.500 23.339 1.00 72.45  ? 146 GLY B N     1 
ATOM   2542 C CA    . GLY B 1 174 ? -26.069 32.697 22.602 1.00 73.88  ? 146 GLY B CA    1 
ATOM   2543 C C     . GLY B 1 174 ? -24.925 33.463 23.239 1.00 78.18  ? 146 GLY B C     1 
ATOM   2544 O O     . GLY B 1 174 ? -24.483 34.483 22.710 1.00 88.43  ? 146 GLY B O     1 
ATOM   2545 N N     . TRP B 1 175 ? -24.444 32.972 24.377 1.00 73.62  ? 147 TRP B N     1 
ATOM   2546 C CA    . TRP B 1 175 ? -23.348 33.625 25.086 1.00 53.99  ? 147 TRP B CA    1 
ATOM   2547 C C     . TRP B 1 175 ? -22.009 32.960 24.787 1.00 64.59  ? 147 TRP B C     1 
ATOM   2548 O O     . TRP B 1 175 ? -21.886 31.737 24.849 1.00 72.68  ? 147 TRP B O     1 
ATOM   2549 C CB    . TRP B 1 175 ? -23.591 33.617 26.598 1.00 59.21  ? 147 TRP B CB    1 
ATOM   2550 C CG    . TRP B 1 175 ? -24.692 34.522 27.059 1.00 59.59  ? 147 TRP B CG    1 
ATOM   2551 C CD1   . TRP B 1 175 ? -25.907 34.709 26.468 1.00 63.59  ? 147 TRP B CD1   1 
ATOM   2552 C CD2   . TRP B 1 175 ? -24.672 35.373 28.211 1.00 59.57  ? 147 TRP B CD2   1 
ATOM   2553 N NE1   . TRP B 1 175 ? -26.647 35.618 27.184 1.00 53.26  ? 147 TRP B NE1   1 
ATOM   2554 C CE2   . TRP B 1 175 ? -25.911 36.042 28.258 1.00 50.83  ? 147 TRP B CE2   1 
ATOM   2555 C CE3   . TRP B 1 175 ? -23.727 35.633 29.209 1.00 47.66  ? 147 TRP B CE3   1 
ATOM   2556 C CZ2   . TRP B 1 175 ? -26.230 36.952 29.263 1.00 49.48  ? 147 TRP B CZ2   1 
ATOM   2557 C CZ3   . TRP B 1 175 ? -24.045 36.538 30.205 1.00 58.44  ? 147 TRP B CZ3   1 
ATOM   2558 C CH2   . TRP B 1 175 ? -25.286 37.187 30.224 1.00 61.31  ? 147 TRP B CH2   1 
ATOM   2559 N N     . GLY B 1 176 ? -21.006 33.773 24.470 1.00 61.93  ? 148 GLY B N     1 
ATOM   2560 C CA    . GLY B 1 176 ? -19.662 33.273 24.248 1.00 52.22  ? 148 GLY B CA    1 
ATOM   2561 C C     . GLY B 1 176 ? -18.950 33.007 25.560 1.00 62.01  ? 148 GLY B C     1 
ATOM   2562 O O     . GLY B 1 176 ? -19.471 33.320 26.631 1.00 60.41  ? 148 GLY B O     1 
ATOM   2563 N N     . ALA B 1 177 ? -17.755 32.429 25.479 1.00 55.93  ? 149 ALA B N     1 
ATOM   2564 C CA    . ALA B 1 177 ? -16.975 32.105 26.669 1.00 53.53  ? 149 ALA B CA    1 
ATOM   2565 C C     . ALA B 1 177 ? -16.492 33.362 27.388 1.00 62.97  ? 149 ALA B C     1 
ATOM   2566 O O     . ALA B 1 177 ? -16.492 33.423 28.617 1.00 69.30  ? 149 ALA B O     1 
ATOM   2567 C CB    . ALA B 1 177 ? -15.797 31.214 26.306 1.00 54.74  ? 149 ALA B CB    1 
ATOM   2568 N N     . GLN B 1 178 ? -16.081 34.360 26.613 1.00 65.38  ? 150 GLN B N     1 
ATOM   2569 C CA    . GLN B 1 178 ? -15.625 35.632 27.163 1.00 65.84  ? 150 GLN B CA    1 
ATOM   2570 C C     . GLN B 1 178 ? -16.744 36.353 27.911 1.00 66.82  ? 150 GLN B C     1 
ATOM   2571 O O     . GLN B 1 178 ? -16.571 36.764 29.059 1.00 59.05  ? 150 GLN B O     1 
ATOM   2572 C CB    . GLN B 1 178 ? -15.079 36.524 26.044 1.00 74.92  ? 150 GLN B CB    1 
ATOM   2573 C CG    . GLN B 1 178 ? -14.977 37.999 26.403 1.00 78.09  ? 150 GLN B CG    1 
ATOM   2574 C CD    . GLN B 1 178 ? -13.945 38.272 27.478 1.00 79.60  ? 150 GLN B CD    1 
ATOM   2575 O OE1   . GLN B 1 178 ? -12.998 37.506 27.655 1.00 87.85  ? 150 GLN B OE1   1 
ATOM   2576 N NE2   . GLN B 1 178 ? -14.123 39.370 28.204 1.00 71.30  ? 150 GLN B NE2   1 
ATOM   2577 N N     . LEU B 1 179 ? -17.890 36.496 27.250 1.00 76.17  ? 151 LEU B N     1 
ATOM   2578 C CA    . LEU B 1 179 ? -19.037 37.202 27.813 1.00 44.78  ? 151 LEU B CA    1 
ATOM   2579 C C     . LEU B 1 179 ? -19.537 36.552 29.097 1.00 57.73  ? 151 LEU B C     1 
ATOM   2580 O O     . LEU B 1 179 ? -19.754 37.228 30.102 1.00 51.25  ? 151 LEU B O     1 
ATOM   2581 C CB    . LEU B 1 179 ? -20.173 37.261 26.790 1.00 46.91  ? 151 LEU B CB    1 
ATOM   2582 C CG    . LEU B 1 179 ? -21.461 37.948 27.243 1.00 47.06  ? 151 LEU B CG    1 
ATOM   2583 C CD1   . LEU B 1 179 ? -21.192 39.402 27.587 1.00 45.95  ? 151 LEU B CD1   1 
ATOM   2584 C CD2   . LEU B 1 179 ? -22.539 37.836 26.175 1.00 49.45  ? 151 LEU B CD2   1 
ATOM   2585 N N     . PHE B 1 180 ? -19.718 35.236 29.055 1.00 62.20  ? 152 PHE B N     1 
ATOM   2586 C CA    . PHE B 1 180 ? -20.231 34.491 30.199 1.00 44.07  ? 152 PHE B CA    1 
ATOM   2587 C C     . PHE B 1 180 ? -19.273 34.531 31.384 1.00 42.04  ? 152 PHE B C     1 
ATOM   2588 O O     . PHE B 1 180 ? -19.701 34.527 32.535 1.00 41.50  ? 152 PHE B O     1 
ATOM   2589 C CB    . PHE B 1 180 ? -20.513 33.042 29.800 1.00 45.62  ? 152 PHE B CB    1 
ATOM   2590 C CG    . PHE B 1 180 ? -21.101 32.209 30.905 1.00 54.59  ? 152 PHE B CG    1 
ATOM   2591 C CD1   . PHE B 1 180 ? -22.413 32.394 31.307 1.00 55.30  ? 152 PHE B CD1   1 
ATOM   2592 C CD2   . PHE B 1 180 ? -20.347 31.228 31.528 1.00 54.96  ? 152 PHE B CD2   1 
ATOM   2593 C CE1   . PHE B 1 180 ? -22.960 31.623 32.319 1.00 53.22  ? 152 PHE B CE1   1 
ATOM   2594 C CE2   . PHE B 1 180 ? -20.888 30.454 32.539 1.00 44.90  ? 152 PHE B CE2   1 
ATOM   2595 C CZ    . PHE B 1 180 ? -22.196 30.654 32.935 1.00 45.55  ? 152 PHE B CZ    1 
ATOM   2596 N N     . SER B 1 181 ? -17.976 34.577 31.098 1.00 58.46  ? 153 SER B N     1 
ATOM   2597 C CA    . SER B 1 181 ? -16.968 34.546 32.151 1.00 48.30  ? 153 SER B CA    1 
ATOM   2598 C C     . SER B 1 181 ? -16.830 35.882 32.873 1.00 48.71  ? 153 SER B C     1 
ATOM   2599 O O     . SER B 1 181 ? -16.667 35.917 34.089 1.00 50.97  ? 153 SER B O     1 
ATOM   2600 C CB    . SER B 1 181 ? -15.614 34.113 31.590 1.00 53.21  ? 153 SER B CB    1 
ATOM   2601 O OG    . SER B 1 181 ? -14.642 34.039 32.617 1.00 52.64  ? 153 SER B OG    1 
ATOM   2602 N N     . ILE B 1 182 ? -16.893 36.978 32.124 1.00 53.34  ? 154 ILE B N     1 
ATOM   2603 C CA    . ILE B 1 182 ? -16.728 38.303 32.716 1.00 52.69  ? 154 ILE B CA    1 
ATOM   2604 C C     . ILE B 1 182 ? -17.942 38.710 33.555 1.00 50.89  ? 154 ILE B C     1 
ATOM   2605 O O     . ILE B 1 182 ? -17.804 39.384 34.576 1.00 44.28  ? 154 ILE B O     1 
ATOM   2606 C CB    . ILE B 1 182 ? -16.411 39.381 31.646 1.00 38.28  ? 154 ILE B CB    1 
ATOM   2607 C CG1   . ILE B 1 182 ? -16.096 40.723 32.309 1.00 37.31  ? 154 ILE B CG1   1 
ATOM   2608 C CG2   . ILE B 1 182 ? -17.550 39.521 30.648 1.00 55.02  ? 154 ILE B CG2   1 
ATOM   2609 C CD1   . ILE B 1 182 ? -14.912 40.673 33.248 1.00 35.93  ? 154 ILE B CD1   1 
ATOM   2610 N N     . VAL B 1 183 ? -19.127 38.282 33.132 1.00 38.73  ? 155 VAL B N     1 
ATOM   2611 C CA    . VAL B 1 183 ? -20.355 38.619 33.841 1.00 43.01  ? 155 VAL B CA    1 
ATOM   2612 C C     . VAL B 1 183 ? -20.507 37.801 35.121 1.00 48.92  ? 155 VAL B C     1 
ATOM   2613 O O     . VAL B 1 183 ? -20.775 38.350 36.191 1.00 37.44  ? 155 VAL B O     1 
ATOM   2614 C CB    . VAL B 1 183 ? -21.598 38.410 32.950 1.00 46.98  ? 155 VAL B CB    1 
ATOM   2615 C CG1   . VAL B 1 183 ? -22.874 38.591 33.760 1.00 45.72  ? 155 VAL B CG1   1 
ATOM   2616 C CG2   . VAL B 1 183 ? -21.571 39.365 31.768 1.00 50.88  ? 155 VAL B CG2   1 
ATOM   2617 N N     . MET B 1 184 ? -20.328 36.488 35.007 1.00 48.99  ? 156 MET B N     1 
ATOM   2618 C CA    . MET B 1 184 ? -20.528 35.588 36.139 1.00 49.79  ? 156 MET B CA    1 
ATOM   2619 C C     . MET B 1 184 ? -19.451 35.738 37.206 1.00 46.88  ? 156 MET B C     1 
ATOM   2620 O O     . MET B 1 184 ? -19.754 35.802 38.397 1.00 50.42  ? 156 MET B O     1 
ATOM   2621 C CB    . MET B 1 184 ? -20.613 34.134 35.670 1.00 52.60  ? 156 MET B CB    1 
ATOM   2622 C CG    . MET B 1 184 ? -21.807 33.849 34.776 1.00 54.92  ? 156 MET B CG    1 
ATOM   2623 S SD    . MET B 1 184 ? -23.357 34.419 35.492 1.00 49.24  ? 156 MET B SD    1 
ATOM   2624 C CE    . MET B 1 184 ? -23.435 33.416 36.971 1.00 81.40  ? 156 MET B CE    1 
ATOM   2625 N N     . ASN B 1 185 ? -18.193 35.789 36.780 1.00 45.77  ? 157 ASN B N     1 
ATOM   2626 C CA    . ASN B 1 185 ? -17.092 35.976 37.718 1.00 50.50  ? 157 ASN B CA    1 
ATOM   2627 C C     . ASN B 1 185 ? -17.085 37.387 38.288 1.00 49.26  ? 157 ASN B C     1 
ATOM   2628 O O     . ASN B 1 185 ? -16.644 37.608 39.414 1.00 54.73  ? 157 ASN B O     1 
ATOM   2629 C CB    . ASN B 1 185 ? -15.753 35.648 37.059 1.00 43.36  ? 157 ASN B CB    1 
ATOM   2630 C CG    . ASN B 1 185 ? -15.627 34.182 36.702 1.00 45.26  ? 157 ASN B CG    1 
ATOM   2631 O OD1   . ASN B 1 185 ? -15.718 33.312 37.569 1.00 51.04  ? 157 ASN B OD1   1 
ATOM   2632 N ND2   . ASN B 1 185 ? -15.439 33.898 35.419 1.00 44.09  ? 157 ASN B ND2   1 
ATOM   2633 N N     . GLY B 1 186 ? -17.584 38.337 37.503 1.00 44.27  ? 158 GLY B N     1 
ATOM   2634 C CA    . GLY B 1 186 ? -17.736 39.702 37.968 1.00 44.20  ? 158 GLY B CA    1 
ATOM   2635 C C     . GLY B 1 186 ? -18.782 39.784 39.062 1.00 45.74  ? 158 GLY B C     1 
ATOM   2636 O O     . GLY B 1 186 ? -18.571 40.421 40.093 1.00 48.60  ? 158 GLY B O     1 
ATOM   2637 N N     . ALA B 1 187 ? -19.915 39.128 38.836 1.00 35.03  ? 159 ALA B N     1 
ATOM   2638 C CA    . ALA B 1 187 ? -20.995 39.097 39.814 1.00 42.19  ? 159 ALA B CA    1 
ATOM   2639 C C     . ALA B 1 187 ? -20.567 38.354 41.074 1.00 41.13  ? 159 ALA B C     1 
ATOM   2640 O O     . ALA B 1 187 ? -20.825 38.806 42.190 1.00 36.01  ? 159 ALA B O     1 
ATOM   2641 C CB    . ALA B 1 187 ? -22.238 38.455 39.213 1.00 36.76  ? 159 ALA B CB    1 
ATOM   2642 N N     . SER B 1 188 ? -19.912 37.212 40.886 1.00 45.90  ? 160 SER B N     1 
ATOM   2643 C CA    . SER B 1 188 ? -19.419 36.415 42.004 1.00 47.38  ? 160 SER B CA    1 
ATOM   2644 C C     . SER B 1 188 ? -18.414 37.205 42.831 1.00 52.18  ? 160 SER B C     1 
ATOM   2645 O O     . SER B 1 188 ? -18.413 37.132 44.059 1.00 46.77  ? 160 SER B O     1 
ATOM   2646 C CB    . SER B 1 188 ? -18.782 35.119 41.503 1.00 43.57  ? 160 SER B CB    1 
ATOM   2647 O OG    . SER B 1 188 ? -19.743 34.283 40.884 1.00 43.64  ? 160 SER B OG    1 
ATOM   2648 N N     . CYS B 1 189 ? -17.559 37.962 42.151 1.00 51.69  ? 161 CYS B N     1 
ATOM   2649 C CA    . CYS B 1 189 ? -16.602 38.824 42.830 1.00 42.68  ? 161 CYS B CA    1 
ATOM   2650 C C     . CYS B 1 189 ? -17.336 39.952 43.542 1.00 44.70  ? 161 CYS B C     1 
ATOM   2651 O O     . CYS B 1 189 ? -17.033 40.271 44.692 1.00 54.34  ? 161 CYS B O     1 
ATOM   2652 C CB    . CYS B 1 189 ? -15.589 39.399 41.837 1.00 40.17  ? 161 CYS B CB    1 
ATOM   2653 S SG    . CYS B 1 189 ? -14.303 40.427 42.590 1.00 40.70  ? 161 CYS B SG    1 
ATOM   2654 N N     . LEU B 1 190 ? -18.306 40.547 42.852 1.00 37.72  ? 162 LEU B N     1 
ATOM   2655 C CA    . LEU B 1 190 ? -19.093 41.640 43.414 1.00 40.05  ? 162 LEU B CA    1 
ATOM   2656 C C     . LEU B 1 190 ? -19.821 41.212 44.682 1.00 39.72  ? 162 LEU B C     1 
ATOM   2657 O O     . LEU B 1 190 ? -19.768 41.900 45.700 1.00 41.37  ? 162 LEU B O     1 
ATOM   2658 C CB    . LEU B 1 190 ? -20.102 42.164 42.391 1.00 33.46  ? 162 LEU B CB    1 
ATOM   2659 C CG    . LEU B 1 190 ? -21.022 43.279 42.894 1.00 35.85  ? 162 LEU B CG    1 
ATOM   2660 C CD1   . LEU B 1 190 ? -20.215 44.512 43.272 1.00 35.15  ? 162 LEU B CD1   1 
ATOM   2661 C CD2   . LEU B 1 190 ? -22.086 43.621 41.861 1.00 35.03  ? 162 LEU B CD2   1 
ATOM   2662 N N     . GLY B 1 191 ? -20.495 40.068 44.615 1.00 34.12  ? 163 GLY B N     1 
ATOM   2663 C CA    . GLY B 1 191 ? -21.241 39.557 45.749 1.00 42.70  ? 163 GLY B CA    1 
ATOM   2664 C C     . GLY B 1 191 ? -20.347 39.166 46.909 1.00 45.90  ? 163 GLY B C     1 
ATOM   2665 O O     . GLY B 1 191 ? -20.713 39.336 48.072 1.00 46.63  ? 163 GLY B O     1 
ATOM   2666 N N     . THR B 1 192 ? -19.168 38.644 46.588 1.00 46.28  ? 164 THR B N     1 
ATOM   2667 C CA    . THR B 1 192 ? -18.221 38.209 47.607 1.00 45.71  ? 164 THR B CA    1 
ATOM   2668 C C     . THR B 1 192 ? -17.593 39.390 48.343 1.00 48.19  ? 164 THR B C     1 
ATOM   2669 O O     . THR B 1 192 ? -17.562 39.416 49.574 1.00 54.54  ? 164 THR B O     1 
ATOM   2670 C CB    . THR B 1 192 ? -17.117 37.321 47.006 1.00 39.32  ? 164 THR B CB    1 
ATOM   2671 O OG1   . THR B 1 192 ? -17.684 36.070 46.598 1.00 43.36  ? 164 THR B OG1   1 
ATOM   2672 C CG2   . THR B 1 192 ? -16.025 37.060 48.025 1.00 38.82  ? 164 THR B CG2   1 
ATOM   2673 N N     . VAL B 1 193 ? -17.100 40.367 47.587 1.00 39.39  ? 165 VAL B N     1 
ATOM   2674 C CA    . VAL B 1 193 ? -16.470 41.544 48.178 1.00 46.15  ? 165 VAL B CA    1 
ATOM   2675 C C     . VAL B 1 193 ? -17.464 42.355 49.011 1.00 44.53  ? 165 VAL B C     1 
ATOM   2676 O O     . VAL B 1 193 ? -17.120 42.866 50.077 1.00 41.35  ? 165 VAL B O     1 
ATOM   2677 C CB    . VAL B 1 193 ? -15.815 42.440 47.100 1.00 44.45  ? 165 VAL B CB    1 
ATOM   2678 C CG1   . VAL B 1 193 ? -15.268 43.719 47.719 1.00 39.02  ? 165 VAL B CG1   1 
ATOM   2679 C CG2   . VAL B 1 193 ? -14.707 41.682 46.387 1.00 40.73  ? 165 VAL B CG2   1 
ATOM   2680 N N     . LEU B 1 194 ? -18.699 42.456 48.528 1.00 45.83  ? 166 LEU B N     1 
ATOM   2681 C CA    . LEU B 1 194 ? -19.742 43.179 49.249 1.00 43.29  ? 166 LEU B CA    1 
ATOM   2682 C C     . LEU B 1 194 ? -20.062 42.537 50.597 1.00 42.58  ? 166 LEU B C     1 
ATOM   2683 O O     . LEU B 1 194 ? -20.012 43.201 51.633 1.00 40.83  ? 166 LEU B O     1 
ATOM   2684 C CB    . LEU B 1 194 ? -21.014 43.295 48.404 1.00 33.76  ? 166 LEU B CB    1 
ATOM   2685 C CG    . LEU B 1 194 ? -21.028 44.410 47.357 1.00 60.42  ? 166 LEU B CG    1 
ATOM   2686 C CD1   . LEU B 1 194 ? -22.315 44.372 46.551 1.00 57.32  ? 166 LEU B CD1   1 
ATOM   2687 C CD2   . LEU B 1 194 ? -20.851 45.765 48.022 1.00 34.02  ? 166 LEU B CD2   1 
ATOM   2688 N N     . VAL B 1 195 ? -20.386 41.248 50.581 1.00 34.82  ? 167 VAL B N     1 
ATOM   2689 C CA    . VAL B 1 195 ? -20.733 40.543 51.811 1.00 40.74  ? 167 VAL B CA    1 
ATOM   2690 C C     . VAL B 1 195 ? -19.560 40.508 52.786 1.00 43.44  ? 167 VAL B C     1 
ATOM   2691 O O     . VAL B 1 195 ? -19.703 40.879 53.951 1.00 48.13  ? 167 VAL B O     1 
ATOM   2692 C CB    . VAL B 1 195 ? -21.227 39.109 51.535 1.00 42.64  ? 167 VAL B CB    1 
ATOM   2693 C CG1   . VAL B 1 195 ? -21.433 38.356 52.843 1.00 35.59  ? 167 VAL B CG1   1 
ATOM   2694 C CG2   . VAL B 1 195 ? -22.516 39.140 50.732 1.00 41.08  ? 167 VAL B CG2   1 
ATOM   2695 N N     . SER B 1 196 ? -18.401 40.072 52.301 1.00 45.66  ? 168 SER B N     1 
ATOM   2696 C CA    . SER B 1 196 ? -17.203 39.997 53.131 1.00 48.79  ? 168 SER B CA    1 
ATOM   2697 C C     . SER B 1 196 ? -16.794 41.377 53.638 1.00 45.40  ? 168 SER B C     1 
ATOM   2698 O O     . SER B 1 196 ? -16.396 41.531 54.792 1.00 43.12  ? 168 SER B O     1 
ATOM   2699 C CB    . SER B 1 196 ? -16.046 39.363 52.354 1.00 49.07  ? 168 SER B CB    1 
ATOM   2700 O OG    . SER B 1 196 ? -16.394 38.079 51.866 1.00 46.32  ? 168 SER B OG    1 
ATOM   2701 N N     . GLY B 1 197 ? -16.903 42.376 52.768 1.00 40.65  ? 169 GLY B N     1 
ATOM   2702 C CA    . GLY B 1 197 ? -16.516 43.734 53.104 1.00 42.07  ? 169 GLY B CA    1 
ATOM   2703 C C     . GLY B 1 197 ? -17.328 44.342 54.230 1.00 53.51  ? 169 GLY B C     1 
ATOM   2704 O O     . GLY B 1 197 ? -16.792 45.066 55.069 1.00 55.85  ? 169 GLY B O     1 
ATOM   2705 N N     . ILE B 1 198 ? -18.626 44.054 54.246 1.00 56.15  ? 170 ILE B N     1 
ATOM   2706 C CA    . ILE B 1 198 ? -19.506 44.563 55.291 1.00 53.52  ? 170 ILE B CA    1 
ATOM   2707 C C     . ILE B 1 198 ? -19.201 43.896 56.630 1.00 54.26  ? 170 ILE B C     1 
ATOM   2708 O O     . ILE B 1 198 ? -19.149 44.561 57.666 1.00 57.48  ? 170 ILE B O     1 
ATOM   2709 C CB    . ILE B 1 198 ? -20.993 44.371 54.928 1.00 50.82  ? 170 ILE B CB    1 
ATOM   2710 C CG1   . ILE B 1 198 ? -21.352 45.215 53.703 1.00 49.93  ? 170 ILE B CG1   1 
ATOM   2711 C CG2   . ILE B 1 198 ? -21.888 44.746 56.099 1.00 45.16  ? 170 ILE B CG2   1 
ATOM   2712 C CD1   . ILE B 1 198 ? -22.796 45.086 53.274 1.00 51.39  ? 170 ILE B CD1   1 
ATOM   2713 N N     . ILE B 1 199 ? -18.987 42.584 56.598 1.00 50.28  ? 171 ILE B N     1 
ATOM   2714 C CA    . ILE B 1 199 ? -18.643 41.833 57.801 1.00 51.74  ? 171 ILE B CA    1 
ATOM   2715 C C     . ILE B 1 199 ? -17.335 42.339 58.406 1.00 53.27  ? 171 ILE B C     1 
ATOM   2716 O O     . ILE B 1 199 ? -17.243 42.548 59.616 1.00 59.58  ? 171 ILE B O     1 
ATOM   2717 C CB    . ILE B 1 199 ? -18.534 40.319 57.517 1.00 49.38  ? 171 ILE B CB    1 
ATOM   2718 C CG1   . ILE B 1 199 ? -19.867 39.776 56.997 1.00 49.61  ? 171 ILE B CG1   1 
ATOM   2719 C CG2   . ILE B 1 199 ? -18.102 39.565 58.769 1.00 39.74  ? 171 ILE B CG2   1 
ATOM   2720 C CD1   . ILE B 1 199 ? -21.024 39.947 57.964 1.00 38.11  ? 171 ILE B CD1   1 
ATOM   2721 N N     . ILE B 1 200 ? -16.333 42.546 57.557 1.00 43.34  ? 172 ILE B N     1 
ATOM   2722 C CA    . ILE B 1 200 ? -15.048 43.087 57.995 1.00 43.40  ? 172 ILE B CA    1 
ATOM   2723 C C     . ILE B 1 200 ? -15.207 44.485 58.592 1.00 45.62  ? 172 ILE B C     1 
ATOM   2724 O O     . ILE B 1 200 ? -14.628 44.791 59.635 1.00 48.82  ? 172 ILE B O     1 
ATOM   2725 C CB    . ILE B 1 200 ? -14.029 43.135 56.836 1.00 46.26  ? 172 ILE B CB    1 
ATOM   2726 C CG1   . ILE B 1 200 ? -13.638 41.720 56.408 1.00 44.24  ? 172 ILE B CG1   1 
ATOM   2727 C CG2   . ILE B 1 200 ? -12.787 43.917 57.240 1.00 42.69  ? 172 ILE B CG2   1 
ATOM   2728 C CD1   . ILE B 1 200 ? -12.921 40.933 57.481 1.00 34.69  ? 172 ILE B CD1   1 
ATOM   2729 N N     . SER B 1 201 ? -16.003 45.322 57.931 1.00 44.03  ? 173 SER B N     1 
ATOM   2730 C CA    . SER B 1 201 ? -16.252 46.686 58.393 1.00 53.71  ? 173 SER B CA    1 
ATOM   2731 C C     . SER B 1 201 ? -16.832 46.712 59.805 1.00 54.56  ? 173 SER B C     1 
ATOM   2732 O O     . SER B 1 201 ? -16.493 47.580 60.610 1.00 50.00  ? 173 SER B O     1 
ATOM   2733 C CB    . SER B 1 201 ? -17.191 47.417 57.430 1.00 54.04  ? 173 SER B CB    1 
ATOM   2734 O OG    . SER B 1 201 ? -16.607 47.547 56.145 1.00 52.56  ? 173 SER B OG    1 
ATOM   2735 N N     . ILE B 1 202 ? -17.708 45.757 60.098 1.00 52.48  ? 174 ILE B N     1 
ATOM   2736 C CA    . ILE B 1 202 ? -18.302 45.642 61.424 1.00 52.83  ? 174 ILE B CA    1 
ATOM   2737 C C     . ILE B 1 202 ? -17.278 45.120 62.427 1.00 51.87  ? 174 ILE B C     1 
ATOM   2738 O O     . ILE B 1 202 ? -17.194 45.606 63.556 1.00 52.21  ? 174 ILE B O     1 
ATOM   2739 C CB    . ILE B 1 202 ? -19.531 44.714 61.406 1.00 54.59  ? 174 ILE B CB    1 
ATOM   2740 C CG1   . ILE B 1 202 ? -20.590 45.263 60.450 1.00 48.81  ? 174 ILE B CG1   1 
ATOM   2741 C CG2   . ILE B 1 202 ? -20.112 44.554 62.803 1.00 42.51  ? 174 ILE B CG2   1 
ATOM   2742 C CD1   . ILE B 1 202 ? -21.747 44.329 60.228 1.00 47.88  ? 174 ILE B CD1   1 
ATOM   2743 N N     . LEU B 1 203 ? -16.492 44.136 62.002 1.00 51.00  ? 175 LEU B N     1 
ATOM   2744 C CA    . LEU B 1 203 ? -15.463 43.552 62.856 1.00 53.14  ? 175 LEU B CA    1 
ATOM   2745 C C     . LEU B 1 203 ? -14.359 44.553 63.197 1.00 56.27  ? 175 LEU B C     1 
ATOM   2746 O O     . LEU B 1 203 ? -13.667 44.402 64.201 1.00 57.74  ? 175 LEU B O     1 
ATOM   2747 C CB    . LEU B 1 203 ? -14.870 42.299 62.208 1.00 52.07  ? 175 LEU B CB    1 
ATOM   2748 C CG    . LEU B 1 203 ? -15.811 41.096 62.108 1.00 53.57  ? 175 LEU B CG    1 
ATOM   2749 C CD1   . LEU B 1 203 ? -15.118 39.920 61.439 1.00 57.87  ? 175 LEU B CD1   1 
ATOM   2750 C CD2   . LEU B 1 203 ? -16.334 40.706 63.482 1.00 40.75  ? 175 LEU B CD2   1 
ATOM   2751 N N     . LEU B 1 204 ? -14.197 45.571 62.358 1.00 60.67  ? 176 LEU B N     1 
ATOM   2752 C CA    . LEU B 1 204 ? -13.258 46.650 62.645 1.00 64.76  ? 176 LEU B CA    1 
ATOM   2753 C C     . LEU B 1 204 ? -13.805 47.528 63.766 1.00 75.90  ? 176 LEU B C     1 
ATOM   2754 O O     . LEU B 1 204 ? -13.047 48.152 64.510 1.00 79.43  ? 176 LEU B O     1 
ATOM   2755 C CB    . LEU B 1 204 ? -13.010 47.496 61.396 1.00 56.42  ? 176 LEU B CB    1 
ATOM   2756 C CG    . LEU B 1 204 ? -12.214 46.852 60.259 1.00 49.18  ? 176 LEU B CG    1 
ATOM   2757 C CD1   . LEU B 1 204 ? -12.181 47.770 59.047 1.00 48.93  ? 176 LEU B CD1   1 
ATOM   2758 C CD2   . LEU B 1 204 ? -10.805 46.514 60.717 1.00 43.10  ? 176 LEU B CD2   1 
ATOM   2759 N N     . LYS B 1 205 ? -15.129 47.566 63.876 1.00 75.98  ? 177 LYS B N     1 
ATOM   2760 C CA    . LYS B 1 205 ? -15.805 48.356 64.898 1.00 70.48  ? 177 LYS B CA    1 
ATOM   2761 C C     . LYS B 1 205 ? -15.916 47.590 66.212 1.00 73.36  ? 177 LYS B C     1 
ATOM   2762 O O     . LYS B 1 205 ? -15.684 48.145 67.286 1.00 81.23  ? 177 LYS B O     1 
ATOM   2763 C CB    . LYS B 1 205 ? -17.199 48.762 64.411 1.00 68.02  ? 177 LYS B CB    1 
ATOM   2764 C CG    . LYS B 1 205 ? -18.109 49.343 65.486 1.00 67.26  ? 177 LYS B CG    1 
ATOM   2765 C CD    . LYS B 1 205 ? -17.568 50.656 66.020 1.00 71.64  ? 177 LYS B CD    1 
ATOM   2766 C CE    . LYS B 1 205 ? -18.495 51.263 67.059 1.00 75.54  ? 177 LYS B CE    1 
ATOM   2767 N NZ    . LYS B 1 205 ? -17.954 52.545 67.591 1.00 75.88  ? 177 LYS B NZ    1 
ATOM   2768 N N     . THR B 1 206 ? -16.264 46.310 66.120 1.00 68.61  ? 178 THR B N     1 
ATOM   2769 C CA    . THR B 1 206 ? -16.526 45.504 67.308 1.00 67.86  ? 178 THR B CA    1 
ATOM   2770 C C     . THR B 1 206 ? -15.288 44.779 67.837 1.00 69.48  ? 178 THR B C     1 
ATOM   2771 O O     . THR B 1 206 ? -15.187 44.511 69.035 1.00 75.15  ? 178 THR B O     1 
ATOM   2772 C CB    . THR B 1 206 ? -17.637 44.466 67.048 1.00 60.88  ? 178 THR B CB    1 
ATOM   2773 O OG1   . THR B 1 206 ? -17.149 43.450 66.163 1.00 54.30  ? 178 THR B OG1   1 
ATOM   2774 C CG2   . THR B 1 206 ? -18.855 45.132 66.430 1.00 46.51  ? 178 THR B CG2   1 
ATOM   2775 N N     . SER B 1 207 ? -14.350 44.463 66.949 1.00 57.26  ? 179 SER B N     1 
ATOM   2776 C CA    . SER B 1 207 ? -13.175 43.688 67.338 1.00 49.28  ? 179 SER B CA    1 
ATOM   2777 C C     . SER B 1 207 ? -11.881 44.206 66.710 1.00 51.85  ? 179 SER B C     1 
ATOM   2778 O O     . SER B 1 207 ? -11.300 43.539 65.854 1.00 54.76  ? 179 SER B O     1 
ATOM   2779 C CB    . SER B 1 207 ? -13.373 42.220 66.955 1.00 53.70  ? 179 SER B CB    1 
ATOM   2780 O OG    . SER B 1 207 ? -14.619 41.734 67.424 1.00 61.95  ? 179 SER B OG    1 
ATOM   2781 N N     . PRO B 1 208 ? -11.419 45.391 67.142 1.00 58.19  ? 180 PRO B N     1 
ATOM   2782 C CA    . PRO B 1 208 ? -10.221 46.012 66.562 1.00 55.14  ? 180 PRO B CA    1 
ATOM   2783 C C     . PRO B 1 208 ? -8.949  45.213 66.836 1.00 57.56  ? 180 PRO B C     1 
ATOM   2784 O O     . PRO B 1 208 ? -8.066  45.158 65.981 1.00 43.63  ? 180 PRO B O     1 
ATOM   2785 C CB    . PRO B 1 208 ? -10.145 47.367 67.278 1.00 49.20  ? 180 PRO B CB    1 
ATOM   2786 C CG    . PRO B 1 208 ? -11.515 47.598 67.827 1.00 54.23  ? 180 PRO B CG    1 
ATOM   2787 C CD    . PRO B 1 208 ? -12.021 46.240 68.182 1.00 61.96  ? 180 PRO B CD    1 
ATOM   2788 N N     . LYS B 1 209 ? -8.866  44.602 68.014 1.00 57.47  ? 181 LYS B N     1 
ATOM   2789 C CA    . LYS B 1 209 ? -7.672  43.867 68.426 1.00 49.76  ? 181 LYS B CA    1 
ATOM   2790 C C     . LYS B 1 209 ? -7.449  42.598 67.603 1.00 48.39  ? 181 LYS B C     1 
ATOM   2791 O O     . LYS B 1 209 ? -6.365  42.014 67.628 1.00 53.34  ? 181 LYS B O     1 
ATOM   2792 C CB    . LYS B 1 209 ? -7.742  43.535 69.919 1.00 48.79  ? 181 LYS B CB    1 
ATOM   2793 C CG    . LYS B 1 209 ? -7.741  44.763 70.819 1.00 69.89  ? 181 LYS B CG    1 
ATOM   2794 C CD    . LYS B 1 209 ? -8.027  44.407 72.271 1.00 73.59  ? 181 LYS B CD    1 
ATOM   2795 C CE    . LYS B 1 209 ? -6.955  43.499 72.848 1.00 83.15  ? 181 LYS B CE    1 
ATOM   2796 N NZ    . LYS B 1 209 ? -7.200  43.201 74.287 1.00 87.84  ? 181 LYS B NZ    1 
ATOM   2797 N N     . LEU B 1 210 ? -8.478  42.177 66.877 1.00 52.40  ? 182 LEU B N     1 
ATOM   2798 C CA    . LEU B 1 210 ? -8.377  41.018 65.998 1.00 54.31  ? 182 LEU B CA    1 
ATOM   2799 C C     . LEU B 1 210 ? -7.479  41.336 64.805 1.00 55.80  ? 182 LEU B C     1 
ATOM   2800 O O     . LEU B 1 210 ? -6.852  40.447 64.228 1.00 55.41  ? 182 LEU B O     1 
ATOM   2801 C CB    . LEU B 1 210 ? -9.769  40.592 65.523 1.00 50.35  ? 182 LEU B CB    1 
ATOM   2802 C CG    . LEU B 1 210 ? -9.863  39.381 64.592 1.00 57.73  ? 182 LEU B CG    1 
ATOM   2803 C CD1   . LEU B 1 210 ? -9.268  38.147 65.251 1.00 58.47  ? 182 LEU B CD1   1 
ATOM   2804 C CD2   . LEU B 1 210 ? -11.307 39.130 64.182 1.00 59.64  ? 182 LEU B CD2   1 
ATOM   2805 N N     . PHE B 1 211 ? -7.414  42.615 64.450 1.00 55.50  ? 183 PHE B N     1 
ATOM   2806 C CA    . PHE B 1 211 ? -6.620  43.066 63.314 1.00 56.03  ? 183 PHE B CA    1 
ATOM   2807 C C     . PHE B 1 211 ? -5.299  43.684 63.764 1.00 59.25  ? 183 PHE B C     1 
ATOM   2808 O O     . PHE B 1 211 ? -4.475  44.076 62.938 1.00 57.26  ? 183 PHE B O     1 
ATOM   2809 C CB    . PHE B 1 211 ? -7.407  44.089 62.492 1.00 59.11  ? 183 PHE B CB    1 
ATOM   2810 C CG    . PHE B 1 211 ? -8.745  43.593 62.019 1.00 62.32  ? 183 PHE B CG    1 
ATOM   2811 C CD1   . PHE B 1 211 ? -9.877  43.760 62.801 1.00 55.43  ? 183 PHE B CD1   1 
ATOM   2812 C CD2   . PHE B 1 211 ? -8.873  42.968 60.790 1.00 70.57  ? 183 PHE B CD2   1 
ATOM   2813 C CE1   . PHE B 1 211 ? -11.110 43.308 62.368 1.00 58.30  ? 183 PHE B CE1   1 
ATOM   2814 C CE2   . PHE B 1 211 ? -10.102 42.514 60.351 1.00 70.98  ? 183 PHE B CE2   1 
ATOM   2815 C CZ    . PHE B 1 211 ? -11.223 42.684 61.141 1.00 68.56  ? 183 PHE B CZ    1 
ATOM   2816 N N     . LEU B 1 212 ? -5.102  43.772 65.076 1.00 57.23  ? 184 LEU B N     1 
ATOM   2817 C CA    . LEU B 1 212 ? -3.920  44.427 65.626 1.00 56.79  ? 184 LEU B CA    1 
ATOM   2818 C C     . LEU B 1 212 ? -3.098  43.489 66.505 1.00 68.15  ? 184 LEU B C     1 
ATOM   2819 O O     . LEU B 1 212 ? -3.323  43.408 67.713 1.00 74.76  ? 184 LEU B O     1 
ATOM   2820 C CB    . LEU B 1 212 ? -4.323  45.669 66.425 1.00 52.84  ? 184 LEU B CB    1 
ATOM   2821 C CG    . LEU B 1 212 ? -5.054  46.775 65.659 1.00 53.33  ? 184 LEU B CG    1 
ATOM   2822 C CD1   . LEU B 1 212 ? -5.473  47.897 66.595 1.00 46.53  ? 184 LEU B CD1   1 
ATOM   2823 C CD2   . LEU B 1 212 ? -4.186  47.312 64.532 1.00 43.71  ? 184 LEU B CD2   1 
ATOM   2824 N N     . PRO B 1 213 ? -2.141  42.772 65.897 1.00 69.60  ? 185 PRO B N     1 
ATOM   2825 C CA    . PRO B 1 213 ? -1.234  41.898 66.647 1.00 70.21  ? 185 PRO B CA    1 
ATOM   2826 C C     . PRO B 1 213 ? -0.115  42.693 67.313 1.00 65.39  ? 185 PRO B C     1 
ATOM   2827 O O     . PRO B 1 213 ? 0.160   42.472 68.493 1.00 67.45  ? 185 PRO B O     1 
ATOM   2828 C CB    . PRO B 1 213 ? -0.661  40.986 65.561 1.00 63.83  ? 185 PRO B CB    1 
ATOM   2829 C CG    . PRO B 1 213 ? -0.693  41.818 64.330 1.00 58.12  ? 185 PRO B CG    1 
ATOM   2830 C CD    . PRO B 1 213 ? -1.926  42.675 64.442 1.00 61.46  ? 185 PRO B CD    1 
HETATM 2831 N "N1'" . TPP C 2 .   ? 18.768  31.375 50.531 1.00 45.45  ? 301 TPP A "N1'" 1 
HETATM 2832 C "C2'" . TPP C 2 .   ? 17.955  32.428 50.896 1.00 50.27  ? 301 TPP A "C2'" 1 
HETATM 2833 C CM2   . TPP C 2 .   ? 18.525  33.566 51.688 1.00 36.83  ? 301 TPP A CM2   1 
HETATM 2834 N "N3'" . TPP C 2 .   ? 16.622  32.432 50.534 1.00 48.70  ? 301 TPP A "N3'" 1 
HETATM 2835 C "C4'" . TPP C 2 .   ? 16.094  31.383 49.808 1.00 45.75  ? 301 TPP A "C4'" 1 
HETATM 2836 N "N4'" . TPP C 2 .   ? 14.810  31.400 49.465 1.00 44.93  ? 301 TPP A "N4'" 1 
HETATM 2837 C "C5'" . TPP C 2 .   ? 16.914  30.324 49.427 1.00 42.46  ? 301 TPP A "C5'" 1 
HETATM 2838 C "C6'" . TPP C 2 .   ? 18.251  30.324 49.803 1.00 42.77  ? 301 TPP A "C6'" 1 
HETATM 2839 C "C7'" . TPP C 2 .   ? 16.380  29.148 48.640 1.00 37.61  ? 301 TPP A "C7'" 1 
HETATM 2840 N N3    . TPP C 2 .   ? 16.021  29.471 47.283 1.00 40.16  ? 301 TPP A N3    1 
HETATM 2841 C C2    . TPP C 2 .   ? 16.410  30.595 46.592 1.00 50.25  ? 301 TPP A C2    1 
HETATM 2842 S S1    . TPP C 2 .   ? 15.837  30.640 45.099 1.00 43.00  ? 301 TPP A S1    1 
HETATM 2843 C C5    . TPP C 2 .   ? 15.103  29.240 45.265 1.00 38.09  ? 301 TPP A C5    1 
HETATM 2844 C C4    . TPP C 2 .   ? 15.261  28.665 46.511 1.00 40.59  ? 301 TPP A C4    1 
HETATM 2845 C CM4   . TPP C 2 .   ? 14.673  27.353 46.940 1.00 45.10  ? 301 TPP A CM4   1 
HETATM 2846 C C6    . TPP C 2 .   ? 14.362  28.785 44.044 1.00 45.45  ? 301 TPP A C6    1 
HETATM 2847 C C7    . TPP C 2 .   ? 15.262  27.839 43.262 1.00 51.32  ? 301 TPP A C7    1 
HETATM 2848 O O7    . TPP C 2 .   ? 16.415  28.549 42.866 1.00 59.09  ? 301 TPP A O7    1 
HETATM 2849 P PA    . TPP C 2 .   ? 17.218  28.120 41.542 1.00 86.33  ? 301 TPP A PA    1 
HETATM 2850 O O1A   . TPP C 2 .   ? 17.655  29.365 40.806 1.00 81.89  ? 301 TPP A O1A   1 
HETATM 2851 O O2A   . TPP C 2 .   ? 18.394  27.232 41.875 1.00 87.86  ? 301 TPP A O2A   1 
HETATM 2852 O O3A   . TPP C 2 .   ? 16.084  27.326 40.719 1.00 113.49 ? 301 TPP A O3A   1 
HETATM 2853 P PB    . TPP C 2 .   ? 15.760  27.607 39.169 1.00 66.56  ? 301 TPP A PB    1 
HETATM 2854 O O1B   . TPP C 2 .   ? 16.965  28.174 38.458 1.00 72.40  ? 301 TPP A O1B   1 
HETATM 2855 O O2B   . TPP C 2 .   ? 15.341  26.313 38.516 1.00 62.37  ? 301 TPP A O2B   1 
HETATM 2856 O O3B   . TPP C 2 .   ? 14.627  28.600 39.084 1.00 75.46  ? 301 TPP A O3B   1 
HETATM 2857 C C1    . BGL D 3 .   ? -4.198  43.219 30.265 1.00 128.86 ? 302 BGL A C1    1 
HETATM 2858 O O1    . BGL D 3 .   ? -5.298  43.145 31.049 1.00 133.38 ? 302 BGL A O1    1 
HETATM 2859 C C2    . BGL D 3 .   ? -3.255  42.106 30.614 1.00 112.86 ? 302 BGL A C2    1 
HETATM 2860 O O2    . BGL D 3 .   ? -2.733  42.321 31.927 1.00 93.60  ? 302 BGL A O2    1 
HETATM 2861 C C3    . BGL D 3 .   ? -2.154  42.015 29.669 1.00 113.01 ? 302 BGL A C3    1 
HETATM 2862 O O3    . BGL D 3 .   ? -1.255  40.940 30.031 1.00 104.96 ? 302 BGL A O3    1 
HETATM 2863 C C4    . BGL D 3 .   ? -2.630  41.840 28.290 1.00 121.92 ? 302 BGL A C4    1 
HETATM 2864 O O4    . BGL D 3 .   ? -1.549  41.777 27.367 1.00 117.69 ? 302 BGL A O4    1 
HETATM 2865 C C5    . BGL D 3 .   ? -3.566  42.945 27.872 1.00 126.98 ? 302 BGL A C5    1 
HETATM 2866 O O5    . BGL D 3 .   ? -4.598  43.238 28.846 1.00 130.93 ? 302 BGL A O5    1 
HETATM 2867 C C6    . BGL D 3 .   ? -4.180  42.618 26.566 1.00 126.48 ? 302 BGL A C6    1 
HETATM 2868 O O6    . BGL D 3 .   ? -5.145  43.508 26.064 1.00 130.57 ? 302 BGL A O6    1 
HETATM 2869 C "C1'" . BGL D 3 .   ? -3.291  41.645 33.021 1.00 79.77  ? 302 BGL A "C1'" 1 
HETATM 2870 C "C2'" . BGL D 3 .   ? -3.279  42.345 34.353 1.00 70.60  ? 302 BGL A "C2'" 1 
HETATM 2871 C "C3'" . BGL D 3 .   ? -4.313  41.877 35.434 1.00 73.72  ? 302 BGL A "C3'" 1 
HETATM 2872 C "C4'" . BGL D 3 .   ? -3.781  41.404 36.754 1.00 67.54  ? 302 BGL A "C4'" 1 
HETATM 2873 C "C5'" . BGL D 3 .   ? -4.764  41.302 37.924 1.00 55.57  ? 302 BGL A "C5'" 1 
HETATM 2874 C "C6'" . BGL D 3 .   ? -4.189  41.217 39.309 1.00 46.26  ? 302 BGL A "C6'" 1 
HETATM 2875 C C1    . BGL E 3 .   ? 26.205  30.855 49.801 1.00 95.30  ? 303 BGL A C1    1 
HETATM 2876 O O1    . BGL E 3 .   ? 25.332  31.650 49.138 1.00 84.18  ? 303 BGL A O1    1 
HETATM 2877 C C2    . BGL E 3 .   ? 27.174  31.705 50.574 1.00 97.23  ? 303 BGL A C2    1 
HETATM 2878 O O2    . BGL E 3 .   ? 28.103  32.302 49.666 1.00 89.63  ? 303 BGL A O2    1 
HETATM 2879 C C3    . BGL E 3 .   ? 27.918  30.934 51.559 1.00 103.83 ? 303 BGL A C3    1 
HETATM 2880 O O3    . BGL E 3 .   ? 28.834  31.773 52.303 1.00 111.20 ? 303 BGL A O3    1 
HETATM 2881 C C4    . BGL E 3 .   ? 27.023  30.218 52.474 1.00 99.49  ? 303 BGL A C4    1 
HETATM 2882 O O4    . BGL E 3 .   ? 27.748  29.514 53.475 1.00 95.15  ? 303 BGL A O4    1 
HETATM 2883 C C5    . BGL E 3 .   ? 26.155  29.251 51.715 1.00 100.83 ? 303 BGL A C5    1 
HETATM 2884 O O5    . BGL E 3 .   ? 25.458  29.866 50.604 1.00 99.07  ? 303 BGL A O5    1 
HETATM 2885 C C6    . BGL E 3 .   ? 25.194  28.605 52.635 1.00 103.91 ? 303 BGL A C6    1 
HETATM 2886 O O6    . BGL E 3 .   ? 25.689  28.149 53.870 1.00 106.21 ? 303 BGL A O6    1 
HETATM 2887 C "C1'" . BGL E 3 .   ? 27.865  33.575 49.133 1.00 67.55  ? 303 BGL A "C1'" 1 
HETATM 2888 C "C2'" . BGL E 3 .   ? 28.657  33.974 47.917 1.00 51.57  ? 303 BGL A "C2'" 1 
HETATM 2889 C "C3'" . BGL E 3 .   ? 28.217  35.261 47.140 1.00 51.86  ? 303 BGL A "C3'" 1 
HETATM 2890 C "C4'" . BGL E 3 .   ? 28.428  35.270 45.656 1.00 49.85  ? 303 BGL A "C4'" 1 
HETATM 2891 C "C5'" . BGL E 3 .   ? 27.913  36.474 44.864 1.00 48.79  ? 303 BGL A "C5'" 1 
HETATM 2892 C "C6'" . BGL E 3 .   ? 28.141  36.478 43.379 1.00 46.28  ? 303 BGL A "C6'" 1 
HETATM 2893 C C1    . BGL F 3 .   ? 31.931  36.615 55.997 1.00 79.89  ? 304 BGL A C1    1 
HETATM 2894 O O1    . BGL F 3 .   ? 31.470  35.516 55.358 1.00 85.00  ? 304 BGL A O1    1 
HETATM 2895 C C2    . BGL F 3 .   ? 30.999  37.763 55.742 1.00 72.38  ? 304 BGL A C2    1 
HETATM 2896 O O2    . BGL F 3 .   ? 31.130  38.174 54.380 1.00 59.55  ? 304 BGL A O2    1 
HETATM 2897 C C3    . BGL F 3 .   ? 31.264  38.900 56.611 1.00 77.37  ? 304 BGL A C3    1 
HETATM 2898 O O3    . BGL F 3 .   ? 30.320  39.973 56.371 1.00 84.77  ? 304 BGL A O3    1 
HETATM 2899 C C4    . BGL F 3 .   ? 31.251  38.517 58.028 1.00 76.66  ? 304 BGL A C4    1 
HETATM 2900 O O4    . BGL F 3 .   ? 31.494  39.636 58.870 1.00 83.93  ? 304 BGL A O4    1 
HETATM 2901 C C5    . BGL F 3 .   ? 32.281  37.453 58.302 1.00 79.18  ? 304 BGL A C5    1 
HETATM 2902 O O5    . BGL F 3 .   ? 32.143  36.312 57.424 1.00 77.12  ? 304 BGL A O5    1 
HETATM 2903 C C6    . BGL F 3 .   ? 32.230  37.031 59.719 1.00 88.75  ? 304 BGL A C6    1 
HETATM 2904 O O6    . BGL F 3 .   ? 33.067  35.973 60.114 1.00 97.06  ? 304 BGL A O6    1 
HETATM 2905 C "C1'" . BGL F 3 .   ? 29.986  38.300 53.582 1.00 51.00  ? 304 BGL A "C1'" 1 
HETATM 2906 C "C2'" . BGL F 3 .   ? 30.167  38.532 52.106 1.00 40.82  ? 304 BGL A "C2'" 1 
HETATM 2907 C "C3'" . BGL F 3 .   ? 29.026  39.313 51.368 1.00 54.74  ? 304 BGL A "C3'" 1 
HETATM 2908 C "C4'" . BGL F 3 .   ? 28.942  39.198 49.877 1.00 49.24  ? 304 BGL A "C4'" 1 
HETATM 2909 C "C5'" . BGL F 3 .   ? 27.789  39.928 49.183 1.00 46.87  ? 304 BGL A "C5'" 1 
HETATM 2910 C "C6'" . BGL F 3 .   ? 27.745  39.893 47.682 1.00 47.06  ? 304 BGL A "C6'" 1 
HETATM 2911 C "C7'" . BGL F 3 .   ? 26.478  40.427 46.991 1.00 44.62  ? 304 BGL A "C7'" 1 
HETATM 2912 C "C8'" . BGL F 3 .   ? 26.434  40.372 45.481 1.00 46.96  ? 304 BGL A "C8'" 1 
HETATM 2913 C C1    . BGL G 3 .   ? 15.021  51.066 29.982 1.00 97.20  ? 305 BGL A C1    1 
HETATM 2914 O O1    . BGL G 3 .   ? 14.866  49.825 29.471 1.00 109.30 ? 305 BGL A O1    1 
HETATM 2915 C C2    . BGL G 3 .   ? 15.870  51.874 29.052 1.00 96.20  ? 305 BGL A C2    1 
HETATM 2916 O O2    . BGL G 3 .   ? 17.187  51.323 29.046 1.00 102.52 ? 305 BGL A O2    1 
HETATM 2917 C C3    . BGL G 3 .   ? 15.935  53.274 29.443 1.00 93.58  ? 305 BGL A C3    1 
HETATM 2918 O O3    . BGL G 3 .   ? 16.744  54.024 28.505 1.00 91.04  ? 305 BGL A O3    1 
HETATM 2919 C C4    . BGL G 3 .   ? 14.600  53.876 29.575 1.00 93.49  ? 305 BGL A C4    1 
HETATM 2920 O O4    . BGL G 3 .   ? 14.678  55.225 30.021 1.00 87.66  ? 305 BGL A O4    1 
HETATM 2921 C C5    . BGL G 3 .   ? 13.724  53.097 30.526 1.00 92.41  ? 305 BGL A C5    1 
HETATM 2922 O O5    . BGL G 3 .   ? 13.709  51.674 30.263 1.00 88.37  ? 305 BGL A O5    1 
HETATM 2923 C C6    . BGL G 3 .   ? 12.345  53.633 30.519 1.00 87.09  ? 305 BGL A C6    1 
HETATM 2924 O O6    . BGL G 3 .   ? 11.521  53.292 31.606 1.00 81.32  ? 305 BGL A O6    1 
HETATM 2925 C "C1'" . BGL G 3 .   ? 17.707  50.772 27.869 1.00 102.39 ? 305 BGL A "C1'" 1 
HETATM 2926 C "C2'" . BGL G 3 .   ? 18.843  49.794 28.002 1.00 97.07  ? 305 BGL A "C2'" 1 
HETATM 2927 C "C3'" . BGL G 3 .   ? 18.489  48.268 28.009 1.00 47.21  ? 305 BGL A "C3'" 1 
HETATM 2928 C "C4'" . BGL G 3 .   ? 19.120  47.401 26.960 1.00 54.20  ? 305 BGL A "C4'" 1 
HETATM 2929 C "C5'" . BGL G 3 .   ? 20.592  47.019 27.137 1.00 47.49  ? 305 BGL A "C5'" 1 
HETATM 2930 C "C6'" . BGL G 3 .   ? 21.271  46.309 26.001 1.00 48.92  ? 305 BGL A "C6'" 1 
HETATM 2931 C "C7'" . BGL G 3 .   ? 21.178  44.773 25.950 1.00 54.51  ? 305 BGL A "C7'" 1 
HETATM 2932 C "C8'" . BGL G 3 .   ? 22.097  44.049 24.992 1.00 51.33  ? 305 BGL A "C8'" 1 
HETATM 2933 C C1    . BGL H 3 .   ? 14.588  53.053 34.617 1.00 102.85 ? 306 BGL A C1    1 
HETATM 2934 O O1    . BGL H 3 .   ? 13.676  52.057 34.543 1.00 112.79 ? 306 BGL A O1    1 
HETATM 2935 C C2    . BGL H 3 .   ? 15.626  52.876 33.549 1.00 91.42  ? 306 BGL A C2    1 
HETATM 2936 O O2    . BGL H 3 .   ? 16.387  51.696 33.818 1.00 89.16  ? 306 BGL A O2    1 
HETATM 2937 C C3    . BGL H 3 .   ? 16.530  54.017 33.484 1.00 89.50  ? 306 BGL A C3    1 
HETATM 2938 O O3    . BGL H 3 .   ? 17.512  53.835 32.434 1.00 81.96  ? 306 BGL A O3    1 
HETATM 2939 C C4    . BGL H 3 .   ? 15.825  55.297 33.309 1.00 98.57  ? 306 BGL A C4    1 
HETATM 2940 O O4    . BGL H 3 .   ? 16.731  56.393 33.362 1.00 92.44  ? 306 BGL A O4    1 
HETATM 2941 C C5    . BGL H 3 .   ? 14.745  55.514 34.342 1.00 104.87 ? 306 BGL A C5    1 
HETATM 2942 O O5    . BGL H 3 .   ? 13.906  54.357 34.564 1.00 104.82 ? 306 BGL A O5    1 
HETATM 2943 C C6    . BGL H 3 .   ? 13.901  56.673 33.975 1.00 106.82 ? 306 BGL A C6    1 
HETATM 2944 O O6    . BGL H 3 .   ? 12.521  56.564 34.224 1.00 105.68 ? 306 BGL A O6    1 
HETATM 2945 C "C1'" . BGL H 3 .   ? 16.015  50.468 33.256 1.00 76.72  ? 306 BGL A "C1'" 1 
HETATM 2946 C "C2'" . BGL H 3 .   ? 16.856  49.262 33.570 1.00 71.55  ? 306 BGL A "C2'" 1 
HETATM 2947 C "C3'" . BGL H 3 .   ? 18.204  49.090 32.788 1.00 73.63  ? 306 BGL A "C3'" 1 
HETATM 2948 C "C4'" . BGL H 3 .   ? 18.675  47.690 32.532 1.00 75.27  ? 306 BGL A "C4'" 1 
HETATM 2949 C "C5'" . BGL H 3 .   ? 19.654  47.453 31.378 1.00 71.56  ? 306 BGL A "C5'" 1 
HETATM 2950 C "C6'" . BGL H 3 .   ? 21.123  47.566 31.660 1.00 64.54  ? 306 BGL A "C6'" 1 
HETATM 2951 C "C7'" . BGL H 3 .   ? 21.922  46.260 31.816 1.00 55.61  ? 306 BGL A "C7'" 1 
HETATM 2952 C "C8'" . BGL H 3 .   ? 22.073  45.382 30.594 1.00 46.06  ? 306 BGL A "C8'" 1 
HETATM 2953 C C1    . BGL I 3 .   ? 8.544   52.673 29.244 1.00 83.47  ? 307 BGL A C1    1 
HETATM 2954 O O1    . BGL I 3 .   ? 9.514   51.778 29.535 1.00 90.64  ? 307 BGL A O1    1 
HETATM 2955 C C2    . BGL I 3 .   ? 8.296   53.541 30.442 1.00 85.17  ? 307 BGL A C2    1 
HETATM 2956 O O2    . BGL I 3 .   ? 7.711   52.754 31.482 1.00 88.65  ? 307 BGL A O2    1 
HETATM 2957 C C3    . BGL I 3 .   ? 7.411   54.654 30.136 1.00 80.03  ? 307 BGL A C3    1 
HETATM 2958 O O3    . BGL I 3 .   ? 7.193   55.474 31.309 1.00 79.76  ? 307 BGL A O3    1 
HETATM 2959 C C4    . BGL I 3 .   ? 7.927   55.463 29.023 1.00 79.57  ? 307 BGL A C4    1 
HETATM 2960 O O4    . BGL I 3 .   ? 7.059   56.546 28.714 1.00 81.59  ? 307 BGL A O4    1 
HETATM 2961 C C5    . BGL I 3 .   ? 8.126   54.628 27.785 1.00 82.21  ? 307 BGL A C5    1 
HETATM 2962 O O5    . BGL I 3 .   ? 8.896   53.425 28.027 1.00 75.30  ? 307 BGL A O5    1 
HETATM 2963 C C6    . BGL I 3 .   ? 8.746   55.440 26.715 1.00 89.99  ? 307 BGL A C6    1 
HETATM 2964 O O6    . BGL I 3 .   ? 7.928   55.813 25.635 1.00 94.20  ? 307 BGL A O6    1 
HETATM 2965 C "C1'" . BGL I 3 .   ? 8.465   52.415 32.612 1.00 80.10  ? 307 BGL A "C1'" 1 
HETATM 2966 C "C2'" . BGL I 3 .   ? 7.989   51.252 33.440 1.00 71.98  ? 307 BGL A "C2'" 1 
HETATM 2967 C "C3'" . BGL I 3 .   ? 9.033   50.555 34.378 1.00 62.26  ? 307 BGL A "C3'" 1 
HETATM 2968 C "C4'" . BGL I 3 .   ? 9.153   51.049 35.788 1.00 66.43  ? 307 BGL A "C4'" 1 
HETATM 2969 C "C5'" . BGL I 3 .   ? 10.391  50.620 36.582 1.00 67.29  ? 307 BGL A "C5'" 1 
HETATM 2970 C "C6'" . BGL I 3 .   ? 10.865  49.202 36.436 1.00 54.25  ? 307 BGL A "C6'" 1 
HETATM 2971 N "N1'" . TPP J 2 .   ? -17.947 29.534 35.928 1.00 52.34  ? 301 TPP B "N1'" 1 
HETATM 2972 C "C2'" . TPP J 2 .   ? -17.125 30.398 35.235 1.00 59.31  ? 301 TPP B "C2'" 1 
HETATM 2973 C CM2   . TPP J 2 .   ? -17.696 31.257 34.146 1.00 59.68  ? 301 TPP B CM2   1 
HETATM 2974 N "N3'" . TPP J 2 .   ? -15.781 30.473 35.544 1.00 56.68  ? 301 TPP B "N3'" 1 
HETATM 2975 C "C4'" . TPP J 2 .   ? -15.250 29.683 36.544 1.00 48.29  ? 301 TPP B "C4'" 1 
HETATM 2976 N "N4'" . TPP J 2 .   ? -13.955 29.765 36.834 1.00 48.31  ? 301 TPP B "N4'" 1 
HETATM 2977 C "C5'" . TPP J 2 .   ? -16.076 28.819 37.254 1.00 53.06  ? 301 TPP B "C5'" 1 
HETATM 2978 C "C6'" . TPP J 2 .   ? -17.426 28.744 36.932 1.00 55.41  ? 301 TPP B "C6'" 1 
HETATM 2979 C "C7'" . TPP J 2 .   ? -15.531 27.929 38.349 1.00 55.58  ? 301 TPP B "C7'" 1 
HETATM 2980 N N3    . TPP J 2 .   ? -15.145 28.647 39.536 1.00 51.58  ? 301 TPP B N3    1 
HETATM 2981 C C2    . TPP J 2 .   ? -15.487 29.945 39.834 1.00 51.56  ? 301 TPP B C2    1 
HETATM 2982 S S1    . TPP J 2 .   ? -14.901 30.437 41.237 1.00 42.92  ? 301 TPP B S1    1 
HETATM 2983 C C5    . TPP J 2 .   ? -14.219 29.029 41.530 1.00 46.55  ? 301 TPP B C5    1 
HETATM 2984 C C4    . TPP J 2 .   ? -14.410 28.097 40.527 1.00 43.86  ? 301 TPP B C4    1 
HETATM 2985 C CM4   . TPP J 2 .   ? -13.877 26.695 40.538 1.00 41.66  ? 301 TPP B CM4   1 
HETATM 2986 C C6    . TPP J 2 .   ? -13.481 28.951 42.834 1.00 50.39  ? 301 TPP B C6    1 
HETATM 2987 C C7    . TPP J 2 .   ? -14.409 28.369 43.891 1.00 57.45  ? 301 TPP B C7    1 
HETATM 2988 O O7    . TPP J 2 .   ? -15.384 29.338 44.202 1.00 62.10  ? 301 TPP B O7    1 
HETATM 2989 P PA    . TPP J 2 .   ? -16.532 29.045 45.289 1.00 76.29  ? 301 TPP B PA    1 
HETATM 2990 O O1A   . TPP J 2 .   ? -17.677 28.317 44.626 1.00 73.09  ? 301 TPP B O1A   1 
HETATM 2991 O O2A   . TPP J 2 .   ? -17.000 30.330 45.929 1.00 71.29  ? 301 TPP B O2A   1 
HETATM 2992 O O3A   . TPP J 2 .   ? -15.817 28.066 46.350 1.00 188.81 ? 301 TPP B O3A   1 
HETATM 2993 P PB    . TPP J 2 .   ? -15.247 28.616 47.752 1.00 57.47  ? 301 TPP B PB    1 
HETATM 2994 O O1B   . TPP J 2 .   ? -14.727 30.022 47.569 1.00 51.27  ? 301 TPP B O1B   1 
HETATM 2995 O O2B   . TPP J 2 .   ? -16.352 28.616 48.781 1.00 74.43  ? 301 TPP B O2B   1 
HETATM 2996 O O3B   . TPP J 2 .   ? -14.126 27.721 48.222 1.00 60.14  ? 301 TPP B O3B   1 
HETATM 2997 C C1    . BGL K 3 .   ? -29.992 35.641 27.533 1.00 85.54  ? 302 BGL B C1    1 
HETATM 2998 O O1    . BGL K 3 .   ? -29.960 36.967 27.797 1.00 85.77  ? 302 BGL B O1    1 
HETATM 2999 C C2    . BGL K 3 .   ? -30.646 34.930 28.684 1.00 79.23  ? 302 BGL B C2    1 
HETATM 3000 O O2    . BGL K 3 .   ? -29.737 34.871 29.785 1.00 70.12  ? 302 BGL B O2    1 
HETATM 3001 C C3    . BGL K 3 .   ? -31.048 33.580 28.333 1.00 82.17  ? 302 BGL B C3    1 
HETATM 3002 O O3    . BGL K 3 .   ? -31.636 32.903 29.470 1.00 81.18  ? 302 BGL B O3    1 
HETATM 3003 C C4    . BGL K 3 .   ? -31.972 33.604 27.194 1.00 95.16  ? 302 BGL B C4    1 
HETATM 3004 O O4    . BGL K 3 .   ? -32.499 32.317 26.901 1.00 96.95  ? 302 BGL B O4    1 
HETATM 3005 C C5    . BGL K 3 .   ? -31.284 34.156 25.974 1.00 101.38 ? 302 BGL B C5    1 
HETATM 3006 O O5    . BGL K 3 .   ? -30.618 35.421 26.214 1.00 91.21  ? 302 BGL B O5    1 
HETATM 3007 C C6    . BGL K 3 .   ? -32.251 34.286 24.860 1.00 106.97 ? 302 BGL B C6    1 
HETATM 3008 O O6    . BGL K 3 .   ? -31.843 33.859 23.584 1.00 101.96 ? 302 BGL B O6    1 
HETATM 3009 C "C1'" . BGL K 3 .   ? -30.025 35.546 30.978 1.00 54.75  ? 302 BGL B "C1'" 1 
HETATM 3010 C "C2'" . BGL K 3 .   ? -28.953 36.447 31.531 1.00 50.42  ? 302 BGL B "C2'" 1 
HETATM 3011 C "C3'" . BGL K 3 .   ? -28.776 36.535 33.086 1.00 33.86  ? 302 BGL B "C3'" 1 
HETATM 3012 C "C4'" . BGL K 3 .   ? -27.851 37.593 33.606 1.00 32.06  ? 302 BGL B "C4'" 1 
HETATM 3013 C "C5'" . BGL K 3 .   ? -27.651 37.695 35.120 1.00 30.47  ? 302 BGL B "C5'" 1 
HETATM 3014 C "C6'" . BGL K 3 .   ? -26.675 38.719 35.625 1.00 37.10  ? 302 BGL B "C6'" 1 
HETATM 3015 C "C7'" . BGL K 3 .   ? -26.667 39.015 37.136 1.00 39.20  ? 302 BGL B "C7'" 1 
HETATM 3016 C "C8'" . BGL K 3 .   ? -25.700 40.063 37.638 1.00 38.61  ? 302 BGL B "C8'" 1 
HETATM 3017 C C1    . BGL L 3 .   ? -27.960 26.931 47.453 1.00 82.26  ? 303 BGL B C1    1 
HETATM 3018 O O1    . BGL L 3 .   ? -26.683 27.301 47.704 1.00 61.48  ? 303 BGL B O1    1 
HETATM 3019 C C2    . BGL L 3 .   ? -28.721 28.114 46.939 1.00 83.39  ? 303 BGL B C2    1 
HETATM 3020 O O2    . BGL L 3 .   ? -28.836 29.081 47.984 1.00 64.65  ? 303 BGL B O2    1 
HETATM 3021 C C3    . BGL L 3 .   ? -30.052 27.752 46.478 1.00 97.33  ? 303 BGL B C3    1 
HETATM 3022 O O3    . BGL L 3 .   ? -30.736 28.916 45.953 1.00 103.56 ? 303 BGL B O3    1 
HETATM 3023 C C4    . BGL L 3 .   ? -30.033 26.681 45.470 1.00 98.01  ? 303 BGL B C4    1 
HETATM 3024 O O4    . BGL L 3 .   ? -31.352 26.271 45.135 1.00 102.28 ? 303 BGL B O4    1 
HETATM 3025 C C5    . BGL L 3 .   ? -29.256 25.468 45.917 1.00 97.04  ? 303 BGL B C5    1 
HETATM 3026 O O5    . BGL L 3 .   ? -27.985 25.774 46.542 1.00 93.40  ? 303 BGL B O5    1 
HETATM 3027 C C6    . BGL L 3 .   ? -29.053 24.558 44.768 1.00 98.93  ? 303 BGL B C6    1 
HETATM 3028 O O6    . BGL L 3 .   ? -28.890 25.141 43.499 1.00 96.58  ? 303 BGL B O6    1 
HETATM 3029 C "C1'" . BGL L 3 .   ? -28.072 30.252 47.936 1.00 59.73  ? 303 BGL B "C1'" 1 
HETATM 3030 C "C2'" . BGL L 3 .   ? -28.706 31.476 47.333 1.00 53.74  ? 303 BGL B "C2'" 1 
HETATM 3031 C "C3'" . BGL L 3 .   ? -27.761 32.637 46.869 1.00 42.40  ? 303 BGL B "C3'" 1 
HETATM 3032 C "C4'" . BGL L 3 .   ? -28.210 34.042 47.139 1.00 36.78  ? 303 BGL B "C4'" 1 
HETATM 3033 C "C5'" . BGL L 3 .   ? -27.513 35.169 46.374 1.00 32.21  ? 303 BGL B "C5'" 1 
HETATM 3034 C "C6'" . BGL L 3 .   ? -27.653 36.563 46.914 1.00 45.43  ? 303 BGL B "C6'" 1 
HETATM 3035 C "C7'" . BGL L 3 .   ? -29.046 37.216 46.874 1.00 51.06  ? 303 BGL B "C7'" 1 
HETATM 3036 C "C8'" . BGL L 3 .   ? -29.119 38.708 47.110 1.00 54.16  ? 303 BGL B "C8'" 1 
HETATM 3037 C C1    . BGL M 3 .   ? -7.622  39.855 29.987 1.00 115.32 ? 304 BGL B C1    1 
HETATM 3038 O O1    . BGL M 3 .   ? -6.519  40.477 30.463 1.00 117.41 ? 304 BGL B O1    1 
HETATM 3039 C C2    . BGL M 3 .   ? -8.384  40.791 29.097 1.00 116.68 ? 304 BGL B C2    1 
HETATM 3040 O O2    . BGL M 3 .   ? -9.420  41.429 29.848 1.00 115.41 ? 304 BGL B O2    1 
HETATM 3041 C C3    . BGL M 3 .   ? -8.992  40.100 27.971 1.00 110.46 ? 304 BGL B C3    1 
HETATM 3042 O O3    . BGL M 3 .   ? -9.793  41.021 27.190 1.00 107.94 ? 304 BGL B O3    1 
HETATM 3043 C C4    . BGL M 3 .   ? -8.012  39.408 27.118 1.00 105.74 ? 304 BGL B C4    1 
HETATM 3044 O O4    . BGL M 3 .   ? -8.678  38.525 26.222 1.00 96.68  ? 304 BGL B O4    1 
HETATM 3045 C C5    . BGL M 3 .   ? -6.997  38.616 27.911 1.00 110.40 ? 304 BGL B C5    1 
HETATM 3046 O O5    . BGL M 3 .   ? -7.237  38.589 29.340 1.00 108.69 ? 304 BGL B O5    1 
HETATM 3047 C C6    . BGL M 3 .   ? -5.620  39.090 27.639 1.00 107.69 ? 304 BGL B C6    1 
HETATM 3048 O O6    . BGL M 3 .   ? -5.299  39.431 26.313 1.00 103.25 ? 304 BGL B O6    1 
HETATM 3049 C "C1'" . BGL M 3 .   ? -9.110  42.338 30.867 1.00 113.89 ? 304 BGL B "C1'" 1 
HETATM 3050 C "C2'" . BGL M 3 .   ? -10.031 42.381 32.056 1.00 112.46 ? 304 BGL B "C2'" 1 
HETATM 3051 C "C3'" . BGL M 3 .   ? -9.919  41.227 33.112 1.00 63.77  ? 304 BGL B "C3'" 1 
HETATM 3052 C "C4'" . BGL M 3 .   ? -11.159 40.861 33.872 1.00 60.27  ? 304 BGL B "C4'" 1 
HETATM 3053 C "C5'" . BGL M 3 .   ? -11.050 40.688 35.391 1.00 57.83  ? 304 BGL B "C5'" 1 
HETATM 3054 C "C6'" . BGL M 3 .   ? -12.321 40.460 36.159 1.00 63.88  ? 304 BGL B "C6'" 1 
HETATM 3055 C "C7'" . BGL M 3 .   ? -12.213 40.125 37.659 1.00 57.81  ? 304 BGL B "C7'" 1 
HETATM 3056 C "C8'" . BGL M 3 .   ? -13.499 39.802 38.385 1.00 30.70  ? 304 BGL B "C8'" 1 
HETATM 3057 C C1    . BGL N 3 .   ? -26.827 29.387 34.299 1.00 81.09  ? 305 BGL B C1    1 
HETATM 3058 O O1    . BGL N 3 .   ? -28.154 29.608 34.160 1.00 78.89  ? 305 BGL B O1    1 
HETATM 3059 C C2    . BGL N 3 .   ? -26.444 29.571 35.737 1.00 82.96  ? 305 BGL B C2    1 
HETATM 3060 O O2    . BGL N 3 .   ? -26.589 30.943 36.110 1.00 79.64  ? 305 BGL B O2    1 
HETATM 3061 C C3    . BGL N 3 .   ? -25.078 29.137 35.983 1.00 81.57  ? 305 BGL B C3    1 
HETATM 3062 O O3    . BGL N 3 .   ? -24.688 29.391 37.354 1.00 69.29  ? 305 BGL B O3    1 
HETATM 3063 C C4    . BGL N 3 .   ? -24.911 27.717 35.645 1.00 83.73  ? 305 BGL B C4    1 
HETATM 3064 O O4    . BGL N 3 .   ? -23.587 27.265 35.903 1.00 85.71  ? 305 BGL B O4    1 
HETATM 3065 C C5    . BGL N 3 .   ? -25.249 27.447 34.199 1.00 82.01  ? 305 BGL B C5    1 
HETATM 3066 O O5    . BGL N 3 .   ? -26.487 28.059 33.754 1.00 81.84  ? 305 BGL B O5    1 
HETATM 3067 C C6    . BGL N 3 .   ? -25.288 25.987 33.957 1.00 82.21  ? 305 BGL B C6    1 
HETATM 3068 O O6    . BGL N 3 .   ? -25.358 25.550 32.622 1.00 84.66  ? 305 BGL B O6    1 
HETATM 3069 C "C1'" . BGL N 3 .   ? -27.692 31.327 36.886 1.00 66.04  ? 305 BGL B "C1'" 1 
HETATM 3070 C "C2'" . BGL N 3 .   ? -27.574 32.564 37.736 1.00 38.31  ? 305 BGL B "C2'" 1 
HETATM 3071 C "C3'" . BGL N 3 .   ? -27.730 33.956 37.037 1.00 29.98  ? 305 BGL B "C3'" 1 
HETATM 3072 C "C4'" . BGL N 3 .   ? -27.765 35.168 37.918 1.00 40.36  ? 305 BGL B "C4'" 1 
HETATM 3073 C "C5'" . BGL N 3 .   ? -27.016 35.090 39.250 1.00 56.66  ? 305 BGL B "C5'" 1 
HETATM 3074 C "C6'" . BGL N 3 .   ? -26.716 36.379 39.958 1.00 66.10  ? 305 BGL B "C6'" 1 
HETATM 3075 C "C7'" . BGL N 3 .   ? -27.210 36.531 41.407 1.00 70.29  ? 305 BGL B "C7'" 1 
HETATM 3076 C "C8'" . BGL N 3 .   ? -28.704 36.512 41.637 1.00 77.50  ? 305 BGL B "C8'" 1 
HETATM 3077 C C1    . BGL O 3 .   ? -13.860 56.288 50.797 1.00 88.15  ? 306 BGL B C1    1 
HETATM 3078 O O1    . BGL O 3 .   ? -15.150 56.695 50.845 1.00 95.69  ? 306 BGL B O1    1 
HETATM 3079 C C2    . BGL O 3 .   ? -13.802 54.880 50.278 1.00 79.08  ? 306 BGL B C2    1 
HETATM 3080 O O2    . BGL O 3 .   ? -14.287 53.997 51.292 1.00 74.25  ? 306 BGL B O2    1 
HETATM 3081 C C3    . BGL O 3 .   ? -12.450 54.486 49.909 1.00 77.69  ? 306 BGL B C3    1 
HETATM 3082 O O3    . BGL O 3 .   ? -12.412 53.132 49.395 1.00 67.03  ? 306 BGL B O3    1 
HETATM 3083 C C4    . BGL O 3 .   ? -11.859 55.416 48.940 1.00 87.55  ? 306 BGL B C4    1 
HETATM 3084 O O4    . BGL O 3 .   ? -10.557 55.002 48.546 1.00 88.75  ? 306 BGL B O4    1 
HETATM 3085 C C5    . BGL O 3 .   ? -11.791 56.810 49.507 1.00 93.91  ? 306 BGL B C5    1 
HETATM 3086 O O5    . BGL O 3 .   ? -13.059 57.266 50.035 1.00 91.03  ? 306 BGL B O5    1 
HETATM 3087 C C6    . BGL O 3 .   ? -11.291 57.759 48.487 1.00 101.86 ? 306 BGL B C6    1 
HETATM 3088 O O6    . BGL O 3 .   ? -11.152 59.105 48.867 1.00 106.62 ? 306 BGL B O6    1 
HETATM 3089 C "C1'" . BGL O 3 .   ? -15.625 53.579 51.299 1.00 63.09  ? 306 BGL B "C1'" 1 
HETATM 3090 C "C2'" . BGL O 3 .   ? -16.274 53.360 52.640 1.00 47.51  ? 306 BGL B "C2'" 1 
HETATM 3091 C "C3'" . BGL O 3 .   ? -17.486 52.370 52.720 1.00 51.62  ? 306 BGL B "C3'" 1 
HETATM 3092 C "C4'" . BGL O 3 .   ? -18.103 52.132 54.067 1.00 56.77  ? 306 BGL B "C4'" 1 
HETATM 3093 C "C5'" . BGL O 3 .   ? -19.131 51.002 54.182 1.00 53.44  ? 306 BGL B "C5'" 1 
HETATM 3094 C "C6'" . BGL O 3 .   ? -19.618 50.618 55.551 1.00 43.09  ? 306 BGL B "C6'" 1 
HETATM 3095 C "C7'" . BGL O 3 .   ? -20.547 49.394 55.654 1.00 42.03  ? 306 BGL B "C7'" 1 
HETATM 3096 C "C8'" . BGL O 3 .   ? -21.083 49.025 57.020 1.00 31.53  ? 306 BGL B "C8'" 1 
HETATM 3097 C C1    . BGL P 3 .   ? -16.822 56.746 42.023 1.00 91.65  ? 307 BGL B C1    1 
HETATM 3098 O O1    . BGL P 3 .   ? -15.693 57.367 42.442 1.00 90.48  ? 307 BGL B O1    1 
HETATM 3099 C C2    . BGL P 3 .   ? -17.688 56.381 43.193 1.00 85.70  ? 307 BGL B C2    1 
HETATM 3100 O O2    . BGL P 3 .   ? -17.786 54.956 43.186 1.00 68.46  ? 307 BGL B O2    1 
HETATM 3101 C C3    . BGL P 3 .   ? -19.020 56.980 43.132 1.00 94.06  ? 307 BGL B C3    1 
HETATM 3102 O O3    . BGL P 3 .   ? -19.731 56.830 44.386 1.00 94.40  ? 307 BGL B O3    1 
HETATM 3103 C C4    . BGL P 3 .   ? -18.992 58.406 42.769 1.00 91.89  ? 307 BGL B C4    1 
HETATM 3104 O O4    . BGL P 3 .   ? -20.305 58.957 42.730 1.00 81.29  ? 307 BGL B O4    1 
HETATM 3105 C C5    . BGL P 3 .   ? -18.319 58.652 41.442 1.00 100.63 ? 307 BGL B C5    1 
HETATM 3106 O O5    . BGL P 3 .   ? -17.501 57.547 40.989 1.00 96.70  ? 307 BGL B O5    1 
HETATM 3107 C C6    . BGL P 3 .   ? -17.513 59.894 41.503 1.00 108.74 ? 307 BGL B C6    1 
HETATM 3108 O O6    . BGL P 3 .   ? -18.064 61.066 40.950 1.00 105.83 ? 307 BGL B O6    1 
HETATM 3109 C "C1'" . BGL P 3 .   ? -18.081 54.228 44.344 1.00 49.48  ? 307 BGL B "C1'" 1 
HETATM 3110 C "C2'" . BGL P 3 .   ? -19.256 53.296 44.237 1.00 48.11  ? 307 BGL B "C2'" 1 
HETATM 3111 C "C3'" . BGL P 3 .   ? -19.138 51.887 44.906 1.00 55.81  ? 307 BGL B "C3'" 1 
HETATM 3112 C "C4'" . BGL P 3 .   ? -19.260 50.686 44.022 1.00 45.31  ? 307 BGL B "C4'" 1 
HETATM 3113 C "C5'" . BGL P 3 .   ? -19.859 49.417 44.629 1.00 46.52  ? 307 BGL B "C5'" 1 
HETATM 3114 C "C6'" . BGL P 3 .   ? -19.036 48.655 45.625 1.00 40.62  ? 307 BGL B "C6'" 1 
HETATM 3115 C "C7'" . BGL P 3 .   ? -18.126 47.535 45.093 1.00 46.96  ? 307 BGL B "C7'" 1 
HETATM 3116 C "C8'" . BGL P 3 .   ? -17.639 46.503 46.084 1.00 54.34  ? 307 BGL B "C8'" 1 
HETATM 3117 C C1    . BGL Q 3 .   ? -6.959  57.965 49.039 1.00 74.21  ? 308 BGL B C1    1 
HETATM 3118 O O1    . BGL Q 3 .   ? -5.945  58.199 48.175 1.00 76.68  ? 308 BGL B O1    1 
HETATM 3119 C C2    . BGL Q 3 .   ? -7.037  56.498 49.325 1.00 72.44  ? 308 BGL B C2    1 
HETATM 3120 O O2    . BGL Q 3 .   ? -7.404  55.802 48.133 1.00 74.44  ? 308 BGL B O2    1 
HETATM 3121 C C3    . BGL Q 3 .   ? -8.012  56.206 50.362 1.00 74.43  ? 308 BGL B C3    1 
HETATM 3122 O O3    . BGL Q 3 .   ? -8.056  54.782 50.614 1.00 84.46  ? 308 BGL B O3    1 
HETATM 3123 C C4    . BGL Q 3 .   ? -7.742  56.938 51.609 1.00 73.47  ? 308 BGL B C4    1 
HETATM 3124 O O4    . BGL Q 3 .   ? -8.767  56.714 52.570 1.00 66.35  ? 308 BGL B O4    1 
HETATM 3125 C C5    . BGL Q 3 .   ? -7.598  58.425 51.395 1.00 73.36  ? 308 BGL B C5    1 
HETATM 3126 O O5    . BGL Q 3 .   ? -6.791  58.789 50.248 1.00 68.66  ? 308 BGL B O5    1 
HETATM 3127 C C6    . BGL Q 3 .   ? -7.049  59.054 52.616 1.00 75.72  ? 308 BGL B C6    1 
HETATM 3128 O O6    . BGL Q 3 .   ? -6.302  60.235 52.456 1.00 80.46  ? 308 BGL B O6    1 
HETATM 3129 C "C1'" . BGL Q 3 .   ? -6.532  54.858 47.575 1.00 65.87  ? 308 BGL B "C1'" 1 
HETATM 3130 C "C2'" . BGL Q 3 .   ? -7.053  53.464 47.354 1.00 56.27  ? 308 BGL B "C2'" 1 
HETATM 3131 C "C3'" . BGL Q 3 .   ? -7.702  53.133 45.966 1.00 64.73  ? 308 BGL B "C3'" 1 
HETATM 3132 C "C4'" . BGL Q 3 .   ? -8.379  51.803 45.818 1.00 62.52  ? 308 BGL B "C4'" 1 
HETATM 3133 C "C5'" . BGL Q 3 .   ? -9.280  51.588 44.599 1.00 51.08  ? 308 BGL B "C5'" 1 
HETATM 3134 C "C6'" . BGL Q 3 .   ? -10.118 50.341 44.563 1.00 39.37  ? 308 BGL B "C6'" 1 
HETATM 3135 C C1    . BGL R 3 .   ? -14.314 44.394 33.222 1.00 109.93 ? 309 BGL B C1    1 
HETATM 3136 O O1    . BGL R 3 .   ? -13.627 43.569 34.043 1.00 122.06 ? 309 BGL B O1    1 
HETATM 3137 C C2    . BGL R 3 .   ? -14.715 45.628 33.976 1.00 97.26  ? 309 BGL B C2    1 
HETATM 3138 O O2    . BGL R 3 .   ? -15.748 45.296 34.909 1.00 84.95  ? 309 BGL B O2    1 
HETATM 3139 C C3    . BGL R 3 .   ? -15.206 46.676 33.092 1.00 96.47  ? 309 BGL B C3    1 
HETATM 3140 O O3    . BGL R 3 .   ? -15.561 47.861 33.845 1.00 89.41  ? 309 BGL B O3    1 
HETATM 3141 C C4    . BGL R 3 .   ? -14.244 47.011 32.032 1.00 98.57  ? 309 BGL B C4    1 
HETATM 3142 O O4    . BGL R 3 .   ? -14.758 48.014 31.165 1.00 93.88  ? 309 BGL B O4    1 
HETATM 3143 C C5    . BGL R 3 .   ? -13.871 45.803 31.211 1.00 104.14 ? 309 BGL B C5    1 
HETATM 3144 O O5    . BGL R 3 .   ? -13.517 44.647 32.007 1.00 106.68 ? 309 BGL B O5    1 
HETATM 3145 C C6    . BGL R 3 .   ? -12.764 46.135 30.287 1.00 103.96 ? 309 BGL B C6    1 
HETATM 3146 O O6    . BGL R 3 .   ? -11.998 45.068 29.786 1.00 103.85 ? 309 BGL B O6    1 
HETATM 3147 C "C1'" . BGL R 3 .   ? -15.440 44.901 36.218 1.00 71.76  ? 309 BGL B "C1'" 1 
HETATM 3148 C "C2'" . BGL R 3 .   ? -16.422 43.996 36.913 1.00 70.81  ? 309 BGL B "C2'" 1 
HETATM 3149 C "C3'" . BGL R 3 .   ? -15.994 43.336 38.269 1.00 49.89  ? 309 BGL B "C3'" 1 
HETATM 3150 C "C4'" . BGL R 3 .   ? -16.082 44.163 39.517 1.00 46.65  ? 309 BGL B "C4'" 1 
HETATM 3151 C "C5'" . BGL R 3 .   ? -15.876 43.445 40.854 1.00 47.58  ? 309 BGL B "C5'" 1 
HETATM 3152 C "C6'" . BGL R 3 .   ? -15.831 44.280 42.102 1.00 48.46  ? 309 BGL B "C6'" 1 
HETATM 3153 C C1    . BGL S 3 .   ? -15.475 56.369 46.599 1.00 92.26  ? 310 BGL B C1    1 
HETATM 3154 O O1    . BGL S 3 .   ? -16.699 55.808 46.726 1.00 91.63  ? 310 BGL B O1    1 
HETATM 3155 C C2    . BGL S 3 .   ? -14.575 55.439 45.843 1.00 86.76  ? 310 BGL B C2    1 
HETATM 3156 O O2    . BGL S 3 .   ? -14.370 54.255 46.616 1.00 75.75  ? 310 BGL B O2    1 
HETATM 3157 C C3    . BGL S 3 .   ? -13.292 56.058 45.554 1.00 95.54  ? 310 BGL B C3    1 
HETATM 3158 O O3    . BGL S 3 .   ? -12.428 55.141 44.840 1.00 94.19  ? 310 BGL B O3    1 
HETATM 3159 C C4    . BGL S 3 .   ? -13.442 57.315 44.803 1.00 101.75 ? 310 BGL B C4    1 
HETATM 3160 O O4    . BGL S 3 .   ? -12.183 57.943 44.588 1.00 102.27 ? 310 BGL B O4    1 
HETATM 3161 C C5    . BGL S 3 .   ? -14.361 58.294 45.493 1.00 101.88 ? 310 BGL B C5    1 
HETATM 3162 O O5    . BGL S 3 .   ? -15.589 57.704 45.985 1.00 94.58  ? 310 BGL B O5    1 
HETATM 3163 C C6    . BGL S 3 .   ? -14.662 59.425 44.585 1.00 104.00 ? 310 BGL B C6    1 
HETATM 3164 O O6    . BGL S 3 .   ? -15.948 59.991 44.648 1.00 102.37 ? 310 BGL B O6    1 
HETATM 3165 C "C1'" . BGL S 3 .   ? -14.695 53.002 46.080 1.00 66.45  ? 310 BGL B "C1'" 1 
HETATM 3166 C "C2'" . BGL S 3 .   ? -15.049 51.899 47.042 1.00 58.62  ? 310 BGL B "C2'" 1 
HETATM 3167 C "C3'" . BGL S 3 .   ? -16.406 52.024 47.818 1.00 58.73  ? 310 BGL B "C3'" 1 
HETATM 3168 C "C4'" . BGL S 3 .   ? -16.879 50.840 48.606 1.00 56.99  ? 310 BGL B "C4'" 1 
HETATM 3169 C "C5'" . BGL S 3 .   ? -18.208 50.972 49.356 1.00 53.46  ? 310 BGL B "C5'" 1 
HETATM 3170 C "C6'" . BGL S 3 .   ? -18.963 49.711 49.668 1.00 53.11  ? 310 BGL B "C6'" 1 
HETATM 3171 C "C7'" . BGL S 3 .   ? -20.337 49.842 50.349 1.00 47.71  ? 310 BGL B "C7'" 1 
HETATM 3172 C "C8'" . BGL S 3 .   ? -21.040 48.566 50.753 1.00 42.87  ? 310 BGL B "C8'" 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ASN A 31  ? 0.9256 1.5761 1.1313 -0.0608 -0.1285 -0.2555 3   ASN A N     
2    C CA    . ASN A 31  ? 0.9145 1.5838 1.0855 -0.0578 -0.1327 -0.2403 3   ASN A CA    
3    C C     . ASN A 31  ? 0.8993 1.5414 1.0624 -0.0487 -0.1249 -0.2126 3   ASN A C     
4    O O     . ASN A 31  ? 0.9190 1.5348 1.0844 -0.0457 -0.1115 -0.2157 3   ASN A O     
5    C CB    . ASN A 31  ? 0.9284 1.6353 1.0873 -0.0601 -0.1509 -0.2302 3   ASN A CB    
6    C CG    . ASN A 31  ? 0.9787 1.7224 1.1325 -0.0699 -0.1595 -0.2583 3   ASN A CG    
7    O OD1   . ASN A 31  ? 0.9838 1.7422 1.1550 -0.0742 -0.1698 -0.2664 3   ASN A OD1   
8    N ND2   . ASN A 31  ? 0.9739 1.7328 1.1042 -0.0738 -0.1547 -0.2742 3   ASN A ND2   
9    N N     . LYS A 32  ? 0.7592 1.4083 0.9154 -0.0443 -0.1337 -0.1859 4   LYS A N     
10   C CA    . LYS A 32  ? 0.6603 1.2885 0.8081 -0.0363 -0.1277 -0.1598 4   LYS A CA    
11   C C     . LYS A 32  ? 0.7255 1.3142 0.8943 -0.0321 -0.1148 -0.1570 4   LYS A C     
12   O O     . LYS A 32  ? 0.7323 1.3013 0.8926 -0.0275 -0.1048 -0.1487 4   LYS A O     
13   C CB    . LYS A 32  ? 0.4117 1.0536 0.5569 -0.0327 -0.1402 -0.1333 4   LYS A CB    
14   N N     . ARG A 33  ? 0.7592 1.3384 0.9554 -0.0342 -0.1151 -0.1637 5   ARG A N     
15   C CA    . ARG A 33  ? 0.6910 1.2354 0.9065 -0.0316 -0.1031 -0.1604 5   ARG A CA    
16   C C     . ARG A 33  ? 0.8235 1.3487 1.0382 -0.0324 -0.0909 -0.1752 5   ARG A C     
17   O O     . ARG A 33  ? 0.8482 1.3480 1.0622 -0.0277 -0.0810 -0.1651 5   ARG A O     
18   C CB    . ARG A 33  ? 0.6330 1.1745 0.8780 -0.0355 -0.1054 -0.1668 5   ARG A CB    
19   C CG    . ARG A 33  ? 0.6621 1.2162 0.9155 -0.0331 -0.1154 -0.1500 5   ARG A CG    
20   C CD    . ARG A 33  ? 0.5499 1.1051 0.8343 -0.0379 -0.1174 -0.1594 5   ARG A CD    
21   N NE    . ARG A 33  ? 0.5185 1.0851 0.8153 -0.0347 -0.1263 -0.1437 5   ARG A NE    
22   C CZ    . ARG A 33  ? 0.6745 1.2722 0.9702 -0.0351 -0.1422 -0.1414 5   ARG A CZ    
23   N NH1   . ARG A 33  ? 0.8022 1.4244 1.0814 -0.0395 -0.1507 -0.1545 5   ARG A NH1   
24   N NH2   . ARG A 33  ? 0.6252 1.2306 0.9370 -0.0312 -0.1498 -0.1262 5   ARG A NH2   
25   N N     . LEU A 34  ? 0.8889 1.4274 1.1054 -0.0383 -0.0919 -0.1998 6   LEU A N     
26   C CA    . LEU A 34  ? 0.9146 1.4369 1.1349 -0.0389 -0.0809 -0.2162 6   LEU A CA    
27   C C     . LEU A 34  ? 0.8844 1.4079 1.0792 -0.0340 -0.0764 -0.2092 6   LEU A C     
28   O O     . LEU A 34  ? 0.8919 1.3918 1.0901 -0.0300 -0.0661 -0.2077 6   LEU A O     
29   C CB    . LEU A 34  ? 1.0515 1.5909 1.2820 -0.0468 -0.0832 -0.2469 6   LEU A CB    
30   C CG    . LEU A 34  ? 1.1186 1.6572 1.3783 -0.0530 -0.0866 -0.2580 6   LEU A CG    
31   C CD1   . LEU A 34  ? 1.1403 1.6990 1.4091 -0.0614 -0.0892 -0.2906 6   LEU A CD1   
32   C CD2   . LEU A 34  ? 1.0775 1.5787 1.3621 -0.0515 -0.0757 -0.2515 6   LEU A CD2   
33   N N     . ILE A 35  ? 0.8327 1.3849 1.0029 -0.0345 -0.0845 -0.2039 7   ILE A N     
34   C CA    . ILE A 35  ? 0.7607 1.3185 0.9059 -0.0313 -0.0803 -0.1976 7   ILE A CA    
35   C C     . ILE A 35  ? 0.6896 1.2227 0.8319 -0.0235 -0.0742 -0.1728 7   ILE A C     
36   O O     . ILE A 35  ? 0.6600 1.1790 0.7985 -0.0201 -0.0648 -0.1737 7   ILE A O     
37   C CB    . ILE A 35  ? 0.6246 1.2198 0.7430 -0.0344 -0.0909 -0.1931 7   ILE A CB    
38   C CG1   . ILE A 35  ? 0.5351 1.1589 0.6515 -0.0429 -0.0954 -0.2218 7   ILE A CG1   
39   C CG2   . ILE A 35  ? 0.5519 1.1510 0.6453 -0.0312 -0.0855 -0.1815 7   ILE A CG2   
40   C CD1   . ILE A 35  ? 0.5476 1.1667 0.6672 -0.0449 -0.0839 -0.2482 7   ILE A CD1   
41   N N     . ILE A 36  ? 0.6500 1.1789 0.7963 -0.0209 -0.0798 -0.1519 8   ILE A N     
42   C CA    . ILE A 36  ? 0.5846 1.0922 0.7297 -0.0143 -0.0745 -0.1298 8   ILE A CA    
43   C C     . ILE A 36  ? 0.4976 0.9736 0.6594 -0.0120 -0.0636 -0.1333 8   ILE A C     
44   O O     . ILE A 36  ? 0.4550 0.9157 0.6110 -0.0074 -0.0563 -0.1247 8   ILE A O     
45   C CB    . ILE A 36  ? 0.5330 1.0430 0.6846 -0.0123 -0.0822 -0.1099 8   ILE A CB    
46   C CG1   . ILE A 36  ? 0.5121 1.0530 0.6471 -0.0138 -0.0941 -0.1016 8   ILE A CG1   
47   C CG2   . ILE A 36  ? 0.4503 0.9382 0.6031 -0.0063 -0.0757 -0.0906 8   ILE A CG2   
48   C CD1   . ILE A 36  ? 0.3571 0.9020 0.5030 -0.0113 -0.1030 -0.0826 8   ILE A CD1   
49   N N     . LEU A 37  ? 0.4874 0.9545 0.6705 -0.0156 -0.0628 -0.1455 9   LEU A N     
50   C CA    . LEU A 37  ? 0.5210 0.9591 0.7208 -0.0144 -0.0531 -0.1478 9   LEU A CA    
51   C C     . LEU A 37  ? 0.5622 0.9938 0.7593 -0.0130 -0.0460 -0.1608 9   LEU A C     
52   O O     . LEU A 37  ? 0.5694 0.9797 0.7692 -0.0087 -0.0386 -0.1535 9   LEU A O     
53   C CB    . LEU A 37  ? 0.5038 0.9356 0.7283 -0.0198 -0.0535 -0.1583 9   LEU A CB    
54   C CG    . LEU A 37  ? 0.5272 0.9578 0.7620 -0.0206 -0.0569 -0.1450 9   LEU A CG    
55   C CD1   . LEU A 37  ? 0.3414 0.7664 0.6020 -0.0270 -0.0559 -0.1573 9   LEU A CD1   
56   C CD2   . LEU A 37  ? 0.5220 0.9326 0.7538 -0.0155 -0.0505 -0.1250 9   LEU A CD2   
57   N N     . LEU A 38  ? 0.5464 0.9980 0.7391 -0.0169 -0.0484 -0.1808 10  LEU A N     
58   C CA    . LEU A 38  ? 0.5266 0.9757 0.7194 -0.0158 -0.0414 -0.1965 10  LEU A CA    
59   C C     . LEU A 38  ? 0.5938 1.0436 0.7666 -0.0101 -0.0377 -0.1838 10  LEU A C     
60   O O     . LEU A 38  ? 0.6552 1.0891 0.8343 -0.0060 -0.0300 -0.1861 10  LEU A O     
61   C CB    . LEU A 38  ? 0.5732 1.0484 0.7639 -0.0221 -0.0446 -0.2227 10  LEU A CB    
62   C CG    . LEU A 38  ? 0.6948 1.1658 0.9124 -0.0281 -0.0448 -0.2441 10  LEU A CG    
63   C CD1   . LEU A 38  ? 0.7303 1.2315 0.9432 -0.0348 -0.0481 -0.2719 10  LEU A CD1   
64   C CD2   . LEU A 38  ? 0.7072 1.1460 0.9507 -0.0254 -0.0351 -0.2487 10  LEU A CD2   
65   N N     . GLU A 39  ? 0.5943 1.0628 0.7452 -0.0099 -0.0434 -0.1699 11  GLU A N     
66   C CA    . GLU A 39  ? 0.5615 1.0317 0.6943 -0.0054 -0.0399 -0.1563 11  GLU A CA    
67   C C     . GLU A 39  ? 0.6247 1.0666 0.7659 0.0007  -0.0345 -0.1398 11  GLU A C     
68   O O     . GLU A 39  ? 0.6926 1.1273 0.8300 0.0047  -0.0282 -0.1374 11  GLU A O     
69   C CB    . GLU A 39  ? 0.5115 1.0044 0.6230 -0.0066 -0.0478 -0.1408 11  GLU A CB    
70   C CG    . GLU A 39  ? 0.5689 1.0950 0.6646 -0.0127 -0.0532 -0.1546 11  GLU A CG    
71   C CD    . GLU A 39  ? 0.6412 1.1891 0.7152 -0.0136 -0.0611 -0.1350 11  GLU A CD    
72   O OE1   . GLU A 39  ? 0.7346 1.2706 0.8064 -0.0090 -0.0603 -0.1124 11  GLU A OE1   
73   O OE2   . GLU A 39  ? 0.6480 1.2255 0.7079 -0.0193 -0.0683 -0.1419 11  GLU A OE2   
74   N N     . CYS A 40  ? 0.5227 0.9506 0.6757 0.0008  -0.0368 -0.1294 12  CYS A N     
75   C CA    . CYS A 40  ? 0.4363 0.8392 0.5971 0.0051  -0.0317 -0.1154 12  CYS A CA    
76   C C     . CYS A 40  ? 0.5616 0.9463 0.7365 0.0070  -0.0247 -0.1256 12  CYS A C     
77   O O     . CYS A 40  ? 0.6425 1.0146 0.8162 0.0117  -0.0200 -0.1174 12  CYS A O     
78   C CB    . CYS A 40  ? 0.3340 0.7281 0.5066 0.0033  -0.0343 -0.1065 12  CYS A CB    
79   S SG    . CYS A 40  ? 0.5337 0.9436 0.6968 0.0034  -0.0420 -0.0899 12  CYS A SG    
80   N N     . ALA A 41  ? 0.5289 0.9128 0.7190 0.0031  -0.0246 -0.1435 13  ALA A N     
81   C CA    . ALA A 41  ? 0.4820 0.8476 0.6910 0.0047  -0.0185 -0.1536 13  ALA A CA    
82   C C     . ALA A 41  ? 0.4439 0.8159 0.6480 0.0084  -0.0143 -0.1634 13  ALA A C     
83   O O     . ALA A 41  ? 0.4186 0.7738 0.6339 0.0132  -0.0094 -0.1615 13  ALA A O     
84   C CB    . ALA A 41  ? 0.3571 0.7215 0.5868 -0.0010 -0.0193 -0.1719 13  ALA A CB    
85   N N     . ILE A 42  ? 0.4736 0.8713 0.6615 0.0061  -0.0163 -0.1735 14  ILE A N     
86   C CA    . ILE A 42  ? 0.5710 0.9789 0.7533 0.0085  -0.0112 -0.1846 14  ILE A CA    
87   C C     . ILE A 42  ? 0.6294 1.0312 0.8006 0.0145  -0.0084 -0.1658 14  ILE A C     
88   O O     . ILE A 42  ? 0.6963 1.0882 0.8778 0.0193  -0.0029 -0.1689 14  ILE A O     
89   C CB    . ILE A 42  ? 0.5246 0.9652 0.6883 0.0031  -0.0136 -0.1987 14  ILE A CB    
90   C CG1   . ILE A 42  ? 0.4844 0.9335 0.6612 -0.0033 -0.0161 -0.2220 14  ILE A CG1   
91   C CG2   . ILE A 42  ? 0.4180 0.8710 0.5746 0.0051  -0.0068 -0.2090 14  ILE A CG2   
92   C CD1   . ILE A 42  ? 0.5226 1.0072 0.6799 -0.0097 -0.0192 -0.2373 14  ILE A CD1   
93   N N     . PHE A 43  ? 0.5888 0.9969 0.7420 0.0142  -0.0124 -0.1468 15  PHE A N     
94   C CA    . PHE A 43  ? 0.6011 1.0042 0.7451 0.0190  -0.0100 -0.1294 15  PHE A CA    
95   C C     . PHE A 43  ? 0.5503 0.9268 0.7093 0.0236  -0.0078 -0.1192 15  PHE A C     
96   O O     . PHE A 43  ? 0.5542 0.9250 0.7116 0.0282  -0.0047 -0.1108 15  PHE A O     
97   C CB    . PHE A 43  ? 0.3272 0.7413 0.4532 0.0173  -0.0150 -0.1117 15  PHE A CB    
98   C CG    . PHE A 43  ? 0.5427 0.9843 0.6494 0.0138  -0.0165 -0.1153 15  PHE A CG    
99   C CD1   . PHE A 43  ? 0.4801 0.9315 0.5765 0.0151  -0.0111 -0.1152 15  PHE A CD1   
100  C CD2   . PHE A 43  ? 0.5457 1.0050 0.6445 0.0086  -0.0235 -0.1182 15  PHE A CD2   
101  C CE1   . PHE A 43  ? 0.4336 0.9118 0.5104 0.0108  -0.0118 -0.1171 15  PHE A CE1   
102  C CE2   . PHE A 43  ? 0.5144 1.0012 0.5932 0.0046  -0.0256 -0.1195 15  PHE A CE2   
103  C CZ    . PHE A 43  ? 0.4546 0.9507 0.5214 0.0054  -0.0193 -0.1186 15  PHE A CZ    
104  N N     . ALA A 44  ? 0.5394 0.9013 0.7127 0.0219  -0.0094 -0.1196 16  ALA A N     
105  C CA    . ALA A 44  ? 0.5185 0.8565 0.7056 0.0252  -0.0073 -0.1101 16  ALA A CA    
106  C C     . ALA A 44  ? 0.5934 0.9225 0.7975 0.0291  -0.0032 -0.1213 16  ALA A C     
107  O O     . ALA A 44  ? 0.6283 0.9450 0.8379 0.0341  -0.0015 -0.1117 16  ALA A O     
108  C CB    . ALA A 44  ? 0.4027 0.7292 0.6009 0.0211  -0.0093 -0.1075 16  ALA A CB    
109  N N     . ALA A 45  ? 0.5063 0.8429 0.7204 0.0268  -0.0020 -0.1423 17  ALA A N     
110  C CA    . ALA A 45  ? 0.5075 0.8369 0.7427 0.0305  0.0024  -0.1565 17  ALA A CA    
111  C C     . ALA A 45  ? 0.5852 0.9255 0.8126 0.0354  0.0058  -0.1577 17  ALA A C     
112  O O     . ALA A 45  ? 0.3509 0.6797 0.5943 0.0414  0.0084  -0.1567 17  ALA A O     
113  C CB    . ALA A 45  ? 0.3656 0.7034 0.6139 0.0259  0.0035  -0.1819 17  ALA A CB    
114  N N     . VAL A 46  ? 0.5411 0.9042 0.7452 0.0327  0.0057  -0.1590 18  VAL A N     
115  C CA    . VAL A 46  ? 0.5235 0.8993 0.7185 0.0360  0.0098  -0.1592 18  VAL A CA    
116  C C     . VAL A 46  ? 0.6196 0.9823 0.8129 0.0413  0.0090  -0.1378 18  VAL A C     
117  O O     . VAL A 46  ? 0.6929 1.0543 0.8949 0.0465  0.0124  -0.1388 18  VAL A O     
118  C CB    . VAL A 46  ? 0.4362 0.8390 0.6045 0.0308  0.0094  -0.1604 18  VAL A CB    
119  C CG1   . VAL A 46  ? 0.3460 0.7615 0.5053 0.0333  0.0146  -0.1583 18  VAL A CG1   
120  C CG2   . VAL A 46  ? 0.3944 0.8147 0.5624 0.0249  0.0098  -0.1833 18  VAL A CG2   
121  N N     . ALA A 47  ? 0.5621 0.9165 0.7459 0.0397  0.0046  -0.1198 19  ALA A N     
122  C CA    . ALA A 47  ? 0.4581 0.8013 0.6397 0.0435  0.0037  -0.1009 19  ALA A CA    
123  C C     . ALA A 47  ? 0.4580 0.7819 0.6612 0.0486  0.0038  -0.0990 19  ALA A C     
124  O O     . ALA A 47  ? 0.5836 0.9041 0.7897 0.0534  0.0042  -0.0909 19  ALA A O     
125  C CB    . ALA A 47  ? 0.3145 0.6534 0.4849 0.0401  -0.0003 -0.0856 19  ALA A CB    
126  N N     . MET A 48  ? 0.3973 0.7091 0.6167 0.0473  0.0032  -0.1060 20  MET A N     
127  C CA    . MET A 48  ? 0.4663 0.7583 0.7087 0.0517  0.0028  -0.1025 20  MET A CA    
128  C C     . MET A 48  ? 0.5146 0.8097 0.7749 0.0577  0.0060  -0.1153 20  MET A C     
129  O O     . MET A 48  ? 0.4706 0.7542 0.7463 0.0637  0.0047  -0.1074 20  MET A O     
130  C CB    . MET A 48  ? 0.5030 0.7816 0.7610 0.0478  0.0021  -0.1074 20  MET A CB    
131  C CG    . MET A 48  ? 0.4370 0.6926 0.7172 0.0511  0.0009  -0.0970 20  MET A CG    
132  S SD    . MET A 48  ? 0.4388 0.6857 0.7037 0.0517  -0.0027 -0.0684 20  MET A SD    
133  C CE    . MET A 48  ? 0.4860 0.7297 0.7640 0.0612  -0.0042 -0.0627 20  MET A CE    
134  N N     . VAL A 49  ? 0.5287 0.8411 0.7874 0.0560  0.0099  -0.1354 21  VAL A N     
135  C CA    . VAL A 49  ? 0.4967 0.8160 0.7725 0.0610  0.0145  -0.1510 21  VAL A CA    
136  C C     . VAL A 49  ? 0.5347 0.8623 0.8013 0.0654  0.0152  -0.1405 21  VAL A C     
137  O O     . VAL A 49  ? 0.5716 0.8942 0.8583 0.0723  0.0159  -0.1409 21  VAL A O     
138  C CB    . VAL A 49  ? 0.5106 0.8510 0.7830 0.0564  0.0196  -0.1765 21  VAL A CB    
139  C CG1   . VAL A 49  ? 0.3650 0.7177 0.6509 0.0609  0.0260  -0.1925 21  VAL A CG1   
140  C CG2   . VAL A 49  ? 0.3707 0.7029 0.6604 0.0527  0.0194  -0.1916 21  VAL A CG2   
141  N N     . LEU A 50  ? 0.4942 0.8344 0.7328 0.0615  0.0147  -0.1307 22  LEU A N     
142  C CA    . LEU A 50  ? 0.5163 0.8651 0.7458 0.0643  0.0156  -0.1207 22  LEU A CA    
143  C C     . LEU A 50  ? 0.4889 0.8212 0.7266 0.0693  0.0107  -0.1025 22  LEU A C     
144  O O     . LEU A 50  ? 0.5436 0.8806 0.7844 0.0735  0.0110  -0.0975 22  LEU A O     
145  C CB    . LEU A 50  ? 0.4108 0.7740 0.6114 0.0584  0.0157  -0.1126 22  LEU A CB    
146  C CG    . LEU A 50  ? 0.3969 0.7815 0.5842 0.0528  0.0199  -0.1271 22  LEU A CG    
147  C CD1   . LEU A 50  ? 0.3317 0.7283 0.4932 0.0478  0.0186  -0.1140 22  LEU A CD1   
148  C CD2   . LEU A 50  ? 0.3287 0.7283 0.5259 0.0550  0.0271  -0.1442 22  LEU A CD2   
149  N N     . SER A 51  ? 0.4152 0.7298 0.6564 0.0683  0.0062  -0.0929 23  SER A N     
150  C CA    . SER A 51  ? 0.4562 0.7566 0.7026 0.0718  0.0012  -0.0747 23  SER A CA    
151  C C     . SER A 51  ? 0.5357 0.8283 0.8102 0.0797  -0.0001 -0.0769 23  SER A C     
152  O O     . SER A 51  ? 0.6095 0.8951 0.8887 0.0836  -0.0050 -0.0618 23  SER A O     
153  C CB    . SER A 51  ? 0.5302 0.8154 0.7731 0.0675  -0.0020 -0.0643 23  SER A CB    
154  O OG    . SER A 51  ? 0.6397 0.9322 0.8595 0.0613  -0.0017 -0.0600 23  SER A OG    
155  N N     . PHE A 52  ? 0.5843 0.8791 0.8785 0.0819  0.0040  -0.0961 24  PHE A N     
156  C CA    . PHE A 52  ? 0.5899 0.8783 0.9163 0.0901  0.0033  -0.1007 24  PHE A CA    
157  C C     . PHE A 52  ? 0.6191 0.9252 0.9484 0.0945  0.0063  -0.1074 24  PHE A C     
158  O O     . PHE A 52  ? 0.5782 0.8834 0.9362 0.1019  0.0066  -0.1142 24  PHE A O     
159  C CB    . PHE A 52  ? 0.4895 0.7710 0.8417 0.0905  0.0069  -0.1204 24  PHE A CB    
160  C CG    . PHE A 52  ? 0.5414 0.8004 0.9044 0.0885  0.0031  -0.1113 24  PHE A CG    
161  C CD1   . PHE A 52  ? 0.6661 0.9233 1.0099 0.0802  0.0034  -0.1103 24  PHE A CD1   
162  C CD2   . PHE A 52  ? 0.5908 0.8311 0.9848 0.0949  -0.0010 -0.1027 24  PHE A CD2   
163  C CE1   . PHE A 52  ? 0.7159 0.9534 1.0709 0.0775  0.0008  -0.1021 24  PHE A CE1   
164  C CE2   . PHE A 52  ? 0.6829 0.9023 1.0874 0.0922  -0.0039 -0.0926 24  PHE A CE2   
165  C CZ    . PHE A 52  ? 0.7290 0.9472 1.1137 0.0831  -0.0024 -0.0929 24  PHE A CZ    
166  N N     . ILE A 53  ? 0.6220 0.9444 0.9240 0.0900  0.0089  -0.1052 25  ILE A N     
167  C CA    . ILE A 53  ? 0.6200 0.9596 0.9221 0.0927  0.0119  -0.1081 25  ILE A CA    
168  C C     . ILE A 53  ? 0.6550 0.9921 0.9467 0.0940  0.0056  -0.0870 25  ILE A C     
169  O O     . ILE A 53  ? 0.7334 1.0744 0.9995 0.0882  0.0052  -0.0775 25  ILE A O     
170  C CB    . ILE A 53  ? 0.5356 0.8962 0.8157 0.0861  0.0195  -0.1193 25  ILE A CB    
171  C CG1   . ILE A 53  ? 0.4107 0.7773 0.6987 0.0838  0.0257  -0.1422 25  ILE A CG1   
172  C CG2   . ILE A 53  ? 0.4841 0.8624 0.7653 0.0880  0.0236  -0.1211 25  ILE A CG2   
173  C CD1   . ILE A 53  ? 0.3956 0.7856 0.6604 0.0766  0.0328  -0.1525 25  ILE A CD1   
174  N N     . PRO A 54  ? 0.6875 1.0189 1.0008 0.1015  0.0002  -0.0800 26  PRO A N     
175  C CA    . PRO A 54  ? 0.7063 1.0357 1.0117 0.1026  -0.0073 -0.0602 26  PRO A CA    
176  C C     . PRO A 54  ? 0.6470 0.9949 0.9404 0.1009  -0.0049 -0.0597 26  PRO A C     
177  O O     . PRO A 54  ? 0.7783 1.1388 1.0880 0.1052  -0.0020 -0.0691 26  PRO A O     
178  C CB    . PRO A 54  ? 0.7008 1.0214 1.0372 0.1117  -0.0140 -0.0551 26  PRO A CB    
179  C CG    . PRO A 54  ? 0.6634 0.9897 1.0264 0.1164  -0.0076 -0.0762 26  PRO A CG    
180  C CD    . PRO A 54  ? 0.6688 0.9967 1.0178 0.1095  0.0006  -0.0912 26  PRO A CD    
181  N N     . LEU A 55  ? 0.4317 0.7814 0.6993 0.0945  -0.0057 -0.0495 27  LEU A N     
182  C CA    . LEU A 55  ? 0.4900 0.8545 0.7484 0.0924  -0.0045 -0.0463 27  LEU A CA    
183  C C     . LEU A 55  ? 0.5595 0.9192 0.8089 0.0913  -0.0124 -0.0299 27  LEU A C     
184  O O     . LEU A 55  ? 0.5074 0.8702 0.7375 0.0851  -0.0113 -0.0245 27  LEU A O     
185  C CB    . LEU A 55  ? 0.4304 0.8043 0.6682 0.0849  0.0031  -0.0512 27  LEU A CB    
186  C CG    . LEU A 55  ? 0.3692 0.7584 0.6117 0.0842  0.0120  -0.0666 27  LEU A CG    
187  C CD1   . LEU A 55  ? 0.3937 0.7784 0.6472 0.0864  0.0148  -0.0802 27  LEU A CD1   
188  C CD2   . LEU A 55  ? 0.3804 0.7797 0.6006 0.0763  0.0177  -0.0652 27  LEU A CD2   
189  N N     . ASP A 56  ? 0.5836 0.9366 0.8479 0.0971  -0.0204 -0.0220 28  ASP A N     
190  C CA    . ASP A 56  ? 0.4984 0.8475 0.7526 0.0955  -0.0285 -0.0060 28  ASP A CA    
191  C C     . ASP A 56  ? 0.4862 0.8482 0.7509 0.0996  -0.0349 -0.0015 28  ASP A C     
192  O O     . ASP A 56  ? 0.4507 0.8184 0.7388 0.1067  -0.0361 -0.0071 28  ASP A O     
193  C CB    . ASP A 56  ? 0.5233 0.8550 0.7833 0.0977  -0.0341 0.0039  28  ASP A CB    
194  C CG    . ASP A 56  ? 0.5963 0.9158 0.8550 0.0951  -0.0281 -0.0037 28  ASP A CG    
195  O OD1   . ASP A 56  ? 0.7645 1.0872 1.0057 0.0889  -0.0219 -0.0098 28  ASP A OD1   
196  O OD2   . ASP A 56  ? 0.5087 0.8156 0.7858 0.0994  -0.0301 -0.0036 28  ASP A OD2   
197  N N     . ILE A 57  ? 0.6151 0.9831 0.8637 0.0949  -0.0388 0.0073  29  ILE A N     
198  C CA    . ILE A 57  ? 0.5761 0.9567 0.8325 0.0979  -0.0472 0.0134  29  ILE A CA    
199  C C     . ILE A 57  ? 0.6565 1.0324 0.8995 0.0954  -0.0560 0.0293  29  ILE A C     
200  O O     . ILE A 57  ? 0.7634 1.1444 0.9860 0.0880  -0.0554 0.0320  29  ILE A O     
201  C CB    . ILE A 57  ? 0.4829 0.8807 0.7336 0.0933  -0.0434 0.0063  29  ILE A CB    
202  C CG1   . ILE A 57  ? 0.4495 0.8529 0.7096 0.0939  -0.0331 -0.0079 29  ILE A CG1   
203  C CG2   . ILE A 57  ? 0.2784 0.6915 0.5400 0.0965  -0.0528 0.0107  29  ILE A CG2   
204  C CD1   . ILE A 57  ? 0.5050 0.9238 0.7618 0.0887  -0.0282 -0.0137 29  ILE A CD1   
205  N N     . GLY A 58  ? 0.6024 0.9690 0.8579 0.1012  -0.0636 0.0399  30  GLY A N     
206  C CA    . GLY A 58  ? 0.5708 0.9326 0.8130 0.0982  -0.0715 0.0573  30  GLY A CA    
207  C C     . GLY A 58  ? 0.6818 1.0256 0.9112 0.0932  -0.0658 0.0602  30  GLY A C     
208  O O     . GLY A 58  ? 0.7248 1.0571 0.9638 0.0950  -0.0592 0.0512  30  GLY A O     
209  N N     . SER A 59  ? 0.7780 1.1211 0.9859 0.0861  -0.0681 0.0715  31  SER A N     
210  C CA    . SER A 59  ? 0.7770 1.1046 0.9735 0.0805  -0.0628 0.0750  31  SER A CA    
211  C C     . SER A 59  ? 0.6960 1.0285 0.8703 0.0715  -0.0545 0.0667  31  SER A C     
212  O O     . SER A 59  ? 0.6557 0.9778 0.8210 0.0663  -0.0491 0.0671  31  SER A O     
213  C CB    . SER A 59  ? 0.7350 1.0571 0.9256 0.0787  -0.0703 0.0955  31  SER A CB    
214  O OG    . SER A 59  ? 0.6594 0.9982 0.8296 0.0729  -0.0748 0.1024  31  SER A OG    
215  N N     . SER A 60  ? 0.6075 0.9558 0.7762 0.0697  -0.0535 0.0588  32  SER A N     
216  C CA    . SER A 60  ? 0.4824 0.8362 0.6339 0.0614  -0.0466 0.0517  32  SER A CA    
217  C C     . SER A 60  ? 0.4352 0.7923 0.5920 0.0618  -0.0391 0.0372  32  SER A C     
218  O O     . SER A 60  ? 0.5357 0.8944 0.6827 0.0559  -0.0329 0.0314  32  SER A O     
219  C CB    . SER A 60  ? 0.4335 0.8037 0.5721 0.0564  -0.0510 0.0554  32  SER A CB    
220  O OG    . SER A 60  ? 0.4050 0.7740 0.5348 0.0546  -0.0575 0.0705  32  SER A OG    
221  N N     . PHE A 61  ? 0.3066 0.6654 0.4800 0.0686  -0.0396 0.0319  33  PHE A N     
222  C CA    . PHE A 61  ? 0.3624 0.7247 0.5401 0.0685  -0.0320 0.0197  33  PHE A CA    
223  C C     . PHE A 61  ? 0.3941 0.7471 0.5830 0.0732  -0.0287 0.0142  33  PHE A C     
224  O O     . PHE A 61  ? 0.4203 0.7697 0.6245 0.0797  -0.0329 0.0159  33  PHE A O     
225  C CB    . PHE A 61  ? 0.5285 0.9069 0.7151 0.0702  -0.0329 0.0144  33  PHE A CB    
226  C CG    . PHE A 61  ? 0.4214 0.8045 0.6114 0.0688  -0.0244 0.0041  33  PHE A CG    
227  C CD1   . PHE A 61  ? 0.3478 0.7342 0.5282 0.0621  -0.0190 0.0015  33  PHE A CD1   
228  C CD2   . PHE A 61  ? 0.2958 0.6807 0.4998 0.0740  -0.0214 -0.0027 33  PHE A CD2   
229  C CE1   . PHE A 61  ? 0.3179 0.7086 0.5012 0.0604  -0.0116 -0.0049 33  PHE A CE1   
230  C CE2   . PHE A 61  ? 0.2821 0.6732 0.4865 0.0717  -0.0132 -0.0108 33  PHE A CE2   
231  C CZ    . PHE A 61  ? 0.3560 0.7498 0.5495 0.0648  -0.0087 -0.0105 33  PHE A CZ    
232  N N     . SER A 62  ? 0.3978 0.7482 0.5806 0.0698  -0.0215 0.0072  34  SER A N     
233  C CA    . SER A 62  ? 0.3982 0.7428 0.5890 0.0727  -0.0176 -0.0006 34  SER A CA    
234  C C     . SER A 62  ? 0.4441 0.7930 0.6256 0.0681  -0.0104 -0.0078 34  SER A C     
235  O O     . SER A 62  ? 0.5250 0.8727 0.6939 0.0625  -0.0089 -0.0044 34  SER A O     
236  C CB    . SER A 62  ? 0.5124 0.8413 0.7046 0.0731  -0.0200 0.0039  34  SER A CB    
237  O OG    . SER A 62  ? 0.5528 0.8772 0.7537 0.0750  -0.0160 -0.0062 34  SER A OG    
238  N N     . ILE A 63  ? 0.4624 0.8177 0.6512 0.0703  -0.0060 -0.0175 35  ILE A N     
239  C CA    . ILE A 63  ? 0.4763 0.8371 0.6555 0.0659  0.0002  -0.0229 35  ILE A CA    
240  C C     . ILE A 63  ? 0.4342 0.7869 0.6120 0.0654  0.0010  -0.0281 35  ILE A C     
241  O O     . ILE A 63  ? 0.4231 0.7746 0.6129 0.0693  0.0018  -0.0367 35  ILE A O     
242  C CB    . ILE A 63  ? 0.5376 0.9134 0.7226 0.0668  0.0056  -0.0309 35  ILE A CB    
243  C CG1   . ILE A 63  ? 0.5008 0.8855 0.6876 0.0658  0.0054  -0.0262 35  ILE A CG1   
244  C CG2   . ILE A 63  ? 0.2539 0.6363 0.4277 0.0621  0.0113  -0.0352 35  ILE A CG2   
245  C CD1   . ILE A 63  ? 0.4525 0.8528 0.6461 0.0656  0.0117  -0.0331 35  ILE A CD1   
246  N N     . SER A 64  ? 0.2577 0.6056 0.4235 0.0605  0.0009  -0.0241 36  SER A N     
247  C CA    . SER A 64  ? 0.2632 0.6040 0.4282 0.0591  0.0009  -0.0290 36  SER A CA    
248  C C     . SER A 64  ? 0.4668 0.8191 0.6261 0.0567  0.0051  -0.0382 36  SER A C     
249  O O     . SER A 64  ? 0.4748 0.8323 0.6223 0.0522  0.0058  -0.0345 36  SER A O     
250  C CB    . SER A 64  ? 0.3258 0.6577 0.4826 0.0549  -0.0014 -0.0208 36  SER A CB    
251  O OG    . SER A 64  ? 0.4468 0.7719 0.6053 0.0533  -0.0017 -0.0258 36  SER A OG    
252  N N     . LEU A 65  ? 0.4561 0.8135 0.6246 0.0596  0.0078  -0.0502 37  LEU A N     
253  C CA    . LEU A 65  ? 0.5040 0.8757 0.6657 0.0566  0.0123  -0.0608 37  LEU A CA    
254  C C     . LEU A 65  ? 0.5438 0.9126 0.6987 0.0526  0.0104  -0.0643 37  LEU A C     
255  O O     . LEU A 65  ? 0.6832 1.0656 0.8276 0.0486  0.0124  -0.0700 37  LEU A O     
256  C CB    . LEU A 65  ? 0.4462 0.8251 0.6219 0.0604  0.0165  -0.0759 37  LEU A CB    
257  C CG    . LEU A 65  ? 0.4837 0.8694 0.6692 0.0644  0.0189  -0.0751 37  LEU A CG    
258  C CD1   . LEU A 65  ? 0.4119 0.8061 0.6142 0.0681  0.0239  -0.0926 37  LEU A CD1   
259  C CD2   . LEU A 65  ? 0.5794 0.9785 0.7505 0.0601  0.0221  -0.0677 37  LEU A CD2   
260  N N     . GLY A 66  ? 0.4183 0.7711 0.5793 0.0531  0.0064  -0.0603 38  GLY A N     
261  C CA    . GLY A 66  ? 0.4290 0.7783 0.5872 0.0492  0.0045  -0.0641 38  GLY A CA    
262  C C     . GLY A 66  ? 0.5200 0.8747 0.6633 0.0444  0.0024  -0.0548 38  GLY A C     
263  O O     . GLY A 66  ? 0.6063 0.9617 0.7468 0.0409  0.0002  -0.0578 38  GLY A O     
264  N N     . MET A 67  ? 0.4387 0.7972 0.5750 0.0444  0.0030  -0.0441 39  MET A N     
265  C CA    . MET A 67  ? 0.4413 0.8046 0.5677 0.0405  0.0012  -0.0347 39  MET A CA    
266  C C     . MET A 67  ? 0.4616 0.8426 0.5775 0.0375  0.0021  -0.0378 39  MET A C     
267  O O     . MET A 67  ? 0.4269 0.8132 0.5361 0.0343  -0.0009 -0.0313 39  MET A O     
268  C CB    . MET A 67  ? 0.4227 0.7836 0.5487 0.0411  0.0020  -0.0234 39  MET A CB    
269  C CG    . MET A 67  ? 0.4519 0.7987 0.5843 0.0426  0.0005  -0.0189 39  MET A CG    
270  S SD    . MET A 67  ? 0.4653 0.8029 0.5985 0.0390  -0.0022 -0.0159 39  MET A SD    
271  C CE    . MET A 67  ? 0.2464 0.5924 0.3752 0.0359  -0.0025 -0.0082 39  MET A CE    
272  N N     . ILE A 68  ? 0.4592 0.8505 0.5743 0.0384  0.0060  -0.0476 40  ILE A N     
273  C CA    . ILE A 68  ? 0.3829 0.7941 0.4855 0.0345  0.0076  -0.0516 40  ILE A CA    
274  C C     . ILE A 68  ? 0.3698 0.7867 0.4675 0.0310  0.0035  -0.0589 40  ILE A C     
275  O O     . ILE A 68  ? 0.4418 0.8711 0.5278 0.0271  0.0003  -0.0522 40  ILE A O     
276  C CB    . ILE A 68  ? 0.3939 0.8171 0.4976 0.0356  0.0142  -0.0632 40  ILE A CB    
277  C CG1   . ILE A 68  ? 0.4149 0.8360 0.5236 0.0383  0.0177  -0.0550 40  ILE A CG1   
278  C CG2   . ILE A 68  ? 0.3091 0.7558 0.3971 0.0302  0.0164  -0.0679 40  ILE A CG2   
279  C CD1   . ILE A 68  ? 0.2943 0.7274 0.4077 0.0397  0.0247  -0.0664 40  ILE A CD1   
280  N N     . PRO A 69  ? 0.4054 0.8138 0.5139 0.0323  0.0029  -0.0721 41  PRO A N     
281  C CA    . PRO A 69  ? 0.4834 0.8972 0.5893 0.0283  -0.0015 -0.0792 41  PRO A CA    
282  C C     . PRO A 69  ? 0.5719 0.9774 0.6780 0.0270  -0.0073 -0.0657 41  PRO A C     
283  O O     . PRO A 69  ? 0.6494 1.0650 0.7502 0.0233  -0.0123 -0.0663 41  PRO A O     
284  C CB    . PRO A 69  ? 0.5133 0.9155 0.6362 0.0302  0.0000  -0.0950 41  PRO A CB    
285  C CG    . PRO A 69  ? 0.4962 0.8955 0.6272 0.0349  0.0058  -0.0998 41  PRO A CG    
286  C CD    . PRO A 69  ? 0.3983 0.7947 0.5230 0.0369  0.0062  -0.0821 41  PRO A CD    
287  N N     . MET A 70  ? 0.5187 0.9079 0.6319 0.0299  -0.0068 -0.0546 42  MET A N     
288  C CA    . MET A 70  ? 0.4156 0.7975 0.5311 0.0287  -0.0108 -0.0433 42  MET A CA    
289  C C     . MET A 70  ? 0.4048 0.7992 0.5111 0.0269  -0.0134 -0.0313 42  MET A C     
290  O O     . MET A 70  ? 0.4767 0.8736 0.5846 0.0249  -0.0184 -0.0259 42  MET A O     
291  C CB    . MET A 70  ? 0.4427 0.8071 0.5664 0.0314  -0.0086 -0.0359 42  MET A CB    
292  C CG    . MET A 70  ? 0.6105 0.9603 0.7453 0.0327  -0.0075 -0.0428 42  MET A CG    
293  S SD    . MET A 70  ? 0.3973 0.7432 0.5400 0.0285  -0.0108 -0.0491 42  MET A SD    
294  C CE    . MET A 70  ? 0.3189 0.6720 0.4652 0.0281  -0.0101 -0.0682 42  MET A CE    
295  N N     . TYR A 71  ? 0.4548 0.8570 0.5537 0.0276  -0.0102 -0.0265 43  TYR A N     
296  C CA    . TYR A 71  ? 0.4869 0.8993 0.5793 0.0257  -0.0122 -0.0127 43  TYR A CA    
297  C C     . TYR A 71  ? 0.4813 0.9130 0.5623 0.0219  -0.0171 -0.0129 43  TYR A C     
298  O O     . TYR A 71  ? 0.4704 0.9073 0.5515 0.0205  -0.0227 -0.0011 43  TYR A O     
299  C CB    . TYR A 71  ? 0.4914 0.9067 0.5806 0.0267  -0.0065 -0.0072 43  TYR A CB    
300  C CG    . TYR A 71  ? 0.5323 0.9320 0.6324 0.0295  -0.0040 -0.0017 43  TYR A CG    
301  C CD1   . TYR A 71  ? 0.5085 0.8961 0.6178 0.0300  -0.0067 0.0026  43  TYR A CD1   
302  C CD2   . TYR A 71  ? 0.5792 0.9786 0.6807 0.0311  0.0013  -0.0021 43  TYR A CD2   
303  C CE1   . TYR A 71  ? 0.4503 0.8266 0.5678 0.0316  -0.0041 0.0060  43  TYR A CE1   
304  C CE2   . TYR A 71  ? 0.2559 0.6439 0.3667 0.0330  0.0029  0.0018  43  TYR A CE2   
305  C CZ    . TYR A 71  ? 0.4209 0.7978 0.5386 0.0330  0.0002  0.0056  43  TYR A CZ    
306  O OH    . TYR A 71  ? 0.4303 0.7986 0.5555 0.0340  0.0019  0.0080  43  TYR A OH    
307  N N     . VAL A 72  ? 0.4472 0.8910 0.5198 0.0201  -0.0153 -0.0269 44  VAL A N     
308  C CA    . VAL A 72  ? 0.5033 0.9693 0.5625 0.0155  -0.0201 -0.0292 44  VAL A CA    
309  C C     . VAL A 72  ? 0.4941 0.9594 0.5595 0.0142  -0.0282 -0.0317 44  VAL A C     
310  O O     . VAL A 72  ? 0.5629 1.0411 0.6229 0.0118  -0.0355 -0.0215 44  VAL A O     
311  C CB    . VAL A 72  ? 0.5577 1.0393 0.6070 0.0131  -0.0151 -0.0472 44  VAL A CB    
312  C CG1   . VAL A 72  ? 0.6526 1.1188 0.7164 0.0164  -0.0103 -0.0647 44  VAL A CG1   
313  C CG2   . VAL A 72  ? 0.5039 1.0089 0.5402 0.0075  -0.0211 -0.0541 44  VAL A CG2   
314  N N     . ILE A 73  ? 0.4191 0.8695 0.4975 0.0157  -0.0271 -0.0439 45  ILE A N     
315  C CA    . ILE A 73  ? 0.4852 0.9341 0.5724 0.0140  -0.0336 -0.0476 45  ILE A CA    
316  C C     . ILE A 73  ? 0.4790 0.9210 0.5746 0.0153  -0.0381 -0.0304 45  ILE A C     
317  O O     . ILE A 73  ? 0.4098 0.8594 0.5099 0.0134  -0.0455 -0.0284 45  ILE A O     
318  C CB    . ILE A 73  ? 0.3421 0.7745 0.4438 0.0147  -0.0302 -0.0628 45  ILE A CB    
319  C CG1   . ILE A 73  ? 0.3616 0.7972 0.4722 0.0113  -0.0365 -0.0697 45  ILE A CG1   
320  C CG2   . ILE A 73  ? 0.4001 0.8091 0.5127 0.0187  -0.0255 -0.0550 45  ILE A CG2   
321  C CD1   . ILE A 73  ? 0.4385 0.8996 0.5384 0.0066  -0.0422 -0.0800 45  ILE A CD1   
322  N N     . ALA A 74  ? 0.5216 0.9505 0.6213 0.0185  -0.0336 -0.0192 46  ALA A N     
323  C CA    . ALA A 74  ? 0.3917 0.8142 0.5018 0.0199  -0.0364 -0.0047 46  ALA A CA    
324  C C     . ALA A 74  ? 0.4110 0.8504 0.5150 0.0187  -0.0428 0.0092  46  ALA A C     
325  O O     . ALA A 74  ? 0.4345 0.8760 0.5490 0.0189  -0.0491 0.0178  46  ALA A O     
326  C CB    . ALA A 74  ? 0.3305 0.7371 0.4462 0.0228  -0.0296 0.0012  46  ALA A CB    
327  N N     . ILE A 75  ? 0.4501 0.9021 0.5382 0.0173  -0.0410 0.0119  47  ILE A N     
328  C CA    . ILE A 75  ? 0.4676 0.9373 0.5470 0.0153  -0.0469 0.0274  47  ILE A CA    
329  C C     . ILE A 75  ? 0.4853 0.9757 0.5557 0.0117  -0.0559 0.0223  47  ILE A C     
330  O O     . ILE A 75  ? 0.5592 1.0603 0.6325 0.0111  -0.0652 0.0353  47  ILE A O     
331  C CB    . ILE A 75  ? 0.4823 0.9605 0.5466 0.0138  -0.0408 0.0320  47  ILE A CB    
332  C CG1   . ILE A 75  ? 0.3965 0.8564 0.4715 0.0169  -0.0331 0.0382  47  ILE A CG1   
333  C CG2   . ILE A 75  ? 0.4834 0.9825 0.5357 0.0104  -0.0470 0.0490  47  ILE A CG2   
334  C CD1   . ILE A 75  ? 0.3427 0.8097 0.4062 0.0153  -0.0258 0.0405  47  ILE A CD1   
335  N N     . ARG A 76  ? 0.4702 0.9667 0.5319 0.0094  -0.0534 0.0025  48  ARG A N     
336  C CA    . ARG A 76  ? 0.5536 1.0726 0.6054 0.0049  -0.0610 -0.0068 48  ARG A CA    
337  C C     . ARG A 76  ? 0.6430 1.1601 0.7108 0.0051  -0.0698 -0.0081 48  ARG A C     
338  O O     . ARG A 76  ? 0.7167 1.2547 0.7796 0.0022  -0.0802 -0.0044 48  ARG A O     
339  C CB    . ARG A 76  ? 0.5901 1.1136 0.6341 0.0024  -0.0546 -0.0310 48  ARG A CB    
340  C CG    . ARG A 76  ? 0.6804 1.2274 0.7159 -0.0030 -0.0614 -0.0460 48  ARG A CG    
341  C CD    . ARG A 76  ? 0.6411 1.1905 0.6737 -0.0052 -0.0535 -0.0720 48  ARG A CD    
342  N NE    . ARG A 76  ? 0.6868 1.2583 0.7141 -0.0110 -0.0595 -0.0901 48  ARG A NE    
343  C CZ    . ARG A 76  ? 0.6247 1.2277 0.6297 -0.0169 -0.0626 -0.0942 48  ARG A CZ    
344  N NH1   . ARG A 76  ? 0.5669 1.1821 0.5529 -0.0179 -0.0597 -0.0799 48  ARG A NH1   
345  N NH2   . ARG A 76  ? 0.6488 1.2727 0.6506 -0.0226 -0.0684 -0.1129 48  ARG A NH2   
346  N N     . ARG A 77  ? 0.5693 1.0634 0.6563 0.0081  -0.0658 -0.0130 49  ARG A N     
347  C CA    . ARG A 77  ? 0.4962 0.9884 0.6001 0.0076  -0.0721 -0.0176 49  ARG A CA    
348  C C     . ARG A 77  ? 0.4796 0.9564 0.6038 0.0113  -0.0725 -0.0043 49  ARG A C     
349  O O     . ARG A 77  ? 0.5218 1.0039 0.6602 0.0110  -0.0800 -0.0022 49  ARG A O     
350  C CB    . ARG A 77  ? 0.4906 0.9735 0.6011 0.0057  -0.0672 -0.0396 49  ARG A CB    
351  C CG    . ARG A 77  ? 0.5108 1.0124 0.6074 0.0012  -0.0684 -0.0571 49  ARG A CG    
352  C CD    . ARG A 77  ? 0.5988 1.1280 0.6893 -0.0029 -0.0807 -0.0562 49  ARG A CD    
353  N NE    . ARG A 77  ? 0.6353 1.1859 0.7110 -0.0083 -0.0816 -0.0751 49  ARG A NE    
354  C CZ    . ARG A 77  ? 0.5969 1.1758 0.6640 -0.0132 -0.0922 -0.0792 49  ARG A CZ    
355  N NH1   . ARG A 77  ? 0.4949 1.0832 0.5683 -0.0126 -0.1036 -0.0639 49  ARG A NH1   
356  N NH2   . ARG A 77  ? 0.6105 1.2097 0.6639 -0.0187 -0.0915 -0.0993 49  ARG A NH2   
357  N N     . GLY A 78  ? 0.3889 0.8483 0.5161 0.0146  -0.0645 0.0030  50  GLY A N     
358  C CA    . GLY A 78  ? 0.4344 0.8815 0.5807 0.0176  -0.0640 0.0141  50  GLY A CA    
359  C C     . GLY A 78  ? 0.3967 0.8221 0.5547 0.0187  -0.0550 0.0070  50  GLY A C     
360  O O     . GLY A 78  ? 0.2767 0.6933 0.4278 0.0179  -0.0487 -0.0038 50  GLY A O     
361  N N     . PHE A 79  ? 0.4062 0.8242 0.5830 0.0203  -0.0546 0.0135  51  PHE A N     
362  C CA    . PHE A 79  ? 0.4227 0.8229 0.6098 0.0206  -0.0459 0.0090  51  PHE A CA    
363  C C     . PHE A 79  ? 0.4381 0.8313 0.6265 0.0176  -0.0426 -0.0047 51  PHE A C     
364  O O     . PHE A 79  ? 0.3200 0.7012 0.5016 0.0174  -0.0356 -0.0097 51  PHE A O     
365  C CB    . PHE A 79  ? 0.3788 0.7770 0.5883 0.0220  -0.0465 0.0159  51  PHE A CB    
366  C CG    . PHE A 79  ? 0.2995 0.6827 0.5176 0.0215  -0.0368 0.0117  51  PHE A CG    
367  C CD1   . PHE A 79  ? 0.3466 0.7250 0.5743 0.0186  -0.0333 0.0027  51  PHE A CD1   
368  C CD2   . PHE A 79  ? 0.3662 0.7418 0.5831 0.0232  -0.0311 0.0167  51  PHE A CD2   
369  C CE1   . PHE A 79  ? 0.4191 0.7866 0.6521 0.0171  -0.0242 -0.0006 51  PHE A CE1   
370  C CE2   . PHE A 79  ? 0.3413 0.7064 0.5643 0.0220  -0.0226 0.0119  51  PHE A CE2   
371  C CZ    . PHE A 79  ? 0.3930 0.7546 0.6227 0.0188  -0.0191 0.0037  51  PHE A CZ    
372  N N     . TRP A 80  ? 0.4370 0.8380 0.6362 0.0152  -0.0479 -0.0101 52  TRP A N     
373  C CA    . TRP A 80  ? 0.4045 0.7981 0.6099 0.0115  -0.0442 -0.0223 52  TRP A CA    
374  C C     . TRP A 80  ? 0.4183 0.8094 0.6098 0.0102  -0.0425 -0.0322 52  TRP A C     
375  O O     . TRP A 80  ? 0.3606 0.7383 0.5548 0.0084  -0.0362 -0.0388 52  TRP A O     
376  C CB    . TRP A 80  ? 0.4228 0.8273 0.6451 0.0088  -0.0506 -0.0268 52  TRP A CB    
377  C CG    . TRP A 80  ? 0.4381 0.8610 0.6541 0.0073  -0.0605 -0.0320 52  TRP A CG    
378  C CD1   . TRP A 80  ? 0.4598 0.9013 0.6748 0.0088  -0.0709 -0.0239 52  TRP A CD1   
379  C CD2   . TRP A 80  ? 0.3966 0.8224 0.6072 0.0034  -0.0611 -0.0467 52  TRP A CD2   
380  N NE1   . TRP A 80  ? 0.3347 0.7928 0.5409 0.0057  -0.0782 -0.0331 52  TRP A NE1   
381  C CE2   . TRP A 80  ? 0.3539 0.8024 0.5582 0.0023  -0.0719 -0.0486 52  TRP A CE2   
382  C CE3   . TRP A 80  ? 0.4733 0.8851 0.6852 0.0007  -0.0537 -0.0582 52  TRP A CE3   
383  C CZ2   . TRP A 80  ? 0.4081 0.8668 0.6071 -0.0019 -0.0748 -0.0645 52  TRP A CZ2   
384  C CZ3   . TRP A 80  ? 0.2953 0.7146 0.5051 -0.0029 -0.0564 -0.0732 52  TRP A CZ3   
385  C CH2   . TRP A 80  ? 0.4027 0.8458 0.6060 -0.0044 -0.0666 -0.0776 52  TRP A CH2   
386  N N     . ALA A 81  ? 0.5112 0.9160 0.6892 0.0108  -0.0478 -0.0332 53  ALA A N     
387  C CA    . ALA A 81  ? 0.5227 0.9278 0.6898 0.0096  -0.0457 -0.0450 53  ALA A CA    
388  C C     . ALA A 81  ? 0.4836 0.8736 0.6436 0.0125  -0.0375 -0.0430 53  ALA A C     
389  O O     . ALA A 81  ? 0.4724 0.8530 0.6335 0.0120  -0.0331 -0.0526 53  ALA A O     
390  C CB    . ALA A 81  ? 0.4552 0.8821 0.6080 0.0088  -0.0526 -0.0469 53  ALA A CB    
391  N N     . ALA A 82  ? 0.4183 0.8062 0.5736 0.0156  -0.0357 -0.0304 54  ALA A N     
392  C CA    . ALA A 82  ? 0.3959 0.7720 0.5453 0.0184  -0.0289 -0.0278 54  ALA A CA    
393  C C     . ALA A 82  ? 0.4106 0.7689 0.5693 0.0179  -0.0233 -0.0291 54  ALA A C     
394  O O     . ALA A 82  ? 0.4595 0.8078 0.6153 0.0196  -0.0189 -0.0308 54  ALA A O     
395  C CB    . ALA A 82  ? 0.2634 0.6422 0.4087 0.0209  -0.0285 -0.0148 54  ALA A CB    
396  N N     . GLY A 83  ? 0.4367 0.7925 0.6073 0.0155  -0.0238 -0.0275 55  GLY A N     
397  C CA    . GLY A 83  ? 0.4767 0.8182 0.6549 0.0136  -0.0181 -0.0277 55  GLY A CA    
398  C C     . GLY A 83  ? 0.4428 0.7774 0.6260 0.0109  -0.0171 -0.0372 55  GLY A C     
399  O O     . GLY A 83  ? 0.4132 0.7347 0.5968 0.0110  -0.0125 -0.0366 55  GLY A O     
400  N N     . PHE A 84  ? 0.4035 0.7476 0.5923 0.0085  -0.0219 -0.0458 56  PHE A N     
401  C CA    . PHE A 84  ? 0.3955 0.7341 0.5927 0.0053  -0.0211 -0.0573 56  PHE A CA    
402  C C     . PHE A 84  ? 0.3926 0.7263 0.5833 0.0083  -0.0193 -0.0629 56  PHE A C     
403  O O     . PHE A 84  ? 0.3601 0.6793 0.5587 0.0079  -0.0153 -0.0655 56  PHE A O     
404  C CB    . PHE A 84  ? 0.4032 0.7570 0.6070 0.0019  -0.0276 -0.0672 56  PHE A CB    
405  C CG    . PHE A 84  ? 0.3981 0.7474 0.6135 -0.0021 -0.0268 -0.0816 56  PHE A CG    
406  C CD1   . PHE A 84  ? 0.4220 0.7563 0.6528 -0.0060 -0.0218 -0.0819 56  PHE A CD1   
407  C CD2   . PHE A 84  ? 0.3827 0.7436 0.5946 -0.0026 -0.0305 -0.0953 56  PHE A CD2   
408  C CE1   . PHE A 84  ? 0.4189 0.7476 0.6640 -0.0099 -0.0207 -0.0949 56  PHE A CE1   
409  C CE2   . PHE A 84  ? 0.4041 0.7608 0.6302 -0.0065 -0.0293 -0.1108 56  PHE A CE2   
410  C CZ    . PHE A 84  ? 0.4203 0.7598 0.6644 -0.0100 -0.0245 -0.1102 56  PHE A CZ    
411  N N     . ALA A 85  ? 0.3900 0.7364 0.5681 0.0112  -0.0221 -0.0643 57  ALA A N     
412  C CA    . ALA A 85  ? 0.3777 0.7227 0.5508 0.0142  -0.0196 -0.0710 57  ALA A CA    
413  C C     . ALA A 85  ? 0.4030 0.7328 0.5753 0.0180  -0.0147 -0.0616 57  ALA A C     
414  O O     . ALA A 85  ? 0.5351 0.8556 0.7132 0.0201  -0.0119 -0.0665 57  ALA A O     
415  C CB    . ALA A 85  ? 0.4557 0.8199 0.6138 0.0154  -0.0226 -0.0726 57  ALA A CB    
416  N N     . GLY A 86  ? 0.4057 0.7340 0.5725 0.0190  -0.0141 -0.0485 58  GLY A N     
417  C CA    . GLY A 86  ? 0.4623 0.7795 0.6270 0.0218  -0.0103 -0.0396 58  GLY A CA    
418  C C     . GLY A 86  ? 0.4303 0.7314 0.6051 0.0201  -0.0076 -0.0378 58  GLY A C     
419  O O     . GLY A 86  ? 0.3238 0.6154 0.5006 0.0229  -0.0058 -0.0355 58  GLY A O     
420  N N     . LEU A 87  ? 0.4181 0.7168 0.6005 0.0152  -0.0073 -0.0379 59  LEU A N     
421  C CA    . LEU A 87  ? 0.4406 0.7247 0.6329 0.0120  -0.0040 -0.0346 59  LEU A CA    
422  C C     . LEU A 87  ? 0.5758 0.8511 0.7800 0.0126  -0.0040 -0.0432 59  LEU A C     
423  O O     . LEU A 87  ? 0.6789 0.9401 0.8897 0.0130  -0.0018 -0.0374 59  LEU A O     
424  C CB    . LEU A 87  ? 0.4851 0.7711 0.6850 0.0059  -0.0029 -0.0345 59  LEU A CB    
425  C CG    . LEU A 87  ? 0.4422 0.7146 0.6524 0.0008  0.0017  -0.0302 59  LEU A CG    
426  C CD1   . LEU A 87  ? 0.3989 0.6623 0.6008 0.0021  0.0048  -0.0172 59  LEU A CD1   
427  C CD2   . LEU A 87  ? 0.3789 0.6566 0.5963 -0.0053 0.0037  -0.0306 59  LEU A CD2   
428  N N     . LEU A 88  ? 0.5627 0.8471 0.7706 0.0123  -0.0067 -0.0571 60  LEU A N     
429  C CA    . LEU A 88  ? 0.5006 0.7787 0.7222 0.0128  -0.0062 -0.0693 60  LEU A CA    
430  C C     . LEU A 88  ? 0.5680 0.8399 0.7888 0.0192  -0.0050 -0.0669 60  LEU A C     
431  O O     . LEU A 88  ? 0.5738 0.8315 0.8101 0.0206  -0.0033 -0.0678 60  LEU A O     
432  C CB    . LEU A 88  ? 0.4054 0.6999 0.6271 0.0112  -0.0094 -0.0864 60  LEU A CB    
433  C CG    . LEU A 88  ? 0.4086 0.7091 0.6391 0.0046  -0.0117 -0.0936 60  LEU A CG    
434  C CD1   . LEU A 88  ? 0.3239 0.6441 0.5514 0.0031  -0.0160 -0.1105 60  LEU A CD1   
435  C CD2   . LEU A 88  ? 0.3562 0.6390 0.6085 0.0005  -0.0083 -0.0960 60  LEU A CD2   
436  N N     . TRP A 89  ? 0.5708 0.8534 0.7758 0.0232  -0.0059 -0.0632 61  TRP A N     
437  C CA    . TRP A 89  ? 0.5785 0.8581 0.7827 0.0293  -0.0049 -0.0606 61  TRP A CA    
438  C C     . TRP A 89  ? 0.5648 0.8286 0.7735 0.0307  -0.0040 -0.0457 61  TRP A C     
439  O O     . TRP A 89  ? 0.5669 0.8207 0.7877 0.0347  -0.0039 -0.0451 61  TRP A O     
440  C CB    . TRP A 89  ? 0.5379 0.8325 0.7245 0.0318  -0.0055 -0.0576 61  TRP A CB    
441  C CG    . TRP A 89  ? 0.5045 0.7986 0.6910 0.0377  -0.0043 -0.0556 61  TRP A CG    
442  C CD1   . TRP A 89  ? 0.3975 0.6835 0.5992 0.0418  -0.0033 -0.0611 61  TRP A CD1   
443  C CD2   . TRP A 89  ? 0.4453 0.7479 0.6193 0.0402  -0.0041 -0.0479 61  TRP A CD2   
444  N NE1   . TRP A 89  ? 0.3686 0.6588 0.5674 0.0470  -0.0028 -0.0574 61  TRP A NE1   
445  C CE2   . TRP A 89  ? 0.4207 0.7211 0.6019 0.0456  -0.0031 -0.0495 61  TRP A CE2   
446  C CE3   . TRP A 89  ? 0.3929 0.7045 0.5530 0.0383  -0.0046 -0.0401 61  TRP A CE3   
447  C CZ2   . TRP A 89  ? 0.4068 0.7148 0.5808 0.0487  -0.0025 -0.0441 61  TRP A CZ2   
448  C CZ3   . TRP A 89  ? 0.3279 0.6455 0.4815 0.0412  -0.0036 -0.0347 61  TRP A CZ3   
449  C CH2   . TRP A 89  ? 0.3101 0.6264 0.4699 0.0460  -0.0026 -0.0369 61  TRP A CH2   
450  N N     . GLY A 90  ? 0.5400 0.8029 0.7395 0.0273  -0.0037 -0.0337 62  GLY A N     
451  C CA    . GLY A 90  ? 0.5166 0.7681 0.7161 0.0270  -0.0029 -0.0189 62  GLY A CA    
452  C C     . GLY A 90  ? 0.5689 0.8043 0.7858 0.0247  -0.0019 -0.0169 62  GLY A C     
453  O O     . GLY A 90  ? 0.5065 0.7312 0.7297 0.0272  -0.0027 -0.0068 62  GLY A O     
454  N N     . LEU A 91  ? 0.5701 0.8042 0.7965 0.0196  -0.0007 -0.0257 63  LEU A N     
455  C CA    . LEU A 91  ? 0.5029 0.7213 0.7492 0.0161  0.0010  -0.0248 63  LEU A CA    
456  C C     . LEU A 91  ? 0.4754 0.6850 0.7408 0.0214  0.0000  -0.0334 63  LEU A C     
457  O O     . LEU A 91  ? 0.4353 0.6283 0.7195 0.0208  0.0008  -0.0277 63  LEU A O     
458  C CB    . LEU A 91  ? 0.3411 0.5624 0.5947 0.0089  0.0026  -0.0343 63  LEU A CB    
459  C CG    . LEU A 91  ? 0.5591 0.7863 0.8019 0.0028  0.0048  -0.0260 63  LEU A CG    
460  C CD1   . LEU A 91  ? 0.3354 0.5663 0.5904 -0.0038 0.0057  -0.0369 63  LEU A CD1   
461  C CD2   . LEU A 91  ? 0.5030 0.7190 0.7434 -0.0001 0.0080  -0.0076 63  LEU A CD2   
462  N N     . LEU A 92  ? 0.3455 0.5668 0.6078 0.0262  -0.0013 -0.0470 64  LEU A N     
463  C CA    . LEU A 92  ? 0.4767 0.6927 0.7585 0.0314  -0.0013 -0.0586 64  LEU A CA    
464  C C     . LEU A 92  ? 0.4815 0.6885 0.7685 0.0384  -0.0030 -0.0453 64  LEU A C     
465  O O     . LEU A 92  ? 0.5500 0.7477 0.8600 0.0430  -0.0031 -0.0510 64  LEU A O     
466  C CB    . LEU A 92  ? 0.3493 0.5839 0.6247 0.0334  -0.0012 -0.0780 64  LEU A CB    
467  C CG    . LEU A 92  ? 0.3520 0.5956 0.6312 0.0274  -0.0007 -0.0963 64  LEU A CG    
468  C CD1   . LEU A 92  ? 0.4255 0.6905 0.6934 0.0289  -0.0008 -0.1128 64  LEU A CD1   
469  C CD2   . LEU A 92  ? 0.3681 0.5965 0.6774 0.0253  0.0011  -0.1066 64  LEU A CD2   
470  N N     . HIS A 93  ? 0.4738 0.6844 0.7412 0.0391  -0.0046 -0.0287 65  HIS A N     
471  C CA    . HIS A 93  ? 0.5366 0.7410 0.8073 0.0451  -0.0075 -0.0143 65  HIS A CA    
472  C C     . HIS A 93  ? 0.5606 0.7451 0.8506 0.0439  -0.0085 -0.0011 65  HIS A C     
473  O O     . HIS A 93  ? 0.4323 0.6075 0.7406 0.0501  -0.0113 0.0043  65  HIS A O     
474  C CB    . HIS A 93  ? 0.5444 0.7588 0.7896 0.0444  -0.0090 -0.0007 65  HIS A CB    
475  C CG    . HIS A 93  ? 0.4812 0.7131 0.7120 0.0472  -0.0088 -0.0099 65  HIS A CG    
476  N ND1   . HIS A 93  ? 0.5237 0.7669 0.7453 0.0439  -0.0065 -0.0223 65  HIS A ND1   
477  C CD2   . HIS A 93  ? 0.4000 0.6406 0.6251 0.0526  -0.0107 -0.0074 65  HIS A CD2   
478  C CE1   . HIS A 93  ? 0.4601 0.7172 0.6704 0.0469  -0.0065 -0.0259 65  HIS A CE1   
479  N NE2   . HIS A 93  ? 0.3980 0.6537 0.6107 0.0521  -0.0086 -0.0178 65  HIS A NE2   
480  N N     . PHE A 94  ? 0.6194 0.7976 0.9069 0.0358  -0.0060 0.0048  66  PHE A N     
481  C CA    . PHE A 94  ? 0.6166 0.7758 0.9219 0.0327  -0.0058 0.0188  66  PHE A CA    
482  C C     . PHE A 94  ? 0.6878 0.8333 1.0275 0.0355  -0.0051 0.0061  66  PHE A C     
483  O O     . PHE A 94  ? 0.7067 0.8366 1.0683 0.0392  -0.0074 0.0172  66  PHE A O     
484  C CB    . PHE A 94  ? 0.5270 0.6850 0.8235 0.0223  -0.0016 0.0245  66  PHE A CB    
485  C CG    . PHE A 94  ? 0.5790 0.7487 0.8463 0.0187  -0.0012 0.0377  66  PHE A CG    
486  C CD1   . PHE A 94  ? 0.5630 0.7289 0.8220 0.0183  -0.0033 0.0597  66  PHE A CD1   
487  C CD2   . PHE A 94  ? 0.6064 0.7916 0.8558 0.0155  0.0010  0.0278  66  PHE A CD2   
488  C CE1   . PHE A 94  ? 0.5251 0.7036 0.7578 0.0142  -0.0022 0.0689  66  PHE A CE1   
489  C CE2   . PHE A 94  ? 0.5545 0.7502 0.7810 0.0121  0.0022  0.0375  66  PHE A CE2   
490  C CZ    . PHE A 94  ? 0.5064 0.6993 0.7241 0.0112  0.0010  0.0568  66  PHE A CZ    
491  N N     . LEU A 95  ? 0.6739 0.8263 1.0195 0.0335  -0.0022 -0.0174 67  LEU A N     
492  C CA    . LEU A 95  ? 0.6820 0.8237 1.0610 0.0344  -0.0005 -0.0344 67  LEU A CA    
493  C C     . LEU A 95  ? 0.6552 0.7969 1.0515 0.0445  -0.0023 -0.0436 67  LEU A C     
494  O O     . LEU A 95  ? 0.8002 0.9280 1.2308 0.0471  -0.0014 -0.0517 67  LEU A O     
495  C CB    . LEU A 95  ? 0.6702 0.8238 1.0476 0.0285  0.0025  -0.0583 67  LEU A CB    
496  C CG    . LEU A 95  ? 0.6995 0.8545 1.0657 0.0187  0.0045  -0.0530 67  LEU A CG    
497  C CD1   . LEU A 95  ? 0.7122 0.8813 1.0792 0.0138  0.0056  -0.0775 67  LEU A CD1   
498  C CD2   . LEU A 95  ? 0.6820 0.8150 1.0699 0.0136  0.0065  -0.0383 67  LEU A CD2   
499  N N     . THR A 96  ? 0.5488 0.7062 0.9240 0.0498  -0.0043 -0.0432 68  THR A N     
500  C CA    . THR A 96  ? 0.6119 0.7728 1.0027 0.0591  -0.0053 -0.0530 68  THR A CA    
501  C C     . THR A 96  ? 0.6827 0.8361 1.0776 0.0661  -0.0106 -0.0304 68  THR A C     
502  O O     . THR A 96  ? 0.4182 0.5734 0.8300 0.0746  -0.0122 -0.0357 68  THR A O     
503  C CB    . THR A 96  ? 0.5444 0.7295 0.9132 0.0605  -0.0035 -0.0696 68  THR A CB    
504  O OG1   . THR A 96  ? 0.5822 0.7779 0.9174 0.0586  -0.0055 -0.0544 68  THR A OG1   
505  C CG2   . THR A 96  ? 0.4414 0.6364 0.8088 0.0542  0.0006  -0.0932 68  THR A CG2   
506  N N     . GLY A 97  ? 0.6383 0.7854 1.0179 0.0623  -0.0134 -0.0058 69  GLY A N     
507  C CA    . GLY A 97  ? 0.5439 0.6854 0.9251 0.0675  -0.0196 0.0180  69  GLY A CA    
508  C C     . GLY A 97  ? 0.5559 0.7158 0.9149 0.0725  -0.0228 0.0204  69  GLY A C     
509  O O     . GLY A 97  ? 0.5844 0.7434 0.9515 0.0793  -0.0288 0.0335  69  GLY A O     
510  N N     . LYS A 98  ? 0.6732 0.8503 1.0063 0.0689  -0.0193 0.0084  70  LYS A N     
511  C CA    . LYS A 98  ? 0.7152 0.9100 1.0276 0.0723  -0.0213 0.0099  70  LYS A CA    
512  C C     . LYS A 98  ? 0.6861 0.8869 0.9683 0.0662  -0.0226 0.0264  70  LYS A C     
513  O O     . LYS A 98  ? 0.5957 0.8117 0.8586 0.0668  -0.0233 0.0265  70  LYS A O     
514  C CB    . LYS A 98  ? 0.7371 0.9479 1.0418 0.0724  -0.0165 -0.0129 70  LYS A CB    
515  C CG    . LYS A 98  ? 0.8327 1.0445 1.1641 0.0792  -0.0146 -0.0311 70  LYS A CG    
516  C CD    . LYS A 98  ? 0.8590 1.0736 1.2033 0.0883  -0.0191 -0.0241 70  LYS A CD    
517  C CE    . LYS A 98  ? 0.8326 1.0680 1.1555 0.0893  -0.0184 -0.0272 70  LYS A CE    
518  N NZ    . LYS A 98  ? 0.8319 1.0722 1.1256 0.0847  -0.0213 -0.0101 70  LYS A NZ    
519  N N     . ALA A 99  ? 0.6940 0.8836 0.9740 0.0599  -0.0223 0.0395  71  ALA A N     
520  C CA    . ALA A 99  ? 0.6443 0.8404 0.8973 0.0530  -0.0221 0.0532  71  ALA A CA    
521  C C     . ALA A 99  ? 0.7400 0.9341 0.9896 0.0545  -0.0284 0.0761  71  ALA A C     
522  O O     . ALA A 99  ? 0.8596 1.0391 1.1235 0.0539  -0.0307 0.0904  71  ALA A O     
523  C CB    . ALA A 99  ? 0.5409 0.7298 0.7908 0.0438  -0.0170 0.0532  71  ALA A CB    
524  N N     . TYR A 100 ? 0.6762 0.8858 0.9075 0.0561  -0.0315 0.0799  72  TYR A N     
525  C CA    . TYR A 100 ? 0.7107 0.9237 0.9333 0.0560  -0.0380 0.1010  72  TYR A CA    
526  C C     . TYR A 100 ? 0.7056 0.9177 0.9092 0.0454  -0.0348 0.1136  72  TYR A C     
527  O O     . TYR A 100 ? 0.8223 1.0437 1.0074 0.0390  -0.0289 0.1052  72  TYR A O     
528  C CB    . TYR A 100 ? 0.8288 1.0611 1.0365 0.0591  -0.0414 0.0981  72  TYR A CB    
529  C CG    . TYR A 100 ? 0.9599 1.1963 1.1850 0.0686  -0.0433 0.0849  72  TYR A CG    
530  C CD1   . TYR A 100 ? 1.0812 1.3051 1.3360 0.0760  -0.0456 0.0828  72  TYR A CD1   
531  C CD2   . TYR A 100 ? 1.0137 1.2669 1.2275 0.0698  -0.0421 0.0738  72  TYR A CD2   
532  C CE1   . TYR A 100 ? 1.1759 1.4056 1.4477 0.0842  -0.0460 0.0689  72  TYR A CE1   
533  C CE2   . TYR A 100 ? 1.1515 1.4100 1.3809 0.0775  -0.0427 0.0617  72  TYR A CE2   
534  C CZ    . TYR A 100 ? 1.2149 1.4626 1.4727 0.0847  -0.0444 0.0587  72  TYR A CZ    
535  O OH    . TYR A 100 ? 1.2064 1.4615 1.4808 0.0919  -0.0437 0.0450  72  TYR A OH    
536  N N     . ILE A 101 ? 0.5910 0.7926 0.8007 0.0434  -0.0382 0.1340  73  ILE A N     
537  C CA    . ILE A 101 ? 0.5591 0.7608 0.7514 0.0322  -0.0340 0.1469  73  ILE A CA    
538  C C     . ILE A 101 ? 0.5338 0.7437 0.7104 0.0297  -0.0407 0.1709  73  ILE A C     
539  O O     . ILE A 101 ? 0.5385 0.7376 0.7291 0.0323  -0.0470 0.1904  73  ILE A O     
540  C CB    . ILE A 101 ? 0.5831 0.7645 0.7947 0.0280  -0.0293 0.1502  73  ILE A CB    
541  C CG1   . ILE A 101 ? 0.6223 0.7992 0.8465 0.0290  -0.0231 0.1252  73  ILE A CG1   
542  C CG2   . ILE A 101 ? 0.5096 0.6928 0.7032 0.0156  -0.0239 0.1640  73  ILE A CG2   
543  C CD1   . ILE A 101 ? 0.6865 0.8458 0.9302 0.0237  -0.0179 0.1247  73  ILE A CD1   
544  N N     . LEU A 102 ? 0.5398 0.7697 0.6885 0.0245  -0.0395 0.1694  74  LEU A N     
545  C CA    . LEU A 102 ? 0.5670 0.8097 0.6956 0.0198  -0.0450 0.1900  74  LEU A CA    
546  C C     . LEU A 102 ? 0.6993 0.9387 0.8156 0.0076  -0.0383 0.2032  74  LEU A C     
547  O O     . LEU A 102 ? 0.8752 1.1108 0.9901 0.0046  -0.0428 0.2276  74  LEU A O     
548  C CB    . LEU A 102 ? 0.4775 0.7445 0.5825 0.0181  -0.0454 0.1798  74  LEU A CB    
549  C CG    . LEU A 102 ? 0.4583 0.7325 0.5727 0.0285  -0.0513 0.1669  74  LEU A CG    
550  C CD1   . LEU A 102 ? 0.4358 0.7332 0.5280 0.0245  -0.0499 0.1561  74  LEU A CD1   
551  C CD2   . LEU A 102 ? 0.4548 0.7263 0.5845 0.0374  -0.0637 0.1831  74  LEU A CD2   
552  N N     . MET A 103 ? 0.7172 0.9591 0.8258 0.0004  -0.0273 0.1876  75  MET A N     
553  C CA    . MET A 103 ? 0.7498 0.9904 0.8488 -0.0120 -0.0187 0.1959  75  MET A CA    
554  C C     . MET A 103 ? 0.7889 1.0193 0.9016 -0.0141 -0.0091 0.1769  75  MET A C     
555  O O     . MET A 103 ? 0.8236 1.0549 0.9438 -0.0078 -0.0087 0.1565  75  MET A O     
556  C CB    . MET A 103 ? 0.6292 0.8944 0.6963 -0.0216 -0.0150 0.1970  75  MET A CB    
557  C CG    . MET A 103 ? 0.5759 0.8533 0.6259 -0.0232 -0.0240 0.2198  75  MET A CG    
558  S SD    . MET A 103 ? 0.8644 1.1742 0.8765 -0.0357 -0.0189 0.2169  75  MET A SD    
559  C CE    . MET A 103 ? 2.3609 2.6672 2.3686 -0.0500 -0.0030 0.2161  75  MET A CE    
560  N N     . PRO A 104 ? 0.7236 0.9452 0.8404 -0.0233 -0.0018 0.1843  76  PRO A N     
561  C CA    . PRO A 104 ? 0.7030 0.9169 0.8338 -0.0262 0.0067  0.1667  76  PRO A CA    
562  C C     . PRO A 104 ? 0.6229 0.8539 0.7410 -0.0279 0.0123  0.1454  76  PRO A C     
563  O O     . PRO A 104 ? 0.4261 0.6535 0.5571 -0.0238 0.0138  0.1270  76  PRO A O     
564  C CB    . PRO A 104 ? 0.4922 0.7007 0.6230 -0.0384 0.0142  0.1814  76  PRO A CB    
565  C CG    . PRO A 104 ? 0.7034 0.9053 0.8327 -0.0380 0.0072  0.2089  76  PRO A CG    
566  C CD    . PRO A 104 ? 0.6852 0.9029 0.7964 -0.0314 -0.0016 0.2109  76  PRO A CD    
567  N N     . SER A 105 ? 0.6063 0.8564 0.7003 -0.0341 0.0150  0.1481  77  SER A N     
568  C CA    . SER A 105 ? 0.5371 0.8033 0.6219 -0.0361 0.0206  0.1287  77  SER A CA    
569  C C     . SER A 105 ? 0.6818 0.9497 0.7719 -0.0250 0.0145  0.1142  77  SER A C     
570  O O     . SER A 105 ? 0.7592 1.0296 0.8562 -0.0234 0.0178  0.0969  77  SER A O     
571  C CB    . SER A 105 ? 0.5220 0.8093 0.5812 -0.0446 0.0241  0.1335  77  SER A CB    
572  O OG    . SER A 105 ? 0.8227 1.1100 0.8739 -0.0554 0.0294  0.1503  77  SER A OG    
573  N N     . GLN A 106 ? 0.6564 0.9240 0.7445 -0.0177 0.0054  0.1222  78  GLN A N     
574  C CA    . GLN A 106 ? 0.6184 0.8901 0.7102 -0.0082 0.0002  0.1097  78  GLN A CA    
575  C C     . GLN A 106 ? 0.6341 0.8918 0.7473 -0.0008 -0.0008 0.0987  78  GLN A C     
576  O O     . GLN A 106 ? 0.5944 0.8570 0.7103 0.0039  -0.0010 0.0841  78  GLN A O     
577  C CB    . GLN A 106 ? 0.5461 0.8234 0.6315 -0.0028 -0.0093 0.1210  78  GLN A CB    
578  C CG    . GLN A 106 ? 0.5197 0.7812 0.6236 0.0057  -0.0170 0.1307  78  GLN A CG    
579  C CD    . GLN A 106 ? 0.5652 0.8256 0.6822 0.0163  -0.0210 0.1169  78  GLN A CD    
580  O OE1   . GLN A 106 ? 0.5245 0.7715 0.6616 0.0234  -0.0245 0.1170  78  GLN A OE1   
581  N NE2   . GLN A 106 ? 0.6317 0.9067 0.7389 0.0169  -0.0197 0.1043  78  GLN A NE2   
582  N N     . ALA A 107 ? 0.5745 0.8156 0.7032 -0.0006 -0.0013 0.1056  79  ALA A N     
583  C CA    . ALA A 107 ? 0.4996 0.7289 0.6489 0.0052  -0.0019 0.0934  79  ALA A CA    
584  C C     . ALA A 107 ? 0.5786 0.8113 0.7297 0.0005  0.0049  0.0784  79  ALA A C     
585  O O     . ALA A 107 ? 0.5756 0.8082 0.7356 0.0051  0.0042  0.0639  79  ALA A O     
586  C CB    . ALA A 107 ? 0.4505 0.6611 0.6190 0.0060  -0.0037 0.1038  79  ALA A CB    
587  N N     . ILE A 108 ? 0.6312 0.8686 0.7739 -0.0089 0.0112  0.0823  80  ILE A N     
588  C CA    . ILE A 108 ? 0.5252 0.7680 0.6711 -0.0138 0.0175  0.0693  80  ILE A CA    
589  C C     . ILE A 108 ? 0.4608 0.7179 0.5984 -0.0105 0.0172  0.0572  80  ILE A C     
590  O O     . ILE A 108 ? 0.3598 0.6191 0.5055 -0.0085 0.0177  0.0445  80  ILE A O     
591  C CB    . ILE A 108 ? 0.4628 0.7093 0.6025 -0.0251 0.0254  0.0766  80  ILE A CB    
592  C CG1   . ILE A 108 ? 0.4737 0.7044 0.6257 -0.0294 0.0267  0.0884  80  ILE A CG1   
593  C CG2   . ILE A 108 ? 0.4186 0.6743 0.5625 -0.0295 0.0317  0.0624  80  ILE A CG2   
594  C CD1   . ILE A 108 ? 0.5394 0.7578 0.7146 -0.0265 0.0256  0.0777  80  ILE A CD1   
595  N N     . ILE A 109 ? 0.4366 0.7039 0.5591 -0.0101 0.0160  0.0618  81  ILE A N     
596  C CA    . ILE A 109 ? 0.4345 0.7147 0.5512 -0.0077 0.0163  0.0512  81  ILE A CA    
597  C C     . ILE A 109 ? 0.5216 0.8001 0.6441 0.0018  0.0103  0.0449  81  ILE A C     
598  O O     . ILE A 109 ? 0.4619 0.7465 0.5874 0.0040  0.0109  0.0345  81  ILE A O     
599  C CB    . ILE A 109 ? 0.3802 0.6736 0.4801 -0.0114 0.0172  0.0562  81  ILE A CB    
600  C CG1   . ILE A 109 ? 0.3600 0.6586 0.4521 -0.0220 0.0247  0.0610  81  ILE A CG1   
601  C CG2   . ILE A 109 ? 0.3150 0.6204 0.4130 -0.0091 0.0178  0.0444  81  ILE A CG2   
602  C CD1   . ILE A 109 ? 0.3526 0.6674 0.4265 -0.0273 0.0264  0.0637  81  ILE A CD1   
603  N N     . GLU A 110 ? 0.4837 0.7544 0.6093 0.0072  0.0047  0.0515  82  GLU A N     
604  C CA    . GLU A 110 ? 0.4163 0.6878 0.5468 0.0157  0.0000  0.0453  82  GLU A CA    
605  C C     . GLU A 110 ? 0.4980 0.7615 0.6426 0.0194  -0.0007 0.0365  82  GLU A C     
606  O O     . GLU A 110 ? 0.4888 0.7578 0.6350 0.0236  -0.0017 0.0272  82  GLU A O     
607  C CB    . GLU A 110 ? 0.4604 0.7312 0.5891 0.0204  -0.0058 0.0548  82  GLU A CB    
608  C CG    . GLU A 110 ? 0.4599 0.7431 0.5732 0.0171  -0.0065 0.0613  82  GLU A CG    
609  C CD    . GLU A 110 ? 0.4053 0.6936 0.5183 0.0236  -0.0133 0.0652  82  GLU A CD    
610  O OE1   . GLU A 110 ? 0.4267 0.7110 0.5409 0.0251  -0.0185 0.0782  82  GLU A OE1   
611  O OE2   . GLU A 110 ? 0.4120 0.7089 0.5253 0.0270  -0.0137 0.0561  82  GLU A OE2   
612  N N     . TYR A 111 ? 0.6547 0.9063 0.8096 0.0172  0.0000  0.0391  83  TYR A N     
613  C CA    . TYR A 111 ? 0.5728 0.8178 0.7424 0.0202  -0.0008 0.0288  83  TYR A CA    
614  C C     . TYR A 111 ? 0.4694 0.7156 0.6437 0.0147  0.0027  0.0204  83  TYR A C     
615  O O     . TYR A 111 ? 0.4896 0.7329 0.6751 0.0158  0.0020  0.0102  83  TYR A O     
616  C CB    . TYR A 111 ? 0.4681 0.6985 0.6526 0.0228  -0.0031 0.0344  83  TYR A CB    
617  C CG    . TYR A 111 ? 0.4651 0.6958 0.6504 0.0302  -0.0080 0.0402  83  TYR A CG    
618  C CD1   . TYR A 111 ? 0.4564 0.6918 0.6477 0.0372  -0.0099 0.0290  83  TYR A CD1   
619  C CD2   . TYR A 111 ? 0.5407 0.7691 0.7208 0.0298  -0.0108 0.0568  83  TYR A CD2   
620  C CE1   . TYR A 111 ? 0.4958 0.7329 0.6907 0.0440  -0.0142 0.0332  83  TYR A CE1   
621  C CE2   . TYR A 111 ? 0.4896 0.7201 0.6725 0.0368  -0.0164 0.0622  83  TYR A CE2   
622  C CZ    . TYR A 111 ? 0.4922 0.7266 0.6838 0.0441  -0.0180 0.0498  83  TYR A CZ    
623  O OH    . TYR A 111 ? 0.5694 0.8070 0.7666 0.0513  -0.0233 0.0543  83  TYR A OH    
624  N N     . ILE A 112 ? 0.4241 0.6761 0.5907 0.0086  0.0065  0.0235  84  ILE A N     
625  C CA    . ILE A 112 ? 0.4380 0.6935 0.6107 0.0038  0.0094  0.0156  84  ILE A CA    
626  C C     . ILE A 112 ? 0.4352 0.7043 0.6003 0.0031  0.0108  0.0117  84  ILE A C     
627  O O     . ILE A 112 ? 0.5220 0.7977 0.6912 0.0049  0.0088  0.0031  84  ILE A O     
628  C CB    . ILE A 112 ? 0.4218 0.6702 0.6005 -0.0042 0.0142  0.0216  84  ILE A CB    
629  C CG1   . ILE A 112 ? 0.4646 0.6975 0.6563 -0.0038 0.0129  0.0252  84  ILE A CG1   
630  C CG2   . ILE A 112 ? 0.3677 0.6223 0.5546 -0.0091 0.0171  0.0126  84  ILE A CG2   
631  C CD1   . ILE A 112 ? 0.3455 0.5703 0.5457 -0.0124 0.0180  0.0321  84  ILE A CD1   
632  N N     . LEU A 113 ? 0.3780 0.6520 0.5333 0.0003  0.0139  0.0179  85  LEU A N     
633  C CA    . LEU A 113 ? 0.4195 0.7055 0.5716 -0.0005 0.0159  0.0135  85  LEU A CA    
634  C C     . LEU A 113 ? 0.4879 0.7794 0.6373 0.0063  0.0117  0.0098  85  LEU A C     
635  O O     . LEU A 113 ? 0.5899 0.8877 0.7445 0.0075  0.0107  0.0041  85  LEU A O     
636  C CB    . LEU A 113 ? 0.3896 0.6811 0.5318 -0.0054 0.0207  0.0187  85  LEU A CB    
637  C CG    . LEU A 113 ? 0.3701 0.6635 0.5152 -0.0141 0.0277  0.0193  85  LEU A CG    
638  C CD1   . LEU A 113 ? 0.3015 0.6024 0.4331 -0.0196 0.0324  0.0246  85  LEU A CD1   
639  C CD2   . LEU A 113 ? 0.3861 0.6867 0.5439 -0.0154 0.0302  0.0092  85  LEU A CD2   
640  N N     . ALA A 114 ? 0.4248 0.7144 0.5671 0.0104  0.0090  0.0140  86  ALA A N     
641  C CA    . ALA A 114 ? 0.4255 0.7209 0.5652 0.0159  0.0060  0.0112  86  ALA A CA    
642  C C     . ALA A 114 ? 0.4938 0.7899 0.6393 0.0195  0.0031  0.0048  86  ALA A C     
643  O O     . ALA A 114 ? 0.4517 0.7556 0.5970 0.0213  0.0022  0.0020  86  ALA A O     
644  C CB    . ALA A 114 ? 0.3639 0.6578 0.4978 0.0196  0.0034  0.0165  86  ALA A CB    
645  N N     . PHE A 115 ? 0.5102 0.7989 0.6613 0.0199  0.0018  0.0026  87  PHE A N     
646  C CA    . PHE A 115 ? 0.4400 0.7315 0.5955 0.0222  -0.0008 -0.0056 87  PHE A CA    
647  C C     . PHE A 115 ? 0.4989 0.7962 0.6592 0.0187  -0.0012 -0.0101 87  PHE A C     
648  O O     . PHE A 115 ? 0.6033 0.9078 0.7645 0.0200  -0.0042 -0.0163 87  PHE A O     
649  C CB    . PHE A 115 ? 0.4177 0.6997 0.5810 0.0237  -0.0018 -0.0091 87  PHE A CB    
650  C CG    . PHE A 115 ? 0.4823 0.7614 0.6447 0.0291  -0.0030 -0.0070 87  PHE A CG    
651  C CD1   . PHE A 115 ? 0.4607 0.7329 0.6221 0.0296  -0.0031 0.0030  87  PHE A CD1   
652  C CD2   . PHE A 115 ? 0.4803 0.7656 0.6436 0.0335  -0.0043 -0.0150 87  PHE A CD2   
653  C CE1   . PHE A 115 ? 0.3901 0.6609 0.5535 0.0352  -0.0053 0.0053  87  PHE A CE1   
654  C CE2   . PHE A 115 ? 0.3420 0.6260 0.5079 0.0388  -0.0051 -0.0141 87  PHE A CE2   
655  C CZ    . PHE A 115 ? 0.3374 0.6138 0.5045 0.0400  -0.0061 -0.0038 87  PHE A CZ    
656  N N     . SER A 116 ? 0.5118 0.8080 0.6756 0.0140  0.0017  -0.0073 88  SER A N     
657  C CA    . SER A 116 ? 0.4757 0.7785 0.6473 0.0110  0.0011  -0.0112 88  SER A CA    
658  C C     . SER A 116 ? 0.5123 0.8253 0.6827 0.0130  -0.0002 -0.0096 88  SER A C     
659  O O     . SER A 116 ? 0.4885 0.8096 0.6651 0.0130  -0.0035 -0.0119 88  SER A O     
660  C CB    . SER A 116 ? 0.3855 0.6845 0.5641 0.0050  0.0058  -0.0098 88  SER A CB    
661  O OG    . SER A 116 ? 0.3809 0.6700 0.5642 0.0024  0.0067  -0.0105 88  SER A OG    
662  N N     . PHE A 117 ? 0.4772 0.7902 0.6412 0.0146  0.0021  -0.0051 89  PHE A N     
663  C CA    . PHE A 117 ? 0.4280 0.7487 0.5941 0.0161  0.0018  -0.0032 89  PHE A CA    
664  C C     . PHE A 117 ? 0.4078 0.7338 0.5685 0.0205  -0.0021 -0.0020 89  PHE A C     
665  O O     . PHE A 117 ? 0.4464 0.7774 0.6087 0.0219  -0.0021 0.0014  89  PHE A O     
666  C CB    . PHE A 117 ? 0.4038 0.7239 0.5678 0.0146  0.0066  -0.0010 89  PHE A CB    
667  C CG    . PHE A 117 ? 0.4405 0.7618 0.6126 0.0096  0.0115  -0.0032 89  PHE A CG    
668  C CD1   . PHE A 117 ? 0.4884 0.8050 0.6601 0.0053  0.0142  -0.0037 89  PHE A CD1   
669  C CD2   . PHE A 117 ? 0.3916 0.7191 0.5740 0.0088  0.0141  -0.0052 89  PHE A CD2   
670  C CE1   . PHE A 117 ? 0.2450 0.5646 0.4241 -0.0002 0.0199  -0.0063 89  PHE A CE1   
671  C CE2   . PHE A 117 ? 0.3971 0.7275 0.5890 0.0039  0.0197  -0.0094 89  PHE A CE2   
672  C CZ    . PHE A 117 ? 0.2393 0.5666 0.4283 -0.0008 0.0229  -0.0101 89  PHE A CZ    
673  N N     . ILE A 118 ? 0.3769 0.7021 0.5327 0.0220  -0.0047 -0.0053 90  ILE A N     
674  C CA    . ILE A 118 ? 0.3234 0.6566 0.4733 0.0248  -0.0077 -0.0058 90  ILE A CA    
675  C C     . ILE A 118 ? 0.3547 0.6978 0.5088 0.0238  -0.0122 -0.0050 90  ILE A C     
676  O O     . ILE A 118 ? 0.3951 0.7480 0.5440 0.0250  -0.0151 -0.0027 90  ILE A O     
677  C CB    . ILE A 118 ? 0.2751 0.6061 0.4206 0.0264  -0.0083 -0.0124 90  ILE A CB    
678  C CG1   . ILE A 118 ? 0.3067 0.6271 0.4517 0.0278  -0.0053 -0.0112 90  ILE A CG1   
679  C CG2   . ILE A 118 ? 0.2992 0.6407 0.4371 0.0286  -0.0096 -0.0141 90  ILE A CG2   
680  C CD1   . ILE A 118 ? 0.3414 0.6581 0.4874 0.0302  -0.0056 -0.0177 90  ILE A CD1   
681  N N     . ALA A 119 ? 0.3849 0.7269 0.5490 0.0211  -0.0128 -0.0062 91  ALA A N     
682  C CA    . ALA A 119 ? 0.3354 0.6874 0.5075 0.0204  -0.0180 -0.0045 91  ALA A CA    
683  C C     . ALA A 119 ? 0.3347 0.6926 0.5095 0.0225  -0.0194 0.0046  91  ALA A C     
684  O O     . ALA A 119 ? 0.5010 0.8696 0.6769 0.0232  -0.0253 0.0093  91  ALA A O     
685  C CB    . ALA A 119 ? 0.2409 0.5902 0.4271 0.0173  -0.0168 -0.0073 91  ALA A CB    
686  N N     . PHE A 120 ? 0.3964 0.7479 0.5732 0.0232  -0.0141 0.0075  92  PHE A N     
687  C CA    . PHE A 120 ? 0.4461 0.8009 0.6300 0.0248  -0.0142 0.0154  92  PHE A CA    
688  C C     . PHE A 120 ? 0.5129 0.8737 0.6855 0.0265  -0.0161 0.0212  92  PHE A C     
689  O O     . PHE A 120 ? 0.5918 0.9553 0.7707 0.0274  -0.0164 0.0294  92  PHE A O     
690  C CB    . PHE A 120 ? 0.3661 0.7137 0.5568 0.0240  -0.0075 0.0139  92  PHE A CB    
691  C CG    . PHE A 120 ? 0.3377 0.6839 0.5445 0.0218  -0.0051 0.0101  92  PHE A CG    
692  C CD1   . PHE A 120 ? 0.3225 0.6644 0.5266 0.0188  -0.0017 0.0035  92  PHE A CD1   
693  C CD2   . PHE A 120 ? 0.2678 0.6173 0.4943 0.0226  -0.0057 0.0134  92  PHE A CD2   
694  C CE1   . PHE A 120 ? 0.2733 0.6159 0.4924 0.0159  0.0018  -0.0008 92  PHE A CE1   
695  C CE2   . PHE A 120 ? 0.3083 0.6579 0.5523 0.0206  -0.0026 0.0080  92  PHE A CE2   
696  C CZ    . PHE A 120 ? 0.2195 0.5666 0.4589 0.0170  0.0016  0.0004  92  PHE A CZ    
697  N N     . SER A 121 ? 0.4523 0.8155 0.6103 0.0266  -0.0168 0.0165  93  SER A N     
698  C CA    . SER A 121 ? 0.4548 0.8268 0.6013 0.0273  -0.0179 0.0203  93  SER A CA    
699  C C     . SER A 121 ? 0.4427 0.8279 0.5882 0.0265  -0.0248 0.0270  93  SER A C     
700  O O     . SER A 121 ? 0.4738 0.8690 0.6099 0.0261  -0.0259 0.0334  93  SER A O     
701  C CB    . SER A 121 ? 0.4171 0.7891 0.5513 0.0277  -0.0159 0.0107  93  SER A CB    
702  O OG    . SER A 121 ? 0.4403 0.8007 0.5761 0.0288  -0.0112 0.0065  93  SER A OG    
703  N N     . GLY A 122 ? 0.2540 0.6407 0.4093 0.0258  -0.0295 0.0262  94  GLY A N     
704  C CA    . GLY A 122 ? 0.2628 0.6638 0.4182 0.0251  -0.0379 0.0328  94  GLY A CA    
705  C C     . GLY A 122 ? 0.4032 0.8048 0.5781 0.0265  -0.0419 0.0444  94  GLY A C     
706  O O     . GLY A 122 ? 0.4923 0.9047 0.6729 0.0263  -0.0502 0.0492  94  GLY A O     
707  N N     . VAL A 123 ? 0.3919 0.7829 0.5791 0.0278  -0.0363 0.0482  95  VAL A N     
708  C CA    . VAL A 123 ? 0.4204 0.8103 0.6314 0.0295  -0.0388 0.0574  95  VAL A CA    
709  C C     . VAL A 123 ? 0.5204 0.9204 0.7326 0.0303  -0.0453 0.0747  95  VAL A C     
710  O O     . VAL A 123 ? 0.5888 0.9916 0.8218 0.0322  -0.0510 0.0845  95  VAL A O     
711  C CB    . VAL A 123 ? 0.3331 0.7099 0.5582 0.0300  -0.0301 0.0542  95  VAL A CB    
712  C CG1   . VAL A 123 ? 0.2841 0.6532 0.5105 0.0285  -0.0246 0.0400  95  VAL A CG1   
713  C CG2   . VAL A 123 ? 0.3036 0.6773 0.5167 0.0296  -0.0248 0.0568  95  VAL A CG2   
714  N N     . PHE A 124 ? 0.5796 0.9857 0.7710 0.0289  -0.0444 0.0791  96  PHE A N     
715  C CA    . PHE A 124 ? 0.5899 1.0069 0.7788 0.0284  -0.0498 0.0974  96  PHE A CA    
716  C C     . PHE A 124 ? 0.6470 1.0823 0.8099 0.0257  -0.0554 0.0980  96  PHE A C     
717  O O     . PHE A 124 ? 0.3105 0.7569 0.4615 0.0237  -0.0569 0.1109  96  PHE A O     
718  C CB    . PHE A 124 ? 0.4910 0.9013 0.6804 0.0278  -0.0422 0.1040  96  PHE A CB    
719  C CG    . PHE A 124 ? 0.4924 0.8875 0.7087 0.0297  -0.0370 0.1036  96  PHE A CG    
720  C CD1   . PHE A 124 ? 0.5193 0.9111 0.7623 0.0322  -0.0413 0.1072  96  PHE A CD1   
721  C CD2   . PHE A 124 ? 0.3931 0.7789 0.6097 0.0289  -0.0278 0.0980  96  PHE A CD2   
722  C CE1   . PHE A 124 ? 0.4488 0.8281 0.7182 0.0334  -0.0355 0.1039  96  PHE A CE1   
723  C CE2   . PHE A 124 ? 0.3566 0.7307 0.5979 0.0298  -0.0228 0.0951  96  PHE A CE2   
724  C CZ    . PHE A 124 ? 0.3318 0.7025 0.5994 0.0319  -0.0262 0.0974  96  PHE A CZ    
725  N N     . SER A 125 ? 0.5700 1.0096 0.7251 0.0249  -0.0578 0.0835  97  SER A N     
726  C CA    . SER A 125 ? 0.5565 1.0144 0.6881 0.0217  -0.0623 0.0789  97  SER A CA    
727  C C     . SER A 125 ? 0.6088 1.0866 0.7365 0.0203  -0.0735 0.0961  97  SER A C     
728  O O     . SER A 125 ? 0.6072 1.1023 0.7126 0.0167  -0.0751 0.1003  97  SER A O     
729  C CB    . SER A 125 ? 0.5925 1.0498 0.7234 0.0209  -0.0635 0.0600  97  SER A CB    
730  O OG    . SER A 125 ? 0.6453 1.0868 0.7752 0.0215  -0.0537 0.0458  97  SER A OG    
731  N N     . LYS A 126 ? 0.5720 1.0489 0.7222 0.0230  -0.0814 0.1060  98  LYS A N     
732  C CA    . LYS A 126 ? 0.4586 0.9545 0.6091 0.0224  -0.0941 0.1248  98  LYS A CA    
733  C C     . LYS A 126 ? 0.4687 0.9677 0.6138 0.0215  -0.0929 0.1466  98  LYS A C     
734  O O     . LYS A 126 ? 0.6575 1.1772 0.7838 0.0180  -0.0998 0.1594  98  LYS A O     
735  C CB    . LYS A 126 ? 0.4926 0.9849 0.6750 0.0266  -0.1022 0.1310  98  LYS A CB    
736  N N     . GLN A 127 ? 0.4549 0.9342 0.6163 0.0237  -0.0840 0.1503  99  GLN A N     
737  C CA    . GLN A 127 ? 0.4966 0.9760 0.6574 0.0223  -0.0813 0.1704  99  GLN A CA    
738  C C     . GLN A 127 ? 0.4463 0.9383 0.5737 0.0170  -0.0754 0.1677  99  GLN A C     
739  O O     . GLN A 127 ? 0.3947 0.9019 0.5091 0.0133  -0.0787 0.1863  99  GLN A O     
740  C CB    . GLN A 127 ? 0.4944 0.9501 0.6809 0.0252  -0.0718 0.1699  99  GLN A CB    
741  C CG    . GLN A 127 ? 0.4089 0.8534 0.6329 0.0301  -0.0764 0.1750  99  GLN A CG    
742  C CD    . GLN A 127 ? 0.4647 0.9009 0.6982 0.0324  -0.0744 0.1530  99  GLN A CD    
743  O OE1   . GLN A 127 ? 0.4437 0.8871 0.6571 0.0307  -0.0752 0.1385  99  GLN A OE1   
744  N NE2   . GLN A 127 ? 0.4731 0.8945 0.7386 0.0357  -0.0710 0.1499  99  GLN A NE2   
745  N N     . VAL A 128 ? 0.4573 0.9436 0.5721 0.0163  -0.0665 0.1449  100 VAL A N     
746  C CA    . VAL A 128 ? 0.4912 0.9895 0.5782 0.0117  -0.0596 0.1380  100 VAL A CA    
747  C C     . VAL A 128 ? 0.6288 1.1547 0.6908 0.0071  -0.0677 0.1401  100 VAL A C     
748  O O     . VAL A 128 ? 0.7059 1.2490 0.7485 0.0022  -0.0666 0.1513  100 VAL A O     
749  C CB    . VAL A 128 ? 0.4583 0.9455 0.5408 0.0128  -0.0504 0.1122  100 VAL A CB    
750  C CG1   . VAL A 128 ? 0.4107 0.9119 0.4679 0.0085  -0.0434 0.1036  100 VAL A CG1   
751  C CG2   . VAL A 128 ? 0.3831 0.8464 0.4867 0.0165  -0.0426 0.1098  100 VAL A CG2   
752  N N     . ARG A 129 ? 0.6402 1.1720 0.7028 0.0080  -0.0757 0.1288  101 ARG A N     
753  C CA    . ARG A 129 ? 0.5772 1.1372 0.6173 0.0033  -0.0846 0.1275  101 ARG A CA    
754  C C     . ARG A 129 ? 0.5718 1.1495 0.6089 0.0013  -0.0958 0.1564  101 ARG A C     
755  O O     . ARG A 129 ? 0.5673 1.1717 0.5779 -0.0047 -0.0996 0.1620  101 ARG A O     
756  C CB    . ARG A 129 ? 0.4958 1.0569 0.5428 0.0047  -0.0913 0.1093  101 ARG A CB    
757  C CG    . ARG A 129 ? 0.4196 0.9739 0.4597 0.0039  -0.0821 0.0804  101 ARG A CG    
758  C CD    . ARG A 129 ? 0.4575 1.0170 0.5030 0.0035  -0.0892 0.0635  101 ARG A CD    
759  N NE    . ARG A 129 ? 0.5970 1.1332 0.6700 0.0085  -0.0887 0.0600  101 ARG A NE    
760  C CZ    . ARG A 129 ? 0.6065 1.1423 0.6993 0.0110  -0.0980 0.0711  101 ARG A CZ    
761  N NH1   . ARG A 129 ? 0.7001 1.2566 0.7890 0.0098  -0.1101 0.0883  101 ARG A NH1   
762  N NH2   . ARG A 129 ? 0.5669 1.0826 0.6838 0.0147  -0.0953 0.0654  101 ARG A NH2   
763  N N     . SER A 130 ? 0.5423 1.1058 0.6075 0.0062  -0.1009 0.1747  102 SER A N     
764  C CA    . SER A 130 ? 0.5936 1.1704 0.6627 0.0055  -0.1123 0.2053  102 SER A CA    
765  C C     . SER A 130 ? 0.7699 1.3552 0.8210 0.0003  -0.1062 0.2235  102 SER A C     
766  O O     . SER A 130 ? 0.9435 1.5547 0.9730 -0.0050 -0.1137 0.2403  102 SER A O     
767  C CB    . SER A 130 ? 0.6077 1.1638 0.7172 0.0126  -0.1166 0.2188  102 SER A CB    
768  O OG    . SER A 130 ? 0.8067 1.3731 0.9243 0.0125  -0.1273 0.2507  102 SER A OG    
769  N N     . ASN A 131 ? 0.6833 1.2480 0.7431 0.0012  -0.0925 0.2201  103 ASN A N     
770  C CA    . ASN A 131 ? 0.6428 1.2135 0.6892 -0.0042 -0.0846 0.2359  103 ASN A CA    
771  C C     . ASN A 131 ? 0.7168 1.3111 0.7250 -0.0115 -0.0783 0.2223  103 ASN A C     
772  O O     . ASN A 131 ? 0.7823 1.3956 0.7703 -0.0183 -0.0766 0.2389  103 ASN A O     
773  C CB    . ASN A 131 ? 0.5499 1.0931 0.6190 -0.0014 -0.0719 0.2333  103 ASN A CB    
774  C CG    . ASN A 131 ? 0.5329 1.0552 0.6412 0.0045  -0.0766 0.2486  103 ASN A CG    
775  O OD1   . ASN A 131 ? 0.4928 1.0152 0.6134 0.0034  -0.0798 0.2758  103 ASN A OD1   
776  N ND2   . ASN A 131 ? 0.4076 0.9122 0.5373 0.0105  -0.0766 0.2309  103 ASN A ND2   
777  N N     . LEU A 132 ? 0.6584 1.2519 0.6583 -0.0105 -0.0743 0.1918  104 LEU A N     
778  C CA    . LEU A 132 ? 0.6307 1.2449 0.5995 -0.0168 -0.0670 0.1737  104 LEU A CA    
779  C C     . LEU A 132 ? 0.6691 1.3185 0.6102 -0.0234 -0.0774 0.1806  104 LEU A C     
780  O O     . LEU A 132 ? 0.7325 1.4060 0.6456 -0.0311 -0.0720 0.1805  104 LEU A O     
781  C CB    . LEU A 132 ? 0.5692 1.1718 0.5415 -0.0134 -0.0612 0.1400  104 LEU A CB    
782  C CG    . LEU A 132 ? 0.6143 1.2306 0.5645 -0.0181 -0.0499 0.1175  104 LEU A CG    
783  C CD1   . LEU A 132 ? 0.5493 1.1584 0.5005 -0.0194 -0.0367 0.1234  104 LEU A CD1   
784  C CD2   . LEU A 132 ? 0.7027 1.3065 0.6610 -0.0142 -0.0469 0.0869  104 LEU A CD2   
785  N N     . ALA A 133 ? 0.6284 1.2826 0.5776 -0.0207 -0.0924 0.1862  105 ALA A N     
786  C CA    . ALA A 133 ? 0.5989 1.2883 0.5234 -0.0268 -0.1048 0.1929  105 ALA A CA    
787  C C     . ALA A 133 ? 0.6214 1.3267 0.5369 -0.0310 -0.1113 0.2304  105 ALA A C     
788  O O     . ALA A 133 ? 0.6545 1.3940 0.5402 -0.0387 -0.1181 0.2389  105 ALA A O     
789  C CB    . ALA A 133 ? 0.6389 1.3287 0.5784 -0.0224 -0.1193 0.1862  105 ALA A CB    
790  N N     . ALA A 134 ? 0.6250 1.3059 0.5668 -0.0265 -0.1091 0.2528  106 ALA A N     
791  C CA    . ALA A 134 ? 0.7103 1.4011 0.6501 -0.0300 -0.1146 0.2912  106 ALA A CA    
792  C C     . ALA A 134 ? 0.8897 1.5812 0.8154 -0.0364 -0.0986 0.2974  106 ALA A C     
793  O O     . ALA A 134 ? 0.9438 1.6330 0.8767 -0.0385 -0.0987 0.3288  106 ALA A O     
794  C CB    . ALA A 134 ? 0.5599 1.2247 0.5418 -0.0215 -0.1225 0.3130  106 ALA A CB    
795  N N     . ASN A 135 ? 0.8957 1.5902 0.8041 -0.0393 -0.0848 0.2674  107 ASN A N     
796  C CA    . ASN A 135 ? 0.8895 1.5857 0.7862 -0.0453 -0.0681 0.2675  107 ASN A CA    
797  C C     . ASN A 135 ? 0.8692 1.5343 0.7978 -0.0412 -0.0604 0.2829  107 ASN A C     
798  O O     . ASN A 135 ? 0.9274 1.5967 0.8503 -0.0473 -0.0508 0.2982  107 ASN A O     
799  C CB    . ASN A 135 ? 0.9987 1.7325 0.8591 -0.0568 -0.0687 0.2865  107 ASN A CB    
800  C CG    . ASN A 135 ? 1.1544 1.9218 0.9799 -0.0629 -0.0703 0.2618  107 ASN A CG    
801  O OD1   . ASN A 135 ? 1.2249 1.9992 1.0364 -0.0663 -0.0565 0.2339  107 ASN A OD1   
802  N ND2   . ASN A 135 ? 1.2154 1.9983 1.0340 -0.0640 -0.0856 0.2679  107 ASN A ND2   
803  N N     . GLN A 136 ? 0.8074 1.4425 0.7700 -0.0317 -0.0641 0.2776  108 GLN A N     
804  C CA    . GLN A 136 ? 0.7810 1.3857 0.7763 -0.0275 -0.0562 0.2848  108 GLN A CA    
805  C C     . GLN A 136 ? 0.6705 1.2588 0.6707 -0.0244 -0.0432 0.2520  108 GLN A C     
806  O O     . GLN A 136 ? 0.6692 1.2340 0.6933 -0.0168 -0.0441 0.2383  108 GLN A O     
807  C CB    . GLN A 136 ? 0.8137 1.3973 0.8450 -0.0194 -0.0675 0.2976  108 GLN A CB    
808  C CG    . GLN A 136 ? 0.7503 1.3493 0.7821 -0.0207 -0.0831 0.3303  108 GLN A CG    
809  C CD    . GLN A 136 ? 0.7843 1.3786 0.8298 -0.0242 -0.0809 0.3645  108 GLN A CD    
810  O OE1   . GLN A 136 ? 0.8375 1.4132 0.8989 -0.0247 -0.0679 0.3626  108 GLN A OE1   
811  N NE2   . GLN A 136 ? 0.8379 1.4495 0.8786 -0.0269 -0.0940 0.3967  108 GLN A NE2   
812  N N     . LEU A 137 ? 0.6760 1.2782 0.6538 -0.0303 -0.0312 0.2399  109 LEU A N     
813  C CA    . LEU A 137 ? 0.6444 1.2356 0.6244 -0.0274 -0.0201 0.2085  109 LEU A CA    
814  C C     . LEU A 137 ? 0.5405 1.1018 0.5520 -0.0224 -0.0129 0.2068  109 LEU A C     
815  O O     . LEU A 137 ? 0.5150 1.0591 0.5389 -0.0163 -0.0110 0.1849  109 LEU A O     
816  C CB    . LEU A 137 ? 0.4833 1.0981 0.4358 -0.0351 -0.0085 0.1970  109 LEU A CB    
817  C CG    . LEU A 137 ? 0.4625 1.0686 0.4185 -0.0319 0.0025  0.1650  109 LEU A CG    
818  C CD1   . LEU A 137 ? 0.4456 1.0424 0.4059 -0.0252 -0.0044 0.1422  109 LEU A CD1   
819  C CD2   . LEU A 137 ? 0.4792 1.1123 0.4098 -0.0396 0.0136  0.1533  109 LEU A CD2   
820  N N     . LYS A 138 ? 0.5414 1.0974 0.5660 -0.0254 -0.0091 0.2298  110 LYS A N     
821  C CA    . LYS A 138 ? 0.5647 1.0945 0.6207 -0.0217 -0.0026 0.2281  110 LYS A CA    
822  C C     . LYS A 138 ? 0.5909 1.0982 0.6732 -0.0134 -0.0111 0.2242  110 LYS A C     
823  O O     . LYS A 138 ? 0.6195 1.1092 0.7167 -0.0086 -0.0068 0.2048  110 LYS A O     
824  C CB    . LYS A 138 ? 0.5945 1.1230 0.6631 -0.0272 0.0019  0.2556  110 LYS A CB    
825  C CG    . LYS A 138 ? 0.4347 0.9375 0.5382 -0.0243 0.0086  0.2528  110 LYS A CG    
826  C CD    . LYS A 138 ? 0.7891 1.2896 0.9093 -0.0301 0.0125  0.2812  110 LYS A CD    
827  C CE    . LYS A 138 ? 0.7929 1.2685 0.9506 -0.0276 0.0189  0.2758  110 LYS A CE    
828  N NZ    . LYS A 138 ? 0.8795 1.3503 1.0588 -0.0334 0.0227  0.3034  110 LYS A NZ    
829  N N     . LYS A 139 ? 0.6150 1.1249 0.7031 -0.0120 -0.0232 0.2428  111 LYS A N     
830  C CA    . LYS A 139 ? 0.5325 1.0241 0.6470 -0.0046 -0.0313 0.2398  111 LYS A CA    
831  C C     . LYS A 139 ? 0.5364 1.0267 0.6411 -0.0004 -0.0330 0.2118  111 LYS A C     
832  O O     . LYS A 139 ? 0.6175 1.0891 0.7428 0.0051  -0.0328 0.1989  111 LYS A O     
833  C CB    . LYS A 139 ? 0.5864 1.0853 0.7082 -0.0039 -0.0450 0.2658  111 LYS A CB    
834  C CG    . LYS A 139 ? 0.7101 1.1870 0.8741 0.0013  -0.0486 0.2781  111 LYS A CG    
835  C CD    . LYS A 139 ? 0.8870 1.3512 1.0708 -0.0017 -0.0384 0.2894  111 LYS A CD    
836  C CE    . LYS A 139 ? 0.9321 1.3757 1.1612 0.0029  -0.0420 0.3020  111 LYS A CE    
837  N NZ    . LYS A 139 ? 0.9293 1.3595 1.1812 -0.0005 -0.0316 0.3105  111 LYS A NZ    
838  N N     . ALA A 140 ? 0.4932 1.0041 0.5669 -0.0037 -0.0340 0.2022  112 ALA A N     
839  C CA    . ALA A 140 ? 0.4777 0.9885 0.5425 -0.0006 -0.0354 0.1762  112 ALA A CA    
840  C C     . ALA A 140 ? 0.5350 1.0303 0.6055 0.0019  -0.0244 0.1539  112 ALA A C     
841  O O     . ALA A 140 ? 0.5627 1.0446 0.6427 0.0066  -0.0253 0.1375  112 ALA A O     
842  C CB    . ALA A 140 ? 0.4648 1.0027 0.4973 -0.0055 -0.0384 0.1701  112 ALA A CB    
843  N N     . ILE A 141 ? 0.4894 0.9878 0.5544 -0.0016 -0.0142 0.1545  113 ILE A N     
844  C CA    . ILE A 141 ? 0.4619 0.9479 0.5335 0.0006  -0.0045 0.1355  113 ILE A CA    
845  C C     . ILE A 141 ? 0.5224 0.9846 0.6230 0.0050  -0.0038 0.1366  113 ILE A C     
846  O O     . ILE A 141 ? 0.4921 0.9417 0.6002 0.0090  -0.0015 0.1193  113 ILE A O     
847  C CB    . ILE A 141 ? 0.4276 0.9252 0.4889 -0.0046 0.0063  0.1361  113 ILE A CB    
848  C CG1   . ILE A 141 ? 0.5122 1.0346 0.5445 -0.0089 0.0076  0.1274  113 ILE A CG1   
849  C CG2   . ILE A 141 ? 0.3466 0.8309 0.4206 -0.0016 0.0148  0.1197  113 ILE A CG2   
850  C CD1   . ILE A 141 ? 0.3910 0.9284 0.4128 -0.0147 0.0192  0.1269  113 ILE A CD1   
851  N N     . GLU A 142 ? 0.4691 0.9262 0.5869 0.0039  -0.0059 0.1572  114 GLU A N     
852  C CA    . GLU A 142 ? 0.4784 0.9147 0.6264 0.0073  -0.0048 0.1574  114 GLU A CA    
853  C C     . GLU A 142 ? 0.5128 0.9388 0.6704 0.0127  -0.0113 0.1467  114 GLU A C     
854  O O     . GLU A 142 ? 0.5477 0.9598 0.7184 0.0155  -0.0078 0.1327  114 GLU A O     
855  C CB    . GLU A 142 ? 0.5267 0.9599 0.6947 0.0051  -0.0064 0.1821  114 GLU A CB    
856  C CG    . GLU A 142 ? 0.6420 1.0818 0.8068 -0.0009 0.0022  0.1926  114 GLU A CG    
857  C CD    . GLU A 142 ? 0.7867 1.2232 0.9720 -0.0036 0.0003  0.2199  114 GLU A CD    
858  O OE1   . GLU A 142 ? 0.8562 1.2872 1.0573 -0.0003 -0.0089 0.2314  114 GLU A OE1   
859  O OE2   . GLU A 142 ? 0.7551 1.1947 0.9433 -0.0091 0.0080  0.2301  114 GLU A OE2   
860  N N     . TRP A 143 ? 0.4327 0.8675 0.5834 0.0134  -0.0208 0.1531  115 TRP A N     
861  C CA    . TRP A 143 ? 0.4594 0.8872 0.6183 0.0177  -0.0267 0.1424  115 TRP A CA    
862  C C     . TRP A 143 ? 0.5526 0.9786 0.6966 0.0188  -0.0227 0.1191  115 TRP A C     
863  O O     . TRP A 143 ? 0.5573 0.9712 0.7122 0.0218  -0.0222 0.1068  115 TRP A O     
864  C CB    . TRP A 143 ? 0.5572 0.9983 0.7107 0.0178  -0.0382 0.1535  115 TRP A CB    
865  C CG    . TRP A 143 ? 0.6074 1.0451 0.7859 0.0193  -0.0448 0.1748  115 TRP A CG    
866  C CD1   . TRP A 143 ? 0.6508 1.1002 0.8272 0.0167  -0.0504 0.1992  115 TRP A CD1   
867  C CD2   . TRP A 143 ? 0.5719 0.9940 0.7836 0.0237  -0.0464 0.1739  115 TRP A CD2   
868  N NE1   . TRP A 143 ? 0.6495 1.0899 0.8581 0.0200  -0.0562 0.2146  115 TRP A NE1   
869  C CE2   . TRP A 143 ? 0.5812 1.0050 0.8127 0.0244  -0.0534 0.1980  115 TRP A CE2   
870  C CE3   . TRP A 143 ? 0.5468 0.9546 0.7736 0.0267  -0.0423 0.1551  115 TRP A CE3   
871  C CZ2   . TRP A 143 ? 0.3366 0.7478 0.6058 0.0287  -0.0561 0.2019  115 TRP A CZ2   
872  C CZ3   . TRP A 143 ? 0.4878 0.8849 0.7487 0.0301  -0.0442 0.1582  115 TRP A CZ3   
873  C CH2   . TRP A 143 ? 0.3174 0.7159 0.6008 0.0313  -0.0509 0.1805  115 TRP A CH2   
874  N N     . ALA A 144 ? 0.5993 1.0380 0.7198 0.0160  -0.0195 0.1134  116 ALA A N     
875  C CA    . ALA A 144 ? 0.6248 1.0622 0.7336 0.0172  -0.0160 0.0922  116 ALA A CA    
876  C C     . ALA A 144 ? 0.6834 1.1049 0.8041 0.0196  -0.0089 0.0820  116 ALA A C     
877  O O     . ALA A 144 ? 0.7416 1.1539 0.8648 0.0222  -0.0088 0.0686  116 ALA A O     
878  C CB    . ALA A 144 ? 0.5653 1.0205 0.6506 0.0137  -0.0128 0.0876  116 ALA A CB    
879  N N     . TRP A 145 ? 0.6093 1.0286 0.7377 0.0181  -0.0031 0.0890  117 TRP A N     
880  C CA    . TRP A 145 ? 0.4809 0.8881 0.6209 0.0197  0.0029  0.0797  117 TRP A CA    
881  C C     . TRP A 145 ? 0.4322 0.8251 0.5913 0.0221  0.0007  0.0777  117 TRP A C     
882  O O     . TRP A 145 ? 0.3567 0.7411 0.5198 0.0237  0.0033  0.0657  117 TRP A O     
883  C CB    . TRP A 145 ? 0.2778 0.6875 0.4241 0.0168  0.0094  0.0873  117 TRP A CB    
884  C CG    . TRP A 145 ? 0.4214 0.8430 0.5520 0.0151  0.0149  0.0809  117 TRP A CG    
885  C CD1   . TRP A 145 ? 0.4330 0.8711 0.5479 0.0113  0.0163  0.0877  117 TRP A CD1   
886  C CD2   . TRP A 145 ? 0.4346 0.8543 0.5649 0.0170  0.0197  0.0659  117 TRP A CD2   
887  N NE1   . TRP A 145 ? 0.4012 0.8477 0.5075 0.0107  0.0229  0.0761  117 TRP A NE1   
888  C CE2   . TRP A 145 ? 0.3795 0.8143 0.4965 0.0147  0.0245  0.0631  117 TRP A CE2   
889  C CE3   . TRP A 145 ? 0.4668 0.8750 0.6071 0.0203  0.0202  0.0549  117 TRP A CE3   
890  C CZ2   . TRP A 145 ? 0.2779 0.7153 0.3948 0.0164  0.0296  0.0494  117 TRP A CZ2   
891  C CZ3   . TRP A 145 ? 0.4224 0.8335 0.5605 0.0219  0.0240  0.0434  117 TRP A CZ3   
892  C CH2   . TRP A 145 ? 0.3841 0.8091 0.5123 0.0204  0.0285  0.0405  117 TRP A CH2   
893  N N     . GLY A 146 ? 0.4184 0.8101 0.5899 0.0221  -0.0041 0.0895  118 GLY A N     
894  C CA    . GLY A 146 ? 0.3784 0.7587 0.5703 0.0241  -0.0056 0.0864  118 GLY A CA    
895  C C     . GLY A 146 ? 0.3945 0.7722 0.5793 0.0260  -0.0083 0.0736  118 GLY A C     
896  O O     . GLY A 146 ? 0.4323 0.8010 0.6263 0.0268  -0.0056 0.0638  118 GLY A O     
897  N N     . THR A 147 ? 0.3717 0.7584 0.5403 0.0260  -0.0131 0.0733  119 THR A N     
898  C CA    . THR A 147 ? 0.4001 0.7845 0.5642 0.0271  -0.0158 0.0619  119 THR A CA    
899  C C     . THR A 147 ? 0.4338 0.8144 0.5852 0.0275  -0.0112 0.0482  119 THR A C     
900  O O     . THR A 147 ? 0.4528 0.8269 0.6052 0.0282  -0.0112 0.0388  119 THR A O     
901  C CB    . THR A 147 ? 0.3836 0.7800 0.5387 0.0265  -0.0237 0.0656  119 THR A CB    
902  O OG1   . THR A 147 ? 0.2591 0.6516 0.4182 0.0272  -0.0264 0.0558  119 THR A OG1   
903  C CG2   . THR A 147 ? 0.2732 0.6817 0.4056 0.0247  -0.0232 0.0623  119 THR A CG2   
904  N N     . MET A 148 ? 0.4942 0.8794 0.6360 0.0270  -0.0073 0.0479  120 MET A N     
905  C CA    . MET A 148 ? 0.4952 0.8774 0.6290 0.0282  -0.0034 0.0361  120 MET A CA    
906  C C     . MET A 148 ? 0.4600 0.8317 0.6038 0.0291  0.0004  0.0325  120 MET A C     
907  O O     . MET A 148 ? 0.4315 0.7975 0.5726 0.0305  0.0014  0.0240  120 MET A O     
908  C CB    . MET A 148 ? 0.4591 0.8521 0.5813 0.0274  -0.0002 0.0356  120 MET A CB    
909  C CG    . MET A 148 ? 0.5182 0.9240 0.6262 0.0260  -0.0032 0.0333  120 MET A CG    
910  S SD    . MET A 148 ? 0.5202 0.9413 0.6150 0.0243  0.0026  0.0293  120 MET A SD    
911  C CE    . MET A 148 ? 0.2809 0.7080 0.3792 0.0210  0.0050  0.0476  120 MET A CE    
912  N N     . ILE A 149 ? 0.3823 0.7522 0.5385 0.0279  0.0024  0.0392  121 ILE A N     
913  C CA    . ILE A 149 ? 0.3287 0.6915 0.4951 0.0277  0.0059  0.0344  121 ILE A CA    
914  C C     . ILE A 149 ? 0.3871 0.7427 0.5600 0.0276  0.0047  0.0297  121 ILE A C     
915  O O     . ILE A 149 ? 0.4731 0.8245 0.6433 0.0276  0.0063  0.0222  121 ILE A O     
916  C CB    . ILE A 149 ? 0.3493 0.7125 0.5306 0.0258  0.0090  0.0410  121 ILE A CB    
917  C CG1   . ILE A 149 ? 0.2334 0.6039 0.4089 0.0250  0.0121  0.0436  121 ILE A CG1   
918  C CG2   . ILE A 149 ? 0.2233 0.5806 0.4175 0.0248  0.0120  0.0337  121 ILE A CG2   
919  C CD1   . ILE A 149 ? 0.2355 0.6065 0.4271 0.0223  0.0156  0.0511  121 ILE A CD1   
920  N N     . ILE A 150 ? 0.4097 0.7652 0.5914 0.0274  0.0018  0.0346  122 ILE A N     
921  C CA    . ILE A 150 ? 0.2232 0.5738 0.4132 0.0268  0.0014  0.0295  122 ILE A CA    
922  C C     . ILE A 150 ? 0.2755 0.6239 0.4521 0.0271  0.0003  0.0226  122 ILE A C     
923  O O     . ILE A 150 ? 0.2408 0.5845 0.4181 0.0258  0.0029  0.0163  122 ILE A O     
924  C CB    . ILE A 150 ? 0.4489 0.8016 0.6529 0.0272  -0.0027 0.0364  122 ILE A CB    
925  C CG1   . ILE A 150 ? 0.3816 0.7335 0.6057 0.0270  -0.0010 0.0433  122 ILE A CG1   
926  C CG2   . ILE A 150 ? 0.2227 0.5724 0.4346 0.0265  -0.0027 0.0296  122 ILE A CG2   
927  C CD1   . ILE A 150 ? 0.3766 0.7302 0.6191 0.0281  -0.0058 0.0519  122 ILE A CD1   
928  N N     . GLY A 151 ? 0.3156 0.6683 0.4809 0.0281  -0.0033 0.0236  123 GLY A N     
929  C CA    . GLY A 151 ? 0.3499 0.6997 0.5058 0.0283  -0.0043 0.0167  123 GLY A CA    
930  C C     . GLY A 151 ? 0.3909 0.7358 0.5401 0.0291  -0.0011 0.0120  123 GLY A C     
931  O O     . GLY A 151 ? 0.3658 0.7046 0.5127 0.0287  -0.0008 0.0077  123 GLY A O     
932  N N     . GLY A 152 ? 0.3247 0.6728 0.4720 0.0302  0.0008  0.0138  124 GLY A N     
933  C CA    . GLY A 152 ? 0.2769 0.6224 0.4201 0.0315  0.0027  0.0102  124 GLY A CA    
934  C C     . GLY A 152 ? 0.3720 0.7132 0.5194 0.0297  0.0046  0.0089  124 GLY A C     
935  O O     . GLY A 152 ? 0.4055 0.7424 0.5483 0.0298  0.0043  0.0068  124 GLY A O     
936  N N     . VAL A 153 ? 0.2204 0.5634 0.3773 0.0276  0.0067  0.0103  125 VAL A N     
937  C CA    . VAL A 153 ? 0.2189 0.5608 0.3803 0.0248  0.0095  0.0065  125 VAL A CA    
938  C C     . VAL A 153 ? 0.2208 0.5585 0.3809 0.0226  0.0098  0.0044  125 VAL A C     
939  O O     . VAL A 153 ? 0.2234 0.5606 0.3790 0.0202  0.0115  0.0017  125 VAL A O     
940  C CB    . VAL A 153 ? 0.3795 0.7241 0.5561 0.0228  0.0124  0.0063  125 VAL A CB    
941  C CG1   . VAL A 153 ? 0.2157 0.5612 0.3984 0.0190  0.0162  -0.0007 125 VAL A CG1   
942  C CG2   . VAL A 153 ? 0.2709 0.6198 0.4499 0.0237  0.0132  0.0083  125 VAL A CG2   
943  N N     . ALA A 154 ? 0.4069 0.7432 0.5708 0.0230  0.0080  0.0060  126 ALA A N     
944  C CA    . ALA A 154 ? 0.2929 0.6260 0.4581 0.0206  0.0086  0.0037  126 ALA A CA    
945  C C     . ALA A 154 ? 0.3529 0.6809 0.5066 0.0203  0.0080  0.0033  126 ALA A C     
946  O O     . ALA A 154 ? 0.3507 0.6764 0.5034 0.0168  0.0106  0.0020  126 ALA A O     
947  C CB    . ALA A 154 ? 0.2225 0.5570 0.3946 0.0214  0.0053  0.0054  126 ALA A CB    
948  N N     . ARG A 155 ? 0.3486 0.6754 0.4953 0.0238  0.0051  0.0046  127 ARG A N     
949  C CA    . ARG A 155 ? 0.3431 0.6637 0.4833 0.0245  0.0040  0.0050  127 ARG A CA    
950  C C     . ARG A 155 ? 0.3448 0.6656 0.4795 0.0241  0.0048  0.0072  127 ARG A C     
951  O O     . ARG A 155 ? 0.3360 0.6528 0.4669 0.0215  0.0054  0.0097  127 ARG A O     
952  C CB    . ARG A 155 ? 0.2387 0.5590 0.3769 0.0287  0.0010  0.0035  127 ARG A CB    
953  C CG    . ARG A 155 ? 0.3106 0.6239 0.4468 0.0306  -0.0002 0.0039  127 ARG A CG    
954  C CD    . ARG A 155 ? 0.3840 0.6991 0.5211 0.0351  -0.0019 -0.0001 127 ARG A CD    
955  N NE    . ARG A 155 ? 0.4398 0.7481 0.5797 0.0381  -0.0034 0.0009  127 ARG A NE    
956  C CZ    . ARG A 155 ? 0.5043 0.8131 0.6488 0.0424  -0.0043 -0.0038 127 ARG A CZ    
957  N NH1   . ARG A 155 ? 0.5037 0.8210 0.6472 0.0435  -0.0032 -0.0103 127 ARG A NH1   
958  N NH2   . ARG A 155 ? 0.5533 0.8550 0.7043 0.0456  -0.0062 -0.0018 127 ARG A NH2   
959  N N     . TYR A 156 ? 0.4015 0.7280 0.5358 0.0261  0.0045  0.0070  128 TYR A N     
960  C CA    . TYR A 156 ? 0.3751 0.7045 0.5046 0.0261  0.0037  0.0086  128 TYR A CA    
961  C C     . TYR A 156 ? 0.4853 0.8193 0.6127 0.0207  0.0067  0.0074  128 TYR A C     
962  O O     . TYR A 156 ? 0.5498 0.8881 0.6707 0.0194  0.0054  0.0090  128 TYR A O     
963  C CB    . TYR A 156 ? 0.3063 0.6421 0.4382 0.0295  0.0026  0.0074  128 TYR A CB    
964  C CG    . TYR A 156 ? 0.4417 0.7752 0.5740 0.0347  0.0000  0.0077  128 TYR A CG    
965  C CD1   . TYR A 156 ? 0.4987 0.8317 0.6330 0.0362  0.0006  0.0056  128 TYR A CD1   
966  C CD2   . TYR A 156 ? 0.4500 0.7835 0.5819 0.0380  -0.0033 0.0096  128 TYR A CD2   
967  C CE1   . TYR A 156 ? 0.4770 0.8100 0.6125 0.0402  -0.0007 0.0030  128 TYR A CE1   
968  C CE2   . TYR A 156 ? 0.5247 0.8566 0.6610 0.0430  -0.0049 0.0079  128 TYR A CE2   
969  C CZ    . TYR A 156 ? 0.5774 0.9093 0.7152 0.0438  -0.0029 0.0034  128 TYR A CZ    
970  O OH    . TYR A 156 ? 0.7238 1.0561 0.8666 0.0481  -0.0034 -0.0011 128 TYR A OH    
971  N N     . PHE A 157 ? 0.2377 0.5723 0.3712 0.0172  0.0105  0.0038  129 PHE A N     
972  C CA    . PHE A 157 ? 0.3721 0.7120 0.5051 0.0113  0.0149  0.0001  129 PHE A CA    
973  C C     . PHE A 157 ? 0.4061 0.7436 0.5281 0.0081  0.0149  0.0048  129 PHE A C     
974  O O     . PHE A 157 ? 0.4118 0.7565 0.5252 0.0040  0.0160  0.0049  129 PHE A O     
975  C CB    . PHE A 157 ? 0.2358 0.5760 0.3816 0.0090  0.0191  -0.0048 129 PHE A CB    
976  C CG    . PHE A 157 ? 0.2407 0.5864 0.3873 0.0023  0.0250  -0.0103 129 PHE A CG    
977  C CD1   . PHE A 157 ? 0.2415 0.5966 0.3914 -0.0013 0.0289  -0.0180 129 PHE A CD1   
978  C CD2   . PHE A 157 ? 0.2457 0.5884 0.3907 -0.0010 0.0274  -0.0091 129 PHE A CD2   
979  C CE1   . PHE A 157 ? 0.2476 0.6103 0.3980 -0.0082 0.0355  -0.0253 129 PHE A CE1   
980  C CE2   . PHE A 157 ? 0.2516 0.6014 0.3970 -0.0080 0.0342  -0.0148 129 PHE A CE2   
981  C CZ    . PHE A 157 ? 0.4053 0.7658 0.5528 -0.0116 0.0384  -0.0233 129 PHE A CZ    
982  N N     . TRP A 158 ? 0.4369 0.7653 0.5593 0.0094  0.0135  0.0089  130 TRP A N     
983  C CA    . TRP A 158 ? 0.4568 0.7806 0.5718 0.0062  0.0137  0.0152  130 TRP A CA    
984  C C     . TRP A 158 ? 0.4585 0.7806 0.5652 0.0092  0.0084  0.0232  130 TRP A C     
985  O O     . TRP A 158 ? 0.5346 0.8570 0.6327 0.0055  0.0082  0.0306  130 TRP A O     
986  C CB    . TRP A 158 ? 0.4402 0.7542 0.5621 0.0066  0.0138  0.0159  130 TRP A CB    
987  C CG    . TRP A 158 ? 0.4041 0.7210 0.5355 0.0031  0.0183  0.0094  130 TRP A CG    
988  C CD1   . TRP A 158 ? 0.3890 0.7068 0.5308 0.0062  0.0171  0.0046  130 TRP A CD1   
989  C CD2   . TRP A 158 ? 0.4464 0.7671 0.5790 -0.0041 0.0246  0.0074  130 TRP A CD2   
990  N NE1   . TRP A 158 ? 0.3828 0.7041 0.5345 0.0022  0.0212  0.0000  130 TRP A NE1   
991  C CE2   . TRP A 158 ? 0.4085 0.7318 0.5555 -0.0042 0.0266  0.0005  130 TRP A CE2   
992  C CE3   . TRP A 158 ? 0.3929 0.7165 0.5160 -0.0107 0.0289  0.0113  130 TRP A CE3   
993  C CZ2   . TRP A 158 ? 0.3696 0.6979 0.5243 -0.0103 0.0332  -0.0044 130 TRP A CZ2   
994  C CZ3   . TRP A 158 ? 0.3735 0.7028 0.5015 -0.0178 0.0363  0.0064  130 TRP A CZ3   
995  C CH2   . TRP A 158 ? 0.3630 0.6944 0.5080 -0.0173 0.0387  -0.0022 130 TRP A CH2   
996  N N     . HIS A 159 ? 0.3841 0.7056 0.4944 0.0158  0.0041  0.0224  131 HIS A N     
997  C CA    . HIS A 159 ? 0.4331 0.7551 0.5396 0.0196  -0.0015 0.0289  131 HIS A CA    
998  C C     . HIS A 159 ? 0.5024 0.8375 0.6003 0.0162  -0.0020 0.0290  131 HIS A C     
999  O O     . HIS A 159 ? 0.5334 0.8716 0.6238 0.0158  -0.0063 0.0372  131 HIS A O     
1000 C CB    . HIS A 159 ? 0.4162 0.7367 0.5308 0.0269  -0.0047 0.0257  131 HIS A CB    
1001 C CG    . HIS A 159 ? 0.4935 0.8032 0.6156 0.0302  -0.0052 0.0249  131 HIS A CG    
1002 N ND1   . HIS A 159 ? 0.4313 0.7307 0.5549 0.0290  -0.0058 0.0304  131 HIS A ND1   
1003 C CD2   . HIS A 159 ? 0.5469 0.8557 0.6755 0.0339  -0.0049 0.0184  131 HIS A CD2   
1004 C CE1   . HIS A 159 ? 0.4167 0.7091 0.5492 0.0320  -0.0059 0.0256  131 HIS A CE1   
1005 N NE2   . HIS A 159 ? 0.4859 0.7849 0.6201 0.0348  -0.0054 0.0181  131 HIS A NE2   
1006 N N     . TYR A 160 ? 0.4024 0.7459 0.5028 0.0137  0.0019  0.0198  132 TYR A N     
1007 C CA    . TYR A 160 ? 0.4861 0.8436 0.5802 0.0091  0.0026  0.0161  132 TYR A CA    
1008 C C     . TYR A 160 ? 0.4925 0.8552 0.5746 0.0014  0.0056  0.0190  132 TYR A C     
1009 O O     . TYR A 160 ? 0.4506 0.8246 0.5213 -0.0020 0.0030  0.0219  132 TYR A O     
1010 C CB    . TYR A 160 ? 0.2625 0.6259 0.3668 0.0077  0.0074  0.0045  132 TYR A CB    
1011 C CG    . TYR A 160 ? 0.3952 0.7725 0.4959 0.0004  0.0113  -0.0036 132 TYR A CG    
1012 C CD1   . TYR A 160 ? 0.3575 0.7478 0.4519 -0.0010 0.0076  -0.0052 132 TYR A CD1   
1013 C CD2   . TYR A 160 ? 0.3627 0.7419 0.4676 -0.0053 0.0188  -0.0111 132 TYR A CD2   
1014 C CE1   . TYR A 160 ? 0.4040 0.8095 0.4947 -0.0086 0.0114  -0.0151 132 TYR A CE1   
1015 C CE2   . TYR A 160 ? 0.3013 0.6949 0.4043 -0.0125 0.0235  -0.0214 132 TYR A CE2   
1016 C CZ    . TYR A 160 ? 0.3886 0.7955 0.4835 -0.0144 0.0199  -0.0238 132 TYR A CZ    
1017 O OH    . TYR A 160 ? 0.2868 0.7103 0.3796 -0.0224 0.0247  -0.0364 132 TYR A OH    
1018 N N     . VAL A 161 ? 0.4149 0.7710 0.4995 -0.0019 0.0111  0.0181  133 VAL A N     
1019 C CA    . VAL A 161 ? 0.4537 0.8149 0.5277 -0.0102 0.0157  0.0206  133 VAL A CA    
1020 C C     . VAL A 161 ? 0.4916 0.8500 0.5532 -0.0106 0.0103  0.0361  133 VAL A C     
1021 O O     . VAL A 161 ? 0.4416 0.8121 0.4883 -0.0166 0.0101  0.0406  133 VAL A O     
1022 C CB    . VAL A 161 ? 0.3912 0.7450 0.4738 -0.0131 0.0224  0.0171  133 VAL A CB    
1023 C CG1   . VAL A 161 ? 0.3125 0.6707 0.3842 -0.0220 0.0276  0.0220  133 VAL A CG1   
1024 C CG2   . VAL A 161 ? 0.3636 0.7224 0.4599 -0.0137 0.0277  0.0031  133 VAL A CG2   
1025 N N     . ALA A 162 ? 0.4512 0.7945 0.5198 -0.0043 0.0058  0.0442  134 ALA A N     
1026 C CA    . ALA A 162 ? 0.5209 0.8582 0.5836 -0.0034 0.0002  0.0602  134 ALA A CA    
1027 C C     . ALA A 162 ? 0.5462 0.8929 0.6025 0.0001  -0.0082 0.0663  134 ALA A C     
1028 O O     . ALA A 162 ? 0.4837 0.8326 0.5309 -0.0016 -0.0132 0.0807  134 ALA A O     
1029 C CB    . ALA A 162 ? 0.3308 0.6496 0.4076 0.0028  -0.0020 0.0638  134 ALA A CB    
1030 N N     . GLY A 163 ? 0.4835 0.8364 0.5459 0.0048  -0.0102 0.0562  135 GLY A N     
1031 C CA    . GLY A 163 ? 0.3312 0.6953 0.3903 0.0080  -0.0181 0.0595  135 GLY A CA    
1032 C C     . GLY A 163 ? 0.4690 0.8520 0.5102 -0.0003 -0.0185 0.0614  135 GLY A C     
1033 O O     . GLY A 163 ? 0.5734 0.9646 0.6064 0.0002  -0.0267 0.0729  135 GLY A O     
1034 N N     . VAL A 164 ? 0.3991 0.7905 0.4352 -0.0081 -0.0097 0.0495  136 VAL A N     
1035 C CA    . VAL A 164 ? 0.4544 0.8665 0.4731 -0.0177 -0.0080 0.0473  136 VAL A CA    
1036 C C     . VAL A 164 ? 0.4833 0.8953 0.4860 -0.0238 -0.0080 0.0635  136 VAL A C     
1037 O O     . VAL A 164 ? 0.5609 0.9891 0.5460 -0.0290 -0.0126 0.0718  136 VAL A O     
1038 C CB    . VAL A 164 ? 0.3986 0.8188 0.4208 -0.0244 0.0029  0.0280  136 VAL A CB    
1039 C CG1   . VAL A 164 ? 0.3632 0.8078 0.3679 -0.0348 0.0054  0.0220  136 VAL A CG1   
1040 C CG2   . VAL A 164 ? 0.3489 0.7665 0.3895 -0.0186 0.0034  0.0144  136 VAL A CG2   
1041 N N     . LEU A 165 ? 0.3772 0.7718 0.3864 -0.0237 -0.0031 0.0685  137 LEU A N     
1042 C CA    . LEU A 165 ? 0.3983 0.7908 0.3954 -0.0305 -0.0011 0.0839  137 LEU A CA    
1043 C C     . LEU A 165 ? 0.4797 0.8636 0.4755 -0.0255 -0.0119 0.1064  137 LEU A C     
1044 O O     . LEU A 165 ? 0.5370 0.9283 0.5166 -0.0320 -0.0139 0.1225  137 LEU A O     
1045 C CB    . LEU A 165 ? 0.4443 0.8216 0.4523 -0.0326 0.0082  0.0801  137 LEU A CB    
1046 C CG    . LEU A 165 ? 0.5113 0.8975 0.5213 -0.0396 0.0199  0.0617  137 LEU A CG    
1047 C CD1   . LEU A 165 ? 0.3706 0.7399 0.3972 -0.0383 0.0259  0.0583  137 LEU A CD1   
1048 C CD2   . LEU A 165 ? 0.4020 0.8078 0.3917 -0.0522 0.0264  0.0629  137 LEU A CD2   
1049 N N     . PHE A 166 ? 0.4913 0.8602 0.5050 -0.0143 -0.0185 0.1079  138 PHE A N     
1050 C CA    . PHE A 166 ? 0.4179 0.7738 0.4384 -0.0085 -0.0273 0.1279  138 PHE A CA    
1051 C C     . PHE A 166 ? 0.4447 0.8034 0.4736 0.0014  -0.0392 0.1321  138 PHE A C     
1052 O O     . PHE A 166 ? 0.5618 0.9165 0.5934 0.0049  -0.0483 0.1510  138 PHE A O     
1053 C CB    . PHE A 166 ? 0.6146 0.9462 0.6542 -0.0047 -0.0232 0.1277  138 PHE A CB    
1054 C CG    . PHE A 166 ? 0.5856 0.9140 0.6213 -0.0137 -0.0118 0.1227  138 PHE A CG    
1055 C CD1   . PHE A 166 ? 0.6003 0.9290 0.6249 -0.0228 -0.0087 0.1380  138 PHE A CD1   
1056 C CD2   . PHE A 166 ? 0.5163 0.8422 0.5607 -0.0135 -0.0043 0.1037  138 PHE A CD2   
1057 C CE1   . PHE A 166 ? 0.5331 0.8602 0.5564 -0.0315 0.0025  0.1325  138 PHE A CE1   
1058 C CE2   . PHE A 166 ? 0.4942 0.8185 0.5383 -0.0213 0.0056  0.0987  138 PHE A CE2   
1059 C CZ    . PHE A 166 ? 0.5210 0.8460 0.5550 -0.0304 0.0094  0.1121  138 PHE A CZ    
1060 N N     . TRP A 167 ? 0.4776 0.8434 0.5130 0.0060  -0.0393 0.1154  139 TRP A N     
1061 C CA    . TRP A 167 ? 0.5669 0.9341 0.6154 0.0161  -0.0492 0.1167  139 TRP A CA    
1062 C C     . TRP A 167 ? 0.5599 0.9513 0.5975 0.0145  -0.0563 0.1155  139 TRP A C     
1063 O O     . TRP A 167 ? 0.5286 0.9249 0.5784 0.0219  -0.0622 0.1104  139 TRP A O     
1064 C CB    . TRP A 167 ? 0.3685 0.7257 0.4358 0.0232  -0.0451 0.1003  139 TRP A CB    
1065 C CG    . TRP A 167 ? 0.4761 0.8111 0.5576 0.0269  -0.0416 0.1021  139 TRP A CG    
1066 C CD1   . TRP A 167 ? 0.4350 0.7604 0.5160 0.0222  -0.0325 0.0958  139 TRP A CD1   
1067 C CD2   . TRP A 167 ? 0.5053 0.8262 0.6062 0.0359  -0.0473 0.1094  139 TRP A CD2   
1068 N NE1   . TRP A 167 ? 0.4861 0.7928 0.5834 0.0271  -0.0324 0.0982  139 TRP A NE1   
1069 C CE2   . TRP A 167 ? 0.5129 0.8161 0.6232 0.0355  -0.0409 0.1059  139 TRP A CE2   
1070 C CE3   . TRP A 167 ? 0.5366 0.8589 0.6503 0.0443  -0.0573 0.1174  139 TRP A CE3   
1071 C CZ2   . TRP A 167 ? 0.5678 0.8547 0.6995 0.0427  -0.0435 0.1087  139 TRP A CZ2   
1072 C CZ3   . TRP A 167 ? 0.6405 0.9458 0.7771 0.0520  -0.0596 0.1208  139 TRP A CZ3   
1073 C CH2   . TRP A 167 ? 0.6691 0.9569 0.8143 0.0510  -0.0524 0.1158  139 TRP A CH2   
1074 N N     . GLY A 168 ? 0.5906 0.9989 0.6057 0.0044  -0.0554 0.1195  140 GLY A N     
1075 C CA    . GLY A 168 ? 0.5789 1.0134 0.5818 0.0010  -0.0617 0.1160  140 GLY A CA    
1076 C C     . GLY A 168 ? 0.6386 1.0799 0.6464 0.0082  -0.0770 0.1320  140 GLY A C     
1077 O O     . GLY A 168 ? 0.4303 0.8887 0.4409 0.0105  -0.0835 0.1244  140 GLY A O     
1078 N N     . ALA A 169 ? 0.7025 1.1303 0.7141 0.0118  -0.0830 0.1541  141 ALA A N     
1079 C CA    . ALA A 169 ? 0.6454 1.0795 0.6635 0.0187  -0.0987 0.1730  141 ALA A CA    
1080 C C     . ALA A 169 ? 0.7366 1.1610 0.7851 0.0323  -0.1040 0.1669  141 ALA A C     
1081 O O     . ALA A 169 ? 0.8466 1.2743 0.9076 0.0400  -0.1170 0.1810  141 ALA A O     
1082 C CB    . ALA A 169 ? 0.5795 1.0014 0.5944 0.0177  -0.1032 0.2004  141 ALA A CB    
1083 N N     . TYR A 170 ? 0.7126 1.1264 0.7736 0.0350  -0.0939 0.1463  142 TYR A N     
1084 C CA    . TYR A 170 ? 0.5545 0.9612 0.6427 0.0464  -0.0964 0.1378  142 TYR A CA    
1085 C C     . TYR A 170 ? 0.4377 0.8629 0.5267 0.0456  -0.0949 0.1184  142 TYR A C     
1086 O O     . TYR A 170 ? 0.4178 0.8405 0.5274 0.0533  -0.0947 0.1083  142 TYR A O     
1087 C CB    . TYR A 170 ? 0.3960 0.7777 0.4993 0.0501  -0.0864 0.1299  142 TYR A CB    
1088 C CG    . TYR A 170 ? 0.5188 0.8801 0.6305 0.0527  -0.0882 0.1471  142 TYR A CG    
1089 C CD1   . TYR A 170 ? 0.4913 0.8458 0.5863 0.0438  -0.0830 0.1562  142 TYR A CD1   
1090 C CD2   . TYR A 170 ? 0.4162 0.7652 0.5554 0.0636  -0.0945 0.1533  142 TYR A CD2   
1091 C CE1   . TYR A 170 ? 0.5611 0.8961 0.6661 0.0453  -0.0841 0.1722  142 TYR A CE1   
1092 C CE2   . TYR A 170 ? 0.6680 0.9971 0.8190 0.0657  -0.0959 0.1683  142 TYR A CE2   
1093 C CZ    . TYR A 170 ? 0.6505 0.9721 0.7841 0.0564  -0.0908 0.1783  142 TYR A CZ    
1094 O OH    . TYR A 170 ? 0.6410 0.9420 0.7886 0.0578  -0.0917 0.1936  142 TYR A OH    
1095 N N     . ALA A 171 ? 0.4014 0.8457 0.4687 0.0357  -0.0932 0.1127  143 ALA A N     
1096 C CA    . ALA A 171 ? 0.3881 0.8492 0.4569 0.0331  -0.0903 0.0929  143 ALA A CA    
1097 C C     . ALA A 171 ? 0.4090 0.8881 0.4896 0.0388  -0.1027 0.0942  143 ALA A C     
1098 O O     . ALA A 171 ? 0.4339 0.9165 0.5177 0.0438  -0.1151 0.1120  143 ALA A O     
1099 C CB    . ALA A 171 ? 0.3873 0.8643 0.4324 0.0204  -0.0846 0.0846  143 ALA A CB    
1100 N N     . PHE A 172 ? 0.3700 0.8608 0.4594 0.0380  -0.0996 0.0759  144 PHE A N     
1101 C CA    . PHE A 172 ? 0.3729 0.8851 0.4734 0.0415  -0.1106 0.0739  144 PHE A CA    
1102 C C     . PHE A 172 ? 0.3950 0.9325 0.4739 0.0339  -0.1205 0.0810  144 PHE A C     
1103 O O     . PHE A 172 ? 0.4057 0.9450 0.4606 0.0248  -0.1162 0.0838  144 PHE A O     
1104 C CB    . PHE A 172 ? 0.4659 0.9857 0.5796 0.0398  -0.1032 0.0517  144 PHE A CB    
1105 C CG    . PHE A 172 ? 0.4411 0.9400 0.5732 0.0458  -0.0930 0.0444  144 PHE A CG    
1106 C CD1   . PHE A 172 ? 0.3282 0.8226 0.4836 0.0562  -0.0972 0.0472  144 PHE A CD1   
1107 C CD2   . PHE A 172 ? 0.4397 0.9257 0.5668 0.0408  -0.0794 0.0342  144 PHE A CD2   
1108 C CE1   . PHE A 172 ? 0.5425 1.0209 0.7124 0.0606  -0.0873 0.0395  144 PHE A CE1   
1109 C CE2   . PHE A 172 ? 0.3818 0.8513 0.5233 0.0456  -0.0710 0.0285  144 PHE A CE2   
1110 C CZ    . PHE A 172 ? 0.4014 0.8679 0.5628 0.0550  -0.0746 0.0309  144 PHE A CZ    
1111 N N     . GLN A 173 ? 0.4031 0.9621 0.4902 0.0372  -0.1337 0.0835  145 GLN A N     
1112 C CA    . GLN A 173 ? 0.4259 1.0136 0.4918 0.0296  -0.1446 0.0895  145 GLN A CA    
1113 C C     . GLN A 173 ? 0.6575 1.2627 0.7095 0.0171  -0.1358 0.0666  145 GLN A C     
1114 O O     . GLN A 173 ? 0.6987 1.3102 0.7673 0.0170  -0.1314 0.0470  145 GLN A O     
1115 C CB    . GLN A 173 ? 0.4355 1.0436 0.5170 0.0368  -0.1622 0.0970  145 GLN A CB    
1116 C CG    . GLN A 173 ? 0.6438 1.2820 0.7021 0.0302  -0.1769 0.1094  145 GLN A CG    
1117 C CD    . GLN A 173 ? 0.8937 1.5539 0.9704 0.0377  -0.1954 0.1161  145 GLN A CD    
1118 O OE1   . GLN A 173 ? 0.9104 1.5718 1.0153 0.0442  -0.1948 0.1024  145 GLN A OE1   
1119 N NE2   . GLN A 173 ? 1.1086 1.7877 1.1700 0.0367  -0.2120 0.1381  145 GLN A NE2   
1120 N N     . GLY A 174 ? 0.6493 1.2624 0.6728 0.0064  -0.1323 0.0686  146 GLY A N     
1121 C CA    . GLY A 174 ? 0.5794 1.2106 0.5907 -0.0060 -0.1236 0.0457  146 GLY A CA    
1122 C C     . GLY A 174 ? 0.5351 1.1447 0.5514 -0.0091 -0.1049 0.0300  146 GLY A C     
1123 O O     . GLY A 174 ? 0.5225 1.1429 0.5391 -0.0175 -0.0962 0.0078  146 GLY A O     
1124 N N     . TRP A 175 ? 0.5601 1.1399 0.5826 -0.0025 -0.0992 0.0410  147 TRP A N     
1125 C CA    . TRP A 175 ? 0.5200 1.0793 0.5474 -0.0047 -0.0830 0.0288  147 TRP A CA    
1126 C C     . TRP A 175 ? 0.5180 1.0695 0.5241 -0.0112 -0.0764 0.0372  147 TRP A C     
1127 O O     . TRP A 175 ? 0.4900 1.0366 0.4850 -0.0092 -0.0830 0.0585  147 TRP A O     
1128 C CB    . TRP A 175 ? 0.3961 0.9290 0.4470 0.0064  -0.0796 0.0313  147 TRP A CB    
1129 C CG    . TRP A 175 ? 0.4004 0.9380 0.4742 0.0104  -0.0794 0.0174  147 TRP A CG    
1130 C CD1   . TRP A 175 ? 0.4284 0.9892 0.5089 0.0101  -0.0884 0.0117  147 TRP A CD1   
1131 C CD2   . TRP A 175 ? 0.3784 0.8986 0.4717 0.0145  -0.0696 0.0078  147 TRP A CD2   
1132 N NE1   . TRP A 175 ? 0.4331 0.9910 0.5374 0.0136  -0.0839 -0.0010 147 TRP A NE1   
1133 C CE2   . TRP A 175 ? 0.3570 0.8901 0.4683 0.0162  -0.0723 -0.0028 147 TRP A CE2   
1134 C CE3   . TRP A 175 ? 0.3151 0.8114 0.4120 0.0164  -0.0592 0.0078  147 TRP A CE3   
1135 C CZ2   . TRP A 175 ? 0.3037 0.8262 0.4354 0.0193  -0.0641 -0.0121 147 TRP A CZ2   
1136 C CZ3   . TRP A 175 ? 0.4010 0.8879 0.5168 0.0198  -0.0523 -0.0013 147 TRP A CZ3   
1137 C CH2   . TRP A 175 ? 0.3970 0.8966 0.5294 0.0210  -0.0543 -0.0104 147 TRP A CH2   
1138 N N     . GLY A 176 ? 0.4924 1.0427 0.4956 -0.0190 -0.0631 0.0205  148 GLY A N     
1139 C CA    . GLY A 176 ? 0.5765 1.1191 0.5638 -0.0254 -0.0546 0.0253  148 GLY A CA    
1140 C C     . GLY A 176 ? 0.6237 1.1348 0.6236 -0.0180 -0.0488 0.0331  148 GLY A C     
1141 O O     . GLY A 176 ? 0.6472 1.1440 0.6675 -0.0090 -0.0494 0.0308  148 GLY A O     
1142 N N     . ALA A 177 ? 0.6298 1.1319 0.6175 -0.0223 -0.0429 0.0415  149 ALA A N     
1143 C CA    . ALA A 177 ? 0.5494 1.0235 0.5483 -0.0164 -0.0378 0.0485  149 ALA A CA    
1144 C C     . ALA A 177 ? 0.4762 0.9388 0.4930 -0.0148 -0.0275 0.0305  149 ALA A C     
1145 O O     . ALA A 177 ? 0.4624 0.9062 0.4951 -0.0065 -0.0272 0.0325  149 ALA A O     
1146 C CB    . ALA A 177 ? 0.3980 0.8675 0.3808 -0.0231 -0.0332 0.0603  149 ALA A CB    
1147 N N     . GLN A 178 ? 0.4673 0.9424 0.4823 -0.0230 -0.0191 0.0130  150 GLN A N     
1148 C CA    . GLN A 178 ? 0.3354 0.8008 0.3693 -0.0220 -0.0096 -0.0029 150 GLN A CA    
1149 C C     . GLN A 178 ? 0.3383 0.8016 0.3906 -0.0149 -0.0134 -0.0088 150 GLN A C     
1150 O O     . GLN A 178 ? 0.3044 0.7512 0.3723 -0.0089 -0.0103 -0.0097 150 GLN A O     
1151 C CB    . GLN A 178 ? 0.4655 0.9463 0.4970 -0.0325 0.0000  -0.0211 150 GLN A CB    
1152 C CG    . GLN A 178 ? 0.4162 0.8854 0.4689 -0.0319 0.0103  -0.0349 150 GLN A CG    
1153 C CD    . GLN A 178 ? 0.6197 1.0893 0.6931 -0.0284 0.0100  -0.0465 150 GLN A CD    
1154 O OE1   . GLN A 178 ? 0.7681 1.2525 0.8403 -0.0294 0.0045  -0.0510 150 GLN A OE1   
1155 N NE2   . GLN A 178 ? 0.5619 1.0161 0.6553 -0.0245 0.0156  -0.0506 150 GLN A NE2   
1156 N N     . LEU A 179 ? 0.3278 0.8097 0.3778 -0.0162 -0.0201 -0.0127 151 LEU A N     
1157 C CA    . LEU A 179 ? 0.3727 0.8556 0.4408 -0.0106 -0.0234 -0.0187 151 LEU A CA    
1158 C C     . LEU A 179 ? 0.3855 0.8520 0.4616 0.0001  -0.0290 -0.0049 151 LEU A C     
1159 O O     . LEU A 179 ? 0.4415 0.8972 0.5343 0.0051  -0.0256 -0.0089 151 LEU A O     
1160 C CB    . LEU A 179 ? 0.3246 0.8328 0.3881 -0.0143 -0.0311 -0.0243 151 LEU A CB    
1161 C CG    . LEU A 179 ? 0.3132 0.8250 0.3968 -0.0094 -0.0346 -0.0309 151 LEU A CG    
1162 C CD1   . LEU A 179 ? 0.2978 0.8030 0.4011 -0.0117 -0.0238 -0.0469 151 LEU A CD1   
1163 C CD2   . LEU A 179 ? 0.3256 0.8644 0.4044 -0.0130 -0.0440 -0.0354 151 LEU A CD2   
1164 N N     . PHE A 180 ? 0.3830 0.8483 0.4479 0.0033  -0.0371 0.0112  152 PHE A N     
1165 C CA    . PHE A 180 ? 0.3160 0.7667 0.3907 0.0134  -0.0426 0.0231  152 PHE A CA    
1166 C C     . PHE A 180 ? 0.5685 0.9967 0.6499 0.0166  -0.0349 0.0239  152 PHE A C     
1167 O O     . PHE A 180 ? 0.5796 0.9968 0.6743 0.0242  -0.0356 0.0256  152 PHE A O     
1168 C CB    . PHE A 180 ? 0.3353 0.7887 0.3991 0.0155  -0.0529 0.0412  152 PHE A CB    
1169 C CG    . PHE A 180 ? 0.5238 0.9629 0.6018 0.0263  -0.0587 0.0522  152 PHE A CG    
1170 C CD1   . PHE A 180 ? 0.5036 0.9481 0.5986 0.0333  -0.0639 0.0487  152 PHE A CD1   
1171 C CD2   . PHE A 180 ? 0.3403 0.7612 0.4169 0.0289  -0.0583 0.0649  152 PHE A CD2   
1172 C CE1   . PHE A 180 ? 0.4952 0.9279 0.6058 0.0431  -0.0683 0.0565  152 PHE A CE1   
1173 C CE2   . PHE A 180 ? 0.3400 0.7480 0.4329 0.0386  -0.0631 0.0726  152 PHE A CE2   
1174 C CZ    . PHE A 180 ? 0.3328 0.7470 0.4428 0.0459  -0.0679 0.0679  152 PHE A CZ    
1175 N N     . SER A 181 ? 0.4824 0.9057 0.5552 0.0103  -0.0274 0.0216  153 SER A N     
1176 C CA    . SER A 181 ? 0.4471 0.8513 0.5257 0.0125  -0.0210 0.0224  153 SER A CA    
1177 C C     . SER A 181 ? 0.5277 0.9281 0.6209 0.0137  -0.0145 0.0103  153 SER A C     
1178 O O     . SER A 181 ? 0.4741 0.8622 0.5765 0.0194  -0.0136 0.0119  153 SER A O     
1179 C CB    . SER A 181 ? 0.3055 0.7074 0.3722 0.0052  -0.0154 0.0244  153 SER A CB    
1180 O OG    . SER A 181 ? 0.3703 0.7548 0.4438 0.0075  -0.0106 0.0257  153 SER A OG    
1181 N N     . ILE A 182 ? 0.4590 0.8704 0.5549 0.0079  -0.0100 -0.0016 154 ILE A N     
1182 C CA    . ILE A 182 ? 0.3826 0.7899 0.4942 0.0084  -0.0038 -0.0111 154 ILE A CA    
1183 C C     . ILE A 182 ? 0.4618 0.8694 0.5852 0.0143  -0.0069 -0.0110 154 ILE A C     
1184 O O     . ILE A 182 ? 0.3709 0.7698 0.5048 0.0172  -0.0033 -0.0118 154 ILE A O     
1185 C CB    . ILE A 182 ? 0.3450 0.7637 0.4613 0.0006  0.0021  -0.0250 154 ILE A CB    
1186 C CG1   . ILE A 182 ? 0.3973 0.8090 0.5332 0.0014  0.0083  -0.0320 154 ILE A CG1   
1187 C CG2   . ILE A 182 ? 0.3373 0.7749 0.4509 -0.0025 -0.0024 -0.0310 154 ILE A CG2   
1188 C CD1   . ILE A 182 ? 0.2441 0.6404 0.3832 0.0039  0.0118  -0.0267 154 ILE A CD1   
1189 N N     . VAL A 183 ? 0.4180 0.8371 0.5396 0.0159  -0.0137 -0.0096 155 VAL A N     
1190 C CA    . VAL A 183 ? 0.3310 0.7530 0.4653 0.0210  -0.0163 -0.0105 155 VAL A CA    
1191 C C     . VAL A 183 ? 0.4484 0.8583 0.5849 0.0289  -0.0185 -0.0018 155 VAL A C     
1192 O O     . VAL A 183 ? 0.4689 0.8741 0.6155 0.0320  -0.0150 -0.0038 155 VAL A O     
1193 C CB    . VAL A 183 ? 0.3583 0.7984 0.4926 0.0204  -0.0237 -0.0124 155 VAL A CB    
1194 C CG1   . VAL A 183 ? 0.2549 0.6983 0.4044 0.0263  -0.0262 -0.0129 155 VAL A CG1   
1195 C CG2   . VAL A 183 ? 0.4738 0.9281 0.6091 0.0120  -0.0207 -0.0250 155 VAL A CG2   
1196 N N     . MET A 184 ? 0.4284 0.8338 0.5558 0.0316  -0.0240 0.0077  156 MET A N     
1197 C CA    . MET A 184 ? 0.4144 0.8086 0.5469 0.0390  -0.0263 0.0143  156 MET A CA    
1198 C C     . MET A 184 ? 0.3218 0.7014 0.4545 0.0392  -0.0198 0.0133  156 MET A C     
1199 O O     . MET A 184 ? 0.3289 0.7037 0.4698 0.0437  -0.0180 0.0115  156 MET A O     
1200 C CB    . MET A 184 ? 0.5307 0.9229 0.6570 0.0415  -0.0342 0.0258  156 MET A CB    
1201 C CG    . MET A 184 ? 0.5624 0.9695 0.6920 0.0439  -0.0433 0.0290  156 MET A CG    
1202 S SD    . MET A 184 ? 0.5532 0.9647 0.7047 0.0523  -0.0451 0.0238  156 MET A SD    
1203 C CE    . MET A 184 ? 0.2674 0.6973 0.4223 0.0465  -0.0423 0.0115  156 MET A CE    
1204 N N     . ASN A 185 ? 0.3388 0.7134 0.4626 0.0339  -0.0162 0.0137  157 ASN A N     
1205 C CA    . ASN A 185 ? 0.4954 0.8584 0.6204 0.0336  -0.0109 0.0125  157 ASN A CA    
1206 C C     . ASN A 185 ? 0.4348 0.8002 0.5677 0.0325  -0.0056 0.0057  157 ASN A C     
1207 O O     . ASN A 185 ? 0.4651 0.8240 0.6011 0.0342  -0.0030 0.0054  157 ASN A O     
1208 C CB    . ASN A 185 ? 0.2563 0.6147 0.3724 0.0281  -0.0084 0.0147  157 ASN A CB    
1209 C CG    . ASN A 185 ? 0.4645 0.8178 0.5734 0.0288  -0.0129 0.0243  157 ASN A CG    
1210 O OD1   . ASN A 185 ? 0.5663 0.9261 0.6653 0.0243  -0.0145 0.0282  157 ASN A OD1   
1211 N ND2   . ASN A 185 ? 0.3815 0.7238 0.4959 0.0340  -0.0149 0.0282  157 ASN A ND2   
1212 N N     . GLY A 186 ? 0.3760 0.7517 0.5129 0.0293  -0.0044 0.0005  158 GLY A N     
1213 C CA    . GLY A 186 ? 0.2295 0.6074 0.3770 0.0281  0.0004  -0.0042 158 GLY A CA    
1214 C C     . GLY A 186 ? 0.3662 0.7458 0.5199 0.0329  -0.0002 -0.0032 158 GLY A C     
1215 O O     . GLY A 186 ? 0.3956 0.7723 0.5535 0.0334  0.0035  -0.0027 158 GLY A O     
1216 N N     . ALA A 187 ? 0.2303 0.6161 0.3849 0.0363  -0.0050 -0.0027 159 ALA A N     
1217 C CA    . ALA A 187 ? 0.3374 0.7270 0.5000 0.0410  -0.0050 -0.0035 159 ALA A CA    
1218 C C     . ALA A 187 ? 0.3285 0.7090 0.4885 0.0452  -0.0043 -0.0013 159 ALA A C     
1219 O O     . ALA A 187 ? 0.2275 0.6097 0.3915 0.0463  -0.0003 -0.0033 159 ALA A O     
1220 C CB    . ALA A 187 ? 0.3140 0.7131 0.4813 0.0443  -0.0113 -0.0036 159 ALA A CB    
1221 N N     . SER A 188 ? 0.3115 0.6833 0.4649 0.0467  -0.0078 0.0025  160 SER A N     
1222 C CA    . SER A 188 ? 0.3844 0.7471 0.5371 0.0499  -0.0072 0.0028  160 SER A CA    
1223 C C     . SER A 188 ? 0.4254 0.7851 0.5743 0.0467  -0.0021 0.0013  160 SER A C     
1224 O O     . SER A 188 ? 0.3477 0.7074 0.4977 0.0485  0.0000  -0.0015 160 SER A O     
1225 C CB    . SER A 188 ? 0.3809 0.7339 0.5292 0.0508  -0.0114 0.0081  160 SER A CB    
1226 O OG    . SER A 188 ? 0.3566 0.7125 0.5097 0.0546  -0.0173 0.0119  160 SER A OG    
1227 N N     . CYS A 189 ? 0.4647 0.8233 0.6101 0.0419  -0.0005 0.0028  161 CYS A N     
1228 C CA    . CYS A 189 ? 0.3975 0.7540 0.5420 0.0391  0.0030  0.0031  161 CYS A CA    
1229 C C     . CYS A 189 ? 0.3913 0.7556 0.5409 0.0387  0.0065  0.0025  161 CYS A C     
1230 O O     . CYS A 189 ? 0.3715 0.7368 0.5190 0.0388  0.0081  0.0034  161 CYS A O     
1231 C CB    . CYS A 189 ? 0.3758 0.7299 0.5202 0.0345  0.0043  0.0038  161 CYS A CB    
1232 S SG    . CYS A 189 ? 0.3753 0.7269 0.5232 0.0319  0.0070  0.0057  161 CYS A SG    
1233 N N     . LEU A 190 ? 0.2799 0.6511 0.4360 0.0376  0.0075  0.0013  162 LEU A N     
1234 C CA    . LEU A 190 ? 0.2561 0.6350 0.4190 0.0362  0.0116  0.0017  162 LEU A CA    
1235 C C     . LEU A 190 ? 0.3665 0.7507 0.5278 0.0394  0.0130  0.0000  162 LEU A C     
1236 O O     . LEU A 190 ? 0.3929 0.7810 0.5524 0.0378  0.0165  0.0024  162 LEU A O     
1237 C CB    . LEU A 190 ? 0.2615 0.6476 0.4341 0.0343  0.0122  -0.0013 162 LEU A CB    
1238 C CG    . LEU A 190 ? 0.3558 0.7503 0.5380 0.0322  0.0171  -0.0009 162 LEU A CG    
1239 C CD1   . LEU A 190 ? 0.2177 0.6088 0.4033 0.0282  0.0210  0.0052  162 LEU A CD1   
1240 C CD2   . LEU A 190 ? 0.3377 0.7405 0.5312 0.0304  0.0169  -0.0059 162 LEU A CD2   
1241 N N     . GLY A 191 ? 0.3488 0.7341 0.5115 0.0438  0.0101  -0.0039 163 GLY A N     
1242 C CA    . GLY A 191 ? 0.3843 0.7754 0.5491 0.0473  0.0120  -0.0084 163 GLY A CA    
1243 C C     . GLY A 191 ? 0.3766 0.7638 0.5334 0.0478  0.0128  -0.0099 163 GLY A C     
1244 O O     . GLY A 191 ? 0.3971 0.7925 0.5528 0.0477  0.0169  -0.0137 163 GLY A O     
1245 N N     . THR A 192 ? 0.3789 0.7552 0.5300 0.0476  0.0093  -0.0077 164 THR A N     
1246 C CA    . THR A 192 ? 0.4557 0.8285 0.6008 0.0478  0.0091  -0.0103 164 THR A CA    
1247 C C     . THR A 192 ? 0.4506 0.8289 0.5884 0.0435  0.0116  -0.0069 164 THR A C     
1248 O O     . THR A 192 ? 0.4770 0.8625 0.6099 0.0429  0.0136  -0.0108 164 THR A O     
1249 C CB    . THR A 192 ? 0.4589 0.8189 0.6021 0.0481  0.0049  -0.0086 164 THR A CB    
1250 O OG1   . THR A 192 ? 0.4680 0.8231 0.6179 0.0523  0.0019  -0.0100 164 THR A OG1   
1251 C CG2   . THR A 192 ? 0.4319 0.7893 0.5705 0.0471  0.0047  -0.0120 164 THR A CG2   
1252 N N     . VAL A 193 ? 0.3324 0.7085 0.4707 0.0402  0.0114  0.0004  165 VAL A N     
1253 C CA    . VAL A 193 ? 0.3712 0.7517 0.5058 0.0366  0.0126  0.0066  165 VAL A CA    
1254 C C     . VAL A 193 ? 0.4681 0.8613 0.6019 0.0349  0.0173  0.0084  165 VAL A C     
1255 O O     . VAL A 193 ? 0.4411 0.8420 0.5674 0.0324  0.0182  0.0121  165 VAL A O     
1256 C CB    . VAL A 193 ? 0.4234 0.7980 0.5645 0.0341  0.0117  0.0133  165 VAL A CB    
1257 C CG1   . VAL A 193 ? 0.2350 0.6138 0.3762 0.0311  0.0121  0.0220  165 VAL A CG1   
1258 C CG2   . VAL A 193 ? 0.2287 0.5932 0.3695 0.0347  0.0084  0.0112  165 VAL A CG2   
1259 N N     . LEU A 194 ? 0.4996 0.8965 0.6409 0.0357  0.0202  0.0059  166 LEU A N     
1260 C CA    . LEU A 194 ? 0.4008 0.8104 0.5434 0.0334  0.0259  0.0072  166 LEU A CA    
1261 C C     . LEU A 194 ? 0.4574 0.8779 0.5920 0.0340  0.0288  0.0002  166 LEU A C     
1262 O O     . LEU A 194 ? 0.4891 0.9204 0.6156 0.0300  0.0323  0.0044  166 LEU A O     
1263 C CB    . LEU A 194 ? 0.3019 0.7141 0.4570 0.0342  0.0280  0.0042  166 LEU A CB    
1264 C CG    . LEU A 194 ? 0.3410 0.7505 0.5061 0.0304  0.0289  0.0108  166 LEU A CG    
1265 C CD1   . LEU A 194 ? 0.3064 0.7209 0.4840 0.0310  0.0302  0.0054  166 LEU A CD1   
1266 C CD2   . LEU A 194 ? 0.2397 0.6545 0.4043 0.0253  0.0333  0.0209  166 LEU A CD2   
1267 N N     . VAL A 195 ? 0.2509 0.6694 0.3885 0.0388  0.0276  -0.0106 167 VAL A N     
1268 C CA    . VAL A 195 ? 0.4793 0.9086 0.6133 0.0396  0.0313  -0.0209 167 VAL A CA    
1269 C C     . VAL A 195 ? 0.5087 0.9393 0.6297 0.0375  0.0293  -0.0224 167 VAL A C     
1270 O O     . VAL A 195 ? 0.6170 1.0619 0.7301 0.0350  0.0335  -0.0285 167 VAL A O     
1271 C CB    . VAL A 195 ? 0.4338 0.8596 0.5802 0.0459  0.0303  -0.0325 167 VAL A CB    
1272 C CG1   . VAL A 195 ? 0.5087 0.9354 0.6686 0.0481  0.0306  -0.0308 167 VAL A CG1   
1273 C CG2   . VAL A 195 ? 0.5398 0.9498 0.6869 0.0492  0.0237  -0.0334 167 VAL A CG2   
1274 N N     . SER A 196 ? 0.4361 0.8539 0.5550 0.0379  0.0232  -0.0176 168 SER A N     
1275 C CA    . SER A 196 ? 0.4971 0.9164 0.6057 0.0358  0.0202  -0.0189 168 SER A CA    
1276 C C     . SER A 196 ? 0.5185 0.9475 0.6169 0.0305  0.0202  -0.0069 168 SER A C     
1277 O O     . SER A 196 ? 0.6352 1.0763 0.7219 0.0274  0.0198  -0.0085 168 SER A O     
1278 C CB    . SER A 196 ? 0.5216 0.9246 0.6341 0.0378  0.0142  -0.0180 168 SER A CB    
1279 O OG    . SER A 196 ? 0.5595 0.9530 0.6817 0.0424  0.0136  -0.0260 168 SER A OG    
1280 N N     . GLY A 197 ? 0.3812 0.8055 0.4854 0.0294  0.0204  0.0051  169 GLY A N     
1281 C CA    . GLY A 197 ? 0.3564 0.7876 0.4557 0.0248  0.0201  0.0193  169 GLY A CA    
1282 C C     . GLY A 197 ? 0.4598 0.9100 0.5492 0.0206  0.0259  0.0209  169 GLY A C     
1283 O O     . GLY A 197 ? 0.4843 0.9458 0.5618 0.0165  0.0243  0.0290  169 GLY A O     
1284 N N     . ILE A 198 ? 0.5733 1.0285 0.6677 0.0213  0.0325  0.0136  170 ILE A N     
1285 C CA    . ILE A 198 ? 0.5672 1.0421 0.6534 0.0167  0.0400  0.0135  170 ILE A CA    
1286 C C     . ILE A 198 ? 0.6502 1.1399 0.7208 0.0150  0.0404  0.0028  170 ILE A C     
1287 O O     . ILE A 198 ? 0.7415 1.2487 0.7970 0.0090  0.0426  0.0092  170 ILE A O     
1288 C CB    . ILE A 198 ? 0.4329 0.9110 0.5315 0.0184  0.0471  0.0048  170 ILE A CB    
1289 C CG1   . ILE A 198 ? 0.3487 0.8164 0.4623 0.0184  0.0471  0.0147  170 ILE A CG1   
1290 C CG2   . ILE A 198 ? 0.3075 0.8082 0.3978 0.0131  0.0563  0.0019  170 ILE A CG2   
1291 C CD1   . ILE A 198 ? 0.4018 0.8745 0.5292 0.0196  0.0531  0.0069  170 ILE A CD1   
1292 N N     . ILE A 199 ? 0.5816 1.0649 0.6562 0.0197  0.0383  -0.0133 171 ILE A N     
1293 C CA    . ILE A 199 ? 0.5725 1.0689 0.6359 0.0182  0.0388  -0.0273 171 ILE A CA    
1294 C C     . ILE A 199 ? 0.5291 1.0300 0.5777 0.0144  0.0317  -0.0190 171 ILE A C     
1295 O O     . ILE A 199 ? 0.6062 1.1277 0.6385 0.0092  0.0330  -0.0222 171 ILE A O     
1296 C CB    . ILE A 199 ? 0.4383 0.9239 0.5147 0.0243  0.0378  -0.0458 171 ILE A CB    
1297 C CG1   . ILE A 199 ? 0.3956 0.8821 0.4870 0.0280  0.0447  -0.0548 171 ILE A CG1   
1298 C CG2   . ILE A 199 ? 0.3300 0.8276 0.3976 0.0222  0.0378  -0.0617 171 ILE A CG2   
1299 C CD1   . ILE A 199 ? 0.4438 0.9213 0.5509 0.0343  0.0440  -0.0721 171 ILE A CD1   
1300 N N     . ILE A 200 ? 0.3740 0.8577 0.4288 0.0168  0.0240  -0.0086 172 ILE A N     
1301 C CA    . ILE A 200 ? 0.4647 0.9522 0.5098 0.0139  0.0163  0.0012  172 ILE A CA    
1302 C C     . ILE A 200 ? 0.5271 1.0313 0.5598 0.0080  0.0171  0.0187  172 ILE A C     
1303 O O     . ILE A 200 ? 0.5928 1.1139 0.6096 0.0035  0.0132  0.0219  172 ILE A O     
1304 C CB    . ILE A 200 ? 0.4524 0.9188 0.5105 0.0176  0.0094  0.0095  172 ILE A CB    
1305 C CG1   . ILE A 200 ? 0.4488 0.9021 0.5149 0.0217  0.0071  -0.0058 172 ILE A CG1   
1306 C CG2   . ILE A 200 ? 0.4629 0.9346 0.5153 0.0148  0.0016  0.0238  172 ILE A CG2   
1307 C CD1   . ILE A 200 ? 0.4745 0.9383 0.5317 0.0196  0.0036  -0.0174 172 ILE A CD1   
1308 N N     . SER A 201 ? 0.4352 0.9353 0.4754 0.0074  0.0219  0.0303  173 SER A N     
1309 C CA    . SER A 201 ? 0.4496 0.9634 0.4812 0.0014  0.0238  0.0492  173 SER A CA    
1310 C C     . SER A 201 ? 0.5079 1.0490 0.5186 -0.0048 0.0294  0.0432  173 SER A C     
1311 O O     . SER A 201 ? 0.5405 1.0987 0.5349 -0.0107 0.0266  0.0566  173 SER A O     
1312 C CB    . SER A 201 ? 0.3385 0.8430 0.3855 0.0014  0.0299  0.0585  173 SER A CB    
1313 O OG    . SER A 201 ? 0.4238 0.9058 0.4896 0.0062  0.0254  0.0625  173 SER A OG    
1314 N N     . ILE A 202 ? 0.5180 1.0642 0.5299 -0.0037 0.0374  0.0229  174 ILE A N     
1315 C CA    . ILE A 202 ? 0.5452 1.1187 0.5395 -0.0096 0.0446  0.0119  174 ILE A CA    
1316 C C     . ILE A 202 ? 0.5717 1.1580 0.5495 -0.0118 0.0378  0.0031  174 ILE A C     
1317 O O     . ILE A 202 ? 0.6408 1.2530 0.5968 -0.0193 0.0388  0.0063  174 ILE A O     
1318 C CB    . ILE A 202 ? 0.5312 1.1056 0.5367 -0.0064 0.0541  -0.0110 174 ILE A CB    
1319 C CG1   . ILE A 202 ? 0.4366 1.0006 0.4594 -0.0045 0.0601  -0.0035 174 ILE A CG1   
1320 C CG2   . ILE A 202 ? 0.3981 1.0025 0.3869 -0.0129 0.0629  -0.0255 174 ILE A CG2   
1321 C CD1   . ILE A 202 ? 0.3559 0.9157 0.3961 0.0010  0.0662  -0.0241 174 ILE A CD1   
1322 N N     . LEU A 203 ? 0.5043 1.0737 0.4927 -0.0058 0.0310  -0.0079 175 LEU A N     
1323 C CA    . LEU A 203 ? 0.5644 1.1442 0.5417 -0.0077 0.0241  -0.0185 175 LEU A CA    
1324 C C     . LEU A 203 ? 0.6156 1.2052 0.5787 -0.0120 0.0143  0.0029  175 LEU A C     
1325 O O     . LEU A 203 ? 0.5750 1.1856 0.5209 -0.0169 0.0097  -0.0024 175 LEU A O     
1326 C CB    . LEU A 203 ? 0.5146 1.0716 0.5098 -0.0007 0.0194  -0.0325 175 LEU A CB    
1327 C CG    . LEU A 203 ? 0.4417 0.9921 0.4510 0.0035  0.0273  -0.0557 175 LEU A CG    
1328 C CD1   . LEU A 203 ? 0.4950 1.0216 0.5220 0.0097  0.0219  -0.0647 175 LEU A CD1   
1329 C CD2   . LEU A 203 ? 0.4153 0.9922 0.4126 -0.0016 0.0338  -0.0765 175 LEU A CD2   
1330 N N     . LEU A 204 ? 0.6063 1.1817 0.5783 -0.0102 0.0107  0.0264  176 LEU A N     
1331 C CA    . LEU A 204 ? 0.5703 1.1543 0.5335 -0.0136 0.0013  0.0499  176 LEU A CA    
1332 C C     . LEU A 204 ? 0.6110 1.2242 0.5507 -0.0224 0.0053  0.0609  176 LEU A C     
1333 O O     . LEU A 204 ? 0.7615 1.3939 0.6844 -0.0273 -0.0028 0.0732  176 LEU A O     
1334 C CB    . LEU A 204 ? 0.5711 1.1317 0.5547 -0.0094 -0.0019 0.0707  176 LEU A CB    
1335 C CG    . LEU A 204 ? 0.5375 1.0723 0.5421 -0.0021 -0.0074 0.0646  176 LEU A CG    
1336 C CD1   . LEU A 204 ? 0.5794 1.0945 0.6045 0.0009  -0.0081 0.0825  176 LEU A CD1   
1337 C CD2   . LEU A 204 ? 0.4749 1.0159 0.4752 -0.0021 -0.0187 0.0625  176 LEU A CD2   
1338 N N     . LYS A 205 ? 0.5854 1.2033 0.5240 -0.0248 0.0178  0.0569  177 LYS A N     
1339 C CA    . LYS A 205 ? 0.6275 1.2743 0.5438 -0.0341 0.0245  0.0658  177 LYS A CA    
1340 C C     . LYS A 205 ? 0.6983 1.3741 0.5923 -0.0396 0.0277  0.0426  177 LYS A C     
1341 O O     . LYS A 205 ? 0.8005 1.5045 0.6690 -0.0477 0.0246  0.0512  177 LYS A O     
1342 C CB    . LYS A 205 ? 0.6349 1.2770 0.5615 -0.0350 0.0377  0.0681  177 LYS A CB    
1343 C CG    . LYS A 205 ? 0.7617 1.4353 0.6664 -0.0451 0.0487  0.0692  177 LYS A CG    
1344 C CD    . LYS A 205 ? 0.9265 1.6168 0.8128 -0.0532 0.0436  0.1006  177 LYS A CD    
1345 C CE    . LYS A 205 ? 1.0101 1.7328 0.8738 -0.0644 0.0560  0.1033  177 LYS A CE    
1346 N NZ    . LYS A 205 ? 1.0728 1.8114 0.9188 -0.0727 0.0509  0.1379  177 LYS A NZ    
1347 N N     . THR A 206 ? 0.6144 1.2838 0.5189 -0.0353 0.0338  0.0131  178 THR A N     
1348 C CA    . THR A 206 ? 0.5867 1.2823 0.4758 -0.0402 0.0395  -0.0138 178 THR A CA    
1349 C C     . THR A 206 ? 0.6793 1.3823 0.5602 -0.0407 0.0284  -0.0256 178 THR A C     
1350 O O     . THR A 206 ? 0.7678 1.5023 0.6261 -0.0485 0.0289  -0.0368 178 THR A O     
1351 C CB    . THR A 206 ? 0.5985 1.2844 0.5070 -0.0351 0.0508  -0.0415 178 THR A CB    
1352 O OG1   . THR A 206 ? 0.7079 1.3619 0.6410 -0.0253 0.0444  -0.0486 178 THR A OG1   
1353 C CG2   . THR A 206 ? 0.4647 1.1482 0.3815 -0.0356 0.0622  -0.0325 178 THR A CG2   
1354 N N     . SER A 207 ? 0.6103 1.2863 0.5101 -0.0330 0.0187  -0.0241 179 SER A N     
1355 C CA    . SER A 207 ? 0.6592 1.3397 0.5564 -0.0330 0.0086  -0.0372 179 SER A CA    
1356 C C     . SER A 207 ? 0.8082 1.4732 0.7127 -0.0294 -0.0057 -0.0151 179 SER A C     
1357 O O     . SER A 207 ? 0.9055 1.5437 0.8317 -0.0223 -0.0095 -0.0199 179 SER A O     
1358 C CB    . SER A 207 ? 0.6691 1.3332 0.5869 -0.0273 0.0128  -0.0673 179 SER A CB    
1359 O OG    . SER A 207 ? 0.6463 1.3221 0.5639 -0.0291 0.0264  -0.0882 179 SER A OG    
1360 N N     . PRO A 208 ? 0.8263 1.5088 0.7137 -0.0345 -0.0135 0.0096  180 PRO A N     
1361 C CA    . PRO A 208 ? 0.7254 1.3955 0.6226 -0.0310 -0.0273 0.0317  180 PRO A CA    
1362 C C     . PRO A 208 ? 0.8036 1.4765 0.7042 -0.0300 -0.0380 0.0168  180 PRO A C     
1363 O O     . PRO A 208 ? 0.8375 1.4887 0.7582 -0.0240 -0.0456 0.0231  180 PRO A O     
1364 C CB    . PRO A 208 ? 0.6910 1.3859 0.5666 -0.0379 -0.0325 0.0598  180 PRO A CB    
1365 C CG    . PRO A 208 ? 0.7925 1.5037 0.6519 -0.0440 -0.0185 0.0571  180 PRO A CG    
1366 C CD    . PRO A 208 ? 0.8767 1.5915 0.7365 -0.0439 -0.0092 0.0203  180 PRO A CD    
1367 N N     . LYS A 209 ? 0.8330 1.5334 0.7153 -0.0363 -0.0379 -0.0042 181 LYS A N     
1368 C CA    . LYS A 209 ? 0.7415 1.4488 0.6264 -0.0369 -0.0481 -0.0201 181 LYS A CA    
1369 C C     . LYS A 209 ? 0.7357 1.4126 0.6484 -0.0299 -0.0450 -0.0410 181 LYS A C     
1370 O O     . LYS A 209 ? 0.9029 1.5766 0.8259 -0.0289 -0.0537 -0.0495 181 LYS A O     
1371 C CB    . LYS A 209 ? 0.6751 1.4210 0.5342 -0.0464 -0.0474 -0.0409 181 LYS A CB    
1372 C CG    . LYS A 209 ? 0.5505 1.3315 0.3785 -0.0548 -0.0528 -0.0191 181 LYS A CG    
1373 C CD    . LYS A 209 ? 0.6245 1.4464 0.4257 -0.0651 -0.0514 -0.0433 181 LYS A CD    
1374 C CE    . LYS A 209 ? 0.6269 1.4818 0.3976 -0.0742 -0.0556 -0.0195 181 LYS A CE    
1375 N NZ    . LYS A 209 ? 0.7389 1.6231 0.4938 -0.0839 -0.0507 -0.0436 181 LYS A NZ    
1376 N N     . LEU A 210 ? 0.6436 1.2993 0.5689 -0.0254 -0.0329 -0.0483 182 LEU A N     
1377 C CA    . LEU A 210 ? 0.6490 1.2750 0.6004 -0.0187 -0.0296 -0.0642 182 LEU A CA    
1378 C C     . LEU A 210 ? 0.7475 1.3482 0.7173 -0.0129 -0.0374 -0.0457 182 LEU A C     
1379 O O     . LEU A 210 ? 0.7908 1.3733 0.7790 -0.0094 -0.0395 -0.0563 182 LEU A O     
1380 C CB    . LEU A 210 ? 0.6675 1.2792 0.6277 -0.0151 -0.0161 -0.0724 182 LEU A CB    
1381 C CG    . LEU A 210 ? 0.6002 1.1829 0.5863 -0.0084 -0.0119 -0.0881 182 LEU A CG    
1382 C CD1   . LEU A 210 ? 0.4140 1.0043 0.4053 -0.0107 -0.0116 -0.1172 182 LEU A CD1   
1383 C CD2   . LEU A 210 ? 0.3960 0.9668 0.3903 -0.0043 -0.0007 -0.0894 182 LEU A CD2   
1384 N N     . PHE A 211 ? 0.7940 1.3943 0.7600 -0.0123 -0.0411 -0.0184 183 PHE A N     
1385 C CA    . PHE A 211 ? 0.6893 1.2677 0.6742 -0.0070 -0.0475 -0.0009 183 PHE A CA    
1386 C C     . PHE A 211 ? 0.6488 1.2426 0.6308 -0.0092 -0.0617 0.0110  183 PHE A C     
1387 O O     . PHE A 211 ? 0.6301 1.2092 0.6300 -0.0051 -0.0681 0.0229  183 PHE A O     
1388 C CB    . PHE A 211 ? 0.6230 1.1890 0.6124 -0.0043 -0.0427 0.0208  183 PHE A CB    
1389 C CG    . PHE A 211 ? 0.5912 1.1447 0.5843 -0.0022 -0.0299 0.0108  183 PHE A CG    
1390 C CD1   . PHE A 211 ? 0.5623 1.1337 0.5388 -0.0065 -0.0218 0.0066  183 PHE A CD1   
1391 C CD2   . PHE A 211 ? 0.6327 1.1585 0.6461 0.0038  -0.0260 0.0059  183 PHE A CD2   
1392 C CE1   . PHE A 211 ? 0.6667 1.2278 0.6497 -0.0041 -0.0106 -0.0029 183 PHE A CE1   
1393 C CE2   . PHE A 211 ? 0.7217 1.2378 0.7397 0.0061  -0.0158 -0.0023 183 PHE A CE2   
1394 C CZ    . PHE A 211 ? 0.7515 1.2849 0.7557 0.0025  -0.0083 -0.0069 183 PHE A CZ    
1395 N N     . LEU A 212 ? 0.6359 1.2611 0.5957 -0.0158 -0.0665 0.0070  184 LEU A N     
1396 C CA    . LEU A 212 ? 0.6623 1.3073 0.6171 -0.0185 -0.0815 0.0190  184 LEU A CA    
1397 C C     . LEU A 212 ? 0.6671 1.3305 0.6164 -0.0229 -0.0867 -0.0063 184 LEU A C     
1398 O O     . LEU A 212 ? 0.7893 1.4804 0.7158 -0.0298 -0.0853 -0.0189 184 LEU A O     
1399 C CB    . LEU A 212 ? 0.7214 1.3922 0.6528 -0.0236 -0.0853 0.0422  184 LEU A CB    
1400 C CG    . LEU A 212 ? 0.4625 1.1179 0.3999 -0.0206 -0.0803 0.0685  184 LEU A CG    
1401 C CD1   . LEU A 212 ? 0.4899 1.1735 0.4014 -0.0275 -0.0824 0.0893  184 LEU A CD1   
1402 C CD2   . LEU A 212 ? 0.4470 1.0799 0.4122 -0.0137 -0.0880 0.0870  184 LEU A CD2   
1403 N N     . PRO A 213 ? 0.6148 1.2639 0.5863 -0.0196 -0.0921 -0.0149 185 PRO A N     
1404 C CA    . PRO A 213 ? 0.6500 1.3135 0.6222 -0.0239 -0.0970 -0.0401 185 PRO A CA    
1405 C C     . PRO A 213 ? 0.6089 1.3061 0.5680 -0.0291 -0.1129 -0.0321 185 PRO A C     
1406 O O     . PRO A 213 ? 0.5872 1.2893 0.5454 -0.0272 -0.1219 -0.0041 185 PRO A O     
1407 C CB    . PRO A 213 ? 0.5715 1.2050 0.5744 -0.0185 -0.0966 -0.0464 185 PRO A CB    
1408 C CG    . PRO A 213 ? 0.5622 1.1784 0.5775 -0.0125 -0.0991 -0.0187 185 PRO A CG    
1409 C CD    . PRO A 213 ? 0.5750 1.1931 0.5736 -0.0123 -0.0925 -0.0029 185 PRO A CD    
1410 N N     . VAL B 28  ? 1.1237 1.6184 0.9999 0.1785  -0.1772 0.1478  0   VAL B N     
1411 C CA    . VAL B 28  ? 1.0948 1.5635 0.9959 0.1632  -0.1580 0.1538  0   VAL B CA    
1412 C C     . VAL B 28  ? 1.1271 1.5881 1.0377 0.1474  -0.1553 0.1317  0   VAL B C     
1413 O O     . VAL B 28  ? 1.0821 1.5294 1.0231 0.1330  -0.1488 0.1268  0   VAL B O     
1414 C CB    . VAL B 28  ? 1.0944 1.5463 0.9779 0.1682  -0.1370 0.1799  0   VAL B CB    
1415 N N     . MET B 29  ? 1.1976 1.6675 1.0809 0.1516  -0.1601 0.1187  1   MET B N     
1416 C CA    . MET B 29  ? 1.0576 1.5206 0.9478 0.1390  -0.1585 0.0971  1   MET B CA    
1417 C C     . MET B 29  ? 1.0200 1.4944 0.9329 0.1322  -0.1790 0.0721  1   MET B C     
1418 O O     . MET B 29  ? 0.9871 1.4553 0.9104 0.1214  -0.1800 0.0530  1   MET B O     
1419 C CB    . MET B 29  ? 0.9832 1.4497 0.8348 0.1474  -0.1538 0.0931  1   MET B CB    
1420 C CG    . MET B 29  ? 0.9484 1.4025 0.7842 0.1499  -0.1304 0.1163  1   MET B CG    
1421 S SD    . MET B 29  ? 1.5564 1.9859 1.4238 0.1297  -0.1111 0.1175  1   MET B SD    
1422 C CE    . MET B 29  ? 0.5517 0.9829 0.4168 0.1232  -0.1168 0.0876  1   MET B CE    
1423 N N     . GLN B 30  ? 0.9741 1.4653 0.8966 0.1387  -0.1952 0.0733  2   GLN B N     
1424 C CA    . GLN B 30  ? 0.8068 1.3115 0.7564 0.1317  -0.2153 0.0515  2   GLN B CA    
1425 C C     . GLN B 30  ? 0.7537 1.2503 0.7487 0.1182  -0.2101 0.0550  2   GLN B C     
1426 O O     . GLN B 30  ? 0.7443 1.2483 0.7696 0.1085  -0.2219 0.0387  2   GLN B O     
1427 C CB    . GLN B 30  ? 0.6669 1.1987 0.6050 0.1460  -0.2376 0.0494  2   GLN B CB    
1428 N N     . ASN B 31  ? 0.6869 1.1681 0.6865 0.1180  -0.1920 0.0763  3   ASN B N     
1429 C CA    . ASN B 31  ? 0.6680 1.1397 0.7056 0.1072  -0.1845 0.0804  3   ASN B CA    
1430 C C     . ASN B 31  ? 0.7462 1.1969 0.7934 0.0926  -0.1694 0.0743  3   ASN B C     
1431 O O     . ASN B 31  ? 0.8360 1.2687 0.8742 0.0913  -0.1519 0.0872  3   ASN B O     
1432 C CB    . ASN B 31  ? 0.6685 1.1335 0.7071 0.1155  -0.1743 0.1047  3   ASN B CB    
1433 C CG    . ASN B 31  ? 0.7446 1.2027 0.8207 0.1074  -0.1682 0.1078  3   ASN B CG    
1434 O OD1   . ASN B 31  ? 0.7724 1.2350 0.8756 0.0965  -0.1729 0.0934  3   ASN B OD1   
1435 N ND2   . ASN B 31  ? 0.8358 1.2823 0.9136 0.1133  -0.1570 0.1269  3   ASN B ND2   
1436 N N     . LYS B 32  ? 0.7443 1.1978 0.8113 0.0817  -0.1767 0.0548  4   LYS B N     
1437 C CA    . LYS B 32  ? 0.7025 1.1381 0.7775 0.0691  -0.1643 0.0477  4   LYS B CA    
1438 C C     . LYS B 32  ? 0.7302 1.1500 0.8240 0.0625  -0.1475 0.0609  4   LYS B C     
1439 O O     . LYS B 32  ? 0.7531 1.1562 0.8405 0.0570  -0.1332 0.0636  4   LYS B O     
1440 C CB    . LYS B 32  ? 0.7519 1.1932 0.8498 0.0591  -0.1761 0.0261  4   LYS B CB    
1441 C CG    . LYS B 32  ? 0.9588 1.3826 1.0611 0.0482  -0.1650 0.0177  4   LYS B CG    
1442 C CD    . LYS B 32  ? 1.0293 1.4571 1.1549 0.0390  -0.1771 -0.0030 4   LYS B CD    
1443 C CE    . LYS B 32  ? 0.9883 1.3977 1.1185 0.0296  -0.1656 -0.0097 4   LYS B CE    
1444 N NZ    . LYS B 32  ? 1.0180 1.4191 1.1124 0.0360  -0.1590 -0.0118 4   LYS B NZ    
1445 N N     . ARG B 33  ? 0.7604 1.1863 0.8770 0.0639  -0.1497 0.0685  5   ARG B N     
1446 C CA    . ARG B 33  ? 0.6892 1.1009 0.8233 0.0591  -0.1350 0.0789  5   ARG B CA    
1447 C C     . ARG B 33  ? 0.7738 1.1685 0.8867 0.0639  -0.1208 0.0950  5   ARG B C     
1448 O O     . ARG B 33  ? 0.8044 1.1819 0.9209 0.0569  -0.1072 0.0980  5   ARG B O     
1449 C CB    . ARG B 33  ? 0.6786 1.1027 0.8408 0.0620  -0.1405 0.0833  5   ARG B CB    
1450 C CG    . ARG B 33  ? 0.7833 1.2226 0.9758 0.0539  -0.1514 0.0690  5   ARG B CG    
1451 C CD    . ARG B 33  ? 0.7222 1.1806 0.9417 0.0591  -0.1595 0.0739  5   ARG B CD    
1452 N NE    . ARG B 33  ? 0.6490 1.1243 0.9003 0.0503  -0.1709 0.0605  5   ARG B NE    
1453 C CZ    . ARG B 33  ? 0.7133 1.2114 0.9938 0.0528  -0.1813 0.0612  5   ARG B CZ    
1454 N NH1   . ARG B 33  ? 0.8522 1.3588 1.1322 0.0653  -0.1818 0.0747  5   ARG B NH1   
1455 N NH2   . ARG B 33  ? 0.7451 1.2575 1.0573 0.0428  -0.1911 0.0489  5   ARG B NH2   
1456 N N     . LEU B 34  ? 0.8302 1.2300 0.9218 0.0759  -0.1243 0.1057  6   LEU B N     
1457 C CA    . LEU B 34  ? 0.8061 1.1897 0.8797 0.0803  -0.1109 0.1227  6   LEU B CA    
1458 C C     . LEU B 34  ? 0.7306 1.1040 0.7854 0.0746  -0.1014 0.1202  6   LEU B C     
1459 O O     . LEU B 34  ? 0.7783 1.1343 0.8319 0.0701  -0.0873 0.1288  6   LEU B O     
1460 C CB    . LEU B 34  ? 0.4330 0.8256 0.4881 0.0956  -0.1167 0.1366  6   LEU B CB    
1461 N N     . ILE B 35  ? 0.5834 0.9682 0.6245 0.0752  -0.1096 0.1075  7   ILE B N     
1462 C CA    . ILE B 35  ? 0.5863 0.9646 0.6090 0.0720  -0.1010 0.1043  7   ILE B CA    
1463 C C     . ILE B 35  ? 0.5475 0.9116 0.5877 0.0586  -0.0905 0.0986  7   ILE B C     
1464 O O     . ILE B 35  ? 0.5802 0.9327 0.6138 0.0552  -0.0773 0.1063  7   ILE B O     
1465 C CB    . ILE B 35  ? 0.5312 0.9239 0.5372 0.0760  -0.1130 0.0882  7   ILE B CB    
1466 C CG1   . ILE B 35  ? 0.6025 1.0109 0.5849 0.0911  -0.1234 0.0944  7   ILE B CG1   
1467 C CG2   . ILE B 35  ? 0.4348 0.8209 0.4241 0.0733  -0.1028 0.0842  7   ILE B CG2   
1468 C CD1   . ILE B 35  ? 0.7956 1.2186 0.7589 0.0965  -0.1371 0.0765  7   ILE B CD1   
1469 N N     . ILE B 36  ? 0.5346 0.9010 0.5983 0.0513  -0.0966 0.0858  8   ILE B N     
1470 C CA    . ILE B 36  ? 0.6168 0.9716 0.6971 0.0399  -0.0877 0.0806  8   ILE B CA    
1471 C C     . ILE B 36  ? 0.6007 0.9409 0.6876 0.0372  -0.0751 0.0937  8   ILE B C     
1472 O O     . ILE B 36  ? 0.4567 0.7862 0.5432 0.0308  -0.0648 0.0945  8   ILE B O     
1473 C CB    . ILE B 36  ? 0.4963 0.8568 0.6032 0.0337  -0.0956 0.0682  8   ILE B CB    
1474 C CG1   . ILE B 36  ? 0.4702 0.8425 0.5730 0.0347  -0.1091 0.0526  8   ILE B CG1   
1475 C CG2   . ILE B 36  ? 0.3940 0.7427 0.5158 0.0237  -0.0855 0.0654  8   ILE B CG2   
1476 C CD1   . ILE B 36  ? 0.3391 0.7188 0.4716 0.0283  -0.1185 0.0417  8   ILE B CD1   
1477 N N     . LEU B 37  ? 0.5514 0.8914 0.6445 0.0426  -0.0766 0.1033  9   LEU B N     
1478 C CA    . LEU B 37  ? 0.5426 0.8667 0.6408 0.0414  -0.0658 0.1147  9   LEU B CA    
1479 C C     . LEU B 37  ? 0.6183 0.9326 0.6980 0.0422  -0.0565 0.1257  9   LEU B C     
1480 O O     . LEU B 37  ? 0.5397 0.8401 0.6234 0.0354  -0.0465 0.1286  9   LEU B O     
1481 C CB    . LEU B 37  ? 0.4581 0.7841 0.5655 0.0494  -0.0697 0.1229  9   LEU B CB    
1482 C CG    . LEU B 37  ? 0.3656 0.7011 0.4972 0.0482  -0.0758 0.1150  9   LEU B CG    
1483 C CD1   . LEU B 37  ? 0.3446 0.6836 0.4844 0.0583  -0.0790 0.1245  9   LEU B CD1   
1484 C CD2   . LEU B 37  ? 0.3806 0.7053 0.5264 0.0391  -0.0669 0.1096  9   LEU B CD2   
1485 N N     . LEU B 38  ? 0.6725 0.9953 0.7324 0.0507  -0.0599 0.1320  10  LEU B N     
1486 C CA    . LEU B 38  ? 0.6992 1.0155 0.7417 0.0523  -0.0500 0.1445  10  LEU B CA    
1487 C C     . LEU B 38  ? 0.6678 0.9827 0.7076 0.0438  -0.0429 0.1374  10  LEU B C     
1488 O O     . LEU B 38  ? 0.7344 1.0390 0.7747 0.0387  -0.0317 0.1459  10  LEU B O     
1489 C CB    . LEU B 38  ? 0.6919 1.0210 0.7110 0.0649  -0.0552 0.1524  10  LEU B CB    
1490 C CG    . LEU B 38  ? 0.7490 1.0782 0.7668 0.0757  -0.0591 0.1663  10  LEU B CG    
1491 C CD1   . LEU B 38  ? 0.7475 1.0914 0.7381 0.0892  -0.0642 0.1744  10  LEU B CD1   
1492 C CD2   . LEU B 38  ? 0.7558 1.0637 0.7822 0.0731  -0.0467 0.1821  10  LEU B CD2   
1493 N N     . GLU B 39  ? 0.5235 0.8488 0.5622 0.0423  -0.0498 0.1219  11  GLU B N     
1494 C CA    . GLU B 39  ? 0.5561 0.8809 0.5932 0.0358  -0.0437 0.1143  11  GLU B CA    
1495 C C     . GLU B 39  ? 0.5955 0.9078 0.6519 0.0250  -0.0361 0.1135  11  GLU B C     
1496 O O     . GLU B 39  ? 0.6032 0.9118 0.6589 0.0200  -0.0270 0.1165  11  GLU B O     
1497 C CB    . GLU B 39  ? 0.6338 0.9688 0.6695 0.0364  -0.0533 0.0965  11  GLU B CB    
1498 C CG    . GLU B 39  ? 0.6424 0.9905 0.6542 0.0472  -0.0608 0.0936  11  GLU B CG    
1499 C CD    . GLU B 39  ? 0.6062 0.9609 0.6168 0.0467  -0.0695 0.0739  11  GLU B CD    
1500 O OE1   . GLU B 39  ? 0.6804 1.0286 0.7083 0.0379  -0.0673 0.0649  11  GLU B OE1   
1501 O OE2   . GLU B 39  ? 0.5640 0.9296 0.5560 0.0555  -0.0788 0.0671  11  GLU B OE2   
1502 N N     . CYS B 40  ? 0.6519 0.9597 0.7256 0.0222  -0.0401 0.1097  12  CYS B N     
1503 C CA    . CYS B 40  ? 0.6850 0.9815 0.7743 0.0139  -0.0339 0.1086  12  CYS B CA    
1504 C C     . CYS B 40  ? 0.6619 0.9460 0.7500 0.0119  -0.0251 0.1210  12  CYS B C     
1505 O O     . CYS B 40  ? 0.6926 0.9703 0.7866 0.0044  -0.0187 0.1205  12  CYS B O     
1506 C CB    . CYS B 40  ? 0.6965 0.9919 0.8022 0.0139  -0.0388 0.1040  12  CYS B CB    
1507 S SG    . CYS B 40  ? 0.4881 0.7960 0.6042 0.0126  -0.0478 0.0894  12  CYS B SG    
1508 N N     . ALA B 41  ? 0.5671 0.8481 0.6489 0.0186  -0.0255 0.1324  13  ALA B N     
1509 C CA    . ALA B 41  ? 0.4550 0.7218 0.5376 0.0168  -0.0173 0.1456  13  ALA B CA    
1510 C C     . ALA B 41  ? 0.4528 0.7224 0.5269 0.0135  -0.0092 0.1523  13  ALA B C     
1511 O O     . ALA B 41  ? 0.3964 0.6558 0.4792 0.0058  -0.0017 0.1571  13  ALA B O     
1512 C CB    . ALA B 41  ? 0.3705 0.6335 0.4481 0.0265  -0.0194 0.1577  13  ALA B CB    
1513 N N     . ILE B 42  ? 0.5746 0.8590 0.6327 0.0195  -0.0110 0.1520  14  ILE B N     
1514 C CA    . ILE B 42  ? 0.5921 0.8826 0.6405 0.0187  -0.0022 0.1590  14  ILE B CA    
1515 C C     . ILE B 42  ? 0.6625 0.9539 0.7224 0.0087  0.0023  0.1504  14  ILE B C     
1516 O O     . ILE B 42  ? 0.7121 0.9999 0.7793 0.0022  0.0113  0.1585  14  ILE B O     
1517 C CB    . ILE B 42  ? 0.5090 0.8161 0.5348 0.0293  -0.0058 0.1575  14  ILE B CB    
1518 C CG1   . ILE B 42  ? 0.4130 0.7215 0.4247 0.0406  -0.0088 0.1703  14  ILE B CG1   
1519 C CG2   . ILE B 42  ? 0.3972 0.7129 0.4140 0.0289  0.0043  0.1619  14  ILE B CG2   
1520 C CD1   . ILE B 42  ? 0.4310 0.7567 0.4172 0.0526  -0.0141 0.1677  14  ILE B CD1   
1521 N N     . PHE B 43  ? 0.5661 0.8628 0.6293 0.0074  -0.0041 0.1348  15  PHE B N     
1522 C CA    . PHE B 43  ? 0.4923 0.7910 0.5658 -0.0003 -0.0007 0.1267  15  PHE B CA    
1523 C C     . PHE B 43  ? 0.5018 0.7883 0.5932 -0.0097 0.0017  0.1275  15  PHE B C     
1524 O O     . PHE B 43  ? 0.6165 0.9047 0.7165 -0.0165 0.0065  0.1265  15  PHE B O     
1525 C CB    . PHE B 43  ? 0.4840 0.7889 0.5578 0.0012  -0.0080 0.1111  15  PHE B CB    
1526 C CG    . PHE B 43  ? 0.5633 0.8799 0.6204 0.0088  -0.0095 0.1065  15  PHE B CG    
1527 C CD1   . PHE B 43  ? 0.5687 0.8927 0.6212 0.0090  -0.0023 0.1060  15  PHE B CD1   
1528 C CD2   . PHE B 43  ? 0.5186 0.8398 0.5647 0.0165  -0.0187 0.1017  15  PHE B CD2   
1529 C CE1   . PHE B 43  ? 0.5315 0.8655 0.5666 0.0176  -0.0034 0.1002  15  PHE B CE1   
1530 C CE2   . PHE B 43  ? 0.4948 0.8261 0.5235 0.0241  -0.0213 0.0950  15  PHE B CE2   
1531 C CZ    . PHE B 43  ? 0.5105 0.8473 0.5325 0.0251  -0.0133 0.0939  15  PHE B CZ    
1532 N N     . ALA B 44  ? 0.4682 0.7434 0.5648 -0.0091 -0.0020 0.1286  16  ALA B N     
1533 C CA    . ALA B 44  ? 0.4488 0.7105 0.5593 -0.0164 -0.0003 0.1281  16  ALA B CA    
1534 C C     . ALA B 44  ? 0.5025 0.7568 0.6173 -0.0214 0.0071  0.1403  16  ALA B C     
1535 O O     . ALA B 44  ? 0.5002 0.7486 0.6275 -0.0302 0.0094  0.1384  16  ALA B O     
1536 C CB    . ALA B 44  ? 0.4025 0.6540 0.5163 -0.0124 -0.0052 0.1263  16  ALA B CB    
1537 N N     . ALA B 45  ? 0.5158 0.7711 0.6209 -0.0158 0.0105  0.1533  17  ALA B N     
1538 C CA    . ALA B 45  ? 0.5236 0.7723 0.6339 -0.0202 0.0192  0.1680  17  ALA B CA    
1539 C C     . ALA B 45  ? 0.5783 0.8407 0.6923 -0.0260 0.0260  0.1697  17  ALA B C     
1540 O O     . ALA B 45  ? 0.3617 0.6195 0.4912 -0.0355 0.0316  0.1753  17  ALA B O     
1541 C CB    . ALA B 45  ? 0.3829 0.6306 0.4797 -0.0106 0.0218  0.1834  17  ALA B CB    
1542 N N     . VAL B 46  ? 0.5981 0.8775 0.6995 -0.0201 0.0252  0.1643  18  VAL B N     
1543 C CA    . VAL B 46  ? 0.5174 0.8118 0.6213 -0.0231 0.0320  0.1650  18  VAL B CA    
1544 C C     . VAL B 46  ? 0.4504 0.7448 0.5727 -0.0331 0.0299  0.1545  18  VAL B C     
1545 O O     . VAL B 46  ? 0.4591 0.7603 0.5946 -0.0403 0.0361  0.1591  18  VAL B O     
1546 C CB    . VAL B 46  ? 0.4757 0.7858 0.5606 -0.0129 0.0306  0.1586  18  VAL B CB    
1547 C CG1   . VAL B 46  ? 0.4046 0.7300 0.4932 -0.0146 0.0381  0.1583  18  VAL B CG1   
1548 C CG2   . VAL B 46  ? 0.3693 0.6823 0.4333 -0.0018 0.0320  0.1689  18  VAL B CG2   
1549 N N     . ALA B 47  ? 0.4479 0.7361 0.5716 -0.0332 0.0213  0.1412  19  ALA B N     
1550 C CA    . ALA B 47  ? 0.4056 0.6938 0.5435 -0.0408 0.0183  0.1313  19  ALA B CA    
1551 C C     . ALA B 47  ? 0.4366 0.7130 0.5908 -0.0507 0.0194  0.1350  19  ALA B C     
1552 O O     . ALA B 47  ? 0.4864 0.7681 0.6545 -0.0586 0.0195  0.1315  19  ALA B O     
1553 C CB    . ALA B 47  ? 0.3238 0.6078 0.4583 -0.0373 0.0103  0.1187  19  ALA B CB    
1554 N N     . MET B 48  ? 0.5015 0.7618 0.6546 -0.0500 0.0194  0.1416  20  MET B N     
1555 C CA    . MET B 48  ? 0.5044 0.7492 0.6732 -0.0592 0.0200  0.1444  20  MET B CA    
1556 C C     . MET B 48  ? 0.5548 0.8061 0.7372 -0.0673 0.0283  0.1568  20  MET B C     
1557 O O     . MET B 48  ? 0.6161 0.8624 0.8176 -0.0783 0.0278  0.1551  20  MET B O     
1558 C CB    . MET B 48  ? 0.4292 0.6538 0.5935 -0.0547 0.0190  0.1497  20  MET B CB    
1559 C CG    . MET B 48  ? 0.4298 0.6333 0.6099 -0.0632 0.0181  0.1487  20  MET B CG    
1560 S SD    . MET B 48  ? 0.6668 0.8655 0.8524 -0.0674 0.0089  0.1277  20  MET B SD    
1561 C CE    . MET B 48  ? 0.3546 0.5566 0.5629 -0.0831 0.0095  0.1266  20  MET B CE    
1562 N N     . VAL B 49  ? 0.5134 0.7765 0.6861 -0.0614 0.0360  0.1691  21  VAL B N     
1563 C CA    . VAL B 49  ? 0.5596 0.8331 0.7449 -0.0675 0.0462  0.1830  21  VAL B CA    
1564 C C     . VAL B 49  ? 0.5075 0.7999 0.7057 -0.0736 0.0460  0.1752  21  VAL B C     
1565 O O     . VAL B 49  ? 0.4660 0.7629 0.6870 -0.0846 0.0496  0.1800  21  VAL B O     
1566 C CB    . VAL B 49  ? 0.6230 0.9073 0.7903 -0.0568 0.0551  0.1977  21  VAL B CB    
1567 C CG1   . VAL B 49  ? 0.3830 0.6821 0.5637 -0.0621 0.0676  0.2127  21  VAL B CG1   
1568 C CG2   . VAL B 49  ? 0.3911 0.6581 0.5475 -0.0504 0.0554  0.2082  21  VAL B CG2   
1569 N N     . LEU B 50  ? 0.4972 0.8009 0.6827 -0.0664 0.0414  0.1633  22  LEU B N     
1570 C CA    . LEU B 50  ? 0.5374 0.8589 0.7334 -0.0697 0.0407  0.1557  22  LEU B CA    
1571 C C     . LEU B 50  ? 0.6139 0.9290 0.8276 -0.0800 0.0323  0.1452  22  LEU B C     
1572 O O     . LEU B 50  ? 0.7551 1.0851 0.9843 -0.0856 0.0315  0.1418  22  LEU B O     
1573 C CB    . LEU B 50  ? 0.5385 0.8692 0.7166 -0.0588 0.0376  0.1456  22  LEU B CB    
1574 C CG    . LEU B 50  ? 0.5717 0.9132 0.7316 -0.0478 0.0449  0.1523  22  LEU B CG    
1575 C CD1   . LEU B 50  ? 0.5468 0.8939 0.6925 -0.0386 0.0401  0.1394  22  LEU B CD1   
1576 C CD2   . LEU B 50  ? 0.5152 0.8747 0.6857 -0.0499 0.0565  0.1644  22  LEU B CD2   
1577 N N     . SER B 51  ? 0.5162 0.8101 0.7271 -0.0813 0.0257  0.1396  23  SER B N     
1578 C CA    . SER B 51  ? 0.4312 0.7169 0.6552 -0.0898 0.0172  0.1283  23  SER B CA    
1579 C C     . SER B 51  ? 0.4383 0.7215 0.6874 -0.1032 0.0194  0.1346  23  SER B C     
1580 O O     . SER B 51  ? 0.4454 0.7265 0.7090 -0.1119 0.0118  0.1246  23  SER B O     
1581 C CB    . SER B 51  ? 0.4405 0.7040 0.6532 -0.0856 0.0109  0.1206  23  SER B CB    
1582 O OG    . SER B 51  ? 0.4455 0.7129 0.6401 -0.0750 0.0082  0.1140  23  SER B OG    
1583 N N     . PHE B 52  ? 0.4873 0.7712 0.7418 -0.1049 0.0295  0.1514  24  PHE B N     
1584 C CA    . PHE B 52  ? 0.5080 0.7913 0.7903 -0.1185 0.0337  0.1605  24  PHE B CA    
1585 C C     . PHE B 52  ? 0.4882 0.8008 0.7873 -0.1229 0.0391  0.1656  24  PHE B C     
1586 O O     . PHE B 52  ? 0.5601 0.8785 0.8858 -0.1344 0.0444  0.1757  24  PHE B O     
1587 C CB    . PHE B 52  ? 0.3730 0.6414 0.6550 -0.1181 0.0435  0.1789  24  PHE B CB    
1588 C CG    . PHE B 52  ? 0.5450 0.7820 0.8240 -0.1187 0.0380  0.1751  24  PHE B CG    
1589 C CD1   . PHE B 52  ? 0.6009 0.8266 0.8541 -0.1058 0.0347  0.1706  24  PHE B CD1   
1590 C CD2   . PHE B 52  ? 0.5627 0.7816 0.8664 -0.1320 0.0362  0.1754  24  PHE B CD2   
1591 C CE1   . PHE B 52  ? 0.6174 0.8154 0.8685 -0.1048 0.0305  0.1674  24  PHE B CE1   
1592 C CE2   . PHE B 52  ? 0.5780 0.7663 0.8786 -0.1311 0.0316  0.1710  24  PHE B CE2   
1593 C CZ    . PHE B 52  ? 0.6053 0.7837 0.8790 -0.1168 0.0293  0.1674  24  PHE B CZ    
1594 N N     . ILE B 53  ? 0.3840 0.7151 0.6694 -0.1136 0.0381  0.1591  25  ILE B N     
1595 C CA    . ILE B 53  ? 0.4504 0.8104 0.7512 -0.1157 0.0419  0.1612  25  ILE B CA    
1596 C C     . ILE B 53  ? 0.5773 0.9443 0.8879 -0.1201 0.0293  0.1446  25  ILE B C     
1597 O O     . ILE B 53  ? 0.5946 0.9620 0.8868 -0.1109 0.0232  0.1334  25  ILE B O     
1598 C CB    . ILE B 53  ? 0.3970 0.7731 0.6768 -0.1012 0.0498  0.1651  25  ILE B CB    
1599 C CG1   . ILE B 53  ? 0.4123 0.7846 0.6799 -0.0954 0.0620  0.1818  25  ILE B CG1   
1600 C CG2   . ILE B 53  ? 0.3182 0.7240 0.6145 -0.1017 0.0537  0.1663  25  ILE B CG2   
1601 C CD1   . ILE B 53  ? 0.3906 0.7788 0.6364 -0.0807 0.0696  0.1844  25  ILE B CD1   
1602 N N     . PRO B 54  ? 0.6189 0.9916 0.9593 -0.1342 0.0250  0.1434  26  PRO B N     
1603 C CA    . PRO B 54  ? 0.6205 0.9991 0.9704 -0.1391 0.0109  0.1270  26  PRO B CA    
1604 C C     . PRO B 54  ? 0.7034 1.1121 1.0567 -0.1331 0.0101  0.1243  26  PRO B C     
1605 O O     . PRO B 54  ? 0.7536 1.1864 1.1313 -0.1385 0.0152  0.1325  26  PRO B O     
1606 C CB    . PRO B 54  ? 0.5579 0.9345 0.9418 -0.1569 0.0073  0.1283  26  PRO B CB    
1607 C CG    . PRO B 54  ? 0.5394 0.9249 0.9391 -0.1608 0.0228  0.1492  26  PRO B CG    
1608 C CD    . PRO B 54  ? 0.5601 0.9343 0.9281 -0.1467 0.0330  0.1581  26  PRO B CD    
1609 N N     . LEU B 55  ? 0.5781 0.9853 0.9084 -0.1217 0.0045  0.1139  27  LEU B N     
1610 C CA    . LEU B 55  ? 0.4705 0.9024 0.8036 -0.1153 0.0016  0.1097  27  LEU B CA    
1611 C C     . LEU B 55  ? 0.5538 0.9823 0.8830 -0.1157 -0.0134 0.0942  27  LEU B C     
1612 O O     . LEU B 55  ? 0.2528 0.6822 0.5633 -0.1044 -0.0164 0.0883  27  LEU B O     
1613 C CB    . LEU B 55  ? 0.3589 0.7935 0.6686 -0.0998 0.0095  0.1127  27  LEU B CB    
1614 C CG    . LEU B 55  ? 0.3344 0.7792 0.6451 -0.0960 0.0243  0.1267  27  LEU B CG    
1615 C CD1   . LEU B 55  ? 0.2693 0.7154 0.5562 -0.0803 0.0293  0.1253  27  LEU B CD1   
1616 C CD2   . LEU B 55  ? 0.2585 0.7316 0.5999 -0.1027 0.0291  0.1349  27  LEU B CD2   
1617 N N     . ASP B 56  ? 0.5456 0.9697 0.8925 -0.1284 -0.0226 0.0879  28  ASP B N     
1618 C CA    . ASP B 56  ? 0.4897 0.9084 0.8301 -0.1286 -0.0376 0.0719  28  ASP B CA    
1619 C C     . ASP B 56  ? 0.4753 0.9206 0.8409 -0.1358 -0.0480 0.0664  28  ASP B C     
1620 O O     . ASP B 56  ? 0.4425 0.9036 0.8384 -0.1468 -0.0455 0.0735  28  ASP B O     
1621 C CB    . ASP B 56  ? 0.5804 0.9694 0.9173 -0.1362 -0.0427 0.0645  28  ASP B CB    
1622 C CG    . ASP B 56  ? 0.7715 1.1374 1.0937 -0.1326 -0.0314 0.0738  28  ASP B CG    
1623 O OD1   . ASP B 56  ? 0.8765 1.2425 1.1780 -0.1204 -0.0244 0.0786  28  ASP B OD1   
1624 O OD2   . ASP B 56  ? 0.8163 1.1637 1.1487 -0.1419 -0.0302 0.0763  28  ASP B OD2   
1625 N N     . ILE B 57  ? 0.5012 0.9530 0.8550 -0.1291 -0.0596 0.0546  29  ILE B N     
1626 C CA    . ILE B 57  ? 0.4698 0.9454 0.8443 -0.1352 -0.0733 0.0464  29  ILE B CA    
1627 C C     . ILE B 57  ? 0.5246 0.9845 0.8845 -0.1358 -0.0885 0.0285  29  ILE B C     
1628 O O     . ILE B 57  ? 0.6990 1.1590 1.0338 -0.1230 -0.0933 0.0221  29  ILE B O     
1629 C CB    . ILE B 57  ? 0.4706 0.9757 0.8442 -0.1232 -0.0734 0.0502  29  ILE B CB    
1630 C CG1   . ILE B 57  ? 0.4826 1.0012 0.8662 -0.1196 -0.0571 0.0666  29  ILE B CG1   
1631 C CG2   . ILE B 57  ? 0.2793 0.8123 0.6765 -0.1294 -0.0888 0.0422  29  ILE B CG2   
1632 C CD1   . ILE B 57  ? 0.4659 1.0099 0.8479 -0.1061 -0.0555 0.0708  29  ILE B CD1   
1633 N N     . GLY B 58  ? 0.4955 0.9411 0.8709 -0.1503 -0.0954 0.0206  30  GLY B N     
1634 C CA    . GLY B 58  ? 0.5848 1.0104 0.9442 -0.1505 -0.1086 0.0022  30  GLY B CA    
1635 C C     . GLY B 58  ? 0.7121 1.1031 1.0452 -0.1442 -0.0999 0.0030  30  GLY B C     
1636 O O     . GLY B 58  ? 0.7707 1.1501 1.1070 -0.1461 -0.0863 0.0164  30  GLY B O     
1637 N N     . SER B 59  ? 0.7416 1.1176 1.0481 -0.1357 -0.1076 -0.0108 31  SER B N     
1638 C CA    . SER B 59  ? 0.7249 1.0700 1.0074 -0.1286 -0.0999 -0.0108 31  SER B CA    
1639 C C     . SER B 59  ? 0.7051 1.0533 0.9572 -0.1106 -0.0944 -0.0075 31  SER B C     
1640 O O     . SER B 59  ? 0.6270 0.9540 0.8592 -0.1029 -0.0877 -0.0066 31  SER B O     
1641 C CB    . SER B 59  ? 0.7001 1.0211 0.9772 -0.1328 -0.1109 -0.0292 31  SER B CB    
1642 O OG    . SER B 59  ? 0.7951 1.1281 1.0590 -0.1268 -0.1252 -0.0452 31  SER B OG    
1643 N N     . SER B 60  ? 0.6855 1.0604 0.9362 -0.1039 -0.0968 -0.0048 32  SER B N     
1644 C CA    . SER B 60  ? 0.3192 0.6976 0.5440 -0.0874 -0.0922 -0.0013 32  SER B CA    
1645 C C     . SER B 60  ? 0.5087 0.9015 0.7381 -0.0823 -0.0808 0.0147  32  SER B C     
1646 O O     . SER B 60  ? 0.6434 1.0363 0.8551 -0.0698 -0.0749 0.0197  32  SER B O     
1647 C CB    . SER B 60  ? 0.5790 0.9730 0.7916 -0.0798 -0.1049 -0.0122 32  SER B CB    
1648 O OG    . SER B 60  ? 0.5391 0.9176 0.7422 -0.0821 -0.1154 -0.0291 32  SER B OG    
1649 N N     . PHE B 61  ? 0.3333 0.7381 0.5873 -0.0917 -0.0773 0.0224  33  PHE B N     
1650 C CA    . PHE B 61  ? 0.3160 0.7323 0.5737 -0.0864 -0.0656 0.0363  33  PHE B CA    
1651 C C     . PHE B 61  ? 0.4042 0.8098 0.6723 -0.0939 -0.0550 0.0457  33  PHE B C     
1652 O O     . PHE B 61  ? 0.4922 0.8958 0.7796 -0.1066 -0.0568 0.0454  33  PHE B O     
1653 C CB    . PHE B 61  ? 0.3310 0.7788 0.6065 -0.0859 -0.0692 0.0396  33  PHE B CB    
1654 C CG    . PHE B 61  ? 0.3351 0.7938 0.6132 -0.0787 -0.0570 0.0524  33  PHE B CG    
1655 C CD1   . PHE B 61  ? 0.2893 0.7490 0.5500 -0.0644 -0.0533 0.0554  33  PHE B CD1   
1656 C CD2   . PHE B 61  ? 0.3560 0.8231 0.6539 -0.0856 -0.0487 0.0614  33  PHE B CD2   
1657 C CE1   . PHE B 61  ? 0.2765 0.7434 0.5392 -0.0574 -0.0427 0.0650  33  PHE B CE1   
1658 C CE2   . PHE B 61  ? 0.3138 0.7901 0.6113 -0.0774 -0.0375 0.0714  33  PHE B CE2   
1659 C CZ    . PHE B 61  ? 0.3280 0.8032 0.6078 -0.0634 -0.0351 0.0721  33  PHE B CZ    
1660 N N     . SER B 62  ? 0.3924 0.7914 0.6479 -0.0858 -0.0440 0.0541  34  SER B N     
1661 C CA    . SER B 62  ? 0.4288 0.8195 0.6891 -0.0898 -0.0335 0.0638  34  SER B CA    
1662 C C     . SER B 62  ? 0.4989 0.8904 0.7457 -0.0788 -0.0238 0.0711  34  SER B C     
1663 O O     . SER B 62  ? 0.5765 0.9605 0.8059 -0.0695 -0.0243 0.0679  34  SER B O     
1664 C CB    . SER B 62  ? 0.4632 0.8269 0.7165 -0.0945 -0.0340 0.0609  34  SER B CB    
1665 O OG    . SER B 62  ? 0.5046 0.8611 0.7618 -0.0975 -0.0241 0.0718  34  SER B OG    
1666 N N     . ILE B 63  ? 0.4554 0.8566 0.7112 -0.0797 -0.0149 0.0807  35  ILE B N     
1667 C CA    . ILE B 63  ? 0.4593 0.8588 0.7014 -0.0697 -0.0061 0.0859  35  ILE B CA    
1668 C C     . ILE B 63  ? 0.4340 0.8144 0.6659 -0.0709 -0.0010 0.0899  35  ILE B C     
1669 O O     . ILE B 63  ? 0.5023 0.8840 0.7433 -0.0769 0.0045  0.0978  35  ILE B O     
1670 C CB    . ILE B 63  ? 0.5080 0.9296 0.7616 -0.0670 0.0015  0.0933  35  ILE B CB    
1671 C CG1   . ILE B 63  ? 0.5293 0.9714 0.7937 -0.0639 -0.0037 0.0902  35  ILE B CG1   
1672 C CG2   . ILE B 63  ? 0.4249 0.8419 0.6622 -0.0564 0.0098  0.0962  35  ILE B CG2   
1673 C CD1   . ILE B 63  ? 0.4324 0.8976 0.7092 -0.0593 0.0041  0.0973  35  ILE B CD1   
1674 N N     . SER B 64  ? 0.4357 0.7998 0.6500 -0.0648 -0.0027 0.0857  36  SER B N     
1675 C CA    . SER B 64  ? 0.2414 0.5882 0.4457 -0.0646 0.0003  0.0890  36  SER B CA    
1676 C C     . SER B 64  ? 0.4825 0.8335 0.6782 -0.0580 0.0082  0.0953  36  SER B C     
1677 O O     . SER B 64  ? 0.5797 0.9293 0.7639 -0.0497 0.0083  0.0918  36  SER B O     
1678 C CB    . SER B 64  ? 0.4001 0.7308 0.5913 -0.0602 -0.0046 0.0821  36  SER B CB    
1679 O OG    . SER B 64  ? 0.4300 0.7454 0.6134 -0.0595 -0.0025 0.0854  36  SER B OG    
1680 N N     . LEU B 65  ? 0.4044 0.7605 0.6061 -0.0616 0.0148  0.1046  37  LEU B N     
1681 C CA    . LEU B 65  ? 0.4431 0.8044 0.6339 -0.0542 0.0226  0.1107  37  LEU B CA    
1682 C C     . LEU B 65  ? 0.4767 0.8219 0.6498 -0.0491 0.0213  0.1104  37  LEU B C     
1683 O O     . LEU B 65  ? 0.5452 0.8931 0.7047 -0.0411 0.0247  0.1116  37  LEU B O     
1684 C CB    . LEU B 65  ? 0.2632 0.6358 0.4650 -0.0588 0.0314  0.1228  37  LEU B CB    
1685 C CG    . LEU B 65  ? 0.5867 0.9804 0.8095 -0.0634 0.0338  0.1247  37  LEU B CG    
1686 C CD1   . LEU B 65  ? 0.2708 0.6761 0.5068 -0.0684 0.0442  0.1389  37  LEU B CD1   
1687 C CD2   . LEU B 65  ? 0.2507 0.6578 0.4680 -0.0533 0.0349  0.1193  37  LEU B CD2   
1688 N N     . GLY B 66  ? 0.4684 0.7978 0.6418 -0.0530 0.0158  0.1079  38  GLY B N     
1689 C CA    . GLY B 66  ? 0.5019 0.8175 0.6618 -0.0482 0.0139  0.1082  38  GLY B CA    
1690 C C     . GLY B 66  ? 0.4313 0.7458 0.5806 -0.0405 0.0096  0.0996  38  GLY B C     
1691 O O     . GLY B 66  ? 0.4429 0.7499 0.5824 -0.0357 0.0074  0.0994  38  GLY B O     
1692 N N     . MET B 67  ? 0.3979 0.7204 0.5511 -0.0392 0.0083  0.0933  39  MET B N     
1693 C CA    . MET B 67  ? 0.4642 0.7852 0.6112 -0.0327 0.0051  0.0861  39  MET B CA    
1694 C C     . MET B 67  ? 0.5259 0.8526 0.6631 -0.0259 0.0077  0.0855  39  MET B C     
1695 O O     . MET B 67  ? 0.4544 0.7773 0.5862 -0.0211 0.0043  0.0794  39  MET B O     
1696 C CB    . MET B 67  ? 0.3690 0.6951 0.5235 -0.0327 0.0035  0.0810  39  MET B CB    
1697 C CG    . MET B 67  ? 0.3551 0.6748 0.5142 -0.0366 -0.0008 0.0786  39  MET B CG    
1698 S SD    . MET B 67  ? 0.3851 0.6908 0.5381 -0.0334 -0.0042 0.0756  39  MET B SD    
1699 C CE    . MET B 67  ? 0.8064 1.1158 0.9594 -0.0271 -0.0041 0.0718  39  MET B CE    
1700 N N     . ILE B 68  ? 0.5017 0.8376 0.6372 -0.0254 0.0139  0.0917  40  ILE B N     
1701 C CA    . ILE B 68  ? 0.4926 0.8347 0.6154 -0.0174 0.0170  0.0907  40  ILE B CA    
1702 C C     . ILE B 68  ? 0.4815 0.8162 0.5899 -0.0131 0.0133  0.0905  40  ILE B C     
1703 O O     . ILE B 68  ? 0.4489 0.7827 0.5484 -0.0069 0.0094  0.0823  40  ILE B O     
1704 C CB    . ILE B 68  ? 0.5063 0.8625 0.6301 -0.0165 0.0264  0.0989  40  ILE B CB    
1705 C CG1   . ILE B 68  ? 0.5381 0.9047 0.6785 -0.0201 0.0288  0.0985  40  ILE B CG1   
1706 C CG2   . ILE B 68  ? 0.3728 0.7354 0.4798 -0.0059 0.0299  0.0963  40  ILE B CG2   
1707 C CD1   . ILE B 68  ? 0.4664 0.8501 0.6128 -0.0196 0.0385  0.1073  40  ILE B CD1   
1708 N N     . PRO B 69  ? 0.5239 0.8532 0.6311 -0.0162 0.0138  0.0993  41  PRO B N     
1709 C CA    . PRO B 69  ? 0.5634 0.8871 0.6580 -0.0110 0.0089  0.0992  41  PRO B CA    
1710 C C     . PRO B 69  ? 0.5467 0.8621 0.6462 -0.0115 0.0003  0.0902  41  PRO B C     
1711 O O     . PRO B 69  ? 0.5863 0.9013 0.6779 -0.0063 -0.0056 0.0854  41  PRO B O     
1712 C CB    . PRO B 69  ? 0.5650 0.8828 0.6610 -0.0144 0.0122  0.1119  41  PRO B CB    
1713 C CG    . PRO B 69  ? 0.5702 0.8941 0.6766 -0.0205 0.0205  0.1193  41  PRO B CG    
1714 C CD    . PRO B 69  ? 0.5188 0.8471 0.6362 -0.0237 0.0188  0.1098  41  PRO B CD    
1715 N N     . MET B 70  ? 0.4880 0.7983 0.6009 -0.0174 -0.0004 0.0881  42  MET B N     
1716 C CA    . MET B 70  ? 0.5480 0.8521 0.6670 -0.0176 -0.0064 0.0815  42  MET B CA    
1717 C C     . MET B 70  ? 0.5870 0.8946 0.7063 -0.0141 -0.0093 0.0723  42  MET B C     
1718 O O     . MET B 70  ? 0.5762 0.8809 0.6987 -0.0126 -0.0147 0.0674  42  MET B O     
1719 C CB    . MET B 70  ? 0.5275 0.8269 0.6577 -0.0231 -0.0055 0.0814  42  MET B CB    
1720 C CG    . MET B 70  ? 0.5699 0.8611 0.7020 -0.0269 -0.0045 0.0877  42  MET B CG    
1721 S SD    . MET B 70  ? 0.4371 0.7190 0.5659 -0.0228 -0.0086 0.0898  42  MET B SD    
1722 C CE    . MET B 70  ? 1.2046 1.4881 1.3226 -0.0200 -0.0060 0.0999  42  MET B CE    
1723 N N     . TYR B 71  ? 0.5925 0.9063 0.7106 -0.0127 -0.0054 0.0701  43  TYR B N     
1724 C CA    . TYR B 71  ? 0.5619 0.8764 0.6809 -0.0089 -0.0075 0.0610  43  TYR B CA    
1725 C C     . TYR B 71  ? 0.5424 0.8584 0.6487 -0.0031 -0.0117 0.0554  43  TYR B C     
1726 O O     . TYR B 71  ? 0.4775 0.7902 0.5868 -0.0013 -0.0175 0.0462  43  TYR B O     
1727 C CB    . TYR B 71  ? 0.5059 0.8265 0.6278 -0.0077 -0.0017 0.0606  43  TYR B CB    
1728 C CG    . TYR B 71  ? 0.4627 0.7827 0.5976 -0.0117 -0.0003 0.0626  43  TYR B CG    
1729 C CD1   . TYR B 71  ? 0.2301 0.5429 0.3725 -0.0140 -0.0039 0.0614  43  TYR B CD1   
1730 C CD2   . TYR B 71  ? 0.3572 0.6858 0.4969 -0.0123 0.0046  0.0660  43  TYR B CD2   
1731 C CE1   . TYR B 71  ? 0.5216 0.8349 0.6723 -0.0160 -0.0026 0.0635  43  TYR B CE1   
1732 C CE2   . TYR B 71  ? 0.3570 0.6868 0.5067 -0.0149 0.0044  0.0674  43  TYR B CE2   
1733 C CZ    . TYR B 71  ? 0.4898 0.8116 0.6433 -0.0162 0.0008  0.0661  43  TYR B CZ    
1734 O OH    . TYR B 71  ? 0.4399 0.7639 0.5998 -0.0171 0.0007  0.0678  43  TYR B OH    
1735 N N     . VAL B 72  ? 0.5172 0.8386 0.6099 0.0001  -0.0091 0.0611  44  VAL B N     
1736 C CA    . VAL B 72  ? 0.4286 0.7533 0.5049 0.0073  -0.0135 0.0562  44  VAL B CA    
1737 C C     . VAL B 72  ? 0.4268 0.7475 0.5053 0.0069  -0.0234 0.0531  44  VAL B C     
1738 O O     . VAL B 72  ? 0.5076 0.8281 0.5852 0.0097  -0.0313 0.0419  44  VAL B O     
1739 C CB    . VAL B 72  ? 0.4090 0.7412 0.4693 0.0116  -0.0072 0.0665  44  VAL B CB    
1740 C CG1   . VAL B 72  ? 0.3897 0.7263 0.4296 0.0208  -0.0131 0.0616  44  VAL B CG1   
1741 C CG2   . VAL B 72  ? 0.3747 0.7143 0.4346 0.0128  0.0031  0.0698  44  VAL B CG2   
1742 N N     . ILE B 73  ? 0.3701 0.6879 0.4535 0.0036  -0.0231 0.0625  45  ILE B N     
1743 C CA    . ILE B 73  ? 0.3178 0.6338 0.4054 0.0040  -0.0315 0.0616  45  ILE B CA    
1744 C C     . ILE B 73  ? 0.3138 0.6265 0.4195 0.0001  -0.0364 0.0529  45  ILE B C     
1745 O O     . ILE B 73  ? 0.2823 0.5973 0.3928 0.0013  -0.0452 0.0470  45  ILE B O     
1746 C CB    . ILE B 73  ? 0.3564 0.6679 0.4464 0.0022  -0.0286 0.0739  45  ILE B CB    
1747 C CG1   . ILE B 73  ? 0.4036 0.7157 0.4974 0.0049  -0.0370 0.0738  45  ILE B CG1   
1748 C CG2   . ILE B 73  ? 0.3158 0.6204 0.4197 -0.0049 -0.0227 0.0766  45  ILE B CG2   
1749 C CD1   . ILE B 73  ? 0.4751 0.7955 0.5529 0.0129  -0.0439 0.0730  45  ILE B CD1   
1750 N N     . ALA B 74  ? 0.3932 0.7017 0.5099 -0.0045 -0.0308 0.0528  46  ALA B N     
1751 C CA    . ALA B 74  ? 0.3775 0.6826 0.5116 -0.0078 -0.0331 0.0473  46  ALA B CA    
1752 C C     . ALA B 74  ? 0.2650 0.5706 0.4007 -0.0060 -0.0390 0.0355  46  ALA B C     
1753 O O     . ALA B 74  ? 0.3285 0.6335 0.4782 -0.0080 -0.0453 0.0303  46  ALA B O     
1754 C CB    . ALA B 74  ? 0.2893 0.5911 0.4308 -0.0111 -0.0255 0.0506  46  ALA B CB    
1755 N N     . ILE B 75  ? 0.4580 0.7647 0.5808 -0.0021 -0.0369 0.0310  47  ILE B N     
1756 C CA    . ILE B 75  ? 0.4390 0.7441 0.5603 0.0009  -0.0426 0.0176  47  ILE B CA    
1757 C C     . ILE B 75  ? 0.3938 0.7043 0.5051 0.0046  -0.0533 0.0112  47  ILE B C     
1758 O O     . ILE B 75  ? 0.4066 0.7156 0.5267 0.0036  -0.0628 -0.0002 47  ILE B O     
1759 C CB    . ILE B 75  ? 0.4937 0.7995 0.6016 0.0062  -0.0362 0.0146  47  ILE B CB    
1760 C CG1   . ILE B 75  ? 0.4998 0.8019 0.6199 0.0034  -0.0276 0.0196  47  ILE B CG1   
1761 C CG2   . ILE B 75  ? 0.5083 0.8111 0.6100 0.0112  -0.0430 -0.0012 47  ILE B CG2   
1762 C CD1   . ILE B 75  ? 0.2904 0.5957 0.4004 0.0091  -0.0202 0.0186  47  ILE B CD1   
1763 N N     . ARG B 76  ? 0.3920 0.7090 0.4860 0.0087  -0.0520 0.0192  48  ARG B N     
1764 C CA    . ARG B 76  ? 0.5532 0.8777 0.6329 0.0146  -0.0618 0.0152  48  ARG B CA    
1765 C C     . ARG B 76  ? 0.5833 0.9104 0.6789 0.0114  -0.0720 0.0143  48  ARG B C     
1766 O O     . ARG B 76  ? 0.5072 0.8396 0.6017 0.0139  -0.0842 0.0035  48  ARG B O     
1767 C CB    . ARG B 76  ? 0.5095 0.8398 0.5678 0.0204  -0.0557 0.0279  48  ARG B CB    
1768 C CG    . ARG B 76  ? 0.5058 0.8451 0.5459 0.0285  -0.0649 0.0268  48  ARG B CG    
1769 C CD    . ARG B 76  ? 0.4162 0.7600 0.4369 0.0343  -0.0566 0.0426  48  ARG B CD    
1770 N NE    . ARG B 76  ? 0.4659 0.8189 0.4689 0.0432  -0.0656 0.0441  48  ARG B NE    
1771 C CZ    . ARG B 76  ? 0.4609 0.8225 0.4386 0.0534  -0.0697 0.0372  48  ARG B CZ    
1772 N NH1   . ARG B 76  ? 0.4888 0.8497 0.4566 0.0560  -0.0648 0.0280  48  ARG B NH1   
1773 N NH2   . ARG B 76  ? 0.4771 0.8484 0.4382 0.0623  -0.0788 0.0395  48  ARG B NH2   
1774 N N     . ARG B 77  ? 0.5751 0.8996 0.6861 0.0063  -0.0673 0.0248  49  ARG B N     
1775 C CA    . ARG B 77  ? 0.5692 0.8986 0.6951 0.0049  -0.0749 0.0267  49  ARG B CA    
1776 C C     . ARG B 77  ? 0.4933 0.8190 0.6474 -0.0025 -0.0733 0.0264  49  ARG B C     
1777 O O     . ARG B 77  ? 0.3637 0.6956 0.5351 -0.0041 -0.0806 0.0249  49  ARG B O     
1778 C CB    . ARG B 77  ? 0.4945 0.8260 0.6112 0.0088  -0.0717 0.0407  49  ARG B CB    
1779 C CG    . ARG B 77  ? 0.4219 0.7596 0.5125 0.0173  -0.0745 0.0433  49  ARG B CG    
1780 C CD    . ARG B 77  ? 0.5456 0.8941 0.6324 0.0221  -0.0896 0.0322  49  ARG B CD    
1781 N NE    . ARG B 77  ? 0.6741 1.0304 0.7334 0.0324  -0.0924 0.0367  49  ARG B NE    
1782 C CZ    . ARG B 77  ? 0.6945 1.0624 0.7435 0.0392  -0.1063 0.0284  49  ARG B CZ    
1783 N NH1   . ARG B 77  ? 0.6671 1.0399 0.7343 0.0353  -0.1192 0.0141  49  ARG B NH1   
1784 N NH2   . ARG B 77  ? 0.7415 1.1168 0.7625 0.0500  -0.1073 0.0347  49  ARG B NH2   
1785 N N     . GLY B 78  ? 0.4710 0.7885 0.6304 -0.0064 -0.0634 0.0290  50  GLY B N     
1786 C CA    . GLY B 78  ? 0.5325 0.8467 0.7163 -0.0121 -0.0607 0.0294  50  GLY B CA    
1787 C C     . GLY B 78  ? 0.4812 0.7926 0.6709 -0.0136 -0.0512 0.0407  50  GLY B C     
1788 O O     . GLY B 78  ? 0.4983 0.8073 0.6738 -0.0115 -0.0459 0.0475  50  GLY B O     
1789 N N     . PHE B 79  ? 0.4906 0.8022 0.7019 -0.0171 -0.0491 0.0424  51  PHE B N     
1790 C CA    . PHE B 79  ? 0.2283 0.5374 0.4448 -0.0174 -0.0399 0.0516  51  PHE B CA    
1791 C C     . PHE B 79  ? 0.4202 0.7310 0.6298 -0.0137 -0.0389 0.0583  51  PHE B C     
1792 O O     . PHE B 79  ? 0.4196 0.7248 0.6167 -0.0125 -0.0330 0.0629  51  PHE B O     
1793 C CB    . PHE B 79  ? 0.2992 0.6107 0.5410 -0.0205 -0.0377 0.0531  51  PHE B CB    
1794 C CG    . PHE B 79  ? 0.3346 0.6445 0.5795 -0.0192 -0.0274 0.0621  51  PHE B CG    
1795 C CD1   . PHE B 79  ? 0.3599 0.6640 0.6016 -0.0197 -0.0202 0.0643  51  PHE B CD1   
1796 C CD2   . PHE B 79  ? 0.3301 0.6449 0.5803 -0.0162 -0.0250 0.0681  51  PHE B CD2   
1797 C CE1   . PHE B 79  ? 0.4176 0.7215 0.6591 -0.0171 -0.0116 0.0719  51  PHE B CE1   
1798 C CE2   . PHE B 79  ? 0.2102 0.5236 0.4603 -0.0135 -0.0155 0.0749  51  PHE B CE2   
1799 C CZ    . PHE B 79  ? 0.5071 0.8154 0.7518 -0.0140 -0.0091 0.0765  51  PHE B CZ    
1800 N N     . TRP B 80  ? 0.5103 0.8289 0.7295 -0.0119 -0.0451 0.0587  52  TRP B N     
1801 C CA    . TRP B 80  ? 0.5056 0.8250 0.7214 -0.0072 -0.0436 0.0658  52  TRP B CA    
1802 C C     . TRP B 80  ? 0.5279 0.8417 0.7211 -0.0040 -0.0441 0.0684  52  TRP B C     
1803 O O     . TRP B 80  ? 0.6291 0.9363 0.8160 -0.0015 -0.0391 0.0745  52  TRP B O     
1804 C CB    . TRP B 80  ? 0.4579 0.7895 0.6912 -0.0049 -0.0507 0.0663  52  TRP B CB    
1805 C CG    . TRP B 80  ? 0.4631 0.8022 0.6900 -0.0026 -0.0626 0.0618  52  TRP B CG    
1806 C CD1   . TRP B 80  ? 0.4692 0.8161 0.7049 -0.0056 -0.0726 0.0525  52  TRP B CD1   
1807 C CD2   . TRP B 80  ? 0.4640 0.8035 0.6738 0.0040  -0.0661 0.0663  52  TRP B CD2   
1808 N NE1   . TRP B 80  ? 0.3389 0.6926 0.5615 -0.0006 -0.0828 0.0500  52  TRP B NE1   
1809 C CE2   . TRP B 80  ? 0.3603 0.7100 0.5667 0.0057  -0.0785 0.0597  52  TRP B CE2   
1810 C CE3   . TRP B 80  ? 0.5054 0.8367 0.7025 0.0089  -0.0602 0.0753  52  TRP B CE3   
1811 C CZ2   . TRP B 80  ? 0.3318 0.6855 0.5209 0.0132  -0.0843 0.0636  52  TRP B CZ2   
1812 C CZ3   . TRP B 80  ? 0.2722 0.6055 0.4549 0.0154  -0.0653 0.0798  52  TRP B CZ3   
1813 C CH2   . TRP B 80  ? 0.3728 0.7180 0.5506 0.0180  -0.0769 0.0749  52  TRP B CH2   
1814 N N     . ALA B 81  ? 0.4784 0.7943 0.6599 -0.0039 -0.0495 0.0639  53  ALA B N     
1815 C CA    . ALA B 81  ? 0.4446 0.7568 0.6052 -0.0006 -0.0487 0.0683  53  ALA B CA    
1816 C C     . ALA B 81  ? 0.4424 0.7451 0.5947 -0.0038 -0.0394 0.0714  53  ALA B C     
1817 O O     . ALA B 81  ? 0.4111 0.7078 0.5541 -0.0026 -0.0356 0.0783  53  ALA B O     
1818 C CB    . ALA B 81  ? 0.4084 0.7271 0.5569 0.0018  -0.0560 0.0624  53  ALA B CB    
1819 N N     . ALA B 82  ? 0.4784 0.7800 0.6358 -0.0079 -0.0362 0.0665  54  ALA B N     
1820 C CA    . ALA B 82  ? 0.4086 0.7044 0.5608 -0.0108 -0.0288 0.0687  54  ALA B CA    
1821 C C     . ALA B 82  ? 0.4393 0.7285 0.5951 -0.0114 -0.0243 0.0734  54  ALA B C     
1822 O O     . ALA B 82  ? 0.4895 0.7729 0.6385 -0.0131 -0.0204 0.0767  54  ALA B O     
1823 C CB    . ALA B 82  ? 0.2666 0.5635 0.4249 -0.0134 -0.0269 0.0632  54  ALA B CB    
1824 N N     . GLY B 83  ? 0.3938 0.6843 0.5612 -0.0098 -0.0247 0.0734  55  GLY B N     
1825 C CA    . GLY B 83  ? 0.3918 0.6761 0.5611 -0.0082 -0.0204 0.0764  55  GLY B CA    
1826 C C     . GLY B 83  ? 0.4644 0.7422 0.6276 -0.0050 -0.0212 0.0811  55  GLY B C     
1827 O O     . GLY B 83  ? 0.4976 0.7656 0.6561 -0.0053 -0.0176 0.0825  55  GLY B O     
1828 N N     . PHE B 84  ? 0.3103 0.5932 0.4738 -0.0016 -0.0264 0.0832  56  PHE B N     
1829 C CA    . PHE B 84  ? 0.2992 0.5760 0.4569 0.0029  -0.0272 0.0897  56  PHE B CA    
1830 C C     . PHE B 84  ? 0.3902 0.6591 0.5350 0.0000  -0.0244 0.0936  56  PHE B C     
1831 O O     . PHE B 84  ? 0.3788 0.6355 0.5210 0.0003  -0.0211 0.0982  56  PHE B O     
1832 C CB    . PHE B 84  ? 0.2654 0.5526 0.4254 0.0083  -0.0346 0.0916  56  PHE B CB    
1833 C CG    . PHE B 84  ? 0.4102 0.6918 0.5636 0.0146  -0.0354 0.1002  56  PHE B CG    
1834 C CD1   . PHE B 84  ? 0.3773 0.6497 0.5362 0.0190  -0.0319 0.1041  56  PHE B CD1   
1835 C CD2   . PHE B 84  ? 0.5520 0.8371 0.6927 0.0174  -0.0391 0.1049  56  PHE B CD2   
1836 C CE1   . PHE B 84  ? 0.5546 0.8197 0.7085 0.0256  -0.0322 0.1129  56  PHE B CE1   
1837 C CE2   . PHE B 84  ? 0.6150 0.8944 0.7495 0.0241  -0.0391 0.1151  56  PHE B CE2   
1838 C CZ    . PHE B 84  ? 0.6332 0.9019 0.7754 0.0280  -0.0357 0.1193  56  PHE B CZ    
1839 N N     . ALA B 85  ? 0.4296 0.7050 0.5677 -0.0028 -0.0255 0.0918  57  ALA B N     
1840 C CA    . ALA B 85  ? 0.4322 0.7037 0.5603 -0.0055 -0.0215 0.0966  57  ALA B CA    
1841 C C     . ALA B 85  ? 0.3826 0.6462 0.5145 -0.0119 -0.0162 0.0952  57  ALA B C     
1842 O O     . ALA B 85  ? 0.3665 0.6217 0.4966 -0.0148 -0.0127 0.1007  57  ALA B O     
1843 C CB    . ALA B 85  ? 0.2743 0.5565 0.3944 -0.0054 -0.0230 0.0939  57  ALA B CB    
1844 N N     . GLY B 86  ? 0.3332 0.6001 0.4714 -0.0142 -0.0161 0.0880  58  GLY B N     
1845 C CA    . GLY B 86  ? 0.3561 0.6180 0.4970 -0.0190 -0.0129 0.0853  58  GLY B CA    
1846 C C     . GLY B 86  ? 0.3841 0.6329 0.5266 -0.0185 -0.0119 0.0862  58  GLY B C     
1847 O O     . GLY B 86  ? 0.4407 0.6817 0.5834 -0.0233 -0.0102 0.0864  58  GLY B O     
1848 N N     . LEU B 87  ? 0.3550 0.6014 0.5001 -0.0125 -0.0130 0.0861  59  LEU B N     
1849 C CA    . LEU B 87  ? 0.3765 0.6091 0.5224 -0.0097 -0.0117 0.0859  59  LEU B CA    
1850 C C     . LEU B 87  ? 0.4719 0.6924 0.6154 -0.0104 -0.0110 0.0930  59  LEU B C     
1851 O O     . LEU B 87  ? 0.3978 0.6033 0.5421 -0.0123 -0.0095 0.0918  59  LEU B O     
1852 C CB    . LEU B 87  ? 0.3690 0.6047 0.5200 -0.0017 -0.0121 0.0856  59  LEU B CB    
1853 C CG    . LEU B 87  ? 0.2875 0.5095 0.4390 0.0040  -0.0099 0.0849  59  LEU B CG    
1854 C CD1   . LEU B 87  ? 0.3025 0.5142 0.4496 0.0008  -0.0080 0.0774  59  LEU B CD1   
1855 C CD2   . LEU B 87  ? 0.6245 0.8549 0.7833 0.0121  -0.0090 0.0848  59  LEU B CD2   
1856 N N     . LEU B 88  ? 0.6073 0.8338 0.7475 -0.0084 -0.0122 0.1005  60  LEU B N     
1857 C CA    . LEU B 88  ? 0.6158 0.8323 0.7529 -0.0085 -0.0103 0.1103  60  LEU B CA    
1858 C C     . LEU B 88  ? 0.6842 0.8957 0.8229 -0.0180 -0.0068 0.1110  60  LEU B C     
1859 O O     . LEU B 88  ? 0.6493 0.8453 0.7917 -0.0210 -0.0043 0.1154  60  LEU B O     
1860 C CB    . LEU B 88  ? 0.4801 0.7077 0.6101 -0.0035 -0.0123 0.1181  60  LEU B CB    
1861 C CG    . LEU B 88  ? 0.4704 0.7027 0.6009 0.0062  -0.0170 0.1201  60  LEU B CG    
1862 C CD1   . LEU B 88  ? 0.4182 0.6626 0.5389 0.0112  -0.0205 0.1267  60  LEU B CD1   
1863 C CD2   . LEU B 88  ? 0.3925 0.6082 0.5270 0.0113  -0.0151 0.1253  60  LEU B CD2   
1864 N N     . TRP B 89  ? 0.6838 0.9086 0.8218 -0.0226 -0.0068 0.1069  61  TRP B N     
1865 C CA    . TRP B 89  ? 0.5827 0.8079 0.7252 -0.0316 -0.0040 0.1070  61  TRP B CA    
1866 C C     . TRP B 89  ? 0.5538 0.7669 0.7033 -0.0364 -0.0052 0.0992  61  TRP B C     
1867 O O     . TRP B 89  ? 0.6205 0.8250 0.7772 -0.0437 -0.0038 0.1010  61  TRP B O     
1868 C CB    . TRP B 89  ? 0.4729 0.7157 0.6138 -0.0332 -0.0041 0.1028  61  TRP B CB    
1869 C CG    . TRP B 89  ? 0.4496 0.6973 0.5973 -0.0415 -0.0014 0.1031  61  TRP B CG    
1870 C CD1   . TRP B 89  ? 0.4161 0.6576 0.5712 -0.0482 0.0020  0.1100  61  TRP B CD1   
1871 C CD2   . TRP B 89  ? 0.4771 0.7380 0.6275 -0.0439 -0.0019 0.0970  61  TRP B CD2   
1872 N NE1   . TRP B 89  ? 0.3984 0.6506 0.5619 -0.0551 0.0032  0.1081  61  TRP B NE1   
1873 C CE2   . TRP B 89  ? 0.4257 0.6901 0.5855 -0.0519 0.0008  0.1001  61  TRP B CE2   
1874 C CE3   . TRP B 89  ? 0.2594 0.5295 0.4070 -0.0400 -0.0040 0.0900  61  TRP B CE3   
1875 C CZ2   . TRP B 89  ? 0.3559 0.6345 0.5217 -0.0550 0.0007  0.0963  61  TRP B CZ2   
1876 C CZ3   . TRP B 89  ? 0.3334 0.6149 0.4856 -0.0427 -0.0035 0.0868  61  TRP B CZ3   
1877 C CH2   . TRP B 89  ? 0.3149 0.6014 0.4755 -0.0496 -0.0014 0.0897  61  TRP B CH2   
1878 N N     . GLY B 90  ? 0.4384 0.6515 0.5862 -0.0321 -0.0079 0.0903  62  GLY B N     
1879 C CA    . GLY B 90  ? 0.4566 0.6595 0.6068 -0.0342 -0.0097 0.0810  62  GLY B CA    
1880 C C     . GLY B 90  ? 0.6179 0.7991 0.7704 -0.0334 -0.0093 0.0822  62  GLY B C     
1881 O O     . GLY B 90  ? 0.6669 0.8362 0.8243 -0.0395 -0.0108 0.0766  62  GLY B O     
1882 N N     . LEU B 91  ? 0.6217 0.7975 0.7718 -0.0255 -0.0078 0.0889  63  LEU B N     
1883 C CA    . LEU B 91  ? 0.5855 0.7392 0.7381 -0.0226 -0.0067 0.0914  63  LEU B CA    
1884 C C     . LEU B 91  ? 0.6482 0.7909 0.8076 -0.0306 -0.0044 0.1006  63  LEU B C     
1885 O O     . LEU B 91  ? 0.7676 0.8887 0.9331 -0.0332 -0.0040 0.0993  63  LEU B O     
1886 C CB    . LEU B 91  ? 0.5272 0.6813 0.6768 -0.0109 -0.0060 0.0980  63  LEU B CB    
1887 C CG    . LEU B 91  ? 0.5002 0.6623 0.6476 -0.0023 -0.0069 0.0905  63  LEU B CG    
1888 C CD1   . LEU B 91  ? 0.4567 0.6223 0.6052 0.0084  -0.0069 0.0985  63  LEU B CD1   
1889 C CD2   . LEU B 91  ? 0.5238 0.6710 0.6702 -0.0004 -0.0065 0.0791  63  LEU B CD2   
1890 N N     . LEU B 92  ? 0.5961 0.7532 0.7550 -0.0342 -0.0022 0.1100  64  LEU B N     
1891 C CA    . LEU B 92  ? 0.5697 0.7203 0.7359 -0.0414 0.0021  0.1217  64  LEU B CA    
1892 C C     . LEU B 92  ? 0.6273 0.7705 0.8066 -0.0541 0.0012  0.1149  64  LEU B C     
1893 O O     . LEU B 92  ? 0.6716 0.8029 0.8622 -0.0614 0.0046  0.1234  64  LEU B O     
1894 C CB    . LEU B 92  ? 0.5445 0.7156 0.7052 -0.0410 0.0054  0.1320  64  LEU B CB    
1895 C CG    . LEU B 92  ? 0.5007 0.6770 0.6498 -0.0299 0.0064  0.1427  64  LEU B CG    
1896 C CD1   . LEU B 92  ? 0.3608 0.5574 0.5022 -0.0295 0.0092  0.1497  64  LEU B CD1   
1897 C CD2   . LEU B 92  ? 0.3920 0.5485 0.5437 -0.0265 0.0098  0.1555  64  LEU B CD2   
1898 N N     . HIS B 93  ? 0.6751 0.8260 0.8537 -0.0566 -0.0038 0.1003  65  HIS B N     
1899 C CA    . HIS B 93  ? 0.7024 0.8490 0.8931 -0.0679 -0.0073 0.0913  65  HIS B CA    
1900 C C     . HIS B 93  ? 0.6899 0.8078 0.8874 -0.0701 -0.0093 0.0858  65  HIS B C     
1901 O O     . HIS B 93  ? 0.6396 0.7480 0.8524 -0.0816 -0.0109 0.0836  65  HIS B O     
1902 C CB    . HIS B 93  ? 0.6495 0.8111 0.8345 -0.0672 -0.0128 0.0771  65  HIS B CB    
1903 C CG    . HIS B 93  ? 0.6578 0.8452 0.8417 -0.0684 -0.0112 0.0811  65  HIS B CG    
1904 N ND1   . HIS B 93  ? 0.6790 0.8787 0.8522 -0.0599 -0.0084 0.0865  65  HIS B ND1   
1905 C CD2   . HIS B 93  ? 0.6077 0.8106 0.8008 -0.0765 -0.0124 0.0799  65  HIS B CD2   
1906 C CE1   . HIS B 93  ? 0.5913 0.8105 0.7659 -0.0623 -0.0075 0.0879  65  HIS B CE1   
1907 N NE2   . HIS B 93  ? 0.5165 0.7390 0.7031 -0.0718 -0.0094 0.0847  65  HIS B NE2   
1908 N N     . PHE B 94  ? 0.6272 0.7314 0.8151 -0.0590 -0.0092 0.0831  66  PHE B N     
1909 C CA    . PHE B 94  ? 0.5808 0.6554 0.7735 -0.0583 -0.0105 0.0774  66  PHE B CA    
1910 C C     . PHE B 94  ? 0.6687 0.7259 0.8727 -0.0616 -0.0048 0.0939  66  PHE B C     
1911 O O     . PHE B 94  ? 0.7700 0.8055 0.9884 -0.0704 -0.0055 0.0918  66  PHE B O     
1912 C CB    . PHE B 94  ? 0.4874 0.5548 0.6668 -0.0434 -0.0108 0.0709  66  PHE B CB    
1913 C CG    . PHE B 94  ? 0.5401 0.6210 0.7086 -0.0392 -0.0150 0.0555  66  PHE B CG    
1914 C CD1   . PHE B 94  ? 0.5019 0.5735 0.6701 -0.0432 -0.0208 0.0384  66  PHE B CD1   
1915 C CD2   . PHE B 94  ? 0.6009 0.7037 0.7597 -0.0309 -0.0133 0.0584  66  PHE B CD2   
1916 C CE1   . PHE B 94  ? 0.5642 0.6493 0.7201 -0.0377 -0.0240 0.0260  66  PHE B CE1   
1917 C CE2   . PHE B 94  ? 0.6130 0.7279 0.7627 -0.0266 -0.0157 0.0468  66  PHE B CE2   
1918 C CZ    . PHE B 94  ? 0.5973 0.7038 0.7442 -0.0292 -0.0206 0.0314  66  PHE B CZ    
1919 N N     . LEU B 95  ? 0.6630 0.7298 0.8605 -0.0542 0.0007  0.1104  67  LEU B N     
1920 C CA    . LEU B 95  ? 0.7357 0.7885 0.9404 -0.0543 0.0072  0.1292  67  LEU B CA    
1921 C C     . LEU B 95  ? 0.7662 0.8210 0.9876 -0.0692 0.0109  0.1383  67  LEU B C     
1922 O O     . LEU B 95  ? 0.9319 0.9658 1.1669 -0.0742 0.0155  0.1493  67  LEU B O     
1923 C CB    . LEU B 95  ? 0.7619 0.8299 0.9531 -0.0421 0.0108  0.1439  67  LEU B CB    
1924 C CG    . LEU B 95  ? 0.8601 0.9199 1.0417 -0.0265 0.0096  0.1440  67  LEU B CG    
1925 C CD1   . LEU B 95  ? 0.7909 0.8586 0.9654 -0.0213 0.0041  0.1256  67  LEU B CD1   
1926 C CD2   . LEU B 95  ? 0.9489 1.0250 1.1201 -0.0165 0.0120  0.1602  67  LEU B CD2   
1927 N N     . THR B 96  ? 0.6516 0.7318 0.8736 -0.0761 0.0096  0.1346  68  THR B N     
1928 C CA    . THR B 96  ? 0.6375 0.7255 0.8771 -0.0897 0.0139  0.1437  68  THR B CA    
1929 C C     . THR B 96  ? 0.6632 0.7449 0.9211 -0.1038 0.0071  0.1281  68  THR B C     
1930 O O     . THR B 96  ? 0.6780 0.7680 0.9553 -0.1168 0.0093  0.1334  68  THR B O     
1931 C CB    . THR B 96  ? 0.5847 0.7056 0.8164 -0.0884 0.0172  0.1501  68  THR B CB    
1932 O OG1   . THR B 96  ? 0.5189 0.6559 0.7409 -0.0857 0.0099  0.1331  68  THR B OG1   
1933 C CG2   . THR B 96  ? 0.4319 0.5595 0.6464 -0.0755 0.0231  0.1658  68  THR B CG2   
1934 N N     . GLY B 97  ? 0.6627 0.7314 0.9146 -0.1007 -0.0012 0.1087  69  GLY B N     
1935 C CA    . GLY B 97  ? 0.6648 0.7268 0.9305 -0.1122 -0.0099 0.0909  69  GLY B CA    
1936 C C     . GLY B 97  ? 0.6587 0.7509 0.9285 -0.1194 -0.0142 0.0845  69  GLY B C     
1937 O O     . GLY B 97  ? 0.6884 0.7817 0.9776 -0.1328 -0.0198 0.0766  69  GLY B O     
1938 N N     . LYS B 98  ? 0.7016 0.8185 0.9546 -0.1105 -0.0120 0.0876  70  LYS B N     
1939 C CA    . LYS B 98  ? 0.7146 0.8606 0.9702 -0.1148 -0.0150 0.0832  70  LYS B CA    
1940 C C     . LYS B 98  ? 0.6911 0.8431 0.9319 -0.1084 -0.0239 0.0643  70  LYS B C     
1941 O O     . LYS B 98  ? 0.6133 0.7882 0.8539 -0.1099 -0.0276 0.0592  70  LYS B O     
1942 C CB    . LYS B 98  ? 0.7095 0.8780 0.9567 -0.1089 -0.0067 0.0983  70  LYS B CB    
1943 C CG    . LYS B 98  ? 0.6964 0.8931 0.9542 -0.1155 -0.0062 0.0999  70  LYS B CG    
1944 C CD    . LYS B 98  ? 0.7370 0.9339 1.0227 -0.1302 -0.0030 0.1086  70  LYS B CD    
1945 C CE    . LYS B 98  ? 0.8149 1.0429 1.1129 -0.1356 -0.0016 0.1114  70  LYS B CE    
1946 N NZ    . LYS B 98  ? 0.8683 1.1087 1.1657 -0.1364 -0.0130 0.0934  70  LYS B NZ    
1947 N N     . ALA B 99  ? 0.6474 0.7791 0.8755 -0.1001 -0.0266 0.0551  71  ALA B N     
1948 C CA    . ALA B 99  ? 0.5882 0.7247 0.7999 -0.0920 -0.0332 0.0389  71  ALA B CA    
1949 C C     . ALA B 99  ? 0.7092 0.8380 0.9276 -0.0994 -0.0437 0.0206  71  ALA B C     
1950 O O     . ALA B 99  ? 0.7814 0.8846 1.0075 -0.1038 -0.0466 0.0141  71  ALA B O     
1951 C CB    . ALA B 99  ? 0.5723 0.6942 0.7670 -0.0779 -0.0301 0.0380  71  ALA B CB    
1952 N N     . TYR B 100 ? 0.6937 0.8446 0.9091 -0.1004 -0.0502 0.0120  72  TYR B N     
1953 C CA    . TYR B 100 ? 0.6039 0.7521 0.8220 -0.1056 -0.0622 -0.0072 72  TYR B CA    
1954 C C     . TYR B 100 ? 0.5931 0.7300 0.7867 -0.0919 -0.0655 -0.0217 72  TYR B C     
1955 O O     . TYR B 100 ? 0.5909 0.7448 0.7667 -0.0812 -0.0648 -0.0231 72  TYR B O     
1956 C CB    . TYR B 100 ? 0.5551 0.7341 0.7792 -0.1105 -0.0681 -0.0093 72  TYR B CB    
1957 N N     . ILE B 101 ? 0.6412 0.7489 0.8344 -0.0916 -0.0681 -0.0319 73  ILE B N     
1958 C CA    . ILE B 101 ? 0.4838 0.5786 0.6534 -0.0768 -0.0691 -0.0450 73  ILE B CA    
1959 C C     . ILE B 101 ? 0.5541 0.6443 0.7168 -0.0778 -0.0823 -0.0690 73  ILE B C     
1960 O O     . ILE B 101 ? 0.6145 0.6831 0.7902 -0.0873 -0.0896 -0.0806 73  ILE B O     
1961 C CB    . ILE B 101 ? 0.5012 0.5653 0.6709 -0.0714 -0.0623 -0.0414 73  ILE B CB    
1962 C CG1   . ILE B 101 ? 0.4784 0.5480 0.6540 -0.0698 -0.0507 -0.0180 73  ILE B CG1   
1963 C CG2   . ILE B 101 ? 0.5154 0.5693 0.6608 -0.0541 -0.0615 -0.0537 73  ILE B CG2   
1964 C CD1   . ILE B 101 ? 0.4957 0.5374 0.6734 -0.0642 -0.0443 -0.0116 73  ILE B CD1   
1965 N N     . LEU B 102 ? 0.5922 0.7026 0.7344 -0.0677 -0.0857 -0.0763 74  LEU B N     
1966 C CA    . LEU B 102 ? 0.7270 0.8355 0.8557 -0.0648 -0.0984 -0.0997 74  LEU B CA    
1967 C C     . LEU B 102 ? 0.7961 0.8829 0.9010 -0.0487 -0.0954 -0.1114 74  LEU B C     
1968 O O     . LEU B 102 ? 0.8197 0.8831 0.9221 -0.0494 -0.1036 -0.1308 74  LEU B O     
1969 C CB    . LEU B 102 ? 0.6595 0.8015 0.7757 -0.0598 -0.1030 -0.1005 74  LEU B CB    
1970 C CG    . LEU B 102 ? 0.6502 0.8172 0.7884 -0.0737 -0.1075 -0.0917 74  LEU B CG    
1971 C CD1   . LEU B 102 ? 0.6723 0.8698 0.7950 -0.0654 -0.1124 -0.0936 74  LEU B CD1   
1972 C CD2   . LEU B 102 ? 0.5153 0.6728 0.6788 -0.0915 -0.1195 -0.1031 74  LEU B CD2   
1973 N N     . MET B 103 ? 0.7721 0.8672 0.8611 -0.0339 -0.0836 -0.0998 75  MET B N     
1974 C CA    . MET B 103 ? 0.7077 0.7866 0.7759 -0.0168 -0.0775 -0.1069 75  MET B CA    
1975 C C     . MET B 103 ? 0.7695 0.8465 0.8428 -0.0107 -0.0630 -0.0865 75  MET B C     
1976 O O     . MET B 103 ? 0.7042 0.7991 0.7885 -0.0161 -0.0579 -0.0686 75  MET B O     
1977 C CB    . MET B 103 ? 0.6681 0.7659 0.7078 -0.0015 -0.0786 -0.1153 75  MET B CB    
1978 C CG    . MET B 103 ? 0.7070 0.8070 0.7362 -0.0039 -0.0943 -0.1380 75  MET B CG    
1979 S SD    . MET B 103 ? 1.2099 1.3345 1.2021 0.0167  -0.0940 -0.1445 75  MET B SD    
1980 C CE    . MET B 103 ? 1.5652 1.6712 1.5377 0.0375  -0.0794 -0.1452 75  MET B CE    
1981 N N     . PRO B 104 ? 0.8480 0.9034 0.9135 0.0012  -0.0569 -0.0900 76  PRO B N     
1982 C CA    . PRO B 104 ? 0.7787 0.8347 0.8492 0.0085  -0.0442 -0.0715 76  PRO B CA    
1983 C C     . PRO B 104 ? 0.6324 0.7189 0.6948 0.0164  -0.0369 -0.0587 76  PRO B C     
1984 O O     . PRO B 104 ? 0.5789 0.6748 0.6524 0.0151  -0.0300 -0.0410 76  PRO B O     
1985 C CB    . PRO B 104 ? 0.7280 0.7598 0.7870 0.0235  -0.0402 -0.0820 76  PRO B CB    
1986 C CG    . PRO B 104 ? 0.7510 0.7581 0.8092 0.0170  -0.0515 -0.1037 76  PRO B CG    
1987 C CD    . PRO B 104 ? 0.8106 0.8385 0.8652 0.0076  -0.0621 -0.1118 76  PRO B CD    
1988 N N     . SER B 105 ? 0.6011 0.7027 0.6447 0.0245  -0.0388 -0.0675 77  SER B N     
1989 C CA    . SER B 105 ? 0.5566 0.6852 0.5933 0.0324  -0.0310 -0.0550 77  SER B CA    
1990 C C     . SER B 105 ? 0.6198 0.7695 0.6687 0.0202  -0.0337 -0.0435 77  SER B C     
1991 O O     . SER B 105 ? 0.6657 0.8327 0.7188 0.0227  -0.0263 -0.0287 77  SER B O     
1992 C CB    . SER B 105 ? 0.6461 0.7837 0.6571 0.0471  -0.0306 -0.0661 77  SER B CB    
1993 O OG    . SER B 105 ? 0.8868 1.0248 0.8889 0.0417  -0.0434 -0.0822 77  SER B OG    
1994 N N     . GLN B 106 ? 0.5946 0.7431 0.6509 0.0070  -0.0442 -0.0506 78  GLN B N     
1995 C CA    . GLN B 106 ? 0.5378 0.7064 0.6065 -0.0037 -0.0463 -0.0401 78  GLN B CA    
1996 C C     . GLN B 106 ? 0.5101 0.6742 0.5994 -0.0137 -0.0421 -0.0259 78  GLN B C     
1997 O O     . GLN B 106 ? 0.5191 0.7002 0.6162 -0.0173 -0.0388 -0.0132 78  GLN B O     
1998 C CB    . GLN B 106 ? 0.4885 0.6632 0.5586 -0.0129 -0.0590 -0.0523 78  GLN B CB    
1999 C CG    . GLN B 106 ? 0.6036 0.7595 0.6909 -0.0273 -0.0668 -0.0600 78  GLN B CG    
2000 C CD    . GLN B 106 ? 0.6278 0.7917 0.7390 -0.0416 -0.0653 -0.0456 78  GLN B CD    
2001 O OE1   . GLN B 106 ? 0.7103 0.8574 0.8378 -0.0509 -0.0645 -0.0424 78  GLN B OE1   
2002 N NE2   . GLN B 106 ? 0.5645 0.7540 0.6774 -0.0423 -0.0640 -0.0363 78  GLN B NE2   
2003 N N     . ALA B 107 ? 0.5039 0.6444 0.6011 -0.0172 -0.0421 -0.0281 79  ALA B N     
2004 C CA    . ALA B 107 ? 0.4696 0.6048 0.5833 -0.0242 -0.0374 -0.0135 79  ALA B CA    
2005 C C     . ALA B 107 ? 0.4672 0.6121 0.5779 -0.0144 -0.0282 -0.0005 79  ALA B C     
2006 O O     . ALA B 107 ? 0.4355 0.5903 0.5554 -0.0187 -0.0249 0.0127  79  ALA B O     
2007 C CB    . ALA B 107 ? 0.5164 0.6226 0.6378 -0.0274 -0.0385 -0.0176 79  ALA B CB    
2008 N N     . ILE B 108 ? 0.5396 0.6825 0.6375 -0.0009 -0.0243 -0.0051 80  ILE B N     
2009 C CA    . ILE B 108 ? 0.5509 0.7053 0.6482 0.0087  -0.0160 0.0060  80  ILE B CA    
2010 C C     . ILE B 108 ? 0.5567 0.7360 0.6550 0.0067  -0.0147 0.0136  80  ILE B C     
2011 O O     . ILE B 108 ? 0.5538 0.7427 0.6615 0.0046  -0.0115 0.0254  80  ILE B O     
2012 C CB    . ILE B 108 ? 0.6007 0.7506 0.6849 0.0241  -0.0112 -0.0009 80  ILE B CB    
2013 C CG1   . ILE B 108 ? 0.5432 0.6686 0.6298 0.0290  -0.0097 -0.0040 80  ILE B CG1   
2014 C CG2   . ILE B 108 ? 0.6443 0.8139 0.7294 0.0328  -0.0030 0.0100  80  ILE B CG2   
2015 C CD1   . ILE B 108 ? 0.5686 0.6892 0.6427 0.0457  -0.0039 -0.0109 80  ILE B CD1   
2016 N N     . ILE B 109 ? 0.4888 0.6781 0.5770 0.0079  -0.0177 0.0065  81  ILE B N     
2017 C CA    . ILE B 109 ? 0.4662 0.6774 0.5548 0.0076  -0.0160 0.0138  81  ILE B CA    
2018 C C     . ILE B 109 ? 0.5140 0.7325 0.6158 -0.0046 -0.0191 0.0206  81  ILE B C     
2019 O O     . ILE B 109 ? 0.4356 0.6666 0.5436 -0.0049 -0.0153 0.0304  81  ILE B O     
2020 C CB    . ILE B 109 ? 0.4879 0.7081 0.5612 0.0127  -0.0193 0.0052  81  ILE B CB    
2021 C CG1   . ILE B 109 ? 0.5900 0.8064 0.6477 0.0274  -0.0140 0.0000  81  ILE B CG1   
2022 C CG2   . ILE B 109 ? 0.3832 0.6244 0.4587 0.0123  -0.0175 0.0141  81  ILE B CG2   
2023 C CD1   . ILE B 109 ? 0.5542 0.7785 0.5923 0.0347  -0.0176 -0.0096 81  ILE B CD1   
2024 N N     . GLU B 110 ? 0.5828 0.7933 0.6899 -0.0144 -0.0256 0.0152  82  GLU B N     
2025 C CA    . GLU B 110 ? 0.5449 0.7651 0.6640 -0.0251 -0.0278 0.0212  82  GLU B CA    
2026 C C     . GLU B 110 ? 0.4204 0.6354 0.5504 -0.0299 -0.0240 0.0316  82  GLU B C     
2027 O O     . GLU B 110 ? 0.4325 0.6597 0.5690 -0.0340 -0.0225 0.0394  82  GLU B O     
2028 C CB    . GLU B 110 ? 0.5789 0.7977 0.7022 -0.0342 -0.0362 0.0119  82  GLU B CB    
2029 C CG    . GLU B 110 ? 0.5675 0.7960 0.6789 -0.0294 -0.0419 0.0016  82  GLU B CG    
2030 C CD    . GLU B 110 ? 0.4783 0.7201 0.5988 -0.0387 -0.0499 -0.0019 82  GLU B CD    
2031 O OE1   . GLU B 110 ? 0.4712 0.7056 0.5949 -0.0451 -0.0585 -0.0136 82  GLU B OE1   
2032 O OE2   . GLU B 110 ? 0.4477 0.7076 0.5736 -0.0396 -0.0479 0.0067  82  GLU B OE2   
2033 N N     . TYR B 111 ? 0.3768 0.5740 0.5077 -0.0283 -0.0225 0.0318  83  TYR B N     
2034 C CA    . TYR B 111 ? 0.4331 0.6253 0.5725 -0.0319 -0.0195 0.0425  83  TYR B CA    
2035 C C     . TYR B 111 ? 0.4008 0.5930 0.5378 -0.0227 -0.0148 0.0495  83  TYR B C     
2036 O O     . TYR B 111 ? 0.3817 0.5711 0.5232 -0.0234 -0.0129 0.0585  83  TYR B O     
2037 C CB    . TYR B 111 ? 0.5173 0.6895 0.6637 -0.0386 -0.0215 0.0410  83  TYR B CB    
2038 C CG    . TYR B 111 ? 0.5711 0.7471 0.7267 -0.0506 -0.0262 0.0371  83  TYR B CG    
2039 C CD1   . TYR B 111 ? 0.5948 0.7839 0.7599 -0.0581 -0.0243 0.0468  83  TYR B CD1   
2040 C CD2   . TYR B 111 ? 0.5909 0.7590 0.7461 -0.0539 -0.0329 0.0233  83  TYR B CD2   
2041 C CE1   . TYR B 111 ? 0.7365 0.9321 0.9133 -0.0690 -0.0281 0.0444  83  TYR B CE1   
2042 C CE2   . TYR B 111 ? 0.6060 0.7802 0.7729 -0.0656 -0.0385 0.0195  83  TYR B CE2   
2043 C CZ    . TYR B 111 ? 0.7411 0.9299 0.9203 -0.0733 -0.0357 0.0308  83  TYR B CZ    
2044 O OH    . TYR B 111 ? 0.8248 1.0226 1.0191 -0.0848 -0.0407 0.0281  83  TYR B OH    
2045 N N     . ILE B 112 ? 0.4886 0.6857 0.6192 -0.0137 -0.0129 0.0459  84  ILE B N     
2046 C CA    . ILE B 112 ? 0.5126 0.7138 0.6449 -0.0056 -0.0088 0.0524  84  ILE B CA    
2047 C C     . ILE B 112 ? 0.5502 0.7698 0.6827 -0.0022 -0.0065 0.0544  84  ILE B C     
2048 O O     . ILE B 112 ? 0.6688 0.8984 0.8077 -0.0028 -0.0058 0.0612  84  ILE B O     
2049 C CB    . ILE B 112 ? 0.4474 0.6350 0.5763 0.0039  -0.0065 0.0487  84  ILE B CB    
2050 C CG1   . ILE B 112 ? 0.4116 0.5775 0.5424 0.0008  -0.0084 0.0476  84  ILE B CG1   
2051 C CG2   . ILE B 112 ? 0.3646 0.5606 0.4991 0.0120  -0.0027 0.0563  84  ILE B CG2   
2052 C CD1   . ILE B 112 ? 0.3955 0.5454 0.5233 0.0112  -0.0059 0.0437  84  ILE B CD1   
2053 N N     . LEU B 113 ? 0.4588 0.6823 0.5840 0.0017  -0.0055 0.0485  85  LEU B N     
2054 C CA    . LEU B 113 ? 0.5214 0.7608 0.6475 0.0052  -0.0020 0.0520  85  LEU B CA    
2055 C C     . LEU B 113 ? 0.4941 0.7441 0.6249 -0.0022 -0.0042 0.0554  85  LEU B C     
2056 O O     . LEU B 113 ? 0.5590 0.8182 0.6974 -0.0020 -0.0022 0.0613  85  LEU B O     
2057 C CB    . LEU B 113 ? 0.5706 0.8122 0.6851 0.0123  0.0000  0.0462  85  LEU B CB    
2058 C CG    . LEU B 113 ? 0.6221 0.8591 0.7315 0.0236  0.0054  0.0444  85  LEU B CG    
2059 C CD1   . LEU B 113 ? 0.6634 0.9034 0.7569 0.0314  0.0071  0.0377  85  LEU B CD1   
2060 C CD2   . LEU B 113 ? 0.6230 0.8708 0.7449 0.0280  0.0118  0.0544  85  LEU B CD2   
2061 N N     . ALA B 114 ? 0.4325 0.6811 0.5602 -0.0085 -0.0086 0.0511  86  ALA B N     
2062 C CA    . ALA B 114 ? 0.4039 0.6634 0.5358 -0.0141 -0.0101 0.0538  86  ALA B CA    
2063 C C     . ALA B 114 ? 0.3822 0.6431 0.5217 -0.0182 -0.0097 0.0599  86  ALA B C     
2064 O O     . ALA B 114 ? 0.3879 0.6581 0.5314 -0.0185 -0.0085 0.0633  86  ALA B O     
2065 C CB    . ALA B 114 ? 0.2665 0.5262 0.3964 -0.0200 -0.0152 0.0481  86  ALA B CB    
2066 N N     . PHE B 115 ? 0.4266 0.6774 0.5672 -0.0206 -0.0106 0.0611  87  PHE B N     
2067 C CA    . PHE B 115 ? 0.4626 0.7151 0.6070 -0.0231 -0.0104 0.0672  87  PHE B CA    
2068 C C     . PHE B 115 ? 0.5414 0.7975 0.6885 -0.0175 -0.0095 0.0704  87  PHE B C     
2069 O O     . PHE B 115 ? 0.5513 0.8126 0.7001 -0.0183 -0.0104 0.0737  87  PHE B O     
2070 C CB    . PHE B 115 ? 0.4532 0.6938 0.5978 -0.0267 -0.0111 0.0697  87  PHE B CB    
2071 C CG    . PHE B 115 ? 0.4510 0.6917 0.5984 -0.0348 -0.0122 0.0687  87  PHE B CG    
2072 C CD1   . PHE B 115 ? 0.5215 0.7577 0.6690 -0.0376 -0.0149 0.0611  87  PHE B CD1   
2073 C CD2   . PHE B 115 ? 0.4008 0.6474 0.5513 -0.0394 -0.0106 0.0750  87  PHE B CD2   
2074 C CE1   . PHE B 115 ? 0.4682 0.7065 0.6222 -0.0462 -0.0171 0.0599  87  PHE B CE1   
2075 C CE2   . PHE B 115 ? 0.3931 0.6423 0.5501 -0.0473 -0.0108 0.0754  87  PHE B CE2   
2076 C CZ    . PHE B 115 ? 0.4192 0.6647 0.5798 -0.0514 -0.0145 0.0677  87  PHE B CZ    
2077 N N     . SER B 116 ? 0.5847 0.8395 0.7328 -0.0117 -0.0077 0.0691  88  SER B N     
2078 C CA    . SER B 116 ? 0.5138 0.7748 0.6692 -0.0072 -0.0070 0.0722  88  SER B CA    
2079 C C     . SER B 116 ? 0.4864 0.7585 0.6478 -0.0082 -0.0062 0.0726  88  SER B C     
2080 O O     . SER B 116 ? 0.5375 0.8156 0.7072 -0.0078 -0.0077 0.0743  88  SER B O     
2081 C CB    . SER B 116 ? 0.4897 0.7474 0.6466 0.0000  -0.0039 0.0719  88  SER B CB    
2082 O OG    . SER B 116 ? 0.4862 0.7316 0.6395 0.0021  -0.0048 0.0719  88  SER B OG    
2083 N N     . PHE B 117 ? 0.4599 0.7343 0.6178 -0.0092 -0.0044 0.0707  89  PHE B N     
2084 C CA    . PHE B 117 ? 0.4810 0.7636 0.6449 -0.0093 -0.0026 0.0721  89  PHE B CA    
2085 C C     . PHE B 117 ? 0.4147 0.7003 0.5790 -0.0137 -0.0052 0.0713  89  PHE B C     
2086 O O     . PHE B 117 ? 0.3405 0.6306 0.5089 -0.0137 -0.0038 0.0718  89  PHE B O     
2087 C CB    . PHE B 117 ? 0.4504 0.7355 0.6094 -0.0061 0.0009  0.0721  89  PHE B CB    
2088 C CG    . PHE B 117 ? 0.4279 0.7150 0.5898 0.0004  0.0061  0.0751  89  PHE B CG    
2089 C CD1   . PHE B 117 ? 0.4110 0.6929 0.5693 0.0045  0.0071  0.0735  89  PHE B CD1   
2090 C CD2   . PHE B 117 ? 0.4061 0.7001 0.5752 0.0033  0.0111  0.0804  89  PHE B CD2   
2091 C CE1   . PHE B 117 ? 0.3894 0.6749 0.5505 0.0118  0.0133  0.0768  89  PHE B CE1   
2092 C CE2   . PHE B 117 ? 0.4172 0.7149 0.5901 0.0097  0.0177  0.0851  89  PHE B CE2   
2093 C CZ    . PHE B 117 ? 0.4089 0.7035 0.5775 0.0142  0.0190  0.0831  89  PHE B CZ    
2094 N N     . ILE B 118 ? 0.4609 0.7434 0.6208 -0.0165 -0.0081 0.0708  90  ILE B N     
2095 C CA    . ILE B 118 ? 0.5049 0.7912 0.6636 -0.0189 -0.0096 0.0701  90  ILE B CA    
2096 C C     . ILE B 118 ? 0.4698 0.7588 0.6349 -0.0173 -0.0121 0.0690  90  ILE B C     
2097 O O     . ILE B 118 ? 0.4427 0.7347 0.6068 -0.0178 -0.0138 0.0665  90  ILE B O     
2098 C CB    . ILE B 118 ? 0.3679 0.6514 0.5195 -0.0216 -0.0106 0.0719  90  ILE B CB    
2099 C CG1   . ILE B 118 ? 0.2703 0.5502 0.4198 -0.0247 -0.0094 0.0717  90  ILE B CG1   
2100 C CG2   . ILE B 118 ? 0.2906 0.5800 0.4391 -0.0225 -0.0104 0.0718  90  ILE B CG2   
2101 C CD1   . ILE B 118 ? 0.2825 0.5588 0.4294 -0.0288 -0.0092 0.0750  90  ILE B CD1   
2102 N N     . ALA B 119 ? 0.5229 0.8117 0.6954 -0.0151 -0.0126 0.0701  91  ALA B N     
2103 C CA    . ALA B 119 ? 0.4164 0.7095 0.5998 -0.0146 -0.0161 0.0685  91  ALA B CA    
2104 C C     . ALA B 119 ? 0.3704 0.6653 0.5619 -0.0161 -0.0152 0.0659  91  ALA B C     
2105 O O     . ALA B 119 ? 0.4983 0.7947 0.6952 -0.0171 -0.0197 0.0614  91  ALA B O     
2106 C CB    . ALA B 119 ? 0.3198 0.6148 0.5140 -0.0120 -0.0149 0.0716  91  ALA B CB    
2107 N N     . PHE B 120 ? 0.3784 0.6724 0.5701 -0.0157 -0.0097 0.0684  92  PHE B N     
2108 C CA    . PHE B 120 ? 0.4015 0.6954 0.6016 -0.0160 -0.0076 0.0680  92  PHE B CA    
2109 C C     . PHE B 120 ? 0.4149 0.7078 0.6080 -0.0165 -0.0095 0.0633  92  PHE B C     
2110 O O     . PHE B 120 ? 0.5590 0.8502 0.7582 -0.0158 -0.0077 0.0623  92  PHE B O     
2111 C CB    . PHE B 120 ? 0.3482 0.6428 0.5488 -0.0134 -0.0011 0.0738  92  PHE B CB    
2112 C CG    . PHE B 120 ? 0.3119 0.6086 0.5221 -0.0114 0.0028  0.0791  92  PHE B CG    
2113 C CD1   . PHE B 120 ? 0.3571 0.6545 0.5606 -0.0090 0.0037  0.0802  92  PHE B CD1   
2114 C CD2   . PHE B 120 ? 0.2772 0.5748 0.5047 -0.0115 0.0064  0.0832  92  PHE B CD2   
2115 C CE1   . PHE B 120 ? 0.4117 0.7125 0.6238 -0.0056 0.0086  0.0853  92  PHE B CE1   
2116 C CE2   . PHE B 120 ? 0.2967 0.5985 0.5350 -0.0094 0.0116  0.0898  92  PHE B CE2   
2117 C CZ    . PHE B 120 ? 0.2864 0.5908 0.5162 -0.0058 0.0130  0.0907  92  PHE B CZ    
2118 N N     . SER B 121 ? 0.3360 0.6300 0.5169 -0.0169 -0.0121 0.0612  93  SER B N     
2119 C CA    . SER B 121 ? 0.3839 0.6790 0.5574 -0.0161 -0.0130 0.0570  93  SER B CA    
2120 C C     . SER B 121 ? 0.4150 0.7088 0.5920 -0.0155 -0.0185 0.0499  93  SER B C     
2121 O O     . SER B 121 ? 0.4675 0.7610 0.6390 -0.0135 -0.0194 0.0443  93  SER B O     
2122 C CB    . SER B 121 ? 0.3861 0.6839 0.5466 -0.0165 -0.0127 0.0591  93  SER B CB    
2123 O OG    . SER B 121 ? 0.3809 0.6788 0.5403 -0.0183 -0.0097 0.0639  93  SER B OG    
2124 N N     . GLY B 122 ? 0.4225 0.7163 0.6090 -0.0169 -0.0225 0.0496  94  GLY B N     
2125 C CA    . GLY B 122 ? 0.2338 0.5279 0.4257 -0.0172 -0.0300 0.0417  94  GLY B CA    
2126 C C     . GLY B 122 ? 0.2981 0.5895 0.5121 -0.0202 -0.0311 0.0396  94  GLY B C     
2127 O O     . GLY B 122 ? 0.3077 0.6010 0.5320 -0.0220 -0.0387 0.0337  94  GLY B O     
2128 N N     . VAL B 123 ? 0.4059 0.6936 0.6284 -0.0206 -0.0238 0.0451  95  VAL B N     
2129 C CA    . VAL B 123 ? 0.3351 0.6193 0.5806 -0.0235 -0.0225 0.0461  95  VAL B CA    
2130 C C     . VAL B 123 ? 0.3959 0.6726 0.6484 -0.0247 -0.0275 0.0355  95  VAL B C     
2131 O O     . VAL B 123 ? 0.5001 0.7734 0.7747 -0.0289 -0.0301 0.0330  95  VAL B O     
2132 C CB    . VAL B 123 ? 0.2831 0.5653 0.5333 -0.0219 -0.0125 0.0565  95  VAL B CB    
2133 C CG1   . VAL B 123 ? 0.2606 0.5493 0.5068 -0.0204 -0.0082 0.0651  95  VAL B CG1   
2134 C CG2   . VAL B 123 ? 0.3247 0.6038 0.5607 -0.0181 -0.0090 0.0562  95  VAL B CG2   
2135 N N     . PHE B 124 ? 0.5151 0.7892 0.7500 -0.0209 -0.0285 0.0290  96  PHE B N     
2136 C CA    . PHE B 124 ? 0.5963 0.8619 0.8338 -0.0201 -0.0330 0.0169  96  PHE B CA    
2137 C C     . PHE B 124 ? 0.5525 0.8220 0.7705 -0.0169 -0.0410 0.0058  96  PHE B C     
2138 O O     . PHE B 124 ? 0.5304 0.7946 0.7389 -0.0127 -0.0424 -0.0039 96  PHE B O     
2139 C CB    . PHE B 124 ? 0.6165 0.8748 0.8511 -0.0158 -0.0252 0.0191  96  PHE B CB    
2140 C CG    . PHE B 124 ? 0.6320 0.8857 0.8847 -0.0171 -0.0174 0.0302  96  PHE B CG    
2141 C CD1   . PHE B 124 ? 0.6302 0.8814 0.9064 -0.0228 -0.0182 0.0334  96  PHE B CD1   
2142 C CD2   . PHE B 124 ? 0.5877 0.8413 0.8343 -0.0122 -0.0092 0.0383  96  PHE B CD2   
2143 C CE1   . PHE B 124 ? 0.5644 0.8122 0.8560 -0.0229 -0.0094 0.0458  96  PHE B CE1   
2144 C CE2   . PHE B 124 ? 0.4615 0.7120 0.7219 -0.0117 -0.0020 0.0498  96  PHE B CE2   
2145 C CZ    . PHE B 124 ? 0.4492 0.6962 0.7312 -0.0168 -0.0014 0.0541  96  PHE B CZ    
2146 N N     . SER B 125 ? 0.3971 0.6761 0.6083 -0.0177 -0.0459 0.0078  97  SER B N     
2147 C CA    . SER B 125 ? 0.4029 0.6875 0.5934 -0.0134 -0.0530 0.0001  97  SER B CA    
2148 C C     . SER B 125 ? 0.5087 0.7896 0.7027 -0.0132 -0.0641 -0.0165 97  SER B C     
2149 O O     . SER B 125 ? 0.5820 0.8625 0.7562 -0.0071 -0.0670 -0.0262 97  SER B O     
2150 C CB    . SER B 125 ? 0.4431 0.7377 0.6286 -0.0137 -0.0560 0.0072  97  SER B CB    
2151 O OG    . SER B 125 ? 0.4867 0.7831 0.6626 -0.0126 -0.0470 0.0194  97  SER B OG    
2152 N N     . LYS B 126 ? 0.4477 0.7265 0.6674 -0.0197 -0.0702 -0.0200 98  LYS B N     
2153 C CA    . LYS B 126 ? 0.4704 0.7452 0.6985 -0.0214 -0.0827 -0.0374 98  LYS B CA    
2154 C C     . LYS B 126 ? 0.4623 0.7225 0.6855 -0.0180 -0.0803 -0.0482 98  LYS B C     
2155 O O     . LYS B 126 ? 0.4908 0.7487 0.6988 -0.0131 -0.0884 -0.0641 98  LYS B O     
2156 C CB    . LYS B 126 ? 0.3997 0.6747 0.6633 -0.0308 -0.0878 -0.0371 98  LYS B CB    
2157 N N     . GLN B 127 ? 0.4706 0.7212 0.7054 -0.0192 -0.0689 -0.0395 99  GLN B N     
2158 C CA    . GLN B 127 ? 0.4287 0.6647 0.6616 -0.0149 -0.0649 -0.0474 99  GLN B CA    
2159 C C     . GLN B 127 ? 0.4701 0.7096 0.6704 -0.0043 -0.0623 -0.0525 99  GLN B C     
2160 O O     . GLN B 127 ? 0.5171 0.7475 0.7089 0.0013  -0.0655 -0.0676 99  GLN B O     
2161 C CB    . GLN B 127 ? 0.4285 0.6570 0.6775 -0.0163 -0.0523 -0.0331 99  GLN B CB    
2162 C CG    . GLN B 127 ? 0.4974 0.7193 0.7808 -0.0254 -0.0524 -0.0280 99  GLN B CG    
2163 C CD    . GLN B 127 ? 0.4785 0.7145 0.7706 -0.0305 -0.0509 -0.0143 99  GLN B CD    
2164 O OE1   . GLN B 127 ? 0.4366 0.6857 0.7104 -0.0284 -0.0530 -0.0119 99  GLN B OE1   
2165 N NE2   . GLN B 127 ? 0.5529 0.7857 0.8731 -0.0366 -0.0461 -0.0044 99  GLN B NE2   
2166 N N     . VAL B 128 ? 0.4691 0.7215 0.6522 -0.0015 -0.0558 -0.0399 100 VAL B N     
2167 C CA    . VAL B 128 ? 0.5078 0.7665 0.6627 0.0079  -0.0514 -0.0413 100 VAL B CA    
2168 C C     . VAL B 128 ? 0.5957 0.8586 0.7309 0.0130  -0.0621 -0.0560 100 VAL B C     
2169 O O     . VAL B 128 ? 0.5557 0.8149 0.6746 0.0215  -0.0621 -0.0680 100 VAL B O     
2170 C CB    . VAL B 128 ? 0.4506 0.7223 0.5952 0.0079  -0.0432 -0.0242 100 VAL B CB    
2171 C CG1   . VAL B 128 ? 0.3348 0.6145 0.4536 0.0169  -0.0379 -0.0244 100 VAL B CG1   
2172 C CG2   . VAL B 128 ? 0.3757 0.6448 0.5361 0.0042  -0.0338 -0.0112 100 VAL B CG2   
2173 N N     . ARG B 129 ? 0.5921 0.8636 0.7279 0.0091  -0.0711 -0.0551 101 ARG B N     
2174 C CA    . ARG B 129 ? 0.5188 0.7970 0.6351 0.0145  -0.0830 -0.0680 101 ARG B CA    
2175 C C     . ARG B 129 ? 0.5599 0.8268 0.6825 0.0149  -0.0945 -0.0905 101 ARG B C     
2176 O O     . ARG B 129 ? 0.5030 0.7714 0.6017 0.0239  -0.1008 -0.1051 101 ARG B O     
2177 C CB    . ARG B 129 ? 0.4083 0.6987 0.5284 0.0104  -0.0908 -0.0610 101 ARG B CB    
2178 C CG    . ARG B 129 ? 0.4073 0.7088 0.5100 0.0138  -0.0824 -0.0434 101 ARG B CG    
2179 C CD    . ARG B 129 ? 0.4258 0.7384 0.5297 0.0123  -0.0912 -0.0380 101 ARG B CD    
2180 N NE    . ARG B 129 ? 0.5258 0.8372 0.6587 0.0030  -0.0905 -0.0296 101 ARG B NE    
2181 C CZ    . ARG B 129 ? 0.5667 0.8782 0.7240 -0.0032 -0.1006 -0.0371 101 ARG B CZ    
2182 N NH1   . ARG B 129 ? 0.5159 0.8281 0.6984 -0.0103 -0.0973 -0.0271 101 ARG B NH1   
2183 N NH2   . ARG B 129 ? 0.6562 0.9677 0.8133 -0.0022 -0.1139 -0.0550 101 ARG B NH2   
2184 N N     . SER B 130 ? 0.5828 0.8381 0.7377 0.0055  -0.0971 -0.0933 102 SER B N     
2185 C CA    . SER B 130 ? 0.6748 0.9163 0.8421 0.0036  -0.1084 -0.1148 102 SER B CA    
2186 C C     . SER B 130 ? 0.7566 0.9844 0.9084 0.0131  -0.1026 -0.1262 102 SER B C     
2187 O O     . SER B 130 ? 0.7750 0.9965 0.9146 0.0187  -0.1128 -0.1478 102 SER B O     
2188 C CB    . SER B 130 ? 0.4223 0.6538 0.6315 -0.0093 -0.1093 -0.1113 102 SER B CB    
2189 O OG    . SER B 130 ? 0.9257 1.1430 1.1509 -0.0129 -0.1215 -0.1324 102 SER B OG    
2190 N N     . ASN B 131 ? 0.7733 0.9975 0.9255 0.0159  -0.0867 -0.1123 103 ASN B N     
2191 C CA    . ASN B 131 ? 0.7908 1.0041 0.9298 0.0264  -0.0792 -0.1203 103 ASN B CA    
2192 C C     . ASN B 131 ? 0.6992 0.9256 0.7997 0.0396  -0.0762 -0.1235 103 ASN B C     
2193 O O     . ASN B 131 ? 0.6846 0.9038 0.7683 0.0503  -0.0764 -0.1393 103 ASN B O     
2194 C CB    . ASN B 131 ? 0.6737 0.8817 0.8276 0.0256  -0.0638 -0.1033 103 ASN B CB    
2195 C CG    . ASN B 131 ? 0.5774 0.7669 0.7663 0.0169  -0.0646 -0.1035 103 ASN B CG    
2196 O OD1   . ASN B 131 ? 0.5473 0.7178 0.7437 0.0206  -0.0647 -0.1157 103 ASN B OD1   
2197 N ND2   . ASN B 131 ? 0.5420 0.7363 0.7528 0.0061  -0.0643 -0.0893 103 ASN B ND2   
2198 N N     . LEU B 132 ? 0.6513 0.8967 0.7385 0.0394  -0.0728 -0.1081 104 LEU B N     
2199 C CA    . LEU B 132 ? 0.6592 0.9188 0.7117 0.0514  -0.0681 -0.1067 104 LEU B CA    
2200 C C     . LEU B 132 ? 0.7788 1.0405 0.8087 0.0585  -0.0822 -0.1271 104 LEU B C     
2201 O O     . LEU B 132 ? 0.8216 1.0868 0.8226 0.0720  -0.0793 -0.1359 104 LEU B O     
2202 C CB    . LEU B 132 ? 0.5809 0.8576 0.6286 0.0480  -0.0618 -0.0846 104 LEU B CB    
2203 C CG    . LEU B 132 ? 0.6608 0.9528 0.6779 0.0589  -0.0526 -0.0767 104 LEU B CG    
2204 C CD1   . LEU B 132 ? 0.6237 0.9146 0.6386 0.0659  -0.0380 -0.0733 104 LEU B CD1   
2205 C CD2   . LEU B 132 ? 0.6881 0.9932 0.7045 0.0537  -0.0487 -0.0560 104 LEU B CD2   
2206 N N     . ALA B 133 ? 0.7974 1.0585 0.8405 0.0502  -0.0977 -0.1345 105 ALA B N     
2207 C CA    . ALA B 133 ? 0.7504 1.0151 0.7743 0.0560  -0.1144 -0.1551 105 ALA B CA    
2208 C C     . ALA B 133 ? 0.7636 1.0095 0.7884 0.0603  -0.1215 -0.1816 105 ALA B C     
2209 O O     . ALA B 133 ? 0.8026 1.0504 0.7996 0.0712  -0.1308 -0.2010 105 ALA B O     
2210 C CB    . ALA B 133 ? 0.6644 0.9363 0.7070 0.0453  -0.1295 -0.1546 105 ALA B CB    
2211 N N     . ALA B 134 ? 0.7201 0.9469 0.7760 0.0523  -0.1171 -0.1823 106 ALA B N     
2212 C CA    . ALA B 134 ? 0.7044 0.9088 0.7659 0.0557  -0.1224 -0.2062 106 ALA B CA    
2213 C C     . ALA B 134 ? 0.8279 1.0272 0.8671 0.0707  -0.1072 -0.2071 106 ALA B C     
2214 O O     . ALA B 134 ? 0.8938 1.0722 0.9382 0.0753  -0.1072 -0.2238 106 ALA B O     
2215 C CB    . ALA B 134 ? 0.5721 0.7574 0.6787 0.0410  -0.1236 -0.2047 106 ALA B CB    
2216 N N     . ASN B 135 ? 0.8863 1.1049 0.9029 0.0782  -0.0939 -0.1887 107 ASN B N     
2217 C CA    . ASN B 135 ? 0.9387 1.1589 0.9355 0.0927  -0.0777 -0.1854 107 ASN B CA    
2218 C C     . ASN B 135 ? 0.9280 1.1324 0.9518 0.0901  -0.0659 -0.1784 107 ASN B C     
2219 O O     . ASN B 135 ? 1.0322 1.2310 1.0459 0.1027  -0.0558 -0.1833 107 ASN B O     
2220 C CB    . ASN B 135 ? 1.0259 1.2426 0.9893 0.1093  -0.0831 -0.2108 107 ASN B CB    
2221 C CG    . ASN B 135 ? 1.1236 1.3556 1.0560 0.1262  -0.0661 -0.2023 107 ASN B CG    
2222 O OD1   . ASN B 135 ? 1.1196 1.3732 1.0256 0.1321  -0.0635 -0.1927 107 ASN B OD1   
2223 N ND2   . ASN B 135 ? 1.1905 1.4119 1.1277 0.1346  -0.0536 -0.2044 107 ASN B ND2   
2224 N N     . GLN B 136 ? 0.8127 1.0110 0.8704 0.0750  -0.0668 -0.1660 108 GLN B N     
2225 C CA    . GLN B 136 ? 0.8102 0.9963 0.8935 0.0724  -0.0555 -0.1549 108 GLN B CA    
2226 C C     . GLN B 136 ? 0.7124 0.9181 0.7946 0.0716  -0.0414 -0.1283 108 GLN B C     
2227 O O     . GLN B 136 ? 0.6037 0.8126 0.7067 0.0600  -0.0401 -0.1120 108 GLN B O     
2228 C CB    . GLN B 136 ? 0.8596 1.0294 0.9797 0.0572  -0.0632 -0.1545 108 GLN B CB    
2229 C CG    . GLN B 136 ? 0.9238 1.0782 1.0505 0.0531  -0.0807 -0.1797 108 GLN B CG    
2230 C CD    . GLN B 136 ? 1.0647 1.1893 1.2147 0.0529  -0.0811 -0.1925 108 GLN B CD    
2231 O OE1   . GLN B 136 ? 1.1062 1.2216 1.2565 0.0617  -0.0683 -0.1877 108 GLN B OE1   
2232 N NE2   . GLN B 136 ? 1.1009 1.2104 1.2728 0.0426  -0.0960 -0.2084 108 GLN B NE2   
2233 N N     . LEU B 137 ? 0.7323 0.9515 0.7908 0.0842  -0.0308 -0.1246 109 LEU B N     
2234 C CA    . LEU B 137 ? 0.7617 1.0019 0.8180 0.0832  -0.0188 -0.1012 109 LEU B CA    
2235 C C     . LEU B 137 ? 0.7398 0.9769 0.8229 0.0778  -0.0102 -0.0853 109 LEU B C     
2236 O O     . LEU B 137 ? 0.6447 0.8935 0.7368 0.0692  -0.0071 -0.0673 109 LEU B O     
2237 C CB    . LEU B 137 ? 0.7043 0.9601 0.7334 0.0982  -0.0082 -0.1006 109 LEU B CB    
2238 C CG    . LEU B 137 ? 0.5707 0.8491 0.6002 0.0965  0.0042  -0.0769 109 LEU B CG    
2239 C CD1   . LEU B 137 ? 0.4878 0.7762 0.5159 0.0850  -0.0016 -0.0655 109 LEU B CD1   
2240 C CD2   . LEU B 137 ? 0.4837 0.7781 0.4898 0.1116  0.0159  -0.0760 109 LEU B CD2   
2241 N N     . LYS B 138 ? 0.7362 0.9570 0.8308 0.0839  -0.0066 -0.0922 110 LYS B N     
2242 C CA    . LYS B 138 ? 0.6191 0.8372 0.7375 0.0812  0.0014  -0.0770 110 LYS B CA    
2243 C C     . LYS B 138 ? 0.5908 0.8030 0.7318 0.0660  -0.0045 -0.0675 110 LYS B C     
2244 O O     . LYS B 138 ? 0.5726 0.7962 0.7229 0.0606  0.0006  -0.0493 110 LYS B O     
2245 C CB    . LYS B 138 ? 0.5431 0.7415 0.6705 0.0915  0.0055  -0.0867 110 LYS B CB    
2246 C CG    . LYS B 138 ? 0.5166 0.7130 0.6673 0.0908  0.0137  -0.0697 110 LYS B CG    
2247 C CD    . LYS B 138 ? 0.6997 0.8733 0.8612 0.1013  0.0173  -0.0788 110 LYS B CD    
2248 C CE    . LYS B 138 ? 0.8159 0.9881 1.0003 0.1014  0.0248  -0.0601 110 LYS B CE    
2249 N NZ    . LYS B 138 ? 0.9858 1.1327 1.1831 0.1117  0.0284  -0.0672 110 LYS B NZ    
2250 N N     . LYS B 139 ? 0.5756 0.7711 0.7258 0.0595  -0.0154 -0.0805 111 LYS B N     
2251 C CA    . LYS B 139 ? 0.6127 0.8035 0.7860 0.0456  -0.0203 -0.0718 111 LYS B CA    
2252 C C     . LYS B 139 ? 0.5567 0.7672 0.7221 0.0379  -0.0230 -0.0610 111 LYS B C     
2253 O O     . LYS B 139 ? 0.5264 0.7408 0.7069 0.0294  -0.0213 -0.0466 111 LYS B O     
2254 C CB    . LYS B 139 ? 0.7291 0.8995 0.9172 0.0398  -0.0319 -0.0889 111 LYS B CB    
2255 C CG    . LYS B 139 ? 0.9218 1.0671 1.1258 0.0447  -0.0294 -0.0976 111 LYS B CG    
2256 C CD    . LYS B 139 ? 1.0511 1.1775 1.2857 0.0326  -0.0374 -0.1021 111 LYS B CD    
2257 C CE    . LYS B 139 ? 1.0922 1.1896 1.3435 0.0372  -0.0360 -0.1131 111 LYS B CE    
2258 N NZ    . LYS B 139 ? 1.1051 1.1912 1.3384 0.0455  -0.0444 -0.1406 111 LYS B NZ    
2259 N N     . ALA B 140 ? 0.5350 0.7574 0.6758 0.0420  -0.0265 -0.0677 112 ALA B N     
2260 C CA    . ALA B 140 ? 0.4610 0.7006 0.5931 0.0362  -0.0287 -0.0575 112 ALA B CA    
2261 C C     . ALA B 140 ? 0.4150 0.6682 0.5483 0.0353  -0.0178 -0.0377 112 ALA B C     
2262 O O     . ALA B 140 ? 0.4124 0.6722 0.5528 0.0271  -0.0183 -0.0258 112 ALA B O     
2263 C CB    . ALA B 140 ? 0.4026 0.6519 0.5066 0.0430  -0.0333 -0.0671 112 ALA B CB    
2264 N N     . ILE B 141 ? 0.4650 0.7225 0.5920 0.0441  -0.0083 -0.0351 113 ILE B N     
2265 C CA    . ILE B 141 ? 0.4881 0.7599 0.6182 0.0435  0.0010  -0.0180 113 ILE B CA    
2266 C C     . ILE B 141 ? 0.5415 0.8072 0.6941 0.0378  0.0027  -0.0080 113 ILE B C     
2267 O O     . ILE B 141 ? 0.5972 0.8732 0.7544 0.0323  0.0051  0.0052  113 ILE B O     
2268 C CB    . ILE B 141 ? 0.5386 0.8193 0.6591 0.0553  0.0106  -0.0181 113 ILE B CB    
2269 C CG1   . ILE B 141 ? 0.5684 0.8588 0.6641 0.0618  0.0109  -0.0246 113 ILE B CG1   
2270 C CG2   . ILE B 141 ? 0.5811 0.8778 0.7101 0.0537  0.0187  -0.0012 113 ILE B CG2   
2271 C CD1   . ILE B 141 ? 0.3830 0.6842 0.4688 0.0746  0.0217  -0.0247 113 ILE B CD1   
2272 N N     . GLU B 142 ? 0.4290 0.6772 0.5952 0.0394  0.0014  -0.0146 114 GLU B N     
2273 C CA    . GLU B 142 ? 0.3995 0.6409 0.5864 0.0355  0.0039  -0.0040 114 GLU B CA    
2274 C C     . GLU B 142 ? 0.5065 0.7492 0.7020 0.0242  -0.0008 0.0027  114 GLU B C     
2275 O O     . GLU B 142 ? 0.5996 0.8485 0.8023 0.0212  0.0029  0.0163  114 GLU B O     
2276 C CB    . GLU B 142 ? 0.5102 0.7301 0.7114 0.0394  0.0039  -0.0120 114 GLU B CB    
2277 C CG    . GLU B 142 ? 0.5449 0.7624 0.7408 0.0524  0.0105  -0.0164 114 GLU B CG    
2278 C CD    . GLU B 142 ? 0.5809 0.7735 0.7924 0.0565  0.0107  -0.0242 114 GLU B CD    
2279 O OE1   . GLU B 142 ? 0.6592 0.8367 0.8869 0.0479  0.0053  -0.0265 114 GLU B OE1   
2280 O OE2   . GLU B 142 ? 0.6620 0.8500 0.8715 0.0684  0.0166  -0.0276 114 GLU B OE2   
2281 N N     . TRP B 143 ? 0.4911 0.7289 0.6854 0.0191  -0.0093 -0.0072 115 TRP B N     
2282 C CA    . TRP B 143 ? 0.4801 0.7215 0.6823 0.0097  -0.0137 -0.0013 115 TRP B CA    
2283 C C     . TRP B 143 ? 0.4610 0.7192 0.6491 0.0082  -0.0118 0.0081  115 TRP B C     
2284 O O     . TRP B 143 ? 0.4499 0.7128 0.6446 0.0030  -0.0107 0.0184  115 TRP B O     
2285 C CB    . TRP B 143 ? 0.5718 0.8073 0.7764 0.0054  -0.0245 -0.0148 115 TRP B CB    
2286 C CG    . TRP B 143 ? 0.5925 0.8105 0.8197 0.0022  -0.0280 -0.0223 115 TRP B CG    
2287 C CD1   . TRP B 143 ? 0.6313 0.8355 0.8593 0.0054  -0.0332 -0.0392 115 TRP B CD1   
2288 C CD2   . TRP B 143 ? 0.5304 0.7422 0.7838 -0.0051 -0.0260 -0.0129 115 TRP B CD2   
2289 N NE1   . TRP B 143 ? 0.6036 0.7919 0.8593 -0.0006 -0.0352 -0.0412 115 TRP B NE1   
2290 C CE2   . TRP B 143 ? 0.5321 0.7257 0.8042 -0.0071 -0.0301 -0.0239 115 TRP B CE2   
2291 C CE3   . TRP B 143 ? 0.5005 0.7204 0.7632 -0.0094 -0.0206 0.0037  115 TRP B CE3   
2292 C CZ2   . TRP B 143 ? 0.3470 0.5309 0.6492 -0.0142 -0.0281 -0.0167 115 TRP B CZ2   
2293 C CZ3   . TRP B 143 ? 0.4624 0.6740 0.7517 -0.0150 -0.0182 0.0107  115 TRP B CZ3   
2294 C CH2   . TRP B 143 ? 0.3271 0.5212 0.6371 -0.0177 -0.0215 0.0016  115 TRP B CH2   
2295 N N     . ALA B 144 ? 0.4506 0.7174 0.6198 0.0133  -0.0108 0.0045  116 ALA B N     
2296 C CA    . ALA B 144 ? 0.4600 0.7411 0.6174 0.0116  -0.0086 0.0134  116 ALA B CA    
2297 C C     . ALA B 144 ? 0.4916 0.7795 0.6556 0.0104  -0.0020 0.0262  116 ALA B C     
2298 O O     . ALA B 144 ? 0.5434 0.8373 0.7074 0.0052  -0.0021 0.0341  116 ALA B O     
2299 C CB    . ALA B 144 ? 0.4382 0.7275 0.5761 0.0182  -0.0067 0.0090  116 ALA B CB    
2300 N N     . TRP B 145 ? 0.5254 0.8123 0.6951 0.0158  0.0032  0.0274  117 TRP B N     
2301 C CA    . TRP B 145 ? 0.4492 0.7443 0.6251 0.0158  0.0081  0.0387  117 TRP B CA    
2302 C C     . TRP B 145 ? 0.4756 0.7654 0.6627 0.0110  0.0068  0.0453  117 TRP B C     
2303 O O     . TRP B 145 ? 0.4987 0.7968 0.6855 0.0083  0.0077  0.0534  117 TRP B O     
2304 C CB    . TRP B 145 ? 0.3663 0.6626 0.5465 0.0245  0.0135  0.0390  117 TRP B CB    
2305 C CG    . TRP B 145 ? 0.4470 0.7575 0.6180 0.0293  0.0177  0.0388  117 TRP B CG    
2306 C CD1   . TRP B 145 ? 0.3795 0.6892 0.5411 0.0362  0.0198  0.0300  117 TRP B CD1   
2307 C CD2   . TRP B 145 ? 0.4314 0.7600 0.6025 0.0274  0.0206  0.0479  117 TRP B CD2   
2308 N NE1   . TRP B 145 ? 0.3937 0.7213 0.5502 0.0393  0.0254  0.0349  117 TRP B NE1   
2309 C CE2   . TRP B 145 ? 0.4201 0.7594 0.5842 0.0331  0.0256  0.0459  117 TRP B CE2   
2310 C CE3   . TRP B 145 ? 0.3465 0.6834 0.5233 0.0216  0.0192  0.0568  117 TRP B CE3   
2311 C CZ2   . TRP B 145 ? 0.4446 0.8035 0.6112 0.0318  0.0295  0.0539  117 TRP B CZ2   
2312 C CZ3   . TRP B 145 ? 0.3185 0.6734 0.4967 0.0201  0.0215  0.0625  117 TRP B CZ3   
2313 C CH2   . TRP B 145 ? 0.3399 0.7060 0.5150 0.0245  0.0268  0.0617  117 TRP B CH2   
2314 N N     . GLY B 146 ? 0.5200 0.7964 0.7174 0.0099  0.0047  0.0414  118 GLY B N     
2315 C CA    . GLY B 146 ? 0.4363 0.7084 0.6455 0.0058  0.0050  0.0486  118 GLY B CA    
2316 C C     . GLY B 146 ? 0.4253 0.7033 0.6299 -0.0004 0.0016  0.0507  118 GLY B C     
2317 O O     . GLY B 146 ? 0.4490 0.7313 0.6552 -0.0018 0.0037  0.0592  118 GLY B O     
2318 N N     . THR B 147 ? 0.4017 0.6798 0.5992 -0.0029 -0.0037 0.0428  119 THR B N     
2319 C CA    . THR B 147 ? 0.4316 0.7142 0.6255 -0.0076 -0.0072 0.0448  119 THR B CA    
2320 C C     . THR B 147 ? 0.3649 0.6569 0.5466 -0.0079 -0.0050 0.0504  119 THR B C     
2321 O O     . THR B 147 ? 0.2554 0.5496 0.4355 -0.0109 -0.0060 0.0545  119 THR B O     
2322 C CB    . THR B 147 ? 0.2858 0.5665 0.4761 -0.0090 -0.0145 0.0355  119 THR B CB    
2323 O OG1   . THR B 147 ? 0.3069 0.5902 0.5011 -0.0131 -0.0178 0.0386  119 THR B OG1   
2324 C CG2   . THR B 147 ? 0.2934 0.5801 0.4652 -0.0057 -0.0151 0.0318  119 THR B CG2   
2325 N N     . MET B 148 ? 0.3283 0.6258 0.5033 -0.0046 -0.0020 0.0505  120 MET B N     
2326 C CA    . MET B 148 ? 0.3960 0.7030 0.5638 -0.0062 -0.0001 0.0558  120 MET B CA    
2327 C C     . MET B 148 ? 0.3763 0.6871 0.5493 -0.0064 0.0020  0.0623  120 MET B C     
2328 O O     . MET B 148 ? 0.2951 0.6099 0.4651 -0.0098 0.0012  0.0655  120 MET B O     
2329 C CB    . MET B 148 ? 0.2296 0.5442 0.3906 -0.0028 0.0028  0.0542  120 MET B CB    
2330 C CG    . MET B 148 ? 0.4022 0.7167 0.5521 -0.0022 0.0010  0.0498  120 MET B CG    
2331 S SD    . MET B 148 ? 0.3562 0.6822 0.4968 0.0031  0.0069  0.0501  120 MET B SD    
2332 C CE    . MET B 148 ? 0.6544 0.9760 0.7995 0.0113  0.0090  0.0425  120 MET B CE    
2333 N N     . ILE B 149 ? 0.3093 0.6183 0.4897 -0.0021 0.0045  0.0639  121 ILE B N     
2334 C CA    . ILE B 149 ? 0.3227 0.6365 0.5061 -0.0003 0.0062  0.0706  121 ILE B CA    
2335 C C     . ILE B 149 ? 0.3934 0.7030 0.5773 -0.0027 0.0054  0.0736  121 ILE B C     
2336 O O     . ILE B 149 ? 0.3860 0.7009 0.5647 -0.0036 0.0045  0.0762  121 ILE B O     
2337 C CB    . ILE B 149 ? 0.3056 0.6173 0.4967 0.0064  0.0098  0.0737  121 ILE B CB    
2338 C CG1   . ILE B 149 ? 0.2243 0.5436 0.4148 0.0108  0.0114  0.0718  121 ILE B CG1   
2339 C CG2   . ILE B 149 ? 0.2205 0.5369 0.4128 0.0096  0.0113  0.0820  121 ILE B CG2   
2340 C CD1   . ILE B 149 ? 0.2321 0.5479 0.4306 0.0189  0.0152  0.0747  121 ILE B CD1   
2341 N N     . ILE B 150 ? 0.3321 0.6327 0.5232 -0.0036 0.0057  0.0726  122 ILE B N     
2342 C CA    . ILE B 150 ? 0.3018 0.6001 0.4961 -0.0051 0.0063  0.0763  122 ILE B CA    
2343 C C     . ILE B 150 ? 0.3532 0.6538 0.5386 -0.0085 0.0032  0.0743  122 ILE B C     
2344 O O     . ILE B 150 ? 0.3291 0.6317 0.5104 -0.0076 0.0043  0.0775  122 ILE B O     
2345 C CB    . ILE B 150 ? 0.3021 0.5923 0.5099 -0.0069 0.0062  0.0749  122 ILE B CB    
2346 C CG1   . ILE B 150 ? 0.2403 0.5252 0.4601 -0.0035 0.0106  0.0792  122 ILE B CG1   
2347 C CG2   . ILE B 150 ? 0.2139 0.5048 0.4260 -0.0087 0.0069  0.0784  122 ILE B CG2   
2348 C CD1   . ILE B 150 ? 0.2688 0.5451 0.5067 -0.0068 0.0102  0.0777  122 ILE B CD1   
2349 N N     . GLY B 151 ? 0.3676 0.6672 0.5489 -0.0116 -0.0003 0.0691  123 GLY B N     
2350 C CA    . GLY B 151 ? 0.3846 0.6844 0.5586 -0.0145 -0.0028 0.0684  123 GLY B CA    
2351 C C     . GLY B 151 ? 0.4230 0.7272 0.5899 -0.0154 -0.0025 0.0698  123 GLY B C     
2352 O O     . GLY B 151 ? 0.3964 0.6983 0.5594 -0.0165 -0.0034 0.0702  123 GLY B O     
2353 N N     . GLY B 152 ? 0.3785 0.6891 0.5450 -0.0148 -0.0017 0.0700  124 GLY B N     
2354 C CA    . GLY B 152 ? 0.3424 0.6597 0.5059 -0.0166 -0.0029 0.0706  124 GLY B CA    
2355 C C     . GLY B 152 ? 0.4123 0.7310 0.5737 -0.0138 -0.0032 0.0720  124 GLY B C     
2356 O O     . GLY B 152 ? 0.4873 0.8059 0.6440 -0.0160 -0.0060 0.0700  124 GLY B O     
2357 N N     . VAL B 153 ? 0.3100 0.6293 0.4745 -0.0084 -0.0003 0.0755  125 VAL B N     
2358 C CA    . VAL B 153 ? 0.3260 0.6478 0.4863 -0.0035 0.0007  0.0786  125 VAL B CA    
2359 C C     . VAL B 153 ? 0.4616 0.7768 0.6178 -0.0036 0.0014  0.0777  125 VAL B C     
2360 O O     . VAL B 153 ? 0.5891 0.9060 0.7365 -0.0010 0.0003  0.0765  125 VAL B O     
2361 C CB    . VAL B 153 ? 0.2169 0.5394 0.3831 0.0028  0.0055  0.0853  125 VAL B CB    
2362 C CG1   . VAL B 153 ? 0.2243 0.5498 0.3843 0.0093  0.0082  0.0907  125 VAL B CG1   
2363 C CG2   . VAL B 153 ? 0.2167 0.5464 0.3864 0.0051  0.0051  0.0864  125 VAL B CG2   
2364 N N     . ALA B 154 ? 0.4184 0.7266 0.5805 -0.0058 0.0026  0.0775  126 ALA B N     
2365 C CA    . ALA B 154 ? 0.2931 0.5963 0.4542 -0.0051 0.0038  0.0774  126 ALA B CA    
2366 C C     . ALA B 154 ? 0.3317 0.6315 0.4836 -0.0074 0.0000  0.0723  126 ALA B C     
2367 O O     . ALA B 154 ? 0.4131 0.7101 0.5594 -0.0040 0.0012  0.0713  126 ALA B O     
2368 C CB    . ALA B 154 ? 0.2723 0.5714 0.4436 -0.0075 0.0039  0.0776  126 ALA B CB    
2369 N N     . ARG B 155 ? 0.3296 0.6292 0.4807 -0.0129 -0.0037 0.0692  127 ARG B N     
2370 C CA    . ARG B 155 ? 0.3442 0.6388 0.4899 -0.0165 -0.0072 0.0650  127 ARG B CA    
2371 C C     . ARG B 155 ? 0.3655 0.6646 0.5051 -0.0158 -0.0102 0.0612  127 ARG B C     
2372 O O     . ARG B 155 ? 0.3816 0.6751 0.5140 -0.0141 -0.0119 0.0566  127 ARG B O     
2373 C CB    . ARG B 155 ? 0.3013 0.5952 0.4503 -0.0228 -0.0089 0.0651  127 ARG B CB    
2374 C CG    . ARG B 155 ? 0.3346 0.6237 0.4820 -0.0281 -0.0122 0.0620  127 ARG B CG    
2375 C CD    . ARG B 155 ? 0.4145 0.7062 0.5669 -0.0342 -0.0120 0.0648  127 ARG B CD    
2376 N NE    . ARG B 155 ? 0.4430 0.7314 0.5986 -0.0408 -0.0149 0.0626  127 ARG B NE    
2377 C CZ    . ARG B 155 ? 0.4737 0.7652 0.6362 -0.0472 -0.0140 0.0662  127 ARG B CZ    
2378 N NH1   . ARG B 155 ? 0.5914 0.8899 0.7549 -0.0462 -0.0100 0.0718  127 ARG B NH1   
2379 N NH2   . ARG B 155 ? 0.3974 0.6848 0.5663 -0.0543 -0.0169 0.0641  127 ARG B NH2   
2380 N N     . TYR B 156 ? 0.3636 0.6732 0.5058 -0.0162 -0.0113 0.0624  128 TYR B N     
2381 C CA    . TYR B 156 ? 0.3446 0.6620 0.4825 -0.0160 -0.0163 0.0584  128 TYR B CA    
2382 C C     . TYR B 156 ? 0.3808 0.7008 0.5080 -0.0073 -0.0156 0.0581  128 TYR B C     
2383 O O     . TYR B 156 ? 0.4178 0.7448 0.5383 -0.0056 -0.0209 0.0536  128 TYR B O     
2384 C CB    . TYR B 156 ? 0.2988 0.6295 0.4445 -0.0178 -0.0176 0.0608  128 TYR B CB    
2385 C CG    . TYR B 156 ? 0.4048 0.7366 0.5592 -0.0267 -0.0194 0.0597  128 TYR B CG    
2386 C CD1   . TYR B 156 ? 0.3667 0.6945 0.5256 -0.0289 -0.0151 0.0634  128 TYR B CD1   
2387 C CD2   . TYR B 156 ? 0.4692 0.8069 0.6279 -0.0327 -0.0256 0.0550  128 TYR B CD2   
2388 C CE1   . TYR B 156 ? 0.4231 0.7531 0.5889 -0.0358 -0.0150 0.0645  128 TYR B CE1   
2389 C CE2   . TYR B 156 ? 0.4328 0.7723 0.6024 -0.0413 -0.0257 0.0561  128 TYR B CE2   
2390 C CZ    . TYR B 156 ? 0.4914 0.8273 0.6638 -0.0423 -0.0195 0.0618  128 TYR B CZ    
2391 O OH    . TYR B 156 ? 0.6315 0.9703 0.8137 -0.0497 -0.0180 0.0649  128 TYR B OH    
2392 N N     . PHE B 157 ? 0.4107 0.7265 0.5367 -0.0016 -0.0092 0.0632  129 PHE B N     
2393 C CA    . PHE B 157 ? 0.4301 0.7481 0.5452 0.0077  -0.0062 0.0647  129 PHE B CA    
2394 C C     . PHE B 157 ? 0.4530 0.7639 0.5567 0.0085  -0.0098 0.0555  129 PHE B C     
2395 O O     . PHE B 157 ? 0.4381 0.7536 0.5282 0.0147  -0.0125 0.0512  129 PHE B O     
2396 C CB    . PHE B 157 ? 0.3680 0.6833 0.4889 0.0122  0.0025  0.0732  129 PHE B CB    
2397 C CG    . PHE B 157 ? 0.2629 0.5797 0.3732 0.0219  0.0077  0.0757  129 PHE B CG    
2398 C CD1   . PHE B 157 ? 0.3012 0.6277 0.4028 0.0305  0.0103  0.0813  129 PHE B CD1   
2399 C CD2   . PHE B 157 ? 0.3163 0.6259 0.4246 0.0239  0.0108  0.0734  129 PHE B CD2   
2400 C CE1   . PHE B 157 ? 0.2862 0.6156 0.3758 0.0409  0.0164  0.0847  129 PHE B CE1   
2401 C CE2   . PHE B 157 ? 0.2809 0.5934 0.3789 0.0343  0.0171  0.0760  129 PHE B CE2   
2402 C CZ    . PHE B 157 ? 0.4527 0.7754 0.5405 0.0429  0.0202  0.0818  129 PHE B CZ    
2403 N N     . TRP B 158 ? 0.4918 0.7909 0.6001 0.0033  -0.0101 0.0522  130 TRP B N     
2404 C CA    . TRP B 158 ? 0.4728 0.7612 0.5722 0.0044  -0.0128 0.0433  130 TRP B CA    
2405 C C     . TRP B 158 ? 0.5265 0.8136 0.6238 -0.0023 -0.0223 0.0334  130 TRP B C     
2406 O O     . TRP B 158 ? 0.6541 0.9346 0.7408 0.0002  -0.0265 0.0233  130 TRP B O     
2407 C CB    . TRP B 158 ? 0.4197 0.6959 0.5263 0.0019  -0.0097 0.0448  130 TRP B CB    
2408 C CG    . TRP B 158 ? 0.4293 0.7083 0.5407 0.0080  -0.0017 0.0532  130 TRP B CG    
2409 C CD1   . TRP B 158 ? 0.4908 0.7741 0.6150 0.0050  0.0011  0.0609  130 TRP B CD1   
2410 C CD2   . TRP B 158 ? 0.4180 0.6967 0.5232 0.0179  0.0044  0.0544  130 TRP B CD2   
2411 N NE1   . TRP B 158 ? 0.2543 0.5401 0.3834 0.0110  0.0077  0.0668  130 TRP B NE1   
2412 C CE2   . TRP B 158 ? 0.4161 0.7002 0.5343 0.0192  0.0108  0.0640  130 TRP B CE2   
2413 C CE3   . TRP B 158 ? 0.3867 0.6616 0.4768 0.0262  0.0053  0.0476  130 TRP B CE3   
2414 C CZ2   . TRP B 158 ? 0.3608 0.6483 0.4803 0.0279  0.0189  0.0690  130 TRP B CZ2   
2415 C CZ3   . TRP B 158 ? 0.4156 0.6935 0.5036 0.0365  0.0141  0.0523  130 TRP B CZ3   
2416 C CH2   . TRP B 158 ? 0.3585 0.6436 0.4625 0.0369  0.0212  0.0638  130 TRP B CH2   
2417 N N     . HIS B 159 ? 0.5371 0.8308 0.6457 -0.0106 -0.0255 0.0357  131 HIS B N     
2418 C CA    . HIS B 159 ? 0.5031 0.8000 0.6150 -0.0181 -0.0345 0.0278  131 HIS B CA    
2419 C C     . HIS B 159 ? 0.4763 0.7869 0.5777 -0.0119 -0.0399 0.0233  131 HIS B C     
2420 O O     . HIS B 159 ? 0.4031 0.7139 0.5004 -0.0143 -0.0490 0.0122  131 HIS B O     
2421 C CB    . HIS B 159 ? 0.3541 0.6579 0.4823 -0.0273 -0.0347 0.0334  131 HIS B CB    
2422 C CG    . HIS B 159 ? 0.4014 0.6927 0.5379 -0.0337 -0.0311 0.0369  131 HIS B CG    
2423 N ND1   . HIS B 159 ? 0.4239 0.6977 0.5574 -0.0347 -0.0315 0.0324  131 HIS B ND1   
2424 C CD2   . HIS B 159 ? 0.4029 0.6967 0.5490 -0.0379 -0.0270 0.0447  131 HIS B CD2   
2425 C CE1   . HIS B 159 ? 0.4504 0.7171 0.5918 -0.0394 -0.0278 0.0387  131 HIS B CE1   
2426 N NE2   . HIS B 159 ? 0.4189 0.6981 0.5670 -0.0413 -0.0252 0.0459  131 HIS B NE2   
2427 N N     . TYR B 160 ? 0.4357 0.7575 0.5332 -0.0036 -0.0348 0.0321  132 TYR B N     
2428 C CA    . TYR B 160 ? 0.4493 0.7848 0.5341 0.0052  -0.0385 0.0308  132 TYR B CA    
2429 C C     . TYR B 160 ? 0.5239 0.8530 0.5885 0.0145  -0.0387 0.0233  132 TYR B C     
2430 O O     . TYR B 160 ? 0.5929 0.9289 0.6443 0.0187  -0.0470 0.0142  132 TYR B O     
2431 C CB    . TYR B 160 ? 0.2927 0.6389 0.3793 0.0126  -0.0311 0.0443  132 TYR B CB    
2432 C CG    . TYR B 160 ? 0.3759 0.7319 0.4449 0.0260  -0.0301 0.0470  132 TYR B CG    
2433 C CD1   . TYR B 160 ? 0.3906 0.7620 0.4518 0.0298  -0.0393 0.0430  132 TYR B CD1   
2434 C CD2   . TYR B 160 ? 0.3821 0.7335 0.4425 0.0355  -0.0199 0.0545  132 TYR B CD2   
2435 C CE1   . TYR B 160 ? 0.4355 0.8170 0.4776 0.0437  -0.0384 0.0465  132 TYR B CE1   
2436 C CE2   . TYR B 160 ? 0.4103 0.7714 0.4532 0.0489  -0.0174 0.0591  132 TYR B CE2   
2437 C CZ    . TYR B 160 ? 0.4635 0.8393 0.4956 0.0535  -0.0267 0.0551  132 TYR B CZ    
2438 O OH    . TYR B 160 ? 0.5232 0.9098 0.5352 0.0685  -0.0241 0.0607  132 TYR B OH    
2439 N N     . VAL B 161 ? 0.4843 0.8014 0.5465 0.0183  -0.0298 0.0268  133 VAL B N     
2440 C CA    . VAL B 161 ? 0.4532 0.7639 0.4967 0.0285  -0.0276 0.0205  133 VAL B CA    
2441 C C     . VAL B 161 ? 0.5086 0.8079 0.5461 0.0240  -0.0378 0.0032  133 VAL B C     
2442 O O     . VAL B 161 ? 0.5357 0.8372 0.5543 0.0316  -0.0435 -0.0075 133 VAL B O     
2443 C CB    . VAL B 161 ? 0.3984 0.6997 0.4458 0.0324  -0.0160 0.0282  133 VAL B CB    
2444 C CG1   . VAL B 161 ? 0.3961 0.6884 0.4263 0.0422  -0.0139 0.0195  133 VAL B CG1   
2445 C CG2   . VAL B 161 ? 0.3245 0.6368 0.3765 0.0386  -0.0060 0.0439  133 VAL B CG2   
2446 N N     . ALA B 162 ? 0.4462 0.7328 0.4995 0.0119  -0.0402 0.0004  134 ALA B N     
2447 C CA    . ALA B 162 ? 0.5393 0.8117 0.5920 0.0056  -0.0495 -0.0150 134 ALA B CA    
2448 C C     . ALA B 162 ? 0.6396 0.9236 0.6927 0.0001  -0.0626 -0.0247 134 ALA B C     
2449 O O     . ALA B 162 ? 0.6592 0.9358 0.7044 -0.0007 -0.0723 -0.0409 134 ALA B O     
2450 C CB    . ALA B 162 ? 0.4750 0.7325 0.5466 -0.0060 -0.0477 -0.0120 134 ALA B CB    
2451 N N     . GLY B 163 ? 0.5965 0.8991 0.6601 -0.0034 -0.0634 -0.0155 135 GLY B N     
2452 C CA    . GLY B 163 ? 0.5453 0.8639 0.6122 -0.0077 -0.0758 -0.0226 135 GLY B CA    
2453 C C     . GLY B 163 ? 0.6224 0.9501 0.6645 0.0050  -0.0824 -0.0321 135 GLY B C     
2454 O O     . GLY B 163 ? 0.7389 1.0711 0.7782 0.0018  -0.0963 -0.0469 135 GLY B O     
2455 N N     . VAL B 164 ? 0.5036 0.8348 0.5279 0.0196  -0.0726 -0.0233 136 VAL B N     
2456 C CA    . VAL B 164 ? 0.5325 0.8730 0.5292 0.0346  -0.0762 -0.0298 136 VAL B CA    
2457 C C     . VAL B 164 ? 0.6280 0.9505 0.6077 0.0386  -0.0796 -0.0473 136 VAL B C     
2458 O O     . VAL B 164 ? 0.6740 1.0005 0.6359 0.0437  -0.0914 -0.0633 136 VAL B O     
2459 C CB    . VAL B 164 ? 0.4888 0.8380 0.4736 0.0492  -0.0620 -0.0124 136 VAL B CB    
2460 C CG1   . VAL B 164 ? 0.4467 0.8067 0.4003 0.0664  -0.0645 -0.0174 136 VAL B CG1   
2461 C CG2   . VAL B 164 ? 0.4581 0.8220 0.4598 0.0462  -0.0584 0.0041  136 VAL B CG2   
2462 N N     . LEU B 165 ? 0.5785 0.8810 0.5637 0.0370  -0.0698 -0.0450 137 LEU B N     
2463 C CA    . LEU B 165 ? 0.5713 0.8544 0.5411 0.0429  -0.0703 -0.0599 137 LEU B CA    
2464 C C     . LEU B 165 ? 0.6271 0.8947 0.6047 0.0307  -0.0847 -0.0799 137 LEU B C     
2465 O O     . LEU B 165 ? 0.5489 0.8053 0.5081 0.0372  -0.0912 -0.0983 137 LEU B O     
2466 C CB    . LEU B 165 ? 0.5842 0.8523 0.5606 0.0454  -0.0554 -0.0498 137 LEU B CB    
2467 C CG    . LEU B 165 ? 0.7281 1.0058 0.6941 0.0601  -0.0400 -0.0345 137 LEU B CG    
2468 C CD1   . LEU B 165 ? 0.4363 0.7013 0.4179 0.0579  -0.0284 -0.0247 137 LEU B CD1   
2469 C CD2   . LEU B 165 ? 0.4860 0.7662 0.4207 0.0781  -0.0387 -0.0438 137 LEU B CD2   
2470 N N     . PHE B 166 ? 0.6885 0.9549 0.6939 0.0133  -0.0893 -0.0764 138 PHE B N     
2471 C CA    . PHE B 166 ? 0.6454 0.8937 0.6649 -0.0004 -0.1001 -0.0918 138 PHE B CA    
2472 C C     . PHE B 166 ? 0.5999 0.8623 0.6390 -0.0151 -0.1141 -0.0967 138 PHE B C     
2473 O O     . PHE B 166 ? 0.7049 0.9592 0.7476 -0.0224 -0.1279 -0.1154 138 PHE B O     
2474 C CB    . PHE B 166 ? 0.6228 0.8496 0.6611 -0.0085 -0.0905 -0.0831 138 PHE B CB    
2475 C CG    . PHE B 166 ? 0.6360 0.8507 0.6602 0.0050  -0.0771 -0.0776 138 PHE B CG    
2476 C CD1   . PHE B 166 ? 0.6411 0.8352 0.6498 0.0134  -0.0780 -0.0926 138 PHE B CD1   
2477 C CD2   . PHE B 166 ? 0.6807 0.9050 0.7089 0.0094  -0.0640 -0.0579 138 PHE B CD2   
2478 C CE1   . PHE B 166 ? 0.7093 0.8949 0.7074 0.0265  -0.0650 -0.0867 138 PHE B CE1   
2479 C CE2   . PHE B 166 ? 0.7117 0.9278 0.7310 0.0211  -0.0522 -0.0524 138 PHE B CE2   
2480 C CZ    . PHE B 166 ? 0.7535 0.9514 0.7582 0.0300  -0.0522 -0.0661 138 PHE B CZ    
2481 N N     . TRP B 167 ? 0.6431 0.9264 0.6967 -0.0193 -0.1106 -0.0805 139 TRP B N     
2482 C CA    . TRP B 167 ? 0.7216 1.0198 0.7998 -0.0340 -0.1212 -0.0817 139 TRP B CA    
2483 C C     . TRP B 167 ? 0.8050 1.1299 0.8741 -0.0288 -0.1343 -0.0888 139 TRP B C     
2484 O O     . TRP B 167 ? 0.8357 1.1819 0.9243 -0.0364 -0.1393 -0.0828 139 TRP B O     
2485 C CB    . TRP B 167 ? 0.4163 0.7226 0.5169 -0.0413 -0.1105 -0.0611 139 TRP B CB    
2486 C CG    . TRP B 167 ? 0.4624 0.7454 0.5752 -0.0485 -0.1006 -0.0545 139 TRP B CG    
2487 C CD1   . TRP B 167 ? 0.3996 0.6690 0.5020 -0.0402 -0.0878 -0.0458 139 TRP B CD1   
2488 C CD2   . TRP B 167 ? 0.4756 0.7475 0.6143 -0.0650 -0.1028 -0.0550 139 TRP B CD2   
2489 N NE1   . TRP B 167 ? 0.3958 0.6467 0.5140 -0.0495 -0.0827 -0.0412 139 TRP B NE1   
2490 C CE2   . TRP B 167 ? 0.4806 0.7317 0.6204 -0.0645 -0.0910 -0.0459 139 TRP B CE2   
2491 C CE3   . TRP B 167 ? 0.4169 0.6955 0.5796 -0.0800 -0.1134 -0.0611 139 TRP B CE3   
2492 C CZ2   . TRP B 167 ? 0.4039 0.6399 0.5653 -0.0774 -0.0888 -0.0418 139 TRP B CZ2   
2493 C CZ3   . TRP B 167 ? 0.4556 0.7188 0.6422 -0.0941 -0.1103 -0.0568 139 TRP B CZ3   
2494 C CH2   . TRP B 167 ? 0.4119 0.6536 0.5964 -0.0921 -0.0978 -0.0467 139 TRP B CH2   
2495 N N     . GLY B 168 ? 0.8623 1.1873 0.9014 -0.0148 -0.1397 -0.1014 140 GLY B N     
2496 C CA    . GLY B 168 ? 0.8678 1.2190 0.8930 -0.0067 -0.1522 -0.1077 140 GLY B CA    
2497 C C     . GLY B 168 ? 0.9000 1.2585 0.9395 -0.0191 -0.1735 -0.1273 140 GLY B C     
2498 O O     . GLY B 168 ? 0.9055 1.2909 0.9419 -0.0156 -0.1858 -0.1307 140 GLY B O     
2499 N N     . ALA B 169 ? 0.8145 1.1494 0.8716 -0.0338 -0.1781 -0.1398 141 ALA B N     
2500 C CA    . ALA B 169 ? 0.6647 1.0030 0.7395 -0.0478 -0.1988 -0.1601 141 ALA B CA    
2501 C C     . ALA B 169 ? 0.6395 0.9932 0.7570 -0.0670 -0.2010 -0.1495 141 ALA B C     
2502 O O     . ALA B 169 ? 0.7169 1.0812 0.8559 -0.0799 -0.2182 -0.1629 141 ALA B O     
2503 C CB    . ALA B 169 ? 0.5877 0.8908 0.6611 -0.0539 -0.2033 -0.1801 141 ALA B CB    
2504 N N     . TYR B 170 ? 0.6877 1.0436 0.8180 -0.0685 -0.1837 -0.1258 142 TYR B N     
2505 C CA    . TYR B 170 ? 0.6417 1.0133 0.8103 -0.0842 -0.1823 -0.1132 142 TYR B CA    
2506 C C     . TYR B 170 ? 0.6242 1.0319 0.7937 -0.0763 -0.1828 -0.1007 142 TYR B C     
2507 O O     . TYR B 170 ? 0.5289 0.9537 0.7270 -0.0854 -0.1794 -0.0879 142 TYR B O     
2508 C CB    . TYR B 170 ? 0.6353 0.9875 0.8172 -0.0902 -0.1635 -0.0957 142 TYR B CB    
2509 C CG    . TYR B 170 ? 0.7241 1.0414 0.9121 -0.0995 -0.1625 -0.1050 142 TYR B CG    
2510 C CD1   . TYR B 170 ? 0.8537 1.1452 1.0135 -0.0881 -0.1580 -0.1125 142 TYR B CD1   
2511 C CD2   . TYR B 170 ? 0.7679 1.0783 0.9914 -0.1192 -0.1652 -0.1049 142 TYR B CD2   
2512 C CE1   . TYR B 170 ? 0.9266 1.1851 1.0924 -0.0951 -0.1568 -0.1205 142 TYR B CE1   
2513 C CE2   . TYR B 170 ? 0.8478 1.1243 1.0779 -0.1272 -0.1638 -0.1119 142 TYR B CE2   
2514 C CZ    . TYR B 170 ? 0.9302 1.1803 1.1310 -0.1147 -0.1599 -0.1201 142 TYR B CZ    
2515 O OH    . TYR B 170 ? 0.9600 1.1752 1.1677 -0.1213 -0.1582 -0.1267 142 TYR B OH    
2516 N N     . ALA B 171 ? 0.6493 1.0684 0.7870 -0.0583 -0.1863 -0.1038 143 ALA B N     
2517 C CA    . ALA B 171 ? 0.4521 0.9026 0.5865 -0.0476 -0.1855 -0.0904 143 ALA B CA    
2518 C C     . ALA B 171 ? 0.5204 1.0021 0.6770 -0.0552 -0.2041 -0.0979 143 ALA B C     
2519 O O     . ALA B 171 ? 0.6029 1.0824 0.7722 -0.0673 -0.2203 -0.1170 143 ALA B O     
2520 C CB    . ALA B 171 ? 0.4647 0.9173 0.5583 -0.0255 -0.1830 -0.0899 143 ALA B CB    
2521 N N     . PHE B 172 ? 0.4499 0.9606 0.6129 -0.0479 -0.2020 -0.0830 144 PHE B N     
2522 C CA    . PHE B 172 ? 0.4506 0.9963 0.6323 -0.0511 -0.2199 -0.0885 144 PHE B CA    
2523 C C     . PHE B 172 ? 0.6303 1.1850 0.7823 -0.0397 -0.2385 -0.1072 144 PHE B C     
2524 O O     . PHE B 172 ? 0.6261 1.1633 0.7408 -0.0258 -0.2339 -0.1111 144 PHE B O     
2525 C CB    . PHE B 172 ? 0.4269 1.0000 0.6170 -0.0414 -0.2118 -0.0671 144 PHE B CB    
2526 C CG    . PHE B 172 ? 0.5239 1.0904 0.7391 -0.0497 -0.1933 -0.0491 144 PHE B CG    
2527 C CD1   . PHE B 172 ? 0.5573 1.1372 0.8133 -0.0667 -0.1959 -0.0475 144 PHE B CD1   
2528 C CD2   . PHE B 172 ? 0.4941 1.0424 0.6925 -0.0400 -0.1734 -0.0339 144 PHE B CD2   
2529 C CE1   . PHE B 172 ? 0.4684 1.0433 0.7440 -0.0723 -0.1783 -0.0309 144 PHE B CE1   
2530 C CE2   . PHE B 172 ? 0.4703 1.0129 0.6890 -0.0464 -0.1577 -0.0192 144 PHE B CE2   
2531 C CZ    . PHE B 172 ? 0.4079 0.9638 0.6632 -0.0617 -0.1598 -0.0177 144 PHE B CZ    
2532 N N     . GLN B 173 ? 0.7081 1.2920 0.8765 -0.0447 -0.2597 -0.1187 145 GLN B N     
2533 C CA    . GLN B 173 ? 0.8278 1.4249 0.9665 -0.0323 -0.2795 -0.1370 145 GLN B CA    
2534 C C     . GLN B 173 ? 0.6989 1.3142 0.8049 -0.0070 -0.2731 -0.1212 145 GLN B C     
2535 O O     . GLN B 173 ? 0.5904 1.2297 0.7118 -0.0024 -0.2677 -0.1022 145 GLN B O     
2536 C CB    . GLN B 173 ? 1.0386 1.6574 1.2045 -0.0449 -0.3033 -0.1521 145 GLN B CB    
2537 C CG    . GLN B 173 ? 1.2691 1.9135 1.4693 -0.0487 -0.3007 -0.1330 145 GLN B CG    
2538 C CD    . GLN B 173 ? 1.4120 2.0539 1.6593 -0.0701 -0.2909 -0.1241 145 GLN B CD    
2539 O OE1   . GLN B 173 ? 1.4602 2.0852 1.7087 -0.0744 -0.2747 -0.1173 145 GLN B OE1   
2540 N NE2   . GLN B 173 ? 1.3745 2.0319 1.6603 -0.0830 -0.2995 -0.1226 145 GLN B NE2   
2541 N N     . GLY B 174 ? 0.6962 1.2989 0.7576 0.0099  -0.2724 -0.1281 146 GLY B N     
2542 C CA    . GLY B 174 ? 0.7205 1.3379 0.7488 0.0347  -0.2651 -0.1123 146 GLY B CA    
2543 C C     . GLY B 174 ? 0.7856 1.3808 0.8040 0.0423  -0.2372 -0.0894 146 GLY B C     
2544 O O     . GLY B 174 ? 0.9214 1.5240 0.9145 0.0621  -0.2276 -0.0735 146 GLY B O     
2545 N N     . TRP B 175 ? 0.7298 1.2981 0.7694 0.0265  -0.2245 -0.0873 147 TRP B N     
2546 C CA    . TRP B 175 ? 0.4901 1.0371 0.5242 0.0314  -0.1997 -0.0675 147 TRP B CA    
2547 C C     . TRP B 175 ? 0.6438 1.1602 0.6503 0.0362  -0.1917 -0.0760 147 TRP B C     
2548 O O     . TRP B 175 ? 0.7512 1.2496 0.7609 0.0249  -0.1993 -0.0952 147 TRP B O     
2549 C CB    . TRP B 175 ? 0.5462 1.0846 0.6187 0.0137  -0.1892 -0.0574 147 TRP B CB    
2550 C CG    . TRP B 175 ? 0.5330 1.0993 0.6318 0.0125  -0.1900 -0.0433 147 TRP B CG    
2551 C CD1   . TRP B 175 ? 0.5694 1.1689 0.6779 0.0145  -0.2071 -0.0475 147 TRP B CD1   
2552 C CD2   . TRP B 175 ? 0.5268 1.0910 0.6456 0.0102  -0.1729 -0.0234 147 TRP B CD2   
2553 N NE1   . TRP B 175 ? 0.4237 1.0420 0.5580 0.0140  -0.2007 -0.0304 147 TRP B NE1   
2554 C CE2   . TRP B 175 ? 0.3984 0.9945 0.5383 0.0116  -0.1796 -0.0161 147 TRP B CE2   
2555 C CE3   . TRP B 175 ? 0.3837 0.9229 0.5043 0.0078  -0.1533 -0.0119 147 TRP B CE3   
2556 C CZ2   . TRP B 175 ? 0.3723 0.9741 0.5336 0.0113  -0.1664 0.0018  147 TRP B CZ2   
2557 C CZ3   . TRP B 175 ? 0.5115 1.0566 0.6525 0.0068  -0.1416 0.0048  147 TRP B CZ3   
2558 C CH2   . TRP B 175 ? 0.5314 1.1066 0.6917 0.0089  -0.1476 0.0112  147 TRP B CH2   
2559 N N     . GLY B 176 ? 0.6205 1.1310 0.6018 0.0530  -0.1757 -0.0611 148 GLY B N     
2560 C CA    . GLY B 176 ? 0.5141 0.9982 0.4717 0.0591  -0.1650 -0.0655 148 GLY B CA    
2561 C C     . GLY B 176 ? 0.6395 1.0975 0.6190 0.0457  -0.1498 -0.0585 148 GLY B C     
2562 O O     . GLY B 176 ? 0.6082 1.0691 0.6181 0.0334  -0.1463 -0.0487 148 GLY B O     
2563 N N     . ALA B 177 ? 0.5760 1.0099 0.5393 0.0495  -0.1407 -0.0632 149 ALA B N     
2564 C CA    . ALA B 177 ? 0.5477 0.9571 0.5291 0.0387  -0.1272 -0.0571 149 ALA B CA    
2565 C C     . ALA B 177 ? 0.6632 1.0752 0.6542 0.0421  -0.1096 -0.0325 149 ALA B C     
2566 O O     . ALA B 177 ? 0.7379 1.1415 0.7538 0.0299  -0.1030 -0.0248 149 ALA B O     
2567 C CB    . ALA B 177 ? 0.5779 0.9632 0.5389 0.0443  -0.1222 -0.0680 149 ALA B CB    
2568 N N     . GLN B 178 ? 0.6967 1.1201 0.6675 0.0592  -0.1022 -0.0202 150 GLN B N     
2569 C CA    . GLN B 178 ? 0.6988 1.1241 0.6788 0.0633  -0.0862 0.0026  150 GLN B CA    
2570 C C     . GLN B 178 ? 0.6978 1.1375 0.7034 0.0553  -0.0895 0.0112  150 GLN B C     
2571 O O     . GLN B 178 ? 0.5951 1.0267 0.6218 0.0470  -0.0801 0.0211  150 GLN B O     
2572 C CB    . GLN B 178 ? 0.8190 1.2548 0.7729 0.0837  -0.0783 0.0145  150 GLN B CB    
2573 C CG    . GLN B 178 ? 0.8531 1.2955 0.8184 0.0886  -0.0655 0.0381  150 GLN B CG    
2574 C CD    . GLN B 178 ? 0.8728 1.2962 0.8556 0.0815  -0.0500 0.0481  150 GLN B CD    
2575 O OE1   . GLN B 178 ? 0.9839 1.3910 0.9630 0.0788  -0.0453 0.0415  150 GLN B OE1   
2576 N NE2   . GLN B 178 ? 0.7604 1.1860 0.7626 0.0791  -0.0427 0.0632  150 GLN B NE2   
2577 N N     . LEU B 179 ? 0.8095 1.2718 0.8128 0.0586  -0.1032 0.0068  151 LEU B N     
2578 C CA    . LEU B 179 ? 0.3981 0.8783 0.4251 0.0536  -0.1068 0.0150  151 LEU B CA    
2579 C C     . LEU B 179 ? 0.5545 1.0272 0.6117 0.0339  -0.1089 0.0095  151 LEU B C     
2580 O O     . LEU B 179 ? 0.4654 0.9388 0.5429 0.0293  -0.1004 0.0214  151 LEU B O     
2581 C CB    . LEU B 179 ? 0.4185 0.9262 0.4377 0.0606  -0.1238 0.0086  151 LEU B CB    
2582 C CG    . LEU B 179 ? 0.4043 0.9350 0.4489 0.0572  -0.1290 0.0165  151 LEU B CG    
2583 C CD1   . LEU B 179 ? 0.3888 0.9203 0.4369 0.0673  -0.1132 0.0393  151 LEU B CD1   
2584 C CD2   . LEU B 179 ? 0.4274 0.9869 0.4644 0.0638  -0.1484 0.0078  151 LEU B CD2   
2585 N N     . PHE B 180 ? 0.6129 1.0779 0.6726 0.0231  -0.1197 -0.0086 152 PHE B N     
2586 C CA    . PHE B 180 ? 0.3759 0.8342 0.4646 0.0042  -0.1217 -0.0132 152 PHE B CA    
2587 C C     . PHE B 180 ? 0.3553 0.7906 0.4516 -0.0010 -0.1055 -0.0039 152 PHE B C     
2588 O O     . PHE B 180 ? 0.3407 0.7754 0.4607 -0.0121 -0.1016 0.0015  152 PHE B O     
2589 C CB    . PHE B 180 ? 0.3978 0.8488 0.4869 -0.0057 -0.1364 -0.0346 152 PHE B CB    
2590 C CG    . PHE B 180 ? 0.5030 0.9474 0.6237 -0.0255 -0.1384 -0.0381 152 PHE B CG    
2591 C CD1   . PHE B 180 ? 0.4951 0.9625 0.6436 -0.0345 -0.1453 -0.0353 152 PHE B CD1   
2592 C CD2   . PHE B 180 ? 0.5161 0.9325 0.6398 -0.0343 -0.1329 -0.0430 152 PHE B CD2   
2593 C CE1   . PHE B 180 ? 0.4603 0.9229 0.6389 -0.0524 -0.1455 -0.0365 152 PHE B CE1   
2594 C CE2   . PHE B 180 ? 0.3811 0.7911 0.5336 -0.0518 -0.1337 -0.0440 152 PHE B CE2   
2595 C CZ    . PHE B 180 ? 0.3723 0.8057 0.5525 -0.0611 -0.1395 -0.0404 152 PHE B CZ    
2596 N N     . SER B 181 ? 0.5756 0.9939 0.6518 0.0076  -0.0962 -0.0018 153 SER B N     
2597 C CA    . SER B 181 ? 0.4517 0.8493 0.5342 0.0033  -0.0826 0.0056  153 SER B CA    
2598 C C     . SER B 181 ? 0.4522 0.8547 0.5439 0.0070  -0.0707 0.0231  153 SER B C     
2599 O O     . SER B 181 ? 0.4785 0.8722 0.5857 -0.0011 -0.0639 0.0284  153 SER B O     
2600 C CB    . SER B 181 ? 0.5270 0.9069 0.5880 0.0114  -0.0768 0.0018  153 SER B CB    
2601 O OG    . SER B 181 ? 0.5231 0.8851 0.5921 0.0071  -0.0652 0.0085  153 SER B OG    
2602 N N     . ILE B 182 ? 0.5099 0.9256 0.5913 0.0198  -0.0684 0.0320  154 ILE B N     
2603 C CA    . ILE B 182 ? 0.4980 0.9157 0.5882 0.0243  -0.0573 0.0480  154 ILE B CA    
2604 C C     . ILE B 182 ? 0.4635 0.8944 0.5758 0.0176  -0.0599 0.0514  154 ILE B C     
2605 O O     . ILE B 182 ? 0.3774 0.8029 0.5021 0.0155  -0.0510 0.0597  154 ILE B O     
2606 C CB    . ILE B 182 ? 0.3181 0.7442 0.3921 0.0407  -0.0526 0.0587  154 ILE B CB    
2607 C CG1   . ILE B 182 ? 0.3031 0.7258 0.3886 0.0443  -0.0402 0.0745  154 ILE B CG1   
2608 C CG2   . ILE B 182 ? 0.5247 0.9741 0.5917 0.0478  -0.0644 0.0562  154 ILE B CG2   
2609 C CD1   . ILE B 182 ? 0.2903 0.6924 0.3825 0.0382  -0.0299 0.0767  154 ILE B CD1   
2610 N N     . VAL B 183 ? 0.3017 0.7505 0.4195 0.0146  -0.0724 0.0441  155 VAL B N     
2611 C CA    . VAL B 183 ? 0.3428 0.8081 0.4834 0.0091  -0.0749 0.0476  155 VAL B CA    
2612 C C     . VAL B 183 ? 0.4146 0.8705 0.5738 -0.0063 -0.0728 0.0438  155 VAL B C     
2613 O O     . VAL B 183 ? 0.2640 0.7211 0.4376 -0.0087 -0.0650 0.0517  155 VAL B O     
2614 C CB    . VAL B 183 ? 0.3834 0.8744 0.5272 0.0106  -0.0900 0.0413  155 VAL B CB    
2615 C CG1   . VAL B 183 ? 0.3518 0.8615 0.5237 0.0034  -0.0921 0.0446  155 VAL B CG1   
2616 C CG2   . VAL B 183 ? 0.4348 0.9384 0.5602 0.0280  -0.0913 0.0483  155 VAL B CG2   
2617 N N     . MET B 184 ? 0.4192 0.8650 0.5771 -0.0157 -0.0793 0.0320  156 MET B N     
2618 C CA    . MET B 184 ? 0.4263 0.8633 0.6021 -0.0304 -0.0777 0.0295  156 MET B CA    
2619 C C     . MET B 184 ? 0.3974 0.8135 0.5705 -0.0310 -0.0645 0.0364  156 MET B C     
2620 O O     . MET B 184 ? 0.4373 0.8535 0.6250 -0.0372 -0.0584 0.0423  156 MET B O     
2621 C CB    . MET B 184 ? 0.4644 0.8935 0.6407 -0.0400 -0.0885 0.0149  156 MET B CB    
2622 C CG    . MET B 184 ? 0.4839 0.9351 0.6679 -0.0425 -0.1041 0.0057  156 MET B CG    
2623 S SD    . MET B 184 ? 0.3914 0.8725 0.6071 -0.0482 -0.1050 0.0146  156 MET B SD    
2624 C CE    . MET B 184 ? 0.7957 1.2624 1.0349 -0.0657 -0.0976 0.0170  156 MET B CE    
2625 N N     . ASN B 185 ? 0.3950 0.7949 0.5493 -0.0241 -0.0603 0.0359  157 ASN B N     
2626 C CA    . ASN B 185 ? 0.4614 0.8437 0.6136 -0.0240 -0.0493 0.0419  157 ASN B CA    
2627 C C     . ASN B 185 ? 0.4424 0.8305 0.5987 -0.0176 -0.0409 0.0530  157 ASN B C     
2628 O O     . ASN B 185 ? 0.5129 0.8922 0.6744 -0.0202 -0.0336 0.0575  157 ASN B O     
2629 C CB    . ASN B 185 ? 0.3824 0.7486 0.5166 -0.0180 -0.0470 0.0386  157 ASN B CB    
2630 C CG    . ASN B 185 ? 0.4114 0.7663 0.5419 -0.0242 -0.0540 0.0266  157 ASN B CG    
2631 O OD1   . ASN B 185 ? 0.4842 0.8293 0.6257 -0.0343 -0.0540 0.0247  157 ASN B OD1   
2632 N ND2   . ASN B 185 ? 0.4018 0.7575 0.5160 -0.0173 -0.0597 0.0185  157 ASN B ND2   
2633 N N     . GLY B 186 ? 0.3753 0.7779 0.5288 -0.0087 -0.0425 0.0570  158 GLY B N     
2634 C CA    . GLY B 186 ? 0.3709 0.7784 0.5301 -0.0021 -0.0352 0.0669  158 GLY B CA    
2635 C C     . GLY B 186 ? 0.3812 0.7986 0.5580 -0.0080 -0.0342 0.0685  158 GLY B C     
2636 O O     . GLY B 186 ? 0.4177 0.8293 0.5994 -0.0073 -0.0264 0.0732  158 GLY B O     
2637 N N     . ALA B 187 ? 0.2368 0.6703 0.4237 -0.0137 -0.0424 0.0643  159 ALA B N     
2638 C CA    . ALA B 187 ? 0.3168 0.7633 0.5228 -0.0195 -0.0408 0.0668  159 ALA B CA    
2639 C C     . ALA B 187 ? 0.3069 0.7391 0.5169 -0.0289 -0.0349 0.0664  159 ALA B C     
2640 O O     . ALA B 187 ? 0.2389 0.6732 0.4561 -0.0286 -0.0273 0.0716  159 ALA B O     
2641 C CB    . ALA B 187 ? 0.2365 0.7045 0.4557 -0.0250 -0.0516 0.0622  159 ALA B CB    
2642 N N     . SER B 188 ? 0.3740 0.7918 0.5780 -0.0360 -0.0384 0.0603  160 SER B N     
2643 C CA    . SER B 188 ? 0.3969 0.8000 0.6031 -0.0438 -0.0333 0.0610  160 SER B CA    
2644 C C     . SER B 188 ? 0.4651 0.8555 0.6618 -0.0376 -0.0242 0.0659  160 SER B C     
2645 O O     . SER B 188 ? 0.3963 0.7839 0.5969 -0.0403 -0.0182 0.0697  160 SER B O     
2646 C CB    . SER B 188 ? 0.3560 0.7433 0.5561 -0.0500 -0.0387 0.0534  160 SER B CB    
2647 O OG    . SER B 188 ? 0.3499 0.7470 0.5613 -0.0579 -0.0482 0.0470  160 SER B OG    
2648 N N     . CYS B 189 ? 0.4652 0.8490 0.6499 -0.0291 -0.0235 0.0658  161 CYS B N     
2649 C CA    . CYS B 189 ? 0.3566 0.7295 0.5356 -0.0237 -0.0163 0.0695  161 CYS B CA    
2650 C C     . CYS B 189 ? 0.3764 0.7592 0.5627 -0.0191 -0.0115 0.0739  161 CYS B C     
2651 O O     . CYS B 189 ? 0.5006 0.8774 0.6867 -0.0187 -0.0062 0.0751  161 CYS B O     
2652 C CB    . CYS B 189 ? 0.3307 0.6960 0.4994 -0.0163 -0.0159 0.0698  161 CYS B CB    
2653 S SG    . CYS B 189 ? 0.3429 0.6943 0.5094 -0.0118 -0.0086 0.0733  161 CYS B SG    
2654 N N     . LEU B 190 ? 0.2809 0.6793 0.4729 -0.0144 -0.0137 0.0758  162 LEU B N     
2655 C CA    . LEU B 190 ? 0.3044 0.7130 0.5041 -0.0081 -0.0089 0.0800  162 LEU B CA    
2656 C C     . LEU B 190 ? 0.2950 0.7108 0.5035 -0.0133 -0.0051 0.0807  162 LEU B C     
2657 O O     . LEU B 190 ? 0.3173 0.7298 0.5249 -0.0090 0.0015  0.0820  162 LEU B O     
2658 C CB    . LEU B 190 ? 0.2128 0.6398 0.4186 -0.0020 -0.0131 0.0827  162 LEU B CB    
2659 C CG    . LEU B 190 ? 0.2358 0.6748 0.4514 0.0061  -0.0080 0.0875  162 LEU B CG    
2660 C CD1   . LEU B 190 ? 0.2345 0.6569 0.4440 0.0143  -0.0011 0.0894  162 LEU B CD1   
2661 C CD2   . LEU B 190 ? 0.2157 0.6762 0.4389 0.0120  -0.0135 0.0908  162 LEU B CD2   
2662 N N     . GLY B 191 ? 0.2180 0.6434 0.4351 -0.0223 -0.0091 0.0799  163 GLY B N     
2663 C CA    . GLY B 191 ? 0.3203 0.7544 0.5478 -0.0277 -0.0043 0.0830  163 GLY B CA    
2664 C C     . GLY B 191 ? 0.3695 0.7871 0.5873 -0.0301 0.0013  0.0834  163 GLY B C     
2665 O O     . GLY B 191 ? 0.3766 0.7990 0.5960 -0.0284 0.0085  0.0870  163 GLY B O     
2666 N N     . THR B 192 ? 0.3841 0.7835 0.5910 -0.0328 -0.0020 0.0799  164 THR B N     
2667 C CA    . THR B 192 ? 0.3850 0.7693 0.5824 -0.0344 0.0016  0.0805  164 THR B CA    
2668 C C     . THR B 192 ? 0.4217 0.7997 0.6097 -0.0257 0.0060  0.0796  164 THR B C     
2669 O O     . THR B 192 ? 0.5038 0.8812 0.6874 -0.0242 0.0110  0.0812  164 THR B O     
2670 C CB    . THR B 192 ? 0.3120 0.6798 0.5022 -0.0386 -0.0033 0.0770  164 THR B CB    
2671 O OG1   . THR B 192 ? 0.3595 0.7295 0.5584 -0.0476 -0.0073 0.0766  164 THR B OG1   
2672 C CG2   . THR B 192 ? 0.3136 0.6673 0.4940 -0.0379 -0.0003 0.0781  164 THR B CG2   
2673 N N     . VAL B 193 ? 0.3127 0.6861 0.4978 -0.0197 0.0042  0.0770  165 VAL B N     
2674 C CA    . VAL B 193 ? 0.4029 0.7681 0.5824 -0.0125 0.0073  0.0748  165 VAL B CA    
2675 C C     . VAL B 193 ? 0.3779 0.7535 0.5606 -0.0064 0.0127  0.0755  165 VAL B C     
2676 O O     . VAL B 193 ? 0.3418 0.7116 0.5177 -0.0023 0.0159  0.0724  165 VAL B O     
2677 C CB    . VAL B 193 ? 0.3837 0.7419 0.5632 -0.0079 0.0053  0.0740  165 VAL B CB    
2678 C CG1   . VAL B 193 ? 0.3186 0.6674 0.4967 -0.0016 0.0082  0.0712  165 VAL B CG1   
2679 C CG2   . VAL B 193 ? 0.3416 0.6897 0.5164 -0.0121 0.0016  0.0732  165 VAL B CG2   
2680 N N     . LEU B 194 ? 0.3854 0.7775 0.5785 -0.0052 0.0135  0.0789  166 LEU B N     
2681 C CA    . LEU B 194 ? 0.3473 0.7520 0.5454 0.0017  0.0197  0.0803  166 LEU B CA    
2682 C C     . LEU B 194 ? 0.3377 0.7476 0.5326 -0.0004 0.0254  0.0820  166 LEU B C     
2683 O O     . LEU B 194 ? 0.3190 0.7263 0.5059 0.0069  0.0306  0.0793  166 LEU B O     
2684 C CB    . LEU B 194 ? 0.2150 0.6399 0.4277 0.0032  0.0186  0.0846  166 LEU B CB    
2685 C CG    . LEU B 194 ? 0.5524 0.9761 0.7673 0.0114  0.0163  0.0849  166 LEU B CG    
2686 C CD1   . LEU B 194 ? 0.5005 0.9476 0.7297 0.0129  0.0137  0.0895  166 LEU B CD1   
2687 C CD2   . LEU B 194 ? 0.2224 0.6366 0.4335 0.0221  0.0222  0.0825  166 LEU B CD2   
2688 N N     . VAL B 195 ? 0.2352 0.6519 0.4359 -0.0098 0.0245  0.0866  167 VAL B N     
2689 C CA    . VAL B 195 ? 0.3088 0.7314 0.5078 -0.0120 0.0311  0.0914  167 VAL B CA    
2690 C C     . VAL B 195 ? 0.3548 0.7608 0.5349 -0.0095 0.0319  0.0882  167 VAL B C     
2691 O O     . VAL B 195 ? 0.4163 0.8253 0.5870 -0.0026 0.0382  0.0883  167 VAL B O     
2692 C CB    . VAL B 195 ? 0.3261 0.7559 0.5379 -0.0241 0.0297  0.0977  167 VAL B CB    
2693 C CG1   . VAL B 195 ? 0.2366 0.6700 0.4457 -0.0260 0.0380  0.1052  167 VAL B CG1   
2694 C CG2   . VAL B 195 ? 0.2924 0.7433 0.5251 -0.0266 0.0282  0.1003  167 VAL B CG2   
2695 N N     . SER B 196 ? 0.3903 0.7801 0.5646 -0.0142 0.0252  0.0852  168 SER B N     
2696 C CA    . SER B 196 ? 0.4398 0.8155 0.5985 -0.0122 0.0240  0.0821  168 SER B CA    
2697 C C     . SER B 196 ? 0.4017 0.7720 0.5514 -0.0025 0.0242  0.0742  168 SER B C     
2698 O O     . SER B 196 ? 0.3782 0.7456 0.5146 0.0024  0.0258  0.0714  168 SER B O     
2699 C CB    . SER B 196 ? 0.4485 0.8098 0.6060 -0.0180 0.0169  0.0804  168 SER B CB    
2700 O OG    . SER B 196 ? 0.4104 0.7734 0.5760 -0.0267 0.0159  0.0857  168 SER B OG    
2701 N N     . GLY B 197 ? 0.3397 0.7084 0.4966 0.0006  0.0224  0.0704  169 GLY B N     
2702 C CA    . GLY B 197 ? 0.3620 0.7224 0.5142 0.0089  0.0223  0.0624  169 GLY B CA    
2703 C C     . GLY B 197 ? 0.5063 0.8747 0.6521 0.0179  0.0290  0.0599  169 GLY B C     
2704 O O     . GLY B 197 ? 0.5425 0.9020 0.6775 0.0242  0.0282  0.0513  169 GLY B O     
2705 N N     . ILE B 198 ? 0.5314 0.9174 0.6848 0.0190  0.0354  0.0668  170 ILE B N     
2706 C CA    . ILE B 198 ? 0.4962 0.8930 0.6443 0.0289  0.0438  0.0659  170 ILE B CA    
2707 C C     . ILE B 198 ? 0.5109 0.9087 0.6420 0.0301  0.0469  0.0666  170 ILE B C     
2708 O O     . ILE B 198 ? 0.5573 0.9532 0.6735 0.0402  0.0500  0.0595  170 ILE B O     
2709 C CB    . ILE B 198 ? 0.4490 0.8682 0.6136 0.0293  0.0503  0.0748  170 ILE B CB    
2710 C CG1   . ILE B 198 ? 0.4328 0.8527 0.6115 0.0317  0.0472  0.0739  170 ILE B CG1   
2711 C CG2   . ILE B 198 ? 0.3747 0.8075 0.5335 0.0402  0.0610  0.0754  170 ILE B CG2   
2712 C CD1   . ILE B 198 ? 0.4371 0.8815 0.6341 0.0327  0.0516  0.0820  170 ILE B CD1   
2713 N N     . ILE B 199 ? 0.4594 0.8593 0.5916 0.0207  0.0459  0.0749  171 ILE B N     
2714 C CA    . ILE B 199 ? 0.4831 0.8837 0.5991 0.0219  0.0489  0.0785  171 ILE B CA    
2715 C C     . ILE B 199 ? 0.5140 0.8986 0.6114 0.0267  0.0416  0.0674  171 ILE B C     
2716 O O     . ILE B 199 ? 0.5995 0.9862 0.6782 0.0355  0.0444  0.0639  171 ILE B O     
2717 C CB    . ILE B 199 ? 0.4505 0.8520 0.5737 0.0103  0.0482  0.0898  171 ILE B CB    
2718 C CG1   . ILE B 199 ? 0.4407 0.8593 0.5850 0.0043  0.0544  0.1000  171 ILE B CG1   
2719 C CG2   . ILE B 199 ? 0.3345 0.7354 0.4400 0.0130  0.0515  0.0954  171 ILE B CG2   
2720 C CD1   . ILE B 199 ? 0.2886 0.7268 0.4325 0.0119  0.0668  0.1066  171 ILE B CD1   
2721 N N     . ILE B 200 ? 0.3912 0.7613 0.4943 0.0212  0.0322  0.0617  172 ILE B N     
2722 C CA    . ILE B 200 ? 0.4004 0.7566 0.4920 0.0240  0.0239  0.0507  172 ILE B CA    
2723 C C     . ILE B 200 ? 0.4321 0.7850 0.5161 0.0346  0.0244  0.0380  172 ILE B C     
2724 O O     . ILE B 200 ? 0.4796 0.8285 0.5466 0.0408  0.0208  0.0291  172 ILE B O     
2725 C CB    . ILE B 200 ? 0.4367 0.7803 0.5407 0.0161  0.0156  0.0484  172 ILE B CB    
2726 C CG1   . ILE B 200 ? 0.4100 0.7537 0.5174 0.0074  0.0140  0.0581  172 ILE B CG1   
2727 C CG2   . ILE B 200 ? 0.3975 0.7288 0.4957 0.0187  0.0072  0.0364  172 ILE B CG2   
2728 C CD1   . ILE B 200 ? 0.2944 0.6371 0.3867 0.0088  0.0117  0.0600  172 ILE B CD1   
2729 N N     . SER B 201 ? 0.4074 0.7618 0.5038 0.0373  0.0283  0.0368  173 SER B N     
2730 C CA    . SER B 201 ? 0.5334 0.8823 0.6251 0.0480  0.0297  0.0248  173 SER B CA    
2731 C C     . SER B 201 ? 0.5477 0.9063 0.6191 0.0592  0.0363  0.0216  173 SER B C     
2732 O O     . SER B 201 ? 0.4974 0.8473 0.5549 0.0681  0.0335  0.0075  173 SER B O     
2733 C CB    . SER B 201 ? 0.5307 0.8825 0.6400 0.0503  0.0345  0.0278  173 SER B CB    
2734 O OG    . SER B 201 ? 0.5100 0.8523 0.6348 0.0423  0.0287  0.0302  173 SER B OG    
2735 N N     . ILE B 202 ? 0.5159 0.8924 0.5858 0.0589  0.0452  0.0347  174 ILE B N     
2736 C CA    . ILE B 202 ? 0.5227 0.9115 0.5729 0.0700  0.0538  0.0353  174 ILE B CA    
2737 C C     . ILE B 202 ? 0.5198 0.9040 0.5470 0.0714  0.0479  0.0317  174 ILE B C     
2738 O O     . ILE B 202 ? 0.5316 0.9161 0.5359 0.0834  0.0485  0.0219  174 ILE B O     
2739 C CB    . ILE B 202 ? 0.5344 0.9454 0.5944 0.0679  0.0661  0.0530  174 ILE B CB    
2740 C CG1   . ILE B 202 ? 0.4506 0.8698 0.5339 0.0678  0.0709  0.0560  174 ILE B CG1   
2741 C CG2   . ILE B 202 ? 0.3836 0.8090 0.4226 0.0802  0.0771  0.0560  174 ILE B CG2   
2742 C CD1   . ILE B 202 ? 0.4257 0.8675 0.5258 0.0626  0.0804  0.0729  174 ILE B CD1   
2743 N N     . LEU B 203 ? 0.5085 0.8884 0.5410 0.0601  0.0415  0.0392  175 LEU B N     
2744 C CA    . LEU B 203 ? 0.5431 0.9196 0.5563 0.0612  0.0349  0.0378  175 LEU B CA    
2745 C C     . LEU B 203 ? 0.5908 0.9530 0.5941 0.0653  0.0223  0.0183  175 LEU B C     
2746 O O     . LEU B 203 ? 0.6164 0.9788 0.5984 0.0711  0.0164  0.0128  175 LEU B O     
2747 C CB    . LEU B 203 ? 0.5267 0.9005 0.5511 0.0486  0.0312  0.0502  175 LEU B CB    
2748 C CG    . LEU B 203 ? 0.5389 0.9254 0.5712 0.0437  0.0422  0.0693  175 LEU B CG    
2749 C CD1   . LEU B 203 ? 0.5922 0.9714 0.6352 0.0319  0.0371  0.0785  175 LEU B CD1   
2750 C CD2   . LEU B 203 ? 0.3791 0.7791 0.3900 0.0541  0.0518  0.0769  175 LEU B CD2   
2751 N N     . LEU B 204 ? 0.6451 0.9952 0.6648 0.0623  0.0177  0.0084  176 LEU B N     
2752 C CA    . LEU B 204 ? 0.7032 1.0387 0.7188 0.0653  0.0063  -0.0108 176 LEU B CA    
2753 C C     . LEU B 204 ? 0.8509 1.1877 0.8454 0.0803  0.0095  -0.0244 176 LEU B C     
2754 O O     . LEU B 204 ? 0.9028 1.2312 0.8838 0.0855  -0.0006 -0.0414 176 LEU B O     
2755 C CB    . LEU B 204 ? 0.5936 0.9152 0.6350 0.0580  0.0028  -0.0149 176 LEU B CB    
2756 C CG    . LEU B 204 ? 0.4969 0.8143 0.5575 0.0446  -0.0022 -0.0057 176 LEU B CG    
2757 C CD1   . LEU B 204 ? 0.4899 0.7959 0.5735 0.0402  -0.0026 -0.0075 176 LEU B CD1   
2758 C CD2   . LEU B 204 ? 0.4231 0.7362 0.4782 0.0410  -0.0141 -0.0114 176 LEU B CD2   
2759 N N     . LYS B 205 ? 0.8486 1.1970 0.8413 0.0876  0.0232  -0.0172 177 LYS B N     
2760 C CA    . LYS B 205 ? 0.7847 1.1363 0.7570 0.1039  0.0291  -0.0287 177 LYS B CA    
2761 C C     . LYS B 205 ? 0.8262 1.1931 0.7682 0.1134  0.0335  -0.0244 177 LYS B C     
2762 O O     . LYS B 205 ? 0.9351 1.2999 0.8512 0.1260  0.0298  -0.0400 177 LYS B O     
2763 C CB    . LYS B 205 ? 0.7462 1.1061 0.7322 0.1088  0.0430  -0.0218 177 LYS B CB    
2764 C CG    . LYS B 205 ? 0.7407 1.1094 0.7056 0.1273  0.0533  -0.0291 177 LYS B CG    
2765 C CD    . LYS B 205 ? 0.8070 1.1561 0.7590 0.1370  0.0445  -0.0548 177 LYS B CD    
2766 C CE    . LYS B 205 ? 0.8614 1.2182 0.7906 0.1574  0.0554  -0.0637 177 LYS B CE    
2767 N NZ    . LYS B 205 ? 0.8774 1.2122 0.7935 0.1669  0.0455  -0.0915 177 LYS B NZ    
2768 N N     . THR B 206 ? 0.7601 1.1417 0.7051 0.1077  0.0412  -0.0032 178 THR B N     
2769 C CA    . THR B 206 ? 0.7540 1.1518 0.6725 0.1170  0.0488  0.0061  178 THR B CA    
2770 C C     . THR B 206 ? 0.7808 1.1756 0.6834 0.1145  0.0370  0.0063  178 THR B C     
2771 O O     . THR B 206 ? 0.8597 1.2636 0.7321 0.1264  0.0384  0.0061  178 THR B O     
2772 C CB    . THR B 206 ? 0.6551 1.0713 0.5868 0.1128  0.0649  0.0308  178 THR B CB    
2773 O OG1   . THR B 206 ? 0.5663 0.9783 0.5183 0.0962  0.0601  0.0438  178 THR B OG1   
2774 C CG2   . THR B 206 ? 0.4644 0.8868 0.4160 0.1146  0.0753  0.0318  178 THR B CG2   
2775 N N     . SER B 207 ? 0.6234 1.0067 0.5456 0.1002  0.0258  0.0073  179 SER B N     
2776 C CA    . SER B 207 ? 0.5263 0.9081 0.4379 0.0973  0.0150  0.0098  179 SER B CA    
2777 C C     . SER B 207 ? 0.5592 0.9251 0.4856 0.0883  -0.0023 -0.0044 179 SER B C     
2778 O O     . SER B 207 ? 0.5911 0.9525 0.5369 0.0762  -0.0061 0.0047  179 SER B O     
2779 C CB    . SER B 207 ? 0.5765 0.9654 0.4987 0.0885  0.0226  0.0342  179 SER B CB    
2780 O OG    . SER B 207 ? 0.6779 1.0823 0.5935 0.0945  0.0397  0.0494  179 SER B OG    
2781 N N     . PRO B 208 ? 0.6453 1.0026 0.5633 0.0944  -0.0124 -0.0270 180 PRO B N     
2782 C CA    . PRO B 208 ? 0.6055 0.9481 0.5416 0.0853  -0.0282 -0.0408 180 PRO B CA    
2783 C C     . PRO B 208 ? 0.6362 0.9821 0.5687 0.0813  -0.0407 -0.0380 180 PRO B C     
2784 O O     . PRO B 208 ? 0.4543 0.7928 0.4108 0.0698  -0.0487 -0.0376 180 PRO B O     
2785 C CB    . PRO B 208 ? 0.5372 0.8716 0.4604 0.0950  -0.0356 -0.0660 180 PRO B CB    
2786 C CG    . PRO B 208 ? 0.6044 0.9465 0.5096 0.1081  -0.0204 -0.0642 180 PRO B CG    
2787 C CD    . PRO B 208 ? 0.7004 1.0607 0.5929 0.1104  -0.0092 -0.0413 180 PRO B CD    
2788 N N     . LYS B 209 ? 0.6409 0.9991 0.5437 0.0920  -0.0417 -0.0350 181 LYS B N     
2789 C CA    . LYS B 209 ? 0.5437 0.9071 0.4400 0.0913  -0.0542 -0.0324 181 LYS B CA    
2790 C C     . LYS B 209 ? 0.5198 0.8844 0.4344 0.0809  -0.0492 -0.0100 181 LYS B C     
2791 O O     . LYS B 209 ? 0.5807 0.9471 0.4988 0.0780  -0.0596 -0.0070 181 LYS B O     
2792 C CB    . LYS B 209 ? 0.5400 0.9173 0.3965 0.1077  -0.0554 -0.0330 181 LYS B CB    
2793 C CG    . LYS B 209 ? 0.8151 1.1907 0.6498 0.1193  -0.0640 -0.0590 181 LYS B CG    
2794 C CD    . LYS B 209 ? 0.8713 1.2626 0.6623 0.1380  -0.0617 -0.0578 181 LYS B CD    
2795 C CE    . LYS B 209 ? 0.9931 1.3951 0.7710 0.1407  -0.0739 -0.0506 181 LYS B CE    
2796 N NZ    . LYS B 209 ? 1.0624 1.4806 0.7946 0.1607  -0.0722 -0.0492 181 LYS B NZ    
2797 N N     . LEU B 210 ? 0.5668 0.9306 0.4937 0.0757  -0.0339 0.0048  182 LEU B N     
2798 C CA    . LEU B 210 ? 0.5852 0.9475 0.5308 0.0654  -0.0289 0.0238  182 LEU B CA    
2799 C C     . LEU B 210 ? 0.5982 0.9492 0.5727 0.0533  -0.0378 0.0178  182 LEU B C     
2800 O O     . LEU B 210 ? 0.5897 0.9387 0.5767 0.0466  -0.0397 0.0281  182 LEU B O     
2801 C CB    . LEU B 210 ? 0.5317 0.8968 0.4848 0.0625  -0.0117 0.0384  182 LEU B CB    
2802 C CG    . LEU B 210 ? 0.6196 0.9819 0.5921 0.0517  -0.0060 0.0565  182 LEU B CG    
2803 C CD1   . LEU B 210 ? 0.6319 0.9979 0.5918 0.0548  -0.0074 0.0700  182 LEU B CD1   
2804 C CD2   . LEU B 210 ? 0.6390 1.0062 0.6208 0.0486  0.0092  0.0677  182 LEU B CD2   
2805 N N     . PHE B 211 ? 0.5935 0.9368 0.5786 0.0514  -0.0425 0.0014  183 PHE B N     
2806 C CA    . PHE B 211 ? 0.5941 0.9272 0.6074 0.0406  -0.0491 -0.0036 183 PHE B CA    
2807 C C     . PHE B 211 ? 0.6346 0.9662 0.6502 0.0408  -0.0657 -0.0193 183 PHE B C     
2808 O O     . PHE B 211 ? 0.6034 0.9284 0.6438 0.0321  -0.0719 -0.0232 183 PHE B O     
2809 C CB    . PHE B 211 ? 0.6310 0.9555 0.6594 0.0374  -0.0425 -0.0089 183 PHE B CB    
2810 C CG    . PHE B 211 ? 0.6700 0.9986 0.6993 0.0370  -0.0277 0.0050  183 PHE B CG    
2811 C CD1   . PHE B 211 ? 0.5861 0.9220 0.5978 0.0462  -0.0188 0.0052  183 PHE B CD1   
2812 C CD2   . PHE B 211 ? 0.7688 1.0952 0.8174 0.0277  -0.0228 0.0172  183 PHE B CD2   
2813 C CE1   . PHE B 211 ? 0.6187 0.9610 0.6354 0.0450  -0.0056 0.0182  183 PHE B CE1   
2814 C CE2   . PHE B 211 ? 0.7712 1.1027 0.8229 0.0264  -0.0111 0.0285  183 PHE B CE2   
2815 C CZ    . PHE B 211 ? 0.7424 1.0825 0.7800 0.0345  -0.0026 0.0294  183 PHE B CZ    
2816 N N     . LEU B 212 ? 0.6151 0.9540 0.6053 0.0510  -0.0731 -0.0281 184 LEU B N     
2817 C CA    . LEU B 212 ? 0.6090 0.9483 0.6006 0.0517  -0.0910 -0.0459 184 LEU B CA    
2818 C C     . LEU B 212 ? 0.7540 1.1067 0.7286 0.0578  -0.1004 -0.0410 184 LEU B C     
2819 O O     . LEU B 212 ? 0.8452 1.2068 0.7887 0.0700  -0.1031 -0.0453 184 LEU B O     
2820 C CB    . LEU B 212 ? 0.5655 0.9003 0.5419 0.0595  -0.0954 -0.0673 184 LEU B CB    
2821 C CG    . LEU B 212 ? 0.5709 0.8910 0.5644 0.0553  -0.0879 -0.0744 184 LEU B CG    
2822 C CD1   . LEU B 212 ? 0.4928 0.8077 0.4674 0.0656  -0.0918 -0.0960 184 LEU B CD1   
2823 C CD2   . LEU B 212 ? 0.4403 0.7497 0.4708 0.0417  -0.0938 -0.0771 184 LEU B CD2   
2824 N N     . PRO B 213 ? 0.7650 1.1201 0.7592 0.0506  -0.1049 -0.0313 185 PRO B N     
2825 C CA    . PRO B 213 ? 0.7725 1.1406 0.7548 0.0567  -0.1150 -0.0260 185 PRO B CA    
2826 C C     . PRO B 213 ? 0.7085 1.0829 0.6929 0.0582  -0.1358 -0.0466 185 PRO B C     
2827 O O     . PRO B 213 ? 0.7395 1.1260 0.6974 0.0694  -0.1454 -0.0510 185 PRO B O     
2828 C CB    . PRO B 213 ? 0.6838 1.0499 0.6915 0.0479  -0.1110 -0.0097 185 PRO B CB    
2829 C CG    . PRO B 213 ? 0.6055 0.9597 0.6432 0.0361  -0.1075 -0.0154 185 PRO B CG    
2830 C CD    . PRO B 213 ? 0.6540 1.0004 0.6809 0.0381  -0.0992 -0.0231 185 PRO B CD    
2831 N "N1'" . TPP C .   ? 0.4230 0.7700 0.5339 0.0422  -0.0405 0.0659  301 TPP A "N1'" 
2832 C "C2'" . TPP C .   ? 0.4861 0.8399 0.5841 0.0341  -0.0340 0.0590  301 TPP A "C2'" 
2833 C CM2   . TPP C .   ? 0.3122 0.6851 0.4021 0.0299  -0.0351 0.0534  301 TPP A CM2   
2834 N "N3'" . TPP C .   ? 0.4705 0.8142 0.5658 0.0299  -0.0266 0.0561  301 TPP A "N3'" 
2835 C "C4'" . TPP C .   ? 0.4356 0.7630 0.5398 0.0330  -0.0258 0.0595  301 TPP A "C4'" 
2836 N "N4'" . TPP C .   ? 0.4283 0.7478 0.5311 0.0287  -0.0193 0.0560  301 TPP A "N4'" 
2837 C "C5'" . TPP C .   ? 0.3921 0.7121 0.5092 0.0408  -0.0318 0.0652  301 TPP A "C5'" 
2838 C "C6'" . TPP C .   ? 0.3914 0.7212 0.5125 0.0457  -0.0391 0.0687  301 TPP A "C6'" 
2839 C "C7'" . TPP C .   ? 0.3321 0.6347 0.4621 0.0439  -0.0306 0.0665  301 TPP A "C7'" 
2840 N N3    . TPP C .   ? 0.3633 0.6622 0.5002 0.0455  -0.0251 0.0528  301 TPP A N3    
2841 C C2    . TPP C .   ? 0.4884 0.7971 0.6240 0.0462  -0.0223 0.0419  301 TPP A C2    
2842 S S1    . TPP C .   ? 0.3961 0.6997 0.5381 0.0472  -0.0173 0.0307  301 TPP A S1    
2843 C C5    . TPP C .   ? 0.3367 0.6256 0.4851 0.0469  -0.0182 0.0365  301 TPP A C5    
2844 C C4    . TPP C .   ? 0.3701 0.6562 0.5159 0.0459  -0.0224 0.0497  301 TPP A C4    
2845 C CM4   . TPP C .   ? 0.4297 0.7016 0.5823 0.0447  -0.0237 0.0596  301 TPP A CM4   
2846 C C6    . TPP C .   ? 0.4296 0.7114 0.5860 0.0471  -0.0148 0.0271  301 TPP A C6    
2847 C C7    . TPP C .   ? 0.4998 0.7776 0.6725 0.0542  -0.0168 0.0218  301 TPP A C7    
2848 O O7    . TPP C .   ? 0.5943 0.8839 0.7670 0.0582  -0.0173 0.0169  301 TPP A O7    
2849 P PA    . TPP C .   ? 0.9336 1.2264 1.1200 0.0639  -0.0157 0.0041  301 TPP A PA    
2850 O O1A   . TPP C .   ? 0.8754 1.1828 1.0533 0.0630  -0.0123 -0.0028 301 TPP A O1A   
2851 O O2A   . TPP C .   ? 0.9480 1.2384 1.1518 0.0711  -0.0200 0.0068  301 TPP A O2A   
2852 O O3A   . TPP C .   ? 1.2789 1.5626 1.4705 0.0614  -0.0128 -0.0037 301 TPP A O3A   
2853 P PB    . TPP C .   ? 0.6825 0.9745 0.8719 0.0600  -0.0082 -0.0189 301 TPP A PB    
2854 O O1B   . TPP C .   ? 0.7517 1.0576 0.9414 0.0634  -0.0063 -0.0257 301 TPP A O1B   
2855 O O2B   . TPP C .   ? 0.6272 0.9107 0.8319 0.0608  -0.0073 -0.0287 301 TPP A O2B   
2856 O O3B   . TPP C .   ? 0.7992 1.0952 0.9728 0.0536  -0.0067 -0.0168 301 TPP A O3B   
2933 C C1    . BGL H .   ? 1.0737 1.4664 1.3676 0.0087  0.0335  0.1027  306 BGL A C1    
2934 O O1    . BGL H .   ? 1.2073 1.5960 1.4823 0.0096  0.0263  0.0998  306 BGL A O1    
2935 C C2    . BGL H .   ? 0.9339 1.3337 1.2060 0.0091  0.0345  0.1108  306 BGL A C2    
2936 O O2    . BGL H .   ? 0.9151 1.3147 1.1578 0.0117  0.0358  0.0967  306 BGL A O2    
2937 C C3    . BGL H .   ? 0.9005 1.3046 1.1954 0.0078  0.0423  0.1165  306 BGL A C3    
2938 O O3    . BGL H .   ? 0.8096 1.2214 1.0831 0.0074  0.0442  0.1242  306 BGL A O3    
2939 C C4    . BGL H .   ? 1.0028 1.4067 1.3355 0.0053  0.0418  0.1309  306 BGL A C4    
2940 O O4    . BGL H .   ? 0.9152 1.3227 1.2743 0.0040  0.0504  0.1347  306 BGL A O4    
2941 C C5    . BGL H .   ? 1.0765 1.4736 1.4344 0.0049  0.0406  0.1217  306 BGL A C5    
2942 O O5    . BGL H .   ? 1.0855 1.4779 1.4191 0.0062  0.0339  0.1138  306 BGL A O5    
2943 C C6    . BGL H .   ? 1.0883 1.4851 1.4851 0.0026  0.0383  0.1379  306 BGL A C6    
2944 O O6    . BGL H .   ? 1.0714 1.4631 1.4807 0.0021  0.0319  0.1376  306 BGL A O6    
2945 C "C1'" . BGL H .   ? 0.7676 1.1670 0.9802 0.0129  0.0294  0.0948  306 BGL A "C1'" 
2946 C "C2'" . BGL H .   ? 0.7103 1.1091 0.8990 0.0157  0.0312  0.0802  306 BGL A "C2'" 
2947 C "C3'" . BGL H .   ? 0.7390 1.1460 0.9127 0.0159  0.0361  0.0803  306 BGL A "C3'" 
2948 C "C4'" . BGL H .   ? 0.7680 1.1761 0.9159 0.0181  0.0350  0.0693  306 BGL A "C4'" 
2949 C "C5'" . BGL H .   ? 0.7232 1.1415 0.8544 0.0167  0.0389  0.0706  306 BGL A "C5'" 
2950 C "C6'" . BGL H .   ? 0.6318 1.0532 0.7674 0.0180  0.0470  0.0631  306 BGL A "C6'" 
2951 C "C7'" . BGL H .   ? 0.5231 0.9445 0.6453 0.0212  0.0481  0.0474  306 BGL A "C7'" 
2952 C "C8'" . BGL H .   ? 0.4066 0.8361 0.5073 0.0193  0.0482  0.0442  306 BGL A "C8'" 
2971 N "N1'" . TPP J .   ? 0.4968 0.8345 0.6575 -0.0619 -0.0914 -0.0180 301 TPP B "N1'" 
2972 C "C2'" . TPP J .   ? 0.5920 0.9321 0.7294 -0.0468 -0.0869 -0.0153 301 TPP B "C2'" 
2973 C CM2   . TPP J .   ? 0.5927 0.9555 0.7195 -0.0374 -0.0937 -0.0170 301 TPP B CM2   
2974 N "N3'" . TPP J .   ? 0.5684 0.8915 0.6938 -0.0400 -0.0761 -0.0098 301 TPP B "N3'" 
2975 C "C4'" . TPP J .   ? 0.4657 0.7692 0.5999 -0.0471 -0.0705 -0.0074 301 TPP B "C4'" 
2976 N "N4'" . TPP J .   ? 0.4738 0.7636 0.5980 -0.0401 -0.0612 -0.0022 301 TPP B "N4'" 
2977 C "C5'" . TPP J .   ? 0.5204 0.8202 0.6756 -0.0613 -0.0744 -0.0091 301 TPP B "C5'" 
2978 C "C6'" . TPP J .   ? 0.5397 0.8565 0.7091 -0.0693 -0.0845 -0.0143 301 TPP B "C6'" 
2979 C "C7'" . TPP J .   ? 0.5564 0.8349 0.7206 -0.0681 -0.0679 -0.0043 301 TPP B "C7'" 
2980 N N3    . TPP J .   ? 0.5035 0.7850 0.6713 -0.0664 -0.0569 0.0109  301 TPP B N3    
2981 C C2    . TPP J .   ? 0.4964 0.7974 0.6654 -0.0625 -0.0528 0.0198  301 TPP B C2    
2982 S S1    . TPP J .   ? 0.3871 0.6849 0.5587 -0.0612 -0.0419 0.0331  301 TPP B S1    
2983 C C5    . TPP J .   ? 0.4411 0.7150 0.6129 -0.0654 -0.0416 0.0302  301 TPP B C5    
2984 C C4    . TPP J .   ? 0.4104 0.6753 0.5808 -0.0681 -0.0498 0.0176  301 TPP B C4    
2985 C CM4   . TPP J .   ? 0.3907 0.6305 0.5617 -0.0714 -0.0511 0.0118  301 TPP B CM4   
2986 C C6    . TPP J .   ? 0.4924 0.7573 0.6650 -0.0646 -0.0332 0.0408  301 TPP B C6    
2987 C C7    . TPP J .   ? 0.5757 0.8421 0.7651 -0.0752 -0.0311 0.0480  301 TPP B C7    
2988 O O7    . TPP J .   ? 0.6248 0.9132 0.8215 -0.0765 -0.0297 0.0528  301 TPP B O7    
2989 P PA    . TPP J .   ? 0.7950 1.0932 1.0103 -0.0859 -0.0255 0.0622  301 TPP B PA    
2990 O O1A   . TPP J .   ? 0.7468 1.0503 0.9801 -0.0969 -0.0329 0.0561  301 TPP B O1A   
2991 O O2A   . TPP J .   ? 0.7251 1.0432 0.9403 -0.0811 -0.0201 0.0692  301 TPP B O2A   
2992 O O3A   . TPP J .   ? 2.2269 2.5057 2.4414 -0.0877 -0.0194 0.0704  301 TPP B O3A   
2993 P PB    . TPP J .   ? 0.5657 0.8467 0.7713 -0.0810 -0.0103 0.0823  301 TPP B PB    
2994 O O1B   . TPP J .   ? 0.4882 0.7791 0.6807 -0.0710 -0.0103 0.0792  301 TPP B O1B   
2995 O O2B   . TPP J .   ? 0.7716 1.0665 0.9900 -0.0864 -0.0038 0.0931  301 TPP B O2B   
2996 O O3B   . TPP J .   ? 0.6089 0.8689 0.8072 -0.0784 -0.0083 0.0860  301 TPP B O3B   
3037 C C1    . BGL M .   ? 1.3186 1.6723 1.3908 0.1027  0.0020  0.0636  304 BGL B C1    
3038 O O1    . BGL M .   ? 1.3426 1.6886 1.4298 0.1042  0.0115  0.0743  304 BGL B O1    
3039 C C2    . BGL M .   ? 1.3313 1.7038 1.3981 0.1145  0.0042  0.0685  304 BGL B C2    
3040 O O2    . BGL M .   ? 1.3076 1.6905 1.3869 0.1053  0.0010  0.0687  304 BGL B O2    
3041 C C3    . BGL M .   ? 1.2577 1.6371 1.3020 0.1223  -0.0033 0.0592  304 BGL B C3    
3042 O O3    . BGL M .   ? 1.2207 1.6202 1.2602 0.1336  -0.0020 0.0645  304 BGL B O3    
3043 C C4    . BGL M .   ? 1.2069 1.5758 1.2349 0.1335  -0.0001 0.0578  304 BGL B C4    
3044 O O4    . BGL M .   ? 1.0981 1.4712 1.1041 0.1379  -0.0107 0.0441  304 BGL B O4    
3045 C C5    . BGL M .   ? 1.2702 1.6186 1.3060 0.1239  0.0013  0.0560  304 BGL B C5    
3046 O O5    . BGL M .   ? 1.2438 1.5873 1.2987 0.1057  -0.0023 0.0546  304 BGL B O5    
3047 C C6    . BGL M .   ? 1.2368 1.5777 1.2773 0.1352  0.0149  0.0693  304 BGL B C6    
3048 O O6    . BGL M .   ? 1.1835 1.5312 1.2085 0.1557  0.0225  0.0759  304 BGL B O6    
3049 C "C1'" . BGL M .   ? 1.2823 1.6626 1.3823 0.0996  0.0074  0.0767  304 BGL B "C1'" 
3050 C "C2'" . BGL M .   ? 1.2598 1.6428 1.3703 0.0847  0.0014  0.0718  304 BGL B "C2'" 
3051 C "C3'" . BGL M .   ? 0.6472 1.0168 0.7590 0.0694  -0.0058 0.0629  304 BGL B "C3'" 
3052 C "C4'" . BGL M .   ? 0.5998 0.9754 0.7150 0.0571  -0.0138 0.0561  304 BGL B "C4'" 
3053 C "C5'" . BGL M .   ? 0.5680 0.9348 0.6943 0.0442  -0.0144 0.0555  304 BGL B "C5'" 
3054 C "C6'" . BGL M .   ? 0.6404 1.0149 0.7717 0.0339  -0.0198 0.0514  304 BGL B "C6'" 
3055 C "C7'" . BGL M .   ? 0.5639 0.9298 0.7028 0.0227  -0.0201 0.0511  304 BGL B "C7'" 
3056 C "C8'" . BGL M .   ? 0.2163 0.5900 0.3603 0.0135  -0.0242 0.0485  304 BGL B "C8'" 
3097 C C1    . BGL P .   ? 0.9327 1.3402 1.2094 0.0729  0.0631  0.0913  307 BGL B C1    
3098 O O1    . BGL P .   ? 0.9157 1.3132 1.2090 0.0742  0.0651  0.0879  307 BGL B O1    
3099 C C2    . BGL P .   ? 0.8561 1.2732 1.1269 0.0686  0.0613  0.0863  307 BGL B C2    
3100 O O2    . BGL P .   ? 0.6401 1.0649 0.8962 0.0623  0.0533  0.0851  307 BGL B O2    
3101 C C3    . BGL P .   ? 0.9611 1.3827 1.2302 0.0713  0.0663  0.0898  307 BGL B C3    
3102 O O3    . BGL P .   ? 0.9639 1.3929 1.2299 0.0687  0.0670  0.0852  307 BGL B O3    
3103 C C4    . BGL P .   ? 0.9321 1.3445 1.2149 0.0781  0.0745  0.0928  307 BGL B C4    
3104 O O4    . BGL P .   ? 0.7968 1.2139 1.0778 0.0807  0.0792  0.0966  307 BGL B O4    
3105 C C5    . BGL P .   ? 1.0444 1.4495 1.3296 0.0821  0.0755  0.0993  307 BGL B C5    
3106 O O5    . BGL P .   ? 0.9970 1.4032 1.2739 0.0791  0.0688  0.0991  307 BGL B O5    
3107 C C6    . BGL P .   ? 1.1449 1.5369 1.4499 0.0864  0.0822  0.0988  307 BGL B C6    
3108 O O6    . BGL P .   ? 1.1071 1.4948 1.4193 0.0924  0.0898  0.1049  307 BGL B O6    
3109 C "C1'" . BGL P .   ? 0.4055 0.8261 0.6484 0.0551  0.0484  0.0779  307 BGL B "C1'" 
3110 C "C2'" . BGL P .   ? 0.3870 0.8211 0.6200 0.0510  0.0455  0.0810  307 BGL B "C2'" 
3111 C "C3'" . BGL P .   ? 0.4910 0.9203 0.7092 0.0422  0.0376  0.0761  307 BGL B "C3'" 
3112 C "C4'" . BGL P .   ? 0.3578 0.7935 0.5703 0.0379  0.0311  0.0784  307 BGL B "C4'" 
3113 C "C5'" . BGL P .   ? 0.3752 0.8133 0.5792 0.0298  0.0261  0.0768  307 BGL B "C5'" 
3114 C "C6'" . BGL P .   ? 0.3084 0.7323 0.5027 0.0244  0.0222  0.0714  307 BGL B "C6'" 
3115 C "C7'" . BGL P .   ? 0.3930 0.8094 0.5818 0.0200  0.0151  0.0692  307 BGL B "C7'" 
3116 C "C8'" . BGL P .   ? 0.4929 0.8992 0.6727 0.0138  0.0112  0.0659  307 BGL B "C8'" 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -27 ?   ?   ?   A . n 
A 1 2   ASP 2   -26 ?   ?   ?   A . n 
A 1 3   TYR 3   -25 ?   ?   ?   A . n 
A 1 4   LYS 4   -24 ?   ?   ?   A . n 
A 1 5   ASP 5   -23 ?   ?   ?   A . n 
A 1 6   ASP 6   -22 ?   ?   ?   A . n 
A 1 7   ASP 7   -21 ?   ?   ?   A . n 
A 1 8   ASP 8   -20 ?   ?   ?   A . n 
A 1 9   LYS 9   -19 ?   ?   ?   A . n 
A 1 10  HIS 10  -18 ?   ?   ?   A . n 
A 1 11  HIS 11  -17 ?   ?   ?   A . n 
A 1 12  HIS 12  -16 ?   ?   ?   A . n 
A 1 13  HIS 13  -15 ?   ?   ?   A . n 
A 1 14  HIS 14  -14 ?   ?   ?   A . n 
A 1 15  HIS 15  -13 ?   ?   ?   A . n 
A 1 16  HIS 16  -12 ?   ?   ?   A . n 
A 1 17  HIS 17  -11 ?   ?   ?   A . n 
A 1 18  HIS 18  -10 ?   ?   ?   A . n 
A 1 19  HIS 19  -9  ?   ?   ?   A . n 
A 1 20  GLU 20  -8  ?   ?   ?   A . n 
A 1 21  ASN 21  -7  ?   ?   ?   A . n 
A 1 22  LEU 22  -6  ?   ?   ?   A . n 
A 1 23  TYR 23  -5  ?   ?   ?   A . n 
A 1 24  PHE 24  -4  ?   ?   ?   A . n 
A 1 25  GLN 25  -3  ?   ?   ?   A . n 
A 1 26  SER 26  -2  ?   ?   ?   A . n 
A 1 27  TYR 27  -1  ?   ?   ?   A . n 
A 1 28  VAL 28  0   ?   ?   ?   A . n 
A 1 29  MET 29  1   ?   ?   ?   A . n 
A 1 30  GLN 30  2   ?   ?   ?   A . n 
A 1 31  ASN 31  3   3   ASN ASN A . n 
A 1 32  LYS 32  4   4   LYS LYS A . n 
A 1 33  ARG 33  5   5   ARG ARG A . n 
A 1 34  LEU 34  6   6   LEU LEU A . n 
A 1 35  ILE 35  7   7   ILE ILE A . n 
A 1 36  ILE 36  8   8   ILE ILE A . n 
A 1 37  LEU 37  9   9   LEU LEU A . n 
A 1 38  LEU 38  10  10  LEU LEU A . n 
A 1 39  GLU 39  11  11  GLU GLU A . n 
A 1 40  CYS 40  12  12  CYS CYS A . n 
A 1 41  ALA 41  13  13  ALA ALA A . n 
A 1 42  ILE 42  14  14  ILE ILE A . n 
A 1 43  PHE 43  15  15  PHE PHE A . n 
A 1 44  ALA 44  16  16  ALA ALA A . n 
A 1 45  ALA 45  17  17  ALA ALA A . n 
A 1 46  VAL 46  18  18  VAL VAL A . n 
A 1 47  ALA 47  19  19  ALA ALA A . n 
A 1 48  MET 48  20  20  MET MET A . n 
A 1 49  VAL 49  21  21  VAL VAL A . n 
A 1 50  LEU 50  22  22  LEU LEU A . n 
A 1 51  SER 51  23  23  SER SER A . n 
A 1 52  PHE 52  24  24  PHE PHE A . n 
A 1 53  ILE 53  25  25  ILE ILE A . n 
A 1 54  PRO 54  26  26  PRO PRO A . n 
A 1 55  LEU 55  27  27  LEU LEU A . n 
A 1 56  ASP 56  28  28  ASP ASP A . n 
A 1 57  ILE 57  29  29  ILE ILE A . n 
A 1 58  GLY 58  30  30  GLY GLY A . n 
A 1 59  SER 59  31  31  SER SER A . n 
A 1 60  SER 60  32  32  SER SER A . n 
A 1 61  PHE 61  33  33  PHE PHE A . n 
A 1 62  SER 62  34  34  SER SER A . n 
A 1 63  ILE 63  35  35  ILE ILE A . n 
A 1 64  SER 64  36  36  SER SER A . n 
A 1 65  LEU 65  37  37  LEU LEU A . n 
A 1 66  GLY 66  38  38  GLY GLY A . n 
A 1 67  MET 67  39  39  MET MET A . n 
A 1 68  ILE 68  40  40  ILE ILE A . n 
A 1 69  PRO 69  41  41  PRO PRO A . n 
A 1 70  MET 70  42  42  MET MET A . n 
A 1 71  TYR 71  43  43  TYR TYR A . n 
A 1 72  VAL 72  44  44  VAL VAL A . n 
A 1 73  ILE 73  45  45  ILE ILE A . n 
A 1 74  ALA 74  46  46  ALA ALA A . n 
A 1 75  ILE 75  47  47  ILE ILE A . n 
A 1 76  ARG 76  48  48  ARG ARG A . n 
A 1 77  ARG 77  49  49  ARG ARG A . n 
A 1 78  GLY 78  50  50  GLY GLY A . n 
A 1 79  PHE 79  51  51  PHE PHE A . n 
A 1 80  TRP 80  52  52  TRP TRP A . n 
A 1 81  ALA 81  53  53  ALA ALA A . n 
A 1 82  ALA 82  54  54  ALA ALA A . n 
A 1 83  GLY 83  55  55  GLY GLY A . n 
A 1 84  PHE 84  56  56  PHE PHE A . n 
A 1 85  ALA 85  57  57  ALA ALA A . n 
A 1 86  GLY 86  58  58  GLY GLY A . n 
A 1 87  LEU 87  59  59  LEU LEU A . n 
A 1 88  LEU 88  60  60  LEU LEU A . n 
A 1 89  TRP 89  61  61  TRP TRP A . n 
A 1 90  GLY 90  62  62  GLY GLY A . n 
A 1 91  LEU 91  63  63  LEU LEU A . n 
A 1 92  LEU 92  64  64  LEU LEU A . n 
A 1 93  HIS 93  65  65  HIS HIS A . n 
A 1 94  PHE 94  66  66  PHE PHE A . n 
A 1 95  LEU 95  67  67  LEU LEU A . n 
A 1 96  THR 96  68  68  THR THR A . n 
A 1 97  GLY 97  69  69  GLY GLY A . n 
A 1 98  LYS 98  70  70  LYS LYS A . n 
A 1 99  ALA 99  71  71  ALA ALA A . n 
A 1 100 TYR 100 72  72  TYR TYR A . n 
A 1 101 ILE 101 73  73  ILE ILE A . n 
A 1 102 LEU 102 74  74  LEU LEU A . n 
A 1 103 MET 103 75  75  MET MET A . n 
A 1 104 PRO 104 76  76  PRO PRO A . n 
A 1 105 SER 105 77  77  SER SER A . n 
A 1 106 GLN 106 78  78  GLN GLN A . n 
A 1 107 ALA 107 79  79  ALA ALA A . n 
A 1 108 ILE 108 80  80  ILE ILE A . n 
A 1 109 ILE 109 81  81  ILE ILE A . n 
A 1 110 GLU 110 82  82  GLU GLU A . n 
A 1 111 TYR 111 83  83  TYR TYR A . n 
A 1 112 ILE 112 84  84  ILE ILE A . n 
A 1 113 LEU 113 85  85  LEU LEU A . n 
A 1 114 ALA 114 86  86  ALA ALA A . n 
A 1 115 PHE 115 87  87  PHE PHE A . n 
A 1 116 SER 116 88  88  SER SER A . n 
A 1 117 PHE 117 89  89  PHE PHE A . n 
A 1 118 ILE 118 90  90  ILE ILE A . n 
A 1 119 ALA 119 91  91  ALA ALA A . n 
A 1 120 PHE 120 92  92  PHE PHE A . n 
A 1 121 SER 121 93  93  SER SER A . n 
A 1 122 GLY 122 94  94  GLY GLY A . n 
A 1 123 VAL 123 95  95  VAL VAL A . n 
A 1 124 PHE 124 96  96  PHE PHE A . n 
A 1 125 SER 125 97  97  SER SER A . n 
A 1 126 LYS 126 98  98  LYS LYS A . n 
A 1 127 GLN 127 99  99  GLN GLN A . n 
A 1 128 VAL 128 100 100 VAL VAL A . n 
A 1 129 ARG 129 101 101 ARG ARG A . n 
A 1 130 SER 130 102 102 SER SER A . n 
A 1 131 ASN 131 103 103 ASN ASN A . n 
A 1 132 LEU 132 104 104 LEU LEU A . n 
A 1 133 ALA 133 105 105 ALA ALA A . n 
A 1 134 ALA 134 106 106 ALA ALA A . n 
A 1 135 ASN 135 107 107 ASN ASN A . n 
A 1 136 GLN 136 108 108 GLN GLN A . n 
A 1 137 LEU 137 109 109 LEU LEU A . n 
A 1 138 LYS 138 110 110 LYS LYS A . n 
A 1 139 LYS 139 111 111 LYS LYS A . n 
A 1 140 ALA 140 112 112 ALA ALA A . n 
A 1 141 ILE 141 113 113 ILE ILE A . n 
A 1 142 GLU 142 114 114 GLU GLU A . n 
A 1 143 TRP 143 115 115 TRP TRP A . n 
A 1 144 ALA 144 116 116 ALA ALA A . n 
A 1 145 TRP 145 117 117 TRP TRP A . n 
A 1 146 GLY 146 118 118 GLY GLY A . n 
A 1 147 THR 147 119 119 THR THR A . n 
A 1 148 MET 148 120 120 MET MET A . n 
A 1 149 ILE 149 121 121 ILE ILE A . n 
A 1 150 ILE 150 122 122 ILE ILE A . n 
A 1 151 GLY 151 123 123 GLY GLY A . n 
A 1 152 GLY 152 124 124 GLY GLY A . n 
A 1 153 VAL 153 125 125 VAL VAL A . n 
A 1 154 ALA 154 126 126 ALA ALA A . n 
A 1 155 ARG 155 127 127 ARG ARG A . n 
A 1 156 TYR 156 128 128 TYR TYR A . n 
A 1 157 PHE 157 129 129 PHE PHE A . n 
A 1 158 TRP 158 130 130 TRP TRP A . n 
A 1 159 HIS 159 131 131 HIS HIS A . n 
A 1 160 TYR 160 132 132 TYR TYR A . n 
A 1 161 VAL 161 133 133 VAL VAL A . n 
A 1 162 ALA 162 134 134 ALA ALA A . n 
A 1 163 GLY 163 135 135 GLY GLY A . n 
A 1 164 VAL 164 136 136 VAL VAL A . n 
A 1 165 LEU 165 137 137 LEU LEU A . n 
A 1 166 PHE 166 138 138 PHE PHE A . n 
A 1 167 TRP 167 139 139 TRP TRP A . n 
A 1 168 GLY 168 140 140 GLY GLY A . n 
A 1 169 ALA 169 141 141 ALA ALA A . n 
A 1 170 TYR 170 142 142 TYR TYR A . n 
A 1 171 ALA 171 143 143 ALA ALA A . n 
A 1 172 PHE 172 144 144 PHE PHE A . n 
A 1 173 GLN 173 145 145 GLN GLN A . n 
A 1 174 GLY 174 146 146 GLY GLY A . n 
A 1 175 TRP 175 147 147 TRP TRP A . n 
A 1 176 GLY 176 148 148 GLY GLY A . n 
A 1 177 ALA 177 149 149 ALA ALA A . n 
A 1 178 GLN 178 150 150 GLN GLN A . n 
A 1 179 LEU 179 151 151 LEU LEU A . n 
A 1 180 PHE 180 152 152 PHE PHE A . n 
A 1 181 SER 181 153 153 SER SER A . n 
A 1 182 ILE 182 154 154 ILE ILE A . n 
A 1 183 VAL 183 155 155 VAL VAL A . n 
A 1 184 MET 184 156 156 MET MET A . n 
A 1 185 ASN 185 157 157 ASN ASN A . n 
A 1 186 GLY 186 158 158 GLY GLY A . n 
A 1 187 ALA 187 159 159 ALA ALA A . n 
A 1 188 SER 188 160 160 SER SER A . n 
A 1 189 CYS 189 161 161 CYS CYS A . n 
A 1 190 LEU 190 162 162 LEU LEU A . n 
A 1 191 GLY 191 163 163 GLY GLY A . n 
A 1 192 THR 192 164 164 THR THR A . n 
A 1 193 VAL 193 165 165 VAL VAL A . n 
A 1 194 LEU 194 166 166 LEU LEU A . n 
A 1 195 VAL 195 167 167 VAL VAL A . n 
A 1 196 SER 196 168 168 SER SER A . n 
A 1 197 GLY 197 169 169 GLY GLY A . n 
A 1 198 ILE 198 170 170 ILE ILE A . n 
A 1 199 ILE 199 171 171 ILE ILE A . n 
A 1 200 ILE 200 172 172 ILE ILE A . n 
A 1 201 SER 201 173 173 SER SER A . n 
A 1 202 ILE 202 174 174 ILE ILE A . n 
A 1 203 LEU 203 175 175 LEU LEU A . n 
A 1 204 LEU 204 176 176 LEU LEU A . n 
A 1 205 LYS 205 177 177 LYS LYS A . n 
A 1 206 THR 206 178 178 THR THR A . n 
A 1 207 SER 207 179 179 SER SER A . n 
A 1 208 PRO 208 180 180 PRO PRO A . n 
A 1 209 LYS 209 181 181 LYS LYS A . n 
A 1 210 LEU 210 182 182 LEU LEU A . n 
A 1 211 PHE 211 183 183 PHE PHE A . n 
A 1 212 LEU 212 184 184 LEU LEU A . n 
A 1 213 PRO 213 185 185 PRO PRO A . n 
A 1 214 LYS 214 186 ?   ?   ?   A . n 
B 1 1   MET 1   -27 ?   ?   ?   B . n 
B 1 2   ASP 2   -26 ?   ?   ?   B . n 
B 1 3   TYR 3   -25 ?   ?   ?   B . n 
B 1 4   LYS 4   -24 ?   ?   ?   B . n 
B 1 5   ASP 5   -23 ?   ?   ?   B . n 
B 1 6   ASP 6   -22 ?   ?   ?   B . n 
B 1 7   ASP 7   -21 ?   ?   ?   B . n 
B 1 8   ASP 8   -20 ?   ?   ?   B . n 
B 1 9   LYS 9   -19 ?   ?   ?   B . n 
B 1 10  HIS 10  -18 ?   ?   ?   B . n 
B 1 11  HIS 11  -17 ?   ?   ?   B . n 
B 1 12  HIS 12  -16 ?   ?   ?   B . n 
B 1 13  HIS 13  -15 ?   ?   ?   B . n 
B 1 14  HIS 14  -14 ?   ?   ?   B . n 
B 1 15  HIS 15  -13 ?   ?   ?   B . n 
B 1 16  HIS 16  -12 ?   ?   ?   B . n 
B 1 17  HIS 17  -11 ?   ?   ?   B . n 
B 1 18  HIS 18  -10 ?   ?   ?   B . n 
B 1 19  HIS 19  -9  ?   ?   ?   B . n 
B 1 20  GLU 20  -8  ?   ?   ?   B . n 
B 1 21  ASN 21  -7  ?   ?   ?   B . n 
B 1 22  LEU 22  -6  ?   ?   ?   B . n 
B 1 23  TYR 23  -5  ?   ?   ?   B . n 
B 1 24  PHE 24  -4  ?   ?   ?   B . n 
B 1 25  GLN 25  -3  ?   ?   ?   B . n 
B 1 26  SER 26  -2  ?   ?   ?   B . n 
B 1 27  TYR 27  -1  ?   ?   ?   B . n 
B 1 28  VAL 28  0   0   VAL VAL B . n 
B 1 29  MET 29  1   1   MET MET B . n 
B 1 30  GLN 30  2   2   GLN GLN B . n 
B 1 31  ASN 31  3   3   ASN ASN B . n 
B 1 32  LYS 32  4   4   LYS LYS B . n 
B 1 33  ARG 33  5   5   ARG ARG B . n 
B 1 34  LEU 34  6   6   LEU LEU B . n 
B 1 35  ILE 35  7   7   ILE ILE B . n 
B 1 36  ILE 36  8   8   ILE ILE B . n 
B 1 37  LEU 37  9   9   LEU LEU B . n 
B 1 38  LEU 38  10  10  LEU LEU B . n 
B 1 39  GLU 39  11  11  GLU GLU B . n 
B 1 40  CYS 40  12  12  CYS CYS B . n 
B 1 41  ALA 41  13  13  ALA ALA B . n 
B 1 42  ILE 42  14  14  ILE ILE B . n 
B 1 43  PHE 43  15  15  PHE PHE B . n 
B 1 44  ALA 44  16  16  ALA ALA B . n 
B 1 45  ALA 45  17  17  ALA ALA B . n 
B 1 46  VAL 46  18  18  VAL VAL B . n 
B 1 47  ALA 47  19  19  ALA ALA B . n 
B 1 48  MET 48  20  20  MET MET B . n 
B 1 49  VAL 49  21  21  VAL VAL B . n 
B 1 50  LEU 50  22  22  LEU LEU B . n 
B 1 51  SER 51  23  23  SER SER B . n 
B 1 52  PHE 52  24  24  PHE PHE B . n 
B 1 53  ILE 53  25  25  ILE ILE B . n 
B 1 54  PRO 54  26  26  PRO PRO B . n 
B 1 55  LEU 55  27  27  LEU LEU B . n 
B 1 56  ASP 56  28  28  ASP ASP B . n 
B 1 57  ILE 57  29  29  ILE ILE B . n 
B 1 58  GLY 58  30  30  GLY GLY B . n 
B 1 59  SER 59  31  31  SER SER B . n 
B 1 60  SER 60  32  32  SER SER B . n 
B 1 61  PHE 61  33  33  PHE PHE B . n 
B 1 62  SER 62  34  34  SER SER B . n 
B 1 63  ILE 63  35  35  ILE ILE B . n 
B 1 64  SER 64  36  36  SER SER B . n 
B 1 65  LEU 65  37  37  LEU LEU B . n 
B 1 66  GLY 66  38  38  GLY GLY B . n 
B 1 67  MET 67  39  39  MET MET B . n 
B 1 68  ILE 68  40  40  ILE ILE B . n 
B 1 69  PRO 69  41  41  PRO PRO B . n 
B 1 70  MET 70  42  42  MET MET B . n 
B 1 71  TYR 71  43  43  TYR TYR B . n 
B 1 72  VAL 72  44  44  VAL VAL B . n 
B 1 73  ILE 73  45  45  ILE ILE B . n 
B 1 74  ALA 74  46  46  ALA ALA B . n 
B 1 75  ILE 75  47  47  ILE ILE B . n 
B 1 76  ARG 76  48  48  ARG ARG B . n 
B 1 77  ARG 77  49  49  ARG ARG B . n 
B 1 78  GLY 78  50  50  GLY GLY B . n 
B 1 79  PHE 79  51  51  PHE PHE B . n 
B 1 80  TRP 80  52  52  TRP TRP B . n 
B 1 81  ALA 81  53  53  ALA ALA B . n 
B 1 82  ALA 82  54  54  ALA ALA B . n 
B 1 83  GLY 83  55  55  GLY GLY B . n 
B 1 84  PHE 84  56  56  PHE PHE B . n 
B 1 85  ALA 85  57  57  ALA ALA B . n 
B 1 86  GLY 86  58  58  GLY GLY B . n 
B 1 87  LEU 87  59  59  LEU LEU B . n 
B 1 88  LEU 88  60  60  LEU LEU B . n 
B 1 89  TRP 89  61  61  TRP TRP B . n 
B 1 90  GLY 90  62  62  GLY GLY B . n 
B 1 91  LEU 91  63  63  LEU LEU B . n 
B 1 92  LEU 92  64  64  LEU LEU B . n 
B 1 93  HIS 93  65  65  HIS HIS B . n 
B 1 94  PHE 94  66  66  PHE PHE B . n 
B 1 95  LEU 95  67  67  LEU LEU B . n 
B 1 96  THR 96  68  68  THR THR B . n 
B 1 97  GLY 97  69  69  GLY GLY B . n 
B 1 98  LYS 98  70  70  LYS LYS B . n 
B 1 99  ALA 99  71  71  ALA ALA B . n 
B 1 100 TYR 100 72  72  TYR TYR B . n 
B 1 101 ILE 101 73  73  ILE ILE B . n 
B 1 102 LEU 102 74  74  LEU LEU B . n 
B 1 103 MET 103 75  75  MET MET B . n 
B 1 104 PRO 104 76  76  PRO PRO B . n 
B 1 105 SER 105 77  77  SER SER B . n 
B 1 106 GLN 106 78  78  GLN GLN B . n 
B 1 107 ALA 107 79  79  ALA ALA B . n 
B 1 108 ILE 108 80  80  ILE ILE B . n 
B 1 109 ILE 109 81  81  ILE ILE B . n 
B 1 110 GLU 110 82  82  GLU GLU B . n 
B 1 111 TYR 111 83  83  TYR TYR B . n 
B 1 112 ILE 112 84  84  ILE ILE B . n 
B 1 113 LEU 113 85  85  LEU LEU B . n 
B 1 114 ALA 114 86  86  ALA ALA B . n 
B 1 115 PHE 115 87  87  PHE PHE B . n 
B 1 116 SER 116 88  88  SER SER B . n 
B 1 117 PHE 117 89  89  PHE PHE B . n 
B 1 118 ILE 118 90  90  ILE ILE B . n 
B 1 119 ALA 119 91  91  ALA ALA B . n 
B 1 120 PHE 120 92  92  PHE PHE B . n 
B 1 121 SER 121 93  93  SER SER B . n 
B 1 122 GLY 122 94  94  GLY GLY B . n 
B 1 123 VAL 123 95  95  VAL VAL B . n 
B 1 124 PHE 124 96  96  PHE PHE B . n 
B 1 125 SER 125 97  97  SER SER B . n 
B 1 126 LYS 126 98  98  LYS LYS B . n 
B 1 127 GLN 127 99  99  GLN GLN B . n 
B 1 128 VAL 128 100 100 VAL VAL B . n 
B 1 129 ARG 129 101 101 ARG ARG B . n 
B 1 130 SER 130 102 102 SER SER B . n 
B 1 131 ASN 131 103 103 ASN ASN B . n 
B 1 132 LEU 132 104 104 LEU LEU B . n 
B 1 133 ALA 133 105 105 ALA ALA B . n 
B 1 134 ALA 134 106 106 ALA ALA B . n 
B 1 135 ASN 135 107 107 ASN ASN B . n 
B 1 136 GLN 136 108 108 GLN GLN B . n 
B 1 137 LEU 137 109 109 LEU LEU B . n 
B 1 138 LYS 138 110 110 LYS LYS B . n 
B 1 139 LYS 139 111 111 LYS LYS B . n 
B 1 140 ALA 140 112 112 ALA ALA B . n 
B 1 141 ILE 141 113 113 ILE ILE B . n 
B 1 142 GLU 142 114 114 GLU GLU B . n 
B 1 143 TRP 143 115 115 TRP TRP B . n 
B 1 144 ALA 144 116 116 ALA ALA B . n 
B 1 145 TRP 145 117 117 TRP TRP B . n 
B 1 146 GLY 146 118 118 GLY GLY B . n 
B 1 147 THR 147 119 119 THR THR B . n 
B 1 148 MET 148 120 120 MET MET B . n 
B 1 149 ILE 149 121 121 ILE ILE B . n 
B 1 150 ILE 150 122 122 ILE ILE B . n 
B 1 151 GLY 151 123 123 GLY GLY B . n 
B 1 152 GLY 152 124 124 GLY GLY B . n 
B 1 153 VAL 153 125 125 VAL VAL B . n 
B 1 154 ALA 154 126 126 ALA ALA B . n 
B 1 155 ARG 155 127 127 ARG ARG B . n 
B 1 156 TYR 156 128 128 TYR TYR B . n 
B 1 157 PHE 157 129 129 PHE PHE B . n 
B 1 158 TRP 158 130 130 TRP TRP B . n 
B 1 159 HIS 159 131 131 HIS HIS B . n 
B 1 160 TYR 160 132 132 TYR TYR B . n 
B 1 161 VAL 161 133 133 VAL VAL B . n 
B 1 162 ALA 162 134 134 ALA ALA B . n 
B 1 163 GLY 163 135 135 GLY GLY B . n 
B 1 164 VAL 164 136 136 VAL VAL B . n 
B 1 165 LEU 165 137 137 LEU LEU B . n 
B 1 166 PHE 166 138 138 PHE PHE B . n 
B 1 167 TRP 167 139 139 TRP TRP B . n 
B 1 168 GLY 168 140 140 GLY GLY B . n 
B 1 169 ALA 169 141 141 ALA ALA B . n 
B 1 170 TYR 170 142 142 TYR TYR B . n 
B 1 171 ALA 171 143 143 ALA ALA B . n 
B 1 172 PHE 172 144 144 PHE PHE B . n 
B 1 173 GLN 173 145 145 GLN GLN B . n 
B 1 174 GLY 174 146 146 GLY GLY B . n 
B 1 175 TRP 175 147 147 TRP TRP B . n 
B 1 176 GLY 176 148 148 GLY GLY B . n 
B 1 177 ALA 177 149 149 ALA ALA B . n 
B 1 178 GLN 178 150 150 GLN GLN B . n 
B 1 179 LEU 179 151 151 LEU LEU B . n 
B 1 180 PHE 180 152 152 PHE PHE B . n 
B 1 181 SER 181 153 153 SER SER B . n 
B 1 182 ILE 182 154 154 ILE ILE B . n 
B 1 183 VAL 183 155 155 VAL VAL B . n 
B 1 184 MET 184 156 156 MET MET B . n 
B 1 185 ASN 185 157 157 ASN ASN B . n 
B 1 186 GLY 186 158 158 GLY GLY B . n 
B 1 187 ALA 187 159 159 ALA ALA B . n 
B 1 188 SER 188 160 160 SER SER B . n 
B 1 189 CYS 189 161 161 CYS CYS B . n 
B 1 190 LEU 190 162 162 LEU LEU B . n 
B 1 191 GLY 191 163 163 GLY GLY B . n 
B 1 192 THR 192 164 164 THR THR B . n 
B 1 193 VAL 193 165 165 VAL VAL B . n 
B 1 194 LEU 194 166 166 LEU LEU B . n 
B 1 195 VAL 195 167 167 VAL VAL B . n 
B 1 196 SER 196 168 168 SER SER B . n 
B 1 197 GLY 197 169 169 GLY GLY B . n 
B 1 198 ILE 198 170 170 ILE ILE B . n 
B 1 199 ILE 199 171 171 ILE ILE B . n 
B 1 200 ILE 200 172 172 ILE ILE B . n 
B 1 201 SER 201 173 173 SER SER B . n 
B 1 202 ILE 202 174 174 ILE ILE B . n 
B 1 203 LEU 203 175 175 LEU LEU B . n 
B 1 204 LEU 204 176 176 LEU LEU B . n 
B 1 205 LYS 205 177 177 LYS LYS B . n 
B 1 206 THR 206 178 178 THR THR B . n 
B 1 207 SER 207 179 179 SER SER B . n 
B 1 208 PRO 208 180 180 PRO PRO B . n 
B 1 209 LYS 209 181 181 LYS LYS B . n 
B 1 210 LEU 210 182 182 LEU LEU B . n 
B 1 211 PHE 211 183 183 PHE PHE B . n 
B 1 212 LEU 212 184 184 LEU LEU B . n 
B 1 213 PRO 213 185 185 PRO PRO B . n 
B 1 214 LYS 214 186 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'New York Consortium on Membrane Protein Structure' 
_pdbx_SG_project.initial_of_center     NYCOMPS 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 TPP 1 301 301 TPP TPP A . 
D 3 BGL 1 302 302 BGL BGL A . 
E 3 BGL 1 303 303 BGL BGL A . 
F 3 BGL 1 304 304 BGL BGL A . 
G 3 BGL 1 305 305 BGL BGL A . 
H 3 BGL 1 306 306 BGL BGL A . 
I 3 BGL 1 307 307 BGL BGL A . 
J 2 TPP 1 301 301 TPP TPP B . 
K 3 BGL 1 302 302 BGL BGL B . 
L 3 BGL 1 303 303 BGL BGL B . 
M 3 BGL 1 304 304 BGL BGL B . 
N 3 BGL 1 305 305 BGL BGL B . 
O 3 BGL 1 306 306 BGL BGL B . 
P 3 BGL 1 307 307 BGL BGL B . 
Q 3 BGL 1 308 308 BGL BGL B . 
R 3 BGL 1 309 309 BGL BGL B . 
S 3 BGL 1 310 310 BGL BGL B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6630  ? 
1 MORE         -22   ? 
1 'SSA (A^2)'  19930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-06-18 
2 'Structure model' 1 1 2014-09-24 
3 'Structure model' 1 2 2014-10-08 
4 'Structure model' 1 3 2014-10-22 
5 'Structure model' 1 4 2017-09-06 
6 'Structure model' 1 5 2019-12-25 
7 'Structure model' 1 6 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 7 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'        
2  3 'Structure model' 'Database references'        
3  4 'Structure model' 'Database references'        
4  5 'Structure model' 'Author supporting evidence' 
5  5 'Structure model' 'Derived calculations'       
6  5 'Structure model' Other                        
7  5 'Structure model' 'Source and taxonomy'        
8  5 'Structure model' 'Structure summary'          
9  6 'Structure model' 'Author supporting evidence' 
10 7 'Structure model' 'Data collection'            
11 7 'Structure model' 'Derived calculations'       
12 7 'Structure model' 'Refinement description'     
13 7 'Structure model' 'Structure summary'          
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  5 'Structure model' entity                    
2  5 'Structure model' entity_src_gen            
3  5 'Structure model' pdbx_audit_support        
4  5 'Structure model' pdbx_database_status      
5  5 'Structure model' pdbx_struct_assembly      
6  5 'Structure model' pdbx_struct_oper_list     
7  6 'Structure model' pdbx_audit_support        
8  7 'Structure model' chem_comp                 
9  7 'Structure model' entity                    
10 7 'Structure model' pdbx_chem_comp_identifier 
11 7 'Structure model' pdbx_entity_nonpoly       
12 7 'Structure model' refine_hist               
13 7 'Structure model' struct_site               
14 7 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_entity.pdbx_description'                    
2  5 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
3  5 'Structure model' '_pdbx_audit_support.funding_organization'    
4  5 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
5  5 'Structure model' '_pdbx_struct_assembly.oligomeric_details'    
6  5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
7  6 'Structure model' '_pdbx_audit_support.funding_organization'    
8  7 'Structure model' '_chem_comp.mon_nstd_flag'                    
9  7 'Structure model' '_chem_comp.name'                             
10 7 'Structure model' '_chem_comp.type'                             
11 7 'Structure model' '_entity.pdbx_description'                    
12 7 'Structure model' '_pdbx_entity_nonpoly.name'                   
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 11.5124  33.8716 36.3927 0.2504 ? 0.0370  ? -0.0030 ? 0.5870 ? -0.0132 ? 0.3832 ? 3.0047 ? 0.5336  
? -0.1165 ? 1.3829 ? 0.3651  ? 0.7676 ? 0.0045  ? 0.2783  ? -0.2068 ? -0.0734 ? 0.0119 ? 0.0195 ? 0.1312 ? 0.0549  ? -0.0359 ? 
2 'X-RAY DIFFRACTION' ? refined -10.3573 35.8251 49.0674 0.2252 ? -0.0311 ? -0.0053 ? 0.5261 ? 0.0745  ? 0.3758 ? 2.4213 ? -0.8975 
? -0.1170 ? 1.7632 ? -0.3125 ? 1.5477 ? -0.0038 ? -0.1080 ? -0.1183 ? 0.0792  ? 0.0292 ? 0.0650 ? 0.1301 ? -0.1664 ? -0.0237 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 'chain A' 
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 'chain B' 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(phenix.refine: 1.8_1069)' 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ILE A 84 ? ? -125.41 -57.13 
2 1 LEU B 27 ? ? -118.19 55.59  
3 1 ILE B 84 ? ? -127.05 -55.71 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 4   ? CG    ? A LYS 32  CG    
2  1 Y 1 A LYS 4   ? CD    ? A LYS 32  CD    
3  1 Y 1 A LYS 4   ? CE    ? A LYS 32  CE    
4  1 Y 1 A LYS 4   ? NZ    ? A LYS 32  NZ    
5  1 Y 1 A LYS 98  ? CG    ? A LYS 126 CG    
6  1 Y 1 A LYS 98  ? CD    ? A LYS 126 CD    
7  1 Y 1 A LYS 98  ? CE    ? A LYS 126 CE    
8  1 Y 1 A LYS 98  ? NZ    ? A LYS 126 NZ    
9  1 Y 1 B VAL 0   ? CG1   ? B VAL 28  CG1   
10 1 Y 1 B VAL 0   ? CG2   ? B VAL 28  CG2   
11 1 Y 1 B GLN 2   ? CG    ? B GLN 30  CG    
12 1 Y 1 B GLN 2   ? CD    ? B GLN 30  CD    
13 1 Y 1 B GLN 2   ? OE1   ? B GLN 30  OE1   
14 1 Y 1 B GLN 2   ? NE2   ? B GLN 30  NE2   
15 1 Y 1 B LEU 6   ? CG    ? B LEU 34  CG    
16 1 Y 1 B LEU 6   ? CD1   ? B LEU 34  CD1   
17 1 Y 1 B LEU 6   ? CD2   ? B LEU 34  CD2   
18 1 Y 1 B TYR 72  ? CG    ? B TYR 100 CG    
19 1 Y 1 B TYR 72  ? CD1   ? B TYR 100 CD1   
20 1 Y 1 B TYR 72  ? CD2   ? B TYR 100 CD2   
21 1 Y 1 B TYR 72  ? CE1   ? B TYR 100 CE1   
22 1 Y 1 B TYR 72  ? CE2   ? B TYR 100 CE2   
23 1 Y 1 B TYR 72  ? CZ    ? B TYR 100 CZ    
24 1 Y 1 B TYR 72  ? OH    ? B TYR 100 OH    
25 1 Y 1 B LYS 98  ? CG    ? B LYS 126 CG    
26 1 Y 1 B LYS 98  ? CD    ? B LYS 126 CD    
27 1 Y 1 B LYS 98  ? CE    ? B LYS 126 CE    
28 1 Y 1 B LYS 98  ? NZ    ? B LYS 126 NZ    
29 1 N 1 A BGL 302 ? "C7'" ? D BGL 1   "C7'" 
30 1 N 1 A BGL 302 ? "C8'" ? D BGL 1   "C8'" 
31 1 N 1 A BGL 303 ? "C7'" ? E BGL 1   "C7'" 
32 1 N 1 A BGL 303 ? "C8'" ? E BGL 1   "C8'" 
33 1 N 1 A BGL 307 ? "C7'" ? I BGL 1   "C7'" 
34 1 N 1 A BGL 307 ? "C8'" ? I BGL 1   "C8'" 
35 1 N 1 B BGL 308 ? "C7'" ? Q BGL 1   "C7'" 
36 1 N 1 B BGL 308 ? "C8'" ? Q BGL 1   "C8'" 
37 1 N 1 B BGL 309 ? "C7'" ? R BGL 1   "C7'" 
38 1 N 1 B BGL 309 ? "C8'" ? R BGL 1   "C8'" 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -27 ? A MET 1   
2  1 Y 1 A ASP -26 ? A ASP 2   
3  1 Y 1 A TYR -25 ? A TYR 3   
4  1 Y 1 A LYS -24 ? A LYS 4   
5  1 Y 1 A ASP -23 ? A ASP 5   
6  1 Y 1 A ASP -22 ? A ASP 6   
7  1 Y 1 A ASP -21 ? A ASP 7   
8  1 Y 1 A ASP -20 ? A ASP 8   
9  1 Y 1 A LYS -19 ? A LYS 9   
10 1 Y 1 A HIS -18 ? A HIS 10  
11 1 Y 1 A HIS -17 ? A HIS 11  
12 1 Y 1 A HIS -16 ? A HIS 12  
13 1 Y 1 A HIS -15 ? A HIS 13  
14 1 Y 1 A HIS -14 ? A HIS 14  
15 1 Y 1 A HIS -13 ? A HIS 15  
16 1 Y 1 A HIS -12 ? A HIS 16  
17 1 Y 1 A HIS -11 ? A HIS 17  
18 1 Y 1 A HIS -10 ? A HIS 18  
19 1 Y 1 A HIS -9  ? A HIS 19  
20 1 Y 1 A GLU -8  ? A GLU 20  
21 1 Y 1 A ASN -7  ? A ASN 21  
22 1 Y 1 A LEU -6  ? A LEU 22  
23 1 Y 1 A TYR -5  ? A TYR 23  
24 1 Y 1 A PHE -4  ? A PHE 24  
25 1 Y 1 A GLN -3  ? A GLN 25  
26 1 Y 1 A SER -2  ? A SER 26  
27 1 Y 1 A TYR -1  ? A TYR 27  
28 1 Y 1 A VAL 0   ? A VAL 28  
29 1 Y 1 A MET 1   ? A MET 29  
30 1 Y 1 A GLN 2   ? A GLN 30  
31 1 Y 1 A LYS 186 ? A LYS 214 
32 1 Y 1 B MET -27 ? B MET 1   
33 1 Y 1 B ASP -26 ? B ASP 2   
34 1 Y 1 B TYR -25 ? B TYR 3   
35 1 Y 1 B LYS -24 ? B LYS 4   
36 1 Y 1 B ASP -23 ? B ASP 5   
37 1 Y 1 B ASP -22 ? B ASP 6   
38 1 Y 1 B ASP -21 ? B ASP 7   
39 1 Y 1 B ASP -20 ? B ASP 8   
40 1 Y 1 B LYS -19 ? B LYS 9   
41 1 Y 1 B HIS -18 ? B HIS 10  
42 1 Y 1 B HIS -17 ? B HIS 11  
43 1 Y 1 B HIS -16 ? B HIS 12  
44 1 Y 1 B HIS -15 ? B HIS 13  
45 1 Y 1 B HIS -14 ? B HIS 14  
46 1 Y 1 B HIS -13 ? B HIS 15  
47 1 Y 1 B HIS -12 ? B HIS 16  
48 1 Y 1 B HIS -11 ? B HIS 17  
49 1 Y 1 B HIS -10 ? B HIS 18  
50 1 Y 1 B HIS -9  ? B HIS 19  
51 1 Y 1 B GLU -8  ? B GLU 20  
52 1 Y 1 B ASN -7  ? B ASN 21  
53 1 Y 1 B LEU -6  ? B LEU 22  
54 1 Y 1 B TYR -5  ? B TYR 23  
55 1 Y 1 B PHE -4  ? B PHE 24  
56 1 Y 1 B GLN -3  ? B GLN 25  
57 1 Y 1 B SER -2  ? B SER 26  
58 1 Y 1 B TYR -1  ? B TYR 27  
59 1 Y 1 B LYS 186 ? B LYS 214 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM095315 1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM107462 2 
# 
_pdbx_chem_comp_identifier.comp_id           BGL 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        b-D-Glcp2octyl 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'THIAMINE DIPHOSPHATE'         TPP 
3 2-O-octyl-beta-D-glucopyranose BGL 
#