data_4TMU
# 
_entry.id   4TMU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4TMU         
WWPDB D_1000201813 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4TMU 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Manthei, K.A.' 1 ? 
'Keck, J.L.'    2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            112 
_citation.language                  ? 
_citation.page_first                4292 
_citation.page_last                 4297 
_citation.title                     'Structural mechanisms of DNA binding and unwinding in bacterial RecQ helicases.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1416746112 
_citation.pdbx_database_id_PubMed   25831501 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Manthei, K.A.' 1 ? 
primary 'Hill, M.C.'    2 ? 
primary 'Burke, J.E.'   3 ? 
primary 'Butcher, S.E.' 4 ? 
primary 'Keck, J.L.'    5 ? 
# 
_cell.entry_id           4TMU 
_cell.length_a           78.348 
_cell.length_b           93.959 
_cell.length_c           100.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4TMU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man RecQ           60445.254 1   ? ? ? 'Exact C-terminus not defined, the HRDC domain was removed with thrombin.' 
2 polymer     syn 'DNA (29-MER)' 10448.737 1   ? ? ? ?                                                                          
3 non-polymer syn 'ZINC ION'     65.409    1   ? ? ? ?                                                                          
4 water       nat water          18.015    302 ? ? ? ?                                                                          
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGSSHHHHHHSSGLVPRGSHMAQAEVYSQETLAKQVLQETFGYQQFRPGQATIIDAVLEGRDCLVVMPTGGGKSLCYQIP
ALVKTGLTIVVSPLISLMKDQVDQLLANGVAAACLNSTQSREEQQAVLAGCRTGQVRLLYIAPERLMMDNFIDTLGYWDL
AMVAVDEAHCISQWGHDFRPEYAALGQLRARFPAVPFMALTATADDTTRRDIVRLLGLDDPLIEISSFDRPNIRYMLMEK
FKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSRGISAAAYHAGLEHEVRASVQEKFQRDDLQIVVATVAFGMGI
NKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKAPGPLQDIERHKLNAMGAFAEAQTC
RRLVLLNYFGEGRQAPCGNCDICLDPPRRYDGLVDAQKALSAIARVEQRFGMGYVVEVLRGANNQRIRELGHDKLKVYGI
GRDQSQEHWVSVIRQLIHLGVVTQNIAQHSALQLTEAARPFLRGEAPLMLAVPRVAALKPR
;
;MGSSHHHHHHSSGLVPRGSHMAQAEVYSQETLAKQVLQETFGYQQFRPGQATIIDAVLEGRDCLVVMPTGGGKSLCYQIP
ALVKTGLTIVVSPLISLMKDQVDQLLANGVAAACLNSTQSREEQQAVLAGCRTGQVRLLYIAPERLMMDNFIDTLGYWDL
AMVAVDEAHCISQWGHDFRPEYAALGQLRARFPAVPFMALTATADDTTRRDIVRLLGLDDPLIEISSFDRPNIRYMLMEK
FKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSRGISAAAYHAGLEHEVRASVQEKFQRDDLQIVVATVAFGMGI
NKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKAPGPLQDIERHKLNAMGAFAEAQTC
RRLVLLNYFGEGRQAPCGNCDICLDPPRRYDGLVDAQKALSAIARVEQRFGMGYVVEVLRGANNQRIRELGHDKLKVYGI
GRDQSQEHWVSVIRQLIHLGVVTQNIAQHSALQLTEAARPFLRGEAPLMLAVPRVAALKPR
;
A ? 
2 polydeoxyribonucleotide no no 
;(DC)(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DT)(DG)(DT)(DA)(DA)(DA)(DA)(DT)(DT)(DC)(DT)
(DA)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DT)(DT)(DA)(DC)(DT)
;
CGGTAGAATTGTAAAATTCTACCGGTGCCTTACT B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ALA n 
1 23  GLN n 
1 24  ALA n 
1 25  GLU n 
1 26  VAL n 
1 27  TYR n 
1 28  SER n 
1 29  GLN n 
1 30  GLU n 
1 31  THR n 
1 32  LEU n 
1 33  ALA n 
1 34  LYS n 
1 35  GLN n 
1 36  VAL n 
1 37  LEU n 
1 38  GLN n 
1 39  GLU n 
1 40  THR n 
1 41  PHE n 
1 42  GLY n 
1 43  TYR n 
1 44  GLN n 
1 45  GLN n 
1 46  PHE n 
1 47  ARG n 
1 48  PRO n 
1 49  GLY n 
1 50  GLN n 
1 51  ALA n 
1 52  THR n 
1 53  ILE n 
1 54  ILE n 
1 55  ASP n 
1 56  ALA n 
1 57  VAL n 
1 58  LEU n 
1 59  GLU n 
1 60  GLY n 
1 61  ARG n 
1 62  ASP n 
1 63  CYS n 
1 64  LEU n 
1 65  VAL n 
1 66  VAL n 
1 67  MET n 
1 68  PRO n 
1 69  THR n 
1 70  GLY n 
1 71  GLY n 
1 72  GLY n 
1 73  LYS n 
1 74  SER n 
1 75  LEU n 
1 76  CYS n 
1 77  TYR n 
1 78  GLN n 
1 79  ILE n 
1 80  PRO n 
1 81  ALA n 
1 82  LEU n 
1 83  VAL n 
1 84  LYS n 
1 85  THR n 
1 86  GLY n 
1 87  LEU n 
1 88  THR n 
1 89  ILE n 
1 90  VAL n 
1 91  VAL n 
1 92  SER n 
1 93  PRO n 
1 94  LEU n 
1 95  ILE n 
1 96  SER n 
1 97  LEU n 
1 98  MET n 
1 99  LYS n 
1 100 ASP n 
1 101 GLN n 
1 102 VAL n 
1 103 ASP n 
1 104 GLN n 
1 105 LEU n 
1 106 LEU n 
1 107 ALA n 
1 108 ASN n 
1 109 GLY n 
1 110 VAL n 
1 111 ALA n 
1 112 ALA n 
1 113 ALA n 
1 114 CYS n 
1 115 LEU n 
1 116 ASN n 
1 117 SER n 
1 118 THR n 
1 119 GLN n 
1 120 SER n 
1 121 ARG n 
1 122 GLU n 
1 123 GLU n 
1 124 GLN n 
1 125 GLN n 
1 126 ALA n 
1 127 VAL n 
1 128 LEU n 
1 129 ALA n 
1 130 GLY n 
1 131 CYS n 
1 132 ARG n 
1 133 THR n 
1 134 GLY n 
1 135 GLN n 
1 136 VAL n 
1 137 ARG n 
1 138 LEU n 
1 139 LEU n 
1 140 TYR n 
1 141 ILE n 
1 142 ALA n 
1 143 PRO n 
1 144 GLU n 
1 145 ARG n 
1 146 LEU n 
1 147 MET n 
1 148 MET n 
1 149 ASP n 
1 150 ASN n 
1 151 PHE n 
1 152 ILE n 
1 153 ASP n 
1 154 THR n 
1 155 LEU n 
1 156 GLY n 
1 157 TYR n 
1 158 TRP n 
1 159 ASP n 
1 160 LEU n 
1 161 ALA n 
1 162 MET n 
1 163 VAL n 
1 164 ALA n 
1 165 VAL n 
1 166 ASP n 
1 167 GLU n 
1 168 ALA n 
1 169 HIS n 
1 170 CYS n 
1 171 ILE n 
1 172 SER n 
1 173 GLN n 
1 174 TRP n 
1 175 GLY n 
1 176 HIS n 
1 177 ASP n 
1 178 PHE n 
1 179 ARG n 
1 180 PRO n 
1 181 GLU n 
1 182 TYR n 
1 183 ALA n 
1 184 ALA n 
1 185 LEU n 
1 186 GLY n 
1 187 GLN n 
1 188 LEU n 
1 189 ARG n 
1 190 ALA n 
1 191 ARG n 
1 192 PHE n 
1 193 PRO n 
1 194 ALA n 
1 195 VAL n 
1 196 PRO n 
1 197 PHE n 
1 198 MET n 
1 199 ALA n 
1 200 LEU n 
1 201 THR n 
1 202 ALA n 
1 203 THR n 
1 204 ALA n 
1 205 ASP n 
1 206 ASP n 
1 207 THR n 
1 208 THR n 
1 209 ARG n 
1 210 ARG n 
1 211 ASP n 
1 212 ILE n 
1 213 VAL n 
1 214 ARG n 
1 215 LEU n 
1 216 LEU n 
1 217 GLY n 
1 218 LEU n 
1 219 ASP n 
1 220 ASP n 
1 221 PRO n 
1 222 LEU n 
1 223 ILE n 
1 224 GLU n 
1 225 ILE n 
1 226 SER n 
1 227 SER n 
1 228 PHE n 
1 229 ASP n 
1 230 ARG n 
1 231 PRO n 
1 232 ASN n 
1 233 ILE n 
1 234 ARG n 
1 235 TYR n 
1 236 MET n 
1 237 LEU n 
1 238 MET n 
1 239 GLU n 
1 240 LYS n 
1 241 PHE n 
1 242 LYS n 
1 243 PRO n 
1 244 LEU n 
1 245 ASP n 
1 246 GLN n 
1 247 LEU n 
1 248 MET n 
1 249 ARG n 
1 250 TYR n 
1 251 VAL n 
1 252 GLN n 
1 253 GLU n 
1 254 GLN n 
1 255 ARG n 
1 256 GLY n 
1 257 LYS n 
1 258 SER n 
1 259 GLY n 
1 260 ILE n 
1 261 ILE n 
1 262 TYR n 
1 263 CYS n 
1 264 ASN n 
1 265 SER n 
1 266 ARG n 
1 267 ALA n 
1 268 LYS n 
1 269 VAL n 
1 270 GLU n 
1 271 ASP n 
1 272 THR n 
1 273 ALA n 
1 274 ALA n 
1 275 ARG n 
1 276 LEU n 
1 277 GLN n 
1 278 SER n 
1 279 ARG n 
1 280 GLY n 
1 281 ILE n 
1 282 SER n 
1 283 ALA n 
1 284 ALA n 
1 285 ALA n 
1 286 TYR n 
1 287 HIS n 
1 288 ALA n 
1 289 GLY n 
1 290 LEU n 
1 291 GLU n 
1 292 HIS n 
1 293 GLU n 
1 294 VAL n 
1 295 ARG n 
1 296 ALA n 
1 297 SER n 
1 298 VAL n 
1 299 GLN n 
1 300 GLU n 
1 301 LYS n 
1 302 PHE n 
1 303 GLN n 
1 304 ARG n 
1 305 ASP n 
1 306 ASP n 
1 307 LEU n 
1 308 GLN n 
1 309 ILE n 
1 310 VAL n 
1 311 VAL n 
1 312 ALA n 
1 313 THR n 
1 314 VAL n 
1 315 ALA n 
1 316 PHE n 
1 317 GLY n 
1 318 MET n 
1 319 GLY n 
1 320 ILE n 
1 321 ASN n 
1 322 LYS n 
1 323 PRO n 
1 324 ASN n 
1 325 VAL n 
1 326 ARG n 
1 327 PHE n 
1 328 VAL n 
1 329 VAL n 
1 330 HIS n 
1 331 PHE n 
1 332 ASP n 
1 333 ILE n 
1 334 PRO n 
1 335 ARG n 
1 336 ASN n 
1 337 ILE n 
1 338 GLU n 
1 339 SER n 
1 340 TYR n 
1 341 TYR n 
1 342 GLN n 
1 343 GLU n 
1 344 THR n 
1 345 GLY n 
1 346 ARG n 
1 347 ALA n 
1 348 GLY n 
1 349 ARG n 
1 350 ASP n 
1 351 GLY n 
1 352 LEU n 
1 353 PRO n 
1 354 ALA n 
1 355 GLU n 
1 356 ALA n 
1 357 MET n 
1 358 LEU n 
1 359 PHE n 
1 360 TYR n 
1 361 ASP n 
1 362 PRO n 
1 363 ALA n 
1 364 ASP n 
1 365 MET n 
1 366 ALA n 
1 367 TRP n 
1 368 LEU n 
1 369 ARG n 
1 370 ARG n 
1 371 CYS n 
1 372 LEU n 
1 373 GLU n 
1 374 GLU n 
1 375 LYS n 
1 376 ALA n 
1 377 PRO n 
1 378 GLY n 
1 379 PRO n 
1 380 LEU n 
1 381 GLN n 
1 382 ASP n 
1 383 ILE n 
1 384 GLU n 
1 385 ARG n 
1 386 HIS n 
1 387 LYS n 
1 388 LEU n 
1 389 ASN n 
1 390 ALA n 
1 391 MET n 
1 392 GLY n 
1 393 ALA n 
1 394 PHE n 
1 395 ALA n 
1 396 GLU n 
1 397 ALA n 
1 398 GLN n 
1 399 THR n 
1 400 CYS n 
1 401 ARG n 
1 402 ARG n 
1 403 LEU n 
1 404 VAL n 
1 405 LEU n 
1 406 LEU n 
1 407 ASN n 
1 408 TYR n 
1 409 PHE n 
1 410 GLY n 
1 411 GLU n 
1 412 GLY n 
1 413 ARG n 
1 414 GLN n 
1 415 ALA n 
1 416 PRO n 
1 417 CYS n 
1 418 GLY n 
1 419 ASN n 
1 420 CYS n 
1 421 ASP n 
1 422 ILE n 
1 423 CYS n 
1 424 LEU n 
1 425 ASP n 
1 426 PRO n 
1 427 PRO n 
1 428 ARG n 
1 429 ARG n 
1 430 TYR n 
1 431 ASP n 
1 432 GLY n 
1 433 LEU n 
1 434 VAL n 
1 435 ASP n 
1 436 ALA n 
1 437 GLN n 
1 438 LYS n 
1 439 ALA n 
1 440 LEU n 
1 441 SER n 
1 442 ALA n 
1 443 ILE n 
1 444 ALA n 
1 445 ARG n 
1 446 VAL n 
1 447 GLU n 
1 448 GLN n 
1 449 ARG n 
1 450 PHE n 
1 451 GLY n 
1 452 MET n 
1 453 GLY n 
1 454 TYR n 
1 455 VAL n 
1 456 VAL n 
1 457 GLU n 
1 458 VAL n 
1 459 LEU n 
1 460 ARG n 
1 461 GLY n 
1 462 ALA n 
1 463 ASN n 
1 464 ASN n 
1 465 GLN n 
1 466 ARG n 
1 467 ILE n 
1 468 ARG n 
1 469 GLU n 
1 470 LEU n 
1 471 GLY n 
1 472 HIS n 
1 473 ASP n 
1 474 LYS n 
1 475 LEU n 
1 476 LYS n 
1 477 VAL n 
1 478 TYR n 
1 479 GLY n 
1 480 ILE n 
1 481 GLY n 
1 482 ARG n 
1 483 ASP n 
1 484 GLN n 
1 485 SER n 
1 486 GLN n 
1 487 GLU n 
1 488 HIS n 
1 489 TRP n 
1 490 VAL n 
1 491 SER n 
1 492 VAL n 
1 493 ILE n 
1 494 ARG n 
1 495 GLN n 
1 496 LEU n 
1 497 ILE n 
1 498 HIS n 
1 499 LEU n 
1 500 GLY n 
1 501 VAL n 
1 502 VAL n 
1 503 THR n 
1 504 GLN n 
1 505 ASN n 
1 506 ILE n 
1 507 ALA n 
1 508 GLN n 
1 509 HIS n 
1 510 SER n 
1 511 ALA n 
1 512 LEU n 
1 513 GLN n 
1 514 LEU n 
1 515 THR n 
1 516 GLU n 
1 517 ALA n 
1 518 ALA n 
1 519 ARG n 
1 520 PRO n 
1 521 PHE n 
1 522 LEU n 
1 523 ARG n 
1 524 GLY n 
1 525 GLU n 
1 526 ALA n 
1 527 PRO n 
1 528 LEU n 
1 529 MET n 
1 530 LEU n 
1 531 ALA n 
1 532 VAL n 
1 533 PRO n 
1 534 ARG n 
1 535 VAL n 
1 536 ALA n 
1 537 ALA n 
1 538 LEU n 
1 539 LYS n 
1 540 PRO n 
1 541 ARG n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DT  n 
2 5   DA  n 
2 6   DG  n 
2 7   DA  n 
2 8   DA  n 
2 9   DT  n 
2 10  DT  n 
2 11  DG  n 
2 12  DT  n 
2 13  DA  n 
2 14  DA  n 
2 15  DA  n 
2 16  DA  n 
2 17  DT  n 
2 18  DT  n 
2 19  DC  n 
2 20  DT  n 
2 21  DA  n 
2 22  DC  n 
2 23  DC  n 
2 24  DG  n 
2 25  DG  n 
2 26  DT  n 
2 27  DG  n 
2 28  DC  n 
2 29  DC  n 
2 30  DT  n 
2 31  DT  n 
2 32  DA  n 
2 33  DC  n 
2 34  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   541 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ESA_03738 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC BAA-894' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Cronobacter sakazakii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     290339 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       34 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP A7MQK9_CROS8 A7MQK9 1 
;MAQAEVYSQETLAKQVLQETFGYQQFRPGQATIIDAVLEGRDCLVVMPTGGGKSLCYQIPALVKTGLTIVVSPLISLMKD
QVDQLLANGVAAACLNSTQSREEQQAVLAGCRTGQVRLLYIAPERLMMDNFIDTLGYWDLAMVAVDEAHCISQWGHDFRP
EYAALGQLRARFPAVPFMALTATADDTTRRDIVRLLGLDDPLIEISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGI
IYCNSRAKVEDTAARLQSRGISAAAYHAGLEHEVRASVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESY
YQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKAPGPLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQAPCGNC
DICLDPPRRYDGLVDAQKALSAIARVEQRFGMGYVVEVLRGANNQRIRELGHDKLKVYGIGRDQSQEHWVSVIRQLIHLG
VVTQNIAQHSALQLTEAARPFLRGEAPLMLAVPRVAALKPR
;
1 ? 
2 PDB 4TMU         4TMU   2 ? 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4TMU A 21 ? 541 ? A7MQK9 1 ? 521 ? 1 521 
2 2 4TMU B 1  ? 34  ? 4TMU   1 ? 34  ? 1 34  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4TMU MET A 1  ? UNP A7MQK9 ? ? 'expression tag' -19 1  
1 4TMU GLY A 2  ? UNP A7MQK9 ? ? 'expression tag' -18 2  
1 4TMU SER A 3  ? UNP A7MQK9 ? ? 'expression tag' -17 3  
1 4TMU SER A 4  ? UNP A7MQK9 ? ? 'expression tag' -16 4  
1 4TMU HIS A 5  ? UNP A7MQK9 ? ? 'expression tag' -15 5  
1 4TMU HIS A 6  ? UNP A7MQK9 ? ? 'expression tag' -14 6  
1 4TMU HIS A 7  ? UNP A7MQK9 ? ? 'expression tag' -13 7  
1 4TMU HIS A 8  ? UNP A7MQK9 ? ? 'expression tag' -12 8  
1 4TMU HIS A 9  ? UNP A7MQK9 ? ? 'expression tag' -11 9  
1 4TMU HIS A 10 ? UNP A7MQK9 ? ? 'expression tag' -10 10 
1 4TMU SER A 11 ? UNP A7MQK9 ? ? 'expression tag' -9  11 
1 4TMU SER A 12 ? UNP A7MQK9 ? ? 'expression tag' -8  12 
1 4TMU GLY A 13 ? UNP A7MQK9 ? ? 'expression tag' -7  13 
1 4TMU LEU A 14 ? UNP A7MQK9 ? ? 'expression tag' -6  14 
1 4TMU VAL A 15 ? UNP A7MQK9 ? ? 'expression tag' -5  15 
1 4TMU PRO A 16 ? UNP A7MQK9 ? ? 'expression tag' -4  16 
1 4TMU ARG A 17 ? UNP A7MQK9 ? ? 'expression tag' -3  17 
1 4TMU GLY A 18 ? UNP A7MQK9 ? ? 'expression tag' -2  18 
1 4TMU SER A 19 ? UNP A7MQK9 ? ? 'expression tag' -1  19 
1 4TMU HIS A 20 ? UNP A7MQK9 ? ? 'expression tag' 0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4TMU 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.60 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '70 mM NaOAc, 24% glycerol, 11% PEG 4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-08-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4TMU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.40 
_reflns.d_resolution_low                 40.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       29764 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            27.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.40 
_reflns_shell.d_res_low                   2.44 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -1.99 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            -1.01 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            3.00 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               51.418 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.925 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4TMU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.40 
_refine.ls_d_res_low                             40.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28225 
_refine.ls_number_reflns_R_free                  1506 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.64 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.18127 
_refine.ls_R_factor_R_free                       0.23253 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.17853 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.329 
_refine.pdbx_overall_ESU_R_Free                  0.236 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             6.757 
_refine.overall_SU_ML                            0.160 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        ? 
_refine_hist.pdbx_number_atoms_nucleic_acid   ? 
_refine_hist.pdbx_number_atoms_ligand         ? 
_refine_hist.number_atoms_solvent             ? 
_refine_hist.number_atoms_total               4907 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        40.0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.018  4748 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  4290 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.242  1.842  6547 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.856  3.000  9838 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.988  5.000  510  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 35.067 23.300 200  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.990 15.000 703  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 16.274 15.000 43   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.072  0.200  698  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  5041 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  1112 ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.590  4.357  2043 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.590  4.356  2042 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 4.202  6.528  2552 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.201  6.530  2553 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 3.415  6.069  2705 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.413  6.066  2704 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.627  9.014  3995 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 8.962  46.176 5865 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 8.866  46.191 5756 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.393 
_refine_ls_shell.d_res_low                        2.455 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             106 
_refine_ls_shell.number_reflns_R_work             1972 
_refine_ls_shell.percent_reflns_obs               96.25 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.276 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.222 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
# 
_struct.entry_id                     4TMU 
_struct.title                        'Crystal structure of RecQ catalytic core from C. sakazakii bound to DNA' 
_struct.pdbx_descriptor              'Protein/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4TMU 
_struct_keywords.text            'RecQ, helicase, Winged helix, ATP binding, Hydrolase-DNA complex' 
_struct_keywords.pdbx_keywords   Hydrolase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ALA A 24  ? THR A 40  ? ALA A 4   THR A 20  1 ? 17 
HELX_P HELX_P2  AA2 GLY A 49  ? GLU A 59  ? GLY A 29  GLU A 39  1 ? 11 
HELX_P HELX_P3  AA3 SER A 74  ? LYS A 84  ? SER A 54  LYS A 64  1 ? 11 
HELX_P HELX_P4  AA4 LEU A 94  ? ASN A 108 ? LEU A 74  ASN A 88  1 ? 15 
HELX_P HELX_P5  AA5 SER A 120 ? THR A 133 ? SER A 100 THR A 113 1 ? 14 
HELX_P HELX_P6  AA6 ALA A 142 ? MET A 147 ? ALA A 122 MET A 127 1 ? 6  
HELX_P HELX_P7  AA7 MET A 148 ? TYR A 157 ? MET A 128 TYR A 137 1 ? 10 
HELX_P HELX_P8  AA8 ALA A 168 ? GLY A 175 ? ALA A 148 GLY A 155 1 ? 8  
HELX_P HELX_P9  AA9 ARG A 179 ? ALA A 183 ? ARG A 159 ALA A 163 5 ? 5  
HELX_P HELX_P10 AB1 ALA A 184 ? PHE A 192 ? ALA A 164 PHE A 172 1 ? 9  
HELX_P HELX_P11 AB2 ASP A 205 ? GLY A 217 ? ASP A 185 GLY A 197 1 ? 13 
HELX_P HELX_P12 AB3 LYS A 242 ? GLN A 254 ? LYS A 222 GLN A 234 1 ? 13 
HELX_P HELX_P13 AB4 SER A 265 ? ARG A 279 ? SER A 245 ARG A 259 1 ? 15 
HELX_P HELX_P14 AB5 GLU A 291 ? ARG A 304 ? GLU A 271 ARG A 284 1 ? 14 
HELX_P HELX_P15 AB6 ASN A 336 ? GLY A 345 ? ASN A 316 GLY A 325 1 ? 10 
HELX_P HELX_P16 AB7 ASP A 361 ? GLU A 373 ? ASP A 341 GLU A 353 1 ? 13 
HELX_P HELX_P17 AB8 GLY A 378 ? GLU A 396 ? GLY A 358 GLU A 376 1 ? 19 
HELX_P HELX_P18 AB9 CYS A 400 ? PHE A 409 ? CYS A 380 PHE A 389 1 ? 10 
HELX_P HELX_P19 AC1 CYS A 420 ? ASP A 425 ? CYS A 400 ASP A 405 1 ? 6  
HELX_P HELX_P20 AC2 GLY A 432 ? VAL A 446 ? GLY A 412 VAL A 426 1 ? 15 
HELX_P HELX_P21 AC3 GLY A 451 ? ARG A 460 ? GLY A 431 ARG A 440 1 ? 10 
HELX_P HELX_P22 AC4 ASN A 464 ? GLY A 471 ? ASN A 444 GLY A 451 1 ? 8  
HELX_P HELX_P23 AC5 SER A 485 ? LEU A 499 ? SER A 465 LEU A 479 1 ? 15 
HELX_P HELX_P24 AC6 ILE A 506 ? HIS A 509 ? ILE A 486 HIS A 489 5 ? 4  
HELX_P HELX_P25 AC7 ALA A 517 ? GLY A 524 ? ALA A 497 GLY A 504 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 400 SG ? ? ? 1_555 C ZN .  ZN ? ? A CYS 380 A ZN 601 1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc2  metalc ? ? A CYS 417 SG ? ? ? 1_555 C ZN .  ZN ? ? A CYS 397 A ZN 601 1_555 ? ? ? ? ? ? ?            2.320 ? 
metalc3  metalc ? ? A CYS 420 SG ? ? ? 1_555 C ZN .  ZN ? ? A CYS 400 A ZN 601 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc4  metalc ? ? A CYS 423 SG ? ? ? 1_555 C ZN .  ZN ? ? A CYS 403 A ZN 601 1_555 ? ? ? ? ? ? ?            2.381 ? 
hydrog1  hydrog ? ? B DG  3   N1 ? ? ? 1_555 B DC 22 N3 ? ? B DG  3   B DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DG  3   N2 ? ? ? 1_555 B DC 22 O2 ? ? B DG  3   B DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  3   O6 ? ? ? 1_555 B DC 22 N4 ? ? B DG  3   B DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  4   N3 ? ? ? 1_555 B DA 21 N1 ? ? B DT  4   B DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  4   O4 ? ? ? 1_555 B DA 21 N6 ? ? B DT  4   B DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  5   N1 ? ? ? 1_555 B DT 20 N3 ? ? B DA  5   B DT 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  5   N6 ? ? ? 1_555 B DT 20 O4 ? ? B DA  5   B DT 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  6   N1 ? ? ? 1_555 B DC 19 N3 ? ? B DG  6   B DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  6   N2 ? ? ? 1_555 B DC 19 O2 ? ? B DG  6   B DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  6   O6 ? ? ? 1_555 B DC 19 N4 ? ? B DG  6   B DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  7   N1 ? ? ? 1_555 B DT 18 N3 ? ? B DA  7   B DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  7   N6 ? ? ? 1_555 B DT 18 O4 ? ? B DA  7   B DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA  8   N1 ? ? ? 1_555 B DT 17 N3 ? ? B DA  8   B DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  8   N6 ? ? ? 1_555 B DT 17 O4 ? ? B DA  8   B DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DT  9   N3 ? ? ? 1_555 B DA 16 N1 ? ? B DT  9   B DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DT  9   O4 ? ? ? 1_555 B DA 16 N6 ? ? B DT  9   B DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DT  10  N3 ? ? ? 1_555 B DA 15 N1 ? ? B DT  10  B DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  10  O4 ? ? ? 1_555 B DA 15 N6 ? ? B DT  10  B DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  11  N2 ? ? ? 1_555 B DA 14 N7 ? ? B DG  11  B DA 14  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     ? 
hydrog20 hydrog ? ? B DG  11  N3 ? ? ? 1_555 B DA 14 N6 ? ? B DG  11  B DA 14  1_555 ? ? ? ? ? ? TYPE_11_PAIR ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           70 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            50 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLY 
_struct_mon_prot_cis.pdbx_label_seq_id_2    71 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLY 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     51 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -12.74 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 6 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 112 ? CYS A 114 ? ALA A 92  CYS A 94  
AA1 2 LEU A 138 ? ILE A 141 ? LEU A 118 ILE A 121 
AA1 3 LEU A 87  ? VAL A 91  ? LEU A 67  VAL A 71  
AA1 4 LEU A 160 ? VAL A 165 ? LEU A 140 VAL A 145 
AA1 5 PHE A 197 ? THR A 201 ? PHE A 177 THR A 181 
AA1 6 CYS A 63  ? VAL A 66  ? CYS A 43  VAL A 46  
AA1 7 LEU A 222 ? ILE A 225 ? LEU A 202 ILE A 205 
AA2 1 ILE A 233 ? GLU A 239 ? ILE A 213 GLU A 219 
AA2 2 ALA A 354 ? TYR A 360 ? ALA A 334 TYR A 340 
AA2 3 PHE A 327 ? HIS A 330 ? PHE A 307 HIS A 310 
AA2 4 GLY A 259 ? TYR A 262 ? GLY A 239 TYR A 242 
AA2 5 ILE A 309 ? ALA A 312 ? ILE A 289 ALA A 292 
AA2 6 ALA A 283 ? TYR A 286 ? ALA A 263 TYR A 266 
AA3 1 ARG A 429 ? ASP A 431 ? ARG A 409 ASP A 411 
AA3 2 MET A 529 ? ALA A 531 ? MET A 509 ALA A 511 
AA4 1 VAL A 502 ? GLN A 504 ? VAL A 482 GLN A 484 
AA4 2 LEU A 512 ? LEU A 514 ? LEU A 492 LEU A 494 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 113 ? N ALA A 93  O TYR A 140 ? O TYR A 120 
AA1 2 3 O LEU A 139 ? O LEU A 119 N VAL A 90  ? N VAL A 70  
AA1 3 4 N ILE A 89  ? N ILE A 69  O ALA A 164 ? O ALA A 144 
AA1 4 5 N VAL A 165 ? N VAL A 145 O MET A 198 ? O MET A 178 
AA1 5 6 O ALA A 199 ? O ALA A 179 N VAL A 65  ? N VAL A 45  
AA1 6 7 N LEU A 64  ? N LEU A 44  O LEU A 222 ? O LEU A 202 
AA2 1 2 N MET A 238 ? N MET A 218 O LEU A 358 ? O LEU A 338 
AA2 2 3 O PHE A 359 ? O PHE A 339 N HIS A 330 ? N HIS A 310 
AA2 3 4 O VAL A 329 ? O VAL A 309 N TYR A 262 ? N TYR A 242 
AA2 4 5 N ILE A 261 ? N ILE A 241 O ALA A 312 ? O ALA A 292 
AA2 5 6 O VAL A 311 ? O VAL A 291 N ALA A 284 ? N ALA A 264 
AA3 1 2 N TYR A 430 ? N TYR A 410 O LEU A 530 ? O LEU A 510 
AA4 1 2 N THR A 503 ? N THR A 483 O GLN A 513 ? O GLN A 493 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ZN 
_struct_site.pdbx_auth_seq_id     601 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'binding site for residue ZN A 601' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 400 ? CYS A 380 . ? 1_555 ? 
2 AC1 4 CYS A 417 ? CYS A 397 . ? 1_555 ? 
3 AC1 4 CYS A 420 ? CYS A 400 . ? 1_555 ? 
4 AC1 4 CYS A 423 ? CYS A 403 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4TMU 
_atom_sites.fract_transf_matrix[1][1]   0.012764 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010643 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009984 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ALA A 1 24  ? -6.721  24.019  -81.537 1.00 99.92  ? 4   ALA A N     1 
ATOM   2    C  CA    . ALA A 1 24  ? -7.885  23.419  -82.269 1.00 100.84 ? 4   ALA A CA    1 
ATOM   3    C  C     . ALA A 1 24  ? -8.639  22.358  -81.439 1.00 101.83 ? 4   ALA A C     1 
ATOM   4    O  O     . ALA A 1 24  ? -9.760  22.608  -80.990 1.00 96.94  ? 4   ALA A O     1 
ATOM   5    C  CB    . ALA A 1 24  ? -7.437  22.842  -83.609 1.00 98.07  ? 4   ALA A CB    1 
ATOM   6    N  N     . GLU A 1 25  ? -8.026  21.189  -81.234 1.00 102.53 ? 5   GLU A N     1 
ATOM   7    C  CA    . GLU A 1 25  ? -8.670  20.078  -80.508 1.00 101.22 ? 5   GLU A CA    1 
ATOM   8    C  C     . GLU A 1 25  ? -8.946  20.407  -79.027 1.00 98.48  ? 5   GLU A C     1 
ATOM   9    O  O     . GLU A 1 25  ? -9.931  19.931  -78.454 1.00 83.90  ? 5   GLU A O     1 
ATOM   10   C  CB    . GLU A 1 25  ? -7.815  18.802  -80.628 1.00 100.77 ? 5   GLU A CB    1 
ATOM   11   C  CG    . GLU A 1 25  ? -8.325  17.594  -79.847 1.00 103.55 ? 5   GLU A CG    1 
ATOM   12   C  CD    . GLU A 1 25  ? -9.741  17.192  -80.224 1.00 105.68 ? 5   GLU A CD    1 
ATOM   13   O  OE1   . GLU A 1 25  ? -9.959  16.798  -81.390 1.00 106.75 ? 5   GLU A OE1   1 
ATOM   14   O  OE2   . GLU A 1 25  ? -10.635 17.256  -79.353 1.00 103.23 ? 5   GLU A OE2   1 
ATOM   15   N  N     . VAL A 1 26  ? -8.077  21.230  -78.433 1.00 102.55 ? 6   VAL A N     1 
ATOM   16   C  CA    . VAL A 1 26  ? -8.140  21.592  -77.002 1.00 100.99 ? 6   VAL A CA    1 
ATOM   17   C  C     . VAL A 1 26  ? -9.152  22.702  -76.676 1.00 96.00  ? 6   VAL A C     1 
ATOM   18   O  O     . VAL A 1 26  ? -9.689  22.745  -75.565 1.00 94.55  ? 6   VAL A O     1 
ATOM   19   C  CB    . VAL A 1 26  ? -6.748  22.009  -76.454 1.00 103.45 ? 6   VAL A CB    1 
ATOM   20   C  CG1   . VAL A 1 26  ? -5.715  20.915  -76.713 1.00 104.49 ? 6   VAL A CG1   1 
ATOM   21   C  CG2   . VAL A 1 26  ? -6.284  23.340  -77.046 1.00 104.61 ? 6   VAL A CG2   1 
ATOM   22   N  N     . TYR A 1 27  ? -9.389  23.602  -77.631 1.00 94.54  ? 7   TYR A N     1 
ATOM   23   C  CA    . TYR A 1 27  ? -10.394 24.665  -77.483 1.00 93.26  ? 7   TYR A CA    1 
ATOM   24   C  C     . TYR A 1 27  ? -11.814 24.150  -77.739 1.00 82.19  ? 7   TYR A C     1 
ATOM   25   O  O     . TYR A 1 27  ? -12.781 24.673  -77.182 1.00 74.44  ? 7   TYR A O     1 
ATOM   26   C  CB    . TYR A 1 27  ? -10.092 25.837  -78.424 1.00 100.55 ? 7   TYR A CB    1 
ATOM   27   C  CG    . TYR A 1 27  ? -8.823  26.584  -78.080 1.00 111.94 ? 7   TYR A CG    1 
ATOM   28   C  CD1   . TYR A 1 27  ? -8.783  27.468  -77.000 1.00 117.02 ? 7   TYR A CD1   1 
ATOM   29   C  CD2   . TYR A 1 27  ? -7.660  26.410  -78.833 1.00 117.59 ? 7   TYR A CD2   1 
ATOM   30   C  CE1   . TYR A 1 27  ? -7.621  28.153  -76.676 1.00 120.17 ? 7   TYR A CE1   1 
ATOM   31   C  CE2   . TYR A 1 27  ? -6.495  27.091  -78.519 1.00 122.25 ? 7   TYR A CE2   1 
ATOM   32   C  CZ    . TYR A 1 27  ? -6.480  27.961  -77.441 1.00 123.69 ? 7   TYR A CZ    1 
ATOM   33   O  OH    . TYR A 1 27  ? -5.323  28.638  -77.129 1.00 126.10 ? 7   TYR A OH    1 
ATOM   34   N  N     . SER A 1 28  ? -11.928 23.141  -78.600 1.00 74.98  ? 8   SER A N     1 
ATOM   35   C  CA    . SER A 1 28  ? -13.201 22.469  -78.848 1.00 72.42  ? 8   SER A CA    1 
ATOM   36   C  C     . SER A 1 28  ? -13.695 21.793  -77.577 1.00 64.39  ? 8   SER A C     1 
ATOM   37   O  O     . SER A 1 28  ? -14.865 21.912  -77.225 1.00 59.58  ? 8   SER A O     1 
ATOM   38   C  CB    . SER A 1 28  ? -13.052 21.442  -79.972 1.00 76.36  ? 8   SER A CB    1 
ATOM   39   O  OG    . SER A 1 28  ? -12.894 22.094  -81.225 1.00 81.63  ? 8   SER A OG    1 
ATOM   40   N  N     . GLN A 1 29  ? -12.785 21.090  -76.903 1.00 58.33  ? 9   GLN A N     1 
ATOM   41   C  CA    . GLN A 1 29  ? -13.022 20.552  -75.564 1.00 53.40  ? 9   GLN A CA    1 
ATOM   42   C  C     . GLN A 1 29  ? -13.487 21.606  -74.556 1.00 48.87  ? 9   GLN A C     1 
ATOM   43   O  O     . GLN A 1 29  ? -14.498 21.410  -73.863 1.00 43.79  ? 9   GLN A O     1 
ATOM   44   C  CB    . GLN A 1 29  ? -11.750 19.874  -75.041 1.00 56.37  ? 9   GLN A CB    1 
ATOM   45   C  CG    . GLN A 1 29  ? -11.469 18.511  -75.661 1.00 57.76  ? 9   GLN A CG    1 
ATOM   46   C  CD    . GLN A 1 29  ? -12.723 17.653  -75.754 1.00 58.83  ? 9   GLN A CD    1 
ATOM   47   O  OE1   . GLN A 1 29  ? -13.023 16.871  -74.857 1.00 53.53  ? 9   GLN A OE1   1 
ATOM   48   N  NE2   . GLN A 1 29  ? -13.484 17.829  -76.831 1.00 63.95  ? 9   GLN A NE2   1 
ATOM   49   N  N     . GLU A 1 30  ? -12.750 22.711  -74.488 1.00 43.66  ? 10  GLU A N     1 
ATOM   50   C  CA    . GLU A 1 30  ? -13.045 23.781  -73.550 1.00 43.70  ? 10  GLU A CA    1 
ATOM   51   C  C     . GLU A 1 30  ? -14.384 24.402  -73.878 1.00 42.03  ? 10  GLU A C     1 
ATOM   52   O  O     . GLU A 1 30  ? -15.129 24.798  -72.981 1.00 42.68  ? 10  GLU A O     1 
ATOM   53   C  CB    . GLU A 1 30  ? -11.937 24.850  -73.554 1.00 47.79  ? 10  GLU A CB    1 
ATOM   54   C  CG    . GLU A 1 30  ? -12.200 26.041  -72.624 1.00 52.84  ? 10  GLU A CG    1 
ATOM   55   C  CD    . GLU A 1 30  ? -10.948 26.855  -72.264 1.00 57.08  ? 10  GLU A CD    1 
ATOM   56   O  OE1   . GLU A 1 30  ? -9.814  26.351  -72.431 1.00 60.14  ? 10  GLU A OE1   1 
ATOM   57   O  OE2   . GLU A 1 30  ? -11.090 28.009  -71.790 1.00 55.31  ? 10  GLU A OE2   1 
ATOM   58   N  N     . THR A 1 31  ? -14.702 24.474  -75.165 1.00 39.97  ? 11  THR A N     1 
ATOM   59   C  CA    . THR A 1 31  ? -15.989 24.996  -75.584 1.00 38.24  ? 11  THR A CA    1 
ATOM   60   C  C     . THR A 1 31  ? -17.096 24.109  -75.023 1.00 34.19  ? 11  THR A C     1 
ATOM   61   O  O     . THR A 1 31  ? -18.037 24.619  -74.460 1.00 32.82  ? 11  THR A O     1 
ATOM   62   C  CB    . THR A 1 31  ? -16.083 25.138  -77.124 1.00 39.74  ? 11  THR A CB    1 
ATOM   63   O  OG1   . THR A 1 31  ? -15.069 26.044  -77.568 1.00 42.97  ? 11  THR A OG1   1 
ATOM   64   C  CG2   . THR A 1 31  ? -17.435 25.699  -77.548 1.00 40.32  ? 11  THR A CG2   1 
ATOM   65   N  N     . LEU A 1 32  ? -16.952 22.793  -75.144 1.00 33.09  ? 12  LEU A N     1 
ATOM   66   C  CA    . LEU A 1 32  ? -17.934 21.855  -74.594 1.00 34.78  ? 12  LEU A CA    1 
ATOM   67   C  C     . LEU A 1 32  ? -18.055 21.977  -73.069 1.00 33.41  ? 12  LEU A C     1 
ATOM   68   O  O     . LEU A 1 32  ? -19.151 21.925  -72.526 1.00 33.46  ? 12  LEU A O     1 
ATOM   69   C  CB    . LEU A 1 32  ? -17.571 20.413  -74.959 1.00 36.85  ? 12  LEU A CB    1 
ATOM   70   C  CG    . LEU A 1 32  ? -17.571 20.025  -76.443 1.00 37.85  ? 12  LEU A CG    1 
ATOM   71   C  CD1   . LEU A 1 32  ? -16.953 18.647  -76.630 1.00 39.07  ? 12  LEU A CD1   1 
ATOM   72   C  CD2   . LEU A 1 32  ? -18.972 20.046  -77.032 1.00 38.38  ? 12  LEU A CD2   1 
ATOM   73   N  N     . ALA A 1 33  ? -16.925 22.152  -72.397 1.00 31.76  ? 13  ALA A N     1 
ATOM   74   C  CA    . ALA A 1 33  ? -16.903 22.346  -70.950 1.00 32.25  ? 13  ALA A CA    1 
ATOM   75   C  C     . ALA A 1 33  ? -17.635 23.605  -70.532 1.00 32.25  ? 13  ALA A C     1 
ATOM   76   O  O     . ALA A 1 33  ? -18.385 23.608  -69.537 1.00 32.71  ? 13  ALA A O     1 
ATOM   77   C  CB    . ALA A 1 33  ? -15.476 22.399  -70.449 1.00 31.12  ? 13  ALA A CB    1 
ATOM   78   N  N     . LYS A 1 34  ? -17.405 24.676  -71.281 1.00 33.55  ? 14  LYS A N     1 
ATOM   79   C  CA    . LYS A 1 34  ? -18.050 25.955  -71.016 1.00 35.20  ? 14  LYS A CA    1 
ATOM   80   C  C     . LYS A 1 34  ? -19.559 25.837  -71.111 1.00 33.89  ? 14  LYS A C     1 
ATOM   81   O  O     . LYS A 1 34  ? -20.300 26.397  -70.311 1.00 32.33  ? 14  LYS A O     1 
ATOM   82   C  CB    . LYS A 1 34  ? -17.555 26.995  -72.010 1.00 39.93  ? 14  LYS A CB    1 
ATOM   83   C  CG    . LYS A 1 34  ? -17.960 28.412  -71.651 1.00 44.70  ? 14  LYS A CG    1 
ATOM   84   C  CD    . LYS A 1 34  ? -17.094 29.430  -72.376 1.00 51.46  ? 14  LYS A CD    1 
ATOM   85   C  CE    . LYS A 1 34  ? -17.726 30.814  -72.360 1.00 55.88  ? 14  LYS A CE    1 
ATOM   86   N  NZ    . LYS A 1 34  ? -18.086 31.224  -70.973 1.00 60.33  ? 14  LYS A NZ    1 
ATOM   87   N  N     . GLN A 1 35  ? -20.021 25.075  -72.083 1.00 33.56  ? 15  GLN A N     1 
ATOM   88   C  CA    . GLN A 1 35  ? -21.449 24.908  -72.254 1.00 35.92  ? 15  GLN A CA    1 
ATOM   89   C  C     . GLN A 1 35  ? -22.026 24.148  -71.060 1.00 34.19  ? 15  GLN A C     1 
ATOM   90   O  O     . GLN A 1 35  ? -23.125 24.468  -70.594 1.00 33.60  ? 15  GLN A O     1 
ATOM   91   C  CB    . GLN A 1 35  ? -21.737 24.174  -73.570 1.00 38.01  ? 15  GLN A CB    1 
ATOM   92   C  CG    . GLN A 1 35  ? -23.212 23.981  -73.874 1.00 38.66  ? 15  GLN A CG    1 
ATOM   93   C  CD    . GLN A 1 35  ? -23.919 25.273  -74.255 1.00 42.97  ? 15  GLN A CD    1 
ATOM   94   O  OE1   . GLN A 1 35  ? -23.344 26.363  -74.191 1.00 44.65  ? 15  GLN A OE1   1 
ATOM   95   N  NE2   . GLN A 1 35  ? -25.182 25.152  -74.660 1.00 43.05  ? 15  GLN A NE2   1 
ATOM   96   N  N     . VAL A 1 36  ? -21.292 23.150  -70.565 1.00 30.97  ? 16  VAL A N     1 
ATOM   97   C  CA    . VAL A 1 36  ? -21.705 22.454  -69.340 1.00 30.51  ? 16  VAL A CA    1 
ATOM   98   C  C     . VAL A 1 36  ? -21.709 23.401  -68.145 1.00 29.72  ? 16  VAL A C     1 
ATOM   99   O  O     . VAL A 1 36  ? -22.659 23.437  -67.377 1.00 28.48  ? 16  VAL A O     1 
ATOM   100  C  CB    . VAL A 1 36  ? -20.839 21.224  -69.026 1.00 29.08  ? 16  VAL A CB    1 
ATOM   101  C  CG1   . VAL A 1 36  ? -21.256 20.633  -67.696 1.00 30.16  ? 16  VAL A CG1   1 
ATOM   102  C  CG2   . VAL A 1 36  ? -20.996 20.147  -70.103 1.00 28.65  ? 16  VAL A CG2   1 
ATOM   103  N  N     . LEU A 1 37  ? -20.644 24.171  -67.992 1.00 31.54  ? 17  LEU A N     1 
ATOM   104  C  CA    . LEU A 1 37  ? -20.582 25.202  -66.950 1.00 34.00  ? 17  LEU A CA    1 
ATOM   105  C  C     . LEU A 1 37  ? -21.862 26.081  -66.951 1.00 35.06  ? 17  LEU A C     1 
ATOM   106  O  O     . LEU A 1 37  ? -22.468 26.349  -65.902 1.00 34.49  ? 17  LEU A O     1 
ATOM   107  C  CB    . LEU A 1 37  ? -19.335 26.052  -67.202 1.00 35.01  ? 17  LEU A CB    1 
ATOM   108  C  CG    . LEU A 1 37  ? -18.650 26.948  -66.169 1.00 36.27  ? 17  LEU A CG    1 
ATOM   109  C  CD1   . LEU A 1 37  ? -18.840 28.411  -66.539 1.00 37.61  ? 17  LEU A CD1   1 
ATOM   110  C  CD2   . LEU A 1 37  ? -19.007 26.677  -64.717 1.00 34.92  ? 17  LEU A CD2   1 
ATOM   111  N  N     . GLN A 1 38  ? -22.276 26.488  -68.145 1.00 34.95  ? 18  GLN A N     1 
ATOM   112  C  CA    . GLN A 1 38  ? -23.480 27.308  -68.328 1.00 38.03  ? 18  GLN A CA    1 
ATOM   113  C  C     . GLN A 1 38  ? -24.791 26.519  -68.196 1.00 38.40  ? 18  GLN A C     1 
ATOM   114  O  O     . GLN A 1 38  ? -25.642 26.860  -67.377 1.00 34.28  ? 18  GLN A O     1 
ATOM   115  C  CB    . GLN A 1 38  ? -23.417 28.015  -69.693 1.00 37.98  ? 18  GLN A CB    1 
ATOM   116  C  CG    . GLN A 1 38  ? -22.326 29.083  -69.765 1.00 42.81  ? 18  GLN A CG    1 
ATOM   117  C  CD    . GLN A 1 38  ? -22.270 29.836  -71.093 1.00 46.13  ? 18  GLN A CD    1 
ATOM   118  O  OE1   . GLN A 1 38  ? -23.110 29.649  -71.973 1.00 53.94  ? 18  GLN A OE1   1 
ATOM   119  N  NE2   . GLN A 1 38  ? -21.279 30.698  -71.235 1.00 46.67  ? 18  GLN A NE2   1 
ATOM   120  N  N     . GLU A 1 39  ? -24.931 25.460  -68.994 1.00 40.79  ? 19  GLU A N     1 
ATOM   121  C  CA    . GLU A 1 39  ? -26.209 24.746  -69.127 1.00 45.61  ? 19  GLU A CA    1 
ATOM   122  C  C     . GLU A 1 39  ? -26.645 24.015  -67.876 1.00 43.53  ? 19  GLU A C     1 
ATOM   123  O  O     . GLU A 1 39  ? -27.831 24.070  -67.531 1.00 43.57  ? 19  GLU A O     1 
ATOM   124  C  CB    . GLU A 1 39  ? -26.196 23.768  -70.311 1.00 50.63  ? 19  GLU A CB    1 
ATOM   125  C  CG    . GLU A 1 39  ? -26.126 24.450  -71.681 1.00 56.73  ? 19  GLU A CG    1 
ATOM   126  C  CD    . GLU A 1 39  ? -27.447 25.061  -72.130 1.00 61.60  ? 19  GLU A CD    1 
ATOM   127  O  OE1   . GLU A 1 39  ? -28.372 24.288  -72.472 1.00 67.25  ? 19  GLU A OE1   1 
ATOM   128  O  OE2   . GLU A 1 39  ? -27.554 26.309  -72.162 1.00 66.50  ? 19  GLU A OE2   1 
ATOM   129  N  N     . THR A 1 40  ? -25.717 23.352  -67.181 1.00 42.41  ? 20  THR A N     1 
ATOM   130  C  CA    . THR A 1 40  ? -26.115 22.569  -65.996 1.00 40.45  ? 20  THR A CA    1 
ATOM   131  C  C     . THR A 1 40  ? -25.853 23.260  -64.667 1.00 39.09  ? 20  THR A C     1 
ATOM   132  O  O     . THR A 1 40  ? -26.652 23.133  -63.766 1.00 41.89  ? 20  THR A O     1 
ATOM   133  C  CB    . THR A 1 40  ? -25.592 21.095  -65.978 1.00 40.94  ? 20  THR A CB    1 
ATOM   134  O  OG1   . THR A 1 40  ? -24.712 20.866  -64.872 1.00 43.97  ? 20  THR A OG1   1 
ATOM   135  C  CG2   . THR A 1 40  ? -24.960 20.668  -67.273 1.00 38.78  ? 20  THR A CG2   1 
ATOM   136  N  N     . PHE A 1 41  ? -24.757 23.998  -64.546 1.00 42.22  ? 21  PHE A N     1 
ATOM   137  C  CA    . PHE A 1 41  ? -24.395 24.658  -63.280 1.00 42.62  ? 21  PHE A CA    1 
ATOM   138  C  C     . PHE A 1 41  ? -24.809 26.131  -63.218 1.00 44.38  ? 21  PHE A C     1 
ATOM   139  O  O     . PHE A 1 41  ? -24.759 26.755  -62.155 1.00 45.89  ? 21  PHE A O     1 
ATOM   140  C  CB    . PHE A 1 41  ? -22.891 24.502  -63.022 1.00 41.65  ? 21  PHE A CB    1 
ATOM   141  C  CG    . PHE A 1 41  ? -22.463 23.058  -62.880 1.00 41.70  ? 21  PHE A CG    1 
ATOM   142  C  CD1   . PHE A 1 41  ? -22.732 22.355  -61.701 1.00 42.91  ? 21  PHE A CD1   1 
ATOM   143  C  CD2   . PHE A 1 41  ? -21.849 22.393  -63.923 1.00 36.47  ? 21  PHE A CD2   1 
ATOM   144  C  CE1   . PHE A 1 41  ? -22.369 21.025  -61.567 1.00 41.84  ? 21  PHE A CE1   1 
ATOM   145  C  CE2   . PHE A 1 41  ? -21.478 21.068  -63.787 1.00 40.54  ? 21  PHE A CE2   1 
ATOM   146  C  CZ    . PHE A 1 41  ? -21.742 20.378  -62.613 1.00 39.46  ? 21  PHE A CZ    1 
ATOM   147  N  N     . GLY A 1 42  ? -25.199 26.683  -64.358 1.00 44.36  ? 22  GLY A N     1 
ATOM   148  C  CA    . GLY A 1 42  ? -25.736 28.026  -64.414 1.00 46.47  ? 22  GLY A CA    1 
ATOM   149  C  C     . GLY A 1 42  ? -24.721 29.131  -64.197 1.00 45.61  ? 22  GLY A C     1 
ATOM   150  O  O     . GLY A 1 42  ? -25.100 30.214  -63.789 1.00 43.85  ? 22  GLY A O     1 
ATOM   151  N  N     . TYR A 1 43  ? -23.445 28.868  -64.469 1.00 44.99  ? 23  TYR A N     1 
ATOM   152  C  CA    . TYR A 1 43  ? -22.407 29.896  -64.332 1.00 45.45  ? 23  TYR A CA    1 
ATOM   153  C  C     . TYR A 1 43  ? -22.033 30.440  -65.689 1.00 46.92  ? 23  TYR A C     1 
ATOM   154  O  O     . TYR A 1 43  ? -22.379 29.859  -66.710 1.00 49.20  ? 23  TYR A O     1 
ATOM   155  C  CB    . TYR A 1 43  ? -21.167 29.346  -63.635 1.00 43.16  ? 23  TYR A CB    1 
ATOM   156  C  CG    . TYR A 1 43  ? -21.382 28.941  -62.195 1.00 44.06  ? 23  TYR A CG    1 
ATOM   157  C  CD1   . TYR A 1 43  ? -22.127 29.743  -61.322 1.00 46.32  ? 23  TYR A CD1   1 
ATOM   158  C  CD2   . TYR A 1 43  ? -20.812 27.777  -61.686 1.00 44.33  ? 23  TYR A CD2   1 
ATOM   159  C  CE1   . TYR A 1 43  ? -22.311 29.388  -59.993 1.00 46.23  ? 23  TYR A CE1   1 
ATOM   160  C  CE2   . TYR A 1 43  ? -20.990 27.411  -60.362 1.00 47.35  ? 23  TYR A CE2   1 
ATOM   161  C  CZ    . TYR A 1 43  ? -21.740 28.222  -59.517 1.00 51.23  ? 23  TYR A CZ    1 
ATOM   162  O  OH    . TYR A 1 43  ? -21.926 27.857  -58.200 1.00 54.44  ? 23  TYR A OH    1 
ATOM   163  N  N     . GLN A 1 44  ? -21.317 31.555  -65.704 1.00 50.31  ? 24  GLN A N     1 
ATOM   164  C  CA    . GLN A 1 44  ? -21.102 32.291  -66.942 1.00 52.93  ? 24  GLN A CA    1 
ATOM   165  C  C     . GLN A 1 44  ? -19.734 32.011  -67.540 1.00 51.21  ? 24  GLN A C     1 
ATOM   166  O  O     . GLN A 1 44  ? -19.616 31.647  -68.713 1.00 50.02  ? 24  GLN A O     1 
ATOM   167  C  CB    . GLN A 1 44  ? -21.272 33.788  -66.682 1.00 58.56  ? 24  GLN A CB    1 
ATOM   168  C  CG    . GLN A 1 44  ? -21.527 34.619  -67.929 1.00 65.39  ? 24  GLN A CG    1 
ATOM   169  C  CD    . GLN A 1 44  ? -22.860 34.310  -68.588 1.00 72.11  ? 24  GLN A CD    1 
ATOM   170  O  OE1   . GLN A 1 44  ? -23.798 33.844  -67.935 1.00 79.33  ? 24  GLN A OE1   1 
ATOM   171  N  NE2   . GLN A 1 44  ? -22.952 34.575  -69.890 1.00 76.04  ? 24  GLN A NE2   1 
ATOM   172  N  N     . GLN A 1 45  ? -18.695 32.184  -66.734 1.00 53.62  ? 25  GLN A N     1 
ATOM   173  C  CA    . GLN A 1 45  ? -17.325 32.141  -67.243 1.00 53.22  ? 25  GLN A CA    1 
ATOM   174  C  C     . GLN A 1 45  ? -16.476 31.326  -66.301 1.00 48.64  ? 25  GLN A C     1 
ATOM   175  O  O     . GLN A 1 45  ? -16.742 31.318  -65.108 1.00 46.54  ? 25  GLN A O     1 
ATOM   176  C  CB    . GLN A 1 45  ? -16.760 33.563  -67.351 1.00 54.35  ? 25  GLN A CB    1 
ATOM   177  C  CG    . GLN A 1 45  ? -17.389 34.413  -68.453 1.00 59.23  ? 25  GLN A CG    1 
ATOM   178  C  CD    . GLN A 1 45  ? -16.979 33.988  -69.864 1.00 63.70  ? 25  GLN A CD    1 
ATOM   179  O  OE1   . GLN A 1 45  ? -17.816 33.899  -70.769 1.00 64.63  ? 25  GLN A OE1   1 
ATOM   180  N  NE2   . GLN A 1 45  ? -15.689 33.730  -70.060 1.00 66.27  ? 25  GLN A NE2   1 
ATOM   181  N  N     . PHE A 1 46  ? -15.474 30.626  -66.838 1.00 45.67  ? 26  PHE A N     1 
ATOM   182  C  CA    . PHE A 1 46  ? -14.485 29.962  -66.003 1.00 45.92  ? 26  PHE A CA    1 
ATOM   183  C  C     . PHE A 1 46  ? -13.667 31.027  -65.312 1.00 49.05  ? 26  PHE A C     1 
ATOM   184  O  O     . PHE A 1 46  ? -13.349 32.052  -65.928 1.00 47.66  ? 26  PHE A O     1 
ATOM   185  C  CB    . PHE A 1 46  ? -13.535 29.086  -66.824 1.00 45.69  ? 26  PHE A CB    1 
ATOM   186  C  CG    . PHE A 1 46  ? -14.136 27.798  -67.286 1.00 42.36  ? 26  PHE A CG    1 
ATOM   187  C  CD1   . PHE A 1 46  ? -14.613 26.870  -66.364 1.00 44.33  ? 26  PHE A CD1   1 
ATOM   188  C  CD2   . PHE A 1 46  ? -14.209 27.497  -68.630 1.00 40.50  ? 26  PHE A CD2   1 
ATOM   189  C  CE1   . PHE A 1 46  ? -15.167 25.671  -66.784 1.00 42.98  ? 26  PHE A CE1   1 
ATOM   190  C  CE2   . PHE A 1 46  ? -14.763 26.302  -69.058 1.00 40.78  ? 26  PHE A CE2   1 
ATOM   191  C  CZ    . PHE A 1 46  ? -15.239 25.387  -68.134 1.00 41.24  ? 26  PHE A CZ    1 
ATOM   192  N  N     . ARG A 1 47  ? -13.322 30.769  -64.050 1.00 50.43  ? 27  ARG A N     1 
ATOM   193  C  CA    . ARG A 1 47  ? -12.427 31.630  -63.283 1.00 53.39  ? 27  ARG A CA    1 
ATOM   194  C  C     . ARG A 1 47  ? -10.988 31.215  -63.621 1.00 58.63  ? 27  ARG A C     1 
ATOM   195  O  O     . ARG A 1 47  ? -10.767 30.124  -64.164 1.00 56.07  ? 27  ARG A O     1 
ATOM   196  C  CB    . ARG A 1 47  ? -12.633 31.447  -61.780 1.00 56.61  ? 27  ARG A CB    1 
ATOM   197  C  CG    . ARG A 1 47  ? -14.065 31.238  -61.303 1.00 58.27  ? 27  ARG A CG    1 
ATOM   198  C  CD    . ARG A 1 47  ? -14.683 32.454  -60.635 1.00 59.99  ? 27  ARG A CD    1 
ATOM   199  N  NE    . ARG A 1 47  ? -15.357 32.076  -59.391 1.00 61.10  ? 27  ARG A NE    1 
ATOM   200  C  CZ    . ARG A 1 47  ? -16.461 32.649  -58.909 1.00 66.11  ? 27  ARG A CZ    1 
ATOM   201  N  NH1   . ARG A 1 47  ? -17.074 33.638  -59.558 1.00 64.07  ? 27  ARG A NH1   1 
ATOM   202  N  NH2   . ARG A 1 47  ? -16.976 32.208  -57.766 1.00 69.37  ? 27  ARG A NH2   1 
ATOM   203  N  N     . PRO A 1 48  ? -10.000 32.067  -63.287 1.00 62.84  ? 28  PRO A N     1 
ATOM   204  C  CA    . PRO A 1 48  ? -8.581  31.711  -63.474 1.00 60.40  ? 28  PRO A CA    1 
ATOM   205  C  C     . PRO A 1 48  ? -8.194  30.332  -62.913 1.00 57.14  ? 28  PRO A C     1 
ATOM   206  O  O     . PRO A 1 48  ? -8.510  30.012  -61.749 1.00 54.68  ? 28  PRO A O     1 
ATOM   207  C  CB    . PRO A 1 48  ? -7.831  32.818  -62.723 1.00 63.89  ? 28  PRO A CB    1 
ATOM   208  C  CG    . PRO A 1 48  ? -8.764  33.988  -62.689 1.00 67.08  ? 28  PRO A CG    1 
ATOM   209  C  CD    . PRO A 1 48  ? -10.172 33.477  -62.874 1.00 67.39  ? 28  PRO A CD    1 
ATOM   210  N  N     . GLY A 1 49  ? -7.539  29.522  -63.745 1.00 49.78  ? 29  GLY A N     1 
ATOM   211  C  CA    . GLY A 1 49  ? -7.095  28.194  -63.323 1.00 51.58  ? 29  GLY A CA    1 
ATOM   212  C  C     . GLY A 1 49  ? -8.032  27.032  -63.626 1.00 47.77  ? 29  GLY A C     1 
ATOM   213  O  O     . GLY A 1 49  ? -7.569  25.902  -63.814 1.00 50.82  ? 29  GLY A O     1 
ATOM   214  N  N     . GLN A 1 50  ? -9.337  27.299  -63.699 1.00 42.52  ? 30  GLN A N     1 
ATOM   215  C  CA    . GLN A 1 50  ? -10.322 26.240  -63.861 1.00 39.53  ? 30  GLN A CA    1 
ATOM   216  C  C     . GLN A 1 50  ? -10.213 25.603  -65.209 1.00 36.89  ? 30  GLN A C     1 
ATOM   217  O  O     . GLN A 1 50  ? -10.262 24.384  -65.326 1.00 37.29  ? 30  GLN A O     1 
ATOM   218  C  CB    . GLN A 1 50  ? -11.732 26.763  -63.710 1.00 41.28  ? 30  GLN A CB    1 
ATOM   219  C  CG    . GLN A 1 50  ? -12.056 27.255  -62.320 1.00 45.04  ? 30  GLN A CG    1 
ATOM   220  C  CD    . GLN A 1 50  ? -13.522 27.621  -62.170 1.00 45.49  ? 30  GLN A CD    1 
ATOM   221  O  OE1   . GLN A 1 50  ? -14.087 28.325  -63.011 1.00 41.61  ? 30  GLN A OE1   1 
ATOM   222  N  NE2   . GLN A 1 50  ? -14.144 27.140  -61.101 1.00 47.41  ? 30  GLN A NE2   1 
ATOM   223  N  N     . ALA A 1 51  ? -10.073 26.416  -66.238 1.00 35.72  ? 31  ALA A N     1 
ATOM   224  C  CA    . ALA A 1 51  ? -10.040 25.874  -67.595 1.00 36.78  ? 31  ALA A CA    1 
ATOM   225  C  C     . ALA A 1 51  ? -8.812  25.006  -67.786 1.00 34.58  ? 31  ALA A C     1 
ATOM   226  O  O     . ALA A 1 51  ? -8.851  23.986  -68.480 1.00 32.36  ? 31  ALA A O     1 
ATOM   227  C  CB    . ALA A 1 51  ? -10.062 26.990  -68.621 1.00 37.47  ? 31  ALA A CB    1 
ATOM   228  N  N     . THR A 1 52  ? -7.716  25.402  -67.167 1.00 34.19  ? 32  THR A N     1 
ATOM   229  C  CA    . THR A 1 52  ? -6.469  24.664  -67.336 1.00 36.04  ? 32  THR A CA    1 
ATOM   230  C  C     . THR A 1 52  ? -6.567  23.234  -66.770 1.00 33.96  ? 32  THR A C     1 
ATOM   231  O  O     . THR A 1 52  ? -6.163  22.264  -67.419 1.00 34.21  ? 32  THR A O     1 
ATOM   232  C  CB    . THR A 1 52  ? -5.314  25.436  -66.700 1.00 38.15  ? 32  THR A CB    1 
ATOM   233  O  OG1   . THR A 1 52  ? -5.277  26.759  -67.251 1.00 43.06  ? 32  THR A OG1   1 
ATOM   234  C  CG2   . THR A 1 52  ? -3.977  24.751  -66.950 1.00 38.15  ? 32  THR A CG2   1 
ATOM   235  N  N     . ILE A 1 53  ? -7.127  23.095  -65.579 1.00 32.81  ? 33  ILE A N     1 
ATOM   236  C  CA    . ILE A 1 53  ? -7.293  21.764  -64.993 1.00 32.67  ? 33  ILE A CA    1 
ATOM   237  C  C     . ILE A 1 53  ? -8.259  20.948  -65.842 1.00 31.87  ? 33  ILE A C     1 
ATOM   238  O  O     . ILE A 1 53  ? -8.013  19.796  -66.182 1.00 32.77  ? 33  ILE A O     1 
ATOM   239  C  CB    . ILE A 1 53  ? -7.844  21.880  -63.564 1.00 33.99  ? 33  ILE A CB    1 
ATOM   240  C  CG1   . ILE A 1 53  ? -6.766  22.448  -62.647 1.00 34.04  ? 33  ILE A CG1   1 
ATOM   241  C  CG2   . ILE A 1 53  ? -8.337  20.530  -63.056 1.00 32.81  ? 33  ILE A CG2   1 
ATOM   242  C  CD1   . ILE A 1 53  ? -7.320  23.273  -61.513 1.00 34.92  ? 33  ILE A CD1   1 
ATOM   243  N  N     . ILE A 1 54  ? -9.365  21.572  -66.195 1.00 29.90  ? 34  ILE A N     1 
ATOM   244  C  CA    . ILE A 1 54  ? -10.401 20.886  -66.920 1.00 31.11  ? 34  ILE A CA    1 
ATOM   245  C  C     . ILE A 1 54  ? -9.904  20.441  -68.299 1.00 32.45  ? 34  ILE A C     1 
ATOM   246  O  O     . ILE A 1 54  ? -10.149 19.310  -68.726 1.00 30.50  ? 34  ILE A O     1 
ATOM   247  C  CB    . ILE A 1 54  ? -11.667 21.760  -66.952 1.00 30.50  ? 34  ILE A CB    1 
ATOM   248  C  CG1   . ILE A 1 54  ? -12.322 21.704  -65.558 1.00 30.06  ? 34  ILE A CG1   1 
ATOM   249  C  CG2   . ILE A 1 54  ? -12.638 21.290  -68.011 1.00 30.08  ? 34  ILE A CG2   1 
ATOM   250  C  CD1   . ILE A 1 54  ? -13.366 22.763  -65.287 1.00 30.04  ? 34  ILE A CD1   1 
ATOM   251  N  N     . ASP A 1 55  ? -9.161  21.309  -68.969 1.00 34.31  ? 35  ASP A N     1 
ATOM   252  C  CA    . ASP A 1 55  ? -8.545  20.950  -70.238 1.00 36.35  ? 35  ASP A CA    1 
ATOM   253  C  C     . ASP A 1 55  ? -7.547  19.804  -70.098 1.00 35.94  ? 35  ASP A C     1 
ATOM   254  O  O     . ASP A 1 55  ? -7.535  18.908  -70.933 1.00 38.09  ? 35  ASP A O     1 
ATOM   255  C  CB    . ASP A 1 55  ? -7.817  22.141  -70.828 1.00 40.91  ? 35  ASP A CB    1 
ATOM   256  C  CG    . ASP A 1 55  ? -8.748  23.272  -71.204 1.00 43.62  ? 35  ASP A CG    1 
ATOM   257  O  OD1   . ASP A 1 55  ? -9.980  23.190  -70.969 1.00 49.64  ? 35  ASP A OD1   1 
ATOM   258  O  OD2   . ASP A 1 55  ? -8.225  24.268  -71.718 1.00 48.60  ? 35  ASP A OD2   1 
ATOM   259  N  N     . ALA A 1 56  ? -6.713  19.819  -69.060 1.00 32.87  ? 36  ALA A N     1 
ATOM   260  C  CA    . ALA A 1 56  ? -5.725  18.742  -68.884 1.00 33.03  ? 36  ALA A CA    1 
ATOM   261  C  C     . ALA A 1 56  ? -6.374  17.366  -68.746 1.00 32.99  ? 36  ALA A C     1 
ATOM   262  O  O     . ALA A 1 56  ? -5.887  16.384  -69.287 1.00 34.24  ? 36  ALA A O     1 
ATOM   263  C  CB    . ALA A 1 56  ? -4.868  19.012  -67.665 1.00 34.94  ? 36  ALA A CB    1 
ATOM   264  N  N     . VAL A 1 57  ? -7.473  17.328  -68.003 1.00 31.45  ? 37  VAL A N     1 
ATOM   265  C  CA    . VAL A 1 57  ? -8.254  16.125  -67.764 1.00 32.07  ? 37  VAL A CA    1 
ATOM   266  C  C     . VAL A 1 57  ? -8.928  15.651  -69.051 1.00 31.68  ? 37  VAL A C     1 
ATOM   267  O  O     . VAL A 1 57  ? -8.897  14.467  -69.376 1.00 30.05  ? 37  VAL A O     1 
ATOM   268  C  CB    . VAL A 1 57  ? -9.315  16.445  -66.683 1.00 34.32  ? 37  VAL A CB    1 
ATOM   269  C  CG1   . VAL A 1 57  ? -10.341 15.362  -66.554 1.00 35.76  ? 37  VAL A CG1   1 
ATOM   270  C  CG2   . VAL A 1 57  ? -8.629  16.661  -65.349 1.00 38.33  ? 37  VAL A CG2   1 
ATOM   271  N  N     . LEU A 1 58  ? -9.532  16.582  -69.781 1.00 30.29  ? 38  LEU A N     1 
ATOM   272  C  CA    . LEU A 1 58  ? -10.113 16.278  -71.075 1.00 33.65  ? 38  LEU A CA    1 
ATOM   273  C  C     . LEU A 1 58  ? -9.055  15.805  -72.081 1.00 36.74  ? 38  LEU A C     1 
ATOM   274  O  O     . LEU A 1 58  ? -9.344  14.968  -72.930 1.00 37.04  ? 38  LEU A O     1 
ATOM   275  C  CB    . LEU A 1 58  ? -10.867 17.492  -71.621 1.00 33.04  ? 38  LEU A CB    1 
ATOM   276  C  CG    . LEU A 1 58  ? -12.053 17.867  -70.749 1.00 33.47  ? 38  LEU A CG    1 
ATOM   277  C  CD1   . LEU A 1 58  ? -12.666 19.185  -71.188 1.00 33.84  ? 38  LEU A CD1   1 
ATOM   278  C  CD2   . LEU A 1 58  ? -13.079 16.740  -70.747 1.00 34.48  ? 38  LEU A CD2   1 
ATOM   279  N  N     . GLU A 1 59  ? -7.830  16.307  -71.954 1.00 39.38  ? 39  GLU A N     1 
ATOM   280  C  CA    . GLU A 1 59  ? -6.727  15.870  -72.814 1.00 43.19  ? 39  GLU A CA    1 
ATOM   281  C  C     . GLU A 1 59  ? -6.125  14.556  -72.359 1.00 39.73  ? 39  GLU A C     1 
ATOM   282  O  O     . GLU A 1 59  ? -5.182  14.075  -72.970 1.00 42.67  ? 39  GLU A O     1 
ATOM   283  C  CB    . GLU A 1 59  ? -5.636  16.941  -72.880 1.00 47.96  ? 39  GLU A CB    1 
ATOM   284  C  CG    . GLU A 1 59  ? -6.041  18.185  -73.666 1.00 53.22  ? 39  GLU A CG    1 
ATOM   285  C  CD    . GLU A 1 59  ? -5.281  19.442  -73.232 1.00 62.35  ? 39  GLU A CD    1 
ATOM   286  O  OE1   . GLU A 1 59  ? -4.370  19.344  -72.360 1.00 60.01  ? 39  GLU A OE1   1 
ATOM   287  O  OE2   . GLU A 1 59  ? -5.606  20.540  -73.759 1.00 67.59  ? 39  GLU A OE2   1 
ATOM   288  N  N     . GLY A 1 60  ? -6.642  13.989  -71.273 1.00 38.41  ? 40  GLY A N     1 
ATOM   289  C  CA    . GLY A 1 60  ? -6.262  12.634  -70.827 1.00 34.81  ? 40  GLY A CA    1 
ATOM   290  C  C     . GLY A 1 60  ? -5.169  12.570  -69.779 1.00 34.21  ? 40  GLY A C     1 
ATOM   291  O  O     . GLY A 1 60  ? -4.647  11.490  -69.473 1.00 34.51  ? 40  GLY A O     1 
ATOM   292  N  N     . ARG A 1 61  ? -4.839  13.716  -69.200 1.00 32.51  ? 41  ARG A N     1 
ATOM   293  C  CA    . ARG A 1 61  ? -3.779  13.791  -68.212 1.00 31.85  ? 41  ARG A CA    1 
ATOM   294  C  C     . ARG A 1 61  ? -4.270  13.706  -66.761 1.00 30.71  ? 41  ARG A C     1 
ATOM   295  O  O     . ARG A 1 61  ? -5.358  14.195  -66.425 1.00 27.49  ? 41  ARG A O     1 
ATOM   296  C  CB    . ARG A 1 61  ? -3.033  15.094  -68.389 1.00 34.50  ? 41  ARG A CB    1 
ATOM   297  C  CG    . ARG A 1 61  ? -1.663  15.032  -67.778 1.00 37.42  ? 41  ARG A CG    1 
ATOM   298  C  CD    . ARG A 1 61  ? -0.880  16.257  -68.134 1.00 37.74  ? 41  ARG A CD    1 
ATOM   299  N  NE    . ARG A 1 61  ? 0.271   16.349  -67.267 1.00 36.76  ? 41  ARG A NE    1 
ATOM   300  C  CZ    . ARG A 1 61  ? 0.926   17.476  -67.038 1.00 38.28  ? 41  ARG A CZ    1 
ATOM   301  N  NH1   . ARG A 1 61  ? 0.524   18.607  -67.611 1.00 35.68  ? 41  ARG A NH1   1 
ATOM   302  N  NH2   . ARG A 1 61  ? 1.972   17.468  -66.221 1.00 40.37  ? 41  ARG A NH2   1 
ATOM   303  N  N     . ASP A 1 62  ? -3.443  13.094  -65.917 1.00 27.62  ? 42  ASP A N     1 
ATOM   304  C  CA    . ASP A 1 62  ? -3.701  13.002  -64.491 1.00 28.07  ? 42  ASP A CA    1 
ATOM   305  C  C     . ASP A 1 62  ? -3.542  14.377  -63.839 1.00 27.98  ? 42  ASP A C     1 
ATOM   306  O  O     . ASP A 1 62  ? -2.744  15.183  -64.297 1.00 27.35  ? 42  ASP A O     1 
ATOM   307  C  CB    . ASP A 1 62  ? -2.738  11.994  -63.865 1.00 27.54  ? 42  ASP A CB    1 
ATOM   308  C  CG    . ASP A 1 62  ? -3.119  10.545  -64.177 1.00 28.07  ? 42  ASP A CG    1 
ATOM   309  O  OD1   . ASP A 1 62  ? -4.163  10.282  -64.831 1.00 25.75  ? 42  ASP A OD1   1 
ATOM   310  O  OD2   . ASP A 1 62  ? -2.363  9.648   -63.758 1.00 28.97  ? 42  ASP A OD2   1 
ATOM   311  N  N     . CYS A 1 63  ? -4.330  14.651  -62.805 1.00 27.87  ? 43  CYS A N     1 
ATOM   312  C  CA    . CYS A 1 63  ? -4.306  15.948  -62.126 1.00 27.72  ? 43  CYS A CA    1 
ATOM   313  C  C     . CYS A 1 63  ? -4.339  15.809  -60.638 1.00 25.26  ? 43  CYS A C     1 
ATOM   314  O  O     . CYS A 1 63  ? -4.993  14.902  -60.101 1.00 23.04  ? 43  CYS A O     1 
ATOM   315  C  CB    . CYS A 1 63  ? -5.508  16.798  -62.485 1.00 30.42  ? 43  CYS A CB    1 
ATOM   316  S  SG    . CYS A 1 63  ? -5.596  17.236  -64.214 1.00 38.60  ? 43  CYS A SG    1 
ATOM   317  N  N     . LEU A 1 64  ? -3.620  16.727  -59.992 1.00 23.13  ? 44  LEU A N     1 
ATOM   318  C  CA    . LEU A 1 64  ? -3.658  16.917  -58.568 1.00 22.97  ? 44  LEU A CA    1 
ATOM   319  C  C     . LEU A 1 64  ? -4.006  18.384  -58.343 1.00 24.50  ? 44  LEU A C     1 
ATOM   320  O  O     . LEU A 1 64  ? -3.260  19.269  -58.760 1.00 25.14  ? 44  LEU A O     1 
ATOM   321  C  CB    . LEU A 1 64  ? -2.333  16.576  -57.907 1.00 22.40  ? 44  LEU A CB    1 
ATOM   322  C  CG    . LEU A 1 64  ? -2.302  16.895  -56.411 1.00 23.19  ? 44  LEU A CG    1 
ATOM   323  C  CD1   . LEU A 1 64  ? -3.287  16.046  -55.647 1.00 24.04  ? 44  LEU A CD1   1 
ATOM   324  C  CD2   . LEU A 1 64  ? -0.918  16.764  -55.800 1.00 25.01  ? 44  LEU A CD2   1 
ATOM   325  N  N     . VAL A 1 65  ? -5.155  18.610  -57.694 1.00 24.91  ? 45  VAL A N     1 
ATOM   326  C  CA    . VAL A 1 65  ? -5.717  19.936  -57.440 1.00 24.67  ? 45  VAL A CA    1 
ATOM   327  C  C     . VAL A 1 65  ? -5.766  20.139  -55.937 1.00 24.55  ? 45  VAL A C     1 
ATOM   328  O  O     . VAL A 1 65  ? -6.344  19.336  -55.205 1.00 26.83  ? 45  VAL A O     1 
ATOM   329  C  CB    . VAL A 1 65  ? -7.156  20.035  -57.976 1.00 26.48  ? 45  VAL A CB    1 
ATOM   330  C  CG1   . VAL A 1 65  ? -7.753  21.416  -57.731 1.00 26.43  ? 45  VAL A CG1   1 
ATOM   331  C  CG2   . VAL A 1 65  ? -7.210  19.659  -59.462 1.00 26.90  ? 45  VAL A CG2   1 
ATOM   332  N  N     . VAL A 1 66  ? -5.124  21.200  -55.494 1.00 23.95  ? 46  VAL A N     1 
ATOM   333  C  CA    . VAL A 1 66  ? -5.045  21.581  -54.108 1.00 24.67  ? 46  VAL A CA    1 
ATOM   334  C  C     . VAL A 1 66  ? -5.661  22.973  -54.085 1.00 25.74  ? 46  VAL A C     1 
ATOM   335  O  O     . VAL A 1 66  ? -5.070  23.923  -54.579 1.00 24.58  ? 46  VAL A O     1 
ATOM   336  C  CB    . VAL A 1 66  ? -3.572  21.570  -53.632 1.00 24.91  ? 46  VAL A CB    1 
ATOM   337  C  CG1   . VAL A 1 66  ? -3.444  21.930  -52.166 1.00 22.95  ? 46  VAL A CG1   1 
ATOM   338  C  CG2   . VAL A 1 66  ? -2.971  20.172  -53.843 1.00 25.32  ? 46  VAL A CG2   1 
ATOM   339  N  N     . MET A 1 67  ? -6.899  23.054  -53.596 1.00 29.63  ? 47  MET A N     1 
ATOM   340  C  CA    . MET A 1 67  ? -7.668  24.297  -53.549 1.00 31.93  ? 47  MET A CA    1 
ATOM   341  C  C     . MET A 1 67  ? -8.105  24.546  -52.129 1.00 29.79  ? 47  MET A C     1 
ATOM   342  O  O     . MET A 1 67  ? -9.212  24.218  -51.778 1.00 28.13  ? 47  MET A O     1 
ATOM   343  C  CB    . MET A 1 67  ? -8.911  24.227  -54.431 1.00 37.71  ? 47  MET A CB    1 
ATOM   344  C  CG    . MET A 1 67  ? -8.743  24.892  -55.783 1.00 44.10  ? 47  MET A CG    1 
ATOM   345  S  SD    . MET A 1 67  ? -10.104 24.491  -56.903 1.00 51.79  ? 47  MET A SD    1 
ATOM   346  C  CE    . MET A 1 67  ? -9.311  24.784  -58.492 1.00 49.15  ? 47  MET A CE    1 
ATOM   347  N  N     . PRO A 1 68  ? -7.224  25.131  -51.303 1.00 29.85  ? 48  PRO A N     1 
ATOM   348  C  CA    . PRO A 1 68  ? -7.590  25.407  -49.923 1.00 31.12  ? 48  PRO A CA    1 
ATOM   349  C  C     . PRO A 1 68  ? -8.667  26.488  -49.764 1.00 36.55  ? 48  PRO A C     1 
ATOM   350  O  O     . PRO A 1 68  ? -9.290  26.546  -48.715 1.00 40.49  ? 48  PRO A O     1 
ATOM   351  C  CB    . PRO A 1 68  ? -6.272  25.855  -49.278 1.00 29.93  ? 48  PRO A CB    1 
ATOM   352  C  CG    . PRO A 1 68  ? -5.218  25.714  -50.321 1.00 29.59  ? 48  PRO A CG    1 
ATOM   353  C  CD    . PRO A 1 68  ? -5.891  25.645  -51.644 1.00 28.27  ? 48  PRO A CD    1 
ATOM   354  N  N     . THR A 1 69  ? -8.895  27.284  -50.803 1.00 43.25  ? 49  THR A N     1 
ATOM   355  C  CA    . THR A 1 69  ? -9.759  28.467  -50.763 1.00 55.11  ? 49  THR A CA    1 
ATOM   356  C  C     . THR A 1 69  ? -11.252 28.145  -50.747 1.00 62.69  ? 49  THR A C     1 
ATOM   357  O  O     . THR A 1 69  ? -11.934 28.314  -49.728 1.00 64.95  ? 49  THR A O     1 
ATOM   358  C  CB    . THR A 1 69  ? -9.520  29.340  -52.028 1.00 60.69  ? 49  THR A CB    1 
ATOM   359  O  OG1   . THR A 1 69  ? -9.796  28.559  -53.211 1.00 58.69  ? 49  THR A OG1   1 
ATOM   360  C  CG2   . THR A 1 69  ? -8.060  29.885  -52.090 1.00 56.68  ? 49  THR A CG2   1 
ATOM   361  N  N     . GLY A 1 70  ? -11.748 27.689  -51.900 1.00 68.75  ? 50  GLY A N     1 
ATOM   362  C  CA    . GLY A 1 70  ? -13.179 27.495  -52.142 1.00 68.16  ? 50  GLY A CA    1 
ATOM   363  C  C     . GLY A 1 70  ? -13.519 27.715  -53.613 1.00 69.43  ? 50  GLY A C     1 
ATOM   364  O  O     . GLY A 1 70  ? -12.653 28.076  -54.424 1.00 66.80  ? 50  GLY A O     1 
ATOM   365  N  N     . GLY A 1 71  ? -14.772 27.485  -53.991 1.00 71.34  ? 51  GLY A N     1 
ATOM   366  C  CA    . GLY A 1 71  ? -15.765 26.789  -53.165 1.00 70.44  ? 51  GLY A CA    1 
ATOM   367  C  C     . GLY A 1 71  ? -16.495 25.749  -53.992 1.00 66.61  ? 51  GLY A C     1 
ATOM   368  O  O     . GLY A 1 71  ? -17.465 25.128  -53.520 1.00 69.77  ? 51  GLY A O     1 
ATOM   369  N  N     . GLY A 1 72  ? -16.026 25.559  -55.226 1.00 56.06  ? 52  GLY A N     1 
ATOM   370  C  CA    . GLY A 1 72  ? -16.570 24.554  -56.120 1.00 52.91  ? 52  GLY A CA    1 
ATOM   371  C  C     . GLY A 1 72  ? -15.438 23.811  -56.794 1.00 47.88  ? 52  GLY A C     1 
ATOM   372  O  O     . GLY A 1 72  ? -15.326 23.823  -58.013 1.00 49.65  ? 52  GLY A O     1 
ATOM   373  N  N     . LYS A 1 73  ? -14.572 23.180  -56.009 1.00 42.53  ? 53  LYS A N     1 
ATOM   374  C  CA    . LYS A 1 73  ? -13.535 22.362  -56.603 1.00 39.53  ? 53  LYS A CA    1 
ATOM   375  C  C     . LYS A 1 73  ? -14.110 21.044  -57.131 1.00 35.42  ? 53  LYS A C     1 
ATOM   376  O  O     . LYS A 1 73  ? -13.499 20.393  -57.964 1.00 32.07  ? 53  LYS A O     1 
ATOM   377  C  CB    . LYS A 1 73  ? -12.420 22.104  -55.622 1.00 42.19  ? 53  LYS A CB    1 
ATOM   378  C  CG    . LYS A 1 73  ? -12.695 21.032  -54.599 1.00 44.25  ? 53  LYS A CG    1 
ATOM   379  C  CD    . LYS A 1 73  ? -11.420 20.806  -53.813 1.00 47.34  ? 53  LYS A CD    1 
ATOM   380  C  CE    . LYS A 1 73  ? -11.663 19.860  -52.670 1.00 49.16  ? 53  LYS A CE    1 
ATOM   381  N  NZ    . LYS A 1 73  ? -12.494 20.495  -51.611 1.00 52.38  ? 53  LYS A NZ    1 
ATOM   382  N  N     . SER A 1 74  ? -15.288 20.666  -56.658 1.00 30.47  ? 54  SER A N     1 
ATOM   383  C  CA    . SER A 1 74  ? -16.008 19.562  -57.255 1.00 32.13  ? 54  SER A CA    1 
ATOM   384  C  C     . SER A 1 74  ? -16.234 19.745  -58.765 1.00 30.34  ? 54  SER A C     1 
ATOM   385  O  O     . SER A 1 74  ? -16.237 18.766  -59.527 1.00 26.42  ? 54  SER A O     1 
ATOM   386  C  CB    . SER A 1 74  ? -17.345 19.367  -56.539 1.00 32.72  ? 54  SER A CB    1 
ATOM   387  O  OG    . SER A 1 74  ? -17.132 18.546  -55.404 1.00 35.63  ? 54  SER A OG    1 
ATOM   388  N  N     . LEU A 1 75  ? -16.432 20.987  -59.190 1.00 28.75  ? 55  LEU A N     1 
ATOM   389  C  CA    . LEU A 1 75  ? -16.574 21.269  -60.610 1.00 30.67  ? 55  LEU A CA    1 
ATOM   390  C  C     . LEU A 1 75  ? -15.387 20.818  -61.433 1.00 29.06  ? 55  LEU A C     1 
ATOM   391  O  O     . LEU A 1 75  ? -15.559 20.506  -62.602 1.00 27.05  ? 55  LEU A O     1 
ATOM   392  C  CB    . LEU A 1 75  ? -16.818 22.746  -60.876 1.00 32.94  ? 55  LEU A CB    1 
ATOM   393  C  CG    . LEU A 1 75  ? -18.169 23.258  -60.394 1.00 37.83  ? 55  LEU A CG    1 
ATOM   394  C  CD1   . LEU A 1 75  ? -18.343 24.679  -60.880 1.00 39.77  ? 55  LEU A CD1   1 
ATOM   395  C  CD2   . LEU A 1 75  ? -19.335 22.384  -60.862 1.00 39.90  ? 55  LEU A CD2   1 
ATOM   396  N  N     . CYS A 1 76  ? -14.195 20.778  -60.829 1.00 27.75  ? 56  CYS A N     1 
ATOM   397  C  CA    . CYS A 1 76  ? -12.995 20.397  -61.554 1.00 26.87  ? 56  CYS A CA    1 
ATOM   398  C  C     . CYS A 1 76  ? -13.114 18.996  -62.107 1.00 26.56  ? 56  CYS A C     1 
ATOM   399  O  O     . CYS A 1 76  ? -12.482 18.695  -63.119 1.00 26.25  ? 56  CYS A O     1 
ATOM   400  C  CB    . CYS A 1 76  ? -11.753 20.484  -60.666 1.00 28.17  ? 56  CYS A CB    1 
ATOM   401  S  SG    . CYS A 1 76  ? -11.336 22.160  -60.123 1.00 32.63  ? 56  CYS A SG    1 
ATOM   402  N  N     . TYR A 1 77  ? -13.876 18.125  -61.439 1.00 24.53  ? 57  TYR A N     1 
ATOM   403  C  CA    . TYR A 1 77  ? -14.149 16.825  -62.017 1.00 24.80  ? 57  TYR A CA    1 
ATOM   404  C  C     . TYR A 1 77  ? -15.553 16.677  -62.564 1.00 24.66  ? 57  TYR A C     1 
ATOM   405  O  O     . TYR A 1 77  ? -15.740 15.909  -63.498 1.00 25.68  ? 57  TYR A O     1 
ATOM   406  C  CB    . TYR A 1 77  ? -13.827 15.678  -61.058 1.00 24.74  ? 57  TYR A CB    1 
ATOM   407  C  CG    . TYR A 1 77  ? -14.658 15.616  -59.817 1.00 23.87  ? 57  TYR A CG    1 
ATOM   408  C  CD1   . TYR A 1 77  ? -15.901 15.013  -59.828 1.00 23.97  ? 57  TYR A CD1   1 
ATOM   409  C  CD2   . TYR A 1 77  ? -14.180 16.108  -58.630 1.00 23.20  ? 57  TYR A CD2   1 
ATOM   410  C  CE1   . TYR A 1 77  ? -16.655 14.925  -58.681 1.00 24.91  ? 57  TYR A CE1   1 
ATOM   411  C  CE2   . TYR A 1 77  ? -14.931 16.033  -57.482 1.00 24.60  ? 57  TYR A CE2   1 
ATOM   412  C  CZ    . TYR A 1 77  ? -16.160 15.433  -57.517 1.00 25.29  ? 57  TYR A CZ    1 
ATOM   413  O  OH    . TYR A 1 77  ? -16.910 15.384  -56.372 1.00 31.22  ? 57  TYR A OH    1 
ATOM   414  N  N     . GLN A 1 78  ? -16.538 17.380  -62.019 1.00 23.39  ? 58  GLN A N     1 
ATOM   415  C  CA    . GLN A 1 78  ? -17.915 17.152  -62.481 1.00 24.89  ? 58  GLN A CA    1 
ATOM   416  C  C     . GLN A 1 78  ? -18.149 17.614  -63.905 1.00 25.82  ? 58  GLN A C     1 
ATOM   417  O  O     . GLN A 1 78  ? -18.860 16.958  -64.681 1.00 25.35  ? 58  GLN A O     1 
ATOM   418  C  CB    . GLN A 1 78  ? -18.930 17.787  -61.545 1.00 24.82  ? 58  GLN A CB    1 
ATOM   419  C  CG    . GLN A 1 78  ? -18.977 17.058  -60.220 1.00 25.27  ? 58  GLN A CG    1 
ATOM   420  C  CD    . GLN A 1 78  ? -19.760 17.797  -59.187 1.00 25.30  ? 58  GLN A CD    1 
ATOM   421  O  OE1   . GLN A 1 78  ? -20.054 18.963  -59.351 1.00 28.13  ? 58  GLN A OE1   1 
ATOM   422  N  NE2   . GLN A 1 78  ? -20.117 17.120  -58.117 1.00 26.61  ? 58  GLN A NE2   1 
ATOM   423  N  N     . ILE A 1 79  ? -17.534 18.735  -64.259 1.00 25.91  ? 59  ILE A N     1 
ATOM   424  C  CA    . ILE A 1 79  ? -17.671 19.260  -65.599 1.00 25.89  ? 59  ILE A CA    1 
ATOM   425  C  C     . ILE A 1 79  ? -17.055 18.336  -66.660 1.00 25.38  ? 59  ILE A C     1 
ATOM   426  O  O     . ILE A 1 79  ? -17.694 18.022  -67.659 1.00 27.09  ? 59  ILE A O     1 
ATOM   427  C  CB    . ILE A 1 79  ? -17.115 20.682  -65.660 1.00 26.85  ? 59  ILE A CB    1 
ATOM   428  C  CG1   . ILE A 1 79  ? -18.058 21.569  -64.855 1.00 28.29  ? 59  ILE A CG1   1 
ATOM   429  C  CG2   . ILE A 1 79  ? -16.993 21.139  -67.106 1.00 27.64  ? 59  ILE A CG2   1 
ATOM   430  C  CD1   . ILE A 1 79  ? -17.790 23.049  -64.942 1.00 29.57  ? 59  ILE A CD1   1 
ATOM   431  N  N     . PRO A 1 80  ? -15.835 17.878  -66.449 1.00 24.22  ? 60  PRO A N     1 
ATOM   432  C  CA    . PRO A 1 80  ? -15.305 16.984  -67.468 1.00 25.94  ? 60  PRO A CA    1 
ATOM   433  C  C     . PRO A 1 80  ? -15.980 15.608  -67.475 1.00 27.51  ? 60  PRO A C     1 
ATOM   434  O  O     . PRO A 1 80  ? -15.979 14.918  -68.504 1.00 26.39  ? 60  PRO A O     1 
ATOM   435  C  CB    . PRO A 1 80  ? -13.819 16.857  -67.112 1.00 26.17  ? 60  PRO A CB    1 
ATOM   436  C  CG    . PRO A 1 80  ? -13.663 17.435  -65.761 1.00 25.85  ? 60  PRO A CG    1 
ATOM   437  C  CD    . PRO A 1 80  ? -14.811 18.355  -65.515 1.00 25.43  ? 60  PRO A CD    1 
ATOM   438  N  N     . ALA A 1 81  ? -16.552 15.215  -66.340 1.00 28.14  ? 61  ALA A N     1 
ATOM   439  C  CA    . ALA A 1 81  ? -17.353 14.005  -66.282 1.00 29.85  ? 61  ALA A CA    1 
ATOM   440  C  C     . ALA A 1 81  ? -18.620 14.145  -67.129 1.00 31.17  ? 61  ALA A C     1 
ATOM   441  O  O     . ALA A 1 81  ? -19.134 13.152  -67.645 1.00 30.99  ? 61  ALA A O     1 
ATOM   442  C  CB    . ALA A 1 81  ? -17.723 13.686  -64.845 1.00 31.14  ? 61  ALA A CB    1 
ATOM   443  N  N     . LEU A 1 82  ? -19.124 15.368  -67.271 1.00 29.93  ? 62  LEU A N     1 
ATOM   444  C  CA    . LEU A 1 82  ? -20.284 15.603  -68.123 1.00 31.26  ? 62  LEU A CA    1 
ATOM   445  C  C     . LEU A 1 82  ? -19.944 15.864  -69.590 1.00 31.18  ? 62  LEU A C     1 
ATOM   446  O  O     . LEU A 1 82  ? -20.828 15.800  -70.428 1.00 33.37  ? 62  LEU A O     1 
ATOM   447  C  CB    . LEU A 1 82  ? -21.141 16.737  -67.567 1.00 31.01  ? 62  LEU A CB    1 
ATOM   448  C  CG    . LEU A 1 82  ? -21.810 16.341  -66.265 1.00 31.80  ? 62  LEU A CG    1 
ATOM   449  C  CD1   . LEU A 1 82  ? -22.500 17.533  -65.643 1.00 32.26  ? 62  LEU A CD1   1 
ATOM   450  C  CD2   . LEU A 1 82  ? -22.791 15.199  -66.499 1.00 33.59  ? 62  LEU A CD2   1 
ATOM   451  N  N     . VAL A 1 83  ? -18.690 16.147  -69.904 1.00 31.10  ? 63  VAL A N     1 
ATOM   452  C  CA    . VAL A 1 83  ? -18.257 16.226  -71.305 1.00 32.61  ? 63  VAL A CA    1 
ATOM   453  C  C     . VAL A 1 83  ? -17.831 14.869  -71.833 1.00 32.19  ? 63  VAL A C     1 
ATOM   454  O  O     . VAL A 1 83  ? -18.147 14.529  -72.946 1.00 33.60  ? 63  VAL A O     1 
ATOM   455  C  CB    . VAL A 1 83  ? -17.059 17.186  -71.482 1.00 32.65  ? 63  VAL A CB    1 
ATOM   456  C  CG1   . VAL A 1 83  ? -16.553 17.153  -72.925 1.00 31.23  ? 63  VAL A CG1   1 
ATOM   457  C  CG2   . VAL A 1 83  ? -17.459 18.596  -71.072 1.00 31.49  ? 63  VAL A CG2   1 
ATOM   458  N  N     . LYS A 1 84  ? -17.080 14.115  -71.042 1.00 33.01  ? 64  LYS A N     1 
ATOM   459  C  CA    . LYS A 1 84  ? -16.601 12.788  -71.455 1.00 34.31  ? 64  LYS A CA    1 
ATOM   460  C  C     . LYS A 1 84  ? -17.763 11.826  -71.591 1.00 35.11  ? 64  LYS A C     1 
ATOM   461  O  O     . LYS A 1 84  ? -18.799 12.010  -70.959 1.00 36.25  ? 64  LYS A O     1 
ATOM   462  C  CB    . LYS A 1 84  ? -15.627 12.205  -70.432 1.00 34.92  ? 64  LYS A CB    1 
ATOM   463  C  CG    . LYS A 1 84  ? -14.265 12.857  -70.443 1.00 38.62  ? 64  LYS A CG    1 
ATOM   464  C  CD    . LYS A 1 84  ? -13.407 12.358  -69.296 1.00 42.64  ? 64  LYS A CD    1 
ATOM   465  C  CE    . LYS A 1 84  ? -12.036 13.033  -69.270 1.00 43.29  ? 64  LYS A CE    1 
ATOM   466  N  NZ    . LYS A 1 84  ? -11.146 12.555  -70.356 1.00 44.92  ? 64  LYS A NZ    1 
ATOM   467  N  N     . THR A 1 85  ? -17.583 10.793  -72.407 1.00 34.36  ? 65  THR A N     1 
ATOM   468  C  CA    . THR A 1 85  ? -18.570 9.753   -72.512 1.00 37.72  ? 65  THR A CA    1 
ATOM   469  C  C     . THR A 1 85  ? -18.073 8.649   -71.618 1.00 35.69  ? 65  THR A C     1 
ATOM   470  O  O     . THR A 1 85  ? -16.884 8.340   -71.588 1.00 37.46  ? 65  THR A O     1 
ATOM   471  C  CB    . THR A 1 85  ? -18.766 9.251   -73.962 1.00 40.87  ? 65  THR A CB    1 
ATOM   472  O  OG1   . THR A 1 85  ? -17.657 8.433   -74.368 1.00 44.78  ? 65  THR A OG1   1 
ATOM   473  C  CG2   . THR A 1 85  ? -18.901 10.425  -74.900 1.00 41.63  ? 65  THR A CG2   1 
ATOM   474  N  N     . GLY A 1 86  ? -18.977 8.060   -70.867 1.00 34.57  ? 66  GLY A N     1 
ATOM   475  C  CA    . GLY A 1 86  ? -18.570 7.016   -69.949 1.00 33.35  ? 66  GLY A CA    1 
ATOM   476  C  C     . GLY A 1 86  ? -18.806 7.457   -68.532 1.00 31.35  ? 66  GLY A C     1 
ATOM   477  O  O     . GLY A 1 86  ? -19.289 8.565   -68.269 1.00 31.07  ? 66  GLY A O     1 
ATOM   478  N  N     . LEU A 1 87  ? -18.455 6.573   -67.620 1.00 29.25  ? 67  LEU A N     1 
ATOM   479  C  CA    . LEU A 1 87  ? -18.744 6.755   -66.235 1.00 29.07  ? 67  LEU A CA    1 
ATOM   480  C  C     . LEU A 1 87  ? -17.533 7.359   -65.527 1.00 26.03  ? 67  LEU A C     1 
ATOM   481  O  O     . LEU A 1 87  ? -16.412 6.924   -65.729 1.00 26.17  ? 67  LEU A O     1 
ATOM   482  C  CB    . LEU A 1 87  ? -19.064 5.395   -65.633 1.00 30.51  ? 67  LEU A CB    1 
ATOM   483  C  CG    . LEU A 1 87  ? -19.295 5.383   -64.133 1.00 31.83  ? 67  LEU A CG    1 
ATOM   484  C  CD1   . LEU A 1 87  ? -20.530 6.196   -63.788 1.00 32.17  ? 67  LEU A CD1   1 
ATOM   485  C  CD2   . LEU A 1 87  ? -19.467 3.955   -63.666 1.00 35.30  ? 67  LEU A CD2   1 
ATOM   486  N  N     . THR A 1 88  ? -17.787 8.336   -64.675 1.00 23.95  ? 68  THR A N     1 
ATOM   487  C  CA    . THR A 1 88  ? -16.802 8.841   -63.736 1.00 22.28  ? 68  THR A CA    1 
ATOM   488  C  C     . THR A 1 88  ? -17.055 8.225   -62.364 1.00 22.63  ? 68  THR A C     1 
ATOM   489  O  O     . THR A 1 88  ? -18.188 8.233   -61.852 1.00 21.93  ? 68  THR A O     1 
ATOM   490  C  CB    . THR A 1 88  ? -16.878 10.370  -63.685 1.00 21.71  ? 68  THR A CB    1 
ATOM   491  O  OG1   . THR A 1 88  ? -16.468 10.871  -64.954 1.00 22.62  ? 68  THR A OG1   1 
ATOM   492  C  CG2   . THR A 1 88  ? -15.950 10.954  -62.643 1.00 22.11  ? 68  THR A CG2   1 
ATOM   493  N  N     . ILE A 1 89  ? -16.015 7.643   -61.782 1.00 22.66  ? 69  ILE A N     1 
ATOM   494  C  CA    . ILE A 1 89  ? -16.121 7.142   -60.430 1.00 22.38  ? 69  ILE A CA    1 
ATOM   495  C  C     . ILE A 1 89  ? -15.530 8.182   -59.507 1.00 20.78  ? 69  ILE A C     1 
ATOM   496  O  O     . ILE A 1 89  ? -14.421 8.651   -59.738 1.00 21.32  ? 69  ILE A O     1 
ATOM   497  C  CB    . ILE A 1 89  ? -15.443 5.776   -60.265 1.00 23.40  ? 69  ILE A CB    1 
ATOM   498  C  CG1   . ILE A 1 89  ? -16.264 4.709   -61.016 1.00 25.59  ? 69  ILE A CG1   1 
ATOM   499  C  CG2   . ILE A 1 89  ? -15.401 5.360   -58.800 1.00 23.23  ? 69  ILE A CG2   1 
ATOM   500  C  CD1   . ILE A 1 89  ? -15.644 3.327   -61.039 1.00 25.59  ? 69  ILE A CD1   1 
ATOM   501  N  N     . VAL A 1 90  ? -16.264 8.532   -58.453 1.00 18.62  ? 70  VAL A N     1 
ATOM   502  C  CA    . VAL A 1 90  ? -15.772 9.480   -57.481 1.00 18.28  ? 70  VAL A CA    1 
ATOM   503  C  C     . VAL A 1 90  ? -15.611 8.811   -56.128 1.00 18.66  ? 70  VAL A C     1 
ATOM   504  O  O     . VAL A 1 90  ? -16.574 8.355   -55.550 1.00 20.06  ? 70  VAL A O     1 
ATOM   505  C  CB    . VAL A 1 90  ? -16.724 10.683  -57.361 1.00 18.69  ? 70  VAL A CB    1 
ATOM   506  C  CG1   . VAL A 1 90  ? -16.156 11.721  -56.404 1.00 18.53  ? 70  VAL A CG1   1 
ATOM   507  C  CG2   . VAL A 1 90  ? -16.950 11.312  -58.730 1.00 18.18  ? 70  VAL A CG2   1 
ATOM   508  N  N     . VAL A 1 91  ? -14.391 8.766   -55.615 1.00 18.43  ? 71  VAL A N     1 
ATOM   509  C  CA    . VAL A 1 91  ? -14.118 8.116   -54.365 1.00 19.42  ? 71  VAL A CA    1 
ATOM   510  C  C     . VAL A 1 91  ? -14.303 9.137   -53.284 1.00 20.54  ? 71  VAL A C     1 
ATOM   511  O  O     . VAL A 1 91  ? -13.717 10.218  -53.388 1.00 21.86  ? 71  VAL A O     1 
ATOM   512  C  CB    . VAL A 1 91  ? -12.679 7.565   -54.309 1.00 19.86  ? 71  VAL A CB    1 
ATOM   513  C  CG1   . VAL A 1 91  ? -12.490 6.718   -53.073 1.00 20.60  ? 71  VAL A CG1   1 
ATOM   514  C  CG2   . VAL A 1 91  ? -12.387 6.717   -55.518 1.00 20.18  ? 71  VAL A CG2   1 
ATOM   515  N  N     . SER A 1 92  ? -15.102 8.804   -52.268 1.00 21.16  ? 72  SER A N     1 
ATOM   516  C  CA    . SER A 1 92  ? -15.403 9.699   -51.152 1.00 24.02  ? 72  SER A CA    1 
ATOM   517  C  C     . SER A 1 92  ? -15.253 8.990   -49.830 1.00 22.63  ? 72  SER A C     1 
ATOM   518  O  O     . SER A 1 92  ? -15.577 7.821   -49.706 1.00 22.56  ? 72  SER A O     1 
ATOM   519  C  CB    . SER A 1 92  ? -16.856 10.232  -51.192 1.00 28.06  ? 72  SER A CB    1 
ATOM   520  O  OG    . SER A 1 92  ? -17.326 10.219  -52.526 1.00 37.45  ? 72  SER A OG    1 
ATOM   521  N  N     . PRO A 1 93  ? -14.805 9.721   -48.822 1.00 21.90  ? 73  PRO A N     1 
ATOM   522  C  CA    . PRO A 1 93  ? -14.522 9.183   -47.519 1.00 22.04  ? 73  PRO A CA    1 
ATOM   523  C  C     . PRO A 1 93  ? -15.734 9.050   -46.645 1.00 23.00  ? 73  PRO A C     1 
ATOM   524  O  O     . PRO A 1 93  ? -15.655 8.416   -45.570 1.00 25.23  ? 73  PRO A O     1 
ATOM   525  C  CB    . PRO A 1 93  ? -13.578 10.222  -46.912 1.00 21.65  ? 73  PRO A CB    1 
ATOM   526  C  CG    . PRO A 1 93  ? -14.007 11.485  -47.535 1.00 21.92  ? 73  PRO A CG    1 
ATOM   527  C  CD    . PRO A 1 93  ? -14.379 11.122  -48.947 1.00 21.35  ? 73  PRO A CD    1 
ATOM   528  N  N     . LEU A 1 94  ? -16.865 9.592   -47.059 1.00 22.76  ? 74  LEU A N     1 
ATOM   529  C  CA    . LEU A 1 94  ? -17.961 9.700   -46.110 1.00 21.99  ? 74  LEU A CA    1 
ATOM   530  C  C     . LEU A 1 94  ? -19.272 9.485   -46.805 1.00 21.57  ? 74  LEU A C     1 
ATOM   531  O  O     . LEU A 1 94  ? -19.525 10.108  -47.821 1.00 22.40  ? 74  LEU A O     1 
ATOM   532  C  CB    . LEU A 1 94  ? -17.880 11.082  -45.483 1.00 23.90  ? 74  LEU A CB    1 
ATOM   533  C  CG    . LEU A 1 94  ? -17.442 11.372  -44.031 1.00 26.15  ? 74  LEU A CG    1 
ATOM   534  C  CD1   . LEU A 1 94  ? -16.485 10.390  -43.353 1.00 24.77  ? 74  LEU A CD1   1 
ATOM   535  C  CD2   . LEU A 1 94  ? -16.921 12.789  -43.936 1.00 25.26  ? 74  LEU A CD2   1 
ATOM   536  N  N     . ILE A 1 95  ? -20.118 8.613   -46.257 1.00 21.94  ? 75  ILE A N     1 
ATOM   537  C  CA    . ILE A 1 95  ? -21.484 8.451   -46.755 1.00 21.82  ? 75  ILE A CA    1 
ATOM   538  C  C     . ILE A 1 95  ? -22.214 9.776   -46.823 1.00 21.79  ? 75  ILE A C     1 
ATOM   539  O  O     . ILE A 1 95  ? -22.960 10.045  -47.776 1.00 21.07  ? 75  ILE A O     1 
ATOM   540  C  CB    . ILE A 1 95  ? -22.353 7.552   -45.841 1.00 24.03  ? 75  ILE A CB    1 
ATOM   541  C  CG1   . ILE A 1 95  ? -21.792 6.131   -45.697 1.00 25.81  ? 75  ILE A CG1   1 
ATOM   542  C  CG2   . ILE A 1 95  ? -23.787 7.478   -46.350 1.00 23.42  ? 75  ILE A CG2   1 
ATOM   543  C  CD1   . ILE A 1 95  ? -21.212 5.617   -46.973 1.00 29.15  ? 75  ILE A CD1   1 
ATOM   544  N  N     . SER A 1 96  ? -22.060 10.592  -45.792 1.00 22.24  ? 76  SER A N     1 
ATOM   545  C  CA    . SER A 1 96  ? -22.784 11.872  -45.763 1.00 24.83  ? 76  SER A CA    1 
ATOM   546  C  C     . SER A 1 96  ? -22.305 12.876  -46.819 1.00 25.02  ? 76  SER A C     1 
ATOM   547  O  O     . SER A 1 96  ? -23.072 13.677  -47.306 1.00 28.12  ? 76  SER A O     1 
ATOM   548  C  CB    . SER A 1 96  ? -22.721 12.501  -44.386 1.00 23.80  ? 76  SER A CB    1 
ATOM   549  O  OG    . SER A 1 96  ? -21.451 13.040  -44.207 1.00 24.99  ? 76  SER A OG    1 
ATOM   550  N  N     . LEU A 1 97  ? -21.043 12.820  -47.173 1.00 27.34  ? 77  LEU A N     1 
ATOM   551  C  CA    . LEU A 1 97  ? -20.523 13.557  -48.323 1.00 28.48  ? 77  LEU A CA    1 
ATOM   552  C  C     . LEU A 1 97  ? -21.112 13.033  -49.643 1.00 27.64  ? 77  LEU A C     1 
ATOM   553  O  O     . LEU A 1 97  ? -21.574 13.817  -50.477 1.00 25.90  ? 77  LEU A O     1 
ATOM   554  C  CB    . LEU A 1 97  ? -19.011 13.415  -48.383 1.00 29.33  ? 77  LEU A CB    1 
ATOM   555  C  CG    . LEU A 1 97  ? -18.137 14.611  -48.072 1.00 34.14  ? 77  LEU A CG    1 
ATOM   556  C  CD1   . LEU A 1 97  ? -18.753 15.578  -47.074 1.00 35.11  ? 77  LEU A CD1   1 
ATOM   557  C  CD2   . LEU A 1 97  ? -16.746 14.142  -47.615 1.00 34.04  ? 77  LEU A CD2   1 
ATOM   558  N  N     . MET A 1 98  ? -21.061 11.720  -49.835 1.00 24.68  ? 78  MET A N     1 
ATOM   559  C  CA    . MET A 1 98  ? -21.655 11.103  -50.999 1.00 25.42  ? 78  MET A CA    1 
ATOM   560  C  C     . MET A 1 98  ? -23.087 11.606  -51.234 1.00 24.50  ? 78  MET A C     1 
ATOM   561  O  O     . MET A 1 98  ? -23.447 11.993  -52.328 1.00 23.59  ? 78  MET A O     1 
ATOM   562  C  CB    . MET A 1 98  ? -21.709 9.587   -50.797 1.00 28.62  ? 78  MET A CB    1 
ATOM   563  C  CG    . MET A 1 98  ? -20.526 8.840   -51.347 1.00 31.54  ? 78  MET A CG    1 
ATOM   564  S  SD    . MET A 1 98  ? -20.372 7.150   -50.756 1.00 32.78  ? 78  MET A SD    1 
ATOM   565  C  CE    . MET A 1 98  ? -22.055 6.614   -50.830 1.00 35.02  ? 78  MET A CE    1 
ATOM   566  N  N     . LYS A 1 99  ? -23.889 11.577  -50.188 1.00 24.31  ? 79  LYS A N     1 
ATOM   567  C  CA    . LYS A 1 99  ? -25.271 12.001  -50.250 1.00 28.23  ? 79  LYS A CA    1 
ATOM   568  C  C     . LYS A 1 99  ? -25.412 13.498  -50.561 1.00 28.27  ? 79  LYS A C     1 
ATOM   569  O  O     . LYS A 1 99  ? -26.230 13.876  -51.408 1.00 28.96  ? 79  LYS A O     1 
ATOM   570  C  CB    . LYS A 1 99  ? -25.958 11.669  -48.934 1.00 31.55  ? 79  LYS A CB    1 
ATOM   571  C  CG    . LYS A 1 99  ? -27.376 12.174  -48.821 1.00 40.35  ? 79  LYS A CG    1 
ATOM   572  C  CD    . LYS A 1 99  ? -28.100 11.599  -47.603 1.00 45.49  ? 79  LYS A CD    1 
ATOM   573  C  CE    . LYS A 1 99  ? -29.429 12.325  -47.341 1.00 50.04  ? 79  LYS A CE    1 
ATOM   574  N  NZ    . LYS A 1 99  ? -30.588 11.820  -48.152 1.00 49.58  ? 79  LYS A NZ    1 
ATOM   575  N  N     . ASP A 1 100 ? -24.633 14.350  -49.905 1.00 25.88  ? 80  ASP A N     1 
ATOM   576  C  CA    . ASP A 1 100 ? -24.727 15.782  -50.209 1.00 28.52  ? 80  ASP A CA    1 
ATOM   577  C  C     . ASP A 1 100 ? -24.430 16.075  -51.671 1.00 25.27  ? 80  ASP A C     1 
ATOM   578  O  O     . ASP A 1 100 ? -25.105 16.878  -52.268 1.00 25.09  ? 80  ASP A O     1 
ATOM   579  C  CB    . ASP A 1 100 ? -23.806 16.640  -49.334 1.00 31.83  ? 80  ASP A CB    1 
ATOM   580  C  CG    . ASP A 1 100 ? -24.261 16.716  -47.883 1.00 40.78  ? 80  ASP A CG    1 
ATOM   581  O  OD1   . ASP A 1 100 ? -25.454 16.415  -47.598 1.00 46.89  ? 80  ASP A OD1   1 
ATOM   582  O  OD2   . ASP A 1 100 ? -23.406 17.073  -47.014 1.00 52.36  ? 80  ASP A OD2   1 
ATOM   583  N  N     . GLN A 1 101 ? -23.448 15.407  -52.248 1.00 23.71  ? 81  GLN A N     1 
ATOM   584  C  CA    . GLN A 1 101 ? -23.015 15.720  -53.586 1.00 24.74  ? 81  GLN A CA    1 
ATOM   585  C  C     . GLN A 1 101 ? -23.901 15.101  -54.628 1.00 23.96  ? 81  GLN A C     1 
ATOM   586  O  O     . GLN A 1 101 ? -24.128 15.711  -55.642 1.00 24.14  ? 81  GLN A O     1 
ATOM   587  C  CB    . GLN A 1 101 ? -21.576 15.291  -53.786 1.00 29.70  ? 81  GLN A CB    1 
ATOM   588  C  CG    . GLN A 1 101 ? -20.650 16.062  -52.857 1.00 36.32  ? 81  GLN A CG    1 
ATOM   589  C  CD    . GLN A 1 101 ? -19.190 15.951  -53.244 1.00 47.33  ? 81  GLN A CD    1 
ATOM   590  O  OE1   . GLN A 1 101 ? -18.338 15.595  -52.405 1.00 48.99  ? 81  GLN A OE1   1 
ATOM   591  N  NE2   . GLN A 1 101 ? -18.880 16.263  -54.525 1.00 48.67  ? 81  GLN A NE2   1 
ATOM   592  N  N     . VAL A 1 102 ? -24.406 13.892  -54.371 1.00 21.41  ? 82  VAL A N     1 
ATOM   593  C  CA    . VAL A 1 102 ? -25.308 13.245  -55.278 1.00 21.11  ? 82  VAL A CA    1 
ATOM   594  C  C     . VAL A 1 102 ? -26.613 14.033  -55.316 1.00 21.00  ? 82  VAL A C     1 
ATOM   595  O  O     . VAL A 1 102 ? -27.153 14.304  -56.383 1.00 20.89  ? 82  VAL A O     1 
ATOM   596  C  CB    . VAL A 1 102 ? -25.536 11.755  -54.895 1.00 21.41  ? 82  VAL A CB    1 
ATOM   597  C  CG1   . VAL A 1 102 ? -26.814 11.203  -55.504 1.00 20.27  ? 82  VAL A CG1   1 
ATOM   598  C  CG2   . VAL A 1 102 ? -24.342 10.924  -55.322 1.00 21.23  ? 82  VAL A CG2   1 
ATOM   599  N  N     . ASP A 1 103 ? -27.095 14.451  -54.162 1.00 21.62  ? 83  ASP A N     1 
ATOM   600  C  CA    . ASP A 1 103 ? -28.310 15.249  -54.128 1.00 22.64  ? 83  ASP A CA    1 
ATOM   601  C  C     . ASP A 1 103 ? -28.189 16.563  -54.925 1.00 22.85  ? 83  ASP A C     1 
ATOM   602  O  O     . ASP A 1 103 ? -29.088 16.882  -55.684 1.00 22.64  ? 83  ASP A O     1 
ATOM   603  C  CB    . ASP A 1 103 ? -28.730 15.504  -52.679 1.00 23.19  ? 83  ASP A CB    1 
ATOM   604  C  CG    . ASP A 1 103 ? -29.186 14.234  -51.985 1.00 25.07  ? 83  ASP A CG    1 
ATOM   605  O  OD1   . ASP A 1 103 ? -29.380 13.217  -52.698 1.00 24.86  ? 83  ASP A OD1   1 
ATOM   606  O  OD2   . ASP A 1 103 ? -29.351 14.248  -50.739 1.00 26.64  ? 83  ASP A OD2   1 
ATOM   607  N  N     . GLN A 1 104 ? -27.101 17.316  -54.743 1.00 23.57  ? 84  GLN A N     1 
ATOM   608  C  CA    . GLN A 1 104 ? -26.868 18.533  -55.525 1.00 24.82  ? 84  GLN A CA    1 
ATOM   609  C  C     . GLN A 1 104 ? -26.807 18.247  -57.021 1.00 22.73  ? 84  GLN A C     1 
ATOM   610  O  O     . GLN A 1 104 ? -27.311 19.020  -57.810 1.00 23.32  ? 84  GLN A O     1 
ATOM   611  C  CB    . GLN A 1 104 ? -25.546 19.228  -55.152 1.00 28.08  ? 84  GLN A CB    1 
ATOM   612  C  CG    . GLN A 1 104 ? -25.568 20.012  -53.869 1.00 35.60  ? 84  GLN A CG    1 
ATOM   613  C  CD    . GLN A 1 104 ? -24.276 20.831  -53.629 1.00 47.86  ? 84  GLN A CD    1 
ATOM   614  O  OE1   . GLN A 1 104 ? -23.142 20.345  -53.832 1.00 50.00  ? 84  GLN A OE1   1 
ATOM   615  N  NE2   . GLN A 1 104 ? -24.446 22.074  -53.166 1.00 51.33  ? 84  GLN A NE2   1 
ATOM   616  N  N     . LEU A 1 105 ? -26.138 17.174  -57.422 1.00 20.22  ? 85  LEU A N     1 
ATOM   617  C  CA    . LEU A 1 105 ? -26.074 16.873  -58.825 1.00 19.98  ? 85  LEU A CA    1 
ATOM   618  C  C     . LEU A 1 105 ? -27.479 16.539  -59.363 1.00 19.86  ? 85  LEU A C     1 
ATOM   619  O  O     . LEU A 1 105 ? -27.808 16.945  -60.470 1.00 18.44  ? 85  LEU A O     1 
ATOM   620  C  CB    . LEU A 1 105 ? -25.102 15.737  -59.092 1.00 21.34  ? 85  LEU A CB    1 
ATOM   621  C  CG    . LEU A 1 105 ? -23.619 16.104  -58.977 1.00 22.45  ? 85  LEU A CG    1 
ATOM   622  C  CD1   . LEU A 1 105 ? -22.780 14.828  -58.899 1.00 21.99  ? 85  LEU A CD1   1 
ATOM   623  C  CD2   . LEU A 1 105 ? -23.186 16.939  -60.172 1.00 23.11  ? 85  LEU A CD2   1 
ATOM   624  N  N     . LEU A 1 106 ? -28.270 15.781  -58.584 1.00 19.34  ? 86  LEU A N     1 
ATOM   625  C  CA    . LEU A 1 106 ? -29.646 15.436  -58.942 1.00 19.54  ? 86  LEU A CA    1 
ATOM   626  C  C     . LEU A 1 106 ? -30.494 16.700  -59.092 1.00 20.94  ? 86  LEU A C     1 
ATOM   627  O  O     . LEU A 1 106 ? -31.264 16.797  -60.039 1.00 19.73  ? 86  LEU A O     1 
ATOM   628  C  CB    . LEU A 1 106 ? -30.276 14.462  -57.926 1.00 19.36  ? 86  LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 106 ? -29.698 13.025  -57.914 1.00 18.68  ? 86  LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 106 ? -30.277 12.173  -56.799 1.00 18.89  ? 86  LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 106 ? -29.940 12.310  -59.223 1.00 18.75  ? 86  LEU A CD2   1 
ATOM   632  N  N     . ALA A 1 107 ? -30.301 17.680  -58.205 1.00 21.76  ? 87  ALA A N     1 
ATOM   633  C  CA    . ALA A 1 107 ? -30.970 18.986  -58.323 1.00 23.68  ? 87  ALA A CA    1 
ATOM   634  C  C     . ALA A 1 107 ? -30.656 19.694  -59.641 1.00 24.26  ? 87  ALA A C     1 
ATOM   635  O  O     . ALA A 1 107 ? -31.526 20.364  -60.158 1.00 24.58  ? 87  ALA A O     1 
ATOM   636  C  CB    . ALA A 1 107 ? -30.623 19.926  -57.155 1.00 23.15  ? 87  ALA A CB    1 
ATOM   637  N  N     . ASN A 1 108 ? -29.437 19.553  -60.157 1.00 24.45  ? 88  ASN A N     1 
ATOM   638  C  CA    . ASN A 1 108 ? -29.065 20.098  -61.478 1.00 26.07  ? 88  ASN A CA    1 
ATOM   639  C  C     . ASN A 1 108 ? -29.359 19.162  -62.632 1.00 24.27  ? 88  ASN A C     1 
ATOM   640  O  O     . ASN A 1 108 ? -28.867 19.374  -63.726 1.00 25.08  ? 88  ASN A O     1 
ATOM   641  C  CB    . ASN A 1 108 ? -27.564 20.386  -61.562 1.00 28.86  ? 88  ASN A CB    1 
ATOM   642  C  CG    . ASN A 1 108 ? -27.119 21.441  -60.591 1.00 32.02  ? 88  ASN A CG    1 
ATOM   643  O  OD1   . ASN A 1 108 ? -27.765 22.478  -60.460 1.00 34.72  ? 88  ASN A OD1   1 
ATOM   644  N  ND2   . ASN A 1 108 ? -26.035 21.165  -59.865 1.00 33.10  ? 88  ASN A ND2   1 
ATOM   645  N  N     . GLY A 1 109 ? -30.111 18.106  -62.390 1.00 23.19  ? 89  GLY A N     1 
ATOM   646  C  CA    . GLY A 1 109 ? -30.478 17.197  -63.449 1.00 23.96  ? 89  GLY A CA    1 
ATOM   647  C  C     . GLY A 1 109 ? -29.418 16.265  -63.988 1.00 22.86  ? 89  GLY A C     1 
ATOM   648  O  O     . GLY A 1 109 ? -29.598 15.735  -65.059 1.00 23.47  ? 89  GLY A O     1 
ATOM   649  N  N     . VAL A 1 110 ? -28.338 16.047  -63.243 1.00 22.92  ? 90  VAL A N     1 
ATOM   650  C  CA    . VAL A 1 110 ? -27.256 15.127  -63.635 1.00 21.26  ? 90  VAL A CA    1 
ATOM   651  C  C     . VAL A 1 110 ? -27.494 13.704  -63.101 1.00 21.41  ? 90  VAL A C     1 
ATOM   652  O  O     . VAL A 1 110 ? -27.940 13.517  -61.959 1.00 21.33  ? 90  VAL A O     1 
ATOM   653  C  CB    . VAL A 1 110 ? -25.928 15.639  -63.068 1.00 21.81  ? 90  VAL A CB    1 
ATOM   654  C  CG1   . VAL A 1 110 ? -24.776 14.686  -63.351 1.00 21.33  ? 90  VAL A CG1   1 
ATOM   655  C  CG2   . VAL A 1 110 ? -25.642 17.028  -63.603 1.00 22.49  ? 90  VAL A CG2   1 
ATOM   656  N  N     . ALA A 1 111 ? -27.199 12.698  -63.918 1.00 20.22  ? 91  ALA A N     1 
ATOM   657  C  CA    . ALA A 1 111 ? -27.399 11.319  -63.514 1.00 20.25  ? 91  ALA A CA    1 
ATOM   658  C  C     . ALA A 1 111 ? -26.291 10.879  -62.561 1.00 21.67  ? 91  ALA A C     1 
ATOM   659  O  O     . ALA A 1 111 ? -25.273 10.293  -62.977 1.00 22.82  ? 91  ALA A O     1 
ATOM   660  C  CB    . ALA A 1 111 ? -27.410 10.414  -64.731 1.00 20.49  ? 91  ALA A CB    1 
ATOM   661  N  N     . ALA A 1 112 ? -26.479 11.166  -61.288 1.00 21.89  ? 92  ALA A N     1 
ATOM   662  C  CA    . ALA A 1 112 ? -25.512 10.785  -60.283 1.00 22.85  ? 92  ALA A CA    1 
ATOM   663  C  C     . ALA A 1 112 ? -26.087 9.716   -59.395 1.00 23.48  ? 92  ALA A C     1 
ATOM   664  O  O     . ALA A 1 112 ? -27.299 9.638   -59.204 1.00 25.37  ? 92  ALA A O     1 
ATOM   665  C  CB    . ALA A 1 112 ? -25.126 11.975  -59.443 1.00 23.00  ? 92  ALA A CB    1 
ATOM   666  N  N     . ALA A 1 113 ? -25.207 8.927   -58.812 1.00 21.99  ? 93  ALA A N     1 
ATOM   667  C  CA    . ALA A 1 113 ? -25.627 7.943   -57.865 1.00 23.01  ? 93  ALA A CA    1 
ATOM   668  C  C     . ALA A 1 113 ? -24.477 7.566   -56.946 1.00 24.52  ? 93  ALA A C     1 
ATOM   669  O  O     . ALA A 1 113 ? -23.329 7.977   -57.147 1.00 22.14  ? 93  ALA A O     1 
ATOM   670  C  CB    . ALA A 1 113 ? -26.148 6.717   -58.590 1.00 22.87  ? 93  ALA A CB    1 
ATOM   671  N  N     . CYS A 1 114 ? -24.811 6.785   -55.930 1.00 25.42  ? 94  CYS A N     1 
ATOM   672  C  CA    . CYS A 1 114 ? -23.828 6.281   -55.037 1.00 28.31  ? 94  CYS A CA    1 
ATOM   673  C  C     . CYS A 1 114 ? -24.122 4.855   -54.600 1.00 28.57  ? 94  CYS A C     1 
ATOM   674  O  O     . CYS A 1 114 ? -25.187 4.317   -54.851 1.00 24.77  ? 94  CYS A O     1 
ATOM   675  C  CB    . CYS A 1 114 ? -23.735 7.179   -53.831 1.00 31.00  ? 94  CYS A CB    1 
ATOM   676  S  SG    . CYS A 1 114 ? -25.241 7.282   -52.847 1.00 37.67  ? 94  CYS A SG    1 
ATOM   677  N  N     . LEU A 1 115 ? -23.124 4.265   -53.958 1.00 29.73  ? 95  LEU A N     1 
ATOM   678  C  CA    . LEU A 1 115 ? -23.201 2.939   -53.380 1.00 29.30  ? 95  LEU A CA    1 
ATOM   679  C  C     . LEU A 1 115 ? -22.680 3.014   -51.966 1.00 29.74  ? 95  LEU A C     1 
ATOM   680  O  O     . LEU A 1 115 ? -21.606 3.572   -51.716 1.00 31.54  ? 95  LEU A O     1 
ATOM   681  C  CB    . LEU A 1 115 ? -22.336 1.995   -54.167 1.00 30.26  ? 95  LEU A CB    1 
ATOM   682  C  CG    . LEU A 1 115 ? -22.925 0.901   -55.072 1.00 32.65  ? 95  LEU A CG    1 
ATOM   683  C  CD1   . LEU A 1 115 ? -24.452 0.843   -55.176 1.00 32.01  ? 95  LEU A CD1   1 
ATOM   684  C  CD2   . LEU A 1 115 ? -22.278 1.002   -56.445 1.00 32.66  ? 95  LEU A CD2   1 
ATOM   685  N  N     . ASN A 1 116 ? -23.451 2.476   -51.043 1.00 27.67  ? 96  ASN A N     1 
ATOM   686  C  CA    . ASN A 1 116 ? -22.998 2.310   -49.690 1.00 29.64  ? 96  ASN A CA    1 
ATOM   687  C  C     . ASN A 1 116 ? -23.904 1.356   -48.939 1.00 29.32  ? 96  ASN A C     1 
ATOM   688  O  O     . ASN A 1 116 ? -24.951 0.942   -49.449 1.00 27.73  ? 96  ASN A O     1 
ATOM   689  C  CB    . ASN A 1 116 ? -22.930 3.660   -48.973 1.00 30.33  ? 96  ASN A CB    1 
ATOM   690  C  CG    . ASN A 1 116 ? -24.244 4.396   -49.006 1.00 31.23  ? 96  ASN A CG    1 
ATOM   691  O  OD1   . ASN A 1 116 ? -24.428 5.340   -49.762 1.00 36.27  ? 96  ASN A OD1   1 
ATOM   692  N  ND2   . ASN A 1 116 ? -25.166 3.961   -48.195 1.00 30.67  ? 96  ASN A ND2   1 
ATOM   693  N  N     . SER A 1 117 ? -23.509 1.062   -47.705 1.00 31.25  ? 97  SER A N     1 
ATOM   694  C  CA    . SER A 1 117 ? -24.086 -0.028  -46.944 1.00 34.07  ? 97  SER A CA    1 
ATOM   695  C  C     . SER A 1 117 ? -25.441 0.276   -46.348 1.00 33.63  ? 97  SER A C     1 
ATOM   696  O  O     . SER A 1 117 ? -26.048 -0.602  -45.772 1.00 37.27  ? 97  SER A O     1 
ATOM   697  C  CB    . SER A 1 117 ? -23.122 -0.462  -45.838 1.00 36.82  ? 97  SER A CB    1 
ATOM   698  O  OG    . SER A 1 117 ? -22.901 0.617   -44.948 1.00 40.41  ? 97  SER A OG    1 
ATOM   699  N  N     . THR A 1 118 ? -25.935 1.495   -46.481 1.00 33.05  ? 98  THR A N     1 
ATOM   700  C  CA    . THR A 1 118 ? -27.279 1.791   -45.991 1.00 34.21  ? 98  THR A CA    1 
ATOM   701  C  C     . THR A 1 118 ? -28.330 1.657   -47.061 1.00 30.37  ? 98  THR A C     1 
ATOM   702  O  O     . THR A 1 118 ? -29.502 1.841   -46.798 1.00 32.01  ? 98  THR A O     1 
ATOM   703  C  CB    . THR A 1 118 ? -27.372 3.203   -45.402 1.00 36.37  ? 98  THR A CB    1 
ATOM   704  O  OG1   . THR A 1 118 ? -27.263 4.158   -46.456 1.00 32.67  ? 98  THR A OG1   1 
ATOM   705  C  CG2   . THR A 1 118 ? -26.252 3.403   -44.356 1.00 37.94  ? 98  THR A CG2   1 
ATOM   706  N  N     . GLN A 1 119 ? -27.904 1.347   -48.272 1.00 28.05  ? 99  GLN A N     1 
ATOM   707  C  CA    . GLN A 1 119 ? -28.828 0.954   -49.310 1.00 26.28  ? 99  GLN A CA    1 
ATOM   708  C  C     . GLN A 1 119 ? -29.264 -0.499  -49.152 1.00 25.40  ? 99  GLN A C     1 
ATOM   709  O  O     . GLN A 1 119 ? -28.493 -1.353  -48.725 1.00 26.48  ? 99  GLN A O     1 
ATOM   710  C  CB    . GLN A 1 119 ? -28.154 1.102   -50.646 1.00 27.46  ? 99  GLN A CB    1 
ATOM   711  C  CG    . GLN A 1 119 ? -27.817 2.538   -50.997 1.00 27.01  ? 99  GLN A CG    1 
ATOM   712  C  CD    . GLN A 1 119 ? -26.982 2.617   -52.250 1.00 26.88  ? 99  GLN A CD    1 
ATOM   713  O  OE1   . GLN A 1 119 ? -26.048 1.853   -52.428 1.00 26.27  ? 99  GLN A OE1   1 
ATOM   714  N  NE2   . GLN A 1 119 ? -27.331 3.520   -53.131 1.00 29.34  ? 99  GLN A NE2   1 
ATOM   715  N  N     . SER A 1 120 ? -30.509 -0.772  -49.492 1.00 24.50  ? 100 SER A N     1 
ATOM   716  C  CA    . SER A 1 120 ? -30.984 -2.143  -49.638 1.00 24.51  ? 100 SER A CA    1 
ATOM   717  C  C     . SER A 1 120 ? -30.244 -2.770  -50.798 1.00 24.92  ? 100 SER A C     1 
ATOM   718  O  O     . SER A 1 120 ? -29.756 -2.061  -51.683 1.00 24.11  ? 100 SER A O     1 
ATOM   719  C  CB    . SER A 1 120 ? -32.485 -2.148  -49.944 1.00 23.46  ? 100 SER A CB    1 
ATOM   720  O  OG    . SER A 1 120 ? -32.706 -1.818  -51.304 1.00 23.31  ? 100 SER A OG    1 
ATOM   721  N  N     . ARG A 1 121 ? -30.193 -4.091  -50.827 1.00 25.99  ? 101 ARG A N     1 
ATOM   722  C  CA    . ARG A 1 121 ? -29.577 -4.784  -51.959 1.00 27.36  ? 101 ARG A CA    1 
ATOM   723  C  C     . ARG A 1 121 ? -30.243 -4.488  -53.299 1.00 25.12  ? 101 ARG A C     1 
ATOM   724  O  O     . ARG A 1 121 ? -29.588 -4.369  -54.309 1.00 22.51  ? 101 ARG A O     1 
ATOM   725  C  CB    . ARG A 1 121 ? -29.549 -6.289  -51.709 1.00 30.70  ? 101 ARG A CB    1 
ATOM   726  C  CG    . ARG A 1 121 ? -28.607 -6.689  -50.581 1.00 33.57  ? 101 ARG A CG    1 
ATOM   727  C  CD    . ARG A 1 121 ? -28.723 -8.169  -50.271 1.00 38.83  ? 101 ARG A CD    1 
ATOM   728  N  NE    . ARG A 1 121 ? -30.092 -8.537  -49.910 1.00 43.73  ? 101 ARG A NE    1 
ATOM   729  C  CZ    . ARG A 1 121 ? -30.506 -9.779  -49.641 1.00 50.94  ? 101 ARG A CZ    1 
ATOM   730  N  NH1   . ARG A 1 121 ? -29.658 -10.803 -49.671 1.00 47.63  ? 101 ARG A NH1   1 
ATOM   731  N  NH2   . ARG A 1 121 ? -31.790 -9.996  -49.340 1.00 53.97  ? 101 ARG A NH2   1 
ATOM   732  N  N     . GLU A 1 122 ? -31.551 -4.368  -53.317 1.00 27.61  ? 102 GLU A N     1 
ATOM   733  C  CA    . GLU A 1 122 ? -32.223 -4.105  -54.590 1.00 31.74  ? 102 GLU A CA    1 
ATOM   734  C  C     . GLU A 1 122 ? -31.942 -2.682  -55.065 1.00 27.73  ? 102 GLU A C     1 
ATOM   735  O  O     . GLU A 1 122 ? -31.808 -2.443  -56.242 1.00 25.51  ? 102 GLU A O     1 
ATOM   736  C  CB    . GLU A 1 122 ? -33.735 -4.439  -54.570 1.00 36.00  ? 102 GLU A CB    1 
ATOM   737  C  CG    . GLU A 1 122 ? -34.409 -4.391  -53.223 1.00 40.53  ? 102 GLU A CG    1 
ATOM   738  C  CD    . GLU A 1 122 ? -34.099 -5.579  -52.325 1.00 43.25  ? 102 GLU A CD    1 
ATOM   739  O  OE1   . GLU A 1 122 ? -34.511 -6.715  -52.665 1.00 42.39  ? 102 GLU A OE1   1 
ATOM   740  O  OE2   . GLU A 1 122 ? -33.466 -5.349  -51.257 1.00 45.68  ? 102 GLU A OE2   1 
ATOM   741  N  N     . GLU A 1 123 ? -31.778 -1.751  -54.143 1.00 28.48  ? 103 GLU A N     1 
ATOM   742  C  CA    . GLU A 1 123 ? -31.348 -0.416  -54.517 1.00 30.88  ? 103 GLU A CA    1 
ATOM   743  C  C     . GLU A 1 123 ? -29.933 -0.452  -55.166 1.00 28.10  ? 103 GLU A C     1 
ATOM   744  O  O     . GLU A 1 123 ? -29.694 0.153   -56.221 1.00 26.19  ? 103 GLU A O     1 
ATOM   745  C  CB    . GLU A 1 123 ? -31.418 0.491   -53.291 1.00 36.39  ? 103 GLU A CB    1 
ATOM   746  C  CG    . GLU A 1 123 ? -31.050 1.950   -53.547 1.00 45.16  ? 103 GLU A CG    1 
ATOM   747  C  CD    . GLU A 1 123 ? -31.414 2.887   -52.386 1.00 51.90  ? 103 GLU A CD    1 
ATOM   748  O  OE1   . GLU A 1 123 ? -31.863 2.370   -51.313 1.00 54.62  ? 103 GLU A OE1   1 
ATOM   749  O  OE2   . GLU A 1 123 ? -31.243 4.134   -52.560 1.00 48.20  ? 103 GLU A OE2   1 
ATOM   750  N  N     . GLN A 1 124 ? -29.019 -1.196  -54.563 1.00 24.23  ? 104 GLN A N     1 
ATOM   751  C  CA    . GLN A 1 124 ? -27.672 -1.299  -55.085 1.00 25.19  ? 104 GLN A CA    1 
ATOM   752  C  C     . GLN A 1 124 ? -27.672 -1.900  -56.482 1.00 24.57  ? 104 GLN A C     1 
ATOM   753  O  O     . GLN A 1 124 ? -26.969 -1.424  -57.386 1.00 20.48  ? 104 GLN A O     1 
ATOM   754  C  CB    . GLN A 1 124 ? -26.780 -2.140  -54.164 1.00 24.80  ? 104 GLN A CB    1 
ATOM   755  C  CG    . GLN A 1 124 ? -26.530 -1.490  -52.831 1.00 26.18  ? 104 GLN A CG    1 
ATOM   756  C  CD    . GLN A 1 124 ? -25.680 -2.324  -51.905 1.00 29.96  ? 104 GLN A CD    1 
ATOM   757  O  OE1   . GLN A 1 124 ? -25.381 -3.477  -52.181 1.00 34.04  ? 104 GLN A OE1   1 
ATOM   758  N  NE2   . GLN A 1 124 ? -25.301 -1.745  -50.777 1.00 34.31  ? 104 GLN A NE2   1 
ATOM   759  N  N     . GLN A 1 125 ? -28.467 -2.951  -56.645 1.00 25.00  ? 105 GLN A N     1 
ATOM   760  C  CA    . GLN A 1 125 ? -28.531 -3.644  -57.922 1.00 25.25  ? 105 GLN A CA    1 
ATOM   761  C  C     . GLN A 1 125 ? -29.001 -2.686  -59.005 1.00 23.77  ? 105 GLN A C     1 
ATOM   762  O  O     . GLN A 1 125 ? -28.533 -2.738  -60.134 1.00 24.39  ? 105 GLN A O     1 
ATOM   763  C  CB    . GLN A 1 125 ? -29.453 -4.873  -57.834 1.00 24.55  ? 105 GLN A CB    1 
ATOM   764  C  CG    . GLN A 1 125 ? -28.864 -5.980  -56.985 1.00 25.76  ? 105 GLN A CG    1 
ATOM   765  C  CD    . GLN A 1 125 ? -27.521 -6.456  -57.492 1.00 26.66  ? 105 GLN A CD    1 
ATOM   766  O  OE1   . GLN A 1 125 ? -27.378 -6.827  -58.674 1.00 26.11  ? 105 GLN A OE1   1 
ATOM   767  N  NE2   . GLN A 1 125 ? -26.511 -6.422  -56.616 1.00 27.35  ? 105 GLN A NE2   1 
ATOM   768  N  N     . ALA A 1 126 ? -29.922 -1.808  -58.663 1.00 22.40  ? 106 ALA A N     1 
ATOM   769  C  CA    . ALA A 1 126 ? -30.426 -0.859  -59.657 1.00 23.31  ? 106 ALA A CA    1 
ATOM   770  C  C     . ALA A 1 126 ? -29.349 0.178   -60.016 1.00 21.63  ? 106 ALA A C     1 
ATOM   771  O  O     . ALA A 1 126 ? -29.203 0.551   -61.168 1.00 21.64  ? 106 ALA A O     1 
ATOM   772  C  CB    . ALA A 1 126 ? -31.713 -0.191  -59.161 1.00 22.11  ? 106 ALA A CB    1 
ATOM   773  N  N     . VAL A 1 127 ? -28.593 0.633   -59.034 1.00 21.69  ? 107 VAL A N     1 
ATOM   774  C  CA    . VAL A 1 127 ? -27.419 1.495   -59.317 1.00 22.75  ? 107 VAL A CA    1 
ATOM   775  C  C     . VAL A 1 127 ? -26.393 0.809   -60.222 1.00 23.94  ? 107 VAL A C     1 
ATOM   776  O  O     . VAL A 1 127 ? -25.887 1.415   -61.186 1.00 24.64  ? 107 VAL A O     1 
ATOM   777  C  CB    . VAL A 1 127 ? -26.731 1.956   -58.012 1.00 22.68  ? 107 VAL A CB    1 
ATOM   778  C  CG1   . VAL A 1 127 ? -25.412 2.655   -58.301 1.00 22.81  ? 107 VAL A CG1   1 
ATOM   779  C  CG2   . VAL A 1 127 ? -27.672 2.897   -57.240 1.00 22.67  ? 107 VAL A CG2   1 
ATOM   780  N  N     . LEU A 1 128 ? -26.081 -0.452  -59.917 1.00 24.33  ? 108 LEU A N     1 
ATOM   781  C  CA    . LEU A 1 128 ? -25.110 -1.185  -60.708 1.00 24.52  ? 108 LEU A CA    1 
ATOM   782  C  C     . LEU A 1 128 ? -25.600 -1.344  -62.158 1.00 24.01  ? 108 LEU A C     1 
ATOM   783  O  O     . LEU A 1 128 ? -24.825 -1.170  -63.097 1.00 24.33  ? 108 LEU A O     1 
ATOM   784  C  CB    . LEU A 1 128 ? -24.793 -2.545  -60.083 1.00 25.53  ? 108 LEU A CB    1 
ATOM   785  C  CG    . LEU A 1 128 ? -23.725 -2.759  -58.999 1.00 26.36  ? 108 LEU A CG    1 
ATOM   786  C  CD1   . LEU A 1 128 ? -22.670 -1.676  -59.012 1.00 27.40  ? 108 LEU A CD1   1 
ATOM   787  C  CD2   . LEU A 1 128 ? -24.278 -2.900  -57.597 1.00 27.02  ? 108 LEU A CD2   1 
ATOM   788  N  N     . ALA A 1 129 ? -26.887 -1.617  -62.355 1.00 24.71  ? 109 ALA A N     1 
ATOM   789  C  CA    . ALA A 1 129 ? -27.449 -1.726  -63.718 1.00 24.39  ? 109 ALA A CA    1 
ATOM   790  C  C     . ALA A 1 129 ? -27.406 -0.382  -64.462 1.00 26.61  ? 109 ALA A C     1 
ATOM   791  O  O     . ALA A 1 129 ? -27.070 -0.325  -65.672 1.00 29.15  ? 109 ALA A O     1 
ATOM   792  C  CB    . ALA A 1 129 ? -28.873 -2.239  -63.647 1.00 23.80  ? 109 ALA A CB    1 
ATOM   793  N  N     . GLY A 1 130 ? -27.745 0.699   -63.758 1.00 24.80  ? 110 GLY A N     1 
ATOM   794  C  CA    . GLY A 1 130 ? -27.518 2.045   -64.303 1.00 26.04  ? 110 GLY A CA    1 
ATOM   795  C  C     . GLY A 1 130 ? -26.075 2.321   -64.755 1.00 26.95  ? 110 GLY A C     1 
ATOM   796  O  O     . GLY A 1 130 ? -25.860 2.941   -65.787 1.00 28.38  ? 110 GLY A O     1 
ATOM   797  N  N     . CYS A 1 131 ? -25.079 1.886   -63.989 1.00 27.08  ? 111 CYS A N     1 
ATOM   798  C  CA    . CYS A 1 131 ? -23.666 2.048   -64.407 1.00 28.44  ? 111 CYS A CA    1 
ATOM   799  C  C     . CYS A 1 131 ? -23.340 1.234   -65.623 1.00 31.15  ? 111 CYS A C     1 
ATOM   800  O  O     . CYS A 1 131 ? -22.574 1.662   -66.475 1.00 30.51  ? 111 CYS A O     1 
ATOM   801  C  CB    . CYS A 1 131 ? -22.705 1.607   -63.313 1.00 26.90  ? 111 CYS A CB    1 
ATOM   802  S  SG    . CYS A 1 131 ? -22.870 2.613   -61.838 1.00 26.18  ? 111 CYS A SG    1 
ATOM   803  N  N     . ARG A 1 132 ? -23.910 0.031   -65.663 1.00 37.49  ? 112 ARG A N     1 
ATOM   804  C  CA    . ARG A 1 132 ? -23.717 -0.914  -66.763 1.00 37.54  ? 112 ARG A CA    1 
ATOM   805  C  C     . ARG A 1 132 ? -24.300 -0.363  -68.070 1.00 35.10  ? 112 ARG A C     1 
ATOM   806  O  O     . ARG A 1 132 ? -23.676 -0.481  -69.110 1.00 33.09  ? 112 ARG A O     1 
ATOM   807  C  CB    . ARG A 1 132 ? -24.359 -2.242  -66.368 1.00 40.23  ? 112 ARG A CB    1 
ATOM   808  C  CG    . ARG A 1 132 ? -24.240 -3.395  -67.351 1.00 43.84  ? 112 ARG A CG    1 
ATOM   809  C  CD    . ARG A 1 132 ? -24.634 -4.717  -66.669 1.00 44.93  ? 112 ARG A CD    1 
ATOM   810  N  NE    . ARG A 1 132 ? -26.046 -4.784  -66.223 1.00 46.73  ? 112 ARG A NE    1 
ATOM   811  C  CZ    . ARG A 1 132 ? -26.480 -4.961  -64.955 1.00 48.81  ? 112 ARG A CZ    1 
ATOM   812  N  NH1   . ARG A 1 132 ? -25.649 -5.092  -63.905 1.00 44.31  ? 112 ARG A NH1   1 
ATOM   813  N  NH2   . ARG A 1 132 ? -27.788 -5.018  -64.725 1.00 49.64  ? 112 ARG A NH2   1 
ATOM   814  N  N     . THR A 1 133 ? -25.469 0.274   -68.000 1.00 34.56  ? 113 THR A N     1 
ATOM   815  C  CA    . THR A 1 133 ? -26.144 0.791   -69.196 1.00 36.25  ? 113 THR A CA    1 
ATOM   816  C  C     . THR A 1 133 ? -25.674 2.176   -69.607 1.00 36.95  ? 113 THR A C     1 
ATOM   817  O  O     . THR A 1 133 ? -26.086 2.691   -70.645 1.00 37.80  ? 113 THR A O     1 
ATOM   818  C  CB    . THR A 1 133 ? -27.664 0.928   -68.992 1.00 38.13  ? 113 THR A CB    1 
ATOM   819  O  OG1   . THR A 1 133 ? -27.917 1.675   -67.791 1.00 40.03  ? 113 THR A OG1   1 
ATOM   820  C  CG2   . THR A 1 133 ? -28.333 -0.450  -68.899 1.00 39.75  ? 113 THR A CG2   1 
ATOM   821  N  N     . GLY A 1 134 ? -24.850 2.811   -68.791 1.00 34.64  ? 114 GLY A N     1 
ATOM   822  C  CA    . GLY A 1 134 ? -24.519 4.186   -69.049 1.00 33.92  ? 114 GLY A CA    1 
ATOM   823  C  C     . GLY A 1 134 ? -25.601 5.173   -68.657 1.00 33.08  ? 114 GLY A C     1 
ATOM   824  O  O     . GLY A 1 134 ? -25.515 6.309   -69.056 1.00 37.03  ? 114 GLY A O     1 
ATOM   825  N  N     . GLN A 1 135 ? -26.617 4.781   -67.888 1.00 33.40  ? 115 GLN A N     1 
ATOM   826  C  CA    . GLN A 1 135 ? -27.545 5.788   -67.358 1.00 37.47  ? 115 GLN A CA    1 
ATOM   827  C  C     . GLN A 1 135 ? -26.796 6.673   -66.381 1.00 37.69  ? 115 GLN A C     1 
ATOM   828  O  O     . GLN A 1 135 ? -26.849 7.896   -66.505 1.00 41.70  ? 115 GLN A O     1 
ATOM   829  C  CB    . GLN A 1 135 ? -28.773 5.197   -66.668 1.00 40.46  ? 115 GLN A CB    1 
ATOM   830  C  CG    . GLN A 1 135 ? -29.753 4.478   -67.589 1.00 46.46  ? 115 GLN A CG    1 
ATOM   831  C  CD    . GLN A 1 135 ? -30.198 5.329   -68.774 1.00 50.84  ? 115 GLN A CD    1 
ATOM   832  O  OE1   . GLN A 1 135 ? -30.192 6.566   -68.708 1.00 52.99  ? 115 GLN A OE1   1 
ATOM   833  N  NE2   . GLN A 1 135 ? -30.579 4.668   -69.871 1.00 50.53  ? 115 GLN A NE2   1 
ATOM   834  N  N     . VAL A 1 136 ? -26.045 6.057   -65.466 1.00 33.13  ? 116 VAL A N     1 
ATOM   835  C  CA    . VAL A 1 136 ? -25.286 6.802   -64.466 1.00 31.03  ? 116 VAL A CA    1 
ATOM   836  C  C     . VAL A 1 136 ? -24.045 7.411   -65.100 1.00 31.10  ? 116 VAL A C     1 
ATOM   837  O  O     . VAL A 1 136 ? -23.340 6.733   -65.832 1.00 32.40  ? 116 VAL A O     1 
ATOM   838  C  CB    . VAL A 1 136 ? -24.880 5.892   -63.311 1.00 29.49  ? 116 VAL A CB    1 
ATOM   839  C  CG1   . VAL A 1 136 ? -24.100 6.665   -62.256 1.00 29.60  ? 116 VAL A CG1   1 
ATOM   840  C  CG2   . VAL A 1 136 ? -26.113 5.272   -62.705 1.00 28.27  ? 116 VAL A CG2   1 
ATOM   841  N  N     . ARG A 1 137 ? -23.811 8.697   -64.837 1.00 30.88  ? 117 ARG A N     1 
ATOM   842  C  CA    . ARG A 1 137 ? -22.623 9.413   -65.298 1.00 29.70  ? 117 ARG A CA    1 
ATOM   843  C  C     . ARG A 1 137 ? -21.591 9.579   -64.198 1.00 28.14  ? 117 ARG A C     1 
ATOM   844  O  O     . ARG A 1 137 ? -20.394 9.578   -64.491 1.00 27.54  ? 117 ARG A O     1 
ATOM   845  C  CB    . ARG A 1 137 ? -22.992 10.806  -65.804 1.00 33.39  ? 117 ARG A CB    1 
ATOM   846  C  CG    . ARG A 1 137 ? -23.975 10.792  -66.942 1.00 38.80  ? 117 ARG A CG    1 
ATOM   847  C  CD    . ARG A 1 137 ? -23.333 10.326  -68.245 1.00 43.83  ? 117 ARG A CD    1 
ATOM   848  N  NE    . ARG A 1 137 ? -22.891 11.478  -69.039 1.00 47.47  ? 117 ARG A NE    1 
ATOM   849  C  CZ    . ARG A 1 137 ? -21.651 11.702  -69.450 1.00 45.44  ? 117 ARG A CZ    1 
ATOM   850  N  NH1   . ARG A 1 137 ? -20.678 10.842  -69.184 1.00 47.62  ? 117 ARG A NH1   1 
ATOM   851  N  NH2   . ARG A 1 137 ? -21.395 12.784  -70.179 1.00 47.32  ? 117 ARG A NH2   1 
ATOM   852  N  N     . LEU A 1 138 ? -22.043 9.759   -62.953 1.00 25.74  ? 118 LEU A N     1 
ATOM   853  C  CA    . LEU A 1 138 ? -21.144 9.806   -61.813 1.00 25.76  ? 118 LEU A CA    1 
ATOM   854  C  C     . LEU A 1 138 ? -21.608 8.874   -60.728 1.00 25.30  ? 118 LEU A C     1 
ATOM   855  O  O     . LEU A 1 138 ? -22.781 8.902   -60.329 1.00 23.83  ? 118 LEU A O     1 
ATOM   856  C  CB    . LEU A 1 138 ? -21.052 11.203  -61.215 1.00 26.91  ? 118 LEU A CB    1 
ATOM   857  C  CG    . LEU A 1 138 ? -20.496 12.254  -62.164 1.00 28.57  ? 118 LEU A CG    1 
ATOM   858  C  CD1   . LEU A 1 138 ? -21.642 13.043  -62.757 1.00 29.61  ? 118 LEU A CD1   1 
ATOM   859  C  CD2   . LEU A 1 138 ? -19.537 13.188  -61.446 1.00 29.57  ? 118 LEU A CD2   1 
ATOM   860  N  N     . LEU A 1 139 ? -20.663 8.067   -60.249 1.00 23.49  ? 119 LEU A N     1 
ATOM   861  C  CA    . LEU A 1 139 ? -20.899 7.093   -59.226 1.00 22.62  ? 119 LEU A CA    1 
ATOM   862  C  C     . LEU A 1 139 ? -20.009 7.433   -58.029 1.00 22.13  ? 119 LEU A C     1 
ATOM   863  O  O     . LEU A 1 139 ? -18.790 7.385   -58.132 1.00 24.48  ? 119 LEU A O     1 
ATOM   864  C  CB    . LEU A 1 139 ? -20.579 5.688   -59.746 1.00 22.54  ? 119 LEU A CB    1 
ATOM   865  C  CG    . LEU A 1 139 ? -20.669 4.614   -58.658 1.00 24.00  ? 119 LEU A CG    1 
ATOM   866  C  CD1   . LEU A 1 139 ? -22.117 4.435   -58.227 1.00 23.32  ? 119 LEU A CD1   1 
ATOM   867  C  CD2   . LEU A 1 139 ? -20.104 3.281   -59.107 1.00 25.12  ? 119 LEU A CD2   1 
ATOM   868  N  N     . TYR A 1 140 ? -20.623 7.759   -56.901 1.00 21.03  ? 120 TYR A N     1 
ATOM   869  C  CA    . TYR A 1 140 ? -19.901 8.025   -55.674 1.00 21.43  ? 120 TYR A CA    1 
ATOM   870  C  C     . TYR A 1 140 ? -19.785 6.729   -54.888 1.00 22.74  ? 120 TYR A C     1 
ATOM   871  O  O     . TYR A 1 140 ? -20.741 5.946   -54.787 1.00 24.01  ? 120 TYR A O     1 
ATOM   872  C  CB    . TYR A 1 140 ? -20.580 9.134   -54.875 1.00 21.70  ? 120 TYR A CB    1 
ATOM   873  C  CG    . TYR A 1 140 ? -20.343 10.511  -55.485 1.00 22.44  ? 120 TYR A CG    1 
ATOM   874  C  CD1   . TYR A 1 140 ? -20.927 10.880  -56.704 1.00 23.02  ? 120 TYR A CD1   1 
ATOM   875  C  CD2   . TYR A 1 140 ? -19.520 11.425  -54.866 1.00 22.53  ? 120 TYR A CD2   1 
ATOM   876  C  CE1   . TYR A 1 140 ? -20.688 12.128  -57.273 1.00 23.73  ? 120 TYR A CE1   1 
ATOM   877  C  CE2   . TYR A 1 140 ? -19.269 12.664  -55.429 1.00 23.78  ? 120 TYR A CE2   1 
ATOM   878  C  CZ    . TYR A 1 140 ? -19.859 13.018  -56.627 1.00 24.64  ? 120 TYR A CZ    1 
ATOM   879  O  OH    . TYR A 1 140 ? -19.590 14.264  -57.168 1.00 26.30  ? 120 TYR A OH    1 
ATOM   880  N  N     . ILE A 1 141 ? -18.594 6.463   -54.376 1.00 23.52  ? 121 ILE A N     1 
ATOM   881  C  CA    . ILE A 1 141 ? -18.297 5.151   -53.756 1.00 23.97  ? 121 ILE A CA    1 
ATOM   882  C  C     . ILE A 1 141 ? -17.112 5.253   -52.775 1.00 23.68  ? 121 ILE A C     1 
ATOM   883  O  O     . ILE A 1 141 ? -16.219 6.098   -52.959 1.00 21.54  ? 121 ILE A O     1 
ATOM   884  C  CB    . ILE A 1 141 ? -17.997 4.100   -54.832 1.00 23.29  ? 121 ILE A CB    1 
ATOM   885  C  CG1   . ILE A 1 141 ? -18.037 2.671   -54.261 1.00 25.64  ? 121 ILE A CG1   1 
ATOM   886  C  CG2   . ILE A 1 141 ? -16.645 4.361   -55.460 1.00 24.22  ? 121 ILE A CG2   1 
ATOM   887  C  CD1   . ILE A 1 141 ? -17.736 1.558   -55.256 1.00 24.14  ? 121 ILE A CD1   1 
ATOM   888  N  N     . ALA A 1 142 ? -17.138 4.431   -51.726 1.00 23.27  ? 122 ALA A N     1 
ATOM   889  C  CA    . ALA A 1 142 ? -16.041 4.373   -50.762 1.00 24.65  ? 122 ALA A CA    1 
ATOM   890  C  C     . ALA A 1 142 ? -14.969 3.416   -51.249 1.00 24.18  ? 122 ALA A C     1 
ATOM   891  O  O     . ALA A 1 142 ? -15.280 2.483   -51.950 1.00 26.13  ? 122 ALA A O     1 
ATOM   892  C  CB    . ALA A 1 142 ? -16.548 3.930   -49.416 1.00 25.25  ? 122 ALA A CB    1 
ATOM   893  N  N     . PRO A 1 143 ? -13.698 3.644   -50.876 1.00 24.87  ? 123 PRO A N     1 
ATOM   894  C  CA    . PRO A 1 143 ? -12.611 2.768   -51.349 1.00 26.27  ? 123 PRO A CA    1 
ATOM   895  C  C     . PRO A 1 143 ? -12.713 1.327   -50.885 1.00 26.43  ? 123 PRO A C     1 
ATOM   896  O  O     . PRO A 1 143 ? -12.312 0.416   -51.621 1.00 27.68  ? 123 PRO A O     1 
ATOM   897  C  CB    . PRO A 1 143 ? -11.339 3.408   -50.788 1.00 25.54  ? 123 PRO A CB    1 
ATOM   898  C  CG    . PRO A 1 143 ? -11.783 4.410   -49.802 1.00 25.49  ? 123 PRO A CG    1 
ATOM   899  C  CD    . PRO A 1 143 ? -13.234 4.670   -49.943 1.00 24.09  ? 123 PRO A CD    1 
ATOM   900  N  N     . GLU A 1 144 ? -13.233 1.098   -49.688 1.00 27.03  ? 124 GLU A N     1 
ATOM   901  C  CA    . GLU A 1 144 ? -13.426 -0.294  -49.241 1.00 26.96  ? 124 GLU A CA    1 
ATOM   902  C  C     . GLU A 1 144 ? -14.350 -1.083  -50.157 1.00 28.29  ? 124 GLU A C     1 
ATOM   903  O  O     . GLU A 1 144 ? -14.153 -2.286  -50.346 1.00 29.65  ? 124 GLU A O     1 
ATOM   904  C  CB    . GLU A 1 144 ? -13.940 -0.370  -47.819 1.00 27.07  ? 124 GLU A CB    1 
ATOM   905  C  CG    . GLU A 1 144 ? -12.947 0.141   -46.775 1.00 29.08  ? 124 GLU A CG    1 
ATOM   906  C  CD    . GLU A 1 144 ? -12.948 1.663   -46.627 1.00 29.00  ? 124 GLU A CD    1 
ATOM   907  O  OE1   . GLU A 1 144 ? -12.260 2.167   -45.718 1.00 29.51  ? 124 GLU A OE1   1 
ATOM   908  O  OE2   . GLU A 1 144 ? -13.646 2.359   -47.409 1.00 26.87  ? 124 GLU A OE2   1 
ATOM   909  N  N     . ARG A 1 145 ? -15.362 -0.440  -50.738 1.00 29.02  ? 125 ARG A N     1 
ATOM   910  C  CA    . ARG A 1 145 ? -16.255 -1.182  -51.633 1.00 29.16  ? 125 ARG A CA    1 
ATOM   911  C  C     . ARG A 1 145 ? -15.594 -1.317  -52.978 1.00 29.35  ? 125 ARG A C     1 
ATOM   912  O  O     . ARG A 1 145 ? -15.639 -2.381  -53.606 1.00 33.97  ? 125 ARG A O     1 
ATOM   913  C  CB    . ARG A 1 145 ? -17.620 -0.506  -51.755 1.00 28.87  ? 125 ARG A CB    1 
ATOM   914  C  CG    . ARG A 1 145 ? -18.561 -1.146  -52.768 1.00 27.95  ? 125 ARG A CG    1 
ATOM   915  C  CD    . ARG A 1 145 ? -19.904 -0.431  -52.783 1.00 29.33  ? 125 ARG A CD    1 
ATOM   916  N  NE    . ARG A 1 145 ? -20.468 -0.367  -51.429 1.00 32.76  ? 125 ARG A NE    1 
ATOM   917  C  CZ    . ARG A 1 145 ? -21.280 -1.282  -50.895 1.00 34.73  ? 125 ARG A CZ    1 
ATOM   918  N  NH1   . ARG A 1 145 ? -21.682 -2.348  -51.602 1.00 35.89  ? 125 ARG A NH1   1 
ATOM   919  N  NH2   . ARG A 1 145 ? -21.701 -1.130  -49.649 1.00 34.63  ? 125 ARG A NH2   1 
ATOM   920  N  N     . LEU A 1 146 ? -14.970 -0.235  -53.421 1.00 28.32  ? 126 LEU A N     1 
ATOM   921  C  CA    . LEU A 1 146 ? -14.403 -0.173  -54.757 1.00 28.94  ? 126 LEU A CA    1 
ATOM   922  C  C     . LEU A 1 146 ? -13.266 -1.170  -54.934 1.00 31.59  ? 126 LEU A C     1 
ATOM   923  O  O     . LEU A 1 146 ? -13.145 -1.770  -56.016 1.00 29.85  ? 126 LEU A O     1 
ATOM   924  C  CB    . LEU A 1 146 ? -13.875 1.228   -55.008 1.00 30.44  ? 126 LEU A CB    1 
ATOM   925  C  CG    . LEU A 1 146 ? -13.101 1.518   -56.284 1.00 30.00  ? 126 LEU A CG    1 
ATOM   926  C  CD1   . LEU A 1 146 ? -13.916 1.202   -57.526 1.00 29.72  ? 126 LEU A CD1   1 
ATOM   927  C  CD2   . LEU A 1 146 ? -12.731 2.985   -56.228 1.00 31.35  ? 126 LEU A CD2   1 
ATOM   928  N  N     . MET A 1 147 ? -12.444 -1.329  -53.884 1.00 30.92  ? 127 MET A N     1 
ATOM   929  C  CA    . MET A 1 147 ? -11.213 -2.123  -53.964 1.00 33.97  ? 127 MET A CA    1 
ATOM   930  C  C     . MET A 1 147 ? -11.380 -3.624  -53.693 1.00 37.79  ? 127 MET A C     1 
ATOM   931  O  O     . MET A 1 147 ? -10.403 -4.370  -53.651 1.00 42.00  ? 127 MET A O     1 
ATOM   932  C  CB    . MET A 1 147 ? -10.124 -1.542  -53.061 1.00 31.25  ? 127 MET A CB    1 
ATOM   933  C  CG    . MET A 1 147 ? -9.674  -0.145  -53.465 1.00 30.89  ? 127 MET A CG    1 
ATOM   934  S  SD    . MET A 1 147 ? -9.458  0.005   -55.246 1.00 31.18  ? 127 MET A SD    1 
ATOM   935  C  CE    . MET A 1 147 ? -8.189  -1.237  -55.571 1.00 29.59  ? 127 MET A CE    1 
ATOM   936  N  N     . MET A 1 148 ? -12.608 -4.075  -53.535 1.00 42.23  ? 128 MET A N     1 
ATOM   937  C  CA    . MET A 1 148 ? -12.864 -5.509  -53.468 1.00 45.68  ? 128 MET A CA    1 
ATOM   938  C  C     . MET A 1 148 ? -12.621 -6.132  -54.853 1.00 45.56  ? 128 MET A C     1 
ATOM   939  O  O     . MET A 1 148 ? -13.034 -5.577  -55.878 1.00 40.69  ? 128 MET A O     1 
ATOM   940  C  CB    . MET A 1 148 ? -14.268 -5.762  -52.912 1.00 46.86  ? 128 MET A CB    1 
ATOM   941  C  CG    . MET A 1 148 ? -14.304 -5.595  -51.395 1.00 51.05  ? 128 MET A CG    1 
ATOM   942  S  SD    . MET A 1 148 ? -15.983 -5.431  -50.739 1.00 72.34  ? 128 MET A SD    1 
ATOM   943  C  CE    . MET A 1 148 ? -15.690 -5.203  -48.973 1.00 66.67  ? 128 MET A CE    1 
ATOM   944  N  N     . ASP A 1 149 ? -11.904 -7.258  -54.873 1.00 46.49  ? 129 ASP A N     1 
ATOM   945  C  CA    . ASP A 1 149 ? -11.404 -7.850  -56.132 1.00 48.59  ? 129 ASP A CA    1 
ATOM   946  C  C     . ASP A 1 149 ? -12.496 -8.078  -57.152 1.00 46.42  ? 129 ASP A C     1 
ATOM   947  O  O     . ASP A 1 149 ? -12.357 -7.730  -58.329 1.00 46.07  ? 129 ASP A O     1 
ATOM   948  C  CB    . ASP A 1 149 ? -10.708 -9.191  -55.861 1.00 52.73  ? 129 ASP A CB    1 
ATOM   949  C  CG    . ASP A 1 149 ? -9.359  -9.016  -55.206 1.00 56.14  ? 129 ASP A CG    1 
ATOM   950  O  OD1   . ASP A 1 149 ? -8.554  -8.197  -55.706 1.00 58.02  ? 129 ASP A OD1   1 
ATOM   951  O  OD2   . ASP A 1 149 ? -9.108  -9.682  -54.181 1.00 57.30  ? 129 ASP A OD2   1 
ATOM   952  N  N     . ASN A 1 150 ? -13.572 -8.696  -56.691 1.00 43.99  ? 130 ASN A N     1 
ATOM   953  C  CA    . ASN A 1 150 ? -14.730 -8.917  -57.531 1.00 45.46  ? 130 ASN A CA    1 
ATOM   954  C  C     . ASN A 1 150 ? -15.351 -7.628  -58.084 1.00 45.17  ? 130 ASN A C     1 
ATOM   955  O  O     . ASN A 1 150 ? -15.792 -7.615  -59.246 1.00 46.00  ? 130 ASN A O     1 
ATOM   956  C  CB    . ASN A 1 150 ? -15.774 -9.771  -56.797 1.00 49.89  ? 130 ASN A CB    1 
ATOM   957  C  CG    . ASN A 1 150 ? -15.991 -9.339  -55.361 1.00 52.53  ? 130 ASN A CG    1 
ATOM   958  O  OD1   . ASN A 1 150 ? -15.121 -8.710  -54.752 1.00 56.65  ? 130 ASN A OD1   1 
ATOM   959  N  ND2   . ASN A 1 150 ? -17.149 -9.689  -54.805 1.00 52.86  ? 130 ASN A ND2   1 
ATOM   960  N  N     . PHE A 1 151 ? -15.369 -6.549  -57.285 1.00 41.42  ? 131 PHE A N     1 
ATOM   961  C  CA    . PHE A 1 151 ? -15.920 -5.281  -57.757 1.00 38.63  ? 131 PHE A CA    1 
ATOM   962  C  C     . PHE A 1 151 ? -15.066 -4.721  -58.868 1.00 37.99  ? 131 PHE A C     1 
ATOM   963  O  O     . PHE A 1 151 ? -15.586 -4.212  -59.857 1.00 33.21  ? 131 PHE A O     1 
ATOM   964  C  CB    . PHE A 1 151 ? -16.064 -4.238  -56.653 1.00 39.17  ? 131 PHE A CB    1 
ATOM   965  C  CG    . PHE A 1 151 ? -16.923 -3.069  -57.058 1.00 38.94  ? 131 PHE A CG    1 
ATOM   966  C  CD1   . PHE A 1 151 ? -18.309 -3.119  -56.904 1.00 41.19  ? 131 PHE A CD1   1 
ATOM   967  C  CD2   . PHE A 1 151 ? -16.367 -1.954  -57.644 1.00 36.33  ? 131 PHE A CD2   1 
ATOM   968  C  CE1   . PHE A 1 151 ? -19.109 -2.057  -57.301 1.00 38.85  ? 131 PHE A CE1   1 
ATOM   969  C  CE2   . PHE A 1 151 ? -17.160 -0.897  -58.043 1.00 38.74  ? 131 PHE A CE2   1 
ATOM   970  C  CZ    . PHE A 1 151 ? -18.537 -0.943  -57.867 1.00 36.78  ? 131 PHE A CZ    1 
ATOM   971  N  N     . ILE A 1 152 ? -13.753 -4.843  -58.702 1.00 41.35  ? 132 ILE A N     1 
ATOM   972  C  CA    . ILE A 1 152 ? -12.793 -4.349  -59.688 1.00 44.13  ? 132 ILE A CA    1 
ATOM   973  C  C     . ILE A 1 152 ? -13.088 -5.077  -60.995 1.00 43.26  ? 132 ILE A C     1 
ATOM   974  O  O     . ILE A 1 152 ? -13.122 -4.459  -62.053 1.00 43.66  ? 132 ILE A O     1 
ATOM   975  C  CB    . ILE A 1 152 ? -11.318 -4.615  -59.266 1.00 49.27  ? 132 ILE A CB    1 
ATOM   976  C  CG1   . ILE A 1 152 ? -10.990 -4.002  -57.899 1.00 48.78  ? 132 ILE A CG1   1 
ATOM   977  C  CG2   . ILE A 1 152 ? -10.335 -4.115  -60.325 1.00 50.43  ? 132 ILE A CG2   1 
ATOM   978  C  CD1   . ILE A 1 152 ? -10.535 -2.567  -57.942 1.00 50.17  ? 132 ILE A CD1   1 
ATOM   979  N  N     . ASP A 1 153 ? -13.334 -6.383  -60.913 1.00 44.93  ? 133 ASP A N     1 
ATOM   980  C  CA    . ASP A 1 153 ? -13.624 -7.164  -62.104 1.00 48.39  ? 133 ASP A CA    1 
ATOM   981  C  C     . ASP A 1 153 ? -14.880 -6.672  -62.813 1.00 49.00  ? 133 ASP A C     1 
ATOM   982  O  O     . ASP A 1 153 ? -14.850 -6.454  -64.024 1.00 48.84  ? 133 ASP A O     1 
ATOM   983  C  CB    . ASP A 1 153 ? -13.709 -8.652  -61.780 1.00 53.28  ? 133 ASP A CB    1 
ATOM   984  C  CG    . ASP A 1 153 ? -12.365 -9.228  -61.358 1.00 57.93  ? 133 ASP A CG    1 
ATOM   985  O  OD1   . ASP A 1 153 ? -11.332 -8.846  -61.956 1.00 62.18  ? 133 ASP A OD1   1 
ATOM   986  O  OD2   . ASP A 1 153 ? -12.334 -10.056 -60.423 1.00 61.57  ? 133 ASP A OD2   1 
ATOM   987  N  N     . THR A 1 154 ? -15.966 -6.444  -62.080 1.00 46.98  ? 134 THR A N     1 
ATOM   988  C  CA    . THR A 1 154 ? -17.169 -5.892  -62.724 1.00 49.12  ? 134 THR A CA    1 
ATOM   989  C  C     . THR A 1 154 ? -16.923 -4.551  -63.425 1.00 45.77  ? 134 THR A C     1 
ATOM   990  O  O     . THR A 1 154 ? -17.575 -4.276  -64.428 1.00 47.08  ? 134 THR A O     1 
ATOM   991  C  CB    . THR A 1 154 ? -18.364 -5.719  -61.764 1.00 47.94  ? 134 THR A CB    1 
ATOM   992  O  OG1   . THR A 1 154 ? -17.992 -4.846  -60.700 1.00 52.35  ? 134 THR A OG1   1 
ATOM   993  C  CG2   . THR A 1 154 ? -18.791 -7.052  -61.203 1.00 50.32  ? 134 THR A CG2   1 
ATOM   994  N  N     . LEU A 1 155 ? -16.003 -3.727  -62.920 1.00 43.47  ? 135 LEU A N     1 
ATOM   995  C  CA    . LEU A 1 155 ? -15.713 -2.439  -63.574 1.00 48.52  ? 135 LEU A CA    1 
ATOM   996  C  C     . LEU A 1 155 ? -15.157 -2.595  -64.970 1.00 48.35  ? 135 LEU A C     1 
ATOM   997  O  O     . LEU A 1 155 ? -15.442 -1.782  -65.847 1.00 49.84  ? 135 LEU A O     1 
ATOM   998  C  CB    . LEU A 1 155 ? -14.681 -1.626  -62.813 1.00 51.36  ? 135 LEU A CB    1 
ATOM   999  C  CG    . LEU A 1 155 ? -15.008 -0.994  -61.483 1.00 52.34  ? 135 LEU A CG    1 
ATOM   1000 C  CD1   . LEU A 1 155 ? -13.912 0.008   -61.199 1.00 53.24  ? 135 LEU A CD1   1 
ATOM   1001 C  CD2   . LEU A 1 155 ? -16.355 -0.312  -61.503 1.00 55.40  ? 135 LEU A CD2   1 
ATOM   1002 N  N     . GLY A 1 156 ? -14.325 -3.616  -65.155 1.00 53.24  ? 136 GLY A N     1 
ATOM   1003 C  CA    . GLY A 1 156 ? -13.674 -3.877  -66.436 1.00 51.52  ? 136 GLY A CA    1 
ATOM   1004 C  C     . GLY A 1 156 ? -14.657 -3.830  -67.581 1.00 51.47  ? 136 GLY A C     1 
ATOM   1005 O  O     . GLY A 1 156 ? -14.324 -3.350  -68.680 1.00 52.98  ? 136 GLY A O     1 
ATOM   1006 N  N     . TYR A 1 157 ? -15.880 -4.285  -67.310 1.00 46.47  ? 137 TYR A N     1 
ATOM   1007 C  CA    . TYR A 1 157 ? -16.905 -4.375  -68.336 1.00 46.99  ? 137 TYR A CA    1 
ATOM   1008 C  C     . TYR A 1 157 ? -17.694 -3.067  -68.559 1.00 49.55  ? 137 TYR A C     1 
ATOM   1009 O  O     . TYR A 1 157 ? -18.333 -2.923  -69.598 1.00 51.73  ? 137 TYR A O     1 
ATOM   1010 C  CB    . TYR A 1 157 ? -17.827 -5.544  -68.016 1.00 47.83  ? 137 TYR A CB    1 
ATOM   1011 C  CG    . TYR A 1 157 ? -17.052 -6.846  -67.840 1.00 50.76  ? 137 TYR A CG    1 
ATOM   1012 C  CD1   . TYR A 1 157 ? -16.563 -7.553  -68.944 1.00 55.41  ? 137 TYR A CD1   1 
ATOM   1013 C  CD2   . TYR A 1 157 ? -16.784 -7.354  -66.570 1.00 52.67  ? 137 TYR A CD2   1 
ATOM   1014 C  CE1   . TYR A 1 157 ? -15.845 -8.736  -68.784 1.00 56.81  ? 137 TYR A CE1   1 
ATOM   1015 C  CE2   . TYR A 1 157 ? -16.067 -8.529  -66.396 1.00 55.45  ? 137 TYR A CE2   1 
ATOM   1016 C  CZ    . TYR A 1 157 ? -15.597 -9.218  -67.507 1.00 59.94  ? 137 TYR A CZ    1 
ATOM   1017 O  OH    . TYR A 1 157 ? -14.886 -10.388 -67.339 1.00 59.84  ? 137 TYR A OH    1 
ATOM   1018 N  N     . TRP A 1 158 ? -17.639 -2.120  -67.613 1.00 45.91  ? 138 TRP A N     1 
ATOM   1019 C  CA    . TRP A 1 158 ? -18.272 -0.805  -67.792 1.00 42.21  ? 138 TRP A CA    1 
ATOM   1020 C  C     . TRP A 1 158 ? -17.404 0.111   -68.629 1.00 42.53  ? 138 TRP A C     1 
ATOM   1021 O  O     . TRP A 1 158 ? -16.211 -0.119  -68.790 1.00 48.47  ? 138 TRP A O     1 
ATOM   1022 C  CB    . TRP A 1 158 ? -18.481 -0.099  -66.464 1.00 39.98  ? 138 TRP A CB    1 
ATOM   1023 C  CG    . TRP A 1 158 ? -19.313 -0.817  -65.472 1.00 36.49  ? 138 TRP A CG    1 
ATOM   1024 C  CD1   . TRP A 1 158 ? -20.092 -1.915  -65.678 1.00 35.68  ? 138 TRP A CD1   1 
ATOM   1025 C  CD2   . TRP A 1 158 ? -19.461 -0.468  -64.100 1.00 34.36  ? 138 TRP A CD2   1 
ATOM   1026 N  NE1   . TRP A 1 158 ? -20.708 -2.275  -64.506 1.00 34.53  ? 138 TRP A NE1   1 
ATOM   1027 C  CE2   . TRP A 1 158 ? -20.336 -1.398  -63.524 1.00 34.49  ? 138 TRP A CE2   1 
ATOM   1028 C  CE3   . TRP A 1 158 ? -18.945 0.550   -63.304 1.00 34.65  ? 138 TRP A CE3   1 
ATOM   1029 C  CZ2   . TRP A 1 158 ? -20.701 -1.340  -62.191 1.00 34.63  ? 138 TRP A CZ2   1 
ATOM   1030 C  CZ3   . TRP A 1 158 ? -19.309 0.600   -61.976 1.00 35.28  ? 138 TRP A CZ3   1 
ATOM   1031 C  CH2   . TRP A 1 158 ? -20.179 -0.333  -61.435 1.00 33.79  ? 138 TRP A CH2   1 
ATOM   1032 N  N     . ASP A 1 159 ? -17.998 1.183   -69.117 1.00 39.71  ? 139 ASP A N     1 
ATOM   1033 C  CA    . ASP A 1 159 ? -17.268 2.156   -69.905 1.00 38.98  ? 139 ASP A CA    1 
ATOM   1034 C  C     . ASP A 1 159 ? -16.769 3.266   -68.976 1.00 35.54  ? 139 ASP A C     1 
ATOM   1035 O  O     . ASP A 1 159 ? -17.484 4.190   -68.629 1.00 34.43  ? 139 ASP A O     1 
ATOM   1036 C  CB    . ASP A 1 159 ? -18.159 2.703   -71.025 1.00 41.81  ? 139 ASP A CB    1 
ATOM   1037 C  CG    . ASP A 1 159 ? -17.452 3.745   -71.873 1.00 45.48  ? 139 ASP A CG    1 
ATOM   1038 O  OD1   . ASP A 1 159 ? -16.201 3.750   -71.857 1.00 44.42  ? 139 ASP A OD1   1 
ATOM   1039 O  OD2   . ASP A 1 159 ? -18.146 4.563   -72.532 1.00 48.27  ? 139 ASP A OD2   1 
ATOM   1040 N  N     . LEU A 1 160 ? -15.515 3.164   -68.587 1.00 34.90  ? 140 LEU A N     1 
ATOM   1041 C  CA    . LEU A 1 160 ? -14.971 3.972   -67.522 1.00 34.94  ? 140 LEU A CA    1 
ATOM   1042 C  C     . LEU A 1 160 ? -14.213 5.184   -68.104 1.00 33.21  ? 140 LEU A C     1 
ATOM   1043 O  O     . LEU A 1 160 ? -13.192 5.024   -68.759 1.00 37.55  ? 140 LEU A O     1 
ATOM   1044 C  CB    . LEU A 1 160 ? -14.058 3.084   -66.690 1.00 36.09  ? 140 LEU A CB    1 
ATOM   1045 C  CG    . LEU A 1 160 ? -13.906 3.285   -65.193 1.00 40.55  ? 140 LEU A CG    1 
ATOM   1046 C  CD1   . LEU A 1 160 ? -12.616 2.627   -64.733 1.00 41.05  ? 140 LEU A CD1   1 
ATOM   1047 C  CD2   . LEU A 1 160 ? -13.875 4.751   -64.802 1.00 43.30  ? 140 LEU A CD2   1 
ATOM   1048 N  N     . ALA A 1 161 ? -14.706 6.389   -67.839 1.00 30.07  ? 141 ALA A N     1 
ATOM   1049 C  CA    . ALA A 1 161 ? -14.123 7.628   -68.393 1.00 29.57  ? 141 ALA A CA    1 
ATOM   1050 C  C     . ALA A 1 161 ? -13.089 8.311   -67.490 1.00 28.12  ? 141 ALA A C     1 
ATOM   1051 O  O     . ALA A 1 161 ? -12.154 8.930   -67.982 1.00 28.15  ? 141 ALA A O     1 
ATOM   1052 C  CB    . ALA A 1 161 ? -15.226 8.615   -68.717 1.00 28.93  ? 141 ALA A CB    1 
ATOM   1053 N  N     . MET A 1 162 ? -13.243 8.209   -66.173 1.00 25.69  ? 142 MET A N     1 
ATOM   1054 C  CA    . MET A 1 162 ? -12.353 8.955   -65.281 1.00 26.02  ? 142 MET A CA    1 
ATOM   1055 C  C     . MET A 1 162 ? -12.505 8.439   -63.871 1.00 23.53  ? 142 MET A C     1 
ATOM   1056 O  O     . MET A 1 162 ? -13.533 7.886   -63.531 1.00 21.16  ? 142 MET A O     1 
ATOM   1057 C  CB    . MET A 1 162 ? -12.736 10.441  -65.330 1.00 27.19  ? 142 MET A CB    1 
ATOM   1058 C  CG    . MET A 1 162 ? -11.827 11.373  -64.574 1.00 31.77  ? 142 MET A CG    1 
ATOM   1059 S  SD    . MET A 1 162 ? -12.249 13.103  -64.905 1.00 36.05  ? 142 MET A SD    1 
ATOM   1060 C  CE    . MET A 1 162 ? -13.754 13.276  -63.968 1.00 32.86  ? 142 MET A CE    1 
ATOM   1061 N  N     . VAL A 1 163 ? -11.489 8.635   -63.050 1.00 22.13  ? 143 VAL A N     1 
ATOM   1062 C  CA    . VAL A 1 163 ? -11.638 8.391   -61.624 1.00 22.53  ? 143 VAL A CA    1 
ATOM   1063 C  C     . VAL A 1 163 ? -11.207 9.636   -60.894 1.00 21.88  ? 143 VAL A C     1 
ATOM   1064 O  O     . VAL A 1 163 ? -10.166 10.212  -61.187 1.00 21.99  ? 143 VAL A O     1 
ATOM   1065 C  CB    . VAL A 1 163 ? -10.812 7.183   -61.149 1.00 23.37  ? 143 VAL A CB    1 
ATOM   1066 C  CG1   . VAL A 1 163 ? -10.941 7.003   -59.643 1.00 23.41  ? 143 VAL A CG1   1 
ATOM   1067 C  CG2   . VAL A 1 163 ? -11.254 5.916   -61.886 1.00 23.02  ? 143 VAL A CG2   1 
ATOM   1068 N  N     . ALA A 1 164 ? -12.032 10.073  -59.959 1.00 21.43  ? 144 ALA A N     1 
ATOM   1069 C  CA    . ALA A 1 164 ? -11.731 11.258  -59.207 1.00 22.09  ? 144 ALA A CA    1 
ATOM   1070 C  C     . ALA A 1 164 ? -11.744 10.900  -57.739 1.00 22.09  ? 144 ALA A C     1 
ATOM   1071 O  O     . ALA A 1 164 ? -12.631 10.207  -57.299 1.00 21.49  ? 144 ALA A O     1 
ATOM   1072 C  CB    . ALA A 1 164 ? -12.726 12.362  -59.515 1.00 21.70  ? 144 ALA A CB    1 
ATOM   1073 N  N     . VAL A 1 165 ? -10.748 11.377  -56.997 1.00 23.18  ? 145 VAL A N     1 
ATOM   1074 C  CA    . VAL A 1 165 ? -10.626 11.079  -55.579 1.00 23.71  ? 145 VAL A CA    1 
ATOM   1075 C  C     . VAL A 1 165 ? -10.741 12.405  -54.874 1.00 25.86  ? 145 VAL A C     1 
ATOM   1076 O  O     . VAL A 1 165 ? -9.847  13.240  -54.968 1.00 27.72  ? 145 VAL A O     1 
ATOM   1077 C  CB    . VAL A 1 165 ? -9.286  10.379  -55.255 1.00 23.03  ? 145 VAL A CB    1 
ATOM   1078 C  CG1   . VAL A 1 165 ? -9.224  9.922   -53.802 1.00 22.37  ? 145 VAL A CG1   1 
ATOM   1079 C  CG2   . VAL A 1 165 ? -9.084  9.181   -56.172 1.00 23.09  ? 145 VAL A CG2   1 
ATOM   1080 N  N     . ASP A 1 166 ? -11.870 12.596  -54.199 1.00 27.44  ? 146 ASP A N     1 
ATOM   1081 C  CA    . ASP A 1 166 ? -12.156 13.787  -53.435 1.00 29.11  ? 146 ASP A CA    1 
ATOM   1082 C  C     . ASP A 1 166 ? -11.490 13.670  -52.074 1.00 26.53  ? 146 ASP A C     1 
ATOM   1083 O  O     . ASP A 1 166 ? -11.113 12.585  -51.663 1.00 27.10  ? 146 ASP A O     1 
ATOM   1084 C  CB    . ASP A 1 166 ? -13.671 13.948  -53.272 1.00 35.23  ? 146 ASP A CB    1 
ATOM   1085 C  CG    . ASP A 1 166 ? -14.145 15.401  -53.472 1.00 45.20  ? 146 ASP A CG    1 
ATOM   1086 O  OD1   . ASP A 1 166 ? -13.314 16.339  -53.296 1.00 43.86  ? 146 ASP A OD1   1 
ATOM   1087 O  OD2   . ASP A 1 166 ? -15.350 15.594  -53.836 1.00 55.71  ? 146 ASP A OD2   1 
ATOM   1088 N  N     . GLU A 1 167 ? -11.306 14.787  -51.380 1.00 26.49  ? 147 GLU A N     1 
ATOM   1089 C  CA    . GLU A 1 167 ? -10.675 14.771  -50.058 1.00 26.78  ? 147 GLU A CA    1 
ATOM   1090 C  C     . GLU A 1 167 ? -9.439  13.865  -50.133 1.00 24.65  ? 147 GLU A C     1 
ATOM   1091 O  O     . GLU A 1 167 ? -9.227  13.016  -49.284 1.00 22.64  ? 147 GLU A O     1 
ATOM   1092 C  CB    . GLU A 1 167 ? -11.651 14.240  -49.004 1.00 30.83  ? 147 GLU A CB    1 
ATOM   1093 C  CG    . GLU A 1 167 ? -13.057 14.812  -49.085 1.00 34.24  ? 147 GLU A CG    1 
ATOM   1094 C  CD    . GLU A 1 167 ? -13.157 16.248  -48.599 1.00 40.40  ? 147 GLU A CD    1 
ATOM   1095 O  OE1   . GLU A 1 167 ? -12.255 16.689  -47.829 1.00 43.95  ? 147 GLU A OE1   1 
ATOM   1096 O  OE2   . GLU A 1 167 ? -14.161 16.935  -48.966 1.00 47.01  ? 147 GLU A OE2   1 
ATOM   1097 N  N     . ALA A 1 168 ? -8.634  14.066  -51.170 1.00 24.05  ? 148 ALA A N     1 
ATOM   1098 C  CA    . ALA A 1 168 ? -7.518  13.176  -51.499 1.00 25.05  ? 148 ALA A CA    1 
ATOM   1099 C  C     . ALA A 1 168 ? -6.423  13.130  -50.439 1.00 24.14  ? 148 ALA A C     1 
ATOM   1100 O  O     . ALA A 1 168 ? -5.656  12.197  -50.412 1.00 25.50  ? 148 ALA A O     1 
ATOM   1101 C  CB    . ALA A 1 168 ? -6.922  13.543  -52.846 1.00 24.63  ? 148 ALA A CB    1 
ATOM   1102 N  N     . HIS A 1 169 ? -6.368  14.119  -49.560 1.00 25.13  ? 149 HIS A N     1 
ATOM   1103 C  CA    . HIS A 1 169 ? -5.460  14.068  -48.411 1.00 27.36  ? 149 HIS A CA    1 
ATOM   1104 C  C     . HIS A 1 169 ? -5.673  12.821  -47.549 1.00 26.55  ? 149 HIS A C     1 
ATOM   1105 O  O     . HIS A 1 169 ? -4.753  12.405  -46.865 1.00 24.79  ? 149 HIS A O     1 
ATOM   1106 C  CB    . HIS A 1 169 ? -5.590  15.320  -47.542 1.00 26.67  ? 149 HIS A CB    1 
ATOM   1107 C  CG    . HIS A 1 169 ? -6.925  15.469  -46.919 1.00 27.79  ? 149 HIS A CG    1 
ATOM   1108 N  ND1   . HIS A 1 169 ? -8.006  15.992  -47.596 1.00 29.41  ? 149 HIS A ND1   1 
ATOM   1109 C  CD2   . HIS A 1 169 ? -7.365  15.161  -45.679 1.00 29.46  ? 149 HIS A CD2   1 
ATOM   1110 C  CE1   . HIS A 1 169 ? -9.062  15.981  -46.806 1.00 28.66  ? 149 HIS A CE1   1 
ATOM   1111 N  NE2   . HIS A 1 169 ? -8.699  15.488  -45.634 1.00 30.94  ? 149 HIS A NE2   1 
ATOM   1112 N  N     . CYS A 1 170 ? -6.882  12.250  -47.597 1.00 25.96  ? 150 CYS A N     1 
ATOM   1113 C  CA    . CYS A 1 170 ? -7.218  11.005  -46.893 1.00 26.78  ? 150 CYS A CA    1 
ATOM   1114 C  C     . CYS A 1 170 ? -6.360  9.836   -47.332 1.00 27.25  ? 150 CYS A C     1 
ATOM   1115 O  O     . CYS A 1 170 ? -6.115  8.924   -46.570 1.00 27.04  ? 150 CYS A O     1 
ATOM   1116 C  CB    . CYS A 1 170 ? -8.692  10.643  -47.109 1.00 26.94  ? 150 CYS A CB    1 
ATOM   1117 S  SG    . CYS A 1 170 ? -9.865  11.708  -46.233 1.00 31.03  ? 150 CYS A SG    1 
ATOM   1118 N  N     . ILE A 1 171 ? -5.928  9.843   -48.586 1.00 28.86  ? 151 ILE A N     1 
ATOM   1119 C  CA    . ILE A 1 171 ? -5.026  8.826   -49.063 1.00 27.71  ? 151 ILE A CA    1 
ATOM   1120 C  C     . ILE A 1 171 ? -3.848  8.769   -48.115 1.00 29.35  ? 151 ILE A C     1 
ATOM   1121 O  O     . ILE A 1 171 ? -3.501  7.703   -47.609 1.00 30.37  ? 151 ILE A O     1 
ATOM   1122 C  CB    . ILE A 1 171 ? -4.589  9.109   -50.505 1.00 27.26  ? 151 ILE A CB    1 
ATOM   1123 C  CG1   . ILE A 1 171 ? -5.775  8.882   -51.426 1.00 28.11  ? 151 ILE A CG1   1 
ATOM   1124 C  CG2   . ILE A 1 171 ? -3.456  8.190   -50.942 1.00 26.69  ? 151 ILE A CG2   1 
ATOM   1125 C  CD1   . ILE A 1 171 ? -5.536  9.386   -52.835 1.00 30.10  ? 151 ILE A CD1   1 
ATOM   1126 N  N     . SER A 1 172 ? -3.264  9.921   -47.837 1.00 30.28  ? 152 SER A N     1 
ATOM   1127 C  CA    . SER A 1 172 ? -2.041  9.982   -47.049 1.00 33.54  ? 152 SER A CA    1 
ATOM   1128 C  C     . SER A 1 172 ? -2.303  9.943   -45.555 1.00 35.32  ? 152 SER A C     1 
ATOM   1129 O  O     . SER A 1 172 ? -1.525  9.383   -44.793 1.00 38.15  ? 152 SER A O     1 
ATOM   1130 C  CB    . SER A 1 172 ? -1.286  11.273  -47.375 1.00 35.13  ? 152 SER A CB    1 
ATOM   1131 O  OG    . SER A 1 172 ? -0.237  11.484  -46.464 1.00 36.30  ? 152 SER A OG    1 
ATOM   1132 N  N     . GLN A 1 173 ? -3.393  10.568  -45.137 1.00 34.87  ? 153 GLN A N     1 
ATOM   1133 C  CA    . GLN A 1 173 ? -3.717  10.728  -43.725 1.00 34.88  ? 153 GLN A CA    1 
ATOM   1134 C  C     . GLN A 1 173 ? -4.344  9.459   -43.106 1.00 34.60  ? 153 GLN A C     1 
ATOM   1135 O  O     . GLN A 1 173 ? -4.278  9.255   -41.893 1.00 33.44  ? 153 GLN A O     1 
ATOM   1136 C  CB    . GLN A 1 173 ? -4.674  11.907  -43.625 1.00 38.66  ? 153 GLN A CB    1 
ATOM   1137 C  CG    . GLN A 1 173 ? -5.055  12.346  -42.238 1.00 43.90  ? 153 GLN A CG    1 
ATOM   1138 C  CD    . GLN A 1 173 ? -6.151  13.404  -42.285 1.00 50.16  ? 153 GLN A CD    1 
ATOM   1139 O  OE1   . GLN A 1 173 ? -5.970  14.488  -42.877 1.00 51.31  ? 153 GLN A OE1   1 
ATOM   1140 N  NE2   . GLN A 1 173 ? -7.292  13.102  -41.669 1.00 50.09  ? 153 GLN A NE2   1 
ATOM   1141 N  N     . TRP A 1 174 ? -4.985  8.642   -43.945 1.00 31.78  ? 154 TRP A N     1 
ATOM   1142 C  CA    . TRP A 1 174 ? -5.660  7.427   -43.515 1.00 31.28  ? 154 TRP A CA    1 
ATOM   1143 C  C     . TRP A 1 174 ? -5.133  6.160   -44.141 1.00 32.14  ? 154 TRP A C     1 
ATOM   1144 O  O     . TRP A 1 174 ? -5.257  5.097   -43.555 1.00 31.70  ? 154 TRP A O     1 
ATOM   1145 C  CB    . TRP A 1 174 ? -7.152  7.503   -43.845 1.00 30.04  ? 154 TRP A CB    1 
ATOM   1146 C  CG    . TRP A 1 174 ? -7.901  8.458   -42.976 1.00 29.30  ? 154 TRP A CG    1 
ATOM   1147 C  CD1   . TRP A 1 174 ? -7.452  9.056   -41.848 1.00 28.27  ? 154 TRP A CD1   1 
ATOM   1148 C  CD2   . TRP A 1 174 ? -9.253  8.876   -43.136 1.00 28.37  ? 154 TRP A CD2   1 
ATOM   1149 N  NE1   . TRP A 1 174 ? -8.430  9.819   -41.289 1.00 27.74  ? 154 TRP A NE1   1 
ATOM   1150 C  CE2   . TRP A 1 174 ? -9.555  9.724   -42.055 1.00 28.98  ? 154 TRP A CE2   1 
ATOM   1151 C  CE3   . TRP A 1 174 ? -10.247 8.601   -44.072 1.00 28.28  ? 154 TRP A CE3   1 
ATOM   1152 C  CZ2   . TRP A 1 174 ? -10.802 10.312  -41.897 1.00 27.64  ? 154 TRP A CZ2   1 
ATOM   1153 C  CZ3   . TRP A 1 174 ? -11.489 9.177   -43.904 1.00 27.40  ? 154 TRP A CZ3   1 
ATOM   1154 C  CH2   . TRP A 1 174 ? -11.749 10.027  -42.840 1.00 27.53  ? 154 TRP A CH2   1 
ATOM   1155 N  N     . GLY A 1 175 ? -4.595  6.246   -45.344 1.00 32.80  ? 155 GLY A N     1 
ATOM   1156 C  CA    . GLY A 1 175 ? -4.247  5.050   -46.074 1.00 34.73  ? 155 GLY A CA    1 
ATOM   1157 C  C     . GLY A 1 175 ? -3.159  4.219   -45.426 1.00 37.34  ? 155 GLY A C     1 
ATOM   1158 O  O     . GLY A 1 175 ? -3.136  3.013   -45.623 1.00 39.03  ? 155 GLY A O     1 
ATOM   1159 N  N     . HIS A 1 176 ? -2.261  4.840   -44.653 1.00 38.53  ? 156 HIS A N     1 
ATOM   1160 C  CA    . HIS A 1 176 ? -1.177  4.072   -44.019 1.00 41.52  ? 156 HIS A CA    1 
ATOM   1161 C  C     . HIS A 1 176 ? -1.617  3.255   -42.820 1.00 43.21  ? 156 HIS A C     1 
ATOM   1162 O  O     . HIS A 1 176 ? -0.887  2.365   -42.437 1.00 45.13  ? 156 HIS A O     1 
ATOM   1163 C  CB    . HIS A 1 176 ? 0.007   4.957   -43.607 1.00 40.96  ? 156 HIS A CB    1 
ATOM   1164 C  CG    . HIS A 1 176 ? 0.650   5.652   -44.760 1.00 41.98  ? 156 HIS A CG    1 
ATOM   1165 N  ND1   . HIS A 1 176 ? 1.349   4.976   -45.732 1.00 44.11  ? 156 HIS A ND1   1 
ATOM   1166 C  CD2   . HIS A 1 176 ? 0.646   6.953   -45.136 1.00 42.92  ? 156 HIS A CD2   1 
ATOM   1167 C  CE1   . HIS A 1 176 ? 1.772   5.833   -46.645 1.00 45.38  ? 156 HIS A CE1   1 
ATOM   1168 N  NE2   . HIS A 1 176 ? 1.352   7.039   -46.309 1.00 44.48  ? 156 HIS A NE2   1 
ATOM   1169 N  N     . ASP A 1 177 ? -2.777  3.549   -42.221 1.00 43.12  ? 157 ASP A N     1 
ATOM   1170 C  CA    . ASP A 1 177 ? -3.184  2.863   -40.983 1.00 42.85  ? 157 ASP A CA    1 
ATOM   1171 C  C     . ASP A 1 177 ? -4.691  2.663   -40.793 1.00 38.41  ? 157 ASP A C     1 
ATOM   1172 O  O     . ASP A 1 177 ? -5.181  1.545   -40.730 1.00 36.80  ? 157 ASP A O     1 
ATOM   1173 C  CB    . ASP A 1 177 ? -2.600  3.580   -39.750 1.00 47.26  ? 157 ASP A CB    1 
ATOM   1174 C  CG    . ASP A 1 177 ? -2.775  5.128   -39.777 1.00 52.74  ? 157 ASP A CG    1 
ATOM   1175 O  OD1   . ASP A 1 177 ? -3.679  5.679   -40.472 1.00 46.99  ? 157 ASP A OD1   1 
ATOM   1176 O  OD2   . ASP A 1 177 ? -1.992  5.798   -39.052 1.00 56.72  ? 157 ASP A OD2   1 
ATOM   1177 N  N     . PHE A 1 178 ? -5.421  3.757   -40.704 1.00 35.28  ? 158 PHE A N     1 
ATOM   1178 C  CA    . PHE A 1 178 ? -6.819  3.720   -40.308 1.00 34.87  ? 158 PHE A CA    1 
ATOM   1179 C  C     . PHE A 1 178 ? -7.739  3.114   -41.386 1.00 32.46  ? 158 PHE A C     1 
ATOM   1180 O  O     . PHE A 1 178 ? -8.615  2.325   -41.071 1.00 33.39  ? 158 PHE A O     1 
ATOM   1181 C  CB    . PHE A 1 178 ? -7.233  5.130   -39.919 1.00 33.85  ? 158 PHE A CB    1 
ATOM   1182 C  CG    . PHE A 1 178 ? -8.687  5.284   -39.669 1.00 33.69  ? 158 PHE A CG    1 
ATOM   1183 C  CD1   . PHE A 1 178 ? -9.301  4.549   -38.685 1.00 33.46  ? 158 PHE A CD1   1 
ATOM   1184 C  CD2   . PHE A 1 178 ? -9.428  6.200   -40.399 1.00 32.47  ? 158 PHE A CD2   1 
ATOM   1185 C  CE1   . PHE A 1 178 ? -10.646 4.700   -38.445 1.00 34.63  ? 158 PHE A CE1   1 
ATOM   1186 C  CE2   . PHE A 1 178 ? -10.767 6.355   -40.177 1.00 33.17  ? 158 PHE A CE2   1 
ATOM   1187 C  CZ    . PHE A 1 178 ? -11.384 5.606   -39.192 1.00 34.39  ? 158 PHE A CZ    1 
ATOM   1188 N  N     . ARG A 1 179 ? -7.514  3.454   -42.645 1.00 29.98  ? 159 ARG A N     1 
ATOM   1189 C  CA    . ARG A 1 179 ? -8.285  2.896   -43.746 1.00 31.26  ? 159 ARG A CA    1 
ATOM   1190 C  C     . ARG A 1 179 ? -7.357  2.555   -44.904 1.00 31.48  ? 159 ARG A C     1 
ATOM   1191 O  O     . ARG A 1 179 ? -7.172  3.369   -45.796 1.00 29.58  ? 159 ARG A O     1 
ATOM   1192 C  CB    . ARG A 1 179 ? -9.356  3.895   -44.180 1.00 31.42  ? 159 ARG A CB    1 
ATOM   1193 C  CG    . ARG A 1 179 ? -10.450 4.017   -43.139 1.00 31.86  ? 159 ARG A CG    1 
ATOM   1194 C  CD    . ARG A 1 179 ? -11.469 5.066   -43.491 1.00 32.52  ? 159 ARG A CD    1 
ATOM   1195 N  NE    . ARG A 1 179 ? -12.208 4.688   -44.685 1.00 31.44  ? 159 ARG A NE    1 
ATOM   1196 C  CZ    . ARG A 1 179 ? -13.226 5.380   -45.169 1.00 30.50  ? 159 ARG A CZ    1 
ATOM   1197 N  NH1   . ARG A 1 179 ? -13.622 6.480   -44.551 1.00 30.77  ? 159 ARG A NH1   1 
ATOM   1198 N  NH2   . ARG A 1 179 ? -13.843 4.969   -46.281 1.00 30.73  ? 159 ARG A NH2   1 
ATOM   1199 N  N     . PRO A 1 180 ? -6.758  1.349   -44.871 1.00 33.75  ? 160 PRO A N     1 
ATOM   1200 C  CA    . PRO A 1 180 ? -5.717  0.939   -45.822 1.00 33.47  ? 160 PRO A CA    1 
ATOM   1201 C  C     . PRO A 1 180 ? -6.171  0.871   -47.254 1.00 30.47  ? 160 PRO A C     1 
ATOM   1202 O  O     . PRO A 1 180 ? -5.345  0.993   -48.150 1.00 30.65  ? 160 PRO A O     1 
ATOM   1203 C  CB    . PRO A 1 180 ? -5.316  -0.477  -45.340 1.00 34.24  ? 160 PRO A CB    1 
ATOM   1204 C  CG    . PRO A 1 180 ? -5.646  -0.464  -43.887 1.00 36.48  ? 160 PRO A CG    1 
ATOM   1205 C  CD    . PRO A 1 180 ? -6.935  0.332   -43.811 1.00 35.96  ? 160 PRO A CD    1 
ATOM   1206 N  N     . GLU A 1 181 ? -7.457  0.656   -47.486 1.00 29.74  ? 161 GLU A N     1 
ATOM   1207 C  CA    . GLU A 1 181 ? -7.939  0.665   -48.859 1.00 30.47  ? 161 GLU A CA    1 
ATOM   1208 C  C     . GLU A 1 181 ? -7.734  2.034   -49.523 1.00 29.08  ? 161 GLU A C     1 
ATOM   1209 O  O     . GLU A 1 181 ? -7.680  2.131   -50.759 1.00 26.88  ? 161 GLU A O     1 
ATOM   1210 C  CB    . GLU A 1 181 ? -9.393  0.219   -48.928 1.00 32.72  ? 161 GLU A CB    1 
ATOM   1211 C  CG    . GLU A 1 181 ? -9.604  -1.202  -48.426 1.00 34.89  ? 161 GLU A CG    1 
ATOM   1212 C  CD    . GLU A 1 181 ? -8.671  -2.209  -49.086 1.00 36.90  ? 161 GLU A CD    1 
ATOM   1213 O  OE1   . GLU A 1 181 ? -8.511  -2.151  -50.335 1.00 35.26  ? 161 GLU A OE1   1 
ATOM   1214 O  OE2   . GLU A 1 181 ? -8.094  -3.049  -48.340 1.00 39.34  ? 161 GLU A OE2   1 
ATOM   1215 N  N     . TYR A 1 182 ? -7.573  3.080   -48.711 1.00 27.32  ? 162 TYR A N     1 
ATOM   1216 C  CA    . TYR A 1 182 ? -7.185  4.369   -49.258 1.00 30.26  ? 162 TYR A CA    1 
ATOM   1217 C  C     . TYR A 1 182 ? -5.830  4.327   -49.934 1.00 32.73  ? 162 TYR A C     1 
ATOM   1218 O  O     . TYR A 1 182 ? -5.647  5.003   -50.953 1.00 33.62  ? 162 TYR A O     1 
ATOM   1219 C  CB    . TYR A 1 182 ? -7.246  5.508   -48.226 1.00 28.37  ? 162 TYR A CB    1 
ATOM   1220 C  CG    . TYR A 1 182 ? -8.473  6.337   -48.419 1.00 26.00  ? 162 TYR A CG    1 
ATOM   1221 C  CD1   . TYR A 1 182 ? -8.624  7.128   -49.550 1.00 25.54  ? 162 TYR A CD1   1 
ATOM   1222 C  CD2   . TYR A 1 182 ? -9.502  6.306   -47.503 1.00 27.30  ? 162 TYR A CD2   1 
ATOM   1223 C  CE1   . TYR A 1 182 ? -9.755  7.892   -49.747 1.00 24.34  ? 162 TYR A CE1   1 
ATOM   1224 C  CE2   . TYR A 1 182 ? -10.651 7.059   -47.698 1.00 26.86  ? 162 TYR A CE2   1 
ATOM   1225 C  CZ    . TYR A 1 182 ? -10.767 7.847   -48.821 1.00 25.75  ? 162 TYR A CZ    1 
ATOM   1226 O  OH    . TYR A 1 182 ? -11.921 8.587   -49.003 1.00 27.58  ? 162 TYR A OH    1 
ATOM   1227 N  N     . ALA A 1 183 ? -4.903  3.536   -49.396 1.00 31.21  ? 163 ALA A N     1 
ATOM   1228 C  CA    . ALA A 1 183 ? -3.600  3.362   -50.047 1.00 34.36  ? 163 ALA A CA    1 
ATOM   1229 C  C     . ALA A 1 183 ? -3.666  2.374   -51.210 1.00 33.51  ? 163 ALA A C     1 
ATOM   1230 O  O     . ALA A 1 183 ? -2.761  2.327   -52.019 1.00 33.45  ? 163 ALA A O     1 
ATOM   1231 C  CB    . ALA A 1 183 ? -2.540  2.920   -49.031 1.00 34.96  ? 163 ALA A CB    1 
ATOM   1232 N  N     . ALA A 1 184 ? -4.729  1.578   -51.291 1.00 32.78  ? 164 ALA A N     1 
ATOM   1233 C  CA    . ALA A 1 184 ? -4.822  0.552   -52.322 1.00 31.10  ? 164 ALA A CA    1 
ATOM   1234 C  C     . ALA A 1 184 ? -5.324  1.048   -53.688 1.00 30.72  ? 164 ALA A C     1 
ATOM   1235 O  O     . ALA A 1 184 ? -5.385  0.260   -54.639 1.00 29.76  ? 164 ALA A O     1 
ATOM   1236 C  CB    . ALA A 1 184 ? -5.707  -0.584  -51.827 1.00 32.17  ? 164 ALA A CB    1 
ATOM   1237 N  N     . LEU A 1 185 ? -5.665  2.331   -53.808 1.00 28.84  ? 165 LEU A N     1 
ATOM   1238 C  CA    . LEU A 1 185 ? -6.327  2.830   -55.019 1.00 27.99  ? 165 LEU A CA    1 
ATOM   1239 C  C     . LEU A 1 185 ? -5.395  2.905   -56.191 1.00 27.31  ? 165 LEU A C     1 
ATOM   1240 O  O     . LEU A 1 185 ? -5.845  2.938   -57.328 1.00 26.18  ? 165 LEU A O     1 
ATOM   1241 C  CB    . LEU A 1 185 ? -6.945  4.209   -54.780 1.00 28.32  ? 165 LEU A CB    1 
ATOM   1242 C  CG    . LEU A 1 185 ? -8.048  4.234   -53.715 1.00 28.41  ? 165 LEU A CG    1 
ATOM   1243 C  CD1   . LEU A 1 185 ? -8.328  5.656   -53.264 1.00 27.76  ? 165 LEU A CD1   1 
ATOM   1244 C  CD2   . LEU A 1 185 ? -9.309  3.552   -54.218 1.00 27.14  ? 165 LEU A CD2   1 
ATOM   1245 N  N     . GLY A 1 186 ? -4.097  2.958   -55.916 1.00 28.55  ? 166 GLY A N     1 
ATOM   1246 C  CA    . GLY A 1 186 ? -3.081  2.802   -56.957 1.00 29.83  ? 166 GLY A CA    1 
ATOM   1247 C  C     . GLY A 1 186 ? -3.230  1.509   -57.749 1.00 30.30  ? 166 GLY A C     1 
ATOM   1248 O  O     . GLY A 1 186 ? -2.967  1.478   -58.953 1.00 30.96  ? 166 GLY A O     1 
ATOM   1249 N  N     . GLN A 1 187 ? -3.689  0.447   -57.096 1.00 33.09  ? 167 GLN A N     1 
ATOM   1250 C  CA    . GLN A 1 187 ? -3.927  -0.839  -57.798 1.00 33.66  ? 167 GLN A CA    1 
ATOM   1251 C  C     . GLN A 1 187 ? -4.989  -0.649  -58.881 1.00 37.13  ? 167 GLN A C     1 
ATOM   1252 O  O     . GLN A 1 187 ? -4.881  -1.188  -59.993 1.00 37.93  ? 167 GLN A O     1 
ATOM   1253 C  CB    . GLN A 1 187 ? -4.386  -1.925  -56.829 1.00 32.95  ? 167 GLN A CB    1 
ATOM   1254 C  CG    . GLN A 1 187 ? -3.444  -2.204  -55.655 1.00 33.05  ? 167 GLN A CG    1 
ATOM   1255 C  CD    . GLN A 1 187 ? -4.115  -2.971  -54.515 1.00 33.58  ? 167 GLN A CD    1 
ATOM   1256 O  OE1   . GLN A 1 187 ? -5.173  -3.569  -54.690 1.00 36.54  ? 167 GLN A OE1   1 
ATOM   1257 N  NE2   . GLN A 1 187 ? -3.483  -2.975  -53.352 1.00 34.46  ? 167 GLN A NE2   1 
ATOM   1258 N  N     . LEU A 1 188 ? -6.014  0.134   -58.553 1.00 37.27  ? 168 LEU A N     1 
ATOM   1259 C  CA    . LEU A 1 188 ? -7.050  0.469   -59.519 1.00 39.28  ? 168 LEU A CA    1 
ATOM   1260 C  C     . LEU A 1 188 ? -6.425  1.217   -60.675 1.00 38.05  ? 168 LEU A C     1 
ATOM   1261 O  O     . LEU A 1 188 ? -6.766  0.993   -61.838 1.00 35.66  ? 168 LEU A O     1 
ATOM   1262 C  CB    . LEU A 1 188 ? -8.121  1.356   -58.880 1.00 42.38  ? 168 LEU A CB    1 
ATOM   1263 C  CG    . LEU A 1 188 ? -9.582  1.171   -59.289 1.00 46.46  ? 168 LEU A CG    1 
ATOM   1264 C  CD1   . LEU A 1 188 ? -10.379 2.431   -58.975 1.00 45.24  ? 168 LEU A CD1   1 
ATOM   1265 C  CD2   . LEU A 1 188 ? -9.744  0.826   -60.755 1.00 48.76  ? 168 LEU A CD2   1 
ATOM   1266 N  N     . ARG A 1 189 ? -5.509  2.123   -60.343 1.00 38.82  ? 169 ARG A N     1 
ATOM   1267 C  CA    . ARG A 1 189 ? -4.884  2.968   -61.353 1.00 40.17  ? 169 ARG A CA    1 
ATOM   1268 C  C     . ARG A 1 189 ? -4.120  2.127   -62.392 1.00 39.31  ? 169 ARG A C     1 
ATOM   1269 O  O     . ARG A 1 189 ? -4.226  2.356   -63.605 1.00 36.63  ? 169 ARG A O     1 
ATOM   1270 C  CB    . ARG A 1 189 ? -3.971  4.029   -60.700 1.00 38.84  ? 169 ARG A CB    1 
ATOM   1271 C  CG    . ARG A 1 189 ? -3.936  5.350   -61.452 1.00 35.73  ? 169 ARG A CG    1 
ATOM   1272 C  CD    . ARG A 1 189 ? -2.926  5.343   -62.581 1.00 35.22  ? 169 ARG A CD    1 
ATOM   1273 N  NE    . ARG A 1 189 ? -3.167  6.451   -63.505 1.00 34.14  ? 169 ARG A NE    1 
ATOM   1274 C  CZ    . ARG A 1 189 ? -4.045  6.418   -64.503 1.00 35.31  ? 169 ARG A CZ    1 
ATOM   1275 N  NH1   . ARG A 1 189 ? -4.759  5.317   -64.757 1.00 36.00  ? 169 ARG A NH1   1 
ATOM   1276 N  NH2   . ARG A 1 189 ? -4.211  7.487   -65.266 1.00 35.17  ? 169 ARG A NH2   1 
ATOM   1277 N  N     . ALA A 1 190 ? -3.376  1.144   -61.905 1.00 38.37  ? 170 ALA A N     1 
ATOM   1278 C  CA    . ALA A 1 190 ? -2.603  0.258   -62.774 1.00 37.64  ? 170 ALA A CA    1 
ATOM   1279 C  C     . ALA A 1 190 ? -3.499  -0.672  -63.617 1.00 39.57  ? 170 ALA A C     1 
ATOM   1280 O  O     . ALA A 1 190 ? -3.161  -1.014  -64.743 1.00 41.16  ? 170 ALA A O     1 
ATOM   1281 C  CB    . ALA A 1 190 ? -1.647  -0.559  -61.926 1.00 37.13  ? 170 ALA A CB    1 
ATOM   1282 N  N     . ARG A 1 191 ? -4.642  -1.076  -63.072 1.00 38.68  ? 171 ARG A N     1 
ATOM   1283 C  CA    . ARG A 1 191 ? -5.609  -1.871  -63.834 1.00 42.81  ? 171 ARG A CA    1 
ATOM   1284 C  C     . ARG A 1 191 ? -6.225  -1.099  -65.005 1.00 39.43  ? 171 ARG A C     1 
ATOM   1285 O  O     . ARG A 1 191 ? -6.618  -1.708  -65.984 1.00 41.60  ? 171 ARG A O     1 
ATOM   1286 C  CB    . ARG A 1 191 ? -6.725  -2.391  -62.913 1.00 48.88  ? 171 ARG A CB    1 
ATOM   1287 C  CG    . ARG A 1 191 ? -7.676  -3.402  -63.554 1.00 54.72  ? 171 ARG A CG    1 
ATOM   1288 C  CD    . ARG A 1 191 ? -7.115  -4.813  -63.534 1.00 58.35  ? 171 ARG A CD    1 
ATOM   1289 N  NE    . ARG A 1 191 ? -7.127  -5.346  -62.168 1.00 62.52  ? 171 ARG A NE    1 
ATOM   1290 C  CZ    . ARG A 1 191 ? -8.041  -6.179  -61.668 1.00 60.83  ? 171 ARG A CZ    1 
ATOM   1291 N  NH1   . ARG A 1 191 ? -9.061  -6.624  -62.409 1.00 60.30  ? 171 ARG A NH1   1 
ATOM   1292 N  NH2   . ARG A 1 191 ? -7.931  -6.575  -60.404 1.00 59.02  ? 171 ARG A NH2   1 
ATOM   1293 N  N     . PHE A 1 192 ? -6.300  0.227   -64.906 1.00 37.79  ? 172 PHE A N     1 
ATOM   1294 C  CA    . PHE A 1 192 ? -6.951  1.056   -65.922 1.00 37.41  ? 172 PHE A CA    1 
ATOM   1295 C  C     . PHE A 1 192 ? -6.067  2.198   -66.420 1.00 37.10  ? 172 PHE A C     1 
ATOM   1296 O  O     . PHE A 1 192 ? -6.420  3.372   -66.295 1.00 35.82  ? 172 PHE A O     1 
ATOM   1297 C  CB    . PHE A 1 192 ? -8.253  1.609   -65.363 1.00 37.62  ? 172 PHE A CB    1 
ATOM   1298 C  CG    . PHE A 1 192 ? -9.260  0.556   -65.076 1.00 37.73  ? 172 PHE A CG    1 
ATOM   1299 C  CD1   . PHE A 1 192 ? -10.036 0.030   -66.092 1.00 38.79  ? 172 PHE A CD1   1 
ATOM   1300 C  CD2   . PHE A 1 192 ? -9.412  0.071   -63.795 1.00 39.77  ? 172 PHE A CD2   1 
ATOM   1301 C  CE1   . PHE A 1 192 ? -10.955 -0.962  -65.830 1.00 40.24  ? 172 PHE A CE1   1 
ATOM   1302 C  CE2   . PHE A 1 192 ? -10.327 -0.924  -63.520 1.00 40.13  ? 172 PHE A CE2   1 
ATOM   1303 C  CZ    . PHE A 1 192 ? -11.097 -1.446  -64.547 1.00 40.46  ? 172 PHE A CZ    1 
ATOM   1304 N  N     . PRO A 1 193 ? -4.939  1.851   -67.046 1.00 38.71  ? 173 PRO A N     1 
ATOM   1305 C  CA    . PRO A 1 193 ? -3.911  2.844   -67.377 1.00 38.19  ? 173 PRO A CA    1 
ATOM   1306 C  C     . PRO A 1 193 ? -4.388  3.906   -68.351 1.00 36.49  ? 173 PRO A C     1 
ATOM   1307 O  O     . PRO A 1 193 ? -3.842  5.000   -68.391 1.00 37.75  ? 173 PRO A O     1 
ATOM   1308 C  CB    . PRO A 1 193 ? -2.803  2.005   -68.023 1.00 39.81  ? 173 PRO A CB    1 
ATOM   1309 C  CG    . PRO A 1 193 ? -3.523  0.823   -68.623 1.00 41.27  ? 173 PRO A CG    1 
ATOM   1310 C  CD    . PRO A 1 193 ? -4.732  0.569   -67.762 1.00 40.68  ? 173 PRO A CD    1 
ATOM   1311 N  N     . ALA A 1 194 ? -5.403  3.597   -69.132 1.00 33.96  ? 174 ALA A N     1 
ATOM   1312 C  CA    . ALA A 1 194 ? -5.873  4.541   -70.110 1.00 33.65  ? 174 ALA A CA    1 
ATOM   1313 C  C     . ALA A 1 194 ? -6.943  5.505   -69.551 1.00 32.03  ? 174 ALA A C     1 
ATOM   1314 O  O     . ALA A 1 194 ? -7.335  6.435   -70.239 1.00 32.19  ? 174 ALA A O     1 
ATOM   1315 C  CB    . ALA A 1 194 ? -6.396  3.789   -71.332 1.00 33.23  ? 174 ALA A CB    1 
ATOM   1316 N  N     . VAL A 1 195 ? -7.409  5.324   -68.319 1.00 30.49  ? 175 VAL A N     1 
ATOM   1317 C  CA    . VAL A 1 195 ? -8.405  6.282   -67.786 1.00 30.37  ? 175 VAL A CA    1 
ATOM   1318 C  C     . VAL A 1 195 ? -7.711  7.299   -66.863 1.00 27.63  ? 175 VAL A C     1 
ATOM   1319 O  O     . VAL A 1 195 ? -6.982  6.919   -65.964 1.00 27.62  ? 175 VAL A O     1 
ATOM   1320 C  CB    . VAL A 1 195 ? -9.679  5.606   -67.155 1.00 31.36  ? 175 VAL A CB    1 
ATOM   1321 C  CG1   . VAL A 1 195 ? -9.872  4.176   -67.662 1.00 31.97  ? 175 VAL A CG1   1 
ATOM   1322 C  CG2   . VAL A 1 195 ? -9.678  5.615   -65.646 1.00 30.58  ? 175 VAL A CG2   1 
ATOM   1323 N  N     . PRO A 1 196 ? -7.914  8.602   -67.112 1.00 26.69  ? 176 PRO A N     1 
ATOM   1324 C  CA    . PRO A 1 196 ? -7.292  9.619   -66.291 1.00 25.67  ? 176 PRO A CA    1 
ATOM   1325 C  C     . PRO A 1 196 ? -7.805  9.598   -64.869 1.00 24.17  ? 176 PRO A C     1 
ATOM   1326 O  O     . PRO A 1 196 ? -8.987  9.282   -64.621 1.00 23.65  ? 176 PRO A O     1 
ATOM   1327 C  CB    . PRO A 1 196 ? -7.699  10.929  -66.958 1.00 27.29  ? 176 PRO A CB    1 
ATOM   1328 C  CG    . PRO A 1 196 ? -8.916  10.629  -67.711 1.00 28.02  ? 176 PRO A CG    1 
ATOM   1329 C  CD    . PRO A 1 196 ? -8.926  9.164   -68.022 1.00 28.76  ? 176 PRO A CD    1 
ATOM   1330 N  N     . PHE A 1 197 ? -6.900  9.896   -63.952 1.00 21.65  ? 177 PHE A N     1 
ATOM   1331 C  CA    . PHE A 1 197 ? -7.196  9.942   -62.540 1.00 21.91  ? 177 PHE A CA    1 
ATOM   1332 C  C     . PHE A 1 197 ? -6.986  11.380  -62.052 1.00 23.40  ? 177 PHE A C     1 
ATOM   1333 O  O     . PHE A 1 197 ? -6.055  12.068  -62.461 1.00 22.75  ? 177 PHE A O     1 
ATOM   1334 C  CB    . PHE A 1 197 ? -6.291  8.989   -61.763 1.00 22.25  ? 177 PHE A CB    1 
ATOM   1335 C  CG    . PHE A 1 197 ? -6.855  7.608   -61.607 1.00 22.48  ? 177 PHE A CG    1 
ATOM   1336 C  CD1   . PHE A 1 197 ? -7.292  6.894   -62.710 1.00 23.77  ? 177 PHE A CD1   1 
ATOM   1337 C  CD2   . PHE A 1 197 ? -6.926  7.019   -60.360 1.00 22.75  ? 177 PHE A CD2   1 
ATOM   1338 C  CE1   . PHE A 1 197 ? -7.812  5.627   -62.563 1.00 24.55  ? 177 PHE A CE1   1 
ATOM   1339 C  CE2   . PHE A 1 197 ? -7.458  5.761   -60.194 1.00 23.19  ? 177 PHE A CE2   1 
ATOM   1340 C  CZ    . PHE A 1 197 ? -7.895  5.060   -61.298 1.00 24.46  ? 177 PHE A CZ    1 
ATOM   1341 N  N     . MET A 1 198 ? -7.876  11.827  -61.181 1.00 25.46  ? 178 MET A N     1 
ATOM   1342 C  CA    . MET A 1 198 ? -7.824  13.177  -60.643 1.00 27.44  ? 178 MET A CA    1 
ATOM   1343 C  C     . MET A 1 198 ? -7.933  13.050  -59.110 1.00 26.26  ? 178 MET A C     1 
ATOM   1344 O  O     . MET A 1 198 ? -8.777  12.312  -58.596 1.00 27.34  ? 178 MET A O     1 
ATOM   1345 C  CB    . MET A 1 198 ? -8.933  14.012  -61.274 1.00 29.54  ? 178 MET A CB    1 
ATOM   1346 C  CG    . MET A 1 198 ? -9.016  15.433  -60.769 1.00 38.77  ? 178 MET A CG    1 
ATOM   1347 S  SD    . MET A 1 198 ? -10.057 16.523  -61.789 1.00 44.36  ? 178 MET A SD    1 
ATOM   1348 C  CE    . MET A 1 198 ? -9.431  18.029  -61.127 1.00 46.89  ? 178 MET A CE    1 
ATOM   1349 N  N     . ALA A 1 199 ? -7.014  13.686  -58.394 1.00 23.23  ? 179 ALA A N     1 
ATOM   1350 C  CA    . ALA A 1 199 ? -7.081  13.784  -56.963 1.00 22.84  ? 179 ALA A CA    1 
ATOM   1351 C  C     . ALA A 1 199 ? -7.312  15.258  -56.568 1.00 21.81  ? 179 ALA A C     1 
ATOM   1352 O  O     . ALA A 1 199 ? -6.632  16.149  -57.087 1.00 22.49  ? 179 ALA A O     1 
ATOM   1353 C  CB    . ALA A 1 199 ? -5.786  13.268  -56.375 1.00 24.38  ? 179 ALA A CB    1 
ATOM   1354 N  N     . LEU A 1 200 ? -8.265  15.512  -55.674 1.00 21.44  ? 180 LEU A N     1 
ATOM   1355 C  CA    . LEU A 1 200 ? -8.583  16.893  -55.191 1.00 22.21  ? 180 LEU A CA    1 
ATOM   1356 C  C     . LEU A 1 200 ? -8.549  16.958  -53.697 1.00 21.51  ? 180 LEU A C     1 
ATOM   1357 O  O     . LEU A 1 200 ? -8.996  16.042  -53.035 1.00 22.26  ? 180 LEU A O     1 
ATOM   1358 C  CB    . LEU A 1 200 ? -9.968  17.351  -55.608 1.00 21.33  ? 180 LEU A CB    1 
ATOM   1359 C  CG    . LEU A 1 200 ? -10.237 17.152  -57.080 1.00 23.19  ? 180 LEU A CG    1 
ATOM   1360 C  CD1   . LEU A 1 200 ? -10.900 15.797  -57.336 1.00 23.57  ? 180 LEU A CD1   1 
ATOM   1361 C  CD2   . LEU A 1 200 ? -11.107 18.293  -57.587 1.00 23.65  ? 180 LEU A CD2   1 
ATOM   1362 N  N     . THR A 1 201 ? -8.039  18.049  -53.174 1.00 21.98  ? 181 THR A N     1 
ATOM   1363 C  CA    . THR A 1 201 ? -7.989  18.266  -51.745 1.00 24.56  ? 181 THR A CA    1 
ATOM   1364 C  C     . THR A 1 201 ? -7.907  19.757  -51.444 1.00 25.02  ? 181 THR A C     1 
ATOM   1365 O  O     . THR A 1 201 ? -7.573  20.571  -52.303 1.00 26.80  ? 181 THR A O     1 
ATOM   1366 C  CB    . THR A 1 201 ? -6.809  17.500  -51.086 1.00 26.11  ? 181 THR A CB    1 
ATOM   1367 O  OG1   . THR A 1 201 ? -6.727  17.821  -49.701 1.00 28.73  ? 181 THR A OG1   1 
ATOM   1368 C  CG2   . THR A 1 201 ? -5.502  17.848  -51.700 1.00 27.06  ? 181 THR A CG2   1 
ATOM   1369 N  N     . ALA A 1 202 ? -8.269  20.116  -50.227 1.00 26.34  ? 182 ALA A N     1 
ATOM   1370 C  CA    . ALA A 1 202 ? -8.197  21.485  -49.788 1.00 28.34  ? 182 ALA A CA    1 
ATOM   1371 C  C     . ALA A 1 202 ? -6.968  21.720  -48.942 1.00 28.97  ? 182 ALA A C     1 
ATOM   1372 O  O     . ALA A 1 202 ? -6.523  22.830  -48.851 1.00 33.82  ? 182 ALA A O     1 
ATOM   1373 C  CB    . ALA A 1 202 ? -9.452  21.865  -49.016 1.00 28.63  ? 182 ALA A CB    1 
ATOM   1374 N  N     . THR A 1 203 ? -6.412  20.694  -48.318 1.00 30.61  ? 183 THR A N     1 
ATOM   1375 C  CA    . THR A 1 203 ? -5.251  20.886  -47.453 1.00 32.27  ? 183 THR A CA    1 
ATOM   1376 C  C     . THR A 1 203 ? -4.238  19.802  -47.739 1.00 30.40  ? 183 THR A C     1 
ATOM   1377 O  O     . THR A 1 203 ? -4.516  18.622  -47.537 1.00 33.37  ? 183 THR A O     1 
ATOM   1378 C  CB    . THR A 1 203 ? -5.659  20.838  -45.963 1.00 36.61  ? 183 THR A CB    1 
ATOM   1379 O  OG1   . THR A 1 203 ? -6.696  21.803  -45.722 1.00 42.01  ? 183 THR A OG1   1 
ATOM   1380 C  CG2   . THR A 1 203 ? -4.481  21.144  -45.048 1.00 36.07  ? 183 THR A CG2   1 
ATOM   1381 N  N     . ALA A 1 204 ? -3.076  20.190  -48.237 1.00 27.51  ? 184 ALA A N     1 
ATOM   1382 C  CA    . ALA A 1 204 ? -2.003  19.233  -48.480 1.00 26.12  ? 184 ALA A CA    1 
ATOM   1383 C  C     . ALA A 1 204 ? -0.665  19.941  -48.531 1.00 26.63  ? 184 ALA A C     1 
ATOM   1384 O  O     . ALA A 1 204 ? -0.459  20.801  -49.391 1.00 26.88  ? 184 ALA A O     1 
ATOM   1385 C  CB    . ALA A 1 204 ? -2.248  18.486  -49.761 1.00 25.49  ? 184 ALA A CB    1 
ATOM   1386 N  N     . ASP A 1 205 ? 0.231   19.624  -47.602 1.00 25.09  ? 185 ASP A N     1 
ATOM   1387 C  CA    . ASP A 1 205 ? 1.613   20.118  -47.732 1.00 28.02  ? 185 ASP A CA    1 
ATOM   1388 C  C     . ASP A 1 205 ? 2.357   19.314  -48.786 1.00 26.93  ? 185 ASP A C     1 
ATOM   1389 O  O     . ASP A 1 205 ? 1.787   18.422  -49.416 1.00 25.80  ? 185 ASP A O     1 
ATOM   1390 C  CB    . ASP A 1 205 ? 2.375   20.159  -46.399 1.00 28.54  ? 185 ASP A CB    1 
ATOM   1391 C  CG    . ASP A 1 205 ? 2.439   18.822  -45.704 1.00 31.43  ? 185 ASP A CG    1 
ATOM   1392 O  OD1   . ASP A 1 205 ? 2.378   17.778  -46.388 1.00 31.81  ? 185 ASP A OD1   1 
ATOM   1393 O  OD2   . ASP A 1 205 ? 2.532   18.833  -44.448 1.00 33.85  ? 185 ASP A OD2   1 
ATOM   1394 N  N     . ASP A 1 206 ? 3.619   19.646  -48.990 1.00 29.13  ? 186 ASP A N     1 
ATOM   1395 C  CA    . ASP A 1 206 ? 4.432   18.963  -49.989 1.00 30.89  ? 186 ASP A CA    1 
ATOM   1396 C  C     . ASP A 1 206 ? 4.537   17.445  -49.783 1.00 29.51  ? 186 ASP A C     1 
ATOM   1397 O  O     . ASP A 1 206 ? 4.453   16.660  -50.730 1.00 29.07  ? 186 ASP A O     1 
ATOM   1398 C  CB    . ASP A 1 206 ? 5.825   19.561  -50.022 1.00 33.47  ? 186 ASP A CB    1 
ATOM   1399 C  CG    . ASP A 1 206 ? 6.694   18.893  -51.047 1.00 38.25  ? 186 ASP A CG    1 
ATOM   1400 O  OD1   . ASP A 1 206 ? 6.352   18.945  -52.257 1.00 45.33  ? 186 ASP A OD1   1 
ATOM   1401 O  OD2   . ASP A 1 206 ? 7.687   18.270  -50.638 1.00 43.21  ? 186 ASP A OD2   1 
ATOM   1402 N  N     . THR A 1 207 ? 4.730   17.047  -48.541 1.00 29.09  ? 187 THR A N     1 
ATOM   1403 C  CA    . THR A 1 207 ? 4.765   15.650  -48.164 1.00 30.63  ? 187 THR A CA    1 
ATOM   1404 C  C     . THR A 1 207 ? 3.464   14.915  -48.516 1.00 30.05  ? 187 THR A C     1 
ATOM   1405 O  O     . THR A 1 207 ? 3.475   13.782  -49.027 1.00 31.17  ? 187 THR A O     1 
ATOM   1406 C  CB    . THR A 1 207 ? 4.988   15.558  -46.652 1.00 32.17  ? 187 THR A CB    1 
ATOM   1407 O  OG1   . THR A 1 207 ? 6.164   16.314  -46.320 1.00 35.51  ? 187 THR A OG1   1 
ATOM   1408 C  CG2   . THR A 1 207 ? 5.159   14.129  -46.207 1.00 33.92  ? 187 THR A CG2   1 
ATOM   1409 N  N     . THR A 1 208 ? 2.335   15.544  -48.238 1.00 26.55  ? 188 THR A N     1 
ATOM   1410 C  CA    . THR A 1 208 ? 1.070   14.909  -48.552 1.00 24.64  ? 188 THR A CA    1 
ATOM   1411 C  C     . THR A 1 208 ? 0.862   14.859  -50.067 1.00 23.82  ? 188 THR A C     1 
ATOM   1412 O  O     . THR A 1 208 ? 0.355   13.895  -50.594 1.00 22.27  ? 188 THR A O     1 
ATOM   1413 C  CB    . THR A 1 208 ? -0.064  15.642  -47.831 1.00 23.62  ? 188 THR A CB    1 
ATOM   1414 O  OG1   . THR A 1 208 ? 0.166   15.541  -46.427 1.00 22.07  ? 188 THR A OG1   1 
ATOM   1415 C  CG2   . THR A 1 208 ? -1.423  15.052  -48.165 1.00 24.03  ? 188 THR A CG2   1 
ATOM   1416 N  N     . ARG A 1 209 ? 1.271   15.898  -50.774 1.00 25.06  ? 189 ARG A N     1 
ATOM   1417 C  CA    . ARG A 1 209 ? 1.112   15.910  -52.216 1.00 26.16  ? 189 ARG A CA    1 
ATOM   1418 C  C     . ARG A 1 209 ? 1.881   14.776  -52.850 1.00 27.42  ? 189 ARG A C     1 
ATOM   1419 O  O     . ARG A 1 209 ? 1.329   14.006  -53.635 1.00 28.39  ? 189 ARG A O     1 
ATOM   1420 C  CB    . ARG A 1 209 ? 1.600   17.212  -52.786 1.00 27.09  ? 189 ARG A CB    1 
ATOM   1421 C  CG    . ARG A 1 209 ? 0.653   18.373  -52.582 1.00 29.11  ? 189 ARG A CG    1 
ATOM   1422 C  CD    . ARG A 1 209 ? 1.301   19.665  -53.097 1.00 32.46  ? 189 ARG A CD    1 
ATOM   1423 N  NE    . ARG A 1 209 ? 1.203   20.647  -52.022 1.00 36.04  ? 189 ARG A NE    1 
ATOM   1424 C  CZ    . ARG A 1 209 ? 2.103   21.556  -51.723 1.00 37.54  ? 189 ARG A CZ    1 
ATOM   1425 N  NH1   . ARG A 1 209 ? 3.195   21.689  -52.459 1.00 42.02  ? 189 ARG A NH1   1 
ATOM   1426 N  NH2   . ARG A 1 209 ? 1.889   22.352  -50.676 1.00 40.69  ? 189 ARG A NH2   1 
ATOM   1427 N  N     . ARG A 1 210 ? 3.150   14.659  -52.481 1.00 27.74  ? 190 ARG A N     1 
ATOM   1428 C  CA    . ARG A 1 210 ? 3.998   13.621  -53.013 1.00 29.22  ? 190 ARG A CA    1 
ATOM   1429 C  C     . ARG A 1 210 ? 3.453   12.251  -52.644 1.00 27.48  ? 190 ARG A C     1 
ATOM   1430 O  O     . ARG A 1 210 ? 3.528   11.314  -53.447 1.00 26.27  ? 190 ARG A O     1 
ATOM   1431 C  CB    . ARG A 1 210 ? 5.432   13.771  -52.494 1.00 32.74  ? 190 ARG A CB    1 
ATOM   1432 C  CG    . ARG A 1 210 ? 6.164   14.977  -53.059 1.00 36.15  ? 190 ARG A CG    1 
ATOM   1433 C  CD    . ARG A 1 210 ? 7.536   15.202  -52.409 1.00 40.16  ? 190 ARG A CD    1 
ATOM   1434 N  NE    . ARG A 1 210 ? 8.128   16.462  -52.886 1.00 46.08  ? 190 ARG A NE    1 
ATOM   1435 C  CZ    . ARG A 1 210 ? 8.633   16.657  -54.113 1.00 50.71  ? 190 ARG A CZ    1 
ATOM   1436 N  NH1   . ARG A 1 210 ? 8.662   15.672  -55.014 1.00 51.12  ? 190 ARG A NH1   1 
ATOM   1437 N  NH2   . ARG A 1 210 ? 9.120   17.856  -54.446 1.00 52.31  ? 190 ARG A NH2   1 
ATOM   1438 N  N     . ASP A 1 211 ? 2.912   12.128  -51.436 1.00 25.97  ? 191 ASP A N     1 
ATOM   1439 C  CA    . ASP A 1 211 ? 2.361   10.855  -50.992 1.00 28.79  ? 191 ASP A CA    1 
ATOM   1440 C  C     . ASP A 1 211 ? 1.142   10.479  -51.817 1.00 28.76  ? 191 ASP A C     1 
ATOM   1441 O  O     . ASP A 1 211 ? 0.912   9.282   -52.075 1.00 28.29  ? 191 ASP A O     1 
ATOM   1442 C  CB    . ASP A 1 211 ? 1.991   10.870  -49.506 1.00 31.58  ? 191 ASP A CB    1 
ATOM   1443 C  CG    . ASP A 1 211 ? 1.903   9.460   -48.892 1.00 36.62  ? 191 ASP A CG    1 
ATOM   1444 O  OD1   . ASP A 1 211 ? 2.504   8.512   -49.462 1.00 41.50  ? 191 ASP A OD1   1 
ATOM   1445 O  OD2   . ASP A 1 211 ? 1.266   9.306   -47.807 1.00 38.47  ? 191 ASP A OD2   1 
ATOM   1446 N  N     . ILE A 1 212 ? 0.366   11.485  -52.232 1.00 26.38  ? 192 ILE A N     1 
ATOM   1447 C  CA    . ILE A 1 212 ? -0.831  11.227  -53.029 1.00 26.99  ? 192 ILE A CA    1 
ATOM   1448 C  C     . ILE A 1 212 ? -0.434  10.746  -54.426 1.00 26.87  ? 192 ILE A C     1 
ATOM   1449 O  O     . ILE A 1 212 ? -0.969  9.754   -54.928 1.00 27.74  ? 192 ILE A O     1 
ATOM   1450 C  CB    . ILE A 1 212 ? -1.740  12.482  -53.133 1.00 26.51  ? 192 ILE A CB    1 
ATOM   1451 C  CG1   . ILE A 1 212 ? -2.417  12.766  -51.785 1.00 25.70  ? 192 ILE A CG1   1 
ATOM   1452 C  CG2   . ILE A 1 212 ? -2.799  12.306  -54.219 1.00 25.52  ? 192 ILE A CG2   1 
ATOM   1453 C  CD1   . ILE A 1 212 ? -3.071  14.125  -51.732 1.00 26.09  ? 192 ILE A CD1   1 
ATOM   1454 N  N     . VAL A 1 213 ? 0.506   11.447  -55.041 1.00 26.30  ? 193 VAL A N     1 
ATOM   1455 C  CA    . VAL A 1 213 ? 1.024   11.066  -56.362 1.00 27.98  ? 193 VAL A CA    1 
ATOM   1456 C  C     . VAL A 1 213 ? 1.525   9.614   -56.341 1.00 28.68  ? 193 VAL A C     1 
ATOM   1457 O  O     . VAL A 1 213 ? 1.118   8.795   -57.145 1.00 32.21  ? 193 VAL A O     1 
ATOM   1458 C  CB    . VAL A 1 213 ? 2.154   12.021  -56.800 1.00 28.37  ? 193 VAL A CB    1 
ATOM   1459 C  CG1   . VAL A 1 213 ? 2.805   11.546  -58.086 1.00 28.18  ? 193 VAL A CG1   1 
ATOM   1460 C  CG2   . VAL A 1 213 ? 1.607   13.424  -56.985 1.00 29.06  ? 193 VAL A CG2   1 
ATOM   1461 N  N     . ARG A 1 214 ? 2.363   9.301   -55.370 1.00 29.44  ? 194 ARG A N     1 
ATOM   1462 C  CA    . ARG A 1 214 ? 2.926   7.962   -55.199 1.00 32.00  ? 194 ARG A CA    1 
ATOM   1463 C  C     . ARG A 1 214 ? 1.853   6.859   -55.005 1.00 31.59  ? 194 ARG A C     1 
ATOM   1464 O  O     . ARG A 1 214 ? 1.805   5.872   -55.737 1.00 31.51  ? 194 ARG A O     1 
ATOM   1465 C  CB    . ARG A 1 214 ? 3.862   7.982   -53.973 1.00 32.72  ? 194 ARG A CB    1 
ATOM   1466 C  CG    . ARG A 1 214 ? 5.076   7.116   -54.119 1.00 35.97  ? 194 ARG A CG    1 
ATOM   1467 C  CD    . ARG A 1 214 ? 5.966   7.219   -52.885 1.00 38.97  ? 194 ARG A CD    1 
ATOM   1468 N  NE    . ARG A 1 214 ? 6.792   8.440   -52.865 1.00 41.37  ? 194 ARG A NE    1 
ATOM   1469 C  CZ    . ARG A 1 214 ? 6.697   9.444   -51.981 1.00 41.46  ? 194 ARG A CZ    1 
ATOM   1470 N  NH1   . ARG A 1 214 ? 5.792   9.435   -50.997 1.00 41.42  ? 194 ARG A NH1   1 
ATOM   1471 N  NH2   . ARG A 1 214 ? 7.533   10.475  -52.077 1.00 40.46  ? 194 ARG A NH2   1 
ATOM   1472 N  N     . LEU A 1 215 ? 1.004   7.033   -53.999 1.00 31.06  ? 195 LEU A N     1 
ATOM   1473 C  CA    . LEU A 1 215 ? 0.066   5.996   -53.601 1.00 30.28  ? 195 LEU A CA    1 
ATOM   1474 C  C     . LEU A 1 215 ? -1.048  5.806   -54.589 1.00 29.49  ? 195 LEU A C     1 
ATOM   1475 O  O     . LEU A 1 215 ? -1.648  4.726   -54.667 1.00 33.64  ? 195 LEU A O     1 
ATOM   1476 C  CB    . LEU A 1 215 ? -0.508  6.295   -52.233 1.00 29.53  ? 195 LEU A CB    1 
ATOM   1477 C  CG    . LEU A 1 215 ? 0.526   6.173   -51.118 1.00 30.75  ? 195 LEU A CG    1 
ATOM   1478 C  CD1   . LEU A 1 215 ? -0.079  6.672   -49.819 1.00 32.23  ? 195 LEU A CD1   1 
ATOM   1479 C  CD2   . LEU A 1 215 ? 0.988   4.736   -50.944 1.00 30.36  ? 195 LEU A CD2   1 
ATOM   1480 N  N     . LEU A 1 216 ? -1.324  6.837   -55.357 1.00 29.01  ? 196 LEU A N     1 
ATOM   1481 C  CA    . LEU A 1 216 ? -2.408  6.770   -56.312 1.00 31.85  ? 196 LEU A CA    1 
ATOM   1482 C  C     . LEU A 1 216 ? -1.873  6.458   -57.699 1.00 32.67  ? 196 LEU A C     1 
ATOM   1483 O  O     . LEU A 1 216 ? -2.657  6.185   -58.598 1.00 37.15  ? 196 LEU A O     1 
ATOM   1484 C  CB    . LEU A 1 216 ? -3.184  8.089   -56.298 1.00 32.32  ? 196 LEU A CB    1 
ATOM   1485 C  CG    . LEU A 1 216 ? -4.538  8.139   -56.963 1.00 33.36  ? 196 LEU A CG    1 
ATOM   1486 C  CD1   . LEU A 1 216 ? -5.485  7.142   -56.318 1.00 34.17  ? 196 LEU A CD1   1 
ATOM   1487 C  CD2   . LEU A 1 216 ? -5.093  9.551   -56.850 1.00 33.85  ? 196 LEU A CD2   1 
ATOM   1488 N  N     . GLY A 1 217 ? -0.552  6.483   -57.865 1.00 34.05  ? 197 GLY A N     1 
ATOM   1489 C  CA    . GLY A 1 217 ? 0.094   6.161   -59.142 1.00 34.34  ? 197 GLY A CA    1 
ATOM   1490 C  C     . GLY A 1 217 ? -0.214  7.176   -60.231 1.00 37.37  ? 197 GLY A C     1 
ATOM   1491 O  O     . GLY A 1 217 ? -0.369  6.810   -61.386 1.00 38.11  ? 197 GLY A O     1 
ATOM   1492 N  N     . LEU A 1 218 ? -0.310  8.457   -59.862 1.00 37.29  ? 198 LEU A N     1 
ATOM   1493 C  CA    . LEU A 1 218 ? -0.531  9.515   -60.843 1.00 37.54  ? 198 LEU A CA    1 
ATOM   1494 C  C     . LEU A 1 218 ? 0.696   9.614   -61.729 1.00 38.52  ? 198 LEU A C     1 
ATOM   1495 O  O     . LEU A 1 218 ? 1.816   9.558   -61.249 1.00 40.25  ? 198 LEU A O     1 
ATOM   1496 C  CB    . LEU A 1 218 ? -0.811  10.876  -60.161 1.00 35.46  ? 198 LEU A CB    1 
ATOM   1497 C  CG    . LEU A 1 218 ? -2.048  10.917  -59.239 1.00 35.18  ? 198 LEU A CG    1 
ATOM   1498 C  CD1   . LEU A 1 218 ? -2.382  12.332  -58.787 1.00 35.09  ? 198 LEU A CD1   1 
ATOM   1499 C  CD2   . LEU A 1 218 ? -3.246  10.290  -59.932 1.00 34.17  ? 198 LEU A CD2   1 
ATOM   1500 N  N     . ASP A 1 219 ? 0.460   9.794   -63.016 1.00 40.18  ? 199 ASP A N     1 
ATOM   1501 C  CA    . ASP A 1 219 ? 1.486   9.785   -64.026 1.00 40.89  ? 199 ASP A CA    1 
ATOM   1502 C  C     . ASP A 1 219 ? 1.810   11.209  -64.470 1.00 39.34  ? 199 ASP A C     1 
ATOM   1503 O  O     . ASP A 1 219 ? 1.013   11.851  -65.140 1.00 41.86  ? 199 ASP A O     1 
ATOM   1504 C  CB    . ASP A 1 219 ? 0.970   8.937   -65.200 1.00 45.52  ? 199 ASP A CB    1 
ATOM   1505 C  CG    . ASP A 1 219 ? 1.980   8.814   -66.343 1.00 47.60  ? 199 ASP A CG    1 
ATOM   1506 O  OD1   . ASP A 1 219 ? 3.199   9.082   -66.139 1.00 43.58  ? 199 ASP A OD1   1 
ATOM   1507 O  OD2   . ASP A 1 219 ? 1.522   8.444   -67.449 1.00 47.40  ? 199 ASP A OD2   1 
ATOM   1508 N  N     . ASP A 1 220 ? 2.986   11.702  -64.096 1.00 38.52  ? 200 ASP A N     1 
ATOM   1509 C  CA    . ASP A 1 220 ? 3.368   13.088  -64.336 1.00 38.92  ? 200 ASP A CA    1 
ATOM   1510 C  C     . ASP A 1 220 ? 2.173   14.061  -64.299 1.00 35.00  ? 200 ASP A C     1 
ATOM   1511 O  O     . ASP A 1 220 ? 1.904   14.756  -65.270 1.00 33.23  ? 200 ASP A O     1 
ATOM   1512 C  CB    . ASP A 1 220 ? 4.123   13.225  -65.671 1.00 44.59  ? 200 ASP A CB    1 
ATOM   1513 C  CG    . ASP A 1 220 ? 4.722   14.628  -65.871 1.00 52.76  ? 200 ASP A CG    1 
ATOM   1514 O  OD1   . ASP A 1 220 ? 5.255   15.198  -64.887 1.00 58.60  ? 200 ASP A OD1   1 
ATOM   1515 O  OD2   . ASP A 1 220 ? 4.640   15.175  -67.003 1.00 60.01  ? 200 ASP A OD2   1 
ATOM   1516 N  N     . PRO A 1 221 ? 1.480   14.146  -63.162 1.00 32.45  ? 201 PRO A N     1 
ATOM   1517 C  CA    . PRO A 1 221 ? 0.263   14.959  -63.142 1.00 32.24  ? 201 PRO A CA    1 
ATOM   1518 C  C     . PRO A 1 221 ? 0.486   16.466  -63.294 1.00 32.95  ? 201 PRO A C     1 
ATOM   1519 O  O     . PRO A 1 221 ? 1.513   16.985  -62.873 1.00 32.28  ? 201 PRO A O     1 
ATOM   1520 C  CB    . PRO A 1 221 ? -0.326  14.672  -61.755 1.00 32.86  ? 201 PRO A CB    1 
ATOM   1521 C  CG    . PRO A 1 221 ? 0.818   14.157  -60.929 1.00 32.64  ? 201 PRO A CG    1 
ATOM   1522 C  CD    . PRO A 1 221 ? 1.690   13.419  -61.900 1.00 32.93  ? 201 PRO A CD    1 
ATOM   1523 N  N     . LEU A 1 222 ? -0.479  17.139  -63.907 1.00 31.47  ? 202 LEU A N     1 
ATOM   1524 C  CA    . LEU A 1 222 ? -0.674  18.562  -63.696 1.00 34.52  ? 202 LEU A CA    1 
ATOM   1525 C  C     . LEU A 1 222 ? -0.932  18.778  -62.200 1.00 34.24  ? 202 LEU A C     1 
ATOM   1526 O  O     . LEU A 1 222 ? -1.877  18.215  -61.638 1.00 32.80  ? 202 LEU A O     1 
ATOM   1527 C  CB    . LEU A 1 222 ? -1.901  19.057  -64.463 1.00 36.44  ? 202 LEU A CB    1 
ATOM   1528 C  CG    . LEU A 1 222 ? -1.898  20.381  -65.235 1.00 41.42  ? 202 LEU A CG    1 
ATOM   1529 C  CD1   . LEU A 1 222 ? -3.241  21.094  -65.058 1.00 42.33  ? 202 LEU A CD1   1 
ATOM   1530 C  CD2   . LEU A 1 222 ? -0.738  21.308  -64.881 1.00 42.45  ? 202 LEU A CD2   1 
ATOM   1531 N  N     . ILE A 1 223 ? -0.089  19.569  -61.558 1.00 32.98  ? 203 ILE A N     1 
ATOM   1532 C  CA    . ILE A 1 223 ? -0.287  19.943  -60.166 1.00 34.53  ? 203 ILE A CA    1 
ATOM   1533 C  C     . ILE A 1 223 ? -0.665  21.417  -60.150 1.00 34.18  ? 203 ILE A C     1 
ATOM   1534 O  O     . ILE A 1 223 ? 0.075   22.236  -60.685 1.00 38.12  ? 203 ILE A O     1 
ATOM   1535 C  CB    . ILE A 1 223 ? 0.976   19.702  -59.312 1.00 34.28  ? 203 ILE A CB    1 
ATOM   1536 C  CG1   . ILE A 1 223 ? 1.449   18.263  -59.500 1.00 35.14  ? 203 ILE A CG1   1 
ATOM   1537 C  CG2   . ILE A 1 223 ? 0.681   19.974  -57.845 1.00 34.28  ? 203 ILE A CG2   1 
ATOM   1538 C  CD1   . ILE A 1 223 ? 2.466   17.771  -58.500 1.00 34.57  ? 203 ILE A CD1   1 
ATOM   1539 N  N     . GLU A 1 224 ? -1.837  21.730  -59.589 1.00 32.94  ? 204 GLU A N     1 
ATOM   1540 C  CA    . GLU A 1 224 ? -2.316  23.110  -59.427 1.00 32.06  ? 204 GLU A CA    1 
ATOM   1541 C  C     . GLU A 1 224 ? -2.679  23.381  -57.975 1.00 29.86  ? 204 GLU A C     1 
ATOM   1542 O  O     . GLU A 1 224 ? -3.555  22.712  -57.399 1.00 25.89  ? 204 GLU A O     1 
ATOM   1543 C  CB    . GLU A 1 224 ? -3.533  23.386  -60.305 1.00 35.17  ? 204 GLU A CB    1 
ATOM   1544 C  CG    . GLU A 1 224 ? -3.221  23.401  -61.791 1.00 42.14  ? 204 GLU A CG    1 
ATOM   1545 C  CD    . GLU A 1 224 ? -2.198  24.469  -62.176 1.00 46.95  ? 204 GLU A CD    1 
ATOM   1546 O  OE1   . GLU A 1 224 ? -2.155  25.524  -61.508 1.00 52.93  ? 204 GLU A OE1   1 
ATOM   1547 O  OE2   . GLU A 1 224 ? -1.437  24.255  -63.145 1.00 52.63  ? 204 GLU A OE2   1 
ATOM   1548 N  N     . ILE A 1 225 ? -2.007  24.383  -57.414 1.00 27.91  ? 205 ILE A N     1 
ATOM   1549 C  CA    . ILE A 1 225 ? -2.091  24.742  -56.007 1.00 27.47  ? 205 ILE A CA    1 
ATOM   1550 C  C     . ILE A 1 225 ? -2.483  26.195  -55.926 1.00 26.95  ? 205 ILE A C     1 
ATOM   1551 O  O     . ILE A 1 225 ? -1.775  27.061  -56.402 1.00 28.34  ? 205 ILE A O     1 
ATOM   1552 C  CB    . ILE A 1 225 ? -0.735  24.594  -55.286 1.00 27.71  ? 205 ILE A CB    1 
ATOM   1553 C  CG1   . ILE A 1 225 ? -0.131  23.197  -55.527 1.00 28.61  ? 205 ILE A CG1   1 
ATOM   1554 C  CG2   . ILE A 1 225 ? -0.899  24.851  -53.802 1.00 27.52  ? 205 ILE A CG2   1 
ATOM   1555 C  CD1   . ILE A 1 225 ? 1.295   23.059  -55.061 1.00 27.70  ? 205 ILE A CD1   1 
ATOM   1556 N  N     . SER A 1 226 ? -3.611  26.470  -55.296 1.00 27.25  ? 206 SER A N     1 
ATOM   1557 C  CA    . SER A 1 226 ? -4.028  27.837  -55.096 1.00 24.49  ? 206 SER A CA    1 
ATOM   1558 C  C     . SER A 1 226 ? -3.651  28.230  -53.685 1.00 23.10  ? 206 SER A C     1 
ATOM   1559 O  O     . SER A 1 226 ? -3.043  27.455  -52.947 1.00 23.34  ? 206 SER A O     1 
ATOM   1560 C  CB    . SER A 1 226 ? -5.526  27.964  -55.350 1.00 25.18  ? 206 SER A CB    1 
ATOM   1561 O  OG    . SER A 1 226 ? -6.243  27.089  -54.513 1.00 27.70  ? 206 SER A OG    1 
ATOM   1562 N  N     . SER A 1 227 ? -4.006  29.450  -53.324 1.00 22.16  ? 207 SER A N     1 
ATOM   1563 C  CA    . SER A 1 227 ? -3.510  30.098  -52.145 1.00 21.37  ? 207 SER A CA    1 
ATOM   1564 C  C     . SER A 1 227 ? -4.130  29.551  -50.875 1.00 21.36  ? 207 SER A C     1 
ATOM   1565 O  O     . SER A 1 227 ? -5.300  29.171  -50.859 1.00 21.21  ? 207 SER A O     1 
ATOM   1566 C  CB    . SER A 1 227 ? -3.797  31.606  -52.241 1.00 21.83  ? 207 SER A CB    1 
ATOM   1567 O  OG    . SER A 1 227 ? -3.463  32.251  -51.031 1.00 22.86  ? 207 SER A OG    1 
ATOM   1568 N  N     . PHE A 1 228 ? -3.331  29.546  -49.805 1.00 21.11  ? 208 PHE A N     1 
ATOM   1569 C  CA    . PHE A 1 228 ? -3.784  29.138  -48.505 1.00 21.08  ? 208 PHE A CA    1 
ATOM   1570 C  C     . PHE A 1 228 ? -4.256  30.315  -47.644 1.00 22.59  ? 208 PHE A C     1 
ATOM   1571 O  O     . PHE A 1 228 ? -4.715  30.106  -46.521 1.00 21.78  ? 208 PHE A O     1 
ATOM   1572 C  CB    . PHE A 1 228 ? -2.660  28.417  -47.795 1.00 21.22  ? 208 PHE A CB    1 
ATOM   1573 C  CG    . PHE A 1 228 ? -2.371  27.044  -48.334 1.00 23.10  ? 208 PHE A CG    1 
ATOM   1574 C  CD1   . PHE A 1 228 ? -1.532  26.869  -49.411 1.00 22.94  ? 208 PHE A CD1   1 
ATOM   1575 C  CD2   . PHE A 1 228 ? -2.927  25.929  -47.740 1.00 23.55  ? 208 PHE A CD2   1 
ATOM   1576 C  CE1   . PHE A 1 228 ? -1.244  25.606  -49.880 1.00 24.08  ? 208 PHE A CE1   1 
ATOM   1577 C  CE2   . PHE A 1 228 ? -2.653  24.670  -48.212 1.00 24.54  ? 208 PHE A CE2   1 
ATOM   1578 C  CZ    . PHE A 1 228 ? -1.813  24.510  -49.291 1.00 24.33  ? 208 PHE A CZ    1 
ATOM   1579 N  N     . ASP A 1 229 ? -4.141  31.543  -48.155 1.00 23.88  ? 209 ASP A N     1 
ATOM   1580 C  CA    . ASP A 1 229 ? -4.415  32.746  -47.359 1.00 25.08  ? 209 ASP A CA    1 
ATOM   1581 C  C     . ASP A 1 229 ? -5.910  32.868  -47.089 1.00 24.16  ? 209 ASP A C     1 
ATOM   1582 O  O     . ASP A 1 229 ? -6.706  32.771  -48.001 1.00 24.17  ? 209 ASP A O     1 
ATOM   1583 C  CB    . ASP A 1 229 ? -3.900  33.969  -48.122 1.00 28.69  ? 209 ASP A CB    1 
ATOM   1584 C  CG    . ASP A 1 229 ? -3.664  35.217  -47.232 1.00 33.43  ? 209 ASP A CG    1 
ATOM   1585 O  OD1   . ASP A 1 229 ? -3.815  35.203  -45.978 1.00 31.89  ? 209 ASP A OD1   1 
ATOM   1586 O  OD2   . ASP A 1 229 ? -3.294  36.251  -47.841 1.00 37.63  ? 209 ASP A OD2   1 
ATOM   1587 N  N     . ARG A 1 230 ? -6.287  33.018  -45.822 1.00 24.80  ? 210 ARG A N     1 
ATOM   1588 C  CA    . ARG A 1 230 ? -7.653  33.353  -45.420 1.00 24.80  ? 210 ARG A CA    1 
ATOM   1589 C  C     . ARG A 1 230 ? -7.602  34.670  -44.674 1.00 23.46  ? 210 ARG A C     1 
ATOM   1590 O  O     . ARG A 1 230 ? -7.434  34.678  -43.471 1.00 24.71  ? 210 ARG A O     1 
ATOM   1591 C  CB    . ARG A 1 230 ? -8.223  32.282  -44.492 1.00 27.39  ? 210 ARG A CB    1 
ATOM   1592 C  CG    . ARG A 1 230 ? -8.473  30.925  -45.161 1.00 31.15  ? 210 ARG A CG    1 
ATOM   1593 C  CD    . ARG A 1 230 ? -9.667  30.957  -46.119 1.00 34.93  ? 210 ARG A CD    1 
ATOM   1594 N  NE    . ARG A 1 230 ? -10.948 31.147  -45.431 1.00 40.70  ? 210 ARG A NE    1 
ATOM   1595 C  CZ    . ARG A 1 230 ? -11.609 30.190  -44.776 1.00 41.31  ? 210 ARG A CZ    1 
ATOM   1596 N  NH1   . ARG A 1 230 ? -11.115 28.955  -44.715 1.00 44.98  ? 210 ARG A NH1   1 
ATOM   1597 N  NH2   . ARG A 1 230 ? -12.769 30.463  -44.186 1.00 38.04  ? 210 ARG A NH2   1 
ATOM   1598 N  N     . PRO A 1 231 ? -7.731  35.797  -45.376 1.00 22.87  ? 211 PRO A N     1 
ATOM   1599 C  CA    . PRO A 1 231 ? -7.449  37.070  -44.686 1.00 23.44  ? 211 PRO A CA    1 
ATOM   1600 C  C     . PRO A 1 231 ? -8.439  37.459  -43.596 1.00 23.04  ? 211 PRO A C     1 
ATOM   1601 O  O     . PRO A 1 231 ? -8.108  38.277  -42.721 1.00 21.40  ? 211 PRO A O     1 
ATOM   1602 C  CB    . PRO A 1 231 ? -7.483  38.116  -45.803 1.00 23.55  ? 211 PRO A CB    1 
ATOM   1603 C  CG    . PRO A 1 231 ? -7.432  37.350  -47.080 1.00 24.07  ? 211 PRO A CG    1 
ATOM   1604 C  CD    . PRO A 1 231 ? -7.906  35.957  -46.825 1.00 22.52  ? 211 PRO A CD    1 
ATOM   1605 N  N     . ASN A 1 232 ? -9.637  36.891  -43.648 1.00 23.45  ? 212 ASN A N     1 
ATOM   1606 C  CA    . ASN A 1 232 ? -10.657 37.221  -42.664 1.00 24.90  ? 212 ASN A CA    1 
ATOM   1607 C  C     . ASN A 1 232 ? -10.543 36.379  -41.398 1.00 24.90  ? 212 ASN A C     1 
ATOM   1608 O  O     . ASN A 1 232 ? -11.276 36.618  -40.438 1.00 26.24  ? 212 ASN A O     1 
ATOM   1609 C  CB    . ASN A 1 232 ? -12.060 37.058  -43.256 1.00 26.19  ? 212 ASN A CB    1 
ATOM   1610 C  CG    . ASN A 1 232 ? -12.333 35.638  -43.653 1.00 26.42  ? 212 ASN A CG    1 
ATOM   1611 O  OD1   . ASN A 1 232 ? -11.507 35.020  -44.308 1.00 30.35  ? 212 ASN A OD1   1 
ATOM   1612 N  ND2   . ASN A 1 232 ? -13.446 35.101  -43.231 1.00 26.59  ? 212 ASN A ND2   1 
ATOM   1613 N  N     . ILE A 1 233 ? -9.656  35.383  -41.395 1.00 22.89  ? 213 ILE A N     1 
ATOM   1614 C  CA    . ILE A 1 233 ? -9.450  34.590  -40.193 1.00 23.06  ? 213 ILE A CA    1 
ATOM   1615 C  C     . ILE A 1 233 ? -8.330  35.203  -39.386 1.00 22.55  ? 213 ILE A C     1 
ATOM   1616 O  O     . ILE A 1 233 ? -7.276  35.452  -39.908 1.00 23.55  ? 213 ILE A O     1 
ATOM   1617 C  CB    . ILE A 1 233 ? -9.131  33.111  -40.515 1.00 23.72  ? 213 ILE A CB    1 
ATOM   1618 C  CG1   . ILE A 1 233 ? -10.368 32.399  -41.063 1.00 22.89  ? 213 ILE A CG1   1 
ATOM   1619 C  CG2   . ILE A 1 233 ? -8.637  32.406  -39.267 1.00 23.92  ? 213 ILE A CG2   1 
ATOM   1620 C  CD1   . ILE A 1 233 ? -10.157 30.922  -41.342 1.00 24.67  ? 213 ILE A CD1   1 
ATOM   1621 N  N     . ARG A 1 234 ? -8.581  35.484  -38.120 1.00 23.55  ? 214 ARG A N     1 
ATOM   1622 C  CA    . ARG A 1 234 ? -7.565  35.987  -37.232 1.00 24.27  ? 214 ARG A CA    1 
ATOM   1623 C  C     . ARG A 1 234 ? -7.023  34.830  -36.386 1.00 23.74  ? 214 ARG A C     1 
ATOM   1624 O  O     . ARG A 1 234 ? -7.775  34.237  -35.620 1.00 23.26  ? 214 ARG A O     1 
ATOM   1625 C  CB    . ARG A 1 234 ? -8.150  37.056  -36.332 1.00 26.51  ? 214 ARG A CB    1 
ATOM   1626 C  CG    . ARG A 1 234 ? -7.135  37.735  -35.413 1.00 28.51  ? 214 ARG A CG    1 
ATOM   1627 C  CD    . ARG A 1 234 ? -7.800  38.731  -34.458 1.00 29.40  ? 214 ARG A CD    1 
ATOM   1628 N  NE    . ARG A 1 234 ? -7.891  40.076  -35.044 1.00 32.30  ? 214 ARG A NE    1 
ATOM   1629 C  CZ    . ARG A 1 234 ? -8.134  41.206  -34.358 1.00 34.44  ? 214 ARG A CZ    1 
ATOM   1630 N  NH1   . ARG A 1 234 ? -8.320  41.190  -33.030 1.00 35.23  ? 214 ARG A NH1   1 
ATOM   1631 N  NH2   . ARG A 1 234 ? -8.180  42.367  -35.000 1.00 33.49  ? 214 ARG A NH2   1 
ATOM   1632 N  N     . TYR A 1 235 ? -5.723  34.538  -36.518 1.00 21.83  ? 215 TYR A N     1 
ATOM   1633 C  CA    . TYR A 1 235 ? -5.111  33.400  -35.854 1.00 22.02  ? 215 TYR A CA    1 
ATOM   1634 C  C     . TYR A 1 235 ? -4.549  33.876  -34.537 1.00 24.04  ? 215 TYR A C     1 
ATOM   1635 O  O     . TYR A 1 235 ? -3.683  34.743  -34.518 1.00 25.27  ? 215 TYR A O     1 
ATOM   1636 C  CB    . TYR A 1 235 ? -3.986  32.776  -36.708 1.00 20.80  ? 215 TYR A CB    1 
ATOM   1637 C  CG    . TYR A 1 235 ? -4.472  32.187  -38.001 1.00 19.78  ? 215 TYR A CG    1 
ATOM   1638 C  CD1   . TYR A 1 235 ? -5.024  30.925  -38.042 1.00 19.18  ? 215 TYR A CD1   1 
ATOM   1639 C  CD2   . TYR A 1 235 ? -4.399  32.901  -39.186 1.00 21.00  ? 215 TYR A CD2   1 
ATOM   1640 C  CE1   . TYR A 1 235 ? -5.507  30.380  -39.216 1.00 18.95  ? 215 TYR A CE1   1 
ATOM   1641 C  CE2   . TYR A 1 235 ? -4.873  32.358  -40.380 1.00 22.02  ? 215 TYR A CE2   1 
ATOM   1642 C  CZ    . TYR A 1 235 ? -5.425  31.088  -40.383 1.00 20.34  ? 215 TYR A CZ    1 
ATOM   1643 O  OH    . TYR A 1 235 ? -5.892  30.543  -41.551 1.00 20.86  ? 215 TYR A OH    1 
ATOM   1644 N  N     . MET A 1 236 ? -5.059  33.314  -33.444 1.00 25.42  ? 216 MET A N     1 
ATOM   1645 C  CA    . MET A 1 236 ? -4.681  33.701  -32.108 1.00 28.21  ? 216 MET A CA    1 
ATOM   1646 C  C     . MET A 1 236 ? -4.235  32.464  -31.307 1.00 29.24  ? 216 MET A C     1 
ATOM   1647 O  O     . MET A 1 236 ? -4.656  31.346  -31.556 1.00 28.12  ? 216 MET A O     1 
ATOM   1648 C  CB    . MET A 1 236 ? -5.864  34.360  -31.395 1.00 31.25  ? 216 MET A CB    1 
ATOM   1649 C  CG    . MET A 1 236 ? -6.519  35.541  -32.114 1.00 34.54  ? 216 MET A CG    1 
ATOM   1650 S  SD    . MET A 1 236 ? -5.415  36.968  -32.280 1.00 40.65  ? 216 MET A SD    1 
ATOM   1651 C  CE    . MET A 1 236 ? -5.562  37.698  -30.644 1.00 39.08  ? 216 MET A CE    1 
ATOM   1652 N  N     . LEU A 1 237 ? -3.385  32.697  -30.330 1.00 31.08  ? 217 LEU A N     1 
ATOM   1653 C  CA    . LEU A 1 237 ? -2.914  31.662  -29.438 1.00 33.74  ? 217 LEU A CA    1 
ATOM   1654 C  C     . LEU A 1 237 ? -2.963  32.249  -28.030 1.00 33.09  ? 217 LEU A C     1 
ATOM   1655 O  O     . LEU A 1 237 ? -2.709  33.427  -27.827 1.00 31.49  ? 217 LEU A O     1 
ATOM   1656 C  CB    . LEU A 1 237 ? -1.487  31.260  -29.815 1.00 34.01  ? 217 LEU A CB    1 
ATOM   1657 C  CG    . LEU A 1 237 ? -0.799  30.217  -28.934 1.00 38.00  ? 217 LEU A CG    1 
ATOM   1658 C  CD1   . LEU A 1 237 ? 0.087   29.305  -29.769 1.00 39.61  ? 217 LEU A CD1   1 
ATOM   1659 C  CD2   . LEU A 1 237 ? 0.018   30.848  -27.808 1.00 39.82  ? 217 LEU A CD2   1 
ATOM   1660 N  N     . MET A 1 238 ? -3.288  31.429  -27.058 1.00 35.50  ? 218 MET A N     1 
ATOM   1661 C  CA    . MET A 1 238 ? -3.266  31.874  -25.668 1.00 39.76  ? 218 MET A CA    1 
ATOM   1662 C  C     . MET A 1 238 ? -2.593  30.769  -24.879 1.00 35.82  ? 218 MET A C     1 
ATOM   1663 O  O     . MET A 1 238 ? -2.885  29.601  -25.063 1.00 31.30  ? 218 MET A O     1 
ATOM   1664 C  CB    . MET A 1 238 ? -4.690  32.105  -25.162 1.00 46.72  ? 218 MET A CB    1 
ATOM   1665 C  CG    . MET A 1 238 ? -4.818  33.231  -24.148 1.00 57.17  ? 218 MET A CG    1 
ATOM   1666 S  SD    . MET A 1 238 ? -6.506  33.432  -23.518 1.00 69.43  ? 218 MET A SD    1 
ATOM   1667 C  CE    . MET A 1 238 ? -7.349  34.075  -24.957 1.00 64.54  ? 218 MET A CE    1 
ATOM   1668 N  N     . GLU A 1 239 ? -1.669  31.147  -24.022 1.00 36.94  ? 219 GLU A N     1 
ATOM   1669 C  CA    . GLU A 1 239 ? -1.001  30.188  -23.179 1.00 40.70  ? 219 GLU A CA    1 
ATOM   1670 C  C     . GLU A 1 239 ? -2.020  29.661  -22.176 1.00 40.02  ? 219 GLU A C     1 
ATOM   1671 O  O     . GLU A 1 239 ? -2.799  30.410  -21.595 1.00 38.28  ? 219 GLU A O     1 
ATOM   1672 C  CB    . GLU A 1 239 ? 0.208   30.814  -22.491 1.00 45.08  ? 219 GLU A CB    1 
ATOM   1673 C  CG    . GLU A 1 239 ? 0.987   29.796  -21.671 1.00 54.93  ? 219 GLU A CG    1 
ATOM   1674 C  CD    . GLU A 1 239 ? 2.436   30.175  -21.392 1.00 57.61  ? 219 GLU A CD    1 
ATOM   1675 O  OE1   . GLU A 1 239 ? 3.212   29.249  -21.081 1.00 60.20  ? 219 GLU A OE1   1 
ATOM   1676 O  OE2   . GLU A 1 239 ? 2.801   31.372  -21.474 1.00 63.25  ? 219 GLU A OE2   1 
ATOM   1677 N  N     . LYS A 1 240 ? -2.022  28.354  -22.012 1.00 39.28  ? 220 LYS A N     1 
ATOM   1678 C  CA    . LYS A 1 240 ? -3.008  27.672  -21.213 1.00 42.81  ? 220 LYS A CA    1 
ATOM   1679 C  C     . LYS A 1 240 ? -2.544  27.650  -19.749 1.00 45.32  ? 220 LYS A C     1 
ATOM   1680 O  O     . LYS A 1 240 ? -1.531  27.028  -19.440 1.00 47.84  ? 220 LYS A O     1 
ATOM   1681 C  CB    . LYS A 1 240 ? -3.111  26.259  -21.761 1.00 43.60  ? 220 LYS A CB    1 
ATOM   1682 C  CG    . LYS A 1 240 ? -4.449  25.561  -21.680 1.00 45.23  ? 220 LYS A CG    1 
ATOM   1683 C  CD    . LYS A 1 240 ? -4.229  24.125  -22.157 1.00 45.30  ? 220 LYS A CD    1 
ATOM   1684 C  CE    . LYS A 1 240 ? -5.499  23.391  -22.503 1.00 47.03  ? 220 LYS A CE    1 
ATOM   1685 N  NZ    . LYS A 1 240 ? -5.160  22.108  -23.190 1.00 49.05  ? 220 LYS A NZ    1 
ATOM   1686 N  N     . PHE A 1 241 ? -3.264  28.327  -18.855 1.00 47.91  ? 221 PHE A N     1 
ATOM   1687 C  CA    . PHE A 1 241 ? -2.957  28.278  -17.408 1.00 52.29  ? 221 PHE A CA    1 
ATOM   1688 C  C     . PHE A 1 241 ? -4.116  27.711  -16.581 1.00 52.20  ? 221 PHE A C     1 
ATOM   1689 O  O     . PHE A 1 241 ? -3.923  26.775  -15.804 1.00 56.70  ? 221 PHE A O     1 
ATOM   1690 C  CB    . PHE A 1 241 ? -2.552  29.658  -16.873 1.00 52.37  ? 221 PHE A CB    1 
ATOM   1691 C  CG    . PHE A 1 241 ? -1.291  30.202  -17.495 1.00 55.45  ? 221 PHE A CG    1 
ATOM   1692 C  CD1   . PHE A 1 241 ? -1.343  31.224  -18.439 1.00 55.36  ? 221 PHE A CD1   1 
ATOM   1693 C  CD2   . PHE A 1 241 ? -0.042  29.682  -17.153 1.00 54.49  ? 221 PHE A CD2   1 
ATOM   1694 C  CE1   . PHE A 1 241 ? -0.181  31.720  -19.016 1.00 54.04  ? 221 PHE A CE1   1 
ATOM   1695 C  CE2   . PHE A 1 241 ? 1.123   30.180  -17.731 1.00 54.34  ? 221 PHE A CE2   1 
ATOM   1696 C  CZ    . PHE A 1 241 ? 1.051   31.203  -18.659 1.00 52.70  ? 221 PHE A CZ    1 
ATOM   1697 N  N     . LYS A 1 242 ? -5.306  28.284  -16.733 1.00 49.20  ? 222 LYS A N     1 
ATOM   1698 C  CA    . LYS A 1 242 ? -6.513  27.731  -16.106 1.00 49.87  ? 222 LYS A CA    1 
ATOM   1699 C  C     . LYS A 1 242 ? -7.506  27.329  -17.191 1.00 44.47  ? 222 LYS A C     1 
ATOM   1700 O  O     . LYS A 1 242 ? -8.459  28.041  -17.460 1.00 41.63  ? 222 LYS A O     1 
ATOM   1701 C  CB    . LYS A 1 242 ? -7.124  28.751  -15.141 1.00 55.60  ? 222 LYS A CB    1 
ATOM   1702 C  CG    . LYS A 1 242 ? -6.566  28.644  -13.729 1.00 61.40  ? 222 LYS A CG    1 
ATOM   1703 C  CD    . LYS A 1 242 ? -6.239  30.003  -13.135 1.00 68.57  ? 222 LYS A CD    1 
ATOM   1704 C  CE    . LYS A 1 242 ? -5.319  29.866  -11.927 1.00 74.56  ? 222 LYS A CE    1 
ATOM   1705 N  NZ    . LYS A 1 242 ? -6.045  29.421  -10.703 1.00 76.55  ? 222 LYS A NZ    1 
ATOM   1706 N  N     . PRO A 1 243 ? -7.263  26.187  -17.837 1.00 43.16  ? 223 PRO A N     1 
ATOM   1707 C  CA    . PRO A 1 243 ? -7.953  25.866  -19.063 1.00 43.19  ? 223 PRO A CA    1 
ATOM   1708 C  C     . PRO A 1 243 ? -9.411  26.307  -19.087 1.00 42.92  ? 223 PRO A C     1 
ATOM   1709 O  O     . PRO A 1 243 ? -9.808  27.123  -19.945 1.00 40.57  ? 223 PRO A O     1 
ATOM   1710 C  CB    . PRO A 1 243 ? -7.846  24.337  -19.125 1.00 43.74  ? 223 PRO A CB    1 
ATOM   1711 C  CG    . PRO A 1 243 ? -6.596  24.008  -18.387 1.00 43.54  ? 223 PRO A CG    1 
ATOM   1712 C  CD    . PRO A 1 243 ? -6.239  25.176  -17.511 1.00 44.18  ? 223 PRO A CD    1 
ATOM   1713 N  N     . LEU A 1 244 ? -10.183 25.787  -18.134 1.00 42.19  ? 224 LEU A N     1 
ATOM   1714 C  CA    . LEU A 1 244 ? -11.628 25.929  -18.150 1.00 45.60  ? 224 LEU A CA    1 
ATOM   1715 C  C     . LEU A 1 244 ? -12.049 27.361  -17.957 1.00 43.42  ? 224 LEU A C     1 
ATOM   1716 O  O     . LEU A 1 244 ? -12.916 27.845  -18.677 1.00 42.15  ? 224 LEU A O     1 
ATOM   1717 C  CB    . LEU A 1 244 ? -12.262 25.074  -17.066 1.00 51.44  ? 224 LEU A CB    1 
ATOM   1718 C  CG    . LEU A 1 244 ? -13.783 25.097  -17.044 1.00 56.06  ? 224 LEU A CG    1 
ATOM   1719 C  CD1   . LEU A 1 244 ? -14.356 24.667  -18.389 1.00 58.04  ? 224 LEU A CD1   1 
ATOM   1720 C  CD2   . LEU A 1 244 ? -14.249 24.175  -15.933 1.00 57.57  ? 224 LEU A CD2   1 
ATOM   1721 N  N     . ASP A 1 245 ? -11.430 28.053  -17.010 1.00 40.23  ? 225 ASP A N     1 
ATOM   1722 C  CA    . ASP A 1 245 ? -11.784 29.451  -16.800 1.00 46.20  ? 225 ASP A CA    1 
ATOM   1723 C  C     . ASP A 1 245 ? -11.431 30.326  -18.005 1.00 41.98  ? 225 ASP A C     1 
ATOM   1724 O  O     . ASP A 1 245 ? -12.194 31.221  -18.365 1.00 41.39  ? 225 ASP A O     1 
ATOM   1725 C  CB    . ASP A 1 245 ? -11.154 29.999  -15.508 1.00 50.86  ? 225 ASP A CB    1 
ATOM   1726 C  CG    . ASP A 1 245 ? -11.748 29.355  -14.251 1.00 60.02  ? 225 ASP A CG    1 
ATOM   1727 O  OD1   . ASP A 1 245 ? -12.954 28.970  -14.257 1.00 61.37  ? 225 ASP A OD1   1 
ATOM   1728 O  OD2   . ASP A 1 245 ? -11.001 29.232  -13.251 1.00 67.69  ? 225 ASP A OD2   1 
ATOM   1729 N  N     . GLN A 1 246 ? -10.280 30.070  -18.627 1.00 39.35  ? 226 GLN A N     1 
ATOM   1730 C  CA    . GLN A 1 246 ? -9.903  30.810  -19.836 1.00 37.96  ? 226 GLN A CA    1 
ATOM   1731 C  C     . GLN A 1 246 ? -10.853 30.520  -20.970 1.00 35.83  ? 226 GLN A C     1 
ATOM   1732 O  O     . GLN A 1 246 ? -11.285 31.434  -21.649 1.00 35.37  ? 226 GLN A O     1 
ATOM   1733 C  CB    . GLN A 1 246 ? -8.491  30.488  -20.274 1.00 38.02  ? 226 GLN A CB    1 
ATOM   1734 C  CG    . GLN A 1 246 ? -7.427  31.030  -19.348 1.00 37.67  ? 226 GLN A CG    1 
ATOM   1735 C  CD    . GLN A 1 246 ? -6.072  30.515  -19.741 1.00 37.37  ? 226 GLN A CD    1 
ATOM   1736 O  OE1   . GLN A 1 246 ? -5.713  29.368  -19.442 1.00 38.45  ? 226 GLN A OE1   1 
ATOM   1737 N  NE2   . GLN A 1 246 ? -5.315  31.341  -20.426 1.00 36.83  ? 226 GLN A NE2   1 
ATOM   1738 N  N     . LEU A 1 247 ? -11.206 29.250  -21.146 1.00 34.03  ? 227 LEU A N     1 
ATOM   1739 C  CA    . LEU A 1 247 ? -12.159 28.871  -22.179 1.00 33.99  ? 227 LEU A CA    1 
ATOM   1740 C  C     . LEU A 1 247 ? -13.523 29.513  -21.933 1.00 36.21  ? 227 LEU A C     1 
ATOM   1741 O  O     . LEU A 1 247 ? -14.146 30.031  -22.860 1.00 39.51  ? 227 LEU A O     1 
ATOM   1742 C  CB    . LEU A 1 247 ? -12.289 27.342  -22.261 1.00 34.08  ? 227 LEU A CB    1 
ATOM   1743 C  CG    . LEU A 1 247 ? -13.336 26.883  -23.281 1.00 35.39  ? 227 LEU A CG    1 
ATOM   1744 C  CD1   . LEU A 1 247 ? -12.849 27.200  -24.690 1.00 35.02  ? 227 LEU A CD1   1 
ATOM   1745 C  CD2   . LEU A 1 247 ? -13.667 25.409  -23.131 1.00 33.87  ? 227 LEU A CD2   1 
ATOM   1746 N  N     . MET A 1 248 ? -13.983 29.489  -20.688 1.00 40.39  ? 228 MET A N     1 
ATOM   1747 C  CA    . MET A 1 248 ? -15.265 30.107  -20.325 1.00 43.85  ? 228 MET A CA    1 
ATOM   1748 C  C     . MET A 1 248 ? -15.256 31.588  -20.651 1.00 39.96  ? 228 MET A C     1 
ATOM   1749 O  O     . MET A 1 248 ? -16.152 32.092  -21.332 1.00 38.03  ? 228 MET A O     1 
ATOM   1750 C  CB    . MET A 1 248 ? -15.527 29.933  -18.827 1.00 52.72  ? 228 MET A CB    1 
ATOM   1751 C  CG    . MET A 1 248 ? -16.987 29.962  -18.439 1.00 62.14  ? 228 MET A CG    1 
ATOM   1752 S  SD    . MET A 1 248 ? -17.897 28.642  -19.256 1.00 73.82  ? 228 MET A SD    1 
ATOM   1753 C  CE    . MET A 1 248 ? -16.853 27.247  -18.838 1.00 69.62  ? 228 MET A CE    1 
ATOM   1754 N  N     . ARG A 1 249 ? -14.221 32.281  -20.184 1.00 38.49  ? 229 ARG A N     1 
ATOM   1755 C  CA    . ARG A 1 249 ? -14.094 33.712  -20.431 1.00 41.80  ? 229 ARG A CA    1 
ATOM   1756 C  C     . ARG A 1 249 ? -14.082 34.010  -21.936 1.00 39.24  ? 229 ARG A C     1 
ATOM   1757 O  O     . ARG A 1 249 ? -14.705 34.971  -22.394 1.00 40.32  ? 229 ARG A O     1 
ATOM   1758 C  CB    . ARG A 1 249 ? -12.835 34.260  -19.753 1.00 45.74  ? 229 ARG A CB    1 
ATOM   1759 C  CG    . ARG A 1 249 ? -12.683 35.768  -19.865 1.00 52.48  ? 229 ARG A CG    1 
ATOM   1760 C  CD    . ARG A 1 249 ? -11.378 36.268  -19.249 1.00 57.26  ? 229 ARG A CD    1 
ATOM   1761 N  NE    . ARG A 1 249 ? -10.979 37.547  -19.844 1.00 63.41  ? 229 ARG A NE    1 
ATOM   1762 C  CZ    . ARG A 1 249 ? -9.979  38.321  -19.412 1.00 66.33  ? 229 ARG A CZ    1 
ATOM   1763 N  NH1   . ARG A 1 249 ? -9.242  37.971  -18.356 1.00 61.86  ? 229 ARG A NH1   1 
ATOM   1764 N  NH2   . ARG A 1 249 ? -9.716  39.464  -20.045 1.00 66.64  ? 229 ARG A NH2   1 
ATOM   1765 N  N     . TYR A 1 250 ? -13.401 33.163  -22.707 1.00 37.29  ? 230 TYR A N     1 
ATOM   1766 C  CA    . TYR A 1 250 ? -13.326 33.351  -24.141 1.00 34.88  ? 230 TYR A CA    1 
ATOM   1767 C  C     . TYR A 1 250 ? -14.694 33.146  -24.784 1.00 33.90  ? 230 TYR A C     1 
ATOM   1768 O  O     . TYR A 1 250 ? -15.128 33.964  -25.609 1.00 32.83  ? 230 TYR A O     1 
ATOM   1769 C  CB    . TYR A 1 250 ? -12.281 32.422  -24.790 1.00 35.21  ? 230 TYR A CB    1 
ATOM   1770 C  CG    . TYR A 1 250 ? -12.244 32.618  -26.296 1.00 32.87  ? 230 TYR A CG    1 
ATOM   1771 C  CD1   . TYR A 1 250 ? -11.483 33.624  -26.857 1.00 31.58  ? 230 TYR A CD1   1 
ATOM   1772 C  CD2   . TYR A 1 250 ? -13.030 31.846  -27.133 1.00 30.68  ? 230 TYR A CD2   1 
ATOM   1773 C  CE1   . TYR A 1 250 ? -11.472 33.835  -28.220 1.00 32.87  ? 230 TYR A CE1   1 
ATOM   1774 C  CE2   . TYR A 1 250 ? -13.038 32.060  -28.496 1.00 33.46  ? 230 TYR A CE2   1 
ATOM   1775 C  CZ    . TYR A 1 250 ? -12.239 33.044  -29.038 1.00 33.39  ? 230 TYR A CZ    1 
ATOM   1776 O  OH    . TYR A 1 250 ? -12.239 33.267  -30.398 1.00 34.73  ? 230 TYR A OH    1 
ATOM   1777 N  N     . VAL A 1 251 ? -15.358 32.046  -24.422 1.00 34.77  ? 231 VAL A N     1 
ATOM   1778 C  CA    . VAL A 1 251 ? -16.712 31.754  -24.931 1.00 36.10  ? 231 VAL A CA    1 
ATOM   1779 C  C     . VAL A 1 251 ? -17.697 32.889  -24.607 1.00 38.78  ? 231 VAL A C     1 
ATOM   1780 O  O     . VAL A 1 251 ? -18.482 33.301  -25.465 1.00 36.42  ? 231 VAL A O     1 
ATOM   1781 C  CB    . VAL A 1 251 ? -17.250 30.404  -24.399 1.00 36.94  ? 231 VAL A CB    1 
ATOM   1782 C  CG1   . VAL A 1 251 ? -18.727 30.218  -24.719 1.00 38.92  ? 231 VAL A CG1   1 
ATOM   1783 C  CG2   . VAL A 1 251 ? -16.470 29.248  -24.993 1.00 36.40  ? 231 VAL A CG2   1 
ATOM   1784 N  N     . GLN A 1 252 ? -17.635 33.415  -23.387 1.00 43.02  ? 232 GLN A N     1 
ATOM   1785 C  CA    . GLN A 1 252 ? -18.544 34.489  -22.991 1.00 46.89  ? 232 GLN A CA    1 
ATOM   1786 C  C     . GLN A 1 252 ? -18.315 35.740  -23.807 1.00 46.30  ? 232 GLN A C     1 
ATOM   1787 O  O     . GLN A 1 252 ? -19.262 36.450  -24.118 1.00 46.59  ? 232 GLN A O     1 
ATOM   1788 C  CB    . GLN A 1 252 ? -18.438 34.784  -21.494 1.00 51.95  ? 232 GLN A CB    1 
ATOM   1789 C  CG    . GLN A 1 252 ? -19.281 33.818  -20.671 1.00 59.27  ? 232 GLN A CG    1 
ATOM   1790 C  CD    . GLN A 1 252 ? -18.789 33.612  -19.248 1.00 63.28  ? 232 GLN A CD    1 
ATOM   1791 O  OE1   . GLN A 1 252 ? -17.809 34.223  -18.804 1.00 64.55  ? 232 GLN A OE1   1 
ATOM   1792 N  NE2   . GLN A 1 252 ? -19.466 32.722  -18.526 1.00 64.02  ? 232 GLN A NE2   1 
ATOM   1793 N  N     . GLU A 1 253 ? -17.065 35.996  -24.179 1.00 46.75  ? 233 GLU A N     1 
ATOM   1794 C  CA    . GLU A 1 253 ? -16.738 37.172  -24.990 1.00 45.89  ? 233 GLU A CA    1 
ATOM   1795 C  C     . GLU A 1 253 ? -17.267 37.105  -26.420 1.00 42.89  ? 233 GLU A C     1 
ATOM   1796 O  O     . GLU A 1 253 ? -17.355 38.123  -27.084 1.00 43.87  ? 233 GLU A O     1 
ATOM   1797 C  CB    . GLU A 1 253 ? -15.227 37.409  -24.990 1.00 51.93  ? 233 GLU A CB    1 
ATOM   1798 C  CG    . GLU A 1 253 ? -14.690 37.881  -23.643 1.00 56.00  ? 233 GLU A CG    1 
ATOM   1799 C  CD    . GLU A 1 253 ? -13.177 37.767  -23.519 1.00 63.28  ? 233 GLU A CD    1 
ATOM   1800 O  OE1   . GLU A 1 253 ? -12.531 37.222  -24.442 1.00 67.94  ? 233 GLU A OE1   1 
ATOM   1801 O  OE2   . GLU A 1 253 ? -12.625 38.219  -22.488 1.00 71.06  ? 233 GLU A OE2   1 
ATOM   1802 N  N     . GLN A 1 254 ? -17.644 35.911  -26.878 1.00 42.05  ? 234 GLN A N     1 
ATOM   1803 C  CA    . GLN A 1 254 ? -18.241 35.720  -28.208 1.00 38.86  ? 234 GLN A CA    1 
ATOM   1804 C  C     . GLN A 1 254 ? -19.714 36.065  -28.242 1.00 40.35  ? 234 GLN A C     1 
ATOM   1805 O  O     . GLN A 1 254 ? -20.319 36.125  -29.324 1.00 34.63  ? 234 GLN A O     1 
ATOM   1806 C  CB    . GLN A 1 254 ? -18.083 34.250  -28.647 1.00 38.04  ? 234 GLN A CB    1 
ATOM   1807 C  CG    . GLN A 1 254 ? -16.649 33.746  -28.619 1.00 36.17  ? 234 GLN A CG    1 
ATOM   1808 C  CD    . GLN A 1 254 ? -15.688 34.739  -29.233 1.00 34.57  ? 234 GLN A CD    1 
ATOM   1809 O  OE1   . GLN A 1 254 ? -14.725 35.146  -28.601 1.00 36.13  ? 234 GLN A OE1   1 
ATOM   1810 N  NE2   . GLN A 1 254 ? -15.969 35.161  -30.453 1.00 33.86  ? 234 GLN A NE2   1 
ATOM   1811 N  N     . ARG A 1 255 ? -20.303 36.201  -27.051 1.00 44.70  ? 235 ARG A N     1 
ATOM   1812 C  CA    . ARG A 1 255 ? -21.639 36.754  -26.882 1.00 47.16  ? 235 ARG A CA    1 
ATOM   1813 C  C     . ARG A 1 255 ? -22.676 36.161  -27.841 1.00 45.75  ? 235 ARG A C     1 
ATOM   1814 O  O     . ARG A 1 255 ? -23.303 36.892  -28.610 1.00 45.16  ? 235 ARG A O     1 
ATOM   1815 C  CB    . ARG A 1 255 ? -21.566 38.268  -27.071 1.00 50.17  ? 235 ARG A CB    1 
ATOM   1816 C  CG    . ARG A 1 255 ? -20.719 38.977  -26.027 1.00 52.76  ? 235 ARG A CG    1 
ATOM   1817 C  CD    . ARG A 1 255 ? -20.386 40.398  -26.477 1.00 54.57  ? 235 ARG A CD    1 
ATOM   1818 N  NE    . ARG A 1 255 ? -21.596 41.151  -26.801 1.00 57.07  ? 235 ARG A NE    1 
ATOM   1819 C  CZ    . ARG A 1 255 ? -21.650 42.234  -27.583 1.00 59.62  ? 235 ARG A CZ    1 
ATOM   1820 N  NH1   . ARG A 1 255 ? -20.558 42.731  -28.158 1.00 53.48  ? 235 ARG A NH1   1 
ATOM   1821 N  NH2   . ARG A 1 255 ? -22.822 42.825  -27.799 1.00 59.23  ? 235 ARG A NH2   1 
ATOM   1822 N  N     . GLY A 1 256 ? -22.831 34.842  -27.821 1.00 42.68  ? 236 GLY A N     1 
ATOM   1823 C  CA    . GLY A 1 256 ? -23.869 34.186  -28.628 1.00 41.26  ? 236 GLY A CA    1 
ATOM   1824 C  C     . GLY A 1 256 ? -23.449 33.697  -30.008 1.00 41.35  ? 236 GLY A C     1 
ATOM   1825 O  O     . GLY A 1 256 ? -24.222 33.018  -30.705 1.00 38.25  ? 236 GLY A O     1 
ATOM   1826 N  N     . LYS A 1 257 ? -22.220 34.014  -30.406 1.00 40.80  ? 237 LYS A N     1 
ATOM   1827 C  CA    . LYS A 1 257 ? -21.709 33.625  -31.729 1.00 38.47  ? 237 LYS A CA    1 
ATOM   1828 C  C     . LYS A 1 257 ? -21.547 32.121  -31.918 1.00 35.36  ? 237 LYS A C     1 
ATOM   1829 O  O     . LYS A 1 257 ? -21.220 31.395  -30.993 1.00 35.74  ? 237 LYS A O     1 
ATOM   1830 C  CB    . LYS A 1 257 ? -20.372 34.309  -31.987 1.00 40.25  ? 237 LYS A CB    1 
ATOM   1831 C  CG    . LYS A 1 257 ? -20.498 35.792  -32.308 1.00 42.36  ? 237 LYS A CG    1 
ATOM   1832 C  CD    . LYS A 1 257 ? -19.134 36.488  -32.229 1.00 45.58  ? 237 LYS A CD    1 
ATOM   1833 C  CE    . LYS A 1 257 ? -19.109 37.804  -32.997 1.00 45.40  ? 237 LYS A CE    1 
ATOM   1834 N  NZ    . LYS A 1 257 ? -18.236 38.784  -32.311 1.00 45.79  ? 237 LYS A NZ    1 
ATOM   1835 N  N     . SER A 1 258 ? -21.798 31.661  -33.129 1.00 33.47  ? 238 SER A N     1 
ATOM   1836 C  CA    . SER A 1 258 ? -21.638 30.260  -33.464 1.00 35.22  ? 238 SER A CA    1 
ATOM   1837 C  C     . SER A 1 258 ? -20.130 29.842  -33.585 1.00 34.30  ? 238 SER A C     1 
ATOM   1838 O  O     . SER A 1 258 ? -19.323 30.551  -34.181 1.00 31.24  ? 238 SER A O     1 
ATOM   1839 C  CB    . SER A 1 258 ? -22.358 30.006  -34.781 1.00 38.31  ? 238 SER A CB    1 
ATOM   1840 O  OG    . SER A 1 258 ? -22.103 28.698  -35.223 1.00 47.80  ? 238 SER A OG    1 
ATOM   1841 N  N     . GLY A 1 259 ? -19.754 28.697  -33.025 1.00 32.44  ? 239 GLY A N     1 
ATOM   1842 C  CA    . GLY A 1 259 ? -18.346 28.280  -33.048 1.00 31.12  ? 239 GLY A CA    1 
ATOM   1843 C  C     . GLY A 1 259 ? -18.118 26.820  -32.712 1.00 29.61  ? 239 GLY A C     1 
ATOM   1844 O  O     . GLY A 1 259 ? -19.044 26.122  -32.294 1.00 28.47  ? 239 GLY A O     1 
ATOM   1845 N  N     . ILE A 1 260 ? -16.886 26.362  -32.928 1.00 27.42  ? 240 ILE A N     1 
ATOM   1846 C  CA    . ILE A 1 260 ? -16.500 24.983  -32.667 1.00 26.62  ? 240 ILE A CA    1 
ATOM   1847 C  C     . ILE A 1 260 ? -15.343 24.945  -31.659 1.00 26.16  ? 240 ILE A C     1 
ATOM   1848 O  O     . ILE A 1 260 ? -14.462 25.782  -31.709 1.00 23.82  ? 240 ILE A O     1 
ATOM   1849 C  CB    . ILE A 1 260 ? -16.073 24.272  -33.958 1.00 26.93  ? 240 ILE A CB    1 
ATOM   1850 C  CG1   . ILE A 1 260 ? -17.206 24.301  -34.975 1.00 28.65  ? 240 ILE A CG1   1 
ATOM   1851 C  CG2   . ILE A 1 260 ? -15.691 22.831  -33.670 1.00 27.42  ? 240 ILE A CG2   1 
ATOM   1852 C  CD1   . ILE A 1 260 ? -16.754 24.030  -36.388 1.00 29.79  ? 240 ILE A CD1   1 
ATOM   1853 N  N     . ILE A 1 261 ? -15.375 23.985  -30.737 1.00 25.23  ? 241 ILE A N     1 
ATOM   1854 C  CA    . ILE A 1 261 ? -14.313 23.813  -29.762 1.00 25.18  ? 241 ILE A CA    1 
ATOM   1855 C  C     . ILE A 1 261 ? -13.799 22.410  -29.946 1.00 24.96  ? 241 ILE A C     1 
ATOM   1856 O  O     . ILE A 1 261 ? -14.551 21.455  -29.751 1.00 24.16  ? 241 ILE A O     1 
ATOM   1857 C  CB    . ILE A 1 261 ? -14.819 23.986  -28.320 1.00 27.52  ? 241 ILE A CB    1 
ATOM   1858 C  CG1   . ILE A 1 261 ? -15.421 25.383  -28.134 1.00 28.66  ? 241 ILE A CG1   1 
ATOM   1859 C  CG2   . ILE A 1 261 ? -13.682 23.813  -27.331 1.00 28.34  ? 241 ILE A CG2   1 
ATOM   1860 C  CD1   . ILE A 1 261 ? -15.973 25.613  -26.744 1.00 30.52  ? 241 ILE A CD1   1 
ATOM   1861 N  N     . TYR A 1 262 ? -12.535 22.294  -30.368 1.00 24.30  ? 242 TYR A N     1 
ATOM   1862 C  CA    . TYR A 1 262 ? -11.903 21.017  -30.642 1.00 23.24  ? 242 TYR A CA    1 
ATOM   1863 C  C     . TYR A 1 262 ? -11.089 20.556  -29.448 1.00 25.69  ? 242 TYR A C     1 
ATOM   1864 O  O     . TYR A 1 262 ? -10.333 21.343  -28.888 1.00 24.49  ? 242 TYR A O     1 
ATOM   1865 C  CB    . TYR A 1 262 ? -10.989 21.120  -31.863 1.00 22.78  ? 242 TYR A CB    1 
ATOM   1866 C  CG    . TYR A 1 262 ? -11.741 21.080  -33.172 1.00 22.60  ? 242 TYR A CG    1 
ATOM   1867 C  CD1   . TYR A 1 262 ? -12.340 19.899  -33.605 1.00 23.47  ? 242 TYR A CD1   1 
ATOM   1868 C  CD2   . TYR A 1 262 ? -11.872 22.205  -33.971 1.00 21.51  ? 242 TYR A CD2   1 
ATOM   1869 C  CE1   . TYR A 1 262 ? -13.046 19.844  -34.795 1.00 22.94  ? 242 TYR A CE1   1 
ATOM   1870 C  CE2   . TYR A 1 262 ? -12.567 22.148  -35.170 1.00 21.79  ? 242 TYR A CE2   1 
ATOM   1871 C  CZ    . TYR A 1 262 ? -13.158 20.964  -35.569 1.00 21.89  ? 242 TYR A CZ    1 
ATOM   1872 O  OH    . TYR A 1 262 ? -13.875 20.876  -36.734 1.00 21.48  ? 242 TYR A OH    1 
ATOM   1873 N  N     . CYS A 1 263 ? -11.269 19.295  -29.049 1.00 27.55  ? 243 CYS A N     1 
ATOM   1874 C  CA    . CYS A 1 263 ? -10.399 18.647  -28.059 1.00 32.36  ? 243 CYS A CA    1 
ATOM   1875 C  C     . CYS A 1 263 ? -9.868  17.351  -28.624 1.00 33.38  ? 243 CYS A C     1 
ATOM   1876 O  O     . CYS A 1 263 ? -10.421 16.811  -29.584 1.00 33.50  ? 243 CYS A O     1 
ATOM   1877 C  CB    . CYS A 1 263 ? -11.123 18.321  -26.769 1.00 33.10  ? 243 CYS A CB    1 
ATOM   1878 S  SG    . CYS A 1 263 ? -12.224 19.616  -26.213 1.00 39.28  ? 243 CYS A SG    1 
ATOM   1879 N  N     . ASN A 1 264 ? -8.815  16.854  -27.986 1.00 35.20  ? 244 ASN A N     1 
ATOM   1880 C  CA    . ASN A 1 264 ? -8.075  15.687  -28.454 1.00 40.79  ? 244 ASN A CA    1 
ATOM   1881 C  C     . ASN A 1 264 ? -8.553  14.341  -27.850 1.00 41.52  ? 244 ASN A C     1 
ATOM   1882 O  O     . ASN A 1 264 ? -7.891  13.320  -28.055 1.00 47.27  ? 244 ASN A O     1 
ATOM   1883 C  CB    . ASN A 1 264 ? -6.553  15.890  -28.212 1.00 43.47  ? 244 ASN A CB    1 
ATOM   1884 C  CG    . ASN A 1 264 ? -5.851  16.716  -29.332 1.00 48.75  ? 244 ASN A CG    1 
ATOM   1885 O  OD1   . ASN A 1 264 ? -6.371  16.898  -30.449 1.00 53.79  ? 244 ASN A OD1   1 
ATOM   1886 N  ND2   . ASN A 1 264 ? -4.648  17.196  -29.029 1.00 48.77  ? 244 ASN A ND2   1 
ATOM   1887 N  N     . SER A 1 265 ? -9.680  14.325  -27.127 1.00 38.27  ? 245 SER A N     1 
ATOM   1888 C  CA    . SER A 1 265 ? -10.220 13.067  -26.570 1.00 41.90  ? 245 SER A CA    1 
ATOM   1889 C  C     . SER A 1 265 ? -11.739 13.106  -26.413 1.00 39.51  ? 245 SER A C     1 
ATOM   1890 O  O     . SER A 1 265 ? -12.331 14.170  -26.225 1.00 39.07  ? 245 SER A O     1 
ATOM   1891 C  CB    . SER A 1 265 ? -9.554  12.719  -25.224 1.00 44.00  ? 245 SER A CB    1 
ATOM   1892 O  OG    . SER A 1 265 ? -10.321 13.199  -24.121 1.00 47.76  ? 245 SER A OG    1 
ATOM   1893 N  N     . ARG A 1 266 ? -12.378 11.944  -26.500 1.00 39.60  ? 246 ARG A N     1 
ATOM   1894 C  CA    . ARG A 1 266 ? -13.835 11.870  -26.308 1.00 40.44  ? 246 ARG A CA    1 
ATOM   1895 C  C     . ARG A 1 266 ? -14.227 12.350  -24.928 1.00 41.94  ? 246 ARG A C     1 
ATOM   1896 O  O     . ARG A 1 266 ? -15.174 13.113  -24.768 1.00 41.83  ? 246 ARG A O     1 
ATOM   1897 C  CB    . ARG A 1 266 ? -14.319 10.442  -26.445 1.00 40.95  ? 246 ARG A CB    1 
ATOM   1898 C  CG    . ARG A 1 266 ? -14.146 9.881   -27.825 1.00 41.62  ? 246 ARG A CG    1 
ATOM   1899 C  CD    . ARG A 1 266 ? -14.865 8.567   -27.945 1.00 41.90  ? 246 ARG A CD    1 
ATOM   1900 N  NE    . ARG A 1 266 ? -14.587 7.977   -29.236 1.00 43.78  ? 246 ARG A NE    1 
ATOM   1901 C  CZ    . ARG A 1 266 ? -15.044 6.803   -29.636 1.00 45.13  ? 246 ARG A CZ    1 
ATOM   1902 N  NH1   . ARG A 1 266 ? -15.813 6.069   -28.834 1.00 45.07  ? 246 ARG A NH1   1 
ATOM   1903 N  NH2   . ARG A 1 266 ? -14.724 6.367   -30.847 1.00 45.46  ? 246 ARG A NH2   1 
ATOM   1904 N  N     . ALA A 1 267 ? -13.493 11.875  -23.929 1.00 44.18  ? 247 ALA A N     1 
ATOM   1905 C  CA    . ALA A 1 267 ? -13.766 12.221  -22.542 1.00 49.17  ? 247 ALA A CA    1 
ATOM   1906 C  C     . ALA A 1 267 ? -13.736 13.734  -22.364 1.00 49.52  ? 247 ALA A C     1 
ATOM   1907 O  O     . ALA A 1 267 ? -14.705 14.328  -21.873 1.00 50.37  ? 247 ALA A O     1 
ATOM   1908 C  CB    . ALA A 1 267 ? -12.748 11.554  -21.624 1.00 49.81  ? 247 ALA A CB    1 
ATOM   1909 N  N     . LYS A 1 268 ? -12.641 14.354  -22.804 1.00 47.08  ? 248 LYS A N     1 
ATOM   1910 C  CA    . LYS A 1 268 ? -12.493 15.814  -22.708 1.00 46.40  ? 248 LYS A CA    1 
ATOM   1911 C  C     . LYS A 1 268 ? -13.643 16.578  -23.367 1.00 42.16  ? 248 LYS A C     1 
ATOM   1912 O  O     . LYS A 1 268 ? -14.124 17.594  -22.834 1.00 44.15  ? 248 LYS A O     1 
ATOM   1913 C  CB    . LYS A 1 268 ? -11.155 16.243  -23.304 1.00 49.96  ? 248 LYS A CB    1 
ATOM   1914 C  CG    . LYS A 1 268 ? -10.679 17.613  -22.841 1.00 56.11  ? 248 LYS A CG    1 
ATOM   1915 C  CD    . LYS A 1 268 ? -9.203  17.564  -22.459 1.00 60.15  ? 248 LYS A CD    1 
ATOM   1916 C  CE    . LYS A 1 268 ? -8.584  18.950  -22.396 1.00 61.54  ? 248 LYS A CE    1 
ATOM   1917 N  NZ    . LYS A 1 268 ? -7.104  18.847  -22.261 1.00 62.66  ? 248 LYS A NZ    1 
ATOM   1918 N  N     . VAL A 1 269 ? -14.088 16.080  -24.518 1.00 39.41  ? 249 VAL A N     1 
ATOM   1919 C  CA    . VAL A 1 269 ? -15.242 16.636  -25.238 1.00 38.74  ? 249 VAL A CA    1 
ATOM   1920 C  C     . VAL A 1 269 ? -16.521 16.556  -24.403 1.00 40.33  ? 249 VAL A C     1 
ATOM   1921 O  O     . VAL A 1 269 ? -17.294 17.515  -24.364 1.00 42.26  ? 249 VAL A O     1 
ATOM   1922 C  CB    . VAL A 1 269 ? -15.415 15.935  -26.614 1.00 37.73  ? 249 VAL A CB    1 
ATOM   1923 C  CG1   . VAL A 1 269 ? -16.794 16.140  -27.224 1.00 35.67  ? 249 VAL A CG1   1 
ATOM   1924 C  CG2   . VAL A 1 269 ? -14.329 16.400  -27.573 1.00 38.43  ? 249 VAL A CG2   1 
ATOM   1925 N  N     . GLU A 1 270 ? -16.746 15.426  -23.737 1.00 46.11  ? 250 GLU A N     1 
ATOM   1926 C  CA    . GLU A 1 270 ? -17.945 15.260  -22.874 1.00 48.76  ? 250 GLU A CA    1 
ATOM   1927 C  C     . GLU A 1 270 ? -17.893 16.191  -21.662 1.00 45.08  ? 250 GLU A C     1 
ATOM   1928 O  O     . GLU A 1 270 ? -18.855 16.905  -21.389 1.00 43.60  ? 250 GLU A O     1 
ATOM   1929 C  CB    . GLU A 1 270 ? -18.111 13.811  -22.396 1.00 50.66  ? 250 GLU A CB    1 
ATOM   1930 C  CG    . GLU A 1 270 ? -18.319 12.780  -23.495 1.00 54.34  ? 250 GLU A CG    1 
ATOM   1931 C  CD    . GLU A 1 270 ? -19.773 12.585  -23.893 1.00 60.20  ? 250 GLU A CD    1 
ATOM   1932 O  OE1   . GLU A 1 270 ? -20.539 13.579  -23.906 1.00 61.02  ? 250 GLU A OE1   1 
ATOM   1933 O  OE2   . GLU A 1 270 ? -20.145 11.425  -24.211 1.00 63.76  ? 250 GLU A OE2   1 
ATOM   1934 N  N     . ASP A 1 271 ? -16.759 16.192  -20.965 1.00 47.29  ? 251 ASP A N     1 
ATOM   1935 C  CA    . ASP A 1 271 ? -16.548 17.076  -19.818 1.00 51.12  ? 251 ASP A CA    1 
ATOM   1936 C  C     . ASP A 1 271 ? -16.821 18.514  -20.227 1.00 53.83  ? 251 ASP A C     1 
ATOM   1937 O  O     . ASP A 1 271 ? -17.695 19.186  -19.656 1.00 58.55  ? 251 ASP A O     1 
ATOM   1938 C  CB    . ASP A 1 271 ? -15.107 17.000  -19.298 1.00 57.66  ? 251 ASP A CB    1 
ATOM   1939 C  CG    . ASP A 1 271 ? -14.687 15.596  -18.874 1.00 66.73  ? 251 ASP A CG    1 
ATOM   1940 O  OD1   . ASP A 1 271 ? -15.560 14.732  -18.626 1.00 77.42  ? 251 ASP A OD1   1 
ATOM   1941 O  OD2   . ASP A 1 271 ? -13.460 15.356  -18.782 1.00 72.92  ? 251 ASP A OD2   1 
ATOM   1942 N  N     . THR A 1 272 ? -16.088 18.978  -21.237 1.00 46.82  ? 252 THR A N     1 
ATOM   1943 C  CA    . THR A 1 272 ? -16.159 20.374  -21.621 1.00 40.72  ? 252 THR A CA    1 
ATOM   1944 C  C     . THR A 1 272 ? -17.556 20.727  -22.007 1.00 38.55  ? 252 THR A C     1 
ATOM   1945 O  O     . THR A 1 272 ? -18.070 21.774  -21.608 1.00 40.45  ? 252 THR A O     1 
ATOM   1946 C  CB    . THR A 1 272 ? -15.216 20.687  -22.796 1.00 37.61  ? 252 THR A CB    1 
ATOM   1947 O  OG1   . THR A 1 272 ? -13.877 20.474  -22.378 1.00 35.04  ? 252 THR A OG1   1 
ATOM   1948 C  CG2   . THR A 1 272 ? -15.346 22.121  -23.243 1.00 36.27  ? 252 THR A CG2   1 
ATOM   1949 N  N     . ALA A 1 273 ? -18.179 19.875  -22.805 1.00 40.97  ? 253 ALA A N     1 
ATOM   1950 C  CA    . ALA A 1 273 ? -19.580 20.099  -23.161 1.00 43.10  ? 253 ALA A CA    1 
ATOM   1951 C  C     . ALA A 1 273 ? -20.415 20.303  -21.900 1.00 46.36  ? 253 ALA A C     1 
ATOM   1952 O  O     . ALA A 1 273 ? -21.070 21.334  -21.748 1.00 44.48  ? 253 ALA A O     1 
ATOM   1953 C  CB    . ALA A 1 273 ? -20.121 18.933  -23.955 1.00 43.62  ? 253 ALA A CB    1 
ATOM   1954 N  N     . ALA A 1 274 ? -20.354 19.320  -20.998 1.00 49.89  ? 254 ALA A N     1 
ATOM   1955 C  CA    . ALA A 1 274 ? -21.123 19.335  -19.738 1.00 53.72  ? 254 ALA A CA    1 
ATOM   1956 C  C     . ALA A 1 274 ? -20.887 20.620  -18.950 1.00 56.14  ? 254 ALA A C     1 
ATOM   1957 O  O     . ALA A 1 274 ? -21.836 21.339  -18.610 1.00 58.61  ? 254 ALA A O     1 
ATOM   1958 C  CB    . ALA A 1 274 ? -20.779 18.114  -18.880 1.00 49.87  ? 254 ALA A CB    1 
ATOM   1959 N  N     . ARG A 1 275 ? -19.618 20.922  -18.696 1.00 58.16  ? 255 ARG A N     1 
ATOM   1960 C  CA    . ARG A 1 275 ? -19.267 22.065  -17.864 1.00 58.45  ? 255 ARG A CA    1 
ATOM   1961 C  C     . ARG A 1 275 ? -19.696 23.391  -18.467 1.00 59.61  ? 255 ARG A C     1 
ATOM   1962 O  O     . ARG A 1 275 ? -19.895 24.352  -17.738 1.00 64.31  ? 255 ARG A O     1 
ATOM   1963 C  CB    . ARG A 1 275 ? -17.781 22.066  -17.563 1.00 60.12  ? 255 ARG A CB    1 
ATOM   1964 C  CG    . ARG A 1 275 ? -17.366 20.877  -16.718 1.00 65.17  ? 255 ARG A CG    1 
ATOM   1965 C  CD    . ARG A 1 275 ? -15.904 20.966  -16.362 1.00 68.71  ? 255 ARG A CD    1 
ATOM   1966 N  NE    . ARG A 1 275 ? -15.465 19.801  -15.599 1.00 77.63  ? 255 ARG A NE    1 
ATOM   1967 C  CZ    . ARG A 1 275 ? -14.422 19.023  -15.903 1.00 83.11  ? 255 ARG A CZ    1 
ATOM   1968 N  NH1   . ARG A 1 275 ? -13.652 19.260  -16.966 1.00 82.95  ? 255 ARG A NH1   1 
ATOM   1969 N  NH2   . ARG A 1 275 ? -14.132 17.994  -15.119 1.00 86.34  ? 255 ARG A NH2   1 
ATOM   1970 N  N     . LEU A 1 276 ? -19.843 23.446  -19.786 1.00 59.91  ? 256 LEU A N     1 
ATOM   1971 C  CA    . LEU A 1 276 ? -20.364 24.641  -20.447 1.00 60.48  ? 256 LEU A CA    1 
ATOM   1972 C  C     . LEU A 1 276 ? -21.868 24.728  -20.293 1.00 60.49  ? 256 LEU A C     1 
ATOM   1973 O  O     . LEU A 1 276 ? -22.414 25.824  -20.137 1.00 62.35  ? 256 LEU A O     1 
ATOM   1974 C  CB    . LEU A 1 276 ? -20.021 24.646  -21.945 1.00 62.97  ? 256 LEU A CB    1 
ATOM   1975 C  CG    . LEU A 1 276 ? -18.751 25.353  -22.432 1.00 67.27  ? 256 LEU A CG    1 
ATOM   1976 C  CD1   . LEU A 1 276 ? -17.523 25.032  -21.588 1.00 70.22  ? 256 LEU A CD1   1 
ATOM   1977 C  CD2   . LEU A 1 276 ? -18.501 24.966  -23.883 1.00 66.35  ? 256 LEU A CD2   1 
ATOM   1978 N  N     . GLN A 1 277 ? -22.538 23.579  -20.396 1.00 60.77  ? 257 GLN A N     1 
ATOM   1979 C  CA    . GLN A 1 277 ? -23.999 23.506  -20.243 1.00 64.04  ? 257 GLN A CA    1 
ATOM   1980 C  C     . GLN A 1 277 ? -24.416 23.924  -18.833 1.00 64.63  ? 257 GLN A C     1 
ATOM   1981 O  O     . GLN A 1 277 ? -25.394 24.653  -18.656 1.00 60.00  ? 257 GLN A O     1 
ATOM   1982 C  CB    . GLN A 1 277 ? -24.506 22.094  -20.534 1.00 62.92  ? 257 GLN A CB    1 
ATOM   1983 C  CG    . GLN A 1 277 ? -24.530 21.748  -22.010 1.00 61.92  ? 257 GLN A CG    1 
ATOM   1984 C  CD    . GLN A 1 277 ? -24.396 20.260  -22.269 1.00 63.02  ? 257 GLN A CD    1 
ATOM   1985 O  OE1   . GLN A 1 277 ? -23.899 19.507  -21.432 1.00 65.59  ? 257 GLN A OE1   1 
ATOM   1986 N  NE2   . GLN A 1 277 ? -24.818 19.831  -23.445 1.00 61.76  ? 257 GLN A NE2   1 
ATOM   1987 N  N     . SER A 1 278 ? -23.664 23.443  -17.845 1.00 64.43  ? 258 SER A N     1 
ATOM   1988 C  CA    . SER A 1 278 ? -23.716 23.968  -16.486 1.00 65.49  ? 258 SER A CA    1 
ATOM   1989 C  C     . SER A 1 278 ? -23.889 25.501  -16.467 1.00 67.04  ? 258 SER A C     1 
ATOM   1990 O  O     . SER A 1 278 ? -24.925 26.005  -16.023 1.00 71.70  ? 258 SER A O     1 
ATOM   1991 C  CB    . SER A 1 278 ? -22.456 23.541  -15.726 1.00 65.90  ? 258 SER A CB    1 
ATOM   1992 O  OG    . SER A 1 278 ? -22.040 24.552  -14.837 1.00 73.88  ? 258 SER A OG    1 
ATOM   1993 N  N     . ARG A 1 279 ? -22.905 26.236  -16.990 1.00 64.04  ? 259 ARG A N     1 
ATOM   1994 C  CA    . ARG A 1 279 ? -22.967 27.709  -17.032 1.00 60.51  ? 259 ARG A CA    1 
ATOM   1995 C  C     . ARG A 1 279 ? -24.004 28.277  -18.008 1.00 55.56  ? 259 ARG A C     1 
ATOM   1996 O  O     . ARG A 1 279 ? -24.033 29.476  -18.218 1.00 57.40  ? 259 ARG A O     1 
ATOM   1997 C  CB    . ARG A 1 279 ? -21.589 28.317  -17.356 1.00 60.69  ? 259 ARG A CB    1 
ATOM   1998 C  CG    . ARG A 1 279 ? -20.589 28.316  -16.208 1.00 61.16  ? 259 ARG A CG    1 
ATOM   1999 C  CD    . ARG A 1 279 ? -19.897 26.976  -16.061 1.00 63.14  ? 259 ARG A CD    1 
ATOM   2000 N  NE    . ARG A 1 279 ? -18.718 27.023  -15.193 1.00 64.79  ? 259 ARG A NE    1 
ATOM   2001 C  CZ    . ARG A 1 279 ? -18.001 25.957  -14.831 1.00 70.43  ? 259 ARG A CZ    1 
ATOM   2002 N  NH1   . ARG A 1 279 ? -18.328 24.732  -15.257 1.00 70.53  ? 259 ARG A NH1   1 
ATOM   2003 N  NH2   . ARG A 1 279 ? -16.949 26.108  -14.029 1.00 71.92  ? 259 ARG A NH2   1 
ATOM   2004 N  N     . GLY A 1 280 ? -24.838 27.434  -18.614 1.00 55.47  ? 260 GLY A N     1 
ATOM   2005 C  CA    . GLY A 1 280 ? -25.984 27.901  -19.421 1.00 56.31  ? 260 GLY A CA    1 
ATOM   2006 C  C     . GLY A 1 280 ? -25.746 28.036  -20.924 1.00 59.31  ? 260 GLY A C     1 
ATOM   2007 O  O     . GLY A 1 280 ? -26.637 28.477  -21.677 1.00 57.81  ? 260 GLY A O     1 
ATOM   2008 N  N     . ILE A 1 281 ? -24.564 27.623  -21.378 1.00 59.51  ? 261 ILE A N     1 
ATOM   2009 C  CA    . ILE A 1 281 ? -24.133 27.907  -22.743 1.00 58.27  ? 261 ILE A CA    1 
ATOM   2010 C  C     . ILE A 1 281 ? -24.648 26.850  -23.700 1.00 53.31  ? 261 ILE A C     1 
ATOM   2011 O  O     . ILE A 1 281 ? -24.532 25.659  -23.437 1.00 53.01  ? 261 ILE A O     1 
ATOM   2012 C  CB    . ILE A 1 281 ? -22.600 28.010  -22.832 1.00 63.21  ? 261 ILE A CB    1 
ATOM   2013 C  CG1   . ILE A 1 281 ? -22.096 29.129  -21.912 1.00 61.46  ? 261 ILE A CG1   1 
ATOM   2014 C  CG2   . ILE A 1 281 ? -22.167 28.299  -24.264 1.00 66.29  ? 261 ILE A CG2   1 
ATOM   2015 C  CD1   . ILE A 1 281 ? -20.697 28.897  -21.402 1.00 63.23  ? 261 ILE A CD1   1 
ATOM   2016 N  N     . SER A 1 282 ? -25.223 27.294  -24.810 1.00 50.40  ? 262 SER A N     1 
ATOM   2017 C  CA    . SER A 1 282 ? -25.717 26.379  -25.821 1.00 49.08  ? 262 SER A CA    1 
ATOM   2018 C  C     . SER A 1 282 ? -24.537 25.616  -26.437 1.00 48.90  ? 262 SER A C     1 
ATOM   2019 O  O     . SER A 1 282 ? -23.853 26.107  -27.336 1.00 50.20  ? 262 SER A O     1 
ATOM   2020 C  CB    . SER A 1 282 ? -26.488 27.149  -26.880 1.00 48.16  ? 262 SER A CB    1 
ATOM   2021 O  OG    . SER A 1 282 ? -26.905 26.273  -27.904 1.00 52.11  ? 262 SER A OG    1 
ATOM   2022 N  N     . ALA A 1 283 ? -24.289 24.425  -25.908 1.00 47.20  ? 263 ALA A N     1 
ATOM   2023 C  CA    . ALA A 1 283 ? -23.180 23.596  -26.320 1.00 44.40  ? 263 ALA A CA    1 
ATOM   2024 C  C     . ALA A 1 283 ? -23.590 22.135  -26.292 1.00 46.25  ? 263 ALA A C     1 
ATOM   2025 O  O     . ALA A 1 283 ? -24.301 21.720  -25.383 1.00 45.66  ? 263 ALA A O     1 
ATOM   2026 C  CB    . ALA A 1 283 ? -22.005 23.815  -25.383 1.00 45.66  ? 263 ALA A CB    1 
ATOM   2027 N  N     . ALA A 1 284 ? -23.130 21.361  -27.279 1.00 46.17  ? 264 ALA A N     1 
ATOM   2028 C  CA    . ALA A 1 284 ? -23.307 19.900  -27.294 1.00 41.86  ? 264 ALA A CA    1 
ATOM   2029 C  C     . ALA A 1 284 ? -22.020 19.213  -27.734 1.00 39.20  ? 264 ALA A C     1 
ATOM   2030 O  O     . ALA A 1 284 ? -21.246 19.776  -28.487 1.00 40.66  ? 264 ALA A O     1 
ATOM   2031 C  CB    . ALA A 1 284 ? -24.444 19.513  -28.226 1.00 41.41  ? 264 ALA A CB    1 
ATOM   2032 N  N     . ALA A 1 285 ? -21.819 17.991  -27.264 1.00 37.04  ? 265 ALA A N     1 
ATOM   2033 C  CA    . ALA A 1 285 ? -20.654 17.191  -27.582 1.00 35.32  ? 265 ALA A CA    1 
ATOM   2034 C  C     . ALA A 1 285 ? -20.859 16.468  -28.900 1.00 35.10  ? 265 ALA A C     1 
ATOM   2035 O  O     . ALA A 1 285 ? -21.980 16.156  -29.251 1.00 35.03  ? 265 ALA A O     1 
ATOM   2036 C  CB    . ALA A 1 285 ? -20.405 16.178  -26.483 1.00 36.05  ? 265 ALA A CB    1 
ATOM   2037 N  N     . TYR A 1 286 ? -19.774 16.206  -29.633 1.00 33.82  ? 266 TYR A N     1 
ATOM   2038 C  CA    . TYR A 1 286 ? -19.858 15.493  -30.899 1.00 32.65  ? 266 TYR A CA    1 
ATOM   2039 C  C     . TYR A 1 286 ? -18.582 14.690  -31.052 1.00 35.74  ? 266 TYR A C     1 
ATOM   2040 O  O     . TYR A 1 286 ? -17.483 15.274  -31.085 1.00 34.25  ? 266 TYR A O     1 
ATOM   2041 C  CB    . TYR A 1 286 ? -20.037 16.463  -32.073 1.00 32.09  ? 266 TYR A CB    1 
ATOM   2042 C  CG    . TYR A 1 286 ? -20.212 15.770  -33.423 1.00 31.96  ? 266 TYR A CG    1 
ATOM   2043 C  CD1   . TYR A 1 286 ? -19.183 15.041  -33.996 1.00 31.80  ? 266 TYR A CD1   1 
ATOM   2044 C  CD2   . TYR A 1 286 ? -21.422 15.828  -34.116 1.00 31.00  ? 266 TYR A CD2   1 
ATOM   2045 C  CE1   . TYR A 1 286 ? -19.342 14.413  -35.220 1.00 30.72  ? 266 TYR A CE1   1 
ATOM   2046 C  CE2   . TYR A 1 286 ? -21.581 15.194  -35.339 1.00 29.51  ? 266 TYR A CE2   1 
ATOM   2047 C  CZ    . TYR A 1 286 ? -20.537 14.493  -35.875 1.00 30.87  ? 266 TYR A CZ    1 
ATOM   2048 O  OH    . TYR A 1 286 ? -20.689 13.864  -37.085 1.00 34.25  ? 266 TYR A OH    1 
ATOM   2049 N  N     . HIS A 1 287 ? -18.727 13.361  -31.115 1.00 35.88  ? 267 HIS A N     1 
ATOM   2050 C  CA    . HIS A 1 287 ? -17.605 12.449  -31.344 1.00 36.84  ? 267 HIS A CA    1 
ATOM   2051 C  C     . HIS A 1 287 ? -18.088 11.101  -31.874 1.00 36.49  ? 267 HIS A C     1 
ATOM   2052 O  O     . HIS A 1 287 ? -19.293 10.858  -31.928 1.00 35.12  ? 267 HIS A O     1 
ATOM   2053 C  CB    . HIS A 1 287 ? -16.745 12.289  -30.087 1.00 39.80  ? 267 HIS A CB    1 
ATOM   2054 C  CG    . HIS A 1 287 ? -17.482 11.797  -28.877 1.00 44.33  ? 267 HIS A CG    1 
ATOM   2055 N  ND1   . HIS A 1 287 ? -17.961 10.511  -28.764 1.00 46.56  ? 267 HIS A ND1   1 
ATOM   2056 C  CD2   . HIS A 1 287 ? -17.753 12.400  -27.695 1.00 46.86  ? 267 HIS A CD2   1 
ATOM   2057 C  CE1   . HIS A 1 287 ? -18.525 10.352  -27.582 1.00 47.97  ? 267 HIS A CE1   1 
ATOM   2058 N  NE2   . HIS A 1 287 ? -18.413 11.484  -26.913 1.00 48.10  ? 267 HIS A NE2   1 
ATOM   2059 N  N     . ALA A 1 288 ? -17.167 10.232  -32.286 1.00 36.27  ? 268 ALA A N     1 
ATOM   2060 C  CA    . ALA A 1 288 ? -17.574 9.004   -33.015 1.00 39.03  ? 268 ALA A CA    1 
ATOM   2061 C  C     . ALA A 1 288 ? -18.153 7.878   -32.155 1.00 41.09  ? 268 ALA A C     1 
ATOM   2062 O  O     . ALA A 1 288 ? -18.637 6.892   -32.701 1.00 43.08  ? 268 ALA A O     1 
ATOM   2063 C  CB    . ALA A 1 288 ? -16.436 8.463   -33.866 1.00 35.77  ? 268 ALA A CB    1 
ATOM   2064 N  N     . GLY A 1 289 ? -18.053 8.006   -30.835 1.00 43.55  ? 269 GLY A N     1 
ATOM   2065 C  CA    . GLY A 1 289 ? -18.709 7.103   -29.896 1.00 45.24  ? 269 GLY A CA    1 
ATOM   2066 C  C     . GLY A 1 289 ? -20.144 7.468   -29.563 1.00 49.17  ? 269 GLY A C     1 
ATOM   2067 O  O     . GLY A 1 289 ? -20.750 6.864   -28.682 1.00 54.20  ? 269 GLY A O     1 
ATOM   2068 N  N     . LEU A 1 290 ? -20.691 8.471   -30.237 1.00 50.96  ? 270 LEU A N     1 
ATOM   2069 C  CA    . LEU A 1 290 ? -22.104 8.783   -30.130 1.00 49.59  ? 270 LEU A CA    1 
ATOM   2070 C  C     . LEU A 1 290 ? -22.833 8.118   -31.274 1.00 53.01  ? 270 LEU A C     1 
ATOM   2071 O  O     . LEU A 1 290 ? -22.252 7.901   -32.330 1.00 51.08  ? 270 LEU A O     1 
ATOM   2072 C  CB    . LEU A 1 290 ? -22.326 10.290  -30.202 1.00 48.72  ? 270 LEU A CB    1 
ATOM   2073 C  CG    . LEU A 1 290 ? -21.592 11.113  -29.151 1.00 50.09  ? 270 LEU A CG    1 
ATOM   2074 C  CD1   . LEU A 1 290 ? -21.972 12.582  -29.268 1.00 47.72  ? 270 LEU A CD1   1 
ATOM   2075 C  CD2   . LEU A 1 290 ? -21.879 10.600  -27.743 1.00 52.05  ? 270 LEU A CD2   1 
ATOM   2076 N  N     . GLU A 1 291 ? -24.113 7.816   -31.065 1.00 58.52  ? 271 GLU A N     1 
ATOM   2077 C  CA    . GLU A 1 291 ? -24.945 7.191   -32.089 1.00 65.08  ? 271 GLU A CA    1 
ATOM   2078 C  C     . GLU A 1 291 ? -25.152 8.098   -33.301 1.00 65.46  ? 271 GLU A C     1 
ATOM   2079 O  O     . GLU A 1 291 ? -25.308 9.309   -33.156 1.00 64.32  ? 271 GLU A O     1 
ATOM   2080 C  CB    . GLU A 1 291 ? -26.310 6.817   -31.507 1.00 74.93  ? 271 GLU A CB    1 
ATOM   2081 C  CG    . GLU A 1 291 ? -26.290 5.671   -30.504 1.00 81.38  ? 271 GLU A CG    1 
ATOM   2082 C  CD    . GLU A 1 291 ? -27.649 5.450   -29.860 1.00 89.65  ? 271 GLU A CD    1 
ATOM   2083 O  OE1   . GLU A 1 291 ? -27.694 5.108   -28.657 1.00 90.43  ? 271 GLU A OE1   1 
ATOM   2084 O  OE2   . GLU A 1 291 ? -28.676 5.630   -30.555 1.00 93.58  ? 271 GLU A OE2   1 
ATOM   2085 N  N     . HIS A 1 292 ? -25.192 7.494   -34.487 1.00 69.24  ? 272 HIS A N     1 
ATOM   2086 C  CA    . HIS A 1 292 ? -25.290 8.242   -35.745 1.00 74.06  ? 272 HIS A CA    1 
ATOM   2087 C  C     . HIS A 1 292 ? -26.487 9.179   -35.870 1.00 75.98  ? 272 HIS A C     1 
ATOM   2088 O  O     . HIS A 1 292 ? -26.418 10.147  -36.632 1.00 81.49  ? 272 HIS A O     1 
ATOM   2089 C  CB    . HIS A 1 292 ? -25.279 7.304   -36.954 1.00 79.01  ? 272 HIS A CB    1 
ATOM   2090 C  CG    . HIS A 1 292 ? -23.951 7.225   -37.637 1.00 87.44  ? 272 HIS A CG    1 
ATOM   2091 N  ND1   . HIS A 1 292 ? -23.015 6.261   -37.332 1.00 91.68  ? 272 HIS A ND1   1 
ATOM   2092 C  CD2   . HIS A 1 292 ? -23.398 7.998   -38.602 1.00 92.13  ? 272 HIS A CD2   1 
ATOM   2093 C  CE1   . HIS A 1 292 ? -21.944 6.439   -38.085 1.00 94.54  ? 272 HIS A CE1   1 
ATOM   2094 N  NE2   . HIS A 1 292 ? -22.150 7.487   -38.864 1.00 94.25  ? 272 HIS A NE2   1 
ATOM   2095 N  N     . GLU A 1 293 ? -27.580 8.897   -35.161 1.00 69.63  ? 273 GLU A N     1 
ATOM   2096 C  CA    . GLU A 1 293 ? -28.741 9.780   -35.209 1.00 67.37  ? 273 GLU A CA    1 
ATOM   2097 C  C     . GLU A 1 293 ? -28.541 10.993  -34.275 1.00 61.98  ? 273 GLU A C     1 
ATOM   2098 O  O     . GLU A 1 293 ? -29.060 12.086  -34.548 1.00 54.21  ? 273 GLU A O     1 
ATOM   2099 C  CB    . GLU A 1 293 ? -30.045 9.009   -34.923 1.00 72.34  ? 273 GLU A CB    1 
ATOM   2100 C  CG    . GLU A 1 293 ? -30.449 8.899   -33.458 1.00 78.26  ? 273 GLU A CG    1 
ATOM   2101 C  CD    . GLU A 1 293 ? -31.340 7.695   -33.179 1.00 83.55  ? 273 GLU A CD    1 
ATOM   2102 O  OE1   . GLU A 1 293 ? -32.533 7.875   -32.836 1.00 77.73  ? 273 GLU A OE1   1 
ATOM   2103 O  OE2   . GLU A 1 293 ? -30.837 6.557   -33.304 1.00 90.50  ? 273 GLU A OE2   1 
ATOM   2104 N  N     . VAL A 1 294 ? -27.772 10.811  -33.199 1.00 55.05  ? 274 VAL A N     1 
ATOM   2105 C  CA    . VAL A 1 294 ? -27.381 11.942  -32.339 1.00 53.90  ? 274 VAL A CA    1 
ATOM   2106 C  C     . VAL A 1 294 ? -26.393 12.888  -33.056 1.00 50.30  ? 274 VAL A C     1 
ATOM   2107 O  O     . VAL A 1 294 ? -26.585 14.111  -33.094 1.00 47.70  ? 274 VAL A O     1 
ATOM   2108 C  CB    . VAL A 1 294 ? -26.736 11.469  -31.023 1.00 54.69  ? 274 VAL A CB    1 
ATOM   2109 C  CG1   . VAL A 1 294 ? -26.346 12.665  -30.159 1.00 54.14  ? 274 VAL A CG1   1 
ATOM   2110 C  CG2   . VAL A 1 294 ? -27.681 10.553  -30.262 1.00 56.42  ? 274 VAL A CG2   1 
ATOM   2111 N  N     . ARG A 1 295 ? -25.337 12.320  -33.626 1.00 48.24  ? 275 ARG A N     1 
ATOM   2112 C  CA    . ARG A 1 295 ? -24.378 13.113  -34.396 1.00 47.66  ? 275 ARG A CA    1 
ATOM   2113 C  C     . ARG A 1 295 ? -25.117 13.951  -35.451 1.00 47.31  ? 275 ARG A C     1 
ATOM   2114 O  O     . ARG A 1 295 ? -24.874 15.167  -35.599 1.00 42.06  ? 275 ARG A O     1 
ATOM   2115 C  CB    . ARG A 1 295 ? -23.324 12.217  -35.056 1.00 46.26  ? 275 ARG A CB    1 
ATOM   2116 C  CG    . ARG A 1 295 ? -22.315 11.597  -34.092 1.00 45.94  ? 275 ARG A CG    1 
ATOM   2117 C  CD    . ARG A 1 295 ? -21.429 10.541  -34.776 1.00 46.55  ? 275 ARG A CD    1 
ATOM   2118 N  NE    . ARG A 1 295 ? -20.531 11.123  -35.792 1.00 48.73  ? 275 ARG A NE    1 
ATOM   2119 C  CZ    . ARG A 1 295 ? -19.510 10.487  -36.386 1.00 49.59  ? 275 ARG A CZ    1 
ATOM   2120 N  NH1   . ARG A 1 295 ? -19.225 9.214   -36.104 1.00 47.13  ? 275 ARG A NH1   1 
ATOM   2121 N  NH2   . ARG A 1 295 ? -18.772 11.132  -37.292 1.00 46.81  ? 275 ARG A NH2   1 
ATOM   2122 N  N     . ALA A 1 296 ? -26.044 13.303  -36.151 1.00 47.85  ? 276 ALA A N     1 
ATOM   2123 C  CA    . ALA A 1 296 ? -26.787 13.949  -37.234 1.00 48.86  ? 276 ALA A CA    1 
ATOM   2124 C  C     . ALA A 1 296 ? -27.609 15.116  -36.721 1.00 45.94  ? 276 ALA A C     1 
ATOM   2125 O  O     . ALA A 1 296 ? -27.708 16.156  -37.380 1.00 44.53  ? 276 ALA A O     1 
ATOM   2126 C  CB    . ALA A 1 296 ? -27.687 12.942  -37.940 1.00 49.54  ? 276 ALA A CB    1 
ATOM   2127 N  N     . SER A 1 297 ? -28.188 14.934  -35.539 1.00 46.90  ? 277 SER A N     1 
ATOM   2128 C  CA    . SER A 1 297 ? -29.022 15.957  -34.908 1.00 48.16  ? 277 SER A CA    1 
ATOM   2129 C  C     . SER A 1 297 ? -28.198 17.158  -34.466 1.00 47.58  ? 277 SER A C     1 
ATOM   2130 O  O     . SER A 1 297 ? -28.607 18.314  -34.676 1.00 44.92  ? 277 SER A O     1 
ATOM   2131 C  CB    . SER A 1 297 ? -29.752 15.376  -33.686 1.00 50.54  ? 277 SER A CB    1 
ATOM   2132 O  OG    . SER A 1 297 ? -30.286 16.414  -32.873 1.00 54.39  ? 277 SER A OG    1 
ATOM   2133 N  N     . VAL A 1 298 ? -27.064 16.874  -33.816 1.00 45.42  ? 278 VAL A N     1 
ATOM   2134 C  CA    . VAL A 1 298 ? -26.124 17.925  -33.392 1.00 44.17  ? 278 VAL A CA    1 
ATOM   2135 C  C     . VAL A 1 298 ? -25.654 18.750  -34.596 1.00 41.19  ? 278 VAL A C     1 
ATOM   2136 O  O     . VAL A 1 298 ? -25.714 19.969  -34.572 1.00 36.43  ? 278 VAL A O     1 
ATOM   2137 C  CB    . VAL A 1 298 ? -24.920 17.347  -32.615 1.00 41.30  ? 278 VAL A CB    1 
ATOM   2138 C  CG1   . VAL A 1 298 ? -23.804 18.369  -32.467 1.00 41.14  ? 278 VAL A CG1   1 
ATOM   2139 C  CG2   . VAL A 1 298 ? -25.362 16.891  -31.242 1.00 42.14  ? 278 VAL A CG2   1 
ATOM   2140 N  N     . GLN A 1 299 ? -25.209 18.076  -35.647 1.00 45.91  ? 279 GLN A N     1 
ATOM   2141 C  CA    . GLN A 1 299 ? -24.740 18.766  -36.848 1.00 47.78  ? 279 GLN A CA    1 
ATOM   2142 C  C     . GLN A 1 299 ? -25.847 19.630  -37.449 1.00 49.94  ? 279 GLN A C     1 
ATOM   2143 O  O     . GLN A 1 299 ? -25.645 20.832  -37.711 1.00 43.61  ? 279 GLN A O     1 
ATOM   2144 C  CB    . GLN A 1 299 ? -24.234 17.766  -37.881 1.00 48.43  ? 279 GLN A CB    1 
ATOM   2145 C  CG    . GLN A 1 299 ? -23.986 18.386  -39.245 1.00 53.59  ? 279 GLN A CG    1 
ATOM   2146 C  CD    . GLN A 1 299 ? -23.133 17.534  -40.157 1.00 56.78  ? 279 GLN A CD    1 
ATOM   2147 O  OE1   . GLN A 1 299 ? -22.776 16.396  -39.837 1.00 61.46  ? 279 GLN A OE1   1 
ATOM   2148 N  NE2   . GLN A 1 299 ? -22.791 18.089  -41.305 1.00 58.18  ? 279 GLN A NE2   1 
ATOM   2149 N  N     . GLU A 1 300 ? -27.003 19.001  -37.667 1.00 52.06  ? 280 GLU A N     1 
ATOM   2150 C  CA    . GLU A 1 300 ? -28.197 19.682  -38.187 1.00 53.99  ? 280 GLU A CA    1 
ATOM   2151 C  C     . GLU A 1 300 ? -28.597 20.869  -37.320 1.00 46.30  ? 280 GLU A C     1 
ATOM   2152 O  O     . GLU A 1 300 ? -28.925 21.922  -37.850 1.00 47.65  ? 280 GLU A O     1 
ATOM   2153 C  CB    . GLU A 1 300 ? -29.369 18.693  -38.318 1.00 60.79  ? 280 GLU A CB    1 
ATOM   2154 C  CG    . GLU A 1 300 ? -30.710 19.306  -38.729 1.00 71.73  ? 280 GLU A CG    1 
ATOM   2155 C  CD    . GLU A 1 300 ? -30.865 19.523  -40.231 1.00 77.26  ? 280 GLU A CD    1 
ATOM   2156 O  OE1   . GLU A 1 300 ? -30.210 20.444  -40.778 1.00 81.11  ? 280 GLU A OE1   1 
ATOM   2157 O  OE2   . GLU A 1 300 ? -31.671 18.786  -40.856 1.00 81.31  ? 280 GLU A OE2   1 
ATOM   2158 N  N     . LYS A 1 301 ? -28.566 20.717  -35.999 1.00 42.68  ? 281 LYS A N     1 
ATOM   2159 C  CA    . LYS A 1 301 ? -28.913 21.834  -35.128 1.00 44.78  ? 281 LYS A CA    1 
ATOM   2160 C  C     . LYS A 1 301 ? -27.908 22.962  -35.294 1.00 44.82  ? 281 LYS A C     1 
ATOM   2161 O  O     . LYS A 1 301 ? -28.288 24.122  -35.518 1.00 43.55  ? 281 LYS A O     1 
ATOM   2162 C  CB    . LYS A 1 301 ? -28.991 21.421  -33.658 1.00 47.96  ? 281 LYS A CB    1 
ATOM   2163 C  CG    . LYS A 1 301 ? -30.401 21.089  -33.205 1.00 53.61  ? 281 LYS A CG    1 
ATOM   2164 C  CD    . LYS A 1 301 ? -30.510 20.952  -31.689 1.00 59.13  ? 281 LYS A CD    1 
ATOM   2165 C  CE    . LYS A 1 301 ? -30.153 19.559  -31.193 1.00 64.60  ? 281 LYS A CE    1 
ATOM   2166 N  NZ    . LYS A 1 301 ? -31.204 18.552  -31.515 1.00 69.06  ? 281 LYS A NZ    1 
ATOM   2167 N  N     . PHE A 1 302 ? -26.624 22.616  -35.193 1.00 41.86  ? 282 PHE A N     1 
ATOM   2168 C  CA    . PHE A 1 302 ? -25.561 23.586  -35.398 1.00 39.46  ? 282 PHE A CA    1 
ATOM   2169 C  C     . PHE A 1 302 ? -25.755 24.336  -36.701 1.00 38.11  ? 282 PHE A C     1 
ATOM   2170 O  O     . PHE A 1 302 ? -25.592 25.534  -36.732 1.00 39.63  ? 282 PHE A O     1 
ATOM   2171 C  CB    . PHE A 1 302 ? -24.205 22.903  -35.388 1.00 39.00  ? 282 PHE A CB    1 
ATOM   2172 C  CG    . PHE A 1 302 ? -23.045 23.849  -35.380 1.00 38.06  ? 282 PHE A CG    1 
ATOM   2173 C  CD1   . PHE A 1 302 ? -22.885 24.762  -34.354 1.00 37.40  ? 282 PHE A CD1   1 
ATOM   2174 C  CD2   . PHE A 1 302 ? -22.084 23.794  -36.385 1.00 38.64  ? 282 PHE A CD2   1 
ATOM   2175 C  CE1   . PHE A 1 302 ? -21.804 25.624  -34.342 1.00 40.14  ? 282 PHE A CE1   1 
ATOM   2176 C  CE2   . PHE A 1 302 ? -20.995 24.641  -36.368 1.00 38.49  ? 282 PHE A CE2   1 
ATOM   2177 C  CZ    . PHE A 1 302 ? -20.858 25.566  -35.349 1.00 38.76  ? 282 PHE A CZ    1 
ATOM   2178 N  N     . GLN A 1 303 ? -26.127 23.635  -37.762 1.00 40.87  ? 283 GLN A N     1 
ATOM   2179 C  CA    . GLN A 1 303 ? -26.362 24.271  -39.054 1.00 49.38  ? 283 GLN A CA    1 
ATOM   2180 C  C     . GLN A 1 303 ? -27.574 25.196  -39.022 1.00 53.54  ? 283 GLN A C     1 
ATOM   2181 O  O     . GLN A 1 303 ? -27.529 26.280  -39.568 1.00 58.37  ? 283 GLN A O     1 
ATOM   2182 C  CB    . GLN A 1 303 ? -26.565 23.215  -40.135 1.00 52.98  ? 283 GLN A CB    1 
ATOM   2183 C  CG    . GLN A 1 303 ? -25.388 22.265  -40.286 1.00 57.63  ? 283 GLN A CG    1 
ATOM   2184 C  CD    . GLN A 1 303 ? -24.578 22.470  -41.552 1.00 61.18  ? 283 GLN A CD    1 
ATOM   2185 O  OE1   . GLN A 1 303 ? -24.401 23.600  -42.050 1.00 58.09  ? 283 GLN A OE1   1 
ATOM   2186 N  NE2   . GLN A 1 303 ? -24.068 21.363  -42.085 1.00 61.98  ? 283 GLN A NE2   1 
ATOM   2187 N  N     . ARG A 1 304 ? -28.648 24.758  -38.371 1.00 60.82  ? 284 ARG A N     1 
ATOM   2188 C  CA    . ARG A 1 304 ? -29.878 25.552  -38.229 1.00 66.08  ? 284 ARG A CA    1 
ATOM   2189 C  C     . ARG A 1 304 ? -29.737 26.710  -37.234 1.00 62.98  ? 284 ARG A C     1 
ATOM   2190 O  O     . ARG A 1 304 ? -30.696 27.439  -36.998 1.00 62.75  ? 284 ARG A O     1 
ATOM   2191 C  CB    . ARG A 1 304 ? -31.059 24.657  -37.788 1.00 71.43  ? 284 ARG A CB    1 
ATOM   2192 C  CG    . ARG A 1 304 ? -31.919 24.117  -38.925 1.00 79.91  ? 284 ARG A CG    1 
ATOM   2193 C  CD    . ARG A 1 304 ? -33.344 23.775  -38.469 1.00 85.02  ? 284 ARG A CD    1 
ATOM   2194 N  NE    . ARG A 1 304 ? -34.335 23.922  -39.545 1.00 87.99  ? 284 ARG A NE    1 
ATOM   2195 C  CZ    . ARG A 1 304 ? -35.661 23.951  -39.380 1.00 87.07  ? 284 ARG A CZ    1 
ATOM   2196 N  NH1   . ARG A 1 304 ? -36.207 23.846  -38.168 1.00 89.04  ? 284 ARG A NH1   1 
ATOM   2197 N  NH2   . ARG A 1 304 ? -36.454 24.089  -40.443 1.00 83.02  ? 284 ARG A NH2   1 
ATOM   2198 N  N     . ASP A 1 305 ? -28.558 26.869  -36.644 1.00 58.44  ? 285 ASP A N     1 
ATOM   2199 C  CA    . ASP A 1 305 ? -28.316 27.890  -35.623 1.00 59.27  ? 285 ASP A CA    1 
ATOM   2200 C  C     . ASP A 1 305 ? -29.183 27.698  -34.378 1.00 57.78  ? 285 ASP A C     1 
ATOM   2201 O  O     . ASP A 1 305 ? -29.360 28.631  -33.593 1.00 55.58  ? 285 ASP A O     1 
ATOM   2202 C  CB    . ASP A 1 305 ? -28.455 29.310  -36.198 1.00 60.60  ? 285 ASP A CB    1 
ATOM   2203 C  CG    . ASP A 1 305 ? -27.221 29.749  -36.975 1.00 62.74  ? 285 ASP A CG    1 
ATOM   2204 O  OD1   . ASP A 1 305 ? -26.137 29.833  -36.354 1.00 64.49  ? 285 ASP A OD1   1 
ATOM   2205 O  OD2   . ASP A 1 305 ? -27.329 30.013  -38.197 1.00 60.87  ? 285 ASP A OD2   1 
ATOM   2206 N  N     . ASP A 1 306 ? -29.681 26.471  -34.191 1.00 58.92  ? 286 ASP A N     1 
ATOM   2207 C  CA    . ASP A 1 306 ? -30.390 26.068  -32.966 1.00 59.97  ? 286 ASP A CA    1 
ATOM   2208 C  C     . ASP A 1 306 ? -29.399 25.667  -31.881 1.00 55.94  ? 286 ASP A C     1 
ATOM   2209 O  O     . ASP A 1 306 ? -29.763 25.552  -30.713 1.00 55.24  ? 286 ASP A O     1 
ATOM   2210 C  CB    . ASP A 1 306 ? -31.336 24.891  -33.244 1.00 63.00  ? 286 ASP A CB    1 
ATOM   2211 C  CG    . ASP A 1 306 ? -32.516 25.272  -34.138 1.00 69.29  ? 286 ASP A CG    1 
ATOM   2212 O  OD1   . ASP A 1 306 ? -33.060 26.392  -33.970 1.00 76.15  ? 286 ASP A OD1   1 
ATOM   2213 O  OD2   . ASP A 1 306 ? -32.907 24.444  -35.002 1.00 66.42  ? 286 ASP A OD2   1 
ATOM   2214 N  N     . LEU A 1 307 ? -28.154 25.418  -32.283 1.00 52.71  ? 287 LEU A N     1 
ATOM   2215 C  CA    . LEU A 1 307 ? -27.060 25.142  -31.349 1.00 49.50  ? 287 LEU A CA    1 
ATOM   2216 C  C     . LEU A 1 307 ? -25.972 26.188  -31.570 1.00 44.16  ? 287 LEU A C     1 
ATOM   2217 O  O     . LEU A 1 307 ? -25.625 26.483  -32.704 1.00 41.22  ? 287 LEU A O     1 
ATOM   2218 C  CB    . LEU A 1 307 ? -26.482 23.750  -31.607 1.00 48.39  ? 287 LEU A CB    1 
ATOM   2219 C  CG    . LEU A 1 307 ? -26.300 22.863  -30.387 1.00 47.51  ? 287 LEU A CG    1 
ATOM   2220 C  CD1   . LEU A 1 307 ? -25.637 21.566  -30.810 1.00 51.80  ? 287 LEU A CD1   1 
ATOM   2221 C  CD2   . LEU A 1 307 ? -25.479 23.521  -29.293 1.00 48.86  ? 287 LEU A CD2   1 
ATOM   2222 N  N     . GLN A 1 308 ? -25.439 26.749  -30.495 1.00 43.31  ? 288 GLN A N     1 
ATOM   2223 C  CA    . GLN A 1 308 ? -24.436 27.801  -30.624 1.00 42.85  ? 288 GLN A CA    1 
ATOM   2224 C  C     . GLN A 1 308 ? -23.087 27.146  -30.898 1.00 39.03  ? 288 GLN A C     1 
ATOM   2225 O  O     . GLN A 1 308 ? -22.432 27.433  -31.893 1.00 37.59  ? 288 GLN A O     1 
ATOM   2226 C  CB    . GLN A 1 308 ? -24.372 28.662  -29.355 1.00 44.73  ? 288 GLN A CB    1 
ATOM   2227 C  CG    . GLN A 1 308 ? -23.448 29.865  -29.478 1.00 48.78  ? 288 GLN A CG    1 
ATOM   2228 C  CD    . GLN A 1 308 ? -23.184 30.576  -28.153 1.00 52.67  ? 288 GLN A CD    1 
ATOM   2229 O  OE1   . GLN A 1 308 ? -24.082 30.693  -27.303 1.00 51.81  ? 288 GLN A OE1   1 
ATOM   2230 N  NE2   . GLN A 1 308 ? -21.937 31.067  -27.971 1.00 50.88  ? 288 GLN A NE2   1 
ATOM   2231 N  N     . ILE A 1 309 ? -22.726 26.219  -30.024 1.00 36.40  ? 289 ILE A N     1 
ATOM   2232 C  CA    . ILE A 1 309 ? -21.412 25.649  -30.000 1.00 34.53  ? 289 ILE A CA    1 
ATOM   2233 C  C     . ILE A 1 309 ? -21.426 24.127  -30.124 1.00 33.40  ? 289 ILE A C     1 
ATOM   2234 O  O     . ILE A 1 309 ? -22.210 23.456  -29.461 1.00 37.31  ? 289 ILE A O     1 
ATOM   2235 C  CB    . ILE A 1 309 ? -20.720 26.029  -28.682 1.00 33.38  ? 289 ILE A CB    1 
ATOM   2236 C  CG1   . ILE A 1 309 ? -20.679 27.541  -28.557 1.00 32.81  ? 289 ILE A CG1   1 
ATOM   2237 C  CG2   . ILE A 1 309 ? -19.312 25.444  -28.623 1.00 34.30  ? 289 ILE A CG2   1 
ATOM   2238 C  CD1   . ILE A 1 309 ? -19.964 28.034  -27.320 1.00 34.10  ? 289 ILE A CD1   1 
ATOM   2239 N  N     . VAL A 1 310 ? -20.525 23.592  -30.948 1.00 31.08  ? 290 VAL A N     1 
ATOM   2240 C  CA    . VAL A 1 310 ? -20.213 22.159  -30.949 1.00 29.68  ? 290 VAL A CA    1 
ATOM   2241 C  C     . VAL A 1 310 ? -18.828 21.933  -30.316 1.00 28.79  ? 290 VAL A C     1 
ATOM   2242 O  O     . VAL A 1 310 ? -17.864 22.627  -30.624 1.00 30.85  ? 290 VAL A O     1 
ATOM   2243 C  CB    . VAL A 1 310 ? -20.281 21.571  -32.372 1.00 30.75  ? 290 VAL A CB    1 
ATOM   2244 C  CG1   . VAL A 1 310 ? -19.950 20.089  -32.359 1.00 30.66  ? 290 VAL A CG1   1 
ATOM   2245 C  CG2   . VAL A 1 310 ? -21.664 21.803  -32.980 1.00 31.15  ? 290 VAL A CG2   1 
ATOM   2246 N  N     . VAL A 1 311 ? -18.759 21.005  -29.376 1.00 28.33  ? 291 VAL A N     1 
ATOM   2247 C  CA    . VAL A 1 311 ? -17.521 20.630  -28.733 1.00 28.14  ? 291 VAL A CA    1 
ATOM   2248 C  C     . VAL A 1 311 ? -17.227 19.277  -29.338 1.00 27.89  ? 291 VAL A C     1 
ATOM   2249 O  O     . VAL A 1 311 ? -18.112 18.424  -29.365 1.00 28.10  ? 291 VAL A O     1 
ATOM   2250 C  CB    . VAL A 1 311 ? -17.682 20.455  -27.215 1.00 28.41  ? 291 VAL A CB    1 
ATOM   2251 C  CG1   . VAL A 1 311 ? -16.320 20.241  -26.577 1.00 28.21  ? 291 VAL A CG1   1 
ATOM   2252 C  CG2   . VAL A 1 311 ? -18.387 21.643  -26.591 1.00 28.10  ? 291 VAL A CG2   1 
ATOM   2253 N  N     . ALA A 1 312 ? -16.016 19.080  -29.851 1.00 27.39  ? 292 ALA A N     1 
ATOM   2254 C  CA    . ALA A 1 312 ? -15.782 17.971  -30.770 1.00 25.35  ? 292 ALA A CA    1 
ATOM   2255 C  C     . ALA A 1 312 ? -14.381 17.444  -30.801 1.00 25.08  ? 292 ALA A C     1 
ATOM   2256 O  O     . ALA A 1 312 ? -13.434 18.158  -30.529 1.00 25.27  ? 292 ALA A O     1 
ATOM   2257 C  CB    . ALA A 1 312 ? -16.154 18.400  -32.177 1.00 25.64  ? 292 ALA A CB    1 
ATOM   2258 N  N     . THR A 1 313 ? -14.280 16.183  -31.195 1.00 25.54  ? 293 THR A N     1 
ATOM   2259 C  CA    . THR A 1 313 ? -13.049 15.601  -31.689 1.00 26.28  ? 293 THR A CA    1 
ATOM   2260 C  C     . THR A 1 313 ? -12.940 15.858  -33.194 1.00 26.70  ? 293 THR A C     1 
ATOM   2261 O  O     . THR A 1 313 ? -13.835 16.458  -33.805 1.00 26.28  ? 293 THR A O     1 
ATOM   2262 C  CB    . THR A 1 313 ? -13.082 14.091  -31.476 1.00 27.52  ? 293 THR A CB    1 
ATOM   2263 O  OG1   . THR A 1 313 ? -14.192 13.556  -32.205 1.00 27.83  ? 293 THR A OG1   1 
ATOM   2264 C  CG2   . THR A 1 313 ? -13.265 13.755  -29.978 1.00 27.36  ? 293 THR A CG2   1 
ATOM   2265 N  N     . VAL A 1 314 ? -11.848 15.385  -33.785 1.00 27.90  ? 294 VAL A N     1 
ATOM   2266 C  CA    . VAL A 1 314 ? -11.649 15.396  -35.250 1.00 31.28  ? 294 VAL A CA    1 
ATOM   2267 C  C     . VAL A 1 314 ? -12.786 14.807  -36.077 1.00 31.95  ? 294 VAL A C     1 
ATOM   2268 O  O     . VAL A 1 314 ? -12.839 15.053  -37.258 1.00 36.57  ? 294 VAL A O     1 
ATOM   2269 C  CB    . VAL A 1 314 ? -10.367 14.640  -35.662 1.00 32.51  ? 294 VAL A CB    1 
ATOM   2270 C  CG1   . VAL A 1 314 ? -9.149  15.349  -35.107 1.00 35.04  ? 294 VAL A CG1   1 
ATOM   2271 C  CG2   . VAL A 1 314 ? -10.394 13.196  -35.159 1.00 33.60  ? 294 VAL A CG2   1 
ATOM   2272 N  N     . ALA A 1 315 ? -13.652 13.995  -35.476 1.00 32.63  ? 295 ALA A N     1 
ATOM   2273 C  CA    . ALA A 1 315 ? -14.842 13.483  -36.151 1.00 33.02  ? 295 ALA A CA    1 
ATOM   2274 C  C     . ALA A 1 315 ? -15.762 14.577  -36.685 1.00 32.51  ? 295 ALA A C     1 
ATOM   2275 O  O     . ALA A 1 315 ? -16.454 14.369  -37.675 1.00 33.01  ? 295 ALA A O     1 
ATOM   2276 C  CB    . ALA A 1 315 ? -15.627 12.582  -35.206 1.00 34.74  ? 295 ALA A CB    1 
ATOM   2277 N  N     . PHE A 1 316 ? -15.800 15.729  -36.028 1.00 30.23  ? 296 PHE A N     1 
ATOM   2278 C  CA    . PHE A 1 316 ? -16.596 16.845  -36.536 1.00 31.02  ? 296 PHE A CA    1 
ATOM   2279 C  C     . PHE A 1 316 ? -15.774 17.609  -37.551 1.00 34.30  ? 296 PHE A C     1 
ATOM   2280 O  O     . PHE A 1 316 ? -14.826 18.341  -37.226 1.00 33.57  ? 296 PHE A O     1 
ATOM   2281 C  CB    . PHE A 1 316 ? -17.040 17.749  -35.414 1.00 29.88  ? 296 PHE A CB    1 
ATOM   2282 C  CG    . PHE A 1 316 ? -18.142 18.672  -35.788 1.00 30.01  ? 296 PHE A CG    1 
ATOM   2283 C  CD1   . PHE A 1 316 ? -19.407 18.169  -36.102 1.00 29.20  ? 296 PHE A CD1   1 
ATOM   2284 C  CD2   . PHE A 1 316 ? -17.942 20.046  -35.785 1.00 29.62  ? 296 PHE A CD2   1 
ATOM   2285 C  CE1   . PHE A 1 316 ? -20.440 19.021  -36.430 1.00 28.89  ? 296 PHE A CE1   1 
ATOM   2286 C  CE2   . PHE A 1 316 ? -18.972 20.906  -36.123 1.00 30.40  ? 296 PHE A CE2   1 
ATOM   2287 C  CZ    . PHE A 1 316 ? -20.226 20.396  -36.447 1.00 30.27  ? 296 PHE A CZ    1 
ATOM   2288 N  N     . GLY A 1 317 ? -16.106 17.415  -38.812 1.00 39.58  ? 297 GLY A N     1 
ATOM   2289 C  CA    . GLY A 1 317 ? -15.186 17.868  -39.824 1.00 42.46  ? 297 GLY A CA    1 
ATOM   2290 C  C     . GLY A 1 317 ? -15.688 17.995  -41.222 1.00 38.20  ? 297 GLY A C     1 
ATOM   2291 O  O     . GLY A 1 317 ? -16.331 18.969  -41.537 1.00 39.19  ? 297 GLY A O     1 
ATOM   2292 N  N     . MET A 1 318 ? -15.353 17.008  -42.044 1.00 42.20  ? 298 MET A N     1 
ATOM   2293 C  CA    . MET A 1 318 ? -15.528 17.086  -43.481 1.00 42.79  ? 298 MET A CA    1 
ATOM   2294 C  C     . MET A 1 318 ? -17.018 17.173  -43.795 1.00 43.29  ? 298 MET A C     1 
ATOM   2295 O  O     . MET A 1 318 ? -17.853 16.555  -43.121 1.00 38.15  ? 298 MET A O     1 
ATOM   2296 C  CB    . MET A 1 318 ? -14.889 15.866  -44.169 1.00 45.74  ? 298 MET A CB    1 
ATOM   2297 C  CG    . MET A 1 318 ? -13.370 15.784  -44.027 1.00 49.18  ? 298 MET A CG    1 
ATOM   2298 S  SD    . MET A 1 318 ? -12.542 14.460  -44.972 1.00 52.04  ? 298 MET A SD    1 
ATOM   2299 C  CE    . MET A 1 318 ? -13.177 13.004  -44.172 1.00 46.98  ? 298 MET A CE    1 
ATOM   2300 N  N     . GLY A 1 319 ? -17.352 17.976  -44.795 1.00 45.82  ? 299 GLY A N     1 
ATOM   2301 C  CA    . GLY A 1 319 ? -18.759 18.182  -45.156 1.00 54.14  ? 299 GLY A CA    1 
ATOM   2302 C  C     . GLY A 1 319 ? -19.548 18.881  -44.067 1.00 57.59  ? 299 GLY A C     1 
ATOM   2303 O  O     . GLY A 1 319 ? -20.562 18.369  -43.572 1.00 57.88  ? 299 GLY A O     1 
ATOM   2304 N  N     . ILE A 1 320 ? -19.026 20.025  -43.659 1.00 58.21  ? 300 ILE A N     1 
ATOM   2305 C  CA    . ILE A 1 320 ? -19.762 20.980  -42.887 1.00 62.05  ? 300 ILE A CA    1 
ATOM   2306 C  C     . ILE A 1 320 ? -19.804 22.201  -43.786 1.00 66.46  ? 300 ILE A C     1 
ATOM   2307 O  O     . ILE A 1 320 ? -18.772 22.832  -44.038 1.00 65.70  ? 300 ILE A O     1 
ATOM   2308 C  CB    . ILE A 1 320 ? -19.057 21.274  -41.554 1.00 64.66  ? 300 ILE A CB    1 
ATOM   2309 C  CG1   . ILE A 1 320 ? -19.239 20.082  -40.614 1.00 66.17  ? 300 ILE A CG1   1 
ATOM   2310 C  CG2   . ILE A 1 320 ? -19.601 22.546  -40.910 1.00 62.10  ? 300 ILE A CG2   1 
ATOM   2311 C  CD1   . ILE A 1 320 ? -18.309 20.094  -39.420 1.00 68.31  ? 300 ILE A CD1   1 
ATOM   2312 N  N     . ASN A 1 321 ? -20.982 22.495  -44.325 1.00 70.85  ? 301 ASN A N     1 
ATOM   2313 C  CA    . ASN A 1 321 ? -21.173 23.740  -45.055 1.00 76.99  ? 301 ASN A CA    1 
ATOM   2314 C  C     . ASN A 1 321 ? -22.015 24.685  -44.216 1.00 66.25  ? 301 ASN A C     1 
ATOM   2315 O  O     . ASN A 1 321 ? -23.206 24.900  -44.456 1.00 69.40  ? 301 ASN A O     1 
ATOM   2316 C  CB    . ASN A 1 321 ? -21.723 23.512  -46.483 1.00 82.44  ? 301 ASN A CB    1 
ATOM   2317 C  CG    . ASN A 1 321 ? -20.624 23.596  -47.554 1.00 85.00  ? 301 ASN A CG    1 
ATOM   2318 O  OD1   . ASN A 1 321 ? -19.438 23.374  -47.269 1.00 86.18  ? 301 ASN A OD1   1 
ATOM   2319 N  ND2   . ASN A 1 321 ? -21.013 23.933  -48.785 1.00 83.53  ? 301 ASN A ND2   1 
ATOM   2320 N  N     . LYS A 1 322 ? -21.354 25.217  -43.195 1.00 51.81  ? 302 LYS A N     1 
ATOM   2321 C  CA    . LYS A 1 322 ? -21.901 26.282  -42.392 1.00 44.83  ? 302 LYS A CA    1 
ATOM   2322 C  C     . LYS A 1 322 ? -21.062 27.525  -42.644 1.00 42.52  ? 302 LYS A C     1 
ATOM   2323 O  O     . LYS A 1 322 ? -19.872 27.548  -42.368 1.00 42.52  ? 302 LYS A O     1 
ATOM   2324 C  CB    . LYS A 1 322 ? -21.889 25.899  -40.922 1.00 42.50  ? 302 LYS A CB    1 
ATOM   2325 C  CG    . LYS A 1 322 ? -22.531 26.938  -40.028 1.00 41.19  ? 302 LYS A CG    1 
ATOM   2326 C  CD    . LYS A 1 322 ? -22.820 26.352  -38.665 1.00 42.10  ? 302 LYS A CD    1 
ATOM   2327 C  CE    . LYS A 1 322 ? -23.183 27.417  -37.648 1.00 42.92  ? 302 LYS A CE    1 
ATOM   2328 N  NZ    . LYS A 1 322 ? -24.410 28.194  -38.006 1.00 44.67  ? 302 LYS A NZ    1 
ATOM   2329 N  N     . PRO A 1 323 ? -21.684 28.568  -43.181 1.00 43.53  ? 303 PRO A N     1 
ATOM   2330 C  CA    . PRO A 1 323 ? -20.950 29.738  -43.618 1.00 40.96  ? 303 PRO A CA    1 
ATOM   2331 C  C     . PRO A 1 323 ? -20.619 30.730  -42.515 1.00 39.73  ? 303 PRO A C     1 
ATOM   2332 O  O     . PRO A 1 323 ? -19.771 31.603  -42.704 1.00 41.50  ? 303 PRO A O     1 
ATOM   2333 C  CB    . PRO A 1 323 ? -21.915 30.370  -44.620 1.00 44.97  ? 303 PRO A CB    1 
ATOM   2334 C  CG    . PRO A 1 323 ? -23.277 30.034  -44.083 1.00 43.85  ? 303 PRO A CG    1 
ATOM   2335 C  CD    . PRO A 1 323 ? -23.128 28.663  -43.492 1.00 43.58  ? 303 PRO A CD    1 
ATOM   2336 N  N     . ASN A 1 324 ? -21.265 30.617  -41.366 1.00 38.96  ? 304 ASN A N     1 
ATOM   2337 C  CA    . ASN A 1 324 ? -21.109 31.631  -40.328 1.00 35.37  ? 304 ASN A CA    1 
ATOM   2338 C  C     . ASN A 1 324 ? -20.564 31.086  -39.010 1.00 32.45  ? 304 ASN A C     1 
ATOM   2339 O  O     . ASN A 1 324 ? -20.999 31.500  -37.942 1.00 36.72  ? 304 ASN A O     1 
ATOM   2340 C  CB    . ASN A 1 324 ? -22.437 32.369  -40.122 1.00 37.99  ? 304 ASN A CB    1 
ATOM   2341 C  CG    . ASN A 1 324 ? -23.558 31.449  -39.688 1.00 40.13  ? 304 ASN A CG    1 
ATOM   2342 O  OD1   . ASN A 1 324 ? -23.579 30.276  -40.050 1.00 43.65  ? 304 ASN A OD1   1 
ATOM   2343 N  ND2   . ASN A 1 324 ? -24.479 31.968  -38.874 1.00 43.49  ? 304 ASN A ND2   1 
ATOM   2344 N  N     . VAL A 1 325 ? -19.594 30.175  -39.079 1.00 30.49  ? 305 VAL A N     1 
ATOM   2345 C  CA    . VAL A 1 325 ? -18.831 29.794  -37.894 1.00 28.37  ? 305 VAL A CA    1 
ATOM   2346 C  C     . VAL A 1 325 ? -17.858 30.937  -37.660 1.00 28.18  ? 305 VAL A C     1 
ATOM   2347 O  O     . VAL A 1 325 ? -17.028 31.256  -38.528 1.00 28.74  ? 305 VAL A O     1 
ATOM   2348 C  CB    . VAL A 1 325 ? -18.037 28.481  -38.077 1.00 29.27  ? 305 VAL A CB    1 
ATOM   2349 C  CG1   . VAL A 1 325 ? -17.284 28.156  -36.808 1.00 28.94  ? 305 VAL A CG1   1 
ATOM   2350 C  CG2   . VAL A 1 325 ? -18.956 27.330  -38.437 1.00 30.62  ? 305 VAL A CG2   1 
ATOM   2351 N  N     . ARG A 1 326 ? -17.956 31.548  -36.494 1.00 26.64  ? 306 ARG A N     1 
ATOM   2352 C  CA    . ARG A 1 326 ? -17.224 32.765  -36.197 1.00 26.72  ? 306 ARG A CA    1 
ATOM   2353 C  C     . ARG A 1 326 ? -15.973 32.509  -35.360 1.00 26.52  ? 306 ARG A C     1 
ATOM   2354 O  O     . ARG A 1 326 ? -15.022 33.324  -35.361 1.00 23.68  ? 306 ARG A O     1 
ATOM   2355 C  CB    . ARG A 1 326 ? -18.148 33.742  -35.476 1.00 28.55  ? 306 ARG A CB    1 
ATOM   2356 C  CG    . ARG A 1 326 ? -19.312 34.253  -36.331 1.00 29.11  ? 306 ARG A CG    1 
ATOM   2357 C  CD    . ARG A 1 326 ? -19.048 35.614  -36.957 1.00 27.90  ? 306 ARG A CD    1 
ATOM   2358 N  NE    . ARG A 1 326 ? -18.139 35.561  -38.081 1.00 28.86  ? 306 ARG A NE    1 
ATOM   2359 C  CZ    . ARG A 1 326 ? -18.477 35.254  -39.332 1.00 30.62  ? 306 ARG A CZ    1 
ATOM   2360 N  NH1   . ARG A 1 326 ? -19.723 34.968  -39.644 1.00 30.26  ? 306 ARG A NH1   1 
ATOM   2361 N  NH2   . ARG A 1 326 ? -17.547 35.212  -40.288 1.00 30.28  ? 306 ARG A NH2   1 
ATOM   2362 N  N     . PHE A 1 327 ? -15.968 31.402  -34.628 1.00 25.10  ? 307 PHE A N     1 
ATOM   2363 C  CA    . PHE A 1 327 ? -14.771 31.008  -33.942 1.00 26.33  ? 307 PHE A CA    1 
ATOM   2364 C  C     . PHE A 1 327 ? -14.535 29.498  -33.968 1.00 26.24  ? 307 PHE A C     1 
ATOM   2365 O  O     . PHE A 1 327 ? -15.478 28.696  -33.931 1.00 26.27  ? 307 PHE A O     1 
ATOM   2366 C  CB    . PHE A 1 327 ? -14.731 31.592  -32.532 1.00 27.62  ? 307 PHE A CB    1 
ATOM   2367 C  CG    . PHE A 1 327 ? -15.786 31.057  -31.611 1.00 29.62  ? 307 PHE A CG    1 
ATOM   2368 C  CD1   . PHE A 1 327 ? -17.029 31.645  -31.547 1.00 30.76  ? 307 PHE A CD1   1 
ATOM   2369 C  CD2   . PHE A 1 327 ? -15.524 29.982  -30.789 1.00 30.88  ? 307 PHE A CD2   1 
ATOM   2370 C  CE1   . PHE A 1 327 ? -18.010 31.154  -30.705 1.00 31.27  ? 307 PHE A CE1   1 
ATOM   2371 C  CE2   . PHE A 1 327 ? -16.496 29.499  -29.926 1.00 32.38  ? 307 PHE A CE2   1 
ATOM   2372 C  CZ    . PHE A 1 327 ? -17.741 30.086  -29.887 1.00 31.72  ? 307 PHE A CZ    1 
ATOM   2373 N  N     . VAL A 1 328 ? -13.259 29.135  -34.112 1.00 24.17  ? 308 VAL A N     1 
ATOM   2374 C  CA    . VAL A 1 328 ? -12.803 27.768  -33.933 1.00 22.89  ? 308 VAL A CA    1 
ATOM   2375 C  C     . VAL A 1 328 ? -11.792 27.792  -32.828 1.00 22.65  ? 308 VAL A C     1 
ATOM   2376 O  O     . VAL A 1 328 ? -10.794 28.492  -32.915 1.00 23.04  ? 308 VAL A O     1 
ATOM   2377 C  CB    . VAL A 1 328 ? -12.168 27.188  -35.199 1.00 22.96  ? 308 VAL A CB    1 
ATOM   2378 C  CG1   . VAL A 1 328 ? -11.478 25.863  -34.903 1.00 22.90  ? 308 VAL A CG1   1 
ATOM   2379 C  CG2   . VAL A 1 328 ? -13.239 26.963  -36.257 1.00 24.03  ? 308 VAL A CG2   1 
ATOM   2380 N  N     . VAL A 1 329 ? -12.083 27.071  -31.753 1.00 23.53  ? 309 VAL A N     1 
ATOM   2381 C  CA    . VAL A 1 329 ? -11.179 26.992  -30.611 1.00 23.40  ? 309 VAL A CA    1 
ATOM   2382 C  C     . VAL A 1 329 ? -10.512 25.632  -30.625 1.00 23.95  ? 309 VAL A C     1 
ATOM   2383 O  O     . VAL A 1 329 ? -11.208 24.594  -30.670 1.00 23.47  ? 309 VAL A O     1 
ATOM   2384 C  CB    . VAL A 1 329 ? -11.889 27.167  -29.258 1.00 22.61  ? 309 VAL A CB    1 
ATOM   2385 C  CG1   . VAL A 1 329 ? -10.966 26.814  -28.118 1.00 22.63  ? 309 VAL A CG1   1 
ATOM   2386 C  CG2   . VAL A 1 329 ? -12.330 28.598  -29.074 1.00 24.59  ? 309 VAL A CG2   1 
ATOM   2387 N  N     . HIS A 1 330 ? -9.175  25.636  -30.566 1.00 22.85  ? 310 HIS A N     1 
ATOM   2388 C  CA    . HIS A 1 330 ? -8.449  24.419  -30.249 1.00 22.60  ? 310 HIS A CA    1 
ATOM   2389 C  C     . HIS A 1 330 ? -8.064  24.428  -28.788 1.00 24.22  ? 310 HIS A C     1 
ATOM   2390 O  O     . HIS A 1 330 ? -7.137  25.111  -28.378 1.00 23.28  ? 310 HIS A O     1 
ATOM   2391 C  CB    . HIS A 1 330 ? -7.212  24.272  -31.112 1.00 22.49  ? 310 HIS A CB    1 
ATOM   2392 C  CG    . HIS A 1 330 ? -7.509  23.884  -32.514 1.00 21.65  ? 310 HIS A CG    1 
ATOM   2393 N  ND1   . HIS A 1 330 ? -7.620  24.800  -33.529 1.00 21.59  ? 310 HIS A ND1   1 
ATOM   2394 C  CD2   . HIS A 1 330 ? -7.725  22.673  -33.070 1.00 22.37  ? 310 HIS A CD2   1 
ATOM   2395 C  CE1   . HIS A 1 330 ? -7.894  24.167  -34.654 1.00 22.37  ? 310 HIS A CE1   1 
ATOM   2396 N  NE2   . HIS A 1 330 ? -7.970  22.876  -34.399 1.00 21.52  ? 310 HIS A NE2   1 
ATOM   2397 N  N     . PHE A 1 331 ? -8.782  23.628  -28.011 1.00 27.31  ? 311 PHE A N     1 
ATOM   2398 C  CA    . PHE A 1 331 ? -8.576  23.542  -26.587 1.00 28.43  ? 311 PHE A CA    1 
ATOM   2399 C  C     . PHE A 1 331 ? -7.329  22.739  -26.318 1.00 29.90  ? 311 PHE A C     1 
ATOM   2400 O  O     . PHE A 1 331 ? -6.634  22.987  -25.334 1.00 30.94  ? 311 PHE A O     1 
ATOM   2401 C  CB    . PHE A 1 331 ? -9.798  22.912  -25.914 1.00 29.39  ? 311 PHE A CB    1 
ATOM   2402 C  CG    . PHE A 1 331 ? -9.900  23.181  -24.428 1.00 31.42  ? 311 PHE A CG    1 
ATOM   2403 C  CD1   . PHE A 1 331 ? -9.508  24.391  -23.878 1.00 30.84  ? 311 PHE A CD1   1 
ATOM   2404 C  CD2   . PHE A 1 331 ? -10.452 22.235  -23.593 1.00 33.48  ? 311 PHE A CD2   1 
ATOM   2405 C  CE1   . PHE A 1 331 ? -9.620  24.620  -22.517 1.00 32.87  ? 311 PHE A CE1   1 
ATOM   2406 C  CE2   . PHE A 1 331 ? -10.581 22.460  -22.235 1.00 34.19  ? 311 PHE A CE2   1 
ATOM   2407 C  CZ    . PHE A 1 331 ? -10.154 23.651  -21.691 1.00 33.53  ? 311 PHE A CZ    1 
ATOM   2408 N  N     . ASP A 1 332 ? -7.059  21.778  -27.197 1.00 31.17  ? 312 ASP A N     1 
ATOM   2409 C  CA    . ASP A 1 332 ? -5.784  21.056  -27.228 1.00 33.14  ? 312 ASP A CA    1 
ATOM   2410 C  C     . ASP A 1 332 ? -5.144  21.315  -28.577 1.00 30.31  ? 312 ASP A C     1 
ATOM   2411 O  O     . ASP A 1 332 ? -5.826  21.338  -29.599 1.00 28.07  ? 312 ASP A O     1 
ATOM   2412 C  CB    . ASP A 1 332 ? -6.006  19.535  -27.101 1.00 34.99  ? 312 ASP A CB    1 
ATOM   2413 C  CG    . ASP A 1 332 ? -6.763  19.159  -25.857 1.00 37.74  ? 312 ASP A CG    1 
ATOM   2414 O  OD1   . ASP A 1 332 ? -6.404  19.691  -24.773 1.00 43.49  ? 312 ASP A OD1   1 
ATOM   2415 O  OD2   . ASP A 1 332 ? -7.720  18.352  -25.957 1.00 36.99  ? 312 ASP A OD2   1 
ATOM   2416 N  N     . ILE A 1 333 ? -3.834  21.474  -28.584 1.00 29.06  ? 313 ILE A N     1 
ATOM   2417 C  CA    . ILE A 1 333 ? -3.116  21.653  -29.822 1.00 29.19  ? 313 ILE A CA    1 
ATOM   2418 C  C     . ILE A 1 333 ? -3.294  20.407  -30.718 1.00 28.54  ? 313 ILE A C     1 
ATOM   2419 O  O     . ILE A 1 333 ? -3.176  19.306  -30.242 1.00 30.91  ? 313 ILE A O     1 
ATOM   2420 C  CB    . ILE A 1 333 ? -1.623  21.914  -29.529 1.00 30.47  ? 313 ILE A CB    1 
ATOM   2421 C  CG1   . ILE A 1 333 ? -0.917  22.474  -30.766 1.00 31.26  ? 313 ILE A CG1   1 
ATOM   2422 C  CG2   . ILE A 1 333 ? -0.908  20.653  -29.023 1.00 30.54  ? 313 ILE A CG2   1 
ATOM   2423 C  CD1   . ILE A 1 333 ? 0.429   23.090  -30.434 1.00 32.47  ? 313 ILE A CD1   1 
ATOM   2424 N  N     . PRO A 1 334 ? -3.593  20.579  -32.017 1.00 28.82  ? 314 PRO A N     1 
ATOM   2425 C  CA    . PRO A 1 334 ? -3.684  19.411  -32.906 1.00 29.32  ? 314 PRO A CA    1 
ATOM   2426 C  C     . PRO A 1 334 ? -2.352  18.743  -33.194 1.00 30.28  ? 314 PRO A C     1 
ATOM   2427 O  O     . PRO A 1 334 ? -1.283  19.233  -32.810 1.00 30.01  ? 314 PRO A O     1 
ATOM   2428 C  CB    . PRO A 1 334 ? -4.250  19.979  -34.215 1.00 28.60  ? 314 PRO A CB    1 
ATOM   2429 C  CG    . PRO A 1 334 ? -4.618  21.380  -33.928 1.00 29.20  ? 314 PRO A CG    1 
ATOM   2430 C  CD    . PRO A 1 334 ? -3.861  21.830  -32.731 1.00 27.79  ? 314 PRO A CD    1 
ATOM   2431 N  N     . ARG A 1 335 ? -2.444  17.624  -33.889 1.00 33.86  ? 315 ARG A N     1 
ATOM   2432 C  CA    . ARG A 1 335 ? -1.308  16.741  -34.100 1.00 36.13  ? 315 ARG A CA    1 
ATOM   2433 C  C     . ARG A 1 335 ? -0.409  17.224  -35.234 1.00 33.86  ? 315 ARG A C     1 
ATOM   2434 O  O     . ARG A 1 335 ? 0.728   16.826  -35.322 1.00 39.85  ? 315 ARG A O     1 
ATOM   2435 C  CB    . ARG A 1 335 ? -1.816  15.313  -34.345 1.00 39.85  ? 315 ARG A CB    1 
ATOM   2436 C  CG    . ARG A 1 335 ? -2.409  15.073  -35.724 1.00 46.79  ? 315 ARG A CG    1 
ATOM   2437 C  CD    . ARG A 1 335 ? -3.213  13.769  -35.819 1.00 50.33  ? 315 ARG A CD    1 
ATOM   2438 N  NE    . ARG A 1 335 ? -2.420  12.563  -35.534 1.00 52.86  ? 315 ARG A NE    1 
ATOM   2439 C  CZ    . ARG A 1 335 ? -2.354  11.932  -34.350 1.00 57.95  ? 315 ARG A CZ    1 
ATOM   2440 N  NH1   . ARG A 1 335 ? -3.026  12.366  -33.278 1.00 62.60  ? 315 ARG A NH1   1 
ATOM   2441 N  NH2   . ARG A 1 335 ? -1.607  10.842  -34.231 1.00 55.41  ? 315 ARG A NH2   1 
ATOM   2442 N  N     . ASN A 1 336 ? -0.905  18.094  -36.095 1.00 30.12  ? 316 ASN A N     1 
ATOM   2443 C  CA    . ASN A 1 336 ? -0.078  18.676  -37.135 1.00 28.70  ? 316 ASN A CA    1 
ATOM   2444 C  C     . ASN A 1 336 ? -0.718  19.917  -37.733 1.00 26.59  ? 316 ASN A C     1 
ATOM   2445 O  O     . ASN A 1 336 ? -1.864  20.229  -37.459 1.00 25.73  ? 316 ASN A O     1 
ATOM   2446 C  CB    . ASN A 1 336 ? 0.211   17.654  -38.239 1.00 29.51  ? 316 ASN A CB    1 
ATOM   2447 C  CG    . ASN A 1 336 ? -1.047  17.087  -38.865 1.00 29.60  ? 316 ASN A CG    1 
ATOM   2448 O  OD1   . ASN A 1 336 ? -1.935  17.815  -39.314 1.00 29.29  ? 316 ASN A OD1   1 
ATOM   2449 N  ND2   . ASN A 1 336 ? -1.135  15.779  -38.887 1.00 31.52  ? 316 ASN A ND2   1 
ATOM   2450 N  N     . ILE A 1 337 ? 0.038   20.606  -38.565 1.00 24.86  ? 317 ILE A N     1 
ATOM   2451 C  CA    . ILE A 1 337 ? -0.364  21.885  -39.099 1.00 24.20  ? 317 ILE A CA    1 
ATOM   2452 C  C     . ILE A 1 337 ? -1.492  21.739  -40.113 1.00 23.13  ? 317 ILE A C     1 
ATOM   2453 O  O     . ILE A 1 337 ? -2.335  22.609  -40.212 1.00 19.97  ? 317 ILE A O     1 
ATOM   2454 C  CB    . ILE A 1 337 ? 0.830   22.635  -39.697 1.00 25.05  ? 317 ILE A CB    1 
ATOM   2455 C  CG1   . ILE A 1 337 ? 1.603   23.268  -38.573 1.00 27.24  ? 317 ILE A CG1   1 
ATOM   2456 C  CG2   . ILE A 1 337 ? 0.387   23.768  -40.620 1.00 28.34  ? 317 ILE A CG2   1 
ATOM   2457 C  CD1   . ILE A 1 337 ? 2.810   24.063  -39.026 1.00 29.11  ? 317 ILE A CD1   1 
ATOM   2458 N  N     . GLU A 1 338 ? -1.496  20.653  -40.870 1.00 23.87  ? 318 GLU A N     1 
ATOM   2459 C  CA    . GLU A 1 338 ? -2.594  20.384  -41.804 1.00 24.97  ? 318 GLU A CA    1 
ATOM   2460 C  C     . GLU A 1 338 ? -3.956  20.244  -41.112 1.00 24.09  ? 318 GLU A C     1 
ATOM   2461 O  O     . GLU A 1 338 ? -4.958  20.750  -41.617 1.00 21.99  ? 318 GLU A O     1 
ATOM   2462 C  CB    . GLU A 1 338 ? -2.315  19.136  -42.622 1.00 25.24  ? 318 GLU A CB    1 
ATOM   2463 C  CG    . GLU A 1 338 ? -1.333  19.372  -43.752 1.00 27.47  ? 318 GLU A CG    1 
ATOM   2464 C  CD    . GLU A 1 338 ? -0.705  18.083  -44.240 1.00 30.00  ? 318 GLU A CD    1 
ATOM   2465 O  OE1   . GLU A 1 338 ? -0.151  17.347  -43.391 1.00 36.59  ? 318 GLU A OE1   1 
ATOM   2466 O  OE2   . GLU A 1 338 ? -0.762  17.788  -45.445 1.00 27.95  ? 318 GLU A OE2   1 
ATOM   2467 N  N     . SER A 1 339 ? -3.990  19.550  -39.975 1.00 24.69  ? 319 SER A N     1 
ATOM   2468 C  CA    . SER A 1 339 ? -5.232  19.414  -39.194 1.00 26.15  ? 319 SER A CA    1 
ATOM   2469 C  C     . SER A 1 339 ? -5.639  20.757  -38.666 1.00 24.01  ? 319 SER A C     1 
ATOM   2470 O  O     . SER A 1 339 ? -6.813  21.095  -38.693 1.00 24.18  ? 319 SER A O     1 
ATOM   2471 C  CB    . SER A 1 339 ? -5.045  18.488  -38.001 1.00 28.35  ? 319 SER A CB    1 
ATOM   2472 O  OG    . SER A 1 339 ? -4.439  17.297  -38.439 1.00 35.82  ? 319 SER A OG    1 
ATOM   2473 N  N     . TYR A 1 340 ? -4.658  21.512  -38.177 1.00 21.88  ? 320 TYR A N     1 
ATOM   2474 C  CA    . TYR A 1 340 ? -4.922  22.851  -37.689 1.00 21.61  ? 320 TYR A CA    1 
ATOM   2475 C  C     . TYR A 1 340 ? -5.476  23.739  -38.795 1.00 21.08  ? 320 TYR A C     1 
ATOM   2476 O  O     . TYR A 1 340 ? -6.487  24.413  -38.590 1.00 20.88  ? 320 TYR A O     1 
ATOM   2477 C  CB    . TYR A 1 340 ? -3.675  23.465  -37.117 1.00 21.44  ? 320 TYR A CB    1 
ATOM   2478 C  CG    . TYR A 1 340 ? -3.836  24.900  -36.700 1.00 21.82  ? 320 TYR A CG    1 
ATOM   2479 C  CD1   . TYR A 1 340 ? -4.366  25.234  -35.463 1.00 23.29  ? 320 TYR A CD1   1 
ATOM   2480 C  CD2   . TYR A 1 340 ? -3.434  25.911  -37.520 1.00 21.76  ? 320 TYR A CD2   1 
ATOM   2481 C  CE1   . TYR A 1 340 ? -4.506  26.557  -35.078 1.00 23.34  ? 320 TYR A CE1   1 
ATOM   2482 C  CE2   . TYR A 1 340 ? -3.558  27.237  -37.146 1.00 23.80  ? 320 TYR A CE2   1 
ATOM   2483 C  CZ    . TYR A 1 340 ? -4.085  27.555  -35.925 1.00 23.70  ? 320 TYR A CZ    1 
ATOM   2484 O  OH    . TYR A 1 340 ? -4.185  28.882  -35.571 1.00 25.56  ? 320 TYR A OH    1 
ATOM   2485 N  N     . TYR A 1 341 ? -4.850  23.701  -39.971 1.00 20.47  ? 321 TYR A N     1 
ATOM   2486 C  CA    . TYR A 1 341 ? -5.273  24.542  -41.078 1.00 20.90  ? 321 TYR A CA    1 
ATOM   2487 C  C     . TYR A 1 341 ? -6.716  24.174  -41.486 1.00 22.95  ? 321 TYR A C     1 
ATOM   2488 O  O     . TYR A 1 341 ? -7.578  25.027  -41.658 1.00 21.48  ? 321 TYR A O     1 
ATOM   2489 C  CB    . TYR A 1 341 ? -4.301  24.450  -42.263 1.00 20.40  ? 321 TYR A CB    1 
ATOM   2490 C  CG    . TYR A 1 341 ? -4.715  25.362  -43.381 1.00 20.40  ? 321 TYR A CG    1 
ATOM   2491 C  CD1   . TYR A 1 341 ? -4.337  26.705  -43.384 1.00 20.81  ? 321 TYR A CD1   1 
ATOM   2492 C  CD2   . TYR A 1 341 ? -5.571  24.917  -44.380 1.00 20.15  ? 321 TYR A CD2   1 
ATOM   2493 C  CE1   . TYR A 1 341 ? -4.777  27.580  -44.376 1.00 20.38  ? 321 TYR A CE1   1 
ATOM   2494 C  CE2   . TYR A 1 341 ? -6.022  25.775  -45.374 1.00 21.01  ? 321 TYR A CE2   1 
ATOM   2495 C  CZ    . TYR A 1 341 ? -5.619  27.113  -45.367 1.00 21.27  ? 321 TYR A CZ    1 
ATOM   2496 O  OH    . TYR A 1 341 ? -6.050  27.966  -46.353 1.00 20.06  ? 321 TYR A OH    1 
ATOM   2497 N  N     . GLN A 1 342 ? -6.967  22.880  -41.598 1.00 25.43  ? 322 GLN A N     1 
ATOM   2498 C  CA    . GLN A 1 342 ? -8.248  22.382  -42.015 1.00 27.24  ? 322 GLN A CA    1 
ATOM   2499 C  C     . GLN A 1 342 ? -9.327  22.695  -40.986 1.00 25.98  ? 322 GLN A C     1 
ATOM   2500 O  O     . GLN A 1 342 ? -10.449 23.006  -41.336 1.00 26.62  ? 322 GLN A O     1 
ATOM   2501 C  CB    . GLN A 1 342 ? -8.125  20.877  -42.231 1.00 32.38  ? 322 GLN A CB    1 
ATOM   2502 C  CG    . GLN A 1 342 ? -9.361  20.195  -42.753 1.00 38.26  ? 322 GLN A CG    1 
ATOM   2503 C  CD    . GLN A 1 342 ? -9.244  18.676  -42.710 1.00 45.86  ? 322 GLN A CD    1 
ATOM   2504 O  OE1   . GLN A 1 342 ? -9.041  18.082  -41.636 1.00 50.28  ? 322 GLN A OE1   1 
ATOM   2505 N  NE2   . GLN A 1 342 ? -9.401  18.034  -43.870 1.00 46.22  ? 322 GLN A NE2   1 
ATOM   2506 N  N     . GLU A 1 343 ? -9.007  22.603  -39.711 1.00 24.50  ? 323 GLU A N     1 
ATOM   2507 C  CA    . GLU A 1 343 ? -10.015 22.846  -38.709 1.00 25.34  ? 323 GLU A CA    1 
ATOM   2508 C  C     . GLU A 1 343 ? -10.270 24.317  -38.483 1.00 23.77  ? 323 GLU A C     1 
ATOM   2509 O  O     . GLU A 1 343 ? -11.412 24.720  -38.286 1.00 22.97  ? 323 GLU A O     1 
ATOM   2510 C  CB    . GLU A 1 343 ? -9.647  22.138  -37.400 1.00 28.48  ? 323 GLU A CB    1 
ATOM   2511 C  CG    . GLU A 1 343 ? -9.756  20.620  -37.537 1.00 31.28  ? 323 GLU A CG    1 
ATOM   2512 C  CD    . GLU A 1 343 ? -9.064  19.833  -36.445 1.00 38.30  ? 323 GLU A CD    1 
ATOM   2513 O  OE1   . GLU A 1 343 ? -8.159  20.339  -35.747 1.00 40.08  ? 323 GLU A OE1   1 
ATOM   2514 O  OE2   . GLU A 1 343 ? -9.434  18.651  -36.282 1.00 52.96  ? 323 GLU A OE2   1 
ATOM   2515 N  N     . THR A 1 344 ? -9.219  25.128  -38.462 1.00 23.27  ? 324 THR A N     1 
ATOM   2516 C  CA    . THR A 1 344 ? -9.407  26.571  -38.317 1.00 22.51  ? 324 THR A CA    1 
ATOM   2517 C  C     . THR A 1 344 ? -10.156 27.090  -39.528 1.00 23.61  ? 324 THR A C     1 
ATOM   2518 O  O     . THR A 1 344 ? -10.972 27.996  -39.415 1.00 23.03  ? 324 THR A O     1 
ATOM   2519 C  CB    . THR A 1 344 ? -8.093  27.338  -38.134 1.00 21.69  ? 324 THR A CB    1 
ATOM   2520 O  OG1   . THR A 1 344 ? -7.169  26.991  -39.162 1.00 19.99  ? 324 THR A OG1   1 
ATOM   2521 C  CG2   . THR A 1 344 ? -7.490  27.013  -36.779 1.00 22.38  ? 324 THR A CG2   1 
ATOM   2522 N  N     . GLY A 1 345 ? -9.927  26.460  -40.675 1.00 24.84  ? 325 GLY A N     1 
ATOM   2523 C  CA    . GLY A 1 345 ? -10.542 26.881  -41.925 1.00 27.02  ? 325 GLY A CA    1 
ATOM   2524 C  C     . GLY A 1 345 ? -12.038 26.674  -42.071 1.00 28.27  ? 325 GLY A C     1 
ATOM   2525 O  O     . GLY A 1 345 ? -12.623 27.147  -43.032 1.00 30.27  ? 325 GLY A O     1 
ATOM   2526 N  N     . ARG A 1 346 ? -12.660 25.994  -41.122 1.00 29.22  ? 326 ARG A N     1 
ATOM   2527 C  CA    . ARG A 1 346 ? -14.116 25.929  -41.039 1.00 30.12  ? 326 ARG A CA    1 
ATOM   2528 C  C     . ARG A 1 346 ? -14.756 27.232  -40.551 1.00 29.86  ? 326 ARG A C     1 
ATOM   2529 O  O     . ARG A 1 346 ? -15.966 27.447  -40.706 1.00 28.45  ? 326 ARG A O     1 
ATOM   2530 C  CB    . ARG A 1 346 ? -14.522 24.748  -40.160 1.00 31.96  ? 326 ARG A CB    1 
ATOM   2531 C  CG    . ARG A 1 346 ? -14.427 23.450  -40.946 1.00 33.56  ? 326 ARG A CG    1 
ATOM   2532 C  CD    . ARG A 1 346 ? -14.147 22.248  -40.087 1.00 36.89  ? 326 ARG A CD    1 
ATOM   2533 N  NE    . ARG A 1 346 ? -13.643 21.159  -40.921 1.00 39.49  ? 326 ARG A NE    1 
ATOM   2534 C  CZ    . ARG A 1 346 ? -12.907 20.132  -40.483 1.00 40.38  ? 326 ARG A CZ    1 
ATOM   2535 N  NH1   . ARG A 1 346 ? -12.590 20.007  -39.202 1.00 39.11  ? 326 ARG A NH1   1 
ATOM   2536 N  NH2   . ARG A 1 346 ? -12.502 19.207  -41.345 1.00 42.79  ? 326 ARG A NH2   1 
ATOM   2537 N  N     . ALA A 1 347 ? -13.942 28.119  -39.993 1.00 28.45  ? 327 ALA A N     1 
ATOM   2538 C  CA    . ALA A 1 347 ? -14.414 29.447  -39.629 1.00 27.20  ? 327 ALA A CA    1 
ATOM   2539 C  C     . ALA A 1 347 ? -14.464 30.379  -40.830 1.00 26.81  ? 327 ALA A C     1 
ATOM   2540 O  O     . ALA A 1 347 ? -13.689 30.252  -41.765 1.00 25.40  ? 327 ALA A O     1 
ATOM   2541 C  CB    . ALA A 1 347 ? -13.529 30.037  -38.551 1.00 27.49  ? 327 ALA A CB    1 
ATOM   2542 N  N     . GLY A 1 348 ? -15.415 31.308  -40.796 1.00 27.56  ? 328 GLY A N     1 
ATOM   2543 C  CA    . GLY A 1 348 ? -15.430 32.447  -41.692 1.00 27.34  ? 328 GLY A CA    1 
ATOM   2544 C  C     . GLY A 1 348 ? -15.598 32.128  -43.155 1.00 26.78  ? 328 GLY A C     1 
ATOM   2545 O  O     . GLY A 1 348 ? -15.133 32.874  -44.004 1.00 26.30  ? 328 GLY A O     1 
ATOM   2546 N  N     . ARG A 1 349 ? -16.285 31.053  -43.480 1.00 27.56  ? 329 ARG A N     1 
ATOM   2547 C  CA    . ARG A 1 349 ? -16.435 30.703  -44.899 1.00 30.18  ? 329 ARG A CA    1 
ATOM   2548 C  C     . ARG A 1 349 ? -17.258 31.751  -45.699 1.00 29.61  ? 329 ARG A C     1 
ATOM   2549 O  O     . ARG A 1 349 ? -17.147 31.808  -46.888 1.00 31.38  ? 329 ARG A O     1 
ATOM   2550 C  CB    . ARG A 1 349 ? -17.016 29.297  -45.038 1.00 32.02  ? 329 ARG A CB    1 
ATOM   2551 C  CG    . ARG A 1 349 ? -16.138 28.193  -44.437 1.00 34.86  ? 329 ARG A CG    1 
ATOM   2552 C  CD    . ARG A 1 349 ? -15.322 27.469  -45.475 1.00 38.79  ? 329 ARG A CD    1 
ATOM   2553 N  NE    . ARG A 1 349 ? -14.570 26.335  -44.924 1.00 44.41  ? 329 ARG A NE    1 
ATOM   2554 C  CZ    . ARG A 1 349 ? -14.982 25.065  -44.882 1.00 46.81  ? 329 ARG A CZ    1 
ATOM   2555 N  NH1   . ARG A 1 349 ? -16.175 24.708  -45.346 1.00 50.82  ? 329 ARG A NH1   1 
ATOM   2556 N  NH2   . ARG A 1 349 ? -14.189 24.134  -44.357 1.00 45.89  ? 329 ARG A NH2   1 
ATOM   2557 N  N     . ASP A 1 350 ? -18.064 32.564  -45.027 1.00 29.82  ? 330 ASP A N     1 
ATOM   2558 C  CA    . ASP A 1 350 ? -18.808 33.678  -45.632 1.00 30.01  ? 330 ASP A CA    1 
ATOM   2559 C  C     . ASP A 1 350 ? -17.979 34.930  -45.862 1.00 32.59  ? 330 ASP A C     1 
ATOM   2560 O  O     . ASP A 1 350 ? -18.493 35.899  -46.388 1.00 36.23  ? 330 ASP A O     1 
ATOM   2561 C  CB    . ASP A 1 350 ? -20.007 34.078  -44.744 1.00 28.74  ? 330 ASP A CB    1 
ATOM   2562 C  CG    . ASP A 1 350 ? -19.580 34.560  -43.321 1.00 30.75  ? 330 ASP A CG    1 
ATOM   2563 O  OD1   . ASP A 1 350 ? -18.357 34.683  -43.033 1.00 31.37  ? 330 ASP A OD1   1 
ATOM   2564 O  OD2   . ASP A 1 350 ? -20.470 34.791  -42.465 1.00 29.17  ? 330 ASP A OD2   1 
ATOM   2565 N  N     . GLY A 1 351 ? -16.715 34.949  -45.444 1.00 34.18  ? 331 GLY A N     1 
ATOM   2566 C  CA    . GLY A 1 351 ? -15.822 36.064  -45.793 1.00 31.59  ? 331 GLY A CA    1 
ATOM   2567 C  C     . GLY A 1 351 ? -15.692 37.127  -44.732 1.00 31.02  ? 331 GLY A C     1 
ATOM   2568 O  O     . GLY A 1 351 ? -14.851 38.012  -44.854 1.00 32.56  ? 331 GLY A O     1 
ATOM   2569 N  N     . LEU A 1 352 ? -16.495 37.029  -43.680 1.00 30.20  ? 332 LEU A N     1 
ATOM   2570 C  CA    . LEU A 1 352 ? -16.496 38.023  -42.616 1.00 31.24  ? 332 LEU A CA    1 
ATOM   2571 C  C     . LEU A 1 352 ? -15.543 37.635  -41.477 1.00 29.26  ? 332 LEU A C     1 
ATOM   2572 O  O     . LEU A 1 352 ? -15.208 36.482  -41.346 1.00 26.91  ? 332 LEU A O     1 
ATOM   2573 C  CB    . LEU A 1 352 ? -17.916 38.175  -42.079 1.00 33.58  ? 332 LEU A CB    1 
ATOM   2574 C  CG    . LEU A 1 352 ? -18.880 38.843  -43.057 1.00 36.88  ? 332 LEU A CG    1 
ATOM   2575 C  CD1   . LEU A 1 352 ? -20.295 38.690  -42.521 1.00 38.93  ? 332 LEU A CD1   1 
ATOM   2576 C  CD2   . LEU A 1 352 ? -18.530 40.316  -43.260 1.00 37.40  ? 332 LEU A CD2   1 
ATOM   2577 N  N     . PRO A 1 353 ? -15.129 38.610  -40.637 1.00 27.83  ? 333 PRO A N     1 
ATOM   2578 C  CA    . PRO A 1 353 ? -14.150 38.336  -39.598 1.00 27.04  ? 333 PRO A CA    1 
ATOM   2579 C  C     . PRO A 1 353 ? -14.502 37.092  -38.789 1.00 25.50  ? 333 PRO A C     1 
ATOM   2580 O  O     . PRO A 1 353 ? -15.628 36.941  -38.359 1.00 24.32  ? 333 PRO A O     1 
ATOM   2581 C  CB    . PRO A 1 353 ? -14.212 39.569  -38.707 1.00 27.48  ? 333 PRO A CB    1 
ATOM   2582 C  CG    . PRO A 1 353 ? -14.713 40.646  -39.584 1.00 28.10  ? 333 PRO A CG    1 
ATOM   2583 C  CD    . PRO A 1 353 ? -15.617 39.998  -40.581 1.00 28.07  ? 333 PRO A CD    1 
ATOM   2584 N  N     . ALA A 1 354 ? -13.533 36.191  -38.654 1.00 23.10  ? 334 ALA A N     1 
ATOM   2585 C  CA    . ALA A 1 354 ? -13.647 35.051  -37.783 1.00 22.38  ? 334 ALA A CA    1 
ATOM   2586 C  C     . ALA A 1 354 ? -12.312 34.885  -37.048 1.00 23.35  ? 334 ALA A C     1 
ATOM   2587 O  O     . ALA A 1 354 ? -11.297 35.476  -37.417 1.00 23.63  ? 334 ALA A O     1 
ATOM   2588 C  CB    . ALA A 1 354 ? -14.029 33.807  -38.567 1.00 22.00  ? 334 ALA A CB    1 
ATOM   2589 N  N     . GLU A 1 355 ? -12.340 34.110  -35.981 1.00 25.24  ? 335 GLU A N     1 
ATOM   2590 C  CA    . GLU A 1 355 ? -11.217 33.990  -35.100 1.00 26.83  ? 335 GLU A CA    1 
ATOM   2591 C  C     . GLU A 1 355 ? -10.881 32.528  -34.848 1.00 25.47  ? 335 GLU A C     1 
ATOM   2592 O  O     . GLU A 1 355 ? -11.760 31.722  -34.600 1.00 26.01  ? 335 GLU A O     1 
ATOM   2593 C  CB    . GLU A 1 355 ? -11.521 34.699  -33.800 1.00 29.87  ? 335 GLU A CB    1 
ATOM   2594 C  CG    . GLU A 1 355 ? -10.342 34.704  -32.872 1.00 35.45  ? 335 GLU A CG    1 
ATOM   2595 C  CD    . GLU A 1 355 ? -10.395 35.841  -31.896 1.00 42.13  ? 335 GLU A CD    1 
ATOM   2596 O  OE1   . GLU A 1 355 ? -11.242 35.798  -30.977 1.00 47.72  ? 335 GLU A OE1   1 
ATOM   2597 O  OE2   . GLU A 1 355 ? -9.569  36.765  -32.048 1.00 50.96  ? 335 GLU A OE2   1 
ATOM   2598 N  N     . ALA A 1 356 ? -9.604  32.187  -34.941 1.00 23.59  ? 336 ALA A N     1 
ATOM   2599 C  CA    . ALA A 1 356 ? -9.133  30.867  -34.563 1.00 23.26  ? 336 ALA A CA    1 
ATOM   2600 C  C     . ALA A 1 356 ? -8.376  31.079  -33.292 1.00 23.83  ? 336 ALA A C     1 
ATOM   2601 O  O     . ALA A 1 356 ? -7.590  31.985  -33.215 1.00 24.72  ? 336 ALA A O     1 
ATOM   2602 C  CB    . ALA A 1 356 ? -8.234  30.294  -35.643 1.00 23.95  ? 336 ALA A CB    1 
ATOM   2603 N  N     . MET A 1 357 ? -8.642  30.286  -32.263 1.00 26.71  ? 337 MET A N     1 
ATOM   2604 C  CA    . MET A 1 357 ? -8.010  30.516  -30.968 1.00 27.61  ? 337 MET A CA    1 
ATOM   2605 C  C     . MET A 1 357 ? -7.483  29.210  -30.403 1.00 26.92  ? 337 MET A C     1 
ATOM   2606 O  O     . MET A 1 357 ? -8.240  28.305  -30.075 1.00 26.30  ? 337 MET A O     1 
ATOM   2607 C  CB    . MET A 1 357 ? -8.966  31.201  -29.982 1.00 29.27  ? 337 MET A CB    1 
ATOM   2608 C  CG    . MET A 1 357 ? -8.443  31.298  -28.541 1.00 29.71  ? 337 MET A CG    1 
ATOM   2609 S  SD    . MET A 1 357 ? -6.974  32.336  -28.357 1.00 33.71  ? 337 MET A SD    1 
ATOM   2610 C  CE    . MET A 1 357 ? -7.735  33.961  -28.479 1.00 31.24  ? 337 MET A CE    1 
ATOM   2611 N  N     . LEU A 1 358 ? -6.165  29.156  -30.277 1.00 26.67  ? 338 LEU A N     1 
ATOM   2612 C  CA    . LEU A 1 358 ? -5.456  27.987  -29.795 1.00 26.79  ? 338 LEU A CA    1 
ATOM   2613 C  C     . LEU A 1 358 ? -5.029  28.204  -28.348 1.00 26.34  ? 338 LEU A C     1 
ATOM   2614 O  O     . LEU A 1 358 ? -4.353  29.177  -28.049 1.00 27.22  ? 338 LEU A O     1 
ATOM   2615 C  CB    . LEU A 1 358 ? -4.221  27.779  -30.657 1.00 26.96  ? 338 LEU A CB    1 
ATOM   2616 C  CG    . LEU A 1 358 ? -3.211  26.720  -30.225 1.00 27.49  ? 338 LEU A CG    1 
ATOM   2617 C  CD1   . LEU A 1 358 ? -3.899  25.400  -30.016 1.00 27.46  ? 338 LEU A CD1   1 
ATOM   2618 C  CD2   . LEU A 1 358 ? -2.127  26.592  -31.275 1.00 28.08  ? 338 LEU A CD2   1 
ATOM   2619 N  N     . PHE A 1 359 ? -5.433  27.300  -27.467 1.00 26.86  ? 339 PHE A N     1 
ATOM   2620 C  CA    . PHE A 1 359 ? -5.013  27.310  -26.075 1.00 29.69  ? 339 PHE A CA    1 
ATOM   2621 C  C     . PHE A 1 359 ? -3.836  26.364  -25.957 1.00 30.64  ? 339 PHE A C     1 
ATOM   2622 O  O     . PHE A 1 359 ? -4.016  25.146  -25.984 1.00 32.31  ? 339 PHE A O     1 
ATOM   2623 C  CB    . PHE A 1 359 ? -6.136  26.836  -25.155 1.00 30.07  ? 339 PHE A CB    1 
ATOM   2624 C  CG    . PHE A 1 359 ? -7.267  27.794  -25.047 1.00 33.63  ? 339 PHE A CG    1 
ATOM   2625 C  CD1   . PHE A 1 359 ? -8.112  28.018  -26.124 1.00 35.21  ? 339 PHE A CD1   1 
ATOM   2626 C  CD2   . PHE A 1 359 ? -7.521  28.463  -23.866 1.00 37.75  ? 339 PHE A CD2   1 
ATOM   2627 C  CE1   . PHE A 1 359 ? -9.170  28.906  -26.031 1.00 33.41  ? 339 PHE A CE1   1 
ATOM   2628 C  CE2   . PHE A 1 359 ? -8.591  29.351  -23.777 1.00 36.48  ? 339 PHE A CE2   1 
ATOM   2629 C  CZ    . PHE A 1 359 ? -9.409  29.569  -24.861 1.00 33.44  ? 339 PHE A CZ    1 
ATOM   2630 N  N     . TYR A 1 360 ? -2.637  26.921  -25.851 1.00 29.03  ? 340 TYR A N     1 
ATOM   2631 C  CA    . TYR A 1 360 ? -1.426  26.117  -25.881 1.00 29.65  ? 340 TYR A CA    1 
ATOM   2632 C  C     . TYR A 1 360 ? -0.810  25.808  -24.515 1.00 30.11  ? 340 TYR A C     1 
ATOM   2633 O  O     . TYR A 1 360 ? -0.476  26.715  -23.754 1.00 30.27  ? 340 TYR A O     1 
ATOM   2634 C  CB    . TYR A 1 360 ? -0.386  26.836  -26.703 1.00 29.03  ? 340 TYR A CB    1 
ATOM   2635 C  CG    . TYR A 1 360 ? 0.953   26.156  -26.778 1.00 28.35  ? 340 TYR A CG    1 
ATOM   2636 C  CD1   . TYR A 1 360 ? 1.071   24.878  -27.261 1.00 28.16  ? 340 TYR A CD1   1 
ATOM   2637 C  CD2   . TYR A 1 360 ? 2.109   26.828  -26.409 1.00 30.59  ? 340 TYR A CD2   1 
ATOM   2638 C  CE1   . TYR A 1 360 ? 2.307   24.266  -27.363 1.00 30.25  ? 340 TYR A CE1   1 
ATOM   2639 C  CE2   . TYR A 1 360 ? 3.352   26.226  -26.502 1.00 31.48  ? 340 TYR A CE2   1 
ATOM   2640 C  CZ    . TYR A 1 360 ? 3.444   24.943  -26.981 1.00 31.36  ? 340 TYR A CZ    1 
ATOM   2641 O  OH    . TYR A 1 360 ? 4.675   24.342  -27.097 1.00 35.88  ? 340 TYR A OH    1 
ATOM   2642 N  N     . ASP A 1 361 ? -0.650  24.518  -24.248 1.00 30.91  ? 341 ASP A N     1 
ATOM   2643 C  CA    . ASP A 1 361 ? 0.155   24.029  -23.148 1.00 32.57  ? 341 ASP A CA    1 
ATOM   2644 C  C     . ASP A 1 361 ? 1.282   23.197  -23.714 1.00 31.18  ? 341 ASP A C     1 
ATOM   2645 O  O     . ASP A 1 361 ? 1.027   22.229  -24.408 1.00 30.88  ? 341 ASP A O     1 
ATOM   2646 C  CB    . ASP A 1 361 ? -0.703  23.156  -22.239 1.00 35.12  ? 341 ASP A CB    1 
ATOM   2647 C  CG    . ASP A 1 361 ? 0.026   22.708  -20.981 1.00 36.06  ? 341 ASP A CG    1 
ATOM   2648 O  OD1   . ASP A 1 361 ? 1.278   22.647  -20.951 1.00 35.84  ? 341 ASP A OD1   1 
ATOM   2649 O  OD2   . ASP A 1 361 ? -0.685  22.394  -20.018 1.00 38.32  ? 341 ASP A OD2   1 
ATOM   2650 N  N     . PRO A 1 362 ? 2.538   23.549  -23.417 1.00 32.79  ? 342 PRO A N     1 
ATOM   2651 C  CA    . PRO A 1 362 ? 3.617   22.708  -23.949 1.00 35.53  ? 342 PRO A CA    1 
ATOM   2652 C  C     . PRO A 1 362 ? 3.504   21.253  -23.511 1.00 37.59  ? 342 PRO A C     1 
ATOM   2653 O  O     . PRO A 1 362 ? 3.780   20.347  -24.286 1.00 38.52  ? 342 PRO A O     1 
ATOM   2654 C  CB    . PRO A 1 362 ? 4.894   23.358  -23.401 1.00 35.99  ? 342 PRO A CB    1 
ATOM   2655 C  CG    . PRO A 1 362 ? 4.451   24.332  -22.357 1.00 34.56  ? 342 PRO A CG    1 
ATOM   2656 C  CD    . PRO A 1 362 ? 3.038   24.694  -22.644 1.00 33.89  ? 342 PRO A CD    1 
ATOM   2657 N  N     . ALA A 1 363 ? 3.043   21.028  -22.295 1.00 42.01  ? 343 ALA A N     1 
ATOM   2658 C  CA    . ALA A 1 363 ? 2.807   19.670  -21.827 1.00 44.75  ? 343 ALA A CA    1 
ATOM   2659 C  C     . ALA A 1 363 ? 1.961   18.872  -22.824 1.00 44.81  ? 343 ALA A C     1 
ATOM   2660 O  O     . ALA A 1 363 ? 2.186   17.683  -22.999 1.00 47.57  ? 343 ALA A O     1 
ATOM   2661 C  CB    . ALA A 1 363 ? 2.149   19.680  -20.446 1.00 44.53  ? 343 ALA A CB    1 
ATOM   2662 N  N     . ASP A 1 364 ? 1.002   19.510  -23.489 1.00 44.04  ? 344 ASP A N     1 
ATOM   2663 C  CA    . ASP A 1 364 ? 0.184   18.793  -24.479 1.00 44.56  ? 344 ASP A CA    1 
ATOM   2664 C  C     . ASP A 1 364 ? 1.022   18.292  -25.658 1.00 45.53  ? 344 ASP A C     1 
ATOM   2665 O  O     . ASP A 1 364 ? 0.670   17.297  -26.298 1.00 45.09  ? 344 ASP A O     1 
ATOM   2666 C  CB    . ASP A 1 364 ? -0.968  19.653  -25.014 1.00 45.89  ? 344 ASP A CB    1 
ATOM   2667 C  CG    . ASP A 1 364 ? -2.077  19.887  -23.990 1.00 48.57  ? 344 ASP A CG    1 
ATOM   2668 O  OD1   . ASP A 1 364 ? -2.294  19.020  -23.102 1.00 50.36  ? 344 ASP A OD1   1 
ATOM   2669 O  OD2   . ASP A 1 364 ? -2.752  20.945  -24.096 1.00 47.31  ? 344 ASP A OD2   1 
ATOM   2670 N  N     . MET A 1 365 ? 2.113   18.996  -25.952 1.00 44.89  ? 345 MET A N     1 
ATOM   2671 C  CA    . MET A 1 365 ? 3.006   18.594  -27.021 1.00 47.15  ? 345 MET A CA    1 
ATOM   2672 C  C     . MET A 1 365 ? 3.744   17.360  -26.589 1.00 46.77  ? 345 MET A C     1 
ATOM   2673 O  O     . MET A 1 365 ? 3.816   16.390  -27.326 1.00 46.06  ? 345 MET A O     1 
ATOM   2674 C  CB    . MET A 1 365 ? 4.016   19.691  -27.357 1.00 48.67  ? 345 MET A CB    1 
ATOM   2675 C  CG    . MET A 1 365 ? 3.512   20.679  -28.374 1.00 50.58  ? 345 MET A CG    1 
ATOM   2676 S  SD    . MET A 1 365 ? 3.369   19.959  -30.011 1.00 53.75  ? 345 MET A SD    1 
ATOM   2677 C  CE    . MET A 1 365 ? 5.083   19.590  -30.334 1.00 51.81  ? 345 MET A CE    1 
ATOM   2678 N  N     . ALA A 1 366 ? 4.300   17.409  -25.386 1.00 49.58  ? 346 ALA A N     1 
ATOM   2679 C  CA    . ALA A 1 366 ? 4.980   16.256  -24.824 1.00 49.64  ? 346 ALA A CA    1 
ATOM   2680 C  C     . ALA A 1 366 ? 4.073   15.015  -24.861 1.00 50.09  ? 346 ALA A C     1 
ATOM   2681 O  O     . ALA A 1 366 ? 4.530   13.944  -25.225 1.00 49.48  ? 346 ALA A O     1 
ATOM   2682 C  CB    . ALA A 1 366 ? 5.429   16.560  -23.412 1.00 50.12  ? 346 ALA A CB    1 
ATOM   2683 N  N     . TRP A 1 367 ? 2.790   15.166  -24.528 1.00 51.35  ? 347 TRP A N     1 
ATOM   2684 C  CA    . TRP A 1 367 ? 1.856   14.046  -24.624 1.00 55.76  ? 347 TRP A CA    1 
ATOM   2685 C  C     . TRP A 1 367 ? 1.838   13.471  -26.032 1.00 52.54  ? 347 TRP A C     1 
ATOM   2686 O  O     . TRP A 1 367 ? 1.967   12.269  -26.212 1.00 49.26  ? 347 TRP A O     1 
ATOM   2687 C  CB    . TRP A 1 367 ? 0.425   14.439  -24.230 1.00 62.91  ? 347 TRP A CB    1 
ATOM   2688 C  CG    . TRP A 1 367 ? -0.588  13.304  -24.437 1.00 73.35  ? 347 TRP A CG    1 
ATOM   2689 C  CD1   . TRP A 1 367 ? -0.678  12.148  -23.713 1.00 79.56  ? 347 TRP A CD1   1 
ATOM   2690 C  CD2   . TRP A 1 367 ? -1.628  13.224  -25.439 1.00 81.28  ? 347 TRP A CD2   1 
ATOM   2691 N  NE1   . TRP A 1 367 ? -1.702  11.358  -24.194 1.00 83.95  ? 347 TRP A NE1   1 
ATOM   2692 C  CE2   . TRP A 1 367 ? -2.299  11.995  -25.251 1.00 83.33  ? 347 TRP A CE2   1 
ATOM   2693 C  CE3   . TRP A 1 367 ? -2.056  14.072  -26.472 1.00 85.12  ? 347 TRP A CE3   1 
ATOM   2694 C  CZ2   . TRP A 1 367 ? -3.375  11.593  -26.058 1.00 83.90  ? 347 TRP A CZ2   1 
ATOM   2695 C  CZ3   . TRP A 1 367 ? -3.127  13.670  -27.273 1.00 83.20  ? 347 TRP A CZ3   1 
ATOM   2696 C  CH2   . TRP A 1 367 ? -3.773  12.444  -27.057 1.00 83.38  ? 347 TRP A CH2   1 
ATOM   2697 N  N     . LEU A 1 368 ? 1.658   14.336  -27.024 1.00 52.02  ? 348 LEU A N     1 
ATOM   2698 C  CA    . LEU A 1 368 ? 1.578   13.894  -28.417 1.00 50.86  ? 348 LEU A CA    1 
ATOM   2699 C  C     . LEU A 1 368 ? 2.885   13.230  -28.864 1.00 49.09  ? 348 LEU A C     1 
ATOM   2700 O  O     . LEU A 1 368 ? 2.851   12.207  -29.552 1.00 42.70  ? 348 LEU A O     1 
ATOM   2701 C  CB    . LEU A 1 368 ? 1.235   15.059  -29.358 1.00 49.87  ? 348 LEU A CB    1 
ATOM   2702 C  CG    . LEU A 1 368 ? -0.223  15.521  -29.391 1.00 51.08  ? 348 LEU A CG    1 
ATOM   2703 C  CD1   . LEU A 1 368 ? -0.327  16.946  -29.930 1.00 50.83  ? 348 LEU A CD1   1 
ATOM   2704 C  CD2   . LEU A 1 368 ? -1.094  14.578  -30.213 1.00 51.82  ? 348 LEU A CD2   1 
ATOM   2705 N  N     . ARG A 1 369 ? 4.020   13.814  -28.476 1.00 48.98  ? 349 ARG A N     1 
ATOM   2706 C  CA    . ARG A 1 369 ? 5.325   13.268  -28.849 1.00 53.73  ? 349 ARG A CA    1 
ATOM   2707 C  C     . ARG A 1 369 ? 5.437   11.841  -28.341 1.00 55.65  ? 349 ARG A C     1 
ATOM   2708 O  O     . ARG A 1 369 ? 5.823   10.933  -29.080 1.00 50.23  ? 349 ARG A O     1 
ATOM   2709 C  CB    . ARG A 1 369 ? 6.464   14.128  -28.300 1.00 55.38  ? 349 ARG A CB    1 
ATOM   2710 C  CG    . ARG A 1 369 ? 6.646   15.430  -29.059 1.00 60.80  ? 349 ARG A CG    1 
ATOM   2711 C  CD    . ARG A 1 369 ? 7.718   16.332  -28.455 1.00 63.51  ? 349 ARG A CD    1 
ATOM   2712 N  NE    . ARG A 1 369 ? 7.832   17.582  -29.209 1.00 67.15  ? 349 ARG A NE    1 
ATOM   2713 C  CZ    . ARG A 1 369 ? 8.572   18.632  -28.850 1.00 73.70  ? 349 ARG A CZ    1 
ATOM   2714 N  NH1   . ARG A 1 369 ? 9.295   18.611  -27.730 1.00 76.21  ? 349 ARG A NH1   1 
ATOM   2715 N  NH2   . ARG A 1 369 ? 8.591   19.718  -29.623 1.00 72.26  ? 349 ARG A NH2   1 
ATOM   2716 N  N     . ARG A 1 370 ? 5.069   11.665  -27.078 1.00 61.55  ? 350 ARG A N     1 
ATOM   2717 C  CA    . ARG A 1 370 ? 4.963   10.351  -26.461 1.00 67.02  ? 350 ARG A CA    1 
ATOM   2718 C  C     . ARG A 1 370 ? 4.098   9.382   -27.287 1.00 64.20  ? 350 ARG A C     1 
ATOM   2719 O  O     . ARG A 1 370 ? 4.538   8.272   -27.568 1.00 64.75  ? 350 ARG A O     1 
ATOM   2720 C  CB    . ARG A 1 370 ? 4.439   10.499  -25.027 1.00 72.55  ? 350 ARG A CB    1 
ATOM   2721 C  CG    . ARG A 1 370 ? 4.123   9.200   -24.298 1.00 82.49  ? 350 ARG A CG    1 
ATOM   2722 C  CD    . ARG A 1 370 ? 3.564   9.490   -22.907 1.00 89.21  ? 350 ARG A CD    1 
ATOM   2723 N  NE    . ARG A 1 370 ? 2.488   8.577   -22.509 1.00 94.65  ? 350 ARG A NE    1 
ATOM   2724 C  CZ    . ARG A 1 370 ? 1.257   8.566   -23.029 1.00 99.91  ? 350 ARG A CZ    1 
ATOM   2725 N  NH1   . ARG A 1 370 ? 0.914   9.398   -24.014 1.00 100.94 ? 350 ARG A NH1   1 
ATOM   2726 N  NH2   . ARG A 1 370 ? 0.359   7.699   -22.573 1.00 102.18 ? 350 ARG A NH2   1 
ATOM   2727 N  N     . CYS A 1 371 ? 2.896   9.786   -27.692 1.00 63.16  ? 351 CYS A N     1 
ATOM   2728 C  CA    . CYS A 1 371 ? 2.037   8.897   -28.500 1.00 69.08  ? 351 CYS A CA    1 
ATOM   2729 C  C     . CYS A 1 371 ? 2.703   8.426   -29.795 1.00 74.60  ? 351 CYS A C     1 
ATOM   2730 O  O     . CYS A 1 371 ? 2.510   7.287   -30.230 1.00 74.55  ? 351 CYS A O     1 
ATOM   2731 C  CB    . CYS A 1 371 ? 0.709   9.567   -28.851 1.00 69.97  ? 351 CYS A CB    1 
ATOM   2732 S  SG    . CYS A 1 371 ? -0.519  9.459   -27.537 1.00 82.01  ? 351 CYS A SG    1 
ATOM   2733 N  N     . LEU A 1 372 ? 3.477   9.318   -30.408 1.00 77.01  ? 352 LEU A N     1 
ATOM   2734 C  CA    . LEU A 1 372 ? 4.086   9.054   -31.701 1.00 77.39  ? 352 LEU A CA    1 
ATOM   2735 C  C     . LEU A 1 372 ? 5.228   8.070   -31.587 1.00 76.35  ? 352 LEU A C     1 
ATOM   2736 O  O     . LEU A 1 372 ? 5.274   7.094   -32.325 1.00 70.49  ? 352 LEU A O     1 
ATOM   2737 C  CB    . LEU A 1 372 ? 4.595   10.346  -32.354 1.00 83.01  ? 352 LEU A CB    1 
ATOM   2738 C  CG    . LEU A 1 372 ? 3.793   10.859  -33.549 1.00 89.22  ? 352 LEU A CG    1 
ATOM   2739 C  CD1   . LEU A 1 372 ? 2.336   11.149  -33.191 1.00 93.02  ? 352 LEU A CD1   1 
ATOM   2740 C  CD2   . LEU A 1 372 ? 4.483   12.097  -34.106 1.00 92.28  ? 352 LEU A CD2   1 
ATOM   2741 N  N     . GLU A 1 373 ? 6.158   8.330   -30.676 1.00 77.67  ? 353 GLU A N     1 
ATOM   2742 C  CA    . GLU A 1 373 ? 7.356   7.507   -30.600 1.00 81.19  ? 353 GLU A CA    1 
ATOM   2743 C  C     . GLU A 1 373 ? 7.146   6.245   -29.754 1.00 82.67  ? 353 GLU A C     1 
ATOM   2744 O  O     . GLU A 1 373 ? 8.110   5.674   -29.249 1.00 89.08  ? 353 GLU A O     1 
ATOM   2745 C  CB    . GLU A 1 373 ? 8.571   8.332   -30.153 1.00 81.55  ? 353 GLU A CB    1 
ATOM   2746 C  CG    . GLU A 1 373 ? 8.579   8.778   -28.703 1.00 86.23  ? 353 GLU A CG    1 
ATOM   2747 C  CD    . GLU A 1 373 ? 9.555   9.921   -28.446 1.00 92.34  ? 353 GLU A CD    1 
ATOM   2748 O  OE1   . GLU A 1 373 ? 9.426   10.585  -27.393 1.00 97.98  ? 353 GLU A OE1   1 
ATOM   2749 O  OE2   . GLU A 1 373 ? 10.446  10.167  -29.293 1.00 88.80  ? 353 GLU A OE2   1 
ATOM   2750 N  N     . GLU A 1 374 ? 5.888   5.812   -29.619 1.00 81.92  ? 354 GLU A N     1 
ATOM   2751 C  CA    . GLU A 1 374 ? 5.564   4.472   -29.124 1.00 83.16  ? 354 GLU A CA    1 
ATOM   2752 C  C     . GLU A 1 374 ? 5.410   3.474   -30.274 1.00 82.50  ? 354 GLU A C     1 
ATOM   2753 O  O     . GLU A 1 374 ? 5.797   2.312   -30.140 1.00 85.75  ? 354 GLU A O     1 
ATOM   2754 C  CB    . GLU A 1 374 ? 4.298   4.490   -28.265 1.00 83.91  ? 354 GLU A CB    1 
ATOM   2755 C  CG    . GLU A 1 374 ? 4.577   4.840   -26.809 1.00 89.64  ? 354 GLU A CG    1 
ATOM   2756 C  CD    . GLU A 1 374 ? 3.317   4.970   -25.963 1.00 94.96  ? 354 GLU A CD    1 
ATOM   2757 O  OE1   . GLU A 1 374 ? 2.222   4.596   -26.442 1.00 94.68  ? 354 GLU A OE1   1 
ATOM   2758 O  OE2   . GLU A 1 374 ? 3.425   5.446   -24.807 1.00 93.75  ? 354 GLU A OE2   1 
ATOM   2759 N  N     . LYS A 1 375 ? 4.860   3.926   -31.400 1.00 79.59  ? 355 LYS A N     1 
ATOM   2760 C  CA    . LYS A 1 375 ? 4.652   3.056   -32.567 1.00 79.14  ? 355 LYS A CA    1 
ATOM   2761 C  C     . LYS A 1 375 ? 5.938   2.766   -33.385 1.00 73.69  ? 355 LYS A C     1 
ATOM   2762 O  O     . LYS A 1 375 ? 7.033   3.178   -33.000 1.00 67.58  ? 355 LYS A O     1 
ATOM   2763 C  CB    . LYS A 1 375 ? 3.533   3.621   -33.445 1.00 79.51  ? 355 LYS A CB    1 
ATOM   2764 C  CG    . LYS A 1 375 ? 3.863   4.911   -34.180 1.00 77.37  ? 355 LYS A CG    1 
ATOM   2765 C  CD    . LYS A 1 375 ? 2.598   5.622   -34.642 1.00 78.55  ? 355 LYS A CD    1 
ATOM   2766 C  CE    . LYS A 1 375 ? 1.734   6.093   -33.476 1.00 77.75  ? 355 LYS A CE    1 
ATOM   2767 N  NZ    . LYS A 1 375 ? 0.463   6.725   -33.925 1.00 75.66  ? 355 LYS A NZ    1 
ATOM   2768 N  N     . ALA A 1 376 ? 5.787   2.039   -34.496 1.00 68.88  ? 356 ALA A N     1 
ATOM   2769 C  CA    . ALA A 1 376 ? 6.923   1.510   -35.268 1.00 68.43  ? 356 ALA A CA    1 
ATOM   2770 C  C     . ALA A 1 376 ? 7.880   2.597   -35.767 1.00 65.66  ? 356 ALA A C     1 
ATOM   2771 O  O     . ALA A 1 376 ? 7.460   3.491   -36.494 1.00 61.72  ? 356 ALA A O     1 
ATOM   2772 C  CB    . ALA A 1 376 ? 6.407   0.701   -36.451 1.00 65.82  ? 356 ALA A CB    1 
ATOM   2773 N  N     . PRO A 1 377 ? 9.166   2.530   -35.370 1.00 65.98  ? 357 PRO A N     1 
ATOM   2774 C  CA    . PRO A 1 377 ? 10.167  3.444   -35.941 1.00 66.20  ? 357 PRO A CA    1 
ATOM   2775 C  C     . PRO A 1 377 ? 10.230  3.376   -37.469 1.00 64.65  ? 357 PRO A C     1 
ATOM   2776 O  O     . PRO A 1 377 ? 9.704   2.437   -38.064 1.00 62.29  ? 357 PRO A O     1 
ATOM   2777 C  CB    . PRO A 1 377 ? 11.485  2.958   -35.324 1.00 65.32  ? 357 PRO A CB    1 
ATOM   2778 C  CG    . PRO A 1 377 ? 11.088  2.349   -34.026 1.00 68.10  ? 357 PRO A CG    1 
ATOM   2779 C  CD    . PRO A 1 377 ? 9.711   1.764   -34.231 1.00 68.07  ? 357 PRO A CD    1 
ATOM   2780 N  N     . GLY A 1 378 ? 10.854  4.375   -38.092 1.00 63.00  ? 358 GLY A N     1 
ATOM   2781 C  CA    . GLY A 1 378 ? 10.958  4.435   -39.556 1.00 60.68  ? 358 GLY A CA    1 
ATOM   2782 C  C     . GLY A 1 378 ? 10.441  5.727   -40.187 1.00 58.76  ? 358 GLY A C     1 
ATOM   2783 O  O     . GLY A 1 378 ? 9.947   6.616   -39.485 1.00 51.02  ? 358 GLY A O     1 
ATOM   2784 N  N     . PRO A 1 379 ? 10.543  5.825   -41.528 1.00 56.84  ? 359 PRO A N     1 
ATOM   2785 C  CA    . PRO A 1 379 ? 10.229  7.014   -42.331 1.00 55.86  ? 359 PRO A CA    1 
ATOM   2786 C  C     . PRO A 1 379 ? 8.857   7.649   -42.074 1.00 58.90  ? 359 PRO A C     1 
ATOM   2787 O  O     . PRO A 1 379 ? 8.738   8.875   -42.090 1.00 54.32  ? 359 PRO A O     1 
ATOM   2788 C  CB    . PRO A 1 379 ? 10.280  6.484   -43.772 1.00 56.82  ? 359 PRO A CB    1 
ATOM   2789 C  CG    . PRO A 1 379 ? 11.209  5.323   -43.718 1.00 55.11  ? 359 PRO A CG    1 
ATOM   2790 C  CD    . PRO A 1 379 ? 10.941  4.688   -42.382 1.00 55.26  ? 359 PRO A CD    1 
ATOM   2791 N  N     . LEU A 1 380 ? 7.840   6.818   -41.861 1.00 61.75  ? 360 LEU A N     1 
ATOM   2792 C  CA    . LEU A 1 380 ? 6.471   7.287   -41.630 1.00 65.43  ? 360 LEU A CA    1 
ATOM   2793 C  C     . LEU A 1 380 ? 6.360   8.031   -40.310 1.00 62.00  ? 360 LEU A C     1 
ATOM   2794 O  O     . LEU A 1 380 ? 5.693   9.068   -40.210 1.00 59.92  ? 360 LEU A O     1 
ATOM   2795 C  CB    . LEU A 1 380 ? 5.502   6.102   -41.601 1.00 69.21  ? 360 LEU A CB    1 
ATOM   2796 C  CG    . LEU A 1 380 ? 4.023   6.489   -41.570 1.00 73.49  ? 360 LEU A CG    1 
ATOM   2797 C  CD1   . LEU A 1 380 ? 3.606   6.964   -42.961 1.00 72.18  ? 360 LEU A CD1   1 
ATOM   2798 C  CD2   . LEU A 1 380 ? 3.161   5.331   -41.067 1.00 73.39  ? 360 LEU A CD2   1 
ATOM   2799 N  N     . GLN A 1 381 ? 7.009   7.471   -39.299 1.00 58.07  ? 361 GLN A N     1 
ATOM   2800 C  CA    . GLN A 1 381 ? 7.048   8.084   -37.988 1.00 58.42  ? 361 GLN A CA    1 
ATOM   2801 C  C     . GLN A 1 381 ? 7.892   9.361   -38.000 1.00 55.00  ? 361 GLN A C     1 
ATOM   2802 O  O     . GLN A 1 381 ? 7.567   10.316  -37.304 1.00 54.31  ? 361 GLN A O     1 
ATOM   2803 C  CB    . GLN A 1 381 ? 7.590   7.100   -36.959 1.00 57.55  ? 361 GLN A CB    1 
ATOM   2804 C  CG    . GLN A 1 381 ? 7.283   7.507   -35.536 1.00 61.05  ? 361 GLN A CG    1 
ATOM   2805 C  CD    . GLN A 1 381 ? 8.082   6.722   -34.514 1.00 64.18  ? 361 GLN A CD    1 
ATOM   2806 O  OE1   . GLN A 1 381 ? 7.735   5.590   -34.172 1.00 68.35  ? 361 GLN A OE1   1 
ATOM   2807 N  NE2   . GLN A 1 381 ? 9.140   7.331   -34.000 1.00 64.61  ? 361 GLN A NE2   1 
ATOM   2808 N  N     . ASP A 1 382 ? 8.972   9.373   -38.777 1.00 52.69  ? 362 ASP A N     1 
ATOM   2809 C  CA    . ASP A 1 382 ? 9.791   10.583  -38.934 1.00 51.35  ? 362 ASP A CA    1 
ATOM   2810 C  C     . ASP A 1 382 ? 9.002   11.693  -39.616 1.00 48.34  ? 362 ASP A C     1 
ATOM   2811 O  O     . ASP A 1 382 ? 9.244   12.867  -39.362 1.00 49.38  ? 362 ASP A O     1 
ATOM   2812 C  CB    . ASP A 1 382 ? 11.058  10.312  -39.760 1.00 50.85  ? 362 ASP A CB    1 
ATOM   2813 C  CG    . ASP A 1 382 ? 12.054  9.409   -39.045 1.00 56.18  ? 362 ASP A CG    1 
ATOM   2814 O  OD1   . ASP A 1 382 ? 11.824  9.069   -37.865 1.00 55.81  ? 362 ASP A OD1   1 
ATOM   2815 O  OD2   . ASP A 1 382 ? 13.076  9.040   -39.674 1.00 58.88  ? 362 ASP A OD2   1 
ATOM   2816 N  N     . ILE A 1 383 ? 8.091   11.331  -40.511 1.00 48.00  ? 363 ILE A N     1 
ATOM   2817 C  CA    . ILE A 1 383 ? 7.250   12.331  -41.160 1.00 50.61  ? 363 ILE A CA    1 
ATOM   2818 C  C     . ILE A 1 383 ? 6.282   12.872  -40.106 1.00 48.62  ? 363 ILE A C     1 
ATOM   2819 O  O     . ILE A 1 383 ? 6.279   14.066  -39.827 1.00 48.59  ? 363 ILE A O     1 
ATOM   2820 C  CB    . ILE A 1 383 ? 6.525   11.770  -42.401 1.00 51.68  ? 363 ILE A CB    1 
ATOM   2821 C  CG1   . ILE A 1 383 ? 7.530   11.614  -43.554 1.00 53.90  ? 363 ILE A CG1   1 
ATOM   2822 C  CG2   . ILE A 1 383 ? 5.369   12.679  -42.826 1.00 50.20  ? 363 ILE A CG2   1 
ATOM   2823 C  CD1   . ILE A 1 383 ? 7.080   10.689  -44.680 1.00 54.46  ? 363 ILE A CD1   1 
ATOM   2824 N  N     . GLU A 1 384 ? 5.519   11.991  -39.477 1.00 47.42  ? 364 GLU A N     1 
ATOM   2825 C  CA    . GLU A 1 384 ? 4.645   12.422  -38.399 1.00 53.41  ? 364 GLU A CA    1 
ATOM   2826 C  C     . GLU A 1 384 ? 5.353   13.261  -37.321 1.00 52.88  ? 364 GLU A C     1 
ATOM   2827 O  O     . GLU A 1 384 ? 4.789   14.269  -36.878 1.00 47.81  ? 364 GLU A O     1 
ATOM   2828 C  CB    . GLU A 1 384 ? 3.900   11.243  -37.784 1.00 59.00  ? 364 GLU A CB    1 
ATOM   2829 C  CG    . GLU A 1 384 ? 2.529   11.037  -38.420 1.00 70.86  ? 364 GLU A CG    1 
ATOM   2830 C  CD    . GLU A 1 384 ? 1.870   9.718   -38.036 1.00 77.94  ? 364 GLU A CD    1 
ATOM   2831 O  OE1   . GLU A 1 384 ? 0.988   9.710   -37.139 1.00 79.23  ? 364 GLU A OE1   1 
ATOM   2832 O  OE2   . GLU A 1 384 ? 2.239   8.686   -38.639 1.00 84.09  ? 364 GLU A OE2   1 
ATOM   2833 N  N     . ARG A 1 385 ? 6.572   12.876  -36.930 1.00 51.98  ? 365 ARG A N     1 
ATOM   2834 C  CA    . ARG A 1 385 ? 7.310   13.599  -35.882 1.00 54.26  ? 365 ARG A CA    1 
ATOM   2835 C  C     . ARG A 1 385 ? 7.684   14.959  -36.397 1.00 46.71  ? 365 ARG A C     1 
ATOM   2836 O  O     . ARG A 1 385 ? 7.604   15.929  -35.665 1.00 46.11  ? 365 ARG A O     1 
ATOM   2837 C  CB    . ARG A 1 385 ? 8.586   12.874  -35.399 1.00 61.79  ? 365 ARG A CB    1 
ATOM   2838 C  CG    . ARG A 1 385 ? 9.881   13.667  -35.615 1.00 71.52  ? 365 ARG A CG    1 
ATOM   2839 C  CD    . ARG A 1 385 ? 11.109  13.109  -34.899 1.00 77.34  ? 365 ARG A CD    1 
ATOM   2840 N  NE    . ARG A 1 385 ? 11.459  11.775  -35.379 1.00 80.02  ? 365 ARG A NE    1 
ATOM   2841 C  CZ    . ARG A 1 385 ? 11.089  10.638  -34.796 1.00 83.41  ? 365 ARG A CZ    1 
ATOM   2842 N  NH1   . ARG A 1 385 ? 10.355  10.642  -33.680 1.00 83.25  ? 365 ARG A NH1   1 
ATOM   2843 N  NH2   . ARG A 1 385 ? 11.460  9.485   -35.337 1.00 87.88  ? 365 ARG A NH2   1 
ATOM   2844 N  N     . HIS A 1 386 ? 8.106   15.029  -37.654 1.00 44.07  ? 366 HIS A N     1 
ATOM   2845 C  CA    . HIS A 1 386 ? 8.402   16.312  -38.273 1.00 44.92  ? 366 HIS A CA    1 
ATOM   2846 C  C     . HIS A 1 386 ? 7.194   17.239  -38.292 1.00 39.40  ? 366 HIS A C     1 
ATOM   2847 O  O     . HIS A 1 386 ? 7.333   18.424  -38.048 1.00 36.73  ? 366 HIS A O     1 
ATOM   2848 C  CB    . HIS A 1 386 ? 8.953   16.153  -39.694 1.00 49.63  ? 366 HIS A CB    1 
ATOM   2849 C  CG    . HIS A 1 386 ? 10.444  16.013  -39.748 1.00 59.91  ? 366 HIS A CG    1 
ATOM   2850 N  ND1   . HIS A 1 386 ? 11.297  16.847  -39.056 1.00 64.91  ? 366 HIS A ND1   1 
ATOM   2851 C  CD2   . HIS A 1 386 ? 11.236  15.134  -40.413 1.00 66.39  ? 366 HIS A CD2   1 
ATOM   2852 C  CE1   . HIS A 1 386 ? 12.548  16.488  -39.291 1.00 70.28  ? 366 HIS A CE1   1 
ATOM   2853 N  NE2   . HIS A 1 386 ? 12.539  15.453  -40.113 1.00 70.19  ? 366 HIS A NE2   1 
ATOM   2854 N  N     . LYS A 1 387 ? 6.023   16.688  -38.596 1.00 38.76  ? 367 LYS A N     1 
ATOM   2855 C  CA    . LYS A 1 387 ? 4.797   17.486  -38.728 1.00 38.11  ? 367 LYS A CA    1 
ATOM   2856 C  C     . LYS A 1 387 ? 4.287   17.945  -37.383 1.00 33.66  ? 367 LYS A C     1 
ATOM   2857 O  O     . LYS A 1 387 ? 3.833   19.068  -37.255 1.00 36.04  ? 367 LYS A O     1 
ATOM   2858 C  CB    . LYS A 1 387 ? 3.699   16.715  -39.464 1.00 38.18  ? 367 LYS A CB    1 
ATOM   2859 C  CG    . LYS A 1 387 ? 3.961   16.598  -40.947 1.00 37.34  ? 367 LYS A CG    1 
ATOM   2860 C  CD    . LYS A 1 387 ? 2.844   15.838  -41.644 1.00 38.20  ? 367 LYS A CD    1 
ATOM   2861 C  CE    . LYS A 1 387 ? 3.113   15.841  -43.131 1.00 39.64  ? 367 LYS A CE    1 
ATOM   2862 N  NZ    . LYS A 1 387 ? 1.877   15.701  -43.919 1.00 40.18  ? 367 LYS A NZ    1 
ATOM   2863 N  N     . LEU A 1 388 ? 4.375   17.085  -36.386 1.00 30.95  ? 368 LEU A N     1 
ATOM   2864 C  CA    . LEU A 1 388 ? 4.077   17.491  -35.029 1.00 32.09  ? 368 LEU A CA    1 
ATOM   2865 C  C     . LEU A 1 388 ? 5.007   18.629  -34.618 1.00 34.27  ? 368 LEU A C     1 
ATOM   2866 O  O     . LEU A 1 388 ? 4.556   19.640  -34.052 1.00 30.31  ? 368 LEU A O     1 
ATOM   2867 C  CB    . LEU A 1 388 ? 4.250   16.336  -34.065 1.00 31.41  ? 368 LEU A CB    1 
ATOM   2868 C  CG    . LEU A 1 388 ? 4.046   16.705  -32.598 1.00 33.90  ? 368 LEU A CG    1 
ATOM   2869 C  CD1   . LEU A 1 388 ? 2.622   17.154  -32.305 1.00 32.61  ? 368 LEU A CD1   1 
ATOM   2870 C  CD2   . LEU A 1 388 ? 4.427   15.532  -31.707 1.00 34.20  ? 368 LEU A CD2   1 
ATOM   2871 N  N     . ASN A 1 389 ? 6.296   18.466  -34.927 1.00 35.69  ? 369 ASN A N     1 
ATOM   2872 C  CA    . ASN A 1 389 ? 7.314   19.411  -34.479 1.00 36.95  ? 369 ASN A CA    1 
ATOM   2873 C  C     . ASN A 1 389 ? 7.093   20.763  -35.073 1.00 33.23  ? 369 ASN A C     1 
ATOM   2874 O  O     . ASN A 1 389 ? 7.266   21.759  -34.400 1.00 32.32  ? 369 ASN A O     1 
ATOM   2875 C  CB    . ASN A 1 389 ? 8.730   18.910  -34.760 1.00 41.84  ? 369 ASN A CB    1 
ATOM   2876 C  CG    . ASN A 1 389 ? 9.259   18.028  -33.641 1.00 50.36  ? 369 ASN A CG    1 
ATOM   2877 O  OD1   . ASN A 1 389 ? 8.967   18.243  -32.448 1.00 53.42  ? 369 ASN A OD1   1 
ATOM   2878 N  ND2   . ASN A 1 389 ? 10.043  17.022  -34.013 1.00 59.93  ? 369 ASN A ND2   1 
ATOM   2879 N  N     . ALA A 1 390 ? 6.679   20.779  -36.334 1.00 31.64  ? 370 ALA A N     1 
ATOM   2880 C  CA    . ALA A 1 390 ? 6.243   21.980  -37.002 1.00 28.53  ? 370 ALA A CA    1 
ATOM   2881 C  C     . ALA A 1 390 ? 5.040   22.643  -36.302 1.00 29.09  ? 370 ALA A C     1 
ATOM   2882 O  O     . ALA A 1 390 ? 5.004   23.875  -36.176 1.00 30.73  ? 370 ALA A O     1 
ATOM   2883 C  CB    . ALA A 1 390 ? 5.904   21.657  -38.449 1.00 28.35  ? 370 ALA A CB    1 
ATOM   2884 N  N     . MET A 1 391 ? 4.051   21.853  -35.868 1.00 27.21  ? 371 MET A N     1 
ATOM   2885 C  CA    . MET A 1 391 ? 2.915   22.398  -35.095 1.00 26.30  ? 371 MET A CA    1 
ATOM   2886 C  C     . MET A 1 391 ? 3.421   23.095  -33.845 1.00 23.38  ? 371 MET A C     1 
ATOM   2887 O  O     . MET A 1 391 ? 2.964   24.171  -33.512 1.00 23.08  ? 371 MET A O     1 
ATOM   2888 C  CB    . MET A 1 391 ? 1.924   21.298  -34.688 1.00 28.03  ? 371 MET A CB    1 
ATOM   2889 C  CG    . MET A 1 391 ? 0.655   21.773  -34.002 1.00 29.53  ? 371 MET A CG    1 
ATOM   2890 S  SD    . MET A 1 391 ? -0.446  22.709  -35.108 1.00 34.29  ? 371 MET A SD    1 
ATOM   2891 C  CE    . MET A 1 391 ? -0.391  24.331  -34.368 1.00 34.25  ? 371 MET A CE    1 
ATOM   2892 N  N     . GLY A 1 392 ? 4.387   22.491  -33.174 1.00 22.57  ? 372 GLY A N     1 
ATOM   2893 C  CA    . GLY A 1 392 ? 4.936   23.043  -31.944 1.00 24.20  ? 372 GLY A CA    1 
ATOM   2894 C  C     . GLY A 1 392 ? 5.711   24.322  -32.179 1.00 27.49  ? 372 GLY A C     1 
ATOM   2895 O  O     . GLY A 1 392 ? 5.674   25.244  -31.358 1.00 30.55  ? 372 GLY A O     1 
ATOM   2896 N  N     . ALA A 1 393 ? 6.377   24.391  -33.328 1.00 28.08  ? 373 ALA A N     1 
ATOM   2897 C  CA    . ALA A 1 393 ? 7.113   25.559  -33.719 1.00 29.68  ? 373 ALA A CA    1 
ATOM   2898 C  C     . ALA A 1 393 ? 6.176   26.718  -34.062 1.00 29.40  ? 373 ALA A C     1 
ATOM   2899 O  O     . ALA A 1 393 ? 6.477   27.874  -33.746 1.00 29.26  ? 373 ALA A O     1 
ATOM   2900 C  CB    . ALA A 1 393 ? 8.008   25.226  -34.898 1.00 32.08  ? 373 ALA A CB    1 
ATOM   2901 N  N     . PHE A 1 394 ? 5.054   26.413  -34.709 1.00 27.30  ? 374 PHE A N     1 
ATOM   2902 C  CA    . PHE A 1 394 ? 3.999   27.403  -34.930 1.00 25.76  ? 374 PHE A CA    1 
ATOM   2903 C  C     . PHE A 1 394 ? 3.499   27.941  -33.605 1.00 23.91  ? 374 PHE A C     1 
ATOM   2904 O  O     . PHE A 1 394 ? 3.331   29.141  -33.446 1.00 22.02  ? 374 PHE A O     1 
ATOM   2905 C  CB    . PHE A 1 394 ? 2.841   26.780  -35.711 1.00 26.14  ? 374 PHE A CB    1 
ATOM   2906 C  CG    . PHE A 1 394 ? 1.602   27.630  -35.788 1.00 25.01  ? 374 PHE A CG    1 
ATOM   2907 C  CD1   . PHE A 1 394 ? 1.452   28.563  -36.785 1.00 25.71  ? 374 PHE A CD1   1 
ATOM   2908 C  CD2   . PHE A 1 394 ? 0.572   27.465  -34.883 1.00 26.00  ? 374 PHE A CD2   1 
ATOM   2909 C  CE1   . PHE A 1 394 ? 0.299   29.333  -36.879 1.00 26.34  ? 374 PHE A CE1   1 
ATOM   2910 C  CE2   . PHE A 1 394 ? -0.587  28.224  -34.961 1.00 26.14  ? 374 PHE A CE2   1 
ATOM   2911 C  CZ    . PHE A 1 394 ? -0.731  29.157  -35.970 1.00 26.38  ? 374 PHE A CZ    1 
ATOM   2912 N  N     . ALA A 1 395 ? 3.280   27.049  -32.645 1.00 25.27  ? 375 ALA A N     1 
ATOM   2913 C  CA    . ALA A 1 395 ? 2.785   27.475  -31.314 1.00 25.49  ? 375 ALA A CA    1 
ATOM   2914 C  C     . ALA A 1 395 ? 3.782   28.347  -30.586 1.00 25.72  ? 375 ALA A C     1 
ATOM   2915 O  O     . ALA A 1 395 ? 3.375   29.301  -29.945 1.00 28.39  ? 375 ALA A O     1 
ATOM   2916 C  CB    . ALA A 1 395 ? 2.422   26.278  -30.449 1.00 25.45  ? 375 ALA A CB    1 
ATOM   2917 N  N     . GLU A 1 396 ? 5.070   28.024  -30.697 1.00 26.58  ? 376 GLU A N     1 
ATOM   2918 C  CA    . GLU A 1 396 ? 6.156   28.749  -30.012 1.00 28.25  ? 376 GLU A CA    1 
ATOM   2919 C  C     . GLU A 1 396 ? 6.721   29.919  -30.848 1.00 27.33  ? 376 GLU A C     1 
ATOM   2920 O  O     . GLU A 1 396 ? 7.699   30.534  -30.472 1.00 28.63  ? 376 GLU A O     1 
ATOM   2921 C  CB    . GLU A 1 396 ? 7.346   27.789  -29.723 1.00 31.06  ? 376 GLU A CB    1 
ATOM   2922 C  CG    . GLU A 1 396 ? 7.067   26.511  -28.929 1.00 33.63  ? 376 GLU A CG    1 
ATOM   2923 C  CD    . GLU A 1 396 ? 7.021   26.718  -27.423 1.00 38.97  ? 376 GLU A CD    1 
ATOM   2924 O  OE1   . GLU A 1 396 ? 7.465   27.793  -26.944 1.00 42.34  ? 376 GLU A OE1   1 
ATOM   2925 O  OE2   . GLU A 1 396 ? 6.548   25.793  -26.706 1.00 40.48  ? 376 GLU A OE2   1 
ATOM   2926 N  N     . ALA A 1 397 ? 6.176   30.189  -32.017 1.00 27.83  ? 377 ALA A N     1 
ATOM   2927 C  CA    . ALA A 1 397 ? 6.791   31.176  -32.890 1.00 28.59  ? 377 ALA A CA    1 
ATOM   2928 C  C     . ALA A 1 397 ? 6.785   32.566  -32.264 1.00 29.26  ? 377 ALA A C     1 
ATOM   2929 O  O     . ALA A 1 397 ? 5.871   32.920  -31.562 1.00 27.58  ? 377 ALA A O     1 
ATOM   2930 C  CB    . ALA A 1 397 ? 6.058   31.204  -34.214 1.00 28.59  ? 377 ALA A CB    1 
ATOM   2931 N  N     . GLN A 1 398 ? 7.809   33.362  -32.504 1.00 34.62  ? 378 GLN A N     1 
ATOM   2932 C  CA    . GLN A 1 398 ? 7.716   34.777  -32.130 1.00 39.11  ? 378 GLN A CA    1 
ATOM   2933 C  C     . GLN A 1 398 ? 7.720   35.598  -33.386 1.00 35.41  ? 378 GLN A C     1 
ATOM   2934 O  O     . GLN A 1 398 ? 8.239   36.714  -33.395 1.00 40.45  ? 378 GLN A O     1 
ATOM   2935 C  CB    . GLN A 1 398 ? 8.857   35.240  -31.227 1.00 46.16  ? 378 GLN A CB    1 
ATOM   2936 C  CG    . GLN A 1 398 ? 8.875   34.649  -29.837 1.00 52.48  ? 378 GLN A CG    1 
ATOM   2937 C  CD    . GLN A 1 398 ? 9.767   33.453  -29.757 1.00 61.49  ? 378 GLN A CD    1 
ATOM   2938 O  OE1   . GLN A 1 398 ? 10.707  33.315  -30.547 1.00 72.41  ? 378 GLN A OE1   1 
ATOM   2939 N  NE2   . GLN A 1 398 ? 9.489   32.570  -28.803 1.00 71.58  ? 378 GLN A NE2   1 
ATOM   2940 N  N     . THR A 1 399 ? 7.154   35.031  -34.445 1.00 30.53  ? 379 THR A N     1 
ATOM   2941 C  CA    . THR A 1 399 ? 6.925   35.754  -35.676 1.00 29.36  ? 379 THR A CA    1 
ATOM   2942 C  C     . THR A 1 399 ? 5.459   35.580  -36.072 1.00 25.45  ? 379 THR A C     1 
ATOM   2943 O  O     . THR A 1 399 ? 4.727   34.795  -35.479 1.00 22.91  ? 379 THR A O     1 
ATOM   2944 C  CB    . THR A 1 399 ? 7.911   35.301  -36.783 1.00 30.56  ? 379 THR A CB    1 
ATOM   2945 O  OG1   . THR A 1 399 ? 7.843   36.203  -37.895 1.00 34.71  ? 379 THR A OG1   1 
ATOM   2946 C  CG2   . THR A 1 399 ? 7.620   33.891  -37.294 1.00 31.31  ? 379 THR A CG2   1 
ATOM   2947 N  N     . CYS A 1 400 ? 5.040   36.330  -37.067 1.00 23.10  ? 380 CYS A N     1 
ATOM   2948 C  CA    . CYS A 1 400 ? 3.650   36.330  -37.519 1.00 22.45  ? 380 CYS A CA    1 
ATOM   2949 C  C     . CYS A 1 400 ? 3.165   34.895  -37.818 1.00 22.52  ? 380 CYS A C     1 
ATOM   2950 O  O     . CYS A 1 400 ? 3.806   34.171  -38.589 1.00 20.89  ? 380 CYS A O     1 
ATOM   2951 C  CB    . CYS A 1 400 ? 3.535   37.215  -38.761 1.00 20.96  ? 380 CYS A CB    1 
ATOM   2952 S  SG    . CYS A 1 400 ? 2.012   37.101  -39.704 1.00 21.81  ? 380 CYS A SG    1 
ATOM   2953 N  N     . ARG A 1 401 ? 2.011   34.527  -37.242 1.00 21.44  ? 381 ARG A N     1 
ATOM   2954 C  CA    . ARG A 1 401 ? 1.490   33.158  -37.323 1.00 22.10  ? 381 ARG A CA    1 
ATOM   2955 C  C     . ARG A 1 401 ? 1.221   32.749  -38.733 1.00 20.83  ? 381 ARG A C     1 
ATOM   2956 O  O     . ARG A 1 401 ? 1.394   31.592  -39.104 1.00 21.34  ? 381 ARG A O     1 
ATOM   2957 C  CB    . ARG A 1 401 ? 0.161   33.038  -36.602 1.00 23.46  ? 381 ARG A CB    1 
ATOM   2958 C  CG    . ARG A 1 401 ? 0.204   33.404  -35.134 1.00 25.73  ? 381 ARG A CG    1 
ATOM   2959 C  CD    . ARG A 1 401 ? 1.040   32.483  -34.284 1.00 25.13  ? 381 ARG A CD    1 
ATOM   2960 N  NE    . ARG A 1 401 ? 0.859   32.870  -32.884 1.00 26.49  ? 381 ARG A NE    1 
ATOM   2961 C  CZ    . ARG A 1 401 ? 1.647   32.494  -31.880 1.00 27.25  ? 381 ARG A CZ    1 
ATOM   2962 N  NH1   . ARG A 1 401 ? 2.675   31.666  -32.073 1.00 26.62  ? 381 ARG A NH1   1 
ATOM   2963 N  NH2   . ARG A 1 401 ? 1.413   32.968  -30.670 1.00 28.66  ? 381 ARG A NH2   1 
ATOM   2964 N  N     . ARG A 1 402 ? 0.760   33.717  -39.494 1.00 20.66  ? 382 ARG A N     1 
ATOM   2965 C  CA    . ARG A 1 402 ? 0.346   33.536  -40.867 1.00 21.43  ? 382 ARG A CA    1 
ATOM   2966 C  C     . ARG A 1 402 ? 1.566   33.332  -41.720 1.00 20.69  ? 382 ARG A C     1 
ATOM   2967 O  O     . ARG A 1 402 ? 1.521   32.579  -42.666 1.00 21.20  ? 382 ARG A O     1 
ATOM   2968 C  CB    . ARG A 1 402 ? -0.412  34.791  -41.338 1.00 22.06  ? 382 ARG A CB    1 
ATOM   2969 C  CG    . ARG A 1 402 ? -1.401  34.555  -42.471 1.00 22.44  ? 382 ARG A CG    1 
ATOM   2970 C  CD    . ARG A 1 402 ? -2.130  35.834  -42.834 1.00 22.67  ? 382 ARG A CD    1 
ATOM   2971 N  NE    . ARG A 1 402 ? -2.906  36.310  -41.698 1.00 21.96  ? 382 ARG A NE    1 
ATOM   2972 C  CZ    . ARG A 1 402 ? -4.192  36.085  -41.507 1.00 21.05  ? 382 ARG A CZ    1 
ATOM   2973 N  NH1   . ARG A 1 402 ? -4.893  35.407  -42.384 1.00 21.62  ? 382 ARG A NH1   1 
ATOM   2974 N  NH2   . ARG A 1 402 ? -4.774  36.559  -40.421 1.00 21.30  ? 382 ARG A NH2   1 
ATOM   2975 N  N     . LEU A 1 403 ? 2.669   33.986  -41.381 1.00 20.45  ? 383 LEU A N     1 
ATOM   2976 C  CA    . LEU A 1 403 ? 3.910   33.725  -42.111 1.00 21.05  ? 383 LEU A CA    1 
ATOM   2977 C  C     . LEU A 1 403 ? 4.360   32.282  -41.908 1.00 19.80  ? 383 LEU A C     1 
ATOM   2978 O  O     . LEU A 1 403 ? 4.852   31.650  -42.829 1.00 19.37  ? 383 LEU A O     1 
ATOM   2979 C  CB    . LEU A 1 403 ? 5.033   34.697  -41.702 1.00 20.84  ? 383 LEU A CB    1 
ATOM   2980 C  CG    . LEU A 1 403 ? 4.810   36.123  -42.171 1.00 21.21  ? 383 LEU A CG    1 
ATOM   2981 C  CD1   . LEU A 1 403 ? 6.010   36.957  -41.866 1.00 21.34  ? 383 LEU A CD1   1 
ATOM   2982 C  CD2   . LEU A 1 403 ? 4.523   36.187  -43.654 1.00 22.82  ? 383 LEU A CD2   1 
ATOM   2983 N  N     . VAL A 1 404 ? 4.206   31.769  -40.699 1.00 20.00  ? 384 VAL A N     1 
ATOM   2984 C  CA    . VAL A 1 404 ? 4.602   30.401  -40.420 1.00 20.92  ? 384 VAL A CA    1 
ATOM   2985 C  C     . VAL A 1 404 ? 3.745   29.451  -41.213 1.00 21.04  ? 384 VAL A C     1 
ATOM   2986 O  O     . VAL A 1 404 ? 4.265   28.592  -41.910 1.00 20.78  ? 384 VAL A O     1 
ATOM   2987 C  CB    . VAL A 1 404 ? 4.495   30.043  -38.930 1.00 21.64  ? 384 VAL A CB    1 
ATOM   2988 C  CG1   . VAL A 1 404 ? 4.948   28.598  -38.670 1.00 21.32  ? 384 VAL A CG1   1 
ATOM   2989 C  CG2   . VAL A 1 404 ? 5.316   31.017  -38.106 1.00 21.46  ? 384 VAL A CG2   1 
ATOM   2990 N  N     . LEU A 1 405 ? 2.429   29.622  -41.139 1.00 23.79  ? 385 LEU A N     1 
ATOM   2991 C  CA    . LEU A 1 405 ? 1.495   28.745  -41.881 1.00 23.80  ? 385 LEU A CA    1 
ATOM   2992 C  C     . LEU A 1 405 ? 1.754   28.765  -43.357 1.00 22.45  ? 385 LEU A C     1 
ATOM   2993 O  O     . LEU A 1 405 ? 1.904   27.725  -43.980 1.00 21.28  ? 385 LEU A O     1 
ATOM   2994 C  CB    . LEU A 1 405 ? 0.053   29.187  -41.704 1.00 25.40  ? 385 LEU A CB    1 
ATOM   2995 C  CG    . LEU A 1 405 ? -0.639  28.887  -40.403 1.00 28.74  ? 385 LEU A CG    1 
ATOM   2996 C  CD1   . LEU A 1 405 ? -2.010  29.555  -40.412 1.00 31.04  ? 385 LEU A CD1   1 
ATOM   2997 C  CD2   . LEU A 1 405 ? -0.782  27.381  -40.187 1.00 28.71  ? 385 LEU A CD2   1 
ATOM   2998 N  N     . LEU A 1 406 ? 1.761   29.967  -43.912 1.00 22.17  ? 386 LEU A N     1 
ATOM   2999 C  CA    . LEU A 1 406 ? 1.835   30.120  -45.344 1.00 22.80  ? 386 LEU A CA    1 
ATOM   3000 C  C     . LEU A 1 406 ? 3.127   29.535  -45.854 1.00 21.07  ? 386 LEU A C     1 
ATOM   3001 O  O     . LEU A 1 406 ? 3.117   28.796  -46.845 1.00 21.21  ? 386 LEU A O     1 
ATOM   3002 C  CB    . LEU A 1 406 ? 1.722   31.575  -45.742 1.00 24.53  ? 386 LEU A CB    1 
ATOM   3003 C  CG    . LEU A 1 406 ? 0.373   32.123  -46.197 1.00 27.16  ? 386 LEU A CG    1 
ATOM   3004 C  CD1   . LEU A 1 406 ? -0.815  31.343  -45.704 1.00 28.67  ? 386 LEU A CD1   1 
ATOM   3005 C  CD2   . LEU A 1 406 ? 0.275   33.589  -45.807 1.00 27.68  ? 386 LEU A CD2   1 
ATOM   3006 N  N     . ASN A 1 407 ? 4.235   29.814  -45.167 1.00 19.81  ? 387 ASN A N     1 
ATOM   3007 C  CA    . ASN A 1 407 ? 5.521   29.278  -45.632 1.00 18.52  ? 387 ASN A CA    1 
ATOM   3008 C  C     . ASN A 1 407 ? 5.632   27.787  -45.402 1.00 18.64  ? 387 ASN A C     1 
ATOM   3009 O  O     . ASN A 1 407 ? 6.240   27.091  -46.217 1.00 20.25  ? 387 ASN A O     1 
ATOM   3010 C  CB    . ASN A 1 407 ? 6.700   30.030  -45.040 1.00 17.66  ? 387 ASN A CB    1 
ATOM   3011 C  CG    . ASN A 1 407 ? 6.917   31.367  -45.719 1.00 17.88  ? 387 ASN A CG    1 
ATOM   3012 O  OD1   . ASN A 1 407 ? 7.433   31.452  -46.818 1.00 17.14  ? 387 ASN A OD1   1 
ATOM   3013 N  ND2   . ASN A 1 407 ? 6.512   32.407  -45.074 1.00 19.42  ? 387 ASN A ND2   1 
ATOM   3014 N  N     . TYR A 1 408 ? 5.020   27.280  -44.336 1.00 18.45  ? 388 TYR A N     1 
ATOM   3015 C  CA    . TYR A 1 408 ? 4.940   25.835  -44.154 1.00 20.26  ? 388 TYR A CA    1 
ATOM   3016 C  C     . TYR A 1 408 ? 4.325   25.169  -45.381 1.00 20.32  ? 388 TYR A C     1 
ATOM   3017 O  O     . TYR A 1 408 ? 4.802   24.135  -45.822 1.00 20.31  ? 388 TYR A O     1 
ATOM   3018 C  CB    . TYR A 1 408 ? 4.137   25.463  -42.924 1.00 20.99  ? 388 TYR A CB    1 
ATOM   3019 C  CG    . TYR A 1 408 ? 3.991   23.965  -42.723 1.00 21.74  ? 388 TYR A CG    1 
ATOM   3020 C  CD1   . TYR A 1 408 ? 5.042   23.193  -42.171 1.00 22.74  ? 388 TYR A CD1   1 
ATOM   3021 C  CD2   . TYR A 1 408 ? 2.832   23.316  -43.103 1.00 20.97  ? 388 TYR A CD2   1 
ATOM   3022 C  CE1   . TYR A 1 408 ? 4.917   21.819  -41.997 1.00 22.26  ? 388 TYR A CE1   1 
ATOM   3023 C  CE2   . TYR A 1 408 ? 2.700   21.956  -42.941 1.00 23.09  ? 388 TYR A CE2   1 
ATOM   3024 C  CZ    . TYR A 1 408 ? 3.747   21.210  -42.403 1.00 23.96  ? 388 TYR A CZ    1 
ATOM   3025 O  OH    . TYR A 1 408 ? 3.558   19.857  -42.228 1.00 27.55  ? 388 TYR A OH    1 
ATOM   3026 N  N     . PHE A 1 409 ? 3.298   25.775  -45.951 1.00 21.17  ? 389 PHE A N     1 
ATOM   3027 C  CA    . PHE A 1 409 ? 2.665   25.216  -47.148 1.00 22.65  ? 389 PHE A CA    1 
ATOM   3028 C  C     . PHE A 1 409 ? 3.369   25.583  -48.468 1.00 24.69  ? 389 PHE A C     1 
ATOM   3029 O  O     . PHE A 1 409 ? 2.829   25.357  -49.531 1.00 27.29  ? 389 PHE A O     1 
ATOM   3030 C  CB    . PHE A 1 409 ? 1.182   25.602  -47.201 1.00 21.30  ? 389 PHE A CB    1 
ATOM   3031 C  CG    . PHE A 1 409 ? 0.352   24.916  -46.168 1.00 20.64  ? 389 PHE A CG    1 
ATOM   3032 C  CD1   . PHE A 1 409 ? 0.021   23.577  -46.308 1.00 20.41  ? 389 PHE A CD1   1 
ATOM   3033 C  CD2   . PHE A 1 409 ? -0.119  25.603  -45.059 1.00 20.04  ? 389 PHE A CD2   1 
ATOM   3034 C  CE1   . PHE A 1 409 ? -0.739  22.932  -45.344 1.00 19.40  ? 389 PHE A CE1   1 
ATOM   3035 C  CE2   . PHE A 1 409 ? -0.889  24.972  -44.108 1.00 19.19  ? 389 PHE A CE2   1 
ATOM   3036 C  CZ    . PHE A 1 409 ? -1.182  23.629  -44.239 1.00 19.34  ? 389 PHE A CZ    1 
ATOM   3037 N  N     . GLY A 1 410 ? 4.583   26.121  -48.411 1.00 27.32  ? 390 GLY A N     1 
ATOM   3038 C  CA    . GLY A 1 410 ? 5.316   26.472  -49.619 1.00 25.92  ? 390 GLY A CA    1 
ATOM   3039 C  C     . GLY A 1 410 ? 4.826   27.724  -50.322 1.00 27.76  ? 390 GLY A C     1 
ATOM   3040 O  O     . GLY A 1 410 ? 5.173   27.945  -51.485 1.00 28.35  ? 390 GLY A O     1 
ATOM   3041 N  N     . GLU A 1 411 ? 4.013   28.543  -49.650 1.00 28.11  ? 391 GLU A N     1 
ATOM   3042 C  CA    . GLU A 1 411 ? 3.547   29.818  -50.227 1.00 28.61  ? 391 GLU A CA    1 
ATOM   3043 C  C     . GLU A 1 411 ? 4.420   30.956  -49.706 1.00 28.62  ? 391 GLU A C     1 
ATOM   3044 O  O     . GLU A 1 411 ? 4.258   31.415  -48.584 1.00 32.11  ? 391 GLU A O     1 
ATOM   3045 C  CB    . GLU A 1 411 ? 2.076   30.059  -49.881 1.00 29.45  ? 391 GLU A CB    1 
ATOM   3046 C  CG    . GLU A 1 411 ? 1.420   31.196  -50.665 1.00 30.84  ? 391 GLU A CG    1 
ATOM   3047 C  CD    . GLU A 1 411 ? -0.104  31.246  -50.510 1.00 33.37  ? 391 GLU A CD    1 
ATOM   3048 O  OE1   . GLU A 1 411 ? -0.709  30.229  -50.103 1.00 32.53  ? 391 GLU A OE1   1 
ATOM   3049 O  OE2   . GLU A 1 411 ? -0.712  32.299  -50.818 1.00 35.05  ? 391 GLU A OE2   1 
ATOM   3050 N  N     . GLY A 1 412 ? 5.379   31.380  -50.506 1.00 27.95  ? 392 GLY A N     1 
ATOM   3051 C  CA    . GLY A 1 412 ? 6.376   32.342  -50.060 1.00 27.63  ? 392 GLY A CA    1 
ATOM   3052 C  C     . GLY A 1 412 ? 5.749   33.664  -49.680 1.00 27.33  ? 392 GLY A C     1 
ATOM   3053 O  O     . GLY A 1 412 ? 5.002   34.203  -50.433 1.00 29.53  ? 392 GLY A O     1 
ATOM   3054 N  N     . ARG A 1 413 ? 6.046   34.150  -48.484 1.00 27.06  ? 393 ARG A N     1 
ATOM   3055 C  CA    . ARG A 1 413 ? 5.634   35.442  -48.032 1.00 26.21  ? 393 ARG A CA    1 
ATOM   3056 C  C     . ARG A 1 413 ? 6.540   35.877  -46.875 1.00 25.83  ? 393 ARG A C     1 
ATOM   3057 O  O     . ARG A 1 413 ? 6.928   35.058  -46.062 1.00 25.72  ? 393 ARG A O     1 
ATOM   3058 C  CB    . ARG A 1 413 ? 4.184   35.430  -47.564 1.00 28.35  ? 393 ARG A CB    1 
ATOM   3059 C  CG    . ARG A 1 413 ? 3.709   36.830  -47.194 1.00 28.97  ? 393 ARG A CG    1 
ATOM   3060 C  CD    . ARG A 1 413 ? 2.225   36.944  -46.934 1.00 32.35  ? 393 ARG A CD    1 
ATOM   3061 N  NE    . ARG A 1 413 ? 1.392   36.507  -48.057 1.00 34.85  ? 393 ARG A NE    1 
ATOM   3062 C  CZ    . ARG A 1 413 ? 0.059   36.513  -48.032 1.00 35.18  ? 393 ARG A CZ    1 
ATOM   3063 N  NH1   . ARG A 1 413 ? -0.590  36.946  -46.963 1.00 35.33  ? 393 ARG A NH1   1 
ATOM   3064 N  NH2   . ARG A 1 413 ? -0.627  36.099  -49.082 1.00 35.98  ? 393 ARG A NH2   1 
ATOM   3065 N  N     . GLN A 1 414 ? 6.841   37.173  -46.805 1.00 25.69  ? 394 GLN A N     1 
ATOM   3066 C  CA    . GLN A 1 414 ? 7.741   37.745  -45.788 1.00 26.34  ? 394 GLN A CA    1 
ATOM   3067 C  C     . GLN A 1 414 ? 7.123   38.870  -44.972 1.00 25.63  ? 394 GLN A C     1 
ATOM   3068 O  O     . GLN A 1 414 ? 7.532   39.095  -43.834 1.00 28.21  ? 394 GLN A O     1 
ATOM   3069 C  CB    . GLN A 1 414 ? 9.012   38.311  -46.435 1.00 27.93  ? 394 GLN A CB    1 
ATOM   3070 C  CG    . GLN A 1 414 ? 9.840   37.328  -47.244 1.00 30.01  ? 394 GLN A CG    1 
ATOM   3071 C  CD    . GLN A 1 414 ? 9.352   37.169  -48.680 1.00 33.94  ? 394 GLN A CD    1 
ATOM   3072 O  OE1   . GLN A 1 414 ? 9.173   38.158  -49.414 1.00 36.88  ? 394 GLN A OE1   1 
ATOM   3073 N  NE2   . GLN A 1 414 ? 9.126   35.918  -49.088 1.00 33.86  ? 394 GLN A NE2   1 
ATOM   3074 N  N     . ALA A 1 415 ? 6.177   39.602  -45.545 1.00 25.21  ? 395 ALA A N     1 
ATOM   3075 C  CA    . ALA A 1 415 ? 5.516   40.693  -44.841 1.00 26.17  ? 395 ALA A CA    1 
ATOM   3076 C  C     . ALA A 1 415 ? 4.510   40.144  -43.848 1.00 27.37  ? 395 ALA A C     1 
ATOM   3077 O  O     . ALA A 1 415 ? 3.699   39.309  -44.205 1.00 30.10  ? 395 ALA A O     1 
ATOM   3078 C  CB    . ALA A 1 415 ? 4.794   41.592  -45.829 1.00 26.43  ? 395 ALA A CB    1 
ATOM   3079 N  N     . PRO A 1 416 ? 4.551   40.619  -42.604 1.00 28.47  ? 396 PRO A N     1 
ATOM   3080 C  CA    . PRO A 1 416 ? 3.608   40.199  -41.563 1.00 27.92  ? 396 PRO A CA    1 
ATOM   3081 C  C     . PRO A 1 416 ? 2.164   40.661  -41.767 1.00 26.95  ? 396 PRO A C     1 
ATOM   3082 O  O     . PRO A 1 416 ? 1.916   41.690  -42.356 1.00 28.54  ? 396 PRO A O     1 
ATOM   3083 C  CB    . PRO A 1 416 ? 4.192   40.837  -40.294 1.00 28.36  ? 396 PRO A CB    1 
ATOM   3084 C  CG    . PRO A 1 416 ? 4.886   42.057  -40.794 1.00 28.73  ? 396 PRO A CG    1 
ATOM   3085 C  CD    . PRO A 1 416 ? 5.525   41.601  -42.084 1.00 28.90  ? 396 PRO A CD    1 
ATOM   3086 N  N     . CYS A 1 417 ? 1.221   39.910  -41.220 1.00 27.90  ? 397 CYS A N     1 
ATOM   3087 C  CA    . CYS A 1 417 ? -0.158  39.974  -41.690 1.00 27.25  ? 397 CYS A CA    1 
ATOM   3088 C  C     . CYS A 1 417 ? -0.987  41.099  -41.058 1.00 27.99  ? 397 CYS A C     1 
ATOM   3089 O  O     . CYS A 1 417 ? -1.942  41.535  -41.650 1.00 31.78  ? 397 CYS A O     1 
ATOM   3090 C  CB    . CYS A 1 417 ? -0.851  38.633  -41.464 1.00 24.95  ? 397 CYS A CB    1 
ATOM   3091 S  SG    . CYS A 1 417 ? -1.250  38.242  -39.744 1.00 21.68  ? 397 CYS A SG    1 
ATOM   3092 N  N     . GLY A 1 418 ? -0.615  41.563  -39.872 1.00 28.55  ? 398 GLY A N     1 
ATOM   3093 C  CA    . GLY A 1 418 ? -1.385  42.580  -39.169 1.00 28.31  ? 398 GLY A CA    1 
ATOM   3094 C  C     . GLY A 1 418 ? -2.655  42.059  -38.510 1.00 30.10  ? 398 GLY A C     1 
ATOM   3095 O  O     . GLY A 1 418 ? -3.409  42.848  -37.963 1.00 32.97  ? 398 GLY A O     1 
ATOM   3096 N  N     . ASN A 1 419 ? -2.871  40.732  -38.516 1.00 27.62  ? 399 ASN A N     1 
ATOM   3097 C  CA    . ASN A 1 419 ? -4.139  40.128  -38.116 1.00 23.92  ? 399 ASN A CA    1 
ATOM   3098 C  C     . ASN A 1 419 ? -3.919  38.747  -37.479 1.00 24.75  ? 399 ASN A C     1 
ATOM   3099 O  O     . ASN A 1 419 ? -4.499  37.737  -37.908 1.00 23.46  ? 399 ASN A O     1 
ATOM   3100 C  CB    . ASN A 1 419 ? -5.056  39.997  -39.334 1.00 23.37  ? 399 ASN A CB    1 
ATOM   3101 C  CG    . ASN A 1 419 ? -6.516  39.787  -38.952 1.00 22.70  ? 399 ASN A CG    1 
ATOM   3102 O  OD1   . ASN A 1 419 ? -6.941  40.130  -37.847 1.00 20.75  ? 399 ASN A OD1   1 
ATOM   3103 N  ND2   . ASN A 1 419 ? -7.290  39.223  -39.867 1.00 22.70  ? 399 ASN A ND2   1 
ATOM   3104 N  N     . CYS A 1 420 ? -3.042  38.720  -36.478 1.00 22.60  ? 400 CYS A N     1 
ATOM   3105 C  CA    . CYS A 1 420 ? -2.702  37.522  -35.764 1.00 21.63  ? 400 CYS A CA    1 
ATOM   3106 C  C     . CYS A 1 420 ? -2.218  38.003  -34.415 1.00 23.14  ? 400 CYS A C     1 
ATOM   3107 O  O     . CYS A 1 420 ? -1.980  39.183  -34.244 1.00 23.43  ? 400 CYS A O     1 
ATOM   3108 C  CB    . CYS A 1 420 ? -1.642  36.706  -36.507 1.00 20.82  ? 400 CYS A CB    1 
ATOM   3109 S  SG    . CYS A 1 420 ? 0.073   37.179  -36.203 1.00 19.45  ? 400 CYS A SG    1 
ATOM   3110 N  N     . ASP A 1 421 ? -2.113  37.126  -33.430 1.00 26.04  ? 401 ASP A N     1 
ATOM   3111 C  CA    . ASP A 1 421 ? -1.810  37.617  -32.075 1.00 28.56  ? 401 ASP A CA    1 
ATOM   3112 C  C     . ASP A 1 421 ? -0.394  38.192  -31.948 1.00 28.41  ? 401 ASP A C     1 
ATOM   3113 O  O     . ASP A 1 421 ? -0.174  39.092  -31.156 1.00 29.96  ? 401 ASP A O     1 
ATOM   3114 C  CB    . ASP A 1 421 ? -2.034  36.541  -31.017 1.00 28.47  ? 401 ASP A CB    1 
ATOM   3115 C  CG    . ASP A 1 421 ? -1.085  35.401  -31.167 1.00 32.70  ? 401 ASP A CG    1 
ATOM   3116 O  OD1   . ASP A 1 421 ? -1.251  34.644  -32.145 1.00 37.67  ? 401 ASP A OD1   1 
ATOM   3117 O  OD2   . ASP A 1 421 ? -0.152  35.262  -30.340 1.00 34.02  ? 401 ASP A OD2   1 
ATOM   3118 N  N     . ILE A 1 422 ? 0.556   37.665  -32.712 1.00 29.08  ? 402 ILE A N     1 
ATOM   3119 C  CA    . ILE A 1 422 ? 1.922   38.163  -32.681 1.00 29.06  ? 402 ILE A CA    1 
ATOM   3120 C  C     . ILE A 1 422 ? 1.976   39.569  -33.274 1.00 28.17  ? 402 ILE A C     1 
ATOM   3121 O  O     . ILE A 1 422 ? 2.628   40.425  -32.701 1.00 28.75  ? 402 ILE A O     1 
ATOM   3122 C  CB    . ILE A 1 422 ? 2.895   37.229  -33.429 1.00 29.22  ? 402 ILE A CB    1 
ATOM   3123 C  CG1   . ILE A 1 422 ? 3.054   35.917  -32.683 1.00 29.98  ? 402 ILE A CG1   1 
ATOM   3124 C  CG2   . ILE A 1 422 ? 4.262   37.888  -33.647 1.00 30.22  ? 402 ILE A CG2   1 
ATOM   3125 C  CD1   . ILE A 1 422 ? 3.613   36.028  -31.288 1.00 31.29  ? 402 ILE A CD1   1 
ATOM   3126 N  N     . CYS A 1 423 ? 1.298   39.800  -34.402 1.00 27.21  ? 403 CYS A N     1 
ATOM   3127 C  CA    . CYS A 1 423 ? 1.260   41.130  -35.018 1.00 28.66  ? 403 CYS A CA    1 
ATOM   3128 C  C     . CYS A 1 423 ? 0.511   42.164  -34.165 1.00 31.79  ? 403 CYS A C     1 
ATOM   3129 O  O     . CYS A 1 423 ? 0.919   43.328  -34.092 1.00 33.27  ? 403 CYS A O     1 
ATOM   3130 C  CB    . CYS A 1 423 ? 0.602   41.087  -36.393 1.00 27.74  ? 403 CYS A CB    1 
ATOM   3131 S  SG    . CYS A 1 423 ? 1.539   40.233  -37.673 1.00 24.76  ? 403 CYS A SG    1 
ATOM   3132 N  N     . LEU A 1 424 ? -0.581  41.741  -33.539 1.00 33.71  ? 404 LEU A N     1 
ATOM   3133 C  CA    . LEU A 1 424 ? -1.456  42.655  -32.804 1.00 35.11  ? 404 LEU A CA    1 
ATOM   3134 C  C     . LEU A 1 424 ? -0.911  42.968  -31.427 1.00 37.90  ? 404 LEU A C     1 
ATOM   3135 O  O     . LEU A 1 424 ? -1.152  44.049  -30.915 1.00 36.95  ? 404 LEU A O     1 
ATOM   3136 C  CB    . LEU A 1 424 ? -2.865  42.080  -32.682 1.00 35.10  ? 404 LEU A CB    1 
ATOM   3137 C  CG    . LEU A 1 424 ? -3.562  41.926  -34.032 1.00 37.59  ? 404 LEU A CG    1 
ATOM   3138 C  CD1   . LEU A 1 424 ? -4.737  40.972  -33.911 1.00 38.86  ? 404 LEU A CD1   1 
ATOM   3139 C  CD2   . LEU A 1 424 ? -4.009  43.284  -34.578 1.00 39.62  ? 404 LEU A CD2   1 
ATOM   3140 N  N     . ASP A 1 425 ? -0.184  42.020  -30.833 1.00 41.38  ? 405 ASP A N     1 
ATOM   3141 C  CA    . ASP A 1 425 ? 0.404   42.199  -29.496 1.00 43.29  ? 405 ASP A CA    1 
ATOM   3142 C  C     . ASP A 1 425 ? 1.820   41.631  -29.447 1.00 39.96  ? 405 ASP A C     1 
ATOM   3143 O  O     . ASP A 1 425 ? 2.019   40.524  -28.983 1.00 37.35  ? 405 ASP A O     1 
ATOM   3144 C  CB    . ASP A 1 425 ? -0.454  41.532  -28.417 1.00 47.17  ? 405 ASP A CB    1 
ATOM   3145 C  CG    . ASP A 1 425 ? 0.049   41.835  -27.004 1.00 55.17  ? 405 ASP A CG    1 
ATOM   3146 O  OD1   . ASP A 1 425 ? 0.769   42.846  -26.833 1.00 60.34  ? 405 ASP A OD1   1 
ATOM   3147 O  OD2   . ASP A 1 425 ? -0.262  41.068  -26.063 1.00 64.03  ? 405 ASP A OD2   1 
ATOM   3148 N  N     . PRO A 1 426 ? 2.805   42.397  -29.928 1.00 39.28  ? 406 PRO A N     1 
ATOM   3149 C  CA    . PRO A 1 426 ? 4.145   41.843  -30.121 1.00 39.82  ? 406 PRO A CA    1 
ATOM   3150 C  C     . PRO A 1 426 ? 4.778   41.248  -28.867 1.00 40.16  ? 406 PRO A C     1 
ATOM   3151 O  O     . PRO A 1 426 ? 4.544   41.741  -27.784 1.00 39.40  ? 406 PRO A O     1 
ATOM   3152 C  CB    . PRO A 1 426 ? 4.946   43.045  -30.616 1.00 39.76  ? 406 PRO A CB    1 
ATOM   3153 C  CG    . PRO A 1 426 ? 3.935   43.876  -31.360 1.00 41.62  ? 406 PRO A CG    1 
ATOM   3154 C  CD    . PRO A 1 426 ? 2.646   43.708  -30.594 1.00 41.55  ? 406 PRO A CD    1 
ATOM   3155 N  N     . PRO A 1 427 ? 5.581   40.187  -29.021 1.00 44.07  ? 407 PRO A N     1 
ATOM   3156 C  CA    . PRO A 1 427 ? 6.245   39.654  -27.846 1.00 48.11  ? 407 PRO A CA    1 
ATOM   3157 C  C     . PRO A 1 427 ? 7.143   40.707  -27.197 1.00 52.18  ? 407 PRO A C     1 
ATOM   3158 O  O     . PRO A 1 427 ? 7.815   41.476  -27.884 1.00 50.79  ? 407 PRO A O     1 
ATOM   3159 C  CB    . PRO A 1 427 ? 7.081   38.486  -28.388 1.00 45.74  ? 407 PRO A CB    1 
ATOM   3160 C  CG    . PRO A 1 427 ? 6.572   38.232  -29.752 1.00 46.47  ? 407 PRO A CG    1 
ATOM   3161 C  CD    . PRO A 1 427 ? 6.042   39.532  -30.256 1.00 44.43  ? 407 PRO A CD    1 
ATOM   3162 N  N     . ARG A 1 428 ? 7.131   40.729  -25.874 1.00 58.16  ? 408 ARG A N     1 
ATOM   3163 C  CA    . ARG A 1 428 ? 7.875   41.708  -25.108 1.00 65.13  ? 408 ARG A CA    1 
ATOM   3164 C  C     . ARG A 1 428 ? 8.779   40.924  -24.167 1.00 62.54  ? 408 ARG A C     1 
ATOM   3165 O  O     . ARG A 1 428 ? 8.318   40.037  -23.458 1.00 65.04  ? 408 ARG A O     1 
ATOM   3166 C  CB    . ARG A 1 428 ? 6.920   42.657  -24.356 1.00 71.12  ? 408 ARG A CB    1 
ATOM   3167 C  CG    . ARG A 1 428 ? 5.442   42.275  -24.426 1.00 78.14  ? 408 ARG A CG    1 
ATOM   3168 C  CD    . ARG A 1 428 ? 4.535   43.101  -23.519 1.00 83.44  ? 408 ARG A CD    1 
ATOM   3169 N  NE    . ARG A 1 428 ? 4.970   44.491  -23.388 1.00 88.94  ? 408 ARG A NE    1 
ATOM   3170 C  CZ    . ARG A 1 428 ? 5.714   44.977  -22.390 1.00 93.84  ? 408 ARG A CZ    1 
ATOM   3171 N  NH1   . ARG A 1 428 ? 6.134   44.196  -21.399 1.00 91.05  ? 408 ARG A NH1   1 
ATOM   3172 N  NH2   . ARG A 1 428 ? 6.046   46.267  -22.385 1.00 97.16  ? 408 ARG A NH2   1 
ATOM   3173 N  N     . ARG A 1 429 ? 10.068  41.231  -24.190 1.00 60.97  ? 409 ARG A N     1 
ATOM   3174 C  CA    . ARG A 1 429 ? 11.047  40.506  -23.385 1.00 62.82  ? 409 ARG A CA    1 
ATOM   3175 C  C     . ARG A 1 429 ? 11.499  41.303  -22.175 1.00 58.64  ? 409 ARG A C     1 
ATOM   3176 O  O     . ARG A 1 429 ? 11.486  42.528  -22.189 1.00 60.62  ? 409 ARG A O     1 
ATOM   3177 C  CB    . ARG A 1 429 ? 12.261  40.129  -24.236 1.00 66.46  ? 409 ARG A CB    1 
ATOM   3178 C  CG    . ARG A 1 429 ? 11.960  39.031  -25.242 1.00 71.68  ? 409 ARG A CG    1 
ATOM   3179 C  CD    . ARG A 1 429 ? 12.876  39.070  -26.455 1.00 76.21  ? 409 ARG A CD    1 
ATOM   3180 N  NE    . ARG A 1 429 ? 12.322  38.278  -27.559 1.00 82.78  ? 409 ARG A NE    1 
ATOM   3181 C  CZ    . ARG A 1 429 ? 11.317  38.657  -28.359 1.00 82.19  ? 409 ARG A CZ    1 
ATOM   3182 N  NH1   . ARG A 1 429 ? 10.715  39.839  -28.206 1.00 84.03  ? 409 ARG A NH1   1 
ATOM   3183 N  NH2   . ARG A 1 429 ? 10.903  37.842  -29.325 1.00 74.33  ? 409 ARG A NH2   1 
ATOM   3184 N  N     . TYR A 1 430 ? 11.907  40.596  -21.132 1.00 56.06  ? 410 TYR A N     1 
ATOM   3185 C  CA    . TYR A 1 430 ? 12.457  41.229  -19.940 1.00 55.76  ? 410 TYR A CA    1 
ATOM   3186 C  C     . TYR A 1 430 ? 13.682  40.452  -19.479 1.00 53.79  ? 410 TYR A C     1 
ATOM   3187 O  O     . TYR A 1 430 ? 13.852  39.292  -19.844 1.00 49.20  ? 410 TYR A O     1 
ATOM   3188 C  CB    . TYR A 1 430 ? 11.397  41.309  -18.830 1.00 55.22  ? 410 TYR A CB    1 
ATOM   3189 C  CG    . TYR A 1 430 ? 11.015  39.974  -18.230 1.00 56.67  ? 410 TYR A CG    1 
ATOM   3190 C  CD1   . TYR A 1 430 ? 10.049  39.169  -18.825 1.00 58.77  ? 410 TYR A CD1   1 
ATOM   3191 C  CD2   . TYR A 1 430 ? 11.613  39.519  -17.062 1.00 58.12  ? 410 TYR A CD2   1 
ATOM   3192 C  CE1   . TYR A 1 430 ? 9.702   37.943  -18.282 1.00 57.45  ? 410 TYR A CE1   1 
ATOM   3193 C  CE2   . TYR A 1 430 ? 11.272  38.298  -16.511 1.00 55.93  ? 410 TYR A CE2   1 
ATOM   3194 C  CZ    . TYR A 1 430 ? 10.314  37.519  -17.128 1.00 56.85  ? 410 TYR A CZ    1 
ATOM   3195 O  OH    . TYR A 1 430 ? 9.971   36.311  -16.592 1.00 59.02  ? 410 TYR A OH    1 
ATOM   3196 N  N     . ASP A 1 431 ? 14.542  41.104  -18.697 1.00 57.69  ? 411 ASP A N     1 
ATOM   3197 C  CA    . ASP A 1 431 ? 15.684  40.429  -18.080 1.00 59.01  ? 411 ASP A CA    1 
ATOM   3198 C  C     . ASP A 1 431 ? 15.175  39.353  -17.125 1.00 56.08  ? 411 ASP A C     1 
ATOM   3199 O  O     . ASP A 1 431 ? 14.653  39.654  -16.065 1.00 55.71  ? 411 ASP A O     1 
ATOM   3200 C  CB    . ASP A 1 431 ? 16.567  41.408  -17.306 1.00 61.84  ? 411 ASP A CB    1 
ATOM   3201 C  CG    . ASP A 1 431 ? 17.712  40.702  -16.590 1.00 65.54  ? 411 ASP A CG    1 
ATOM   3202 O  OD1   . ASP A 1 431 ? 18.689  40.345  -17.279 1.00 63.97  ? 411 ASP A OD1   1 
ATOM   3203 O  OD2   . ASP A 1 431 ? 17.621  40.475  -15.355 1.00 65.37  ? 411 ASP A OD2   1 
ATOM   3204 N  N     . GLY A 1 432 ? 15.324  38.096  -17.504 1.00 58.01  ? 412 GLY A N     1 
ATOM   3205 C  CA    . GLY A 1 432 ? 14.720  37.010  -16.748 1.00 56.97  ? 412 GLY A CA    1 
ATOM   3206 C  C     . GLY A 1 432 ? 15.687  36.286  -15.850 1.00 54.86  ? 412 GLY A C     1 
ATOM   3207 O  O     . GLY A 1 432 ? 15.312  35.295  -15.219 1.00 52.98  ? 412 GLY A O     1 
ATOM   3208 N  N     . LEU A 1 433 ? 16.921  36.788  -15.782 1.00 59.05  ? 413 LEU A N     1 
ATOM   3209 C  CA    . LEU A 1 433 ? 18.005  36.155  -15.015 1.00 59.65  ? 413 LEU A CA    1 
ATOM   3210 C  C     . LEU A 1 433 ? 17.623  35.826  -13.573 1.00 55.51  ? 413 LEU A C     1 
ATOM   3211 O  O     . LEU A 1 433 ? 17.756  34.688  -13.133 1.00 53.57  ? 413 LEU A O     1 
ATOM   3212 C  CB    . LEU A 1 433 ? 19.256  37.047  -15.008 1.00 63.73  ? 413 LEU A CB    1 
ATOM   3213 C  CG    . LEU A 1 433 ? 20.594  36.315  -15.173 1.00 66.16  ? 413 LEU A CG    1 
ATOM   3214 C  CD1   . LEU A 1 433 ? 21.757  37.275  -14.947 1.00 67.10  ? 413 LEU A CD1   1 
ATOM   3215 C  CD2   . LEU A 1 433 ? 20.704  35.098  -14.257 1.00 65.97  ? 413 LEU A CD2   1 
ATOM   3216 N  N     . VAL A 1 434 ? 17.143  36.828  -12.850 1.00 55.28  ? 414 VAL A N     1 
ATOM   3217 C  CA    . VAL A 1 434 ? 16.781  36.652  -11.442 1.00 58.62  ? 414 VAL A CA    1 
ATOM   3218 C  C     . VAL A 1 434 ? 15.686  35.598  -11.258 1.00 59.33  ? 414 VAL A C     1 
ATOM   3219 O  O     . VAL A 1 434 ? 15.770  34.741  -10.362 1.00 60.30  ? 414 VAL A O     1 
ATOM   3220 C  CB    . VAL A 1 434 ? 16.322  37.987  -10.814 1.00 61.02  ? 414 VAL A CB    1 
ATOM   3221 C  CG1   . VAL A 1 434 ? 15.792  37.770  -9.405  1.00 62.60  ? 414 VAL A CG1   1 
ATOM   3222 C  CG2   . VAL A 1 434 ? 17.472  38.992  -10.803 1.00 62.62  ? 414 VAL A CG2   1 
ATOM   3223 N  N     . ASP A 1 435 ? 14.658  35.675  -12.104 1.00 57.67  ? 415 ASP A N     1 
ATOM   3224 C  CA    . ASP A 1 435 ? 13.539  34.739  -12.055 1.00 56.07  ? 415 ASP A CA    1 
ATOM   3225 C  C     . ASP A 1 435 ? 13.993  33.325  -12.346 1.00 51.94  ? 415 ASP A C     1 
ATOM   3226 O  O     . ASP A 1 435 ? 13.489  32.379  -11.760 1.00 49.55  ? 415 ASP A O     1 
ATOM   3227 C  CB    . ASP A 1 435 ? 12.460  35.135  -13.067 1.00 62.18  ? 415 ASP A CB    1 
ATOM   3228 C  CG    . ASP A 1 435 ? 11.695  36.384  -12.657 1.00 67.50  ? 415 ASP A CG    1 
ATOM   3229 O  OD1   . ASP A 1 435 ? 11.568  36.645  -11.438 1.00 78.56  ? 415 ASP A OD1   1 
ATOM   3230 O  OD2   . ASP A 1 435 ? 11.201  37.092  -13.558 1.00 65.37  ? 415 ASP A OD2   1 
ATOM   3231 N  N     . ALA A 1 436 ? 14.947  33.180  -13.258 1.00 51.32  ? 416 ALA A N     1 
ATOM   3232 C  CA    . ALA A 1 436 ? 15.445  31.864  -13.602 1.00 52.96  ? 416 ALA A CA    1 
ATOM   3233 C  C     . ALA A 1 436 ? 16.171  31.274  -12.409 1.00 54.65  ? 416 ALA A C     1 
ATOM   3234 O  O     . ALA A 1 436 ? 15.975  30.096  -12.083 1.00 54.29  ? 416 ALA A O     1 
ATOM   3235 C  CB    . ALA A 1 436 ? 16.360  31.934  -14.812 1.00 54.23  ? 416 ALA A CB    1 
ATOM   3236 N  N     . GLN A 1 437 ? 16.996  32.097  -11.756 1.00 57.16  ? 417 GLN A N     1 
ATOM   3237 C  CA    . GLN A 1 437 ? 17.713  31.687  -10.539 1.00 60.28  ? 417 GLN A CA    1 
ATOM   3238 C  C     . GLN A 1 437 ? 16.749  31.143  -9.511  1.00 57.36  ? 417 GLN A C     1 
ATOM   3239 O  O     . GLN A 1 437 ? 16.946  30.053  -8.996  1.00 57.30  ? 417 GLN A O     1 
ATOM   3240 C  CB    . GLN A 1 437 ? 18.478  32.857  -9.905  1.00 66.49  ? 417 GLN A CB    1 
ATOM   3241 C  CG    . GLN A 1 437 ? 19.764  33.248  -10.615 1.00 70.04  ? 417 GLN A CG    1 
ATOM   3242 C  CD    . GLN A 1 437 ? 20.347  34.556  -10.104 1.00 74.83  ? 417 GLN A CD    1 
ATOM   3243 O  OE1   . GLN A 1 437 ? 19.769  35.224  -9.239  1.00 75.33  ? 417 GLN A OE1   1 
ATOM   3244 N  NE2   . GLN A 1 437 ? 21.499  34.934  -10.649 1.00 76.71  ? 417 GLN A NE2   1 
ATOM   3245 N  N     . LYS A 1 438 ? 15.700  31.905  -9.225  1.00 54.19  ? 418 LYS A N     1 
ATOM   3246 C  CA    . LYS A 1 438 ? 14.744  31.506  -8.205  1.00 53.98  ? 418 LYS A CA    1 
ATOM   3247 C  C     . LYS A 1 438 ? 14.091  30.188  -8.549  1.00 55.16  ? 418 LYS A C     1 
ATOM   3248 O  O     . LYS A 1 438 ? 13.993  29.299  -7.705  1.00 58.90  ? 418 LYS A O     1 
ATOM   3249 C  CB    . LYS A 1 438 ? 13.682  32.584  -8.030  1.00 55.66  ? 418 LYS A CB    1 
ATOM   3250 C  CG    . LYS A 1 438 ? 14.234  33.853  -7.413  1.00 57.27  ? 418 LYS A CG    1 
ATOM   3251 C  CD    . LYS A 1 438 ? 13.189  34.944  -7.372  1.00 59.23  ? 418 LYS A CD    1 
ATOM   3252 C  CE    . LYS A 1 438 ? 13.735  36.200  -6.726  1.00 59.98  ? 418 LYS A CE    1 
ATOM   3253 N  NZ    . LYS A 1 438 ? 12.650  37.196  -6.547  1.00 61.72  ? 418 LYS A NZ    1 
ATOM   3254 N  N     . ALA A 1 439 ? 13.651  30.059  -9.797  1.00 55.64  ? 419 ALA A N     1 
ATOM   3255 C  CA    . ALA A 1 439 ? 12.952  28.862  -10.241 1.00 52.12  ? 419 ALA A CA    1 
ATOM   3256 C  C     . ALA A 1 439 ? 13.887  27.672  -10.274 1.00 51.09  ? 419 ALA A C     1 
ATOM   3257 O  O     . ALA A 1 439 ? 13.539  26.598  -9.801  1.00 52.84  ? 419 ALA A O     1 
ATOM   3258 C  CB    . ALA A 1 439 ? 12.346  29.092  -11.610 1.00 53.78  ? 419 ALA A CB    1 
ATOM   3259 N  N     . LEU A 1 440 ? 15.072  27.867  -10.841 1.00 53.98  ? 420 LEU A N     1 
ATOM   3260 C  CA    . LEU A 1 440 ? 16.067  26.798  -10.930 1.00 60.21  ? 420 LEU A CA    1 
ATOM   3261 C  C     . LEU A 1 440 ? 16.602  26.403  -9.556  1.00 64.08  ? 420 LEU A C     1 
ATOM   3262 O  O     . LEU A 1 440 ? 16.778  25.218  -9.262  1.00 61.62  ? 420 LEU A O     1 
ATOM   3263 C  CB    . LEU A 1 440 ? 17.240  27.217  -11.820 1.00 60.86  ? 420 LEU A CB    1 
ATOM   3264 C  CG    . LEU A 1 440 ? 17.007  27.329  -13.329 1.00 59.77  ? 420 LEU A CG    1 
ATOM   3265 C  CD1   . LEU A 1 440 ? 18.193  28.010  -13.998 1.00 59.20  ? 420 LEU A CD1   1 
ATOM   3266 C  CD2   . LEU A 1 440 ? 16.758  25.968  -13.957 1.00 58.64  ? 420 LEU A CD2   1 
ATOM   3267 N  N     . SER A 1 441 ? 16.867  27.405  -8.726  1.00 70.03  ? 421 SER A N     1 
ATOM   3268 C  CA    . SER A 1 441 ? 17.324  27.176  -7.354  1.00 74.99  ? 421 SER A CA    1 
ATOM   3269 C  C     . SER A 1 441 ? 16.279  26.405  -6.551  1.00 73.63  ? 421 SER A C     1 
ATOM   3270 O  O     . SER A 1 441 ? 16.621  25.518  -5.768  1.00 77.15  ? 421 SER A O     1 
ATOM   3271 C  CB    . SER A 1 441 ? 17.644  28.508  -6.668  1.00 76.65  ? 421 SER A CB    1 
ATOM   3272 O  OG    . SER A 1 441 ? 18.230  28.292  -5.404  1.00 86.37  ? 421 SER A OG    1 
ATOM   3273 N  N     . ALA A 1 442 ? 15.008  26.735  -6.759  1.00 67.80  ? 422 ALA A N     1 
ATOM   3274 C  CA    . ALA A 1 442 ? 13.927  26.023  -6.095  1.00 67.95  ? 422 ALA A CA    1 
ATOM   3275 C  C     . ALA A 1 442 ? 13.885  24.557  -6.515  1.00 69.14  ? 422 ALA A C     1 
ATOM   3276 O  O     . ALA A 1 442 ? 13.647  23.681  -5.693  1.00 73.70  ? 422 ALA A O     1 
ATOM   3277 C  CB    . ALA A 1 442 ? 12.597  26.699  -6.382  1.00 68.40  ? 422 ALA A CB    1 
ATOM   3278 N  N     . ILE A 1 443 ? 14.123  24.292  -7.795  1.00 69.44  ? 423 ILE A N     1 
ATOM   3279 C  CA    . ILE A 1 443 ? 14.130  22.919  -8.304  1.00 67.76  ? 423 ILE A CA    1 
ATOM   3280 C  C     . ILE A 1 443 ? 15.338  22.150  -7.758  1.00 66.96  ? 423 ILE A C     1 
ATOM   3281 O  O     . ILE A 1 443 ? 15.264  20.938  -7.510  1.00 60.17  ? 423 ILE A O     1 
ATOM   3282 C  CB    . ILE A 1 443 ? 14.126  22.896  -9.847  1.00 65.56  ? 423 ILE A CB    1 
ATOM   3283 C  CG1   . ILE A 1 443 ? 12.805  23.462  -10.371 1.00 67.56  ? 423 ILE A CG1   1 
ATOM   3284 C  CG2   . ILE A 1 443 ? 14.318  21.479  -10.379 1.00 66.12  ? 423 ILE A CG2   1 
ATOM   3285 C  CD1   . ILE A 1 443 ? 12.831  23.861  -11.832 1.00 66.47  ? 423 ILE A CD1   1 
ATOM   3286 N  N     . ALA A 1 444 ? 16.449  22.859  -7.583  1.00 71.33  ? 424 ALA A N     1 
ATOM   3287 C  CA    . ALA A 1 444 ? 17.669  22.266  -7.036  1.00 75.49  ? 424 ALA A CA    1 
ATOM   3288 C  C     . ALA A 1 444 ? 17.425  21.762  -5.623  1.00 77.66  ? 424 ALA A C     1 
ATOM   3289 O  O     . ALA A 1 444 ? 17.680  20.593  -5.320  1.00 73.15  ? 424 ALA A O     1 
ATOM   3290 C  CB    . ALA A 1 444 ? 18.805  23.281  -7.044  1.00 73.61  ? 424 ALA A CB    1 
ATOM   3291 N  N     . ARG A 1 445 ? 16.891  22.649  -4.785  1.00 81.08  ? 425 ARG A N     1 
ATOM   3292 C  CA    . ARG A 1 445 ? 16.708  22.375  -3.362  1.00 88.98  ? 425 ARG A CA    1 
ATOM   3293 C  C     . ARG A 1 445 ? 15.778  21.199  -3.064  1.00 87.54  ? 425 ARG A C     1 
ATOM   3294 O  O     . ARG A 1 445 ? 16.041  20.439  -2.129  1.00 95.42  ? 425 ARG A O     1 
ATOM   3295 C  CB    . ARG A 1 445 ? 16.245  23.639  -2.620  1.00 93.74  ? 425 ARG A CB    1 
ATOM   3296 C  CG    . ARG A 1 445 ? 17.388  24.511  -2.111  1.00 97.02  ? 425 ARG A CG    1 
ATOM   3297 C  CD    . ARG A 1 445 ? 17.959  23.988  -0.795  1.00 107.05 ? 425 ARG A CD    1 
ATOM   3298 N  NE    . ARG A 1 445 ? 18.979  22.946  -0.961  1.00 113.46 ? 425 ARG A NE    1 
ATOM   3299 C  CZ    . ARG A 1 445 ? 19.574  22.291  0.040   1.00 113.86 ? 425 ARG A CZ    1 
ATOM   3300 N  NH1   . ARG A 1 445 ? 19.274  22.557  1.307   1.00 113.14 ? 425 ARG A NH1   1 
ATOM   3301 N  NH2   . ARG A 1 445 ? 20.485  21.362  -0.225  1.00 116.27 ? 425 ARG A NH2   1 
ATOM   3302 N  N     . VAL A 1 446 ? 14.722  21.022  -3.856  1.00 81.59  ? 426 VAL A N     1 
ATOM   3303 C  CA    . VAL A 1 446 ? 13.837  19.854  -3.695  1.00 76.86  ? 426 VAL A CA    1 
ATOM   3304 C  C     . VAL A 1 446 ? 14.400  18.589  -4.368  1.00 75.10  ? 426 VAL A C     1 
ATOM   3305 O  O     . VAL A 1 446 ? 13.679  17.602  -4.553  1.00 74.09  ? 426 VAL A O     1 
ATOM   3306 C  CB    . VAL A 1 446 ? 12.399  20.137  -4.193  1.00 79.96  ? 426 VAL A CB    1 
ATOM   3307 C  CG1   . VAL A 1 446 ? 11.828  21.373  -3.511  1.00 78.20  ? 426 VAL A CG1   1 
ATOM   3308 C  CG2   . VAL A 1 446 ? 12.350  20.291  -5.710  1.00 82.44  ? 426 VAL A CG2   1 
ATOM   3309 N  N     . GLU A 1 447 ? 15.682  18.630  -4.734  1.00 77.25  ? 427 GLU A N     1 
ATOM   3310 C  CA    . GLU A 1 447 ? 16.415  17.479  -5.285  1.00 84.91  ? 427 GLU A CA    1 
ATOM   3311 C  C     . GLU A 1 447 ? 15.811  16.888  -6.577  1.00 83.43  ? 427 GLU A C     1 
ATOM   3312 O  O     . GLU A 1 447 ? 15.916  15.679  -6.837  1.00 77.65  ? 427 GLU A O     1 
ATOM   3313 C  CB    . GLU A 1 447 ? 16.618  16.394  -4.209  1.00 89.66  ? 427 GLU A CB    1 
ATOM   3314 C  CG    . GLU A 1 447 ? 17.602  16.792  -3.110  1.00 95.20  ? 427 GLU A CG    1 
ATOM   3315 C  CD    . GLU A 1 447 ? 18.072  15.616  -2.262  1.00 101.04 ? 427 GLU A CD    1 
ATOM   3316 O  OE1   . GLU A 1 447 ? 17.377  14.575  -2.222  1.00 103.42 ? 427 GLU A OE1   1 
ATOM   3317 O  OE2   . GLU A 1 447 ? 19.145  15.735  -1.628  1.00 103.74 ? 427 GLU A OE2   1 
ATOM   3318 N  N     . GLN A 1 448 ? 15.199  17.752  -7.387  1.00 80.32  ? 428 GLN A N     1 
ATOM   3319 C  CA    . GLN A 1 448 ? 14.732  17.380  -8.718  1.00 77.93  ? 428 GLN A CA    1 
ATOM   3320 C  C     . GLN A 1 448 ? 13.853  16.135  -8.704  1.00 78.62  ? 428 GLN A C     1 
ATOM   3321 O  O     . GLN A 1 448 ? 13.993  15.267  -9.570  1.00 76.10  ? 428 GLN A O     1 
ATOM   3322 C  CB    . GLN A 1 448 ? 15.928  17.141  -9.652  1.00 76.30  ? 428 GLN A CB    1 
ATOM   3323 C  CG    . GLN A 1 448 ? 16.893  18.316  -9.773  1.00 76.31  ? 428 GLN A CG    1 
ATOM   3324 C  CD    . GLN A 1 448 ? 18.140  18.012  -10.602 1.00 76.61  ? 428 GLN A CD    1 
ATOM   3325 O  OE1   . GLN A 1 448 ? 19.098  18.787  -10.584 1.00 75.83  ? 428 GLN A OE1   1 
ATOM   3326 N  NE2   . GLN A 1 448 ? 18.137  16.894  -11.336 1.00 75.84  ? 428 GLN A NE2   1 
ATOM   3327 N  N     . ARG A 1 449 ? 12.958  16.039  -7.724  1.00 81.09  ? 429 ARG A N     1 
ATOM   3328 C  CA    . ARG A 1 449 ? 12.081  14.875  -7.612  1.00 85.40  ? 429 ARG A CA    1 
ATOM   3329 C  C     . ARG A 1 449 ? 10.606  15.271  -7.573  1.00 82.45  ? 429 ARG A C     1 
ATOM   3330 O  O     . ARG A 1 449 ? 9.746   14.436  -7.285  1.00 82.90  ? 429 ARG A O     1 
ATOM   3331 C  CB    . ARG A 1 449 ? 12.447  14.045  -6.367  1.00 93.80  ? 429 ARG A CB    1 
ATOM   3332 C  CG    . ARG A 1 449 ? 12.272  12.537  -6.556  1.00 100.47 ? 429 ARG A CG    1 
ATOM   3333 C  CD    . ARG A 1 449 ? 12.090  11.771  -5.246  1.00 102.72 ? 429 ARG A CD    1 
ATOM   3334 N  NE    . ARG A 1 449 ? 13.106  12.105  -4.242  1.00 105.49 ? 429 ARG A NE    1 
ATOM   3335 C  CZ    . ARG A 1 449 ? 12.932  12.921  -3.197  1.00 106.19 ? 429 ARG A CZ    1 
ATOM   3336 N  NH1   . ARG A 1 449 ? 11.769  13.525  -2.965  1.00 107.23 ? 429 ARG A NH1   1 
ATOM   3337 N  NH2   . ARG A 1 449 ? 13.943  13.137  -2.364  1.00 107.47 ? 429 ARG A NH2   1 
ATOM   3338 N  N     . PHE A 1 450 ? 10.306  16.528  -7.892  1.00 81.37  ? 430 PHE A N     1 
ATOM   3339 C  CA    . PHE A 1 450 ? 8.940   17.037  -7.785  1.00 82.68  ? 430 PHE A CA    1 
ATOM   3340 C  C     . PHE A 1 450 ? 8.471   17.770  -9.037  1.00 81.08  ? 430 PHE A C     1 
ATOM   3341 O  O     . PHE A 1 450 ? 9.265   18.349  -9.782  1.00 78.66  ? 430 PHE A O     1 
ATOM   3342 C  CB    . PHE A 1 450 ? 8.825   17.947  -6.569  1.00 86.04  ? 430 PHE A CB    1 
ATOM   3343 C  CG    . PHE A 1 450 ? 9.062   17.234  -5.271  1.00 94.18  ? 430 PHE A CG    1 
ATOM   3344 C  CD1   . PHE A 1 450 ? 8.016   16.596  -4.611  1.00 95.64  ? 430 PHE A CD1   1 
ATOM   3345 C  CD2   . PHE A 1 450 ? 10.334  17.177  -4.718  1.00 100.06 ? 430 PHE A CD2   1 
ATOM   3346 C  CE1   . PHE A 1 450 ? 8.231   15.928  -3.418  1.00 98.43  ? 430 PHE A CE1   1 
ATOM   3347 C  CE2   . PHE A 1 450 ? 10.557  16.511  -3.524  1.00 104.35 ? 430 PHE A CE2   1 
ATOM   3348 C  CZ    . PHE A 1 450 ? 9.503   15.884  -2.873  1.00 103.03 ? 430 PHE A CZ    1 
ATOM   3349 N  N     . GLY A 1 451 ? 7.161   17.742  -9.253  1.00 76.12  ? 431 GLY A N     1 
ATOM   3350 C  CA    . GLY A 1 451 ? 6.571   18.311  -10.444 1.00 71.95  ? 431 GLY A CA    1 
ATOM   3351 C  C     . GLY A 1 451 ? 6.440   19.817  -10.392 1.00 71.53  ? 431 GLY A C     1 
ATOM   3352 O  O     . GLY A 1 451 ? 6.899   20.464  -9.452  1.00 71.07  ? 431 GLY A O     1 
ATOM   3353 N  N     . MET A 1 452 ? 5.781   20.348  -11.419 1.00 71.37  ? 432 MET A N     1 
ATOM   3354 C  CA    . MET A 1 452 ? 5.582   21.782  -11.626 1.00 70.20  ? 432 MET A CA    1 
ATOM   3355 C  C     . MET A 1 452 ? 4.709   22.419  -10.556 1.00 67.57  ? 432 MET A C     1 
ATOM   3356 O  O     . MET A 1 452 ? 5.070   23.450  -9.992  1.00 64.96  ? 432 MET A O     1 
ATOM   3357 C  CB    . MET A 1 452 ? 4.929   22.006  -12.999 1.00 68.66  ? 432 MET A CB    1 
ATOM   3358 C  CG    . MET A 1 452 ? 4.403   23.408  -13.246 1.00 68.87  ? 432 MET A CG    1 
ATOM   3359 S  SD    . MET A 1 452 ? 5.670   24.473  -13.929 1.00 71.02  ? 432 MET A SD    1 
ATOM   3360 C  CE    . MET A 1 452 ? 5.414   24.130  -15.670 1.00 68.40  ? 432 MET A CE    1 
ATOM   3361 N  N     . GLY A 1 453 ? 3.543   21.829  -10.317 1.00 69.36  ? 433 GLY A N     1 
ATOM   3362 C  CA    . GLY A 1 453 ? 2.603   22.365  -9.329  1.00 71.75  ? 433 GLY A CA    1 
ATOM   3363 C  C     . GLY A 1 453 ? 3.254   22.538  -7.969  1.00 70.74  ? 433 GLY A C     1 
ATOM   3364 O  O     . GLY A 1 453 ? 3.119   23.579  -7.330  1.00 66.59  ? 433 GLY A O     1 
ATOM   3365 N  N     . TYR A 1 454 ? 3.994   21.520  -7.547  1.00 74.73  ? 434 TYR A N     1 
ATOM   3366 C  CA    . TYR A 1 454 ? 4.661   21.544  -6.255  1.00 81.07  ? 434 TYR A CA    1 
ATOM   3367 C  C     . TYR A 1 454 ? 5.727   22.630  -6.208  1.00 77.25  ? 434 TYR A C     1 
ATOM   3368 O  O     . TYR A 1 454 ? 5.701   23.490  -5.332  1.00 79.56  ? 434 TYR A O     1 
ATOM   3369 C  CB    . TYR A 1 454 ? 5.281   20.178  -5.942  1.00 87.96  ? 434 TYR A CB    1 
ATOM   3370 C  CG    . TYR A 1 454 ? 5.706   20.042  -4.502  1.00 94.84  ? 434 TYR A CG    1 
ATOM   3371 C  CD1   . TYR A 1 454 ? 4.760   19.904  -3.496  1.00 99.70  ? 434 TYR A CD1   1 
ATOM   3372 C  CD2   . TYR A 1 454 ? 7.052   20.062  -4.142  1.00 100.58 ? 434 TYR A CD2   1 
ATOM   3373 C  CE1   . TYR A 1 454 ? 5.137   19.785  -2.171  1.00 104.69 ? 434 TYR A CE1   1 
ATOM   3374 C  CE2   . TYR A 1 454 ? 7.440   19.944  -2.817  1.00 104.94 ? 434 TYR A CE2   1 
ATOM   3375 C  CZ    . TYR A 1 454 ? 6.477   19.805  -1.834  1.00 106.11 ? 434 TYR A CZ    1 
ATOM   3376 O  OH    . TYR A 1 454 ? 6.848   19.688  -0.513  1.00 111.45 ? 434 TYR A OH    1 
ATOM   3377 N  N     . VAL A 1 455 ? 6.649   22.603  -7.168  1.00 73.03  ? 435 VAL A N     1 
ATOM   3378 C  CA    . VAL A 1 455 ? 7.755   23.564  -7.203  1.00 67.51  ? 435 VAL A CA    1 
ATOM   3379 C  C     . VAL A 1 455 ? 7.257   25.014  -7.159  1.00 64.36  ? 435 VAL A C     1 
ATOM   3380 O  O     . VAL A 1 455 ? 7.917   25.886  -6.600  1.00 61.45  ? 435 VAL A O     1 
ATOM   3381 C  CB    . VAL A 1 455 ? 8.664   23.331  -8.433  1.00 68.24  ? 435 VAL A CB    1 
ATOM   3382 C  CG1   . VAL A 1 455 ? 9.653   24.476  -8.618  1.00 67.33  ? 435 VAL A CG1   1 
ATOM   3383 C  CG2   . VAL A 1 455 ? 9.430   22.019  -8.293  1.00 67.22  ? 435 VAL A CG2   1 
ATOM   3384 N  N     . VAL A 1 456 ? 6.090   25.261  -7.743  1.00 66.27  ? 436 VAL A N     1 
ATOM   3385 C  CA    . VAL A 1 456 ? 5.499   26.596  -7.753  1.00 68.02  ? 436 VAL A CA    1 
ATOM   3386 C  C     . VAL A 1 456 ? 4.938   26.927  -6.367  1.00 70.41  ? 436 VAL A C     1 
ATOM   3387 O  O     . VAL A 1 456 ? 5.160   28.022  -5.844  1.00 74.89  ? 436 VAL A O     1 
ATOM   3388 C  CB    . VAL A 1 456 ? 4.397   26.721  -8.840  1.00 65.93  ? 436 VAL A CB    1 
ATOM   3389 C  CG1   . VAL A 1 456 ? 3.722   28.084  -8.785  1.00 62.49  ? 436 VAL A CG1   1 
ATOM   3390 C  CG2   . VAL A 1 456 ? 4.989   26.499  -10.227 1.00 67.44  ? 436 VAL A CG2   1 
ATOM   3391 N  N     . GLU A 1 457 ? 4.219   25.984  -5.769  1.00 71.98  ? 437 GLU A N     1 
ATOM   3392 C  CA    . GLU A 1 457 ? 3.718   26.168  -4.406  1.00 75.41  ? 437 GLU A CA    1 
ATOM   3393 C  C     . GLU A 1 457 ? 4.842   26.681  -3.502  1.00 75.30  ? 437 GLU A C     1 
ATOM   3394 O  O     . GLU A 1 457 ? 4.720   27.733  -2.870  1.00 71.41  ? 437 GLU A O     1 
ATOM   3395 C  CB    . GLU A 1 457 ? 3.130   24.860  -3.867  1.00 73.83  ? 437 GLU A CB    1 
ATOM   3396 C  CG    . GLU A 1 457 ? 1.735   24.569  -4.401  1.00 74.38  ? 437 GLU A CG    1 
ATOM   3397 C  CD    . GLU A 1 457 ? 1.285   23.147  -4.149  1.00 77.19  ? 437 GLU A CD    1 
ATOM   3398 O  OE1   . GLU A 1 457 ? 1.938   22.435  -3.357  1.00 80.40  ? 437 GLU A OE1   1 
ATOM   3399 O  OE2   . GLU A 1 457 ? 0.271   22.739  -4.749  1.00 80.04  ? 437 GLU A OE2   1 
ATOM   3400 N  N     . VAL A 1 458 ? 5.947   25.939  -3.495  1.00 74.39  ? 438 VAL A N     1 
ATOM   3401 C  CA    . VAL A 1 458 ? 7.175   26.346  -2.820  1.00 73.13  ? 438 VAL A CA    1 
ATOM   3402 C  C     . VAL A 1 458 ? 7.565   27.797  -3.146  1.00 76.73  ? 438 VAL A C     1 
ATOM   3403 O  O     . VAL A 1 458 ? 7.881   28.577  -2.250  1.00 79.51  ? 438 VAL A O     1 
ATOM   3404 C  CB    . VAL A 1 458 ? 8.356   25.421  -3.200  1.00 72.03  ? 438 VAL A CB    1 
ATOM   3405 C  CG1   . VAL A 1 458 ? 9.654   25.906  -2.562  1.00 74.01  ? 438 VAL A CG1   1 
ATOM   3406 C  CG2   . VAL A 1 458 ? 8.078   23.975  -2.799  1.00 70.00  ? 438 VAL A CG2   1 
ATOM   3407 N  N     . LEU A 1 459 ? 7.550   28.153  -4.426  1.00 79.49  ? 439 LEU A N     1 
ATOM   3408 C  CA    . LEU A 1 459 ? 8.041   29.470  -4.864  1.00 80.10  ? 439 LEU A CA    1 
ATOM   3409 C  C     . LEU A 1 459 ? 7.235   30.636  -4.314  1.00 77.54  ? 439 LEU A C     1 
ATOM   3410 O  O     . LEU A 1 459 ? 7.778   31.710  -4.059  1.00 73.20  ? 439 LEU A O     1 
ATOM   3411 C  CB    . LEU A 1 459 ? 8.086   29.553  -6.398  1.00 78.72  ? 439 LEU A CB    1 
ATOM   3412 C  CG    . LEU A 1 459 ? 9.295   28.861  -7.032  1.00 77.67  ? 439 LEU A CG    1 
ATOM   3413 C  CD1   . LEU A 1 459 ? 9.004   28.448  -8.463  1.00 78.89  ? 439 LEU A CD1   1 
ATOM   3414 C  CD2   . LEU A 1 459 ? 10.516  29.764  -6.975  1.00 77.00  ? 439 LEU A CD2   1 
ATOM   3415 N  N     . ARG A 1 460 ? 5.940   30.422  -4.134  1.00 80.60  ? 440 ARG A N     1 
ATOM   3416 C  CA    . ARG A 1 460 ? 5.056   31.482  -3.677  1.00 85.22  ? 440 ARG A CA    1 
ATOM   3417 C  C     . ARG A 1 460 ? 4.819   31.447  -2.163  1.00 89.53  ? 440 ARG A C     1 
ATOM   3418 O  O     . ARG A 1 460 ? 4.005   32.210  -1.640  1.00 85.59  ? 440 ARG A O     1 
ATOM   3419 C  CB    . ARG A 1 460 ? 3.735   31.397  -4.430  1.00 84.99  ? 440 ARG A CB    1 
ATOM   3420 C  CG    . ARG A 1 460 ? 3.928   31.251  -5.928  1.00 82.67  ? 440 ARG A CG    1 
ATOM   3421 C  CD    . ARG A 1 460 ? 2.679   31.591  -6.708  1.00 82.90  ? 440 ARG A CD    1 
ATOM   3422 N  NE    . ARG A 1 460 ? 2.303   32.997  -6.549  1.00 83.69  ? 440 ARG A NE    1 
ATOM   3423 C  CZ    . ARG A 1 460 ? 1.326   33.450  -5.763  1.00 79.70  ? 440 ARG A CZ    1 
ATOM   3424 N  NH1   . ARG A 1 460 ? 1.085   34.756  -5.704  1.00 75.27  ? 440 ARG A NH1   1 
ATOM   3425 N  NH2   . ARG A 1 460 ? 0.589   32.613  -5.034  1.00 79.01  ? 440 ARG A NH2   1 
ATOM   3426 N  N     . GLY A 1 461 ? 5.526   30.556  -1.466  1.00 94.85  ? 441 GLY A N     1 
ATOM   3427 C  CA    . GLY A 1 461 ? 5.495   30.503  -0.006  1.00 98.25  ? 441 GLY A CA    1 
ATOM   3428 C  C     . GLY A 1 461 ? 4.164   30.061  0.564   1.00 100.99 ? 441 GLY A C     1 
ATOM   3429 O  O     . GLY A 1 461 ? 3.865   30.315  1.730   1.00 98.20  ? 441 GLY A O     1 
ATOM   3430 N  N     . ALA A 1 462 ? 3.370   29.391  -0.261  1.00 104.89 ? 442 ALA A N     1 
ATOM   3431 C  CA    . ALA A 1 462 ? 2.053   28.940  0.136   1.00 109.16 ? 442 ALA A CA    1 
ATOM   3432 C  C     . ALA A 1 462 ? 2.203   27.604  0.858   1.00 112.57 ? 442 ALA A C     1 
ATOM   3433 O  O     . ALA A 1 462 ? 2.651   26.624  0.256   1.00 112.76 ? 442 ALA A O     1 
ATOM   3434 C  CB    . ALA A 1 462 ? 1.168   28.800  -1.091  1.00 109.41 ? 442 ALA A CB    1 
ATOM   3435 N  N     . ASN A 1 463 ? 1.833   27.572  2.141   1.00 114.06 ? 443 ASN A N     1 
ATOM   3436 C  CA    . ASN A 1 463 ? 2.048   26.390  2.997   1.00 112.01 ? 443 ASN A CA    1 
ATOM   3437 C  C     . ASN A 1 463 ? 0.859   25.425  3.079   1.00 107.33 ? 443 ASN A C     1 
ATOM   3438 O  O     . ASN A 1 463 ? -0.203  25.780  3.577   1.00 106.27 ? 443 ASN A O     1 
ATOM   3439 C  CB    . ASN A 1 463 ? 2.501   26.794  4.423   1.00 113.15 ? 443 ASN A CB    1 
ATOM   3440 C  CG    . ASN A 1 463 ? 1.489   27.662  5.166   1.00 107.86 ? 443 ASN A CG    1 
ATOM   3441 O  OD1   . ASN A 1 463 ? 0.728   28.416  4.561   1.00 111.43 ? 443 ASN A OD1   1 
ATOM   3442 N  ND2   . ASN A 1 463 ? 1.495   27.569  6.491   1.00 98.91  ? 443 ASN A ND2   1 
ATOM   3443 N  N     . ASN A 1 464 ? 1.057   24.202  2.595   1.00 105.38 ? 444 ASN A N     1 
ATOM   3444 C  CA    . ASN A 1 464 ? 0.086   23.120  2.767   1.00 106.89 ? 444 ASN A CA    1 
ATOM   3445 C  C     . ASN A 1 464 ? 0.751   21.990  3.551   1.00 107.41 ? 444 ASN A C     1 
ATOM   3446 O  O     . ASN A 1 464 ? 1.872   22.165  4.035   1.00 105.08 ? 444 ASN A O     1 
ATOM   3447 C  CB    . ASN A 1 464 ? -0.451  22.647  1.409   1.00 111.37 ? 444 ASN A CB    1 
ATOM   3448 C  CG    . ASN A 1 464 ? 0.642   22.150  0.477   1.00 113.24 ? 444 ASN A CG    1 
ATOM   3449 O  OD1   . ASN A 1 464 ? 1.773   21.903  0.894   1.00 114.64 ? 444 ASN A OD1   1 
ATOM   3450 N  ND2   . ASN A 1 464 ? 0.301   21.999  -0.798  1.00 114.57 ? 444 ASN A ND2   1 
ATOM   3451 N  N     . GLN A 1 465 ? 0.077   20.847  3.688   1.00 109.68 ? 445 GLN A N     1 
ATOM   3452 C  CA    . GLN A 1 465 ? 0.608   19.742  4.500   1.00 117.02 ? 445 GLN A CA    1 
ATOM   3453 C  C     . GLN A 1 465 ? 1.976   19.264  4.011   1.00 115.93 ? 445 GLN A C     1 
ATOM   3454 O  O     . GLN A 1 465 ? 2.897   19.101  4.814   1.00 116.30 ? 445 GLN A O     1 
ATOM   3455 C  CB    . GLN A 1 465 ? -0.384  18.565  4.559   1.00 120.63 ? 445 GLN A CB    1 
ATOM   3456 C  CG    . GLN A 1 465 ? 0.055   17.367  5.414   1.00 123.29 ? 445 GLN A CG    1 
ATOM   3457 C  CD    . GLN A 1 465 ? -0.046  17.599  6.921   1.00 120.66 ? 445 GLN A CD    1 
ATOM   3458 O  OE1   . GLN A 1 465 ? -0.891  17.003  7.593   1.00 115.31 ? 445 GLN A OE1   1 
ATOM   3459 N  NE2   . GLN A 1 465 ? 0.824   18.451  7.460   1.00 119.64 ? 445 GLN A NE2   1 
ATOM   3460 N  N     . ARG A 1 466 ? 2.107   19.054  2.703   1.00 112.33 ? 446 ARG A N     1 
ATOM   3461 C  CA    . ARG A 1 466 ? 3.356   18.541  2.120   1.00 109.37 ? 446 ARG A CA    1 
ATOM   3462 C  C     . ARG A 1 466 ? 4.573   19.450  2.306   1.00 106.15 ? 446 ARG A C     1 
ATOM   3463 O  O     . ARG A 1 466 ? 5.701   18.964  2.334   1.00 101.96 ? 446 ARG A O     1 
ATOM   3464 C  CB    . ARG A 1 466 ? 3.184   18.262  0.631   1.00 110.70 ? 446 ARG A CB    1 
ATOM   3465 C  CG    . ARG A 1 466 ? 3.052   16.797  0.273   1.00 112.53 ? 446 ARG A CG    1 
ATOM   3466 C  CD    . ARG A 1 466 ? 2.789   16.668  -1.217  1.00 117.61 ? 446 ARG A CD    1 
ATOM   3467 N  NE    . ARG A 1 466 ? 3.600   15.627  -1.842  1.00 123.17 ? 446 ARG A NE    1 
ATOM   3468 C  CZ    . ARG A 1 466 ? 3.823   15.525  -3.153  1.00 123.55 ? 446 ARG A CZ    1 
ATOM   3469 N  NH1   . ARG A 1 466 ? 3.300   16.402  -4.009  1.00 122.06 ? 446 ARG A NH1   1 
ATOM   3470 N  NH2   . ARG A 1 466 ? 4.580   14.535  -3.613  1.00 125.04 ? 446 ARG A NH2   1 
ATOM   3471 N  N     . ILE A 1 467 ? 4.353   20.759  2.409   1.00 105.96 ? 447 ILE A N     1 
ATOM   3472 C  CA    . ILE A 1 467 ? 5.449   21.703  2.651   1.00 109.73 ? 447 ILE A CA    1 
ATOM   3473 C  C     . ILE A 1 467 ? 5.972   21.547  4.075   1.00 112.43 ? 447 ILE A C     1 
ATOM   3474 O  O     . ILE A 1 467 ? 7.164   21.313  4.289   1.00 112.19 ? 447 ILE A O     1 
ATOM   3475 C  CB    . ILE A 1 467 ? 5.006   23.168  2.432   1.00 109.33 ? 447 ILE A CB    1 
ATOM   3476 C  CG1   . ILE A 1 467 ? 4.621   23.407  0.964   1.00 111.45 ? 447 ILE A CG1   1 
ATOM   3477 C  CG2   . ILE A 1 467 ? 6.100   24.139  2.867   1.00 107.09 ? 447 ILE A CG2   1 
ATOM   3478 C  CD1   . ILE A 1 467 ? 5.719   23.118  -0.043  1.00 113.71 ? 447 ILE A CD1   1 
ATOM   3479 N  N     . ARG A 1 468 ? 5.068   21.689  5.042   1.00 113.89 ? 448 ARG A N     1 
ATOM   3480 C  CA    . ARG A 1 468 ? 5.415   21.548  6.450   1.00 108.17 ? 448 ARG A CA    1 
ATOM   3481 C  C     . ARG A 1 468 ? 5.848   20.121  6.781   1.00 106.82 ? 448 ARG A C     1 
ATOM   3482 O  O     . ARG A 1 468 ? 6.804   19.931  7.530   1.00 113.49 ? 448 ARG A O     1 
ATOM   3483 C  CB    . ARG A 1 468 ? 4.258   22.008  7.351   1.00 108.02 ? 448 ARG A CB    1 
ATOM   3484 C  CG    . ARG A 1 468 ? 2.994   21.153  7.307   1.00 106.01 ? 448 ARG A CG    1 
ATOM   3485 C  CD    . ARG A 1 468 ? 1.915   21.750  8.192   1.00 104.30 ? 448 ARG A CD    1 
ATOM   3486 N  NE    . ARG A 1 468 ? 1.481   23.056  7.691   1.00 103.28 ? 448 ARG A NE    1 
ATOM   3487 C  CZ    . ARG A 1 468 ? 0.386   23.285  6.961   1.00 101.43 ? 448 ARG A CZ    1 
ATOM   3488 N  NH1   . ARG A 1 468 ? -0.449  22.302  6.624   1.00 100.29 ? 448 ARG A NH1   1 
ATOM   3489 N  NH2   . ARG A 1 468 ? 0.114   24.525  6.568   1.00 96.50  ? 448 ARG A NH2   1 
ATOM   3490 N  N     . GLU A 1 469 ? 5.164   19.130  6.205   1.00 100.74 ? 449 GLU A N     1 
ATOM   3491 C  CA    . GLU A 1 469 ? 5.504   17.720  6.416   1.00 101.56 ? 449 GLU A CA    1 
ATOM   3492 C  C     . GLU A 1 469 ? 6.934   17.407  5.968   1.00 104.33 ? 449 GLU A C     1 
ATOM   3493 O  O     . GLU A 1 469 ? 7.742   16.922  6.760   1.00 107.13 ? 449 GLU A O     1 
ATOM   3494 C  CB    . GLU A 1 469 ? 4.514   16.811  5.683   1.00 101.86 ? 449 GLU A CB    1 
ATOM   3495 C  CG    . GLU A 1 469 ? 4.771   15.320  5.841   1.00 105.32 ? 449 GLU A CG    1 
ATOM   3496 C  CD    . GLU A 1 469 ? 3.854   14.475  4.972   1.00 110.31 ? 449 GLU A CD    1 
ATOM   3497 O  OE1   . GLU A 1 469 ? 4.343   13.494  4.371   1.00 108.41 ? 449 GLU A OE1   1 
ATOM   3498 O  OE2   . GLU A 1 469 ? 2.647   14.794  4.882   1.00 112.85 ? 449 GLU A OE2   1 
ATOM   3499 N  N     . LEU A 1 470 ? 7.246   17.689  4.703   1.00 107.55 ? 450 LEU A N     1 
ATOM   3500 C  CA    . LEU A 1 470 ? 8.592   17.429  4.172   1.00 106.66 ? 450 LEU A CA    1 
ATOM   3501 C  C     . LEU A 1 470 ? 9.617   18.437  4.711   1.00 103.23 ? 450 LEU A C     1 
ATOM   3502 O  O     . LEU A 1 470 ? 10.819  18.170  4.689   1.00 100.24 ? 450 LEU A O     1 
ATOM   3503 C  CB    . LEU A 1 470 ? 8.604   17.397  2.630   1.00 105.98 ? 450 LEU A CB    1 
ATOM   3504 C  CG    . LEU A 1 470 ? 8.096   16.106  1.959   1.00 105.58 ? 450 LEU A CG    1 
ATOM   3505 C  CD1   . LEU A 1 470 ? 6.580   16.082  1.826   1.00 106.70 ? 450 LEU A CD1   1 
ATOM   3506 C  CD2   . LEU A 1 470 ? 8.726   15.904  0.589   1.00 105.71 ? 450 LEU A CD2   1 
ATOM   3507 N  N     . GLY A 1 471 ? 9.134   19.581  5.196   1.00 102.43 ? 451 GLY A N     1 
ATOM   3508 C  CA    . GLY A 1 471 ? 9.980   20.582  5.851   1.00 100.84 ? 451 GLY A CA    1 
ATOM   3509 C  C     . GLY A 1 471 ? 10.575  21.592  4.886   1.00 100.71 ? 451 GLY A C     1 
ATOM   3510 O  O     . GLY A 1 471 ? 11.700  22.058  5.086   1.00 91.98  ? 451 GLY A O     1 
ATOM   3511 N  N     . HIS A 1 472 ? 9.807   21.936  3.848   1.00 103.42 ? 452 HIS A N     1 
ATOM   3512 C  CA    . HIS A 1 472 ? 10.236  22.890  2.818   1.00 102.07 ? 452 HIS A CA    1 
ATOM   3513 C  C     . HIS A 1 472 ? 9.817   24.333  3.125   1.00 100.85 ? 452 HIS A C     1 
ATOM   3514 O  O     . HIS A 1 472 ? 10.053  25.229  2.315   1.00 97.17  ? 452 HIS A O     1 
ATOM   3515 C  CB    . HIS A 1 472 ? 9.687   22.480  1.446   1.00 104.13 ? 452 HIS A CB    1 
ATOM   3516 C  CG    . HIS A 1 472 ? 10.253  21.195  0.922   1.00 104.92 ? 452 HIS A CG    1 
ATOM   3517 N  ND1   . HIS A 1 472 ? 9.479   20.246  0.288   1.00 104.70 ? 452 HIS A ND1   1 
ATOM   3518 C  CD2   . HIS A 1 472 ? 11.515  20.703  0.935   1.00 102.70 ? 452 HIS A CD2   1 
ATOM   3519 C  CE1   . HIS A 1 472 ? 10.240  19.226  -0.068  1.00 103.27 ? 452 HIS A CE1   1 
ATOM   3520 N  NE2   . HIS A 1 472 ? 11.479  19.477  0.315   1.00 103.53 ? 452 HIS A NE2   1 
ATOM   3521 N  N     . ASP A 1 473 ? 9.192   24.551  4.284   1.00 102.49 ? 453 ASP A N     1 
ATOM   3522 C  CA    . ASP A 1 473 ? 8.900   25.908  4.776   1.00 101.98 ? 453 ASP A CA    1 
ATOM   3523 C  C     . ASP A 1 473 ? 10.123  26.573  5.433   1.00 98.84  ? 453 ASP A C     1 
ATOM   3524 O  O     . ASP A 1 473 ? 10.162  27.799  5.585   1.00 91.69  ? 453 ASP A O     1 
ATOM   3525 C  CB    . ASP A 1 473 ? 7.674   25.945  5.723   1.00 103.11 ? 453 ASP A CB    1 
ATOM   3526 C  CG    . ASP A 1 473 ? 7.466   24.650  6.519   1.00 102.53 ? 453 ASP A CG    1 
ATOM   3527 O  OD1   . ASP A 1 473 ? 8.285   23.712  6.412   1.00 98.86  ? 453 ASP A OD1   1 
ATOM   3528 O  OD2   . ASP A 1 473 ? 6.454   24.571  7.250   1.00 103.88 ? 453 ASP A OD2   1 
ATOM   3529 N  N     . LYS A 1 474 ? 11.113  25.760  5.807   1.00 99.95  ? 454 LYS A N     1 
ATOM   3530 C  CA    . LYS A 1 474 ? 12.355  26.252  6.414   1.00 105.41 ? 454 LYS A CA    1 
ATOM   3531 C  C     . LYS A 1 474 ? 13.448  26.567  5.389   1.00 106.20 ? 454 LYS A C     1 
ATOM   3532 O  O     . LYS A 1 474 ? 14.411  27.267  5.714   1.00 106.05 ? 454 LYS A O     1 
ATOM   3533 C  CB    . LYS A 1 474 ? 12.896  25.240  7.432   1.00 106.92 ? 454 LYS A CB    1 
ATOM   3534 C  CG    . LYS A 1 474 ? 12.011  25.054  8.656   1.00 106.93 ? 454 LYS A CG    1 
ATOM   3535 C  CD    . LYS A 1 474 ? 12.840  24.812  9.907   1.00 106.65 ? 454 LYS A CD    1 
ATOM   3536 C  CE    . LYS A 1 474 ? 11.960  24.608  11.126  1.00 107.34 ? 454 LYS A CE    1 
ATOM   3537 N  NZ    . LYS A 1 474 ? 11.322  23.262  11.121  1.00 109.56 ? 454 LYS A NZ    1 
ATOM   3538 N  N     . LEU A 1 475 ? 13.304  26.048  4.168   1.00 104.12 ? 455 LEU A N     1 
ATOM   3539 C  CA    . LEU A 1 475 ? 14.264  26.310  3.086   1.00 95.69  ? 455 LEU A CA    1 
ATOM   3540 C  C     . LEU A 1 475 ? 14.306  27.792  2.733   1.00 89.51  ? 455 LEU A C     1 
ATOM   3541 O  O     . LEU A 1 475 ? 13.306  28.503  2.856   1.00 87.25  ? 455 LEU A O     1 
ATOM   3542 C  CB    . LEU A 1 475 ? 13.929  25.484  1.834   1.00 97.43  ? 455 LEU A CB    1 
ATOM   3543 C  CG    . LEU A 1 475 ? 14.504  24.064  1.729   1.00 96.09  ? 455 LEU A CG    1 
ATOM   3544 C  CD1   . LEU A 1 475 ? 14.327  23.275  3.018   1.00 97.41  ? 455 LEU A CD1   1 
ATOM   3545 C  CD2   . LEU A 1 475 ? 13.864  23.328  0.561   1.00 95.72  ? 455 LEU A CD2   1 
ATOM   3546 N  N     . LYS A 1 476 ? 15.469  28.245  2.282   1.00 87.53  ? 456 LYS A N     1 
ATOM   3547 C  CA    . LYS A 1 476 ? 15.697  29.665  2.025   1.00 93.64  ? 456 LYS A CA    1 
ATOM   3548 C  C     . LYS A 1 476 ? 14.867  30.173  0.841   1.00 97.00  ? 456 LYS A C     1 
ATOM   3549 O  O     . LYS A 1 476 ? 14.376  31.304  0.858   1.00 94.77  ? 456 LYS A O     1 
ATOM   3550 C  CB    . LYS A 1 476 ? 17.191  29.922  1.786   1.00 97.09  ? 456 LYS A CB    1 
ATOM   3551 C  CG    . LYS A 1 476 ? 17.634  31.353  2.058   1.00 99.79  ? 456 LYS A CG    1 
ATOM   3552 C  CD    . LYS A 1 476 ? 19.142  31.441  2.257   1.00 100.26 ? 456 LYS A CD    1 
ATOM   3553 C  CE    . LYS A 1 476 ? 19.546  32.747  2.924   1.00 100.91 ? 456 LYS A CE    1 
ATOM   3554 N  NZ    . LYS A 1 476 ? 20.907  32.649  3.521   1.00 100.55 ? 456 LYS A NZ    1 
ATOM   3555 N  N     . VAL A 1 477 ? 14.706  29.319  -0.170  1.00 100.39 ? 457 VAL A N     1 
ATOM   3556 C  CA    . VAL A 1 477 ? 13.976  29.670  -1.404  1.00 100.91 ? 457 VAL A CA    1 
ATOM   3557 C  C     . VAL A 1 477 ? 12.451  29.726  -1.229  1.00 94.78  ? 457 VAL A C     1 
ATOM   3558 O  O     . VAL A 1 477 ? 11.753  30.356  -2.030  1.00 90.19  ? 457 VAL A O     1 
ATOM   3559 C  CB    . VAL A 1 477 ? 14.308  28.695  -2.567  1.00 101.90 ? 457 VAL A CB    1 
ATOM   3560 C  CG1   . VAL A 1 477 ? 15.811  28.650  -2.818  1.00 104.50 ? 457 VAL A CG1   1 
ATOM   3561 C  CG2   . VAL A 1 477 ? 13.761  27.294  -2.299  1.00 99.55  ? 457 VAL A CG2   1 
ATOM   3562 N  N     . TYR A 1 478 ? 11.950  29.057  -0.191  1.00 92.05  ? 458 TYR A N     1 
ATOM   3563 C  CA    . TYR A 1 478 ? 10.519  29.006  0.113   1.00 87.61  ? 458 TYR A CA    1 
ATOM   3564 C  C     . TYR A 1 478 ? 9.894   30.394  0.260   1.00 84.31  ? 458 TYR A C     1 
ATOM   3565 O  O     . TYR A 1 478 ? 10.156  31.100  1.235   1.00 85.23  ? 458 TYR A O     1 
ATOM   3566 C  CB    . TYR A 1 478 ? 10.285  28.202  1.396   1.00 87.14  ? 458 TYR A CB    1 
ATOM   3567 C  CG    . TYR A 1 478 ? 8.854   28.240  1.864   1.00 88.30  ? 458 TYR A CG    1 
ATOM   3568 C  CD1   . TYR A 1 478 ? 7.883   27.461  1.247   1.00 88.76  ? 458 TYR A CD1   1 
ATOM   3569 C  CD2   . TYR A 1 478 ? 8.464   29.069  2.913   1.00 88.72  ? 458 TYR A CD2   1 
ATOM   3570 C  CE1   . TYR A 1 478 ? 6.566   27.502  1.662   1.00 88.37  ? 458 TYR A CE1   1 
ATOM   3571 C  CE2   . TYR A 1 478 ? 7.148   29.116  3.335   1.00 86.62  ? 458 TYR A CE2   1 
ATOM   3572 C  CZ    . TYR A 1 478 ? 6.207   28.328  2.706   1.00 89.51  ? 458 TYR A CZ    1 
ATOM   3573 O  OH    . TYR A 1 478 ? 4.899   28.368  3.109   1.00 92.38  ? 458 TYR A OH    1 
ATOM   3574 N  N     . GLY A 1 479 ? 9.069   30.770  -0.713  1.00 77.56  ? 459 GLY A N     1 
ATOM   3575 C  CA    . GLY A 1 479 ? 8.355   32.039  -0.685  1.00 74.95  ? 459 GLY A CA    1 
ATOM   3576 C  C     . GLY A 1 479 ? 9.087   33.175  -1.361  1.00 74.79  ? 459 GLY A C     1 
ATOM   3577 O  O     . GLY A 1 479 ? 8.612   34.308  -1.353  1.00 72.30  ? 459 GLY A O     1 
ATOM   3578 N  N     . ILE A 1 480 ? 10.228  32.882  -1.978  1.00 78.49  ? 460 ILE A N     1 
ATOM   3579 C  CA    . ILE A 1 480 ? 11.035  33.937  -2.588  1.00 81.74  ? 460 ILE A CA    1 
ATOM   3580 C  C     . ILE A 1 480 ? 10.336  34.573  -3.793  1.00 80.55  ? 460 ILE A C     1 
ATOM   3581 O  O     . ILE A 1 480 ? 10.671  35.690  -4.180  1.00 84.27  ? 460 ILE A O     1 
ATOM   3582 C  CB    . ILE A 1 480 ? 12.460  33.443  -2.952  1.00 85.36  ? 460 ILE A CB    1 
ATOM   3583 C  CG1   . ILE A 1 480 ? 13.412  34.638  -3.108  1.00 85.34  ? 460 ILE A CG1   1 
ATOM   3584 C  CG2   . ILE A 1 480 ? 12.450  32.562  -4.199  1.00 85.87  ? 460 ILE A CG2   1 
ATOM   3585 C  CD1   . ILE A 1 480 ? 14.878  34.266  -3.028  1.00 85.10  ? 460 ILE A CD1   1 
ATOM   3586 N  N     . GLY A 1 481 ? 9.359   33.870  -4.365  1.00 79.38  ? 461 GLY A N     1 
ATOM   3587 C  CA    . GLY A 1 481 ? 8.540   34.414  -5.445  1.00 80.84  ? 461 GLY A CA    1 
ATOM   3588 C  C     . GLY A 1 481 ? 7.071   34.612  -5.110  1.00 83.17  ? 461 GLY A C     1 
ATOM   3589 O  O     . GLY A 1 481 ? 6.230   34.574  -6.004  1.00 87.02  ? 461 GLY A O     1 
ATOM   3590 N  N     . ARG A 1 482 ? 6.751   34.831  -3.835  1.00 88.84  ? 462 ARG A N     1 
ATOM   3591 C  CA    . ARG A 1 482 ? 5.359   35.088  -3.417  1.00 84.90  ? 462 ARG A CA    1 
ATOM   3592 C  C     . ARG A 1 482 ? 4.835   36.422  -3.963  1.00 79.10  ? 462 ARG A C     1 
ATOM   3593 O  O     . ARG A 1 482 ? 3.630   36.609  -4.145  1.00 75.16  ? 462 ARG A O     1 
ATOM   3594 C  CB    . ARG A 1 482 ? 5.226   35.037  -1.887  1.00 89.28  ? 462 ARG A CB    1 
ATOM   3595 C  CG    . ARG A 1 482 ? 5.954   36.135  -1.115  1.00 91.61  ? 462 ARG A CG    1 
ATOM   3596 C  CD    . ARG A 1 482 ? 5.350   36.335  0.270   1.00 93.48  ? 462 ARG A CD    1 
ATOM   3597 N  NE    . ARG A 1 482 ? 5.144   35.073  0.991   1.00 91.80  ? 462 ARG A NE    1 
ATOM   3598 C  CZ    . ARG A 1 482 ? 6.076   34.417  1.686   1.00 88.84  ? 462 ARG A CZ    1 
ATOM   3599 N  NH1   . ARG A 1 482 ? 7.326   34.872  1.773   1.00 87.94  ? 462 ARG A NH1   1 
ATOM   3600 N  NH2   . ARG A 1 482 ? 5.753   33.283  2.298   1.00 86.08  ? 462 ARG A NH2   1 
ATOM   3601 N  N     . ASP A 1 483 ? 5.760   37.337  -4.234  1.00 77.43  ? 463 ASP A N     1 
ATOM   3602 C  CA    . ASP A 1 483 ? 5.443   38.616  -4.856  1.00 79.58  ? 463 ASP A CA    1 
ATOM   3603 C  C     . ASP A 1 483 ? 4.953   38.515  -6.312  1.00 79.52  ? 463 ASP A C     1 
ATOM   3604 O  O     . ASP A 1 483 ? 4.598   39.532  -6.899  1.00 81.48  ? 463 ASP A O     1 
ATOM   3605 C  CB    . ASP A 1 483 ? 6.669   39.537  -4.788  1.00 84.54  ? 463 ASP A CB    1 
ATOM   3606 C  CG    . ASP A 1 483 ? 7.917   38.906  -5.402  1.00 91.11  ? 463 ASP A CG    1 
ATOM   3607 O  OD1   . ASP A 1 483 ? 8.109   37.679  -5.249  1.00 93.71  ? 463 ASP A OD1   1 
ATOM   3608 O  OD2   . ASP A 1 483 ? 8.711   39.640  -6.030  1.00 97.13  ? 463 ASP A OD2   1 
ATOM   3609 N  N     . GLN A 1 484 ? 4.951   37.314  -6.901  1.00 75.91  ? 464 GLN A N     1 
ATOM   3610 C  CA    . GLN A 1 484 ? 4.465   37.118  -8.275  1.00 70.86  ? 464 GLN A CA    1 
ATOM   3611 C  C     . GLN A 1 484 ? 3.536   35.905  -8.399  1.00 66.75  ? 464 GLN A C     1 
ATOM   3612 O  O     . GLN A 1 484 ? 3.619   34.963  -7.600  1.00 61.77  ? 464 GLN A O     1 
ATOM   3613 C  CB    . GLN A 1 484 ? 5.645   36.994  -9.229  1.00 72.24  ? 464 GLN A CB    1 
ATOM   3614 C  CG    . GLN A 1 484 ? 6.532   38.226  -9.233  1.00 72.65  ? 464 GLN A CG    1 
ATOM   3615 C  CD    . GLN A 1 484 ? 7.596   38.166  -10.302 1.00 73.15  ? 464 GLN A CD    1 
ATOM   3616 O  OE1   . GLN A 1 484 ? 8.670   37.608  -10.084 1.00 77.12  ? 464 GLN A OE1   1 
ATOM   3617 N  NE2   . GLN A 1 484 ? 7.308   38.745  -11.465 1.00 72.15  ? 464 GLN A NE2   1 
ATOM   3618 N  N     . SER A 1 485 ? 2.650   35.942  -9.399  1.00 59.43  ? 465 SER A N     1 
ATOM   3619 C  CA    . SER A 1 485 ? 1.552   34.975  -9.504  1.00 58.61  ? 465 SER A CA    1 
ATOM   3620 C  C     . SER A 1 485 ? 2.025   33.592  -9.879  1.00 58.07  ? 465 SER A C     1 
ATOM   3621 O  O     . SER A 1 485 ? 3.140   33.423  -10.372 1.00 58.69  ? 465 SER A O     1 
ATOM   3622 C  CB    . SER A 1 485 ? 0.548   35.428  -10.552 1.00 60.64  ? 465 SER A CB    1 
ATOM   3623 O  OG    . SER A 1 485 ? 1.134   35.412  -11.840 1.00 62.52  ? 465 SER A OG    1 
ATOM   3624 N  N     . GLN A 1 486 ? 1.171   32.597  -9.675  1.00 56.97  ? 466 GLN A N     1 
ATOM   3625 C  CA    . GLN A 1 486 ? 1.529   31.242  -10.077 1.00 61.40  ? 466 GLN A CA    1 
ATOM   3626 C  C     . GLN A 1 486 ? 1.579   31.125  -11.612 1.00 61.18  ? 466 GLN A C     1 
ATOM   3627 O  O     . GLN A 1 486 ? 2.276   30.265  -12.143 1.00 56.55  ? 466 GLN A O     1 
ATOM   3628 C  CB    . GLN A 1 486 ? 0.605   30.190  -9.450  1.00 64.93  ? 466 GLN A CB    1 
ATOM   3629 C  CG    . GLN A 1 486 ? -0.593  29.778  -10.291 1.00 68.57  ? 466 GLN A CG    1 
ATOM   3630 C  CD    . GLN A 1 486 ? -1.148  28.436  -9.859  1.00 72.25  ? 466 GLN A CD    1 
ATOM   3631 O  OE1   . GLN A 1 486 ? -0.930  27.418  -10.518 1.00 72.83  ? 466 GLN A OE1   1 
ATOM   3632 N  NE2   . GLN A 1 486 ? -1.850  28.423  -8.733  1.00 74.24  ? 466 GLN A NE2   1 
ATOM   3633 N  N     . GLU A 1 487 ? 0.848   31.994  -12.308 1.00 60.28  ? 467 GLU A N     1 
ATOM   3634 C  CA    . GLU A 1 487 ? 0.907   32.059  -13.762 1.00 61.12  ? 467 GLU A CA    1 
ATOM   3635 C  C     . GLU A 1 487 ? 2.279   32.528  -14.245 1.00 61.29  ? 467 GLU A C     1 
ATOM   3636 O  O     . GLU A 1 487 ? 2.818   32.012  -15.230 1.00 56.86  ? 467 GLU A O     1 
ATOM   3637 C  CB    . GLU A 1 487 ? -0.169  32.999  -14.299 1.00 66.72  ? 467 GLU A CB    1 
ATOM   3638 C  CG    . GLU A 1 487 ? -0.013  33.319  -15.779 1.00 75.64  ? 467 GLU A CG    1 
ATOM   3639 C  CD    . GLU A 1 487 ? -1.131  34.184  -16.334 1.00 83.60  ? 467 GLU A CD    1 
ATOM   3640 O  OE1   . GLU A 1 487 ? -2.292  34.034  -15.890 1.00 85.11  ? 467 GLU A OE1   1 
ATOM   3641 O  OE2   . GLU A 1 487 ? -0.843  35.013  -17.230 1.00 90.50  ? 467 GLU A OE2   1 
ATOM   3642 N  N     . HIS A 1 488 ? 2.833   33.521  -13.560 1.00 59.40  ? 468 HIS A N     1 
ATOM   3643 C  CA    . HIS A 1 488 ? 4.156   34.030  -13.897 1.00 56.49  ? 468 HIS A CA    1 
ATOM   3644 C  C     . HIS A 1 488 ? 5.216   32.938  -13.805 1.00 53.34  ? 468 HIS A C     1 
ATOM   3645 O  O     . HIS A 1 488 ? 6.040   32.800  -14.692 1.00 54.63  ? 468 HIS A O     1 
ATOM   3646 C  CB    . HIS A 1 488 ? 4.541   35.194  -12.984 1.00 55.41  ? 468 HIS A CB    1 
ATOM   3647 C  CG    . HIS A 1 488 ? 5.930   35.692  -13.215 1.00 56.63  ? 468 HIS A CG    1 
ATOM   3648 N  ND1   . HIS A 1 488 ? 7.011   35.242  -12.485 1.00 58.02  ? 468 HIS A ND1   1 
ATOM   3649 C  CD2   . HIS A 1 488 ? 6.422   36.572  -14.118 1.00 55.14  ? 468 HIS A CD2   1 
ATOM   3650 C  CE1   . HIS A 1 488 ? 8.106   35.841  -12.915 1.00 56.54  ? 468 HIS A CE1   1 
ATOM   3651 N  NE2   . HIS A 1 488 ? 7.776   36.652  -13.905 1.00 57.17  ? 468 HIS A NE2   1 
ATOM   3652 N  N     . TRP A 1 489 ? 5.189   32.163  -12.730 1.00 54.43  ? 469 TRP A N     1 
ATOM   3653 C  CA    . TRP A 1 489 ? 6.178   31.105  -12.531 1.00 53.87  ? 469 TRP A CA    1 
ATOM   3654 C  C     . TRP A 1 489 ? 5.969   29.891  -13.437 1.00 50.44  ? 469 TRP A C     1 
ATOM   3655 O  O     . TRP A 1 489 ? 6.931   29.207  -13.782 1.00 50.69  ? 469 TRP A O     1 
ATOM   3656 C  CB    . TRP A 1 489 ? 6.217   30.677  -11.054 1.00 56.91  ? 469 TRP A CB    1 
ATOM   3657 C  CG    . TRP A 1 489 ? 6.723   31.771  -10.184 1.00 58.34  ? 469 TRP A CG    1 
ATOM   3658 C  CD1   . TRP A 1 489 ? 6.005   32.500  -9.280  1.00 60.73  ? 469 TRP A CD1   1 
ATOM   3659 C  CD2   . TRP A 1 489 ? 8.048   32.307  -10.174 1.00 58.98  ? 469 TRP A CD2   1 
ATOM   3660 N  NE1   . TRP A 1 489 ? 6.807   33.449  -8.692  1.00 61.31  ? 469 TRP A NE1   1 
ATOM   3661 C  CE2   . TRP A 1 489 ? 8.069   33.351  -9.220  1.00 60.99  ? 469 TRP A CE2   1 
ATOM   3662 C  CE3   . TRP A 1 489 ? 9.224   32.001  -10.866 1.00 59.55  ? 469 TRP A CE3   1 
ATOM   3663 C  CZ2   . TRP A 1 489 ? 9.223   34.092  -8.941  1.00 57.28  ? 469 TRP A CZ2   1 
ATOM   3664 C  CZ3   . TRP A 1 489 ? 10.378  32.743  -10.585 1.00 59.72  ? 469 TRP A CZ3   1 
ATOM   3665 C  CH2   . TRP A 1 489 ? 10.363  33.776  -9.635  1.00 58.33  ? 469 TRP A CH2   1 
ATOM   3666 N  N     . VAL A 1 490 ? 4.732   29.601  -13.810 1.00 46.19  ? 470 VAL A N     1 
ATOM   3667 C  CA    . VAL A 1 490 ? 4.497   28.518  -14.763 1.00 49.04  ? 470 VAL A CA    1 
ATOM   3668 C  C     . VAL A 1 490 ? 5.141   28.896  -16.109 1.00 46.13  ? 470 VAL A C     1 
ATOM   3669 O  O     . VAL A 1 490 ? 5.843   28.092  -16.710 1.00 46.69  ? 470 VAL A O     1 
ATOM   3670 C  CB    . VAL A 1 490 ? 2.988   28.185  -14.921 1.00 50.14  ? 470 VAL A CB    1 
ATOM   3671 C  CG1   . VAL A 1 490 ? 2.762   27.218  -16.075 1.00 49.81  ? 470 VAL A CG1   1 
ATOM   3672 C  CG2   . VAL A 1 490 ? 2.432   27.577  -13.636 1.00 48.30  ? 470 VAL A CG2   1 
ATOM   3673 N  N     . SER A 1 491 ? 4.928   30.131  -16.546 1.00 43.97  ? 471 SER A N     1 
ATOM   3674 C  CA    . SER A 1 491 ? 5.538   30.638  -17.766 1.00 45.39  ? 471 SER A CA    1 
ATOM   3675 C  C     . SER A 1 491 ? 7.073   30.648  -17.723 1.00 48.02  ? 471 SER A C     1 
ATOM   3676 O  O     . SER A 1 491 ? 7.724   30.304  -18.713 1.00 46.48  ? 471 SER A O     1 
ATOM   3677 C  CB    . SER A 1 491 ? 5.049   32.050  -18.057 1.00 44.38  ? 471 SER A CB    1 
ATOM   3678 O  OG    . SER A 1 491 ? 5.761   32.604  -19.154 1.00 44.69  ? 471 SER A OG    1 
ATOM   3679 N  N     . VAL A 1 492 ? 7.645   31.062  -16.590 1.00 47.41  ? 472 VAL A N     1 
ATOM   3680 C  CA    . VAL A 1 492 ? 9.101   31.091  -16.440 1.00 43.76  ? 472 VAL A CA    1 
ATOM   3681 C  C     . VAL A 1 492 ? 9.628   29.675  -16.622 1.00 41.88  ? 472 VAL A C     1 
ATOM   3682 O  O     . VAL A 1 492 ? 10.611  29.455  -17.338 1.00 40.38  ? 472 VAL A O     1 
ATOM   3683 C  CB    . VAL A 1 492 ? 9.552   31.679  -15.075 1.00 45.43  ? 472 VAL A CB    1 
ATOM   3684 C  CG1   . VAL A 1 492 ? 11.056  31.525  -14.872 1.00 43.52  ? 472 VAL A CG1   1 
ATOM   3685 C  CG2   . VAL A 1 492 ? 9.178   33.162  -14.968 1.00 44.88  ? 472 VAL A CG2   1 
ATOM   3686 N  N     . ILE A 1 493 ? 8.946   28.715  -16.014 1.00 40.04  ? 473 ILE A N     1 
ATOM   3687 C  CA    . ILE A 1 493 ? 9.426   27.338  -15.995 1.00 42.93  ? 473 ILE A CA    1 
ATOM   3688 C  C     . ILE A 1 493 ? 9.209   26.652  -17.333 1.00 42.34  ? 473 ILE A C     1 
ATOM   3689 O  O     . ILE A 1 493 ? 10.064  25.891  -17.800 1.00 39.84  ? 473 ILE A O     1 
ATOM   3690 C  CB    . ILE A 1 493 ? 8.772   26.528  -14.857 1.00 44.41  ? 473 ILE A CB    1 
ATOM   3691 C  CG1   . ILE A 1 493 ? 9.366   26.981  -13.519 1.00 48.61  ? 473 ILE A CG1   1 
ATOM   3692 C  CG2   . ILE A 1 493 ? 8.995   25.026  -15.045 1.00 44.70  ? 473 ILE A CG2   1 
ATOM   3693 C  CD1   . ILE A 1 493 ? 8.614   26.470  -12.301 1.00 51.04  ? 473 ILE A CD1   1 
ATOM   3694 N  N     . ARG A 1 494 ? 8.045   26.899  -17.923 1.00 42.59  ? 474 ARG A N     1 
ATOM   3695 C  CA    . ARG A 1 494 ? 7.770   26.450  -19.278 1.00 40.26  ? 474 ARG A CA    1 
ATOM   3696 C  C     . ARG A 1 494 ? 8.855   26.933  -20.241 1.00 39.07  ? 474 ARG A C     1 
ATOM   3697 O  O     . ARG A 1 494 ? 9.332   26.163  -21.078 1.00 35.80  ? 474 ARG A O     1 
ATOM   3698 C  CB    . ARG A 1 494 ? 6.395   26.928  -19.721 1.00 38.43  ? 474 ARG A CB    1 
ATOM   3699 C  CG    . ARG A 1 494 ? 5.276   26.062  -19.187 1.00 37.74  ? 474 ARG A CG    1 
ATOM   3700 C  CD    . ARG A 1 494 ? 3.931   26.607  -19.608 1.00 36.55  ? 474 ARG A CD    1 
ATOM   3701 N  NE    . ARG A 1 494 ? 2.846   25.760  -19.141 1.00 35.36  ? 474 ARG A NE    1 
ATOM   3702 C  CZ    . ARG A 1 494 ? 1.562   26.097  -19.179 1.00 36.86  ? 474 ARG A CZ    1 
ATOM   3703 N  NH1   . ARG A 1 494 ? 1.187   27.275  -19.668 1.00 38.38  ? 474 ARG A NH1   1 
ATOM   3704 N  NH2   . ARG A 1 494 ? 0.644   25.252  -18.722 1.00 37.33  ? 474 ARG A NH2   1 
ATOM   3705 N  N     . GLN A 1 495 ? 9.238   28.199  -20.098 1.00 36.21  ? 475 GLN A N     1 
ATOM   3706 C  CA    . GLN A 1 495 ? 10.282  28.773  -20.906 1.00 38.71  ? 475 GLN A CA    1 
ATOM   3707 C  C     . GLN A 1 495 ? 11.649  28.101  -20.708 1.00 42.70  ? 475 GLN A C     1 
ATOM   3708 O  O     . GLN A 1 495 ? 12.360  27.836  -21.688 1.00 44.76  ? 475 GLN A O     1 
ATOM   3709 C  CB    . GLN A 1 495 ? 10.369  30.282  -20.673 1.00 40.50  ? 475 GLN A CB    1 
ATOM   3710 C  CG    . GLN A 1 495 ? 9.303   31.061  -21.426 1.00 40.45  ? 475 GLN A CG    1 
ATOM   3711 C  CD    . GLN A 1 495 ? 9.372   32.557  -21.190 1.00 41.22  ? 475 GLN A CD    1 
ATOM   3712 O  OE1   . GLN A 1 495 ? 10.170  33.267  -21.807 1.00 44.81  ? 475 GLN A OE1   1 
ATOM   3713 N  NE2   . GLN A 1 495 ? 8.518   33.049  -20.315 1.00 40.62  ? 475 GLN A NE2   1 
ATOM   3714 N  N     . LEU A 1 496 ? 12.008  27.799  -19.462 1.00 45.77  ? 476 LEU A N     1 
ATOM   3715 C  CA    . LEU A 1 496 ? 13.290  27.139  -19.174 1.00 43.91  ? 476 LEU A CA    1 
ATOM   3716 C  C     . LEU A 1 496 ? 13.315  25.711  -19.693 1.00 43.01  ? 476 LEU A C     1 
ATOM   3717 O  O     . LEU A 1 496 ? 14.368  25.229  -20.090 1.00 44.87  ? 476 LEU A O     1 
ATOM   3718 C  CB    . LEU A 1 496 ? 13.600  27.165  -17.676 1.00 45.85  ? 476 LEU A CB    1 
ATOM   3719 C  CG    . LEU A 1 496 ? 13.812  28.567  -17.102 1.00 46.68  ? 476 LEU A CG    1 
ATOM   3720 C  CD1   . LEU A 1 496 ? 13.834  28.517  -15.591 1.00 49.67  ? 476 LEU A CD1   1 
ATOM   3721 C  CD2   . LEU A 1 496 ? 15.077  29.213  -17.635 1.00 46.83  ? 476 LEU A CD2   1 
ATOM   3722 N  N     . ILE A 1 497 ? 12.160  25.046  -19.715 1.00 40.53  ? 477 ILE A N     1 
ATOM   3723 C  CA    . ILE A 1 497 ? 12.038  23.729  -20.368 1.00 40.99  ? 477 ILE A CA    1 
ATOM   3724 C  C     . ILE A 1 497 ? 12.279  23.823  -21.889 1.00 38.35  ? 477 ILE A C     1 
ATOM   3725 O  O     . ILE A 1 497 ? 12.970  22.999  -22.492 1.00 34.06  ? 477 ILE A O     1 
ATOM   3726 C  CB    . ILE A 1 497 ? 10.664  23.075  -20.086 1.00 42.07  ? 477 ILE A CB    1 
ATOM   3727 C  CG1   . ILE A 1 497 ? 10.553  22.721  -18.592 1.00 44.06  ? 477 ILE A CG1   1 
ATOM   3728 C  CG2   . ILE A 1 497 ? 10.460  21.817  -20.938 1.00 40.05  ? 477 ILE A CG2   1 
ATOM   3729 C  CD1   . ILE A 1 497 ? 9.145   22.389  -18.132 1.00 44.98  ? 477 ILE A CD1   1 
ATOM   3730 N  N     . HIS A 1 498 ? 11.716  24.854  -22.489 1.00 38.63  ? 478 HIS A N     1 
ATOM   3731 C  CA    . HIS A 1 498 ? 11.819  25.040  -23.906 1.00 40.23  ? 478 HIS A CA    1 
ATOM   3732 C  C     . HIS A 1 498 ? 13.263  25.357  -24.277 1.00 40.55  ? 478 HIS A C     1 
ATOM   3733 O  O     . HIS A 1 498 ? 13.775  24.819  -25.235 1.00 41.22  ? 478 HIS A O     1 
ATOM   3734 C  CB    . HIS A 1 498 ? 10.880  26.151  -24.362 1.00 39.99  ? 478 HIS A CB    1 
ATOM   3735 C  CG    . HIS A 1 498 ? 10.978  26.448  -25.822 1.00 40.61  ? 478 HIS A CG    1 
ATOM   3736 N  ND1   . HIS A 1 498 ? 10.534  25.574  -26.791 1.00 41.21  ? 478 HIS A ND1   1 
ATOM   3737 C  CD2   . HIS A 1 498 ? 11.490  27.514  -26.477 1.00 41.36  ? 478 HIS A CD2   1 
ATOM   3738 C  CE1   . HIS A 1 498 ? 10.753  26.097  -27.980 1.00 44.42  ? 478 HIS A CE1   1 
ATOM   3739 N  NE2   . HIS A 1 498 ? 11.328  27.277  -27.818 1.00 43.89  ? 478 HIS A NE2   1 
ATOM   3740 N  N     . LEU A 1 499 ? 13.903  26.224  -23.500 1.00 43.42  ? 479 LEU A N     1 
ATOM   3741 C  CA    . LEU A 1 499 ? 15.322  26.529  -23.661 1.00 44.91  ? 479 LEU A CA    1 
ATOM   3742 C  C     . LEU A 1 499 ? 16.267  25.349  -23.458 1.00 45.19  ? 479 LEU A C     1 
ATOM   3743 O  O     . LEU A 1 499 ? 17.423  25.424  -23.881 1.00 45.56  ? 479 LEU A O     1 
ATOM   3744 C  CB    . LEU A 1 499 ? 15.740  27.624  -22.693 1.00 48.08  ? 479 LEU A CB    1 
ATOM   3745 C  CG    . LEU A 1 499 ? 15.363  29.047  -23.076 1.00 52.10  ? 479 LEU A CG    1 
ATOM   3746 C  CD1   . LEU A 1 499 ? 15.929  29.971  -22.014 1.00 56.53  ? 479 LEU A CD1   1 
ATOM   3747 C  CD2   . LEU A 1 499 ? 15.869  29.439  -24.466 1.00 50.50  ? 479 LEU A CD2   1 
ATOM   3748 N  N     . GLY A 1 500 ? 15.792  24.287  -22.808 1.00 43.67  ? 480 GLY A N     1 
ATOM   3749 C  CA    . GLY A 1 500 ? 16.589  23.088  -22.578 1.00 45.23  ? 480 GLY A CA    1 
ATOM   3750 C  C     . GLY A 1 500 ? 17.327  23.114  -21.244 1.00 47.31  ? 480 GLY A C     1 
ATOM   3751 O  O     . GLY A 1 500 ? 18.157  22.255  -20.985 1.00 47.88  ? 480 GLY A O     1 
ATOM   3752 N  N     . VAL A 1 501 ? 17.019  24.104  -20.408 1.00 48.65  ? 481 VAL A N     1 
ATOM   3753 C  CA    . VAL A 1 501 ? 17.620  24.263  -19.079 1.00 50.96  ? 481 VAL A CA    1 
ATOM   3754 C  C     . VAL A 1 501 ? 17.004  23.289  -18.066 1.00 50.14  ? 481 VAL A C     1 
ATOM   3755 O  O     . VAL A 1 501 ? 17.706  22.739  -17.215 1.00 49.70  ? 481 VAL A O     1 
ATOM   3756 C  CB    . VAL A 1 501 ? 17.459  25.713  -18.567 1.00 51.70  ? 481 VAL A CB    1 
ATOM   3757 C  CG1   . VAL A 1 501 ? 18.128  25.889  -17.228 1.00 54.21  ? 481 VAL A CG1   1 
ATOM   3758 C  CG2   . VAL A 1 501 ? 18.081  26.697  -19.544 1.00 53.69  ? 481 VAL A CG2   1 
ATOM   3759 N  N     . VAL A 1 502 ? 15.697  23.076  -18.178 1.00 52.06  ? 482 VAL A N     1 
ATOM   3760 C  CA    . VAL A 1 502 ? 14.950  22.192  -17.286 1.00 51.91  ? 482 VAL A CA    1 
ATOM   3761 C  C     . VAL A 1 502 ? 14.277  21.103  -18.115 1.00 56.12  ? 482 VAL A C     1 
ATOM   3762 O  O     . VAL A 1 502 ? 13.815  21.375  -19.227 1.00 58.32  ? 482 VAL A O     1 
ATOM   3763 C  CB    . VAL A 1 502 ? 13.862  22.988  -16.541 1.00 50.56  ? 482 VAL A CB    1 
ATOM   3764 C  CG1   . VAL A 1 502 ? 12.979  22.078  -15.702 1.00 50.49  ? 482 VAL A CG1   1 
ATOM   3765 C  CG2   . VAL A 1 502 ? 14.501  24.072  -15.684 1.00 50.98  ? 482 VAL A CG2   1 
ATOM   3766 N  N     . THR A 1 503 ? 14.230  19.877  -17.593 1.00 56.69  ? 483 THR A N     1 
ATOM   3767 C  CA    . THR A 1 503 ? 13.435  18.820  -18.219 1.00 58.88  ? 483 THR A CA    1 
ATOM   3768 C  C     . THR A 1 503 ? 12.250  18.472  -17.347 1.00 59.59  ? 483 THR A C     1 
ATOM   3769 O  O     . THR A 1 503 ? 12.195  18.808  -16.165 1.00 54.99  ? 483 THR A O     1 
ATOM   3770 C  CB    . THR A 1 503 ? 14.227  17.527  -18.553 1.00 59.84  ? 483 THR A CB    1 
ATOM   3771 O  OG1   . THR A 1 503 ? 14.930  17.062  -17.394 1.00 63.31  ? 483 THR A OG1   1 
ATOM   3772 C  CG2   . THR A 1 503 ? 15.205  17.772  -19.707 1.00 59.12  ? 483 THR A CG2   1 
ATOM   3773 N  N     . GLN A 1 504 ? 11.292  17.819  -17.985 1.00 61.55  ? 484 GLN A N     1 
ATOM   3774 C  CA    . GLN A 1 504 ? 10.064  17.396  -17.374 1.00 64.55  ? 484 GLN A CA    1 
ATOM   3775 C  C     . GLN A 1 504 ? 9.819   16.008  -17.942 1.00 72.49  ? 484 GLN A C     1 
ATOM   3776 O  O     . GLN A 1 504 ? 8.844   15.778  -18.650 1.00 73.79  ? 484 GLN A O     1 
ATOM   3777 C  CB    . GLN A 1 504 ? 8.948   18.365  -17.754 1.00 62.02  ? 484 GLN A CB    1 
ATOM   3778 C  CG    . GLN A 1 504 ? 7.590   18.063  -17.146 1.00 63.88  ? 484 GLN A CG    1 
ATOM   3779 C  CD    . GLN A 1 504 ? 6.543   19.085  -17.537 1.00 63.35  ? 484 GLN A CD    1 
ATOM   3780 O  OE1   . GLN A 1 504 ? 5.836   19.619  -16.682 1.00 59.10  ? 484 GLN A OE1   1 
ATOM   3781 N  NE2   . GLN A 1 504 ? 6.440   19.367  -18.835 1.00 59.84  ? 484 GLN A NE2   1 
ATOM   3782 N  N     . ASN A 1 505 ? 10.748  15.097  -17.663 1.00 83.63  ? 485 ASN A N     1 
ATOM   3783 C  CA    . ASN A 1 505 ? 10.653  13.723  -18.144 1.00 90.51  ? 485 ASN A CA    1 
ATOM   3784 C  C     . ASN A 1 505 ? 9.505   12.970  -17.470 1.00 95.16  ? 485 ASN A C     1 
ATOM   3785 O  O     . ASN A 1 505 ? 9.462   12.847  -16.240 1.00 94.30  ? 485 ASN A O     1 
ATOM   3786 C  CB    . ASN A 1 505 ? 11.971  12.965  -17.924 1.00 93.80  ? 485 ASN A CB    1 
ATOM   3787 C  CG    . ASN A 1 505 ? 13.069  13.407  -18.877 1.00 92.45  ? 485 ASN A CG    1 
ATOM   3788 O  OD1   . ASN A 1 505 ? 13.006  13.133  -20.075 1.00 90.15  ? 485 ASN A OD1   1 
ATOM   3789 N  ND2   . ASN A 1 505 ? 14.088  14.080  -18.349 1.00 92.08  ? 485 ASN A ND2   1 
ATOM   3790 N  N     . ILE A 1 506 ? 8.589   12.465  -18.299 1.00 98.49  ? 486 ILE A N     1 
ATOM   3791 C  CA    . ILE A 1 506 ? 7.481   11.615  -17.852 1.00 95.28  ? 486 ILE A CA    1 
ATOM   3792 C  C     . ILE A 1 506 ? 8.039   10.344  -17.212 1.00 94.45  ? 486 ILE A C     1 
ATOM   3793 O  O     . ILE A 1 506 ? 7.371   9.728   -16.386 1.00 95.49  ? 486 ILE A O     1 
ATOM   3794 C  CB    . ILE A 1 506 ? 6.534   11.230  -19.019 1.00 95.38  ? 486 ILE A CB    1 
ATOM   3795 C  CG1   . ILE A 1 506 ? 6.015   12.477  -19.763 1.00 95.54  ? 486 ILE A CG1   1 
ATOM   3796 C  CG2   . ILE A 1 506 ? 5.362   10.391  -18.517 1.00 94.56  ? 486 ILE A CG2   1 
ATOM   3797 C  CD1   . ILE A 1 506 ? 5.323   13.505  -18.889 1.00 95.99  ? 486 ILE A CD1   1 
ATOM   3798 N  N     . ALA A 1 507 ? 9.257   9.964   -17.613 1.00 93.65  ? 487 ALA A N     1 
ATOM   3799 C  CA    . ALA A 1 507 ? 10.004  8.858   -17.010 1.00 93.14  ? 487 ALA A CA    1 
ATOM   3800 C  C     . ALA A 1 507 ? 9.842   8.816   -15.491 1.00 94.05  ? 487 ALA A C     1 
ATOM   3801 O  O     . ALA A 1 507 ? 9.398   7.806   -14.949 1.00 93.49  ? 487 ALA A O     1 
ATOM   3802 C  CB    . ALA A 1 507 ? 11.478  8.946   -17.388 1.00 90.75  ? 487 ALA A CB    1 
ATOM   3803 N  N     . GLN A 1 508 ? 10.187  9.906   -14.807 1.00 94.99  ? 488 GLN A N     1 
ATOM   3804 C  CA    . GLN A 1 508 ? 9.919   10.006  -13.369 1.00 94.19  ? 488 GLN A CA    1 
ATOM   3805 C  C     . GLN A 1 508 ? 8.755   10.963  -13.116 1.00 92.05  ? 488 GLN A C     1 
ATOM   3806 O  O     . GLN A 1 508 ? 8.911   12.032  -12.522 1.00 86.27  ? 488 GLN A O     1 
ATOM   3807 C  CB    . GLN A 1 508 ? 11.168  10.407  -12.579 1.00 93.65  ? 488 GLN A CB    1 
ATOM   3808 C  CG    . GLN A 1 508 ? 11.041  10.138  -11.084 1.00 93.09  ? 488 GLN A CG    1 
ATOM   3809 C  CD    . GLN A 1 508 ? 12.293  10.504  -10.322 1.00 92.59  ? 488 GLN A CD    1 
ATOM   3810 O  OE1   . GLN A 1 508 ? 12.278  11.396  -9.473  1.00 92.33  ? 488 GLN A OE1   1 
ATOM   3811 N  NE2   . GLN A 1 508 ? 13.392  9.823   -10.628 1.00 91.13  ? 488 GLN A NE2   1 
ATOM   3812 N  N     . HIS A 1 509 ? 7.588   10.557  -13.605 1.00 94.76  ? 489 HIS A N     1 
ATOM   3813 C  CA    . HIS A 1 509 ? 6.319   11.218  -13.315 1.00 93.99  ? 489 HIS A CA    1 
ATOM   3814 C  C     . HIS A 1 509 ? 6.394   12.735  -13.462 1.00 85.92  ? 489 HIS A C     1 
ATOM   3815 O  O     . HIS A 1 509 ? 5.934   13.483  -12.602 1.00 79.93  ? 489 HIS A O     1 
ATOM   3816 C  CB    . HIS A 1 509 ? 5.845   10.808  -11.920 1.00 99.64  ? 489 HIS A CB    1 
ATOM   3817 C  CG    . HIS A 1 509 ? 5.770   9.322   -11.732 1.00 107.80 ? 489 HIS A CG    1 
ATOM   3818 N  ND1   . HIS A 1 509 ? 6.822   8.579   -11.237 1.00 110.33 ? 489 HIS A ND1   1 
ATOM   3819 C  CD2   . HIS A 1 509 ? 4.778   8.439   -11.998 1.00 109.76 ? 489 HIS A CD2   1 
ATOM   3820 C  CE1   . HIS A 1 509 ? 6.476   7.305   -11.192 1.00 109.52 ? 489 HIS A CE1   1 
ATOM   3821 N  NE2   . HIS A 1 509 ? 5.241   7.193   -11.649 1.00 111.06 ? 489 HIS A NE2   1 
ATOM   3822 N  N     . SER A 1 510 ? 6.996   13.169  -14.566 1.00 83.02  ? 490 SER A N     1 
ATOM   3823 C  CA    . SER A 1 510 ? 7.099   14.588  -14.932 1.00 78.79  ? 490 SER A CA    1 
ATOM   3824 C  C     . SER A 1 510 ? 7.766   15.451  -13.852 1.00 71.05  ? 490 SER A C     1 
ATOM   3825 O  O     . SER A 1 510 ? 7.399   16.604  -13.637 1.00 67.43  ? 490 SER A O     1 
ATOM   3826 C  CB    . SER A 1 510 ? 5.725   15.150  -15.340 1.00 79.83  ? 490 SER A CB    1 
ATOM   3827 O  OG    . SER A 1 510 ? 4.847   15.264  -14.236 1.00 81.28  ? 490 SER A OG    1 
ATOM   3828 N  N     . ALA A 1 511 ? 8.766   14.886  -13.189 1.00 67.85  ? 491 ALA A N     1 
ATOM   3829 C  CA    . ALA A 1 511 ? 9.577   15.639  -12.240 1.00 65.07  ? 491 ALA A CA    1 
ATOM   3830 C  C     . ALA A 1 511 ? 10.446  16.658  -12.978 1.00 61.12  ? 491 ALA A C     1 
ATOM   3831 O  O     . ALA A 1 511 ? 10.996  16.364  -14.035 1.00 57.74  ? 491 ALA A O     1 
ATOM   3832 C  CB    . ALA A 1 511 ? 10.463  14.691  -11.442 1.00 65.42  ? 491 ALA A CB    1 
ATOM   3833 N  N     . LEU A 1 512 ? 10.591  17.842  -12.403 1.00 58.79  ? 492 LEU A N     1 
ATOM   3834 C  CA    . LEU A 1 512 ? 11.460  18.853  -12.975 1.00 58.15  ? 492 LEU A CA    1 
ATOM   3835 C  C     . LEU A 1 512 ? 12.914  18.565  -12.627 1.00 58.51  ? 492 LEU A C     1 
ATOM   3836 O  O     . LEU A 1 512 ? 13.301  18.646  -11.466 1.00 64.37  ? 492 LEU A O     1 
ATOM   3837 C  CB    . LEU A 1 512 ? 11.053  20.241  -12.482 1.00 58.42  ? 492 LEU A CB    1 
ATOM   3838 C  CG    . LEU A 1 512 ? 9.588   20.606  -12.735 1.00 58.01  ? 492 LEU A CG    1 
ATOM   3839 C  CD1   . LEU A 1 512 ? 9.265   21.962  -12.124 1.00 58.54  ? 492 LEU A CD1   1 
ATOM   3840 C  CD2   . LEU A 1 512 ? 9.299   20.593  -14.230 1.00 59.25  ? 492 LEU A CD2   1 
ATOM   3841 N  N     . GLN A 1 513 ? 13.710  18.216  -13.634 1.00 58.88  ? 493 GLN A N     1 
ATOM   3842 C  CA    . GLN A 1 513 ? 15.143  17.979  -13.456 1.00 60.21  ? 493 GLN A CA    1 
ATOM   3843 C  C     . GLN A 1 513 ? 15.932  19.057  -14.191 1.00 58.47  ? 493 GLN A C     1 
ATOM   3844 O  O     . GLN A 1 513 ? 15.455  19.624  -15.164 1.00 58.17  ? 493 GLN A O     1 
ATOM   3845 C  CB    . GLN A 1 513 ? 15.540  16.599  -13.986 1.00 60.59  ? 493 GLN A CB    1 
ATOM   3846 C  CG    . GLN A 1 513 ? 14.813  15.436  -13.332 1.00 63.17  ? 493 GLN A CG    1 
ATOM   3847 C  CD    . GLN A 1 513 ? 15.167  14.099  -13.964 1.00 64.82  ? 493 GLN A CD    1 
ATOM   3848 O  OE1   . GLN A 1 513 ? 14.742  13.794  -15.076 1.00 70.34  ? 493 GLN A OE1   1 
ATOM   3849 N  NE2   . GLN A 1 513 ? 15.945  13.293  -13.255 1.00 67.15  ? 493 GLN A NE2   1 
ATOM   3850 N  N     . LEU A 1 514 ? 17.141  19.326  -13.716 1.00 56.89  ? 494 LEU A N     1 
ATOM   3851 C  CA    . LEU A 1 514 ? 18.022  20.303  -14.329 1.00 57.34  ? 494 LEU A CA    1 
ATOM   3852 C  C     . LEU A 1 514 ? 18.980  19.635  -15.308 1.00 56.90  ? 494 LEU A C     1 
ATOM   3853 O  O     . LEU A 1 514 ? 19.356  18.479  -15.126 1.00 55.30  ? 494 LEU A O     1 
ATOM   3854 C  CB    . LEU A 1 514 ? 18.821  21.020  -13.255 1.00 56.91  ? 494 LEU A CB    1 
ATOM   3855 C  CG    . LEU A 1 514 ? 17.976  21.731  -12.200 1.00 58.66  ? 494 LEU A CG    1 
ATOM   3856 C  CD1   . LEU A 1 514 ? 18.859  22.188  -11.047 1.00 61.19  ? 494 LEU A CD1   1 
ATOM   3857 C  CD2   . LEU A 1 514 ? 17.255  22.921  -12.796 1.00 57.91  ? 494 LEU A CD2   1 
ATOM   3858 N  N     . THR A 1 515 ? 19.364  20.377  -16.346 1.00 57.46  ? 495 THR A N     1 
ATOM   3859 C  CA    . THR A 1 515 ? 20.309  19.899  -17.354 1.00 57.25  ? 495 THR A CA    1 
ATOM   3860 C  C     . THR A 1 515 ? 21.636  20.628  -17.189 1.00 54.83  ? 495 THR A C     1 
ATOM   3861 O  O     . THR A 1 515 ? 21.757  21.533  -16.349 1.00 51.82  ? 495 THR A O     1 
ATOM   3862 C  CB    . THR A 1 515 ? 19.787  20.161  -18.790 1.00 57.03  ? 495 THR A CB    1 
ATOM   3863 O  OG1   . THR A 1 515 ? 19.916  21.558  -19.108 1.00 52.92  ? 495 THR A OG1   1 
ATOM   3864 C  CG2   . THR A 1 515 ? 18.329  19.725  -18.937 1.00 56.85  ? 495 THR A CG2   1 
ATOM   3865 N  N     . GLU A 1 516 ? 22.606  20.250  -18.020 1.00 54.66  ? 496 GLU A N     1 
ATOM   3866 C  CA    . GLU A 1 516 ? 23.922  20.892  -18.046 1.00 60.24  ? 496 GLU A CA    1 
ATOM   3867 C  C     . GLU A 1 516 ? 23.860  22.410  -18.170 1.00 62.56  ? 496 GLU A C     1 
ATOM   3868 O  O     . GLU A 1 516 ? 24.689  23.114  -17.587 1.00 68.52  ? 496 GLU A O     1 
ATOM   3869 C  CB    . GLU A 1 516 ? 24.759  20.359  -19.210 1.00 66.53  ? 496 GLU A CB    1 
ATOM   3870 C  CG    . GLU A 1 516 ? 25.335  18.968  -18.997 1.00 73.67  ? 496 GLU A CG    1 
ATOM   3871 C  CD    . GLU A 1 516 ? 26.376  18.602  -20.050 1.00 80.94  ? 496 GLU A CD    1 
ATOM   3872 O  OE1   . GLU A 1 516 ? 26.071  18.685  -21.258 1.00 86.12  ? 496 GLU A OE1   1 
ATOM   3873 O  OE2   . GLU A 1 516 ? 27.508  18.228  -19.674 1.00 91.26  ? 496 GLU A OE2   1 
ATOM   3874 N  N     . ALA A 1 517 ? 22.895  22.920  -18.936 1.00 60.18  ? 497 ALA A N     1 
ATOM   3875 C  CA    . ALA A 1 517 ? 22.800  24.365  -19.175 1.00 57.19  ? 497 ALA A CA    1 
ATOM   3876 C  C     . ALA A 1 517 ? 22.285  25.154  -17.986 1.00 55.21  ? 497 ALA A C     1 
ATOM   3877 O  O     . ALA A 1 517 ? 22.298  26.380  -18.038 1.00 54.55  ? 497 ALA A O     1 
ATOM   3878 C  CB    . ALA A 1 517 ? 21.931  24.656  -20.391 1.00 58.52  ? 497 ALA A CB    1 
ATOM   3879 N  N     . ALA A 1 518 ? 21.817  24.470  -16.935 1.00 55.50  ? 498 ALA A N     1 
ATOM   3880 C  CA    . ALA A 1 518 ? 21.299  25.137  -15.733 1.00 54.77  ? 498 ALA A CA    1 
ATOM   3881 C  C     . ALA A 1 518 ? 22.359  25.916  -14.959 1.00 55.79  ? 498 ALA A C     1 
ATOM   3882 O  O     . ALA A 1 518 ? 22.091  27.020  -14.470 1.00 51.36  ? 498 ALA A O     1 
ATOM   3883 C  CB    . ALA A 1 518 ? 20.634  24.120  -14.823 1.00 56.47  ? 498 ALA A CB    1 
ATOM   3884 N  N     . ARG A 1 519 ? 23.560  25.341  -14.876 1.00 60.69  ? 499 ARG A N     1 
ATOM   3885 C  CA    . ARG A 1 519 ? 24.631  25.848  -14.017 1.00 63.69  ? 499 ARG A CA    1 
ATOM   3886 C  C     . ARG A 1 519 ? 24.912  27.340  -14.179 1.00 61.32  ? 499 ARG A C     1 
ATOM   3887 O  O     . ARG A 1 519 ? 24.718  28.101  -13.226 1.00 58.71  ? 499 ARG A O     1 
ATOM   3888 C  CB    . ARG A 1 519 ? 25.909  25.015  -14.209 1.00 75.03  ? 499 ARG A CB    1 
ATOM   3889 C  CG    . ARG A 1 519 ? 27.037  25.328  -13.225 1.00 84.48  ? 499 ARG A CG    1 
ATOM   3890 C  CD    . ARG A 1 519 ? 28.161  24.287  -13.245 1.00 90.93  ? 499 ARG A CD    1 
ATOM   3891 N  NE    . ARG A 1 519 ? 27.662  22.906  -13.294 1.00 94.11  ? 499 ARG A NE    1 
ATOM   3892 C  CZ    . ARG A 1 519 ? 27.632  22.129  -14.382 1.00 97.88  ? 499 ARG A CZ    1 
ATOM   3893 N  NH1   . ARG A 1 519 ? 28.089  22.562  -15.559 1.00 97.64  ? 499 ARG A NH1   1 
ATOM   3894 N  NH2   . ARG A 1 519 ? 27.141  20.894  -14.290 1.00 94.96  ? 499 ARG A NH2   1 
ATOM   3895 N  N     . PRO A 1 520 ? 25.329  27.781  -15.380 1.00 62.69  ? 500 PRO A N     1 
ATOM   3896 C  CA    . PRO A 1 520 ? 25.709  29.198  -15.516 1.00 64.43  ? 500 PRO A CA    1 
ATOM   3897 C  C     . PRO A 1 520 ? 24.616  30.191  -15.134 1.00 68.39  ? 500 PRO A C     1 
ATOM   3898 O  O     . PRO A 1 520 ? 24.937  31.287  -14.679 1.00 73.86  ? 500 PRO A O     1 
ATOM   3899 C  CB    . PRO A 1 520 ? 26.047  29.342  -17.010 1.00 63.26  ? 500 PRO A CB    1 
ATOM   3900 C  CG    . PRO A 1 520 ? 26.243  27.952  -17.512 1.00 61.17  ? 500 PRO A CG    1 
ATOM   3901 C  CD    . PRO A 1 520 ? 25.331  27.097  -16.685 1.00 61.81  ? 500 PRO A CD    1 
ATOM   3902 N  N     . PHE A 1 521 ? 23.347  29.818  -15.324 1.00 72.03  ? 501 PHE A N     1 
ATOM   3903 C  CA    . PHE A 1 521 ? 22.216  30.675  -14.940 1.00 75.37  ? 501 PHE A CA    1 
ATOM   3904 C  C     . PHE A 1 521 ? 21.997  30.631  -13.443 1.00 79.90  ? 501 PHE A C     1 
ATOM   3905 O  O     . PHE A 1 521 ? 21.663  31.642  -12.828 1.00 84.61  ? 501 PHE A O     1 
ATOM   3906 C  CB    . PHE A 1 521 ? 20.921  30.242  -15.632 1.00 72.18  ? 501 PHE A CB    1 
ATOM   3907 C  CG    . PHE A 1 521 ? 20.988  30.311  -17.125 1.00 70.08  ? 501 PHE A CG    1 
ATOM   3908 C  CD1   . PHE A 1 521 ? 21.145  31.530  -17.765 1.00 71.16  ? 501 PHE A CD1   1 
ATOM   3909 C  CD2   . PHE A 1 521 ? 20.907  29.158  -17.890 1.00 67.78  ? 501 PHE A CD2   1 
ATOM   3910 C  CE1   . PHE A 1 521 ? 21.224  31.599  -19.142 1.00 71.84  ? 501 PHE A CE1   1 
ATOM   3911 C  CE2   . PHE A 1 521 ? 20.982  29.218  -19.267 1.00 68.92  ? 501 PHE A CE2   1 
ATOM   3912 C  CZ    . PHE A 1 521 ? 21.140  30.441  -19.896 1.00 69.88  ? 501 PHE A CZ    1 
ATOM   3913 N  N     . LEU A 1 522 ? 22.178  29.449  -12.866 1.00 84.24  ? 502 LEU A N     1 
ATOM   3914 C  CA    . LEU A 1 522 ? 21.977  29.266  -11.442 1.00 85.09  ? 502 LEU A CA    1 
ATOM   3915 C  C     . LEU A 1 522 ? 22.994  30.074  -10.636 1.00 88.53  ? 502 LEU A C     1 
ATOM   3916 O  O     . LEU A 1 522 ? 22.632  30.684  -9.637  1.00 90.12  ? 502 LEU A O     1 
ATOM   3917 C  CB    . LEU A 1 522 ? 22.024  27.780  -11.084 1.00 84.52  ? 502 LEU A CB    1 
ATOM   3918 C  CG    . LEU A 1 522 ? 21.329  27.348  -9.791  1.00 85.03  ? 502 LEU A CG    1 
ATOM   3919 C  CD1   . LEU A 1 522 ? 20.117  28.203  -9.458  1.00 86.10  ? 502 LEU A CD1   1 
ATOM   3920 C  CD2   . LEU A 1 522 ? 20.927  25.883  -9.878  1.00 84.79  ? 502 LEU A CD2   1 
ATOM   3921 N  N     . ARG A 1 523 ? 24.249  30.100  -11.083 1.00 94.97  ? 503 ARG A N     1 
ATOM   3922 C  CA    . ARG A 1 523 ? 25.257  31.009  -10.508 1.00 99.43  ? 503 ARG A CA    1 
ATOM   3923 C  C     . ARG A 1 523 ? 25.091  32.411  -11.083 1.00 97.89  ? 503 ARG A C     1 
ATOM   3924 O  O     . ARG A 1 523 ? 25.373  33.407  -10.418 1.00 94.66  ? 503 ARG A O     1 
ATOM   3925 C  CB    . ARG A 1 523 ? 26.688  30.509  -10.749 1.00 104.32 ? 503 ARG A CB    1 
ATOM   3926 C  CG    . ARG A 1 523 ? 27.143  29.434  -9.770  1.00 108.81 ? 503 ARG A CG    1 
ATOM   3927 C  CD    . ARG A 1 523 ? 26.886  28.034  -10.303 1.00 110.89 ? 503 ARG A CD    1 
ATOM   3928 N  NE    . ARG A 1 523 ? 27.984  27.581  -11.161 1.00 115.27 ? 503 ARG A NE    1 
ATOM   3929 C  CZ    . ARG A 1 523 ? 28.973  26.764  -10.788 1.00 117.58 ? 503 ARG A CZ    1 
ATOM   3930 N  NH1   . ARG A 1 523 ? 29.036  26.267  -9.552  1.00 117.18 ? 503 ARG A NH1   1 
ATOM   3931 N  NH2   . ARG A 1 523 ? 29.914  26.432  -11.668 1.00 113.25 ? 503 ARG A NH2   1 
ATOM   3932 N  N     . GLY A 1 524 ? 24.667  32.474  -12.339 1.00 99.20  ? 504 GLY A N     1 
ATOM   3933 C  CA    . GLY A 1 524 ? 24.138  33.697  -12.915 1.00 99.57  ? 504 GLY A CA    1 
ATOM   3934 C  C     . GLY A 1 524 ? 25.138  34.743  -13.352 1.00 99.51  ? 504 GLY A C     1 
ATOM   3935 O  O     . GLY A 1 524 ? 25.067  35.889  -12.901 1.00 100.52 ? 504 GLY A O     1 
ATOM   3936 N  N     . GLU A 1 525 ? 26.074  34.360  -14.217 1.00 97.78  ? 505 GLU A N     1 
ATOM   3937 C  CA    . GLU A 1 525 ? 26.822  35.347  -15.004 1.00 101.70 ? 505 GLU A CA    1 
ATOM   3938 C  C     . GLU A 1 525 ? 26.463  35.278  -16.493 1.00 100.16 ? 505 GLU A C     1 
ATOM   3939 O  O     . GLU A 1 525 ? 26.805  36.185  -17.255 1.00 100.03 ? 505 GLU A O     1 
ATOM   3940 C  CB    . GLU A 1 525 ? 28.338  35.219  -14.797 1.00 106.12 ? 505 GLU A CB    1 
ATOM   3941 C  CG    . GLU A 1 525 ? 29.128  36.419  -15.323 1.00 105.33 ? 505 GLU A CG    1 
ATOM   3942 C  CD    . GLU A 1 525 ? 30.382  36.714  -14.518 1.00 105.60 ? 505 GLU A CD    1 
ATOM   3943 O  OE1   . GLU A 1 525 ? 30.413  37.756  -13.829 1.00 106.27 ? 505 GLU A OE1   1 
ATOM   3944 O  OE2   . GLU A 1 525 ? 31.335  35.910  -14.568 1.00 104.57 ? 505 GLU A OE2   1 
ATOM   3945 N  N     . ALA A 1 526 ? 25.777  34.208  -16.902 1.00 96.88  ? 506 ALA A N     1 
ATOM   3946 C  CA    . ALA A 1 526 ? 25.199  34.120  -18.244 1.00 89.91  ? 506 ALA A CA    1 
ATOM   3947 C  C     . ALA A 1 526 ? 23.884  34.903  -18.282 1.00 82.44  ? 506 ALA A C     1 
ATOM   3948 O  O     . ALA A 1 526 ? 22.957  34.581  -17.540 1.00 82.73  ? 506 ALA A O     1 
ATOM   3949 C  CB    . ALA A 1 526 ? 24.958  32.667  -18.622 1.00 90.19  ? 506 ALA A CB    1 
ATOM   3950 N  N     . PRO A 1 527 ? 23.798  35.935  -19.140 1.00 78.64  ? 507 PRO A N     1 
ATOM   3951 C  CA    . PRO A 1 527 ? 22.578  36.747  -19.207 1.00 78.02  ? 507 PRO A CA    1 
ATOM   3952 C  C     . PRO A 1 527 ? 21.393  36.023  -19.872 1.00 75.85  ? 507 PRO A C     1 
ATOM   3953 O  O     . PRO A 1 527 ? 21.590  35.022  -20.576 1.00 76.47  ? 507 PRO A O     1 
ATOM   3954 C  CB    . PRO A 1 527 ? 23.013  37.974  -20.018 1.00 79.11  ? 507 PRO A CB    1 
ATOM   3955 C  CG    . PRO A 1 527 ? 24.189  37.532  -20.817 1.00 80.53  ? 507 PRO A CG    1 
ATOM   3956 C  CD    . PRO A 1 527 ? 24.824  36.379  -20.103 1.00 79.94  ? 507 PRO A CD    1 
ATOM   3957 N  N     . LEU A 1 528 ? 20.178  36.528  -19.651 1.00 70.53  ? 508 LEU A N     1 
ATOM   3958 C  CA    . LEU A 1 528 ? 18.969  35.838  -20.101 1.00 67.37  ? 508 LEU A CA    1 
ATOM   3959 C  C     . LEU A 1 528 ? 17.755  36.747  -20.238 1.00 65.07  ? 508 LEU A C     1 
ATOM   3960 O  O     . LEU A 1 528 ? 17.301  37.348  -19.266 1.00 64.36  ? 508 LEU A O     1 
ATOM   3961 C  CB    . LEU A 1 528 ? 18.638  34.709  -19.126 1.00 66.34  ? 508 LEU A CB    1 
ATOM   3962 C  CG    . LEU A 1 528 ? 17.384  33.887  -19.394 1.00 66.47  ? 508 LEU A CG    1 
ATOM   3963 C  CD1   . LEU A 1 528 ? 17.473  33.193  -20.739 1.00 69.42  ? 508 LEU A CD1   1 
ATOM   3964 C  CD2   . LEU A 1 528 ? 17.189  32.861  -18.287 1.00 67.93  ? 508 LEU A CD2   1 
ATOM   3965 N  N     . MET A 1 529 ? 17.224  36.823  -21.453 1.00 66.34  ? 509 MET A N     1 
ATOM   3966 C  CA    . MET A 1 529 ? 15.932  37.451  -21.696 1.00 68.05  ? 509 MET A CA    1 
ATOM   3967 C  C     . MET A 1 529 ? 14.830  36.393  -21.636 1.00 62.95  ? 509 MET A C     1 
ATOM   3968 O  O     . MET A 1 529 ? 15.003  35.275  -22.115 1.00 59.87  ? 509 MET A O     1 
ATOM   3969 C  CB    . MET A 1 529 ? 15.915  38.137  -23.068 1.00 74.18  ? 509 MET A CB    1 
ATOM   3970 C  CG    . MET A 1 529 ? 17.031  39.154  -23.289 1.00 79.90  ? 509 MET A CG    1 
ATOM   3971 S  SD    . MET A 1 529 ? 16.920  40.600  -22.209 1.00 89.79  ? 509 MET A SD    1 
ATOM   3972 C  CE    . MET A 1 529 ? 16.030  41.762  -23.244 1.00 84.80  ? 509 MET A CE    1 
ATOM   3973 N  N     . LEU A 1 530 ? 13.708  36.741  -21.025 1.00 59.89  ? 510 LEU A N     1 
ATOM   3974 C  CA    . LEU A 1 530 ? 12.497  35.927  -21.117 1.00 58.28  ? 510 LEU A CA    1 
ATOM   3975 C  C     . LEU A 1 530 ? 11.383  36.778  -21.696 1.00 56.99  ? 510 LEU A C     1 
ATOM   3976 O  O     . LEU A 1 530 ? 11.537  37.986  -21.839 1.00 53.52  ? 510 LEU A O     1 
ATOM   3977 C  CB    . LEU A 1 530 ? 12.088  35.386  -19.746 1.00 55.78  ? 510 LEU A CB    1 
ATOM   3978 C  CG    . LEU A 1 530 ? 13.083  34.426  -19.086 1.00 56.38  ? 510 LEU A CG    1 
ATOM   3979 C  CD1   . LEU A 1 530 ? 12.593  34.022  -17.702 1.00 55.34  ? 510 LEU A CD1   1 
ATOM   3980 C  CD2   . LEU A 1 530 ? 13.340  33.188  -19.937 1.00 55.90  ? 510 LEU A CD2   1 
ATOM   3981 N  N     . ALA A 1 531 ? 10.267  36.136  -22.021 1.00 54.83  ? 511 ALA A N     1 
ATOM   3982 C  CA    . ALA A 1 531 ? 9.118   36.805  -22.600 1.00 55.70  ? 511 ALA A CA    1 
ATOM   3983 C  C     . ALA A 1 531 ? 7.971   36.852  -21.615 1.00 57.66  ? 511 ALA A C     1 
ATOM   3984 O  O     . ALA A 1 531 ? 7.727   35.883  -20.910 1.00 59.73  ? 511 ALA A O     1 
ATOM   3985 C  CB    . ALA A 1 531 ? 8.673   36.063  -23.851 1.00 54.67  ? 511 ALA A CB    1 
ATOM   3986 N  N     . VAL A 1 532 ? 7.242   37.964  -21.606 1.00 60.31  ? 512 VAL A N     1 
ATOM   3987 C  CA    . VAL A 1 532 ? 6.015   38.079  -20.821 1.00 64.19  ? 512 VAL A CA    1 
ATOM   3988 C  C     . VAL A 1 532 ? 4.967   37.134  -21.426 1.00 69.39  ? 512 VAL A C     1 
ATOM   3989 O  O     . VAL A 1 532 ? 4.915   36.981  -22.650 1.00 69.35  ? 512 VAL A O     1 
ATOM   3990 C  CB    . VAL A 1 532 ? 5.481   39.535  -20.824 1.00 68.02  ? 512 VAL A CB    1 
ATOM   3991 C  CG1   . VAL A 1 532 ? 4.131   39.644  -20.115 1.00 68.98  ? 512 VAL A CG1   1 
ATOM   3992 C  CG2   . VAL A 1 532 ? 6.489   40.481  -20.180 1.00 65.86  ? 512 VAL A CG2   1 
ATOM   3993 N  N     . PRO A 1 533 ? 4.120   36.506  -20.584 1.00 70.59  ? 513 PRO A N     1 
ATOM   3994 C  CA    . PRO A 1 533 ? 3.192   35.504  -21.125 1.00 72.19  ? 513 PRO A CA    1 
ATOM   3995 C  C     . PRO A 1 533 ? 1.997   36.054  -21.913 1.00 68.61  ? 513 PRO A C     1 
ATOM   3996 O  O     . PRO A 1 533 ? 1.517   37.158  -21.660 1.00 72.90  ? 513 PRO A O     1 
ATOM   3997 C  CB    . PRO A 1 533 ? 2.707   34.747  -19.874 1.00 74.65  ? 513 PRO A CB    1 
ATOM   3998 C  CG    . PRO A 1 533 ? 3.574   35.212  -18.747 1.00 73.30  ? 513 PRO A CG    1 
ATOM   3999 C  CD    . PRO A 1 533 ? 4.023   36.586  -19.119 1.00 71.56  ? 513 PRO A CD    1 
ATOM   4000 N  N     . ARG A 1 534 ? 1.528   35.240  -22.848 1.00 68.41  ? 514 ARG A N     1 
ATOM   4001 C  CA    . ARG A 1 534 ? 0.436   35.580  -23.746 1.00 68.39  ? 514 ARG A CA    1 
ATOM   4002 C  C     . ARG A 1 534 ? -0.921  35.315  -23.091 1.00 71.88  ? 514 ARG A C     1 
ATOM   4003 O  O     . ARG A 1 534 ? -1.346  34.162  -22.966 1.00 72.42  ? 514 ARG A O     1 
ATOM   4004 C  CB    . ARG A 1 534 ? 0.573   34.741  -25.022 1.00 65.99  ? 514 ARG A CB    1 
ATOM   4005 C  CG    . ARG A 1 534 ? -0.196  35.261  -26.232 1.00 62.52  ? 514 ARG A CG    1 
ATOM   4006 C  CD    . ARG A 1 534 ? 0.681   35.191  -27.470 1.00 57.57  ? 514 ARG A CD    1 
ATOM   4007 N  NE    . ARG A 1 534 ? 1.751   36.184  -27.397 1.00 53.93  ? 514 ARG A NE    1 
ATOM   4008 C  CZ    . ARG A 1 534 ? 1.749   37.355  -28.022 1.00 48.99  ? 514 ARG A CZ    1 
ATOM   4009 N  NH1   . ARG A 1 534 ? 0.759   37.698  -28.820 1.00 48.63  ? 514 ARG A NH1   1 
ATOM   4010 N  NH2   . ARG A 1 534 ? 2.768   38.186  -27.866 1.00 51.06  ? 514 ARG A NH2   1 
ATOM   4011 P  P     . DG  B 2 3   ? 3.722   8.419   -8.193  1.00 159.98 ? 3   DG  B P     1 
ATOM   4012 O  OP1   . DG  B 2 3   ? 4.197   7.610   -7.040  1.00 163.23 ? 3   DG  B OP1   1 
ATOM   4013 O  OP2   . DG  B 2 3   ? 3.144   7.745   -9.386  1.00 156.89 ? 3   DG  B OP2   1 
ATOM   4014 O  "O5'" . DG  B 2 3   ? 4.894   9.401   -8.645  1.00 151.59 ? 3   DG  B "O5'" 1 
ATOM   4015 C  "C5'" . DG  B 2 3   ? 5.338   10.469  -7.784  1.00 149.42 ? 3   DG  B "C5'" 1 
ATOM   4016 C  "C4'" . DG  B 2 3   ? 4.388   11.643  -7.867  1.00 148.40 ? 3   DG  B "C4'" 1 
ATOM   4017 O  "O4'" . DG  B 2 3   ? 3.081   11.171  -8.279  1.00 151.34 ? 3   DG  B "O4'" 1 
ATOM   4018 C  "C3'" . DG  B 2 3   ? 4.159   12.379  -6.543  1.00 142.66 ? 3   DG  B "C3'" 1 
ATOM   4019 O  "O3'" . DG  B 2 3   ? 3.833   13.778  -6.676  1.00 127.68 ? 3   DG  B "O3'" 1 
ATOM   4020 C  "C2'" . DG  B 2 3   ? 2.932   11.672  -5.997  1.00 145.98 ? 3   DG  B "C2'" 1 
ATOM   4021 C  "C1'" . DG  B 2 3   ? 2.129   11.504  -7.278  1.00 148.36 ? 3   DG  B "C1'" 1 
ATOM   4022 N  N9    . DG  B 2 3   ? 1.078   10.487  -7.293  1.00 146.02 ? 3   DG  B N9    1 
ATOM   4023 C  C8    . DG  B 2 3   ? 0.700   9.649   -6.270  1.00 143.96 ? 3   DG  B C8    1 
ATOM   4024 N  N7    . DG  B 2 3   ? -0.289  8.861   -6.594  1.00 139.03 ? 3   DG  B N7    1 
ATOM   4025 C  C5    . DG  B 2 3   ? -0.586  9.202   -7.906  1.00 137.63 ? 3   DG  B C5    1 
ATOM   4026 C  C6    . DG  B 2 3   ? -1.570  8.687   -8.789  1.00 133.47 ? 3   DG  B C6    1 
ATOM   4027 O  O6    . DG  B 2 3   ? -2.403  7.797   -8.582  1.00 129.11 ? 3   DG  B O6    1 
ATOM   4028 N  N1    . DG  B 2 3   ? -1.527  9.321   -10.027 1.00 133.79 ? 3   DG  B N1    1 
ATOM   4029 C  C2    . DG  B 2 3   ? -0.651  10.321  -10.373 1.00 132.07 ? 3   DG  B C2    1 
ATOM   4030 N  N2    . DG  B 2 3   ? -0.765  10.808  -11.617 1.00 129.69 ? 3   DG  B N2    1 
ATOM   4031 N  N3    . DG  B 2 3   ? 0.270   10.809  -9.559  1.00 135.87 ? 3   DG  B N3    1 
ATOM   4032 C  C4    . DG  B 2 3   ? 0.245   10.208  -8.350  1.00 141.37 ? 3   DG  B C4    1 
ATOM   4033 P  P     . DT  B 2 4   ? 4.772   14.809  -7.499  1.00 113.12 ? 4   DT  B P     1 
ATOM   4034 O  OP1   . DT  B 2 4   ? 6.023   14.110  -7.895  1.00 110.01 ? 4   DT  B OP1   1 
ATOM   4035 O  OP2   . DT  B 2 4   ? 4.851   16.082  -6.740  1.00 114.36 ? 4   DT  B OP2   1 
ATOM   4036 O  "O5'" . DT  B 2 4   ? 3.888   15.147  -8.777  1.00 106.82 ? 4   DT  B "O5'" 1 
ATOM   4037 C  "C5'" . DT  B 2 4   ? 4.252   14.667  -10.082 1.00 103.51 ? 4   DT  B "C5'" 1 
ATOM   4038 C  "C4'" . DT  B 2 4   ? 3.152   14.984  -11.066 1.00 98.21  ? 4   DT  B "C4'" 1 
ATOM   4039 O  "O4'" . DT  B 2 4   ? 2.017   14.123  -10.824 1.00 94.88  ? 4   DT  B "O4'" 1 
ATOM   4040 C  "C3'" . DT  B 2 4   ? 2.639   16.424  -10.985 1.00 94.70  ? 4   DT  B "C3'" 1 
ATOM   4041 O  "O3'" . DT  B 2 4   ? 2.835   17.056  -12.251 1.00 84.18  ? 4   DT  B "O3'" 1 
ATOM   4042 C  "C2'" . DT  B 2 4   ? 1.183   16.291  -10.567 1.00 97.57  ? 4   DT  B "C2'" 1 
ATOM   4043 C  "C1'" . DT  B 2 4   ? 0.821   14.865  -10.935 1.00 100.10 ? 4   DT  B "C1'" 1 
ATOM   4044 N  N1    . DT  B 2 4   ? -0.176  14.236  -10.050 1.00 105.69 ? 4   DT  B N1    1 
ATOM   4045 C  C2    . DT  B 2 4   ? -1.312  13.699  -10.614 1.00 109.71 ? 4   DT  B C2    1 
ATOM   4046 O  O2    . DT  B 2 4   ? -1.541  13.728  -11.811 1.00 103.85 ? 4   DT  B O2    1 
ATOM   4047 N  N3    . DT  B 2 4   ? -2.175  13.117  -9.718  1.00 117.04 ? 4   DT  B N3    1 
ATOM   4048 C  C4    . DT  B 2 4   ? -2.016  13.019  -8.347  1.00 117.85 ? 4   DT  B C4    1 
ATOM   4049 O  O4    . DT  B 2 4   ? -2.880  12.469  -7.669  1.00 118.88 ? 4   DT  B O4    1 
ATOM   4050 C  C5    . DT  B 2 4   ? -0.801  13.605  -7.824  1.00 115.17 ? 4   DT  B C5    1 
ATOM   4051 C  C7    . DT  B 2 4   ? -0.548  13.557  -6.350  1.00 112.31 ? 4   DT  B C7    1 
ATOM   4052 C  C6    . DT  B 2 4   ? 0.047   14.174  -8.691  1.00 111.45 ? 4   DT  B C6    1 
ATOM   4053 P  P     . DA  B 2 5   ? 2.533   18.605  -12.435 1.00 77.83  ? 5   DA  B P     1 
ATOM   4054 O  OP1   . DA  B 2 5   ? 3.245   19.062  -13.657 1.00 76.14  ? 5   DA  B OP1   1 
ATOM   4055 O  OP2   . DA  B 2 5   ? 2.782   19.300  -11.142 1.00 71.43  ? 5   DA  B OP2   1 
ATOM   4056 O  "O5'" . DA  B 2 5   ? 0.977   18.596  -12.751 1.00 71.97  ? 5   DA  B "O5'" 1 
ATOM   4057 C  "C5'" . DA  B 2 5   ? 0.444   17.729  -13.767 1.00 73.78  ? 5   DA  B "C5'" 1 
ATOM   4058 C  "C4'" . DA  B 2 5   ? -0.981  18.129  -14.060 1.00 79.08  ? 5   DA  B "C4'" 1 
ATOM   4059 O  "O4'" . DA  B 2 5   ? -1.865  17.326  -13.243 1.00 78.17  ? 5   DA  B "O4'" 1 
ATOM   4060 C  "C3'" . DA  B 2 5   ? -1.286  19.583  -13.703 1.00 83.50  ? 5   DA  B "C3'" 1 
ATOM   4061 O  "O3'" . DA  B 2 5   ? -2.239  20.197  -14.574 1.00 89.96  ? 5   DA  B "O3'" 1 
ATOM   4062 C  "C2'" . DA  B 2 5   ? -1.839  19.479  -12.297 1.00 84.37  ? 5   DA  B "C2'" 1 
ATOM   4063 C  "C1'" . DA  B 2 5   ? -2.590  18.161  -12.352 1.00 83.41  ? 5   DA  B "C1'" 1 
ATOM   4064 N  N9    . DA  B 2 5   ? -2.693  17.476  -11.065 1.00 87.10  ? 5   DA  B N9    1 
ATOM   4065 C  C8    . DA  B 2 5   ? -1.822  17.516  -10.003 1.00 84.93  ? 5   DA  B C8    1 
ATOM   4066 N  N7    . DA  B 2 5   ? -2.211  16.805  -8.974  1.00 83.92  ? 5   DA  B N7    1 
ATOM   4067 C  C5    . DA  B 2 5   ? -3.428  16.273  -9.378  1.00 84.37  ? 5   DA  B C5    1 
ATOM   4068 C  C6    . DA  B 2 5   ? -4.354  15.435  -8.734  1.00 87.02  ? 5   DA  B C6    1 
ATOM   4069 N  N6    . DA  B 2 5   ? -4.190  14.962  -7.496  1.00 88.44  ? 5   DA  B N6    1 
ATOM   4070 N  N1    . DA  B 2 5   ? -5.466  15.085  -9.418  1.00 86.73  ? 5   DA  B N1    1 
ATOM   4071 C  C2    . DA  B 2 5   ? -5.631  15.559  -10.661 1.00 86.48  ? 5   DA  B C2    1 
ATOM   4072 N  N3    . DA  B 2 5   ? -4.835  16.357  -11.369 1.00 83.99  ? 5   DA  B N3    1 
ATOM   4073 C  C4    . DA  B 2 5   ? -3.738  16.681  -10.663 1.00 85.05  ? 5   DA  B C4    1 
ATOM   4074 P  P     . DG  B 2 6   ? -2.327  21.796  -14.638 1.00 89.99  ? 6   DG  B P     1 
ATOM   4075 O  OP1   . DG  B 2 6   ? -1.310  22.273  -15.610 1.00 85.41  ? 6   DG  B OP1   1 
ATOM   4076 O  OP2   . DG  B 2 6   ? -2.294  22.315  -13.244 1.00 93.74  ? 6   DG  B OP2   1 
ATOM   4077 O  "O5'" . DG  B 2 6   ? -3.791  22.067  -15.207 1.00 87.87  ? 6   DG  B "O5'" 1 
ATOM   4078 C  "C5'" . DG  B 2 6   ? -4.567  21.037  -15.846 1.00 87.40  ? 6   DG  B "C5'" 1 
ATOM   4079 C  "C4'" . DG  B 2 6   ? -5.877  20.835  -15.118 1.00 87.53  ? 6   DG  B "C4'" 1 
ATOM   4080 O  "O4'" . DG  B 2 6   ? -5.663  20.105  -13.887 1.00 88.10  ? 6   DG  B "O4'" 1 
ATOM   4081 C  "C3'" . DG  B 2 6   ? -6.618  22.122  -14.733 1.00 85.94  ? 6   DG  B "C3'" 1 
ATOM   4082 O  "O3'" . DG  B 2 6   ? -7.940  22.062  -15.276 1.00 84.25  ? 6   DG  B "O3'" 1 
ATOM   4083 C  "C2'" . DG  B 2 6   ? -6.606  22.117  -13.212 1.00 86.46  ? 6   DG  B "C2'" 1 
ATOM   4084 C  "C1'" . DG  B 2 6   ? -6.521  20.640  -12.897 1.00 86.99  ? 6   DG  B "C1'" 1 
ATOM   4085 N  N9    . DG  B 2 6   ? -5.967  20.302  -11.590 1.00 87.03  ? 6   DG  B N9    1 
ATOM   4086 C  C8    . DG  B 2 6   ? -4.816  20.788  -11.016 1.00 85.42  ? 6   DG  B C8    1 
ATOM   4087 N  N7    . DG  B 2 6   ? -4.580  20.284  -9.835  1.00 80.86  ? 6   DG  B N7    1 
ATOM   4088 C  C5    . DG  B 2 6   ? -5.640  19.415  -9.615  1.00 83.90  ? 6   DG  B C5    1 
ATOM   4089 C  C6    . DG  B 2 6   ? -5.932  18.581  -8.502  1.00 82.30  ? 6   DG  B C6    1 
ATOM   4090 O  O6    . DG  B 2 6   ? -5.292  18.444  -7.454  1.00 79.61  ? 6   DG  B O6    1 
ATOM   4091 N  N1    . DG  B 2 6   ? -7.111  17.867  -8.694  1.00 81.94  ? 6   DG  B N1    1 
ATOM   4092 C  C2    . DG  B 2 6   ? -7.907  17.942  -9.810  1.00 84.36  ? 6   DG  B C2    1 
ATOM   4093 N  N2    . DG  B 2 6   ? -9.006  17.174  -9.809  1.00 84.04  ? 6   DG  B N2    1 
ATOM   4094 N  N3    . DG  B 2 6   ? -7.645  18.711  -10.854 1.00 85.86  ? 6   DG  B N3    1 
ATOM   4095 C  C4    . DG  B 2 6   ? -6.504  19.415  -10.689 1.00 85.63  ? 6   DG  B C4    1 
ATOM   4096 P  P     . DA  B 2 7   ? -8.943  23.305  -15.144 1.00 80.82  ? 7   DA  B P     1 
ATOM   4097 O  OP1   . DA  B 2 7   ? -9.591  23.509  -16.463 1.00 76.30  ? 7   DA  B OP1   1 
ATOM   4098 O  OP2   . DA  B 2 7   ? -8.229  24.427  -14.484 1.00 71.90  ? 7   DA  B OP2   1 
ATOM   4099 O  "O5'" . DA  B 2 7   ? -10.064 22.733  -14.171 1.00 84.00  ? 7   DA  B "O5'" 1 
ATOM   4100 C  "C5'" . DA  B 2 7   ? -10.647 21.443  -14.432 1.00 83.61  ? 7   DA  B "C5'" 1 
ATOM   4101 C  "C4'" . DA  B 2 7   ? -11.735 21.134  -13.431 1.00 82.97  ? 7   DA  B "C4'" 1 
ATOM   4102 O  "O4'" . DA  B 2 7   ? -11.146 20.646  -12.204 1.00 79.39  ? 7   DA  B "O4'" 1 
ATOM   4103 C  "C3'" . DA  B 2 7   ? -12.620 22.319  -13.042 1.00 82.96  ? 7   DA  B "C3'" 1 
ATOM   4104 O  "O3'" . DA  B 2 7   ? -13.984 21.878  -13.026 1.00 85.39  ? 7   DA  B "O3'" 1 
ATOM   4105 C  "C2'" . DA  B 2 7   ? -12.043 22.776  -11.712 1.00 80.79  ? 7   DA  B "C2'" 1 
ATOM   4106 C  "C1'" . DA  B 2 7   ? -11.464 21.500  -11.116 1.00 82.86  ? 7   DA  B "C1'" 1 
ATOM   4107 N  N9    . DA  B 2 7   ? -10.249 21.675  -10.320 1.00 82.49  ? 7   DA  B N9    1 
ATOM   4108 C  C8    . DA  B 2 7   ? -9.218  22.561  -10.521 1.00 83.33  ? 7   DA  B C8    1 
ATOM   4109 N  N7    . DA  B 2 7   ? -8.257  22.462  -9.636  1.00 80.56  ? 7   DA  B N7    1 
ATOM   4110 C  C5    . DA  B 2 7   ? -8.679  21.439  -8.798  1.00 80.06  ? 7   DA  B C5    1 
ATOM   4111 C  C6    . DA  B 2 7   ? -8.104  20.852  -7.657  1.00 78.37  ? 7   DA  B C6    1 
ATOM   4112 N  N6    . DA  B 2 7   ? -6.929  21.224  -7.145  1.00 76.92  ? 7   DA  B N6    1 
ATOM   4113 N  N1    . DA  B 2 7   ? -8.784  19.852  -7.056  1.00 78.15  ? 7   DA  B N1    1 
ATOM   4114 C  C2    . DA  B 2 7   ? -9.962  19.477  -7.571  1.00 79.18  ? 7   DA  B C2    1 
ATOM   4115 N  N3    . DA  B 2 7   ? -10.606 19.953  -8.635  1.00 77.79  ? 7   DA  B N3    1 
ATOM   4116 C  C4    . DA  B 2 7   ? -9.901  20.941  -9.212  1.00 80.73  ? 7   DA  B C4    1 
ATOM   4117 P  P     . DA  B 2 8   ? -15.146 22.835  -12.492 1.00 86.59  ? 8   DA  B P     1 
ATOM   4118 O  OP1   . DA  B 2 8   ? -16.381 22.530  -13.258 1.00 86.85  ? 8   DA  B OP1   1 
ATOM   4119 O  OP2   . DA  B 2 8   ? -14.631 24.225  -12.457 1.00 86.24  ? 8   DA  B OP2   1 
ATOM   4120 O  "O5'" . DA  B 2 8   ? -15.342 22.316  -11.002 1.00 96.16  ? 8   DA  B "O5'" 1 
ATOM   4121 C  "C5'" . DA  B 2 8   ? -15.277 20.905  -10.699 1.00 97.15  ? 8   DA  B "C5'" 1 
ATOM   4122 C  "C4'" . DA  B 2 8   ? -15.393 20.699  -9.208  1.00 97.31  ? 8   DA  B "C4'" 1 
ATOM   4123 O  "O4'" . DA  B 2 8   ? -14.086 20.831  -8.597  1.00 96.16  ? 8   DA  B "O4'" 1 
ATOM   4124 C  "C3'" . DA  B 2 8   ? -16.300 21.720  -8.513  1.00 98.66  ? 8   DA  B "C3'" 1 
ATOM   4125 O  "O3'" . DA  B 2 8   ? -17.212 21.050  -7.637  1.00 103.09 ? 8   DA  B "O3'" 1 
ATOM   4126 C  "C2'" . DA  B 2 8   ? -15.322 22.649  -7.814  1.00 97.72  ? 8   DA  B "C2'" 1 
ATOM   4127 C  "C1'" . DA  B 2 8   ? -14.171 21.719  -7.497  1.00 96.35  ? 8   DA  B "C1'" 1 
ATOM   4128 N  N9    . DA  B 2 8   ? -12.879 22.384  -7.343  1.00 93.86  ? 8   DA  B N9    1 
ATOM   4129 C  C8    . DA  B 2 8   ? -12.332 23.382  -8.112  1.00 92.72  ? 8   DA  B C8    1 
ATOM   4130 N  N7    . DA  B 2 8   ? -11.157 23.786  -7.696  1.00 90.07  ? 8   DA  B N7    1 
ATOM   4131 C  C5    . DA  B 2 8   ? -10.916 23.006  -6.573  1.00 93.39  ? 8   DA  B C5    1 
ATOM   4132 C  C6    . DA  B 2 8   ? -9.836  22.950  -5.674  1.00 98.66  ? 8   DA  B C6    1 
ATOM   4133 N  N6    . DA  B 2 8   ? -8.750  23.720  -5.770  1.00 97.34  ? 8   DA  B N6    1 
ATOM   4134 N  N1    . DA  B 2 8   ? -9.911  22.061  -4.658  1.00 101.41 ? 8   DA  B N1    1 
ATOM   4135 C  C2    . DA  B 2 8   ? -11.001 21.288  -4.559  1.00 101.02 ? 8   DA  B C2    1 
ATOM   4136 N  N3    . DA  B 2 8   ? -12.079 21.251  -5.341  1.00 100.87 ? 8   DA  B N3    1 
ATOM   4137 C  C4    . DA  B 2 8   ? -11.972 22.144  -6.340  1.00 96.57  ? 8   DA  B C4    1 
ATOM   4138 P  P     . DT  B 2 9   ? -18.167 21.888  -6.657  1.00 104.02 ? 9   DT  B P     1 
ATOM   4139 O  OP1   . DT  B 2 9   ? -19.473 21.187  -6.597  1.00 96.71  ? 9   DT  B OP1   1 
ATOM   4140 O  OP2   . DT  B 2 9   ? -18.125 23.319  -7.067  1.00 100.49 ? 9   DT  B OP2   1 
ATOM   4141 O  "O5'" . DT  B 2 9   ? -17.423 21.749  -5.254  1.00 102.50 ? 9   DT  B "O5'" 1 
ATOM   4142 C  "C5'" . DT  B 2 9   ? -16.851 20.486  -4.849  1.00 104.02 ? 9   DT  B "C5'" 1 
ATOM   4143 C  "C4'" . DT  B 2 9   ? -16.058 20.639  -3.571  1.00 101.51 ? 9   DT  B "C4'" 1 
ATOM   4144 O  "O4'" . DT  B 2 9   ? -14.821 21.348  -3.829  1.00 98.12  ? 9   DT  B "O4'" 1 
ATOM   4145 C  "C3'" . DT  B 2 9   ? -16.772 21.420  -2.465  1.00 103.16 ? 9   DT  B "C3'" 1 
ATOM   4146 O  "O3'" . DT  B 2 9   ? -16.567 20.761  -1.209  1.00 109.14 ? 9   DT  B "O3'" 1 
ATOM   4147 C  "C2'" . DT  B 2 9   ? -16.087 22.774  -2.494  1.00 99.21  ? 9   DT  B "C2'" 1 
ATOM   4148 C  "C1'" . DT  B 2 9   ? -14.673 22.372  -2.861  1.00 98.27  ? 9   DT  B "C1'" 1 
ATOM   4149 N  N1    . DT  B 2 9   ? -13.833 23.437  -3.443  1.00 95.70  ? 9   DT  B N1    1 
ATOM   4150 C  C2    . DT  B 2 9   ? -12.617 23.697  -2.854  1.00 93.66  ? 9   DT  B C2    1 
ATOM   4151 O  O2    . DT  B 2 9   ? -12.203 23.090  -1.880  1.00 93.22  ? 9   DT  B O2    1 
ATOM   4152 N  N3    . DT  B 2 9   ? -11.893 24.698  -3.455  1.00 95.92  ? 9   DT  B N3    1 
ATOM   4153 C  C4    . DT  B 2 9   ? -12.258 25.446  -4.559  1.00 96.83  ? 9   DT  B C4    1 
ATOM   4154 O  O4    . DT  B 2 9   ? -11.503 26.315  -4.985  1.00 97.71  ? 9   DT  B O4    1 
ATOM   4155 C  C5    . DT  B 2 9   ? -13.549 25.119  -5.126  1.00 93.28  ? 9   DT  B C5    1 
ATOM   4156 C  C7    . DT  B 2 9   ? -14.033 25.877  -6.322  1.00 90.62  ? 9   DT  B C7    1 
ATOM   4157 C  C6    . DT  B 2 9   ? -14.261 24.143  -4.547  1.00 96.20  ? 9   DT  B C6    1 
ATOM   4158 P  P     . DT  B 2 10  ? -17.750 20.657  -0.127  1.00 105.26 ? 10  DT  B P     1 
ATOM   4159 O  OP1   . DT  B 2 10  ? -18.014 19.217  0.119   1.00 99.90  ? 10  DT  B OP1   1 
ATOM   4160 O  OP2   . DT  B 2 10  ? -18.866 21.536  -0.562  1.00 100.24 ? 10  DT  B OP2   1 
ATOM   4161 O  "O5'" . DT  B 2 10  ? -17.088 21.319  1.162   1.00 103.30 ? 10  DT  B "O5'" 1 
ATOM   4162 C  "C5'" . DT  B 2 10  ? -17.117 22.744  1.346   1.00 109.71 ? 10  DT  B "C5'" 1 
ATOM   4163 C  "C4'" . DT  B 2 10  ? -15.755 23.257  1.753   1.00 118.95 ? 10  DT  B "C4'" 1 
ATOM   4164 O  "O4'" . DT  B 2 10  ? -15.066 23.749  0.586   1.00 124.34 ? 10  DT  B "O4'" 1 
ATOM   4165 C  "C3'" . DT  B 2 10  ? -15.799 24.428  2.735   1.00 124.27 ? 10  DT  B "C3'" 1 
ATOM   4166 O  "O3'" . DT  B 2 10  ? -15.501 23.986  4.062   1.00 129.12 ? 10  DT  B "O3'" 1 
ATOM   4167 C  "C2'" . DT  B 2 10  ? -14.738 25.398  2.236   1.00 124.37 ? 10  DT  B "C2'" 1 
ATOM   4168 C  "C1'" . DT  B 2 10  ? -14.167 24.771  0.973   1.00 124.66 ? 10  DT  B "C1'" 1 
ATOM   4169 N  N1    . DT  B 2 10  ? -14.033 25.716  -0.154  1.00 123.11 ? 10  DT  B N1    1 
ATOM   4170 C  C2    . DT  B 2 10  ? -12.818 26.340  -0.323  1.00 121.95 ? 10  DT  B C2    1 
ATOM   4171 O  O2    . DT  B 2 10  ? -11.860 26.140  0.405   1.00 124.20 ? 10  DT  B O2    1 
ATOM   4172 N  N3    . DT  B 2 10  ? -12.762 27.210  -1.384  1.00 118.53 ? 10  DT  B N3    1 
ATOM   4173 C  C4    . DT  B 2 10  ? -13.781 27.517  -2.266  1.00 116.45 ? 10  DT  B C4    1 
ATOM   4174 O  O4    . DT  B 2 10  ? -13.583 28.320  -3.171  1.00 115.15 ? 10  DT  B O4    1 
ATOM   4175 C  C5    . DT  B 2 10  ? -15.032 26.831  -2.026  1.00 117.48 ? 10  DT  B C5    1 
ATOM   4176 C  C7    . DT  B 2 10  ? -16.193 27.098  -2.931  1.00 115.50 ? 10  DT  B C7    1 
ATOM   4177 C  C6    . DT  B 2 10  ? -15.095 25.979  -0.994  1.00 119.72 ? 10  DT  B C6    1 
ATOM   4178 P  P     . DG  B 2 11  ? -16.096 24.775  5.317   1.00 128.23 ? 11  DG  B P     1 
ATOM   4179 O  OP1   . DG  B 2 11  ? -15.640 24.077  6.545   1.00 129.77 ? 11  DG  B OP1   1 
ATOM   4180 O  OP2   . DG  B 2 11  ? -17.549 24.978  5.080   1.00 122.74 ? 11  DG  B OP2   1 
ATOM   4181 O  "O5'" . DG  B 2 11  ? -15.355 26.186  5.246   1.00 128.55 ? 11  DG  B "O5'" 1 
ATOM   4182 C  "C5'" . DG  B 2 11  ? -14.156 26.444  6.010   1.00 124.50 ? 11  DG  B "C5'" 1 
ATOM   4183 C  "C4'" . DG  B 2 11  ? -13.461 27.691  5.510   1.00 121.48 ? 11  DG  B "C4'" 1 
ATOM   4184 O  "O4'" . DG  B 2 11  ? -13.923 28.009  4.176   1.00 121.97 ? 11  DG  B "O4'" 1 
ATOM   4185 C  "C3'" . DG  B 2 11  ? -13.694 28.951  6.344   1.00 118.46 ? 11  DG  B "C3'" 1 
ATOM   4186 O  "O3'" . DG  B 2 11  ? -12.517 29.765  6.381   1.00 112.14 ? 11  DG  B "O3'" 1 
ATOM   4187 C  "C2'" . DG  B 2 11  ? -14.837 29.643  5.623   1.00 119.54 ? 11  DG  B "C2'" 1 
ATOM   4188 C  "C1'" . DG  B 2 11  ? -14.630 29.245  4.165   1.00 122.58 ? 11  DG  B "C1'" 1 
ATOM   4189 N  N9    . DG  B 2 11  ? -15.856 29.048  3.395   1.00 122.89 ? 11  DG  B N9    1 
ATOM   4190 C  C8    . DG  B 2 11  ? -17.027 28.481  3.838   1.00 121.45 ? 11  DG  B C8    1 
ATOM   4191 N  N7    . DG  B 2 11  ? -17.950 28.425  2.916   1.00 123.65 ? 11  DG  B N7    1 
ATOM   4192 C  C5    . DG  B 2 11  ? -17.350 28.982  1.794   1.00 126.67 ? 11  DG  B C5    1 
ATOM   4193 C  C6    . DG  B 2 11  ? -17.862 29.189  0.485   1.00 126.89 ? 11  DG  B C6    1 
ATOM   4194 O  O6    . DG  B 2 11  ? -18.984 28.913  0.042   1.00 121.33 ? 11  DG  B O6    1 
ATOM   4195 N  N1    . DG  B 2 11  ? -16.917 29.785  -0.346  1.00 126.86 ? 11  DG  B N1    1 
ATOM   4196 C  C2    . DG  B 2 11  ? -15.644 30.137  0.032   1.00 124.70 ? 11  DG  B C2    1 
ATOM   4197 N  N2    . DG  B 2 11  ? -14.881 30.703  -0.915  1.00 120.83 ? 11  DG  B N2    1 
ATOM   4198 N  N3    . DG  B 2 11  ? -15.154 29.947  1.249   1.00 126.43 ? 11  DG  B N3    1 
ATOM   4199 C  C4    . DG  B 2 11  ? -16.056 29.369  2.072   1.00 126.47 ? 11  DG  B C4    1 
ATOM   4200 P  P     . DA  B 2 14  ? -11.443 37.315  -1.533  1.00 128.17 ? 14  DA  B P     1 
ATOM   4201 O  OP1   . DA  B 2 14  ? -12.219 36.539  -0.528  1.00 121.30 ? 14  DA  B OP1   1 
ATOM   4202 O  OP2   . DA  B 2 14  ? -12.045 38.517  -2.163  1.00 126.22 ? 14  DA  B OP2   1 
ATOM   4203 O  "O5'" . DA  B 2 14  ? -11.000 36.331  -2.704  1.00 123.78 ? 14  DA  B "O5'" 1 
ATOM   4204 C  "C5'" . DA  B 2 14  ? -9.628  36.264  -3.140  1.00 126.11 ? 14  DA  B "C5'" 1 
ATOM   4205 C  "C4'" . DA  B 2 14  ? -8.746  35.730  -2.034  1.00 128.40 ? 14  DA  B "C4'" 1 
ATOM   4206 O  "O4'" . DA  B 2 14  ? -9.520  34.887  -1.145  1.00 133.15 ? 14  DA  B "O4'" 1 
ATOM   4207 C  "C3'" . DA  B 2 14  ? -7.573  34.870  -2.509  1.00 127.69 ? 14  DA  B "C3'" 1 
ATOM   4208 O  "O3'" . DA  B 2 14  ? -6.408  35.143  -1.722  1.00 123.42 ? 14  DA  B "O3'" 1 
ATOM   4209 C  "C2'" . DA  B 2 14  ? -8.062  33.454  -2.270  1.00 128.07 ? 14  DA  B "C2'" 1 
ATOM   4210 C  "C1'" . DA  B 2 14  ? -8.877  33.630  -1.006  1.00 130.90 ? 14  DA  B "C1'" 1 
ATOM   4211 N  N9    . DA  B 2 14  ? -9.907  32.617  -0.781  1.00 132.61 ? 14  DA  B N9    1 
ATOM   4212 C  C8    . DA  B 2 14  ? -10.914 32.220  -1.627  1.00 132.09 ? 14  DA  B C8    1 
ATOM   4213 N  N7    . DA  B 2 14  ? -11.684 31.283  -1.127  1.00 130.36 ? 14  DA  B N7    1 
ATOM   4214 C  C5    . DA  B 2 14  ? -11.150 31.050  0.133   1.00 133.13 ? 14  DA  B C5    1 
ATOM   4215 C  C6    . DA  B 2 14  ? -11.514 30.168  1.167   1.00 131.95 ? 14  DA  B C6    1 
ATOM   4216 N  N6    . DA  B 2 14  ? -12.542 29.320  1.093   1.00 130.16 ? 14  DA  B N6    1 
ATOM   4217 N  N1    . DA  B 2 14  ? -10.769 30.182  2.295   1.00 134.30 ? 14  DA  B N1    1 
ATOM   4218 C  C2    . DA  B 2 14  ? -9.734  31.029  2.370   1.00 135.15 ? 14  DA  B C2    1 
ATOM   4219 N  N3    . DA  B 2 14  ? -9.295  31.904  1.467   1.00 132.82 ? 14  DA  B N3    1 
ATOM   4220 C  C4    . DA  B 2 14  ? -10.054 31.862  0.357   1.00 133.58 ? 14  DA  B C4    1 
ATOM   4221 P  P     . DA  B 2 15  ? -4.982  34.562  -2.160  1.00 118.44 ? 15  DA  B P     1 
ATOM   4222 O  OP1   . DA  B 2 15  ? -3.933  35.497  -1.682  1.00 119.76 ? 15  DA  B OP1   1 
ATOM   4223 O  OP2   . DA  B 2 15  ? -5.049  34.194  -3.596  1.00 120.36 ? 15  DA  B OP2   1 
ATOM   4224 O  "O5'" . DA  B 2 15  ? -4.857  33.225  -1.310  1.00 109.82 ? 15  DA  B "O5'" 1 
ATOM   4225 C  "C5'" . DA  B 2 15  ? -3.586  32.576  -1.180  1.00 106.85 ? 15  DA  B "C5'" 1 
ATOM   4226 C  "C4'" . DA  B 2 15  ? -3.632  31.598  -0.033  1.00 104.44 ? 15  DA  B "C4'" 1 
ATOM   4227 O  "O4'" . DA  B 2 15  ? -4.999  31.183  0.187   1.00 101.44 ? 15  DA  B "O4'" 1 
ATOM   4228 C  "C3'" . DA  B 2 15  ? -2.852  30.312  -0.273  1.00 104.35 ? 15  DA  B "C3'" 1 
ATOM   4229 O  "O3'" . DA  B 2 15  ? -2.338  29.848  0.974   1.00 106.92 ? 15  DA  B "O3'" 1 
ATOM   4230 C  "C2'" . DA  B 2 15  ? -3.886  29.399  -0.906  1.00 101.39 ? 15  DA  B "C2'" 1 
ATOM   4231 C  "C1'" . DA  B 2 15  ? -5.207  29.866  -0.309  1.00 100.96 ? 15  DA  B "C1'" 1 
ATOM   4232 N  N9    . DA  B 2 15  ? -6.292  29.922  -1.287  1.00 98.22  ? 15  DA  B N9    1 
ATOM   4233 C  C8    . DA  B 2 15  ? -6.268  30.529  -2.518  1.00 96.65  ? 15  DA  B C8    1 
ATOM   4234 N  N7    . DA  B 2 15  ? -7.388  30.407  -3.188  1.00 94.31  ? 15  DA  B N7    1 
ATOM   4235 C  C5    . DA  B 2 15  ? -8.201  29.663  -2.346  1.00 92.71  ? 15  DA  B C5    1 
ATOM   4236 C  C6    . DA  B 2 15  ? -9.521  29.194  -2.477  1.00 91.65  ? 15  DA  B C6    1 
ATOM   4237 N  N6    . DA  B 2 15  ? -10.283 29.417  -3.549  1.00 90.35  ? 15  DA  B N6    1 
ATOM   4238 N  N1    . DA  B 2 15  ? -10.037 28.480  -1.453  1.00 93.39  ? 15  DA  B N1    1 
ATOM   4239 C  C2    . DA  B 2 15  ? -9.271  28.256  -0.376  1.00 96.87  ? 15  DA  B C2    1 
ATOM   4240 N  N3    . DA  B 2 15  ? -8.020  28.647  -0.136  1.00 97.35  ? 15  DA  B N3    1 
ATOM   4241 C  C4    . DA  B 2 15  ? -7.537  29.354  -1.173  1.00 96.18  ? 15  DA  B C4    1 
ATOM   4242 P  P     . DA  B 2 16  ? -1.866  28.337  1.139   1.00 113.41 ? 16  DA  B P     1 
ATOM   4243 O  OP1   . DA  B 2 16  ? -0.725  28.319  2.086   1.00 113.74 ? 16  DA  B OP1   1 
ATOM   4244 O  OP2   . DA  B 2 16  ? -1.710  27.740  -0.212  1.00 111.09 ? 16  DA  B OP2   1 
ATOM   4245 O  "O5'" . DA  B 2 16  ? -3.124  27.649  1.828   1.00 110.84 ? 16  DA  B "O5'" 1 
ATOM   4246 C  "C5'" . DA  B 2 16  ? -2.936  26.714  2.899   1.00 108.42 ? 16  DA  B "C5'" 1 
ATOM   4247 C  "C4'" . DA  B 2 16  ? -4.184  25.890  3.102   1.00 107.19 ? 16  DA  B "C4'" 1 
ATOM   4248 O  "O4'" . DA  B 2 16  ? -5.197  26.313  2.163   1.00 103.57 ? 16  DA  B "O4'" 1 
ATOM   4249 C  "C3'" . DA  B 2 16  ? -3.991  24.386  2.894   1.00 109.57 ? 16  DA  B "C3'" 1 
ATOM   4250 O  "O3'" . DA  B 2 16  ? -4.440  23.667  4.044   1.00 117.25 ? 16  DA  B "O3'" 1 
ATOM   4251 C  "C2'" . DA  B 2 16  ? -4.804  24.067  1.651   1.00 108.08 ? 16  DA  B "C2'" 1 
ATOM   4252 C  "C1'" . DA  B 2 16  ? -5.824  25.185  1.586   1.00 106.37 ? 16  DA  B "C1'" 1 
ATOM   4253 N  N9    . DA  B 2 16  ? -6.218  25.545  0.225   1.00 104.63 ? 16  DA  B N9    1 
ATOM   4254 C  C8    . DA  B 2 16  ? -5.454  26.183  -0.720  1.00 102.87 ? 16  DA  B C8    1 
ATOM   4255 N  N7    . DA  B 2 16  ? -6.073  26.372  -1.860  1.00 101.28 ? 16  DA  B N7    1 
ATOM   4256 C  C5    . DA  B 2 16  ? -7.328  25.818  -1.654  1.00 100.99 ? 16  DA  B C5    1 
ATOM   4257 C  C6    . DA  B 2 16  ? -8.459  25.699  -2.482  1.00 96.81  ? 16  DA  B C6    1 
ATOM   4258 N  N6    . DA  B 2 16  ? -8.506  26.147  -3.738  1.00 93.03  ? 16  DA  B N6    1 
ATOM   4259 N  N1    . DA  B 2 16  ? -9.554  25.098  -1.968  1.00 95.89  ? 16  DA  B N1    1 
ATOM   4260 C  C2    . DA  B 2 16  ? -9.505  24.646  -0.707  1.00 95.97  ? 16  DA  B C2    1 
ATOM   4261 N  N3    . DA  B 2 16  ? -8.502  24.698  0.168   1.00 99.03  ? 16  DA  B N3    1 
ATOM   4262 C  C4    . DA  B 2 16  ? -7.432  25.306  -0.373  1.00 102.43 ? 16  DA  B C4    1 
ATOM   4263 P  P     . DT  B 2 17  ? -3.969  22.160  4.287   1.00 127.17 ? 17  DT  B P     1 
ATOM   4264 O  OP1   . DT  B 2 17  ? -3.933  21.924  5.753   1.00 126.84 ? 17  DT  B OP1   1 
ATOM   4265 O  OP2   . DT  B 2 17  ? -2.748  21.914  3.477   1.00 120.39 ? 17  DT  B OP2   1 
ATOM   4266 O  "O5'" . DT  B 2 17  ? -5.167  21.313  3.664   1.00 127.87 ? 17  DT  B "O5'" 1 
ATOM   4267 C  "C5'" . DT  B 2 17  ? -6.523  21.482  4.127   1.00 129.28 ? 17  DT  B "C5'" 1 
ATOM   4268 C  "C4'" . DT  B 2 17  ? -7.483  20.713  3.250   1.00 128.47 ? 17  DT  B "C4'" 1 
ATOM   4269 O  "O4'" . DT  B 2 17  ? -7.878  21.530  2.130   1.00 129.46 ? 17  DT  B "O4'" 1 
ATOM   4270 C  "C3'" . DT  B 2 17  ? -6.915  19.440  2.624   1.00 127.79 ? 17  DT  B "C3'" 1 
ATOM   4271 O  "O3'" . DT  B 2 17  ? -6.993  18.322  3.521   1.00 125.21 ? 17  DT  B "O3'" 1 
ATOM   4272 C  "C2'" . DT  B 2 17  ? -7.692  19.307  1.322   1.00 130.22 ? 17  DT  B "C2'" 1 
ATOM   4273 C  "C1'" . DT  B 2 17  ? -8.302  20.684  1.069   1.00 131.26 ? 17  DT  B "C1'" 1 
ATOM   4274 N  N1    . DT  B 2 17  ? -7.874  21.297  -0.203  1.00 131.16 ? 17  DT  B N1    1 
ATOM   4275 C  C2    . DT  B 2 17  ? -8.820  21.527  -1.178  1.00 127.83 ? 17  DT  B C2    1 
ATOM   4276 O  O2    . DT  B 2 17  ? -10.003 21.262  -1.037  1.00 126.17 ? 17  DT  B O2    1 
ATOM   4277 N  N3    . DT  B 2 17  ? -8.330  22.097  -2.327  1.00 128.34 ? 17  DT  B N3    1 
ATOM   4278 C  C4    . DT  B 2 17  ? -7.018  22.441  -2.594  1.00 127.07 ? 17  DT  B C4    1 
ATOM   4279 O  O4    . DT  B 2 17  ? -6.727  22.946  -3.675  1.00 124.35 ? 17  DT  B O4    1 
ATOM   4280 C  C5    . DT  B 2 17  ? -6.078  22.162  -1.532  1.00 127.02 ? 17  DT  B C5    1 
ATOM   4281 C  C7    . DT  B 2 17  ? -4.634  22.499  -1.732  1.00 123.07 ? 17  DT  B C7    1 
ATOM   4282 C  C6    . DT  B 2 17  ? -6.547  21.610  -0.406  1.00 130.50 ? 17  DT  B C6    1 
ATOM   4283 P  P     . DT  B 2 18  ? -8.326  17.435  3.637   1.00 128.37 ? 18  DT  B P     1 
ATOM   4284 O  OP1   . DT  B 2 18  ? -9.498  18.345  3.572   1.00 127.23 ? 18  DT  B OP1   1 
ATOM   4285 O  OP2   . DT  B 2 18  ? -8.171  16.527  4.803   1.00 129.94 ? 18  DT  B OP2   1 
ATOM   4286 O  "O5'" . DT  B 2 18  ? -8.276  16.534  2.324   1.00 126.96 ? 18  DT  B "O5'" 1 
ATOM   4287 C  "C5'" . DT  B 2 18  ? -9.224  15.471  2.116   1.00 126.78 ? 18  DT  B "C5'" 1 
ATOM   4288 C  "C4'" . DT  B 2 18  ? -10.197 15.825  1.013   1.00 128.13 ? 18  DT  B "C4'" 1 
ATOM   4289 O  "O4'" . DT  B 2 18  ? -9.694  16.927  0.221   1.00 132.31 ? 18  DT  B "O4'" 1 
ATOM   4290 C  "C3'" . DT  B 2 18  ? -10.478 14.685  0.025   1.00 128.90 ? 18  DT  B "C3'" 1 
ATOM   4291 O  "O3'" . DT  B 2 18  ? -11.764 14.082  0.260   1.00 123.61 ? 18  DT  B "O3'" 1 
ATOM   4292 C  "C2'" . DT  B 2 18  ? -10.252 15.301  -1.351  1.00 132.38 ? 18  DT  B "C2'" 1 
ATOM   4293 C  "C1'" . DT  B 2 18  ? -10.198 16.797  -1.095  1.00 132.20 ? 18  DT  B "C1'" 1 
ATOM   4294 N  N1    . DT  B 2 18  ? -9.317  17.563  -2.014  1.00 128.24 ? 18  DT  B N1    1 
ATOM   4295 C  C2    . DT  B 2 18  ? -9.868  18.066  -3.173  1.00 122.10 ? 18  DT  B C2    1 
ATOM   4296 O  O2    . DT  B 2 18  ? -11.040 17.913  -3.477  1.00 119.43 ? 18  DT  B O2    1 
ATOM   4297 N  N3    . DT  B 2 18  ? -8.992  18.763  -3.968  1.00 117.80 ? 18  DT  B N3    1 
ATOM   4298 C  C4    . DT  B 2 18  ? -7.651  18.998  -3.727  1.00 120.48 ? 18  DT  B C4    1 
ATOM   4299 O  O4    . DT  B 2 18  ? -6.988  19.641  -4.536  1.00 117.94 ? 18  DT  B O4    1 
ATOM   4300 C  C5    . DT  B 2 18  ? -7.140  18.442  -2.493  1.00 120.05 ? 18  DT  B C5    1 
ATOM   4301 C  C7    . DT  B 2 18  ? -5.698  18.644  -2.148  1.00 114.84 ? 18  DT  B C7    1 
ATOM   4302 C  C6    . DT  B 2 18  ? -7.986  17.759  -1.711  1.00 124.58 ? 18  DT  B C6    1 
ATOM   4303 P  P     . DC  B 2 19  ? -13.122 14.754  -0.279  1.00 118.30 ? 19  DC  B P     1 
ATOM   4304 O  OP1   . DC  B 2 19  ? -12.997 16.225  -0.146  1.00 117.06 ? 19  DC  B OP1   1 
ATOM   4305 O  OP2   . DC  B 2 19  ? -14.262 14.067  0.378   1.00 115.11 ? 19  DC  B OP2   1 
ATOM   4306 O  "O5'" . DC  B 2 19  ? -13.139 14.341  -1.819  1.00 120.84 ? 19  DC  B "O5'" 1 
ATOM   4307 C  "C5'" . DC  B 2 19  ? -14.031 14.968  -2.767  1.00 120.67 ? 19  DC  B "C5'" 1 
ATOM   4308 C  "C4'" . DC  B 2 19  ? -13.628 14.641  -4.188  1.00 120.87 ? 19  DC  B "C4'" 1 
ATOM   4309 O  "O4'" . DC  B 2 19  ? -12.479 15.429  -4.561  1.00 114.58 ? 19  DC  B "O4'" 1 
ATOM   4310 C  "C3'" . DC  B 2 19  ? -13.209 13.188  -4.436  1.00 120.20 ? 19  DC  B "C3'" 1 
ATOM   4311 O  "O3'" . DC  B 2 19  ? -14.285 12.273  -4.741  1.00 124.99 ? 19  DC  B "O3'" 1 
ATOM   4312 C  "C2'" . DC  B 2 19  ? -12.133 13.293  -5.509  1.00 114.04 ? 19  DC  B "C2'" 1 
ATOM   4313 C  "C1'" . DC  B 2 19  ? -11.825 14.784  -5.640  1.00 109.01 ? 19  DC  B "C1'" 1 
ATOM   4314 N  N1    . DC  B 2 19  ? -10.394 15.124  -5.569  1.00 101.49 ? 19  DC  B N1    1 
ATOM   4315 C  C2    . DC  B 2 19  ? -9.832  15.903  -6.584  1.00 95.37  ? 19  DC  B C2    1 
ATOM   4316 O  O2    . DC  B 2 19  ? -10.552 16.278  -7.522  1.00 87.39  ? 19  DC  B O2    1 
ATOM   4317 N  N3    . DC  B 2 19  ? -8.519  16.224  -6.522  1.00 94.37  ? 19  DC  B N3    1 
ATOM   4318 C  C4    . DC  B 2 19  ? -7.777  15.800  -5.496  1.00 94.83  ? 19  DC  B C4    1 
ATOM   4319 N  N4    . DC  B 2 19  ? -6.486  16.141  -5.474  1.00 90.84  ? 19  DC  B N4    1 
ATOM   4320 C  C5    . DC  B 2 19  ? -8.325  15.007  -4.446  1.00 97.53  ? 19  DC  B C5    1 
ATOM   4321 C  C6    . DC  B 2 19  ? -9.626  14.696  -4.522  1.00 100.32 ? 19  DC  B C6    1 
ATOM   4322 P  P     . DT  B 2 20  ? -15.282 12.479  -6.004  1.00 125.31 ? 20  DT  B P     1 
ATOM   4323 O  OP1   . DT  B 2 20  ? -16.049 13.735  -5.798  1.00 119.38 ? 20  DT  B OP1   1 
ATOM   4324 O  OP2   . DT  B 2 20  ? -16.012 11.201  -6.219  1.00 119.19 ? 20  DT  B OP2   1 
ATOM   4325 O  "O5'" . DT  B 2 20  ? -14.300 12.680  -7.242  1.00 129.37 ? 20  DT  B "O5'" 1 
ATOM   4326 C  "C5'" . DT  B 2 20  ? -14.267 11.744  -8.337  1.00 126.56 ? 20  DT  B "C5'" 1 
ATOM   4327 C  "C4'" . DT  B 2 20  ? -13.474 12.325  -9.484  1.00 124.88 ? 20  DT  B "C4'" 1 
ATOM   4328 O  "O4'" . DT  B 2 20  ? -12.460 13.218  -8.975  1.00 120.03 ? 20  DT  B "O4'" 1 
ATOM   4329 C  "C3'" . DT  B 2 20  ? -12.714 11.309  -10.329 1.00 125.66 ? 20  DT  B "C3'" 1 
ATOM   4330 O  "O3'" . DT  B 2 20  ? -13.585 10.763  -11.329 1.00 134.40 ? 20  DT  B "O3'" 1 
ATOM   4331 C  "C2'" . DT  B 2 20  ? -11.570 12.135  -10.891 1.00 122.27 ? 20  DT  B "C2'" 1 
ATOM   4332 C  "C1'" . DT  B 2 20  ? -11.343 13.230  -9.856  1.00 117.47 ? 20  DT  B "C1'" 1 
ATOM   4333 N  N1    . DT  B 2 20  ? -10.117 13.063  -9.050  1.00 113.76 ? 20  DT  B N1    1 
ATOM   4334 C  C2    . DT  B 2 20  ? -8.974  13.696  -9.482  1.00 109.04 ? 20  DT  B C2    1 
ATOM   4335 O  O2    . DT  B 2 20  ? -8.930  14.378  -10.491 1.00 103.27 ? 20  DT  B O2    1 
ATOM   4336 N  N3    . DT  B 2 20  ? -7.875  13.500  -8.683  1.00 107.37 ? 20  DT  B N3    1 
ATOM   4337 C  C4    . DT  B 2 20  ? -7.808  12.750  -7.524  1.00 109.05 ? 20  DT  B C4    1 
ATOM   4338 O  O4    . DT  B 2 20  ? -6.749  12.668  -6.910  1.00 108.98 ? 20  DT  B O4    1 
ATOM   4339 C  C5    . DT  B 2 20  ? -9.043  12.107  -7.134  1.00 109.39 ? 20  DT  B C5    1 
ATOM   4340 C  C7    . DT  B 2 20  ? -9.063  11.267  -5.896  1.00 108.02 ? 20  DT  B C7    1 
ATOM   4341 C  C6    . DT  B 2 20  ? -10.120 12.291  -7.907  1.00 111.79 ? 20  DT  B C6    1 
ATOM   4342 P  P     . DA  B 2 21  ? -12.991 10.003  -12.615 1.00 143.37 ? 21  DA  B P     1 
ATOM   4343 O  OP1   . DA  B 2 21  ? -14.012 10.055  -13.692 1.00 144.78 ? 21  DA  B OP1   1 
ATOM   4344 O  OP2   . DA  B 2 21  ? -12.467 8.688   -12.164 1.00 140.83 ? 21  DA  B OP2   1 
ATOM   4345 O  "O5'" . DA  B 2 21  ? -11.751 10.915  -13.028 1.00 147.78 ? 21  DA  B "O5'" 1 
ATOM   4346 C  "C5'" . DA  B 2 21  ? -11.600 11.514  -14.331 1.00 141.98 ? 21  DA  B "C5'" 1 
ATOM   4347 C  "C4'" . DA  B 2 21  ? -10.203 11.237  -14.831 1.00 140.36 ? 21  DA  B "C4'" 1 
ATOM   4348 O  "O4'" . DA  B 2 21  ? -9.260  11.536  -13.769 1.00 137.38 ? 21  DA  B "O4'" 1 
ATOM   4349 C  "C3'" . DA  B 2 21  ? -9.978  9.764   -15.197 1.00 141.35 ? 21  DA  B "C3'" 1 
ATOM   4350 O  "O3'" . DA  B 2 21  ? -9.130  9.471   -16.322 1.00 143.54 ? 21  DA  B "O3'" 1 
ATOM   4351 C  "C2'" . DA  B 2 21  ? -9.285  9.212   -13.963 1.00 139.86 ? 21  DA  B "C2'" 1 
ATOM   4352 C  "C1'" . DA  B 2 21  ? -8.435  10.403  -13.565 1.00 136.48 ? 21  DA  B "C1'" 1 
ATOM   4353 N  N9    . DA  B 2 21  ? -7.929  10.433  -12.193 1.00 130.77 ? 21  DA  B N9    1 
ATOM   4354 C  C8    . DA  B 2 21  ? -8.404  9.788   -11.077 1.00 128.24 ? 21  DA  B C8    1 
ATOM   4355 N  N7    . DA  B 2 21  ? -7.686  9.998   -10.000 1.00 124.90 ? 21  DA  B N7    1 
ATOM   4356 C  C5    . DA  B 2 21  ? -6.658  10.820  -10.440 1.00 125.92 ? 21  DA  B C5    1 
ATOM   4357 C  C6    . DA  B 2 21  ? -5.560  11.398  -9.779  1.00 123.40 ? 21  DA  B C6    1 
ATOM   4358 N  N6    . DA  B 2 21  ? -5.303  11.228  -8.481  1.00 121.51 ? 21  DA  B N6    1 
ATOM   4359 N  N1    . DA  B 2 21  ? -4.721  12.167  -10.509 1.00 123.36 ? 21  DA  B N1    1 
ATOM   4360 C  C2    . DA  B 2 21  ? -4.978  12.337  -11.813 1.00 121.78 ? 21  DA  B C2    1 
ATOM   4361 N  N3    . DA  B 2 21  ? -5.976  11.846  -12.545 1.00 126.94 ? 21  DA  B N3    1 
ATOM   4362 C  C4    . DA  B 2 21  ? -6.791  11.089  -11.790 1.00 129.20 ? 21  DA  B C4    1 
ATOM   4363 P  P     . DC  B 2 22  ? -9.059  10.408  -17.635 1.00 144.13 ? 22  DC  B P     1 
ATOM   4364 O  OP1   . DC  B 2 22  ? -9.987  11.554  -17.458 1.00 136.97 ? 22  DC  B OP1   1 
ATOM   4365 O  OP2   . DC  B 2 22  ? -9.225  9.532   -18.823 1.00 136.83 ? 22  DC  B OP2   1 
ATOM   4366 O  "O5'" . DC  B 2 22  ? -7.541  10.909  -17.623 1.00 146.96 ? 22  DC  B "O5'" 1 
ATOM   4367 C  "C5'" . DC  B 2 22  ? -6.770  10.908  -16.399 1.00 143.89 ? 22  DC  B "C5'" 1 
ATOM   4368 C  "C4'" . DC  B 2 22  ? -5.317  10.563  -16.632 1.00 142.14 ? 22  DC  B "C4'" 1 
ATOM   4369 O  "O4'" . DC  B 2 22  ? -4.563  10.854  -15.431 1.00 138.48 ? 22  DC  B "O4'" 1 
ATOM   4370 C  "C3'" . DC  B 2 22  ? -5.029  9.091   -16.904 1.00 144.89 ? 22  DC  B "C3'" 1 
ATOM   4371 O  "O3'" . DC  B 2 22  ? -5.170  8.722   -18.275 1.00 153.55 ? 22  DC  B "O3'" 1 
ATOM   4372 C  "C2'" . DC  B 2 22  ? -3.584  8.964   -16.465 1.00 141.90 ? 22  DC  B "C2'" 1 
ATOM   4373 C  "C1'" . DC  B 2 22  ? -3.549  9.863   -15.241 1.00 139.71 ? 22  DC  B "C1'" 1 
ATOM   4374 N  N1    . DC  B 2 22  ? -3.831  9.139   -13.987 1.00 139.08 ? 22  DC  B N1    1 
ATOM   4375 C  C2    . DC  B 2 22  ? -2.753  8.691   -13.216 1.00 139.96 ? 22  DC  B C2    1 
ATOM   4376 O  O2    . DC  B 2 22  ? -1.600  8.951   -13.589 1.00 140.42 ? 22  DC  B O2    1 
ATOM   4377 N  N3    . DC  B 2 22  ? -2.996  8.016   -12.068 1.00 138.23 ? 22  DC  B N3    1 
ATOM   4378 C  C4    . DC  B 2 22  ? -4.252  7.760   -11.698 1.00 135.99 ? 22  DC  B C4    1 
ATOM   4379 N  N4    . DC  B 2 22  ? -4.444  7.088   -10.561 1.00 133.58 ? 22  DC  B N4    1 
ATOM   4380 C  C5    . DC  B 2 22  ? -5.368  8.183   -12.478 1.00 137.10 ? 22  DC  B C5    1 
ATOM   4381 C  C6    . DC  B 2 22  ? -5.114  8.856   -13.608 1.00 137.21 ? 22  DC  B C6    1 
ATOM   4382 P  P     . DC  B 2 23  ? -4.994  7.186   -18.710 1.00 159.27 ? 23  DC  B P     1 
ATOM   4383 O  OP1   . DC  B 2 23  ? -6.088  6.849   -19.657 1.00 160.22 ? 23  DC  B OP1   1 
ATOM   4384 O  OP2   . DC  B 2 23  ? -4.821  6.372   -17.479 1.00 161.46 ? 23  DC  B OP2   1 
ATOM   4385 O  "O5'" . DC  B 2 23  ? -3.607  7.178   -19.501 1.00 146.80 ? 23  DC  B "O5'" 1 
ATOM   4386 C  "C5'" . DC  B 2 23  ? -3.031  8.366   -20.090 1.00 134.94 ? 23  DC  B "C5'" 1 
ATOM   4387 C  "C4'" . DC  B 2 23  ? -4.103  9.249   -20.685 1.00 127.57 ? 23  DC  B "C4'" 1 
ATOM   4388 O  "O4'" . DC  B 2 23  ? -3.765  10.632  -20.504 1.00 125.18 ? 23  DC  B "O4'" 1 
ATOM   4389 C  "C3'" . DC  B 2 23  ? -4.351  9.094   -22.183 1.00 121.28 ? 23  DC  B "C3'" 1 
ATOM   4390 O  "O3'" . DC  B 2 23  ? -5.310  8.035   -22.329 1.00 116.56 ? 23  DC  B "O3'" 1 
ATOM   4391 C  "C2'" . DC  B 2 23  ? -4.812  10.485  -22.609 1.00 121.04 ? 23  DC  B "C2'" 1 
ATOM   4392 C  "C1'" . DC  B 2 23  ? -4.599  11.368  -21.375 1.00 125.90 ? 23  DC  B "C1'" 1 
ATOM   4393 N  N1    . DC  B 2 23  ? -3.961  12.675  -21.611 1.00 129.10 ? 23  DC  B N1    1 
ATOM   4394 C  C2    . DC  B 2 23  ? -4.676  13.662  -22.302 1.00 128.11 ? 23  DC  B C2    1 
ATOM   4395 O  O2    . DC  B 2 23  ? -5.815  13.399  -22.717 1.00 126.13 ? 23  DC  B O2    1 
ATOM   4396 N  N3    . DC  B 2 23  ? -4.102  14.871  -22.509 1.00 124.49 ? 23  DC  B N3    1 
ATOM   4397 C  C4    . DC  B 2 23  ? -2.873  15.114  -22.044 1.00 124.88 ? 23  DC  B C4    1 
ATOM   4398 N  N4    . DC  B 2 23  ? -2.347  16.321  -22.269 1.00 121.80 ? 23  DC  B N4    1 
ATOM   4399 C  C5    . DC  B 2 23  ? -2.129  14.131  -21.328 1.00 123.12 ? 23  DC  B C5    1 
ATOM   4400 C  C6    . DC  B 2 23  ? -2.708  12.939  -21.131 1.00 124.25 ? 23  DC  B C6    1 
ATOM   4401 P  P     . DG  B 2 24  ? -6.042  7.749   -23.727 1.00 115.70 ? 24  DG  B P     1 
ATOM   4402 O  OP1   . DG  B 2 24  ? -7.165  8.717   -23.859 1.00 111.30 ? 24  DG  B OP1   1 
ATOM   4403 O  OP2   . DG  B 2 24  ? -6.321  6.290   -23.813 1.00 113.71 ? 24  DG  B OP2   1 
ATOM   4404 O  "O5'" . DG  B 2 24  ? -4.912  8.063   -24.805 1.00 99.35  ? 24  DG  B "O5'" 1 
ATOM   4405 C  "C5'" . DG  B 2 24  ? -5.180  7.949   -26.216 1.00 76.95  ? 24  DG  B "C5'" 1 
ATOM   4406 C  "C4'" . DG  B 2 24  ? -6.223  8.960   -26.634 1.00 64.45  ? 24  DG  B "C4'" 1 
ATOM   4407 O  "O4'" . DG  B 2 24  ? -5.677  9.817   -27.663 1.00 59.60  ? 24  DG  B "O4'" 1 
ATOM   4408 C  "C3'" . DG  B 2 24  ? -7.479  8.352   -27.246 1.00 55.57  ? 24  DG  B "C3'" 1 
ATOM   4409 O  "O3'" . DG  B 2 24  ? -8.568  9.241   -27.012 1.00 43.23  ? 24  DG  B "O3'" 1 
ATOM   4410 C  "C2'" . DG  B 2 24  ? -7.116  8.276   -28.714 1.00 56.25  ? 24  DG  B "C2'" 1 
ATOM   4411 C  "C1'" . DG  B 2 24  ? -6.365  9.591   -28.884 1.00 58.87  ? 24  DG  B "C1'" 1 
ATOM   4412 N  N9    . DG  B 2 24  ? -5.388  9.640   -29.966 1.00 58.55  ? 24  DG  B N9    1 
ATOM   4413 C  C8    . DG  B 2 24  ? -5.264  10.629  -30.912 1.00 61.16  ? 24  DG  B C8    1 
ATOM   4414 N  N7    . DG  B 2 24  ? -4.295  10.409  -31.758 1.00 59.48  ? 24  DG  B N7    1 
ATOM   4415 C  C5    . DG  B 2 24  ? -3.744  9.206   -31.343 1.00 57.84  ? 24  DG  B C5    1 
ATOM   4416 C  C6    . DG  B 2 24  ? -2.662  8.462   -31.874 1.00 58.99  ? 24  DG  B C6    1 
ATOM   4417 O  O6    . DG  B 2 24  ? -1.952  8.725   -32.849 1.00 58.81  ? 24  DG  B O6    1 
ATOM   4418 N  N1    . DG  B 2 24  ? -2.436  7.298   -31.148 1.00 63.67  ? 24  DG  B N1    1 
ATOM   4419 C  C2    . DG  B 2 24  ? -3.159  6.899   -30.052 1.00 67.26  ? 24  DG  B C2    1 
ATOM   4420 N  N2    . DG  B 2 24  ? -2.786  5.743   -29.486 1.00 74.75  ? 24  DG  B N2    1 
ATOM   4421 N  N3    . DG  B 2 24  ? -4.170  7.585   -29.543 1.00 65.44  ? 24  DG  B N3    1 
ATOM   4422 C  C4    . DG  B 2 24  ? -4.405  8.721   -30.234 1.00 61.22  ? 24  DG  B C4    1 
ATOM   4423 P  P     . DG  B 2 25  ? -10.012 8.839   -27.484 1.00 41.07  ? 25  DG  B P     1 
ATOM   4424 O  OP1   . DG  B 2 25  ? -10.984 9.641   -26.722 1.00 39.40  ? 25  DG  B OP1   1 
ATOM   4425 O  OP2   . DG  B 2 25  ? -10.101 7.356   -27.473 1.00 47.15  ? 25  DG  B OP2   1 
ATOM   4426 O  "O5'" . DG  B 2 25  ? -10.031 9.283   -29.015 1.00 43.97  ? 25  DG  B "O5'" 1 
ATOM   4427 C  "C5'" . DG  B 2 25  ? -10.042 10.677  -29.371 1.00 40.22  ? 25  DG  B "C5'" 1 
ATOM   4428 C  "C4'" . DG  B 2 25  ? -9.886  10.861  -30.861 1.00 36.90  ? 25  DG  B "C4'" 1 
ATOM   4429 O  "O4'" . DG  B 2 25  ? -8.570  10.472  -31.270 1.00 36.92  ? 25  DG  B "O4'" 1 
ATOM   4430 C  "C3'" . DG  B 2 25  ? -10.817 10.033  -31.728 1.00 35.55  ? 25  DG  B "C3'" 1 
ATOM   4431 O  "O3'" . DG  B 2 25  ? -12.056 10.737  -31.762 1.00 34.18  ? 25  DG  B "O3'" 1 
ATOM   4432 C  "C2'" . DG  B 2 25  ? -10.059 9.953   -33.043 1.00 34.72  ? 25  DG  B "C2'" 1 
ATOM   4433 C  "C1'" . DG  B 2 25  ? -8.591  10.123  -32.645 1.00 35.95  ? 25  DG  B "C1'" 1 
ATOM   4434 N  N9    . DG  B 2 25  ? -7.753  8.941   -32.796 1.00 40.30  ? 25  DG  B N9    1 
ATOM   4435 C  C8    . DG  B 2 25  ? -7.868  7.753   -32.112 1.00 40.03  ? 25  DG  B C8    1 
ATOM   4436 N  N7    . DG  B 2 25  ? -6.948  6.885   -32.436 1.00 38.88  ? 25  DG  B N7    1 
ATOM   4437 C  C5    . DG  B 2 25  ? -6.168  7.547   -33.374 1.00 42.65  ? 25  DG  B C5    1 
ATOM   4438 C  C6    . DG  B 2 25  ? -5.017  7.113   -34.080 1.00 45.55  ? 25  DG  B C6    1 
ATOM   4439 O  O6    . DG  B 2 25  ? -4.442  6.021   -34.020 1.00 49.72  ? 25  DG  B O6    1 
ATOM   4440 N  N1    . DG  B 2 25  ? -4.544  8.098   -34.940 1.00 47.07  ? 25  DG  B N1    1 
ATOM   4441 C  C2    . DG  B 2 25  ? -5.097  9.348   -35.089 1.00 51.17  ? 25  DG  B C2    1 
ATOM   4442 N  N2    . DG  B 2 25  ? -4.490  10.165  -35.966 1.00 54.32  ? 25  DG  B N2    1 
ATOM   4443 N  N3    . DG  B 2 25  ? -6.168  9.765   -34.433 1.00 43.98  ? 25  DG  B N3    1 
ATOM   4444 C  C4    . DG  B 2 25  ? -6.641  8.824   -33.592 1.00 42.02  ? 25  DG  B C4    1 
ATOM   4445 P  P     . DT  B 2 26  ? -13.308 10.087  -32.444 1.00 36.01  ? 26  DT  B P     1 
ATOM   4446 O  OP1   . DT  B 2 26  ? -14.517 10.863  -32.050 1.00 31.03  ? 26  DT  B OP1   1 
ATOM   4447 O  OP2   . DT  B 2 26  ? -13.269 8.633   -32.194 1.00 35.52  ? 26  DT  B OP2   1 
ATOM   4448 O  "O5'" . DT  B 2 26  ? -13.008 10.402  -33.969 1.00 33.78  ? 26  DT  B "O5'" 1 
ATOM   4449 C  "C5'" . DT  B 2 26  ? -13.263 9.478   -34.998 1.00 33.03  ? 26  DT  B "C5'" 1 
ATOM   4450 C  "C4'" . DT  B 2 26  ? -12.619 10.009  -36.251 1.00 33.83  ? 26  DT  B "C4'" 1 
ATOM   4451 O  "O4'" . DT  B 2 26  ? -11.191 10.018  -36.092 1.00 33.85  ? 26  DT  B "O4'" 1 
ATOM   4452 C  "C3'" . DT  B 2 26  ? -12.891 9.169   -37.487 1.00 34.22  ? 26  DT  B "C3'" 1 
ATOM   4453 O  "O3'" . DT  B 2 26  ? -14.055 9.737   -38.093 1.00 36.73  ? 26  DT  B "O3'" 1 
ATOM   4454 C  "C2'" . DT  B 2 26  ? -11.647 9.380   -38.328 1.00 33.74  ? 26  DT  B "C2'" 1 
ATOM   4455 C  "C1'" . DT  B 2 26  ? -10.562 9.819   -37.346 1.00 36.47  ? 26  DT  B "C1'" 1 
ATOM   4456 N  N1    . DT  B 2 26  ? -9.461  8.844   -37.160 1.00 41.02  ? 26  DT  B N1    1 
ATOM   4457 C  C2    . DT  B 2 26  ? -8.250  9.114   -37.756 1.00 43.30  ? 26  DT  B C2    1 
ATOM   4458 O  O2    . DT  B 2 26  ? -8.046  10.114  -38.420 1.00 43.99  ? 26  DT  B O2    1 
ATOM   4459 N  N3    . DT  B 2 26  ? -7.284  8.158   -37.554 1.00 46.09  ? 26  DT  B N3    1 
ATOM   4460 C  C4    . DT  B 2 26  ? -7.408  6.987   -36.829 1.00 47.89  ? 26  DT  B C4    1 
ATOM   4461 O  O4    . DT  B 2 26  ? -6.454  6.220   -36.737 1.00 54.20  ? 26  DT  B O4    1 
ATOM   4462 C  C5    . DT  B 2 26  ? -8.708  6.765   -36.236 1.00 47.71  ? 26  DT  B C5    1 
ATOM   4463 C  C7    . DT  B 2 26  ? -8.938  5.519   -35.440 1.00 46.50  ? 26  DT  B C7    1 
ATOM   4464 C  C6    . DT  B 2 26  ? -9.659  7.689   -36.435 1.00 43.02  ? 26  DT  B C6    1 
ATOM   4465 P  P     . DG  B 2 27  ? -15.443 8.944   -38.132 1.00 35.85  ? 27  DG  B P     1 
ATOM   4466 O  OP1   . DG  B 2 27  ? -16.497 9.904   -38.521 1.00 38.82  ? 27  DG  B OP1   1 
ATOM   4467 O  OP2   . DG  B 2 27  ? -15.576 8.152   -36.890 1.00 45.47  ? 27  DG  B OP2   1 
ATOM   4468 O  "O5'" . DG  B 2 27  ? -15.252 7.930   -39.343 1.00 31.01  ? 27  DG  B "O5'" 1 
ATOM   4469 C  "C5'" . DG  B 2 27  ? -14.843 8.411   -40.621 1.00 27.59  ? 27  DG  B "C5'" 1 
ATOM   4470 C  "C4'" . DG  B 2 27  ? -15.244 7.416   -41.679 1.00 28.74  ? 27  DG  B "C4'" 1 
ATOM   4471 O  "O4'" . DG  B 2 27  ? -14.455 6.211   -41.525 1.00 27.48  ? 27  DG  B "O4'" 1 
ATOM   4472 C  "C3'" . DG  B 2 27  ? -16.707 6.974   -41.634 1.00 27.92  ? 27  DG  B "C3'" 1 
ATOM   4473 O  "O3'" . DG  B 2 27  ? -17.117 6.724   -42.972 1.00 30.11  ? 27  DG  B "O3'" 1 
ATOM   4474 C  "C2'" . DG  B 2 27  ? -16.654 5.687   -40.840 1.00 27.98  ? 27  DG  B "C2'" 1 
ATOM   4475 C  "C1'" . DG  B 2 27  ? -15.300 5.113   -41.236 1.00 28.67  ? 27  DG  B "C1'" 1 
ATOM   4476 N  N9    . DG  B 2 27  ? -14.647 4.320   -40.203 1.00 29.94  ? 27  DG  B N9    1 
ATOM   4477 C  C8    . DG  B 2 27  ? -14.724 4.495   -38.841 1.00 28.90  ? 27  DG  B C8    1 
ATOM   4478 N  N7    . DG  B 2 27  ? -14.012 3.627   -38.175 1.00 29.35  ? 27  DG  B N7    1 
ATOM   4479 C  C5    . DG  B 2 27  ? -13.442 2.825   -39.154 1.00 30.09  ? 27  DG  B C5    1 
ATOM   4480 C  C6    . DG  B 2 27  ? -12.573 1.709   -39.037 1.00 29.89  ? 27  DG  B C6    1 
ATOM   4481 O  O6    . DG  B 2 27  ? -12.115 1.197   -38.011 1.00 34.16  ? 27  DG  B O6    1 
ATOM   4482 N  N1    . DG  B 2 27  ? -12.228 1.194   -40.283 1.00 27.94  ? 27  DG  B N1    1 
ATOM   4483 C  C2    . DG  B 2 27  ? -12.677 1.680   -41.489 1.00 28.65  ? 27  DG  B C2    1 
ATOM   4484 N  N2    . DG  B 2 27  ? -12.233 1.048   -42.588 1.00 27.23  ? 27  DG  B N2    1 
ATOM   4485 N  N3    . DG  B 2 27  ? -13.490 2.720   -41.611 1.00 27.33  ? 27  DG  B N3    1 
ATOM   4486 C  C4    . DG  B 2 27  ? -13.832 3.236   -40.411 1.00 27.67  ? 27  DG  B C4    1 
ATOM   4487 P  P     . DC  B 2 28  ? -18.651 6.439   -43.352 1.00 30.32  ? 28  DC  B P     1 
ATOM   4488 O  OP1   . DC  B 2 28  ? -19.339 7.726   -43.597 1.00 30.42  ? 28  DC  B OP1   1 
ATOM   4489 O  OP2   . DC  B 2 28  ? -19.212 5.486   -42.390 1.00 32.94  ? 28  DC  B OP2   1 
ATOM   4490 O  "O5'" . DC  B 2 28  ? -18.503 5.747   -44.774 1.00 32.37  ? 28  DC  B "O5'" 1 
ATOM   4491 C  "C5'" . DC  B 2 28  ? -18.818 4.363   -44.904 1.00 35.38  ? 28  DC  B "C5'" 1 
ATOM   4492 C  "C4'" . DC  B 2 28  ? -17.653 3.593   -45.471 1.00 35.33  ? 28  DC  B "C4'" 1 
ATOM   4493 O  "O4'" . DC  B 2 28  ? -16.603 3.489   -44.481 1.00 35.14  ? 28  DC  B "O4'" 1 
ATOM   4494 C  "C3'" . DC  B 2 28  ? -18.031 2.159   -45.811 1.00 34.00  ? 28  DC  B "C3'" 1 
ATOM   4495 O  "O3'" . DC  B 2 28  ? -18.482 2.095   -47.162 1.00 32.28  ? 28  DC  B "O3'" 1 
ATOM   4496 C  "C2'" . DC  B 2 28  ? -16.742 1.401   -45.589 1.00 32.81  ? 28  DC  B "C2'" 1 
ATOM   4497 C  "C1'" . DC  B 2 28  ? -16.095 2.158   -44.449 1.00 32.90  ? 28  DC  B "C1'" 1 
ATOM   4498 N  N1    . DC  B 2 28  ? -16.270 1.607   -43.084 1.00 31.91  ? 28  DC  B N1    1 
ATOM   4499 C  C2    . DC  B 2 28  ? -15.564 0.445   -42.752 1.00 29.84  ? 28  DC  B C2    1 
ATOM   4500 O  O2    . DC  B 2 28  ? -14.893 -0.115  -43.623 1.00 30.51  ? 28  DC  B O2    1 
ATOM   4501 N  N3    . DC  B 2 28  ? -15.606 -0.018  -41.486 1.00 33.60  ? 28  DC  B N3    1 
ATOM   4502 C  C4    . DC  B 2 28  ? -16.337 0.619   -40.569 1.00 37.95  ? 28  DC  B C4    1 
ATOM   4503 N  N4    . DC  B 2 28  ? -16.385 0.099   -39.341 1.00 40.35  ? 28  DC  B N4    1 
ATOM   4504 C  C5    . DC  B 2 28  ? -17.057 1.813   -40.873 1.00 34.50  ? 28  DC  B C5    1 
ATOM   4505 C  C6    . DC  B 2 28  ? -16.981 2.278   -42.127 1.00 33.16  ? 28  DC  B C6    1 
ATOM   4506 P  P     . DC  B 2 29  ? -19.726 1.190   -47.523 1.00 28.01  ? 29  DC  B P     1 
ATOM   4507 O  OP1   . DC  B 2 29  ? -19.830 1.169   -49.013 1.00 26.98  ? 29  DC  B OP1   1 
ATOM   4508 O  OP2   . DC  B 2 29  ? -20.868 1.639   -46.717 1.00 24.15  ? 29  DC  B OP2   1 
ATOM   4509 O  "O5'" . DC  B 2 29  ? -19.265 -0.238  -46.995 1.00 29.84  ? 29  DC  B "O5'" 1 
ATOM   4510 C  "C5'" . DC  B 2 29  ? -18.158 -0.908  -47.613 1.00 35.31  ? 29  DC  B "C5'" 1 
ATOM   4511 C  "C4'" . DC  B 2 29  ? -17.775 -2.137  -46.819 1.00 43.02  ? 29  DC  B "C4'" 1 
ATOM   4512 O  "O4'" . DC  B 2 29  ? -17.216 -1.785  -45.529 1.00 42.13  ? 29  DC  B "O4'" 1 
ATOM   4513 C  "C3'" . DC  B 2 29  ? -18.937 -3.073  -46.506 1.00 43.64  ? 29  DC  B "C3'" 1 
ATOM   4514 O  "O3'" . DC  B 2 29  ? -19.180 -3.923  -47.633 1.00 50.56  ? 29  DC  B "O3'" 1 
ATOM   4515 C  "C2'" . DC  B 2 29  ? -18.442 -3.812  -45.277 1.00 44.10  ? 29  DC  B "C2'" 1 
ATOM   4516 C  "C1'" . DC  B 2 29  ? -17.522 -2.810  -44.588 1.00 45.73  ? 29  DC  B "C1'" 1 
ATOM   4517 N  N1    . DC  B 2 29  ? -18.114 -2.179  -43.396 1.00 46.04  ? 29  DC  B N1    1 
ATOM   4518 C  C2    . DC  B 2 29  ? -17.792 -2.697  -42.135 1.00 47.30  ? 29  DC  B C2    1 
ATOM   4519 O  O2    . DC  B 2 29  ? -17.032 -3.672  -42.064 1.00 52.01  ? 29  DC  B O2    1 
ATOM   4520 N  N3    . DC  B 2 29  ? -18.312 -2.120  -41.030 1.00 46.18  ? 29  DC  B N3    1 
ATOM   4521 C  C4    . DC  B 2 29  ? -19.141 -1.082  -41.148 1.00 42.64  ? 29  DC  B C4    1 
ATOM   4522 N  N4    . DC  B 2 29  ? -19.637 -0.555  -40.031 1.00 47.17  ? 29  DC  B N4    1 
ATOM   4523 C  C5    . DC  B 2 29  ? -19.493 -0.538  -42.417 1.00 42.49  ? 29  DC  B C5    1 
ATOM   4524 C  C6    . DC  B 2 29  ? -18.962 -1.112  -43.506 1.00 42.26  ? 29  DC  B C6    1 
ATOM   4525 P  P     . DT  B 2 30  ? -20.499 -4.845  -47.690 1.00 58.60  ? 30  DT  B P     1 
ATOM   4526 O  OP1   . DT  B 2 30  ? -20.578 -5.442  -49.043 1.00 59.45  ? 30  DT  B OP1   1 
ATOM   4527 O  OP2   . DT  B 2 30  ? -21.647 -4.066  -47.163 1.00 50.78  ? 30  DT  B OP2   1 
ATOM   4528 O  "O5'" . DT  B 2 30  ? -20.152 -6.011  -46.660 1.00 67.03  ? 30  DT  B "O5'" 1 
ATOM   4529 C  "C5'" . DT  B 2 30  ? -20.868 -6.098  -45.416 1.00 80.82  ? 30  DT  B "C5'" 1 
ATOM   4530 C  "C4'" . DT  B 2 30  ? -20.190 -7.058  -44.465 1.00 88.76  ? 30  DT  B "C4'" 1 
ATOM   4531 O  "O4'" . DT  B 2 30  ? -19.735 -6.334  -43.294 1.00 90.99  ? 30  DT  B "O4'" 1 
ATOM   4532 C  "C3'" . DT  B 2 30  ? -21.105 -8.169  -43.946 1.00 96.24  ? 30  DT  B "C3'" 1 
ATOM   4533 O  "O3'" . DT  B 2 30  ? -20.412 -9.424  -43.902 1.00 110.92 ? 30  DT  B "O3'" 1 
ATOM   4534 C  "C2'" . DT  B 2 30  ? -21.529 -7.667  -42.575 1.00 92.22  ? 30  DT  B "C2'" 1 
ATOM   4535 C  "C1'" . DT  B 2 30  ? -20.308 -6.890  -42.119 1.00 88.70  ? 30  DT  B "C1'" 1 
ATOM   4536 N  N1    . DT  B 2 30  ? -20.582 -5.788  -41.170 1.00 88.02  ? 30  DT  B N1    1 
ATOM   4537 C  C2    . DT  B 2 30  ? -21.217 -4.649  -41.618 1.00 83.66  ? 30  DT  B C2    1 
ATOM   4538 O  O2    . DT  B 2 30  ? -21.565 -4.489  -42.776 1.00 76.81  ? 30  DT  B O2    1 
ATOM   4539 N  N3    . DT  B 2 30  ? -21.428 -3.695  -40.652 1.00 84.93  ? 30  DT  B N3    1 
ATOM   4540 C  C4    . DT  B 2 30  ? -21.076 -3.765  -39.316 1.00 91.46  ? 30  DT  B C4    1 
ATOM   4541 O  O4    . DT  B 2 30  ? -21.330 -2.826  -38.566 1.00 92.50  ? 30  DT  B O4    1 
ATOM   4542 C  C5    . DT  B 2 30  ? -20.412 -4.986  -38.917 1.00 93.00  ? 30  DT  B C5    1 
ATOM   4543 C  C7    . DT  B 2 30  ? -19.993 -5.153  -37.490 1.00 93.39  ? 30  DT  B C7    1 
ATOM   4544 C  C6    . DT  B 2 30  ? -20.203 -5.924  -39.851 1.00 91.66  ? 30  DT  B C6    1 
ATOM   4545 P  P     . DT  B 2 31  ? -20.808 -10.609 -44.916 1.00 123.50 ? 31  DT  B P     1 
ATOM   4546 O  OP1   . DT  B 2 31  ? -20.496 -11.902 -44.252 1.00 122.36 ? 31  DT  B OP1   1 
ATOM   4547 O  OP2   . DT  B 2 31  ? -20.204 -10.301 -46.241 1.00 122.62 ? 31  DT  B OP2   1 
ATOM   4548 O  "O5'" . DT  B 2 31  ? -22.389 -10.451 -45.049 1.00 123.81 ? 31  DT  B "O5'" 1 
ATOM   4549 C  "C5'" . DT  B 2 31  ? -23.276 -11.581 -44.980 1.00 124.39 ? 31  DT  B "C5'" 1 
ATOM   4550 C  "C4'" . DT  B 2 31  ? -23.831 -11.894 -46.350 1.00 129.93 ? 31  DT  B "C4'" 1 
ATOM   4551 O  "O4'" . DT  B 2 31  ? -23.639 -10.777 -47.245 1.00 136.68 ? 31  DT  B "O4'" 1 
ATOM   4552 C  "C3'" . DT  B 2 31  ? -23.200 -13.104 -47.052 1.00 129.20 ? 31  DT  B "C3'" 1 
ATOM   4553 O  "O3'" . DT  B 2 31  ? -24.130 -14.193 -47.092 1.00 118.45 ? 31  DT  B "O3'" 1 
ATOM   4554 C  "C2'" . DT  B 2 31  ? -22.877 -12.608 -48.456 1.00 133.52 ? 31  DT  B "C2'" 1 
ATOM   4555 C  "C1'" . DT  B 2 31  ? -23.658 -11.309 -48.552 1.00 139.83 ? 31  DT  B "C1'" 1 
ATOM   4556 N  N1    . DT  B 2 31  ? -23.119 -10.291 -49.478 1.00 144.34 ? 31  DT  B N1    1 
ATOM   4557 C  C2    . DT  B 2 31  ? -23.992 -9.710  -50.372 1.00 144.14 ? 31  DT  B C2    1 
ATOM   4558 O  O2    . DT  B 2 31  ? -25.178 -9.993  -50.425 1.00 143.71 ? 31  DT  B O2    1 
ATOM   4559 N  N3    . DT  B 2 31  ? -23.423 -8.779  -51.206 1.00 142.82 ? 31  DT  B N3    1 
ATOM   4560 C  C4    . DT  B 2 31  ? -22.098 -8.383  -51.235 1.00 143.18 ? 31  DT  B C4    1 
ATOM   4561 O  O4    . DT  B 2 31  ? -21.731 -7.534  -52.044 1.00 138.88 ? 31  DT  B O4    1 
ATOM   4562 C  C5    . DT  B 2 31  ? -21.238 -9.033  -50.270 1.00 142.12 ? 31  DT  B C5    1 
ATOM   4563 C  C7    . DT  B 2 31  ? -19.788 -8.666  -50.225 1.00 135.58 ? 31  DT  B C7    1 
ATOM   4564 C  C6    . DT  B 2 31  ? -21.785 -9.942  -49.451 1.00 144.43 ? 31  DT  B C6    1 
ATOM   4565 P  P     . DA  B 2 32  ? -24.108 -15.300 -45.945 1.00 98.70  ? 32  DA  B P     1 
ATOM   4566 O  OP1   . DA  B 2 32  ? -25.021 -16.392 -46.345 1.00 106.26 ? 32  DA  B OP1   1 
ATOM   4567 O  OP2   . DA  B 2 32  ? -24.308 -14.619 -44.640 1.00 106.84 ? 32  DA  B OP2   1 
ATOM   4568 O  "O5'" . DA  B 2 32  ? -22.613 -15.836 -46.017 1.00 91.89  ? 32  DA  B "O5'" 1 
ATOM   4569 C  "C5'" . DA  B 2 32  ? -22.252 -17.072 -45.397 1.00 84.91  ? 32  DA  B "C5'" 1 
ATOM   4570 C  "C4'" . DA  B 2 32  ? -20.843 -16.985 -44.865 1.00 82.62  ? 32  DA  B "C4'" 1 
ATOM   4571 O  "O4'" . DA  B 2 32  ? -20.894 -16.628 -43.465 1.00 80.25  ? 32  DA  B "O4'" 1 
ATOM   4572 C  "C3'" . DA  B 2 32  ? -20.067 -18.299 -44.925 1.00 84.81  ? 32  DA  B "C3'" 1 
ATOM   4573 O  "O3'" . DA  B 2 32  ? -18.672 -18.045 -45.094 1.00 91.52  ? 32  DA  B "O3'" 1 
ATOM   4574 C  "C2'" . DA  B 2 32  ? -20.313 -18.903 -43.558 1.00 80.45  ? 32  DA  B "C2'" 1 
ATOM   4575 C  "C1'" . DA  B 2 32  ? -20.312 -17.663 -42.683 1.00 75.17  ? 32  DA  B "C1'" 1 
ATOM   4576 N  N9    . DA  B 2 32  ? -21.077 -17.773 -41.446 1.00 64.11  ? 32  DA  B N9    1 
ATOM   4577 C  C8    . DA  B 2 32  ? -22.131 -18.601 -41.148 1.00 61.32  ? 32  DA  B C8    1 
ATOM   4578 N  N7    . DA  B 2 32  ? -22.596 -18.447 -39.932 1.00 54.77  ? 32  DA  B N7    1 
ATOM   4579 C  C5    . DA  B 2 32  ? -21.798 -17.446 -39.396 1.00 60.46  ? 32  DA  B C5    1 
ATOM   4580 C  C6    . DA  B 2 32  ? -21.785 -16.822 -38.140 1.00 59.42  ? 32  DA  B C6    1 
ATOM   4581 N  N6    . DA  B 2 32  ? -22.623 -17.132 -37.151 1.00 60.77  ? 32  DA  B N6    1 
ATOM   4582 N  N1    . DA  B 2 32  ? -20.865 -15.854 -37.930 1.00 63.21  ? 32  DA  B N1    1 
ATOM   4583 C  C2    . DA  B 2 32  ? -20.012 -15.553 -38.918 1.00 58.49  ? 32  DA  B C2    1 
ATOM   4584 N  N3    . DA  B 2 32  ? -19.928 -16.069 -40.141 1.00 59.60  ? 32  DA  B N3    1 
ATOM   4585 C  C4    . DA  B 2 32  ? -20.857 -17.025 -40.317 1.00 62.45  ? 32  DA  B C4    1 
ATOM   4586 P  P     . DC  B 2 33  ? -17.994 -18.226 -46.524 1.00 91.66  ? 33  DC  B P     1 
ATOM   4587 O  OP1   . DC  B 2 33  ? -16.732 -17.442 -46.526 1.00 92.61  ? 33  DC  B OP1   1 
ATOM   4588 O  OP2   . DC  B 2 33  ? -19.027 -17.957 -47.559 1.00 91.25  ? 33  DC  B OP2   1 
ATOM   4589 O  "O5'" . DC  B 2 33  ? -17.614 -19.775 -46.555 1.00 97.64  ? 33  DC  B "O5'" 1 
ATOM   4590 C  "C5'" . DC  B 2 33  ? -17.922 -20.655 -45.454 1.00 106.78 ? 33  DC  B "C5'" 1 
ATOM   4591 C  "C4'" . DC  B 2 33  ? -17.615 -22.090 -45.816 1.00 115.63 ? 33  DC  B "C4'" 1 
ATOM   4592 O  "O4'" . DC  B 2 33  ? -16.315 -22.458 -45.296 1.00 117.19 ? 33  DC  B "O4'" 1 
ATOM   4593 C  "C3'" . DC  B 2 33  ? -18.599 -23.114 -45.250 1.00 119.42 ? 33  DC  B "C3'" 1 
ATOM   4594 O  "O3'" . DC  B 2 33  ? -18.828 -24.172 -46.187 1.00 113.54 ? 33  DC  B "O3'" 1 
ATOM   4595 C  "C2'" . DC  B 2 33  ? -17.926 -23.575 -43.967 1.00 123.46 ? 33  DC  B "C2'" 1 
ATOM   4596 C  "C1'" . DC  B 2 33  ? -16.435 -23.453 -44.285 1.00 123.19 ? 33  DC  B "C1'" 1 
ATOM   4597 N  N1    . DC  B 2 33  ? -15.543 -23.070 -43.168 1.00 123.14 ? 33  DC  B N1    1 
ATOM   4598 C  C2    . DC  B 2 33  ? -14.201 -23.469 -43.213 1.00 123.31 ? 33  DC  B C2    1 
ATOM   4599 O  O2    . DC  B 2 33  ? -13.810 -24.158 -44.168 1.00 127.91 ? 33  DC  B O2    1 
ATOM   4600 N  N3    . DC  B 2 33  ? -13.370 -23.108 -42.207 1.00 116.73 ? 33  DC  B N3    1 
ATOM   4601 C  C4    . DC  B 2 33  ? -13.830 -22.367 -41.194 1.00 109.32 ? 33  DC  B C4    1 
ATOM   4602 N  N4    . DC  B 2 33  ? -12.976 -22.034 -40.224 1.00 101.78 ? 33  DC  B N4    1 
ATOM   4603 C  C5    . DC  B 2 33  ? -15.188 -21.940 -41.129 1.00 115.17 ? 33  DC  B C5    1 
ATOM   4604 C  C6    . DC  B 2 33  ? -16.000 -22.304 -42.130 1.00 121.45 ? 33  DC  B C6    1 
HETATM 4605 ZN ZN    . ZN  C 3 .   ? 0.535   38.156  -38.264 1.00 21.37  ? 601 ZN  A ZN    1 
HETATM 4606 O  O     . HOH D 4 .   ? -18.187 41.187  -32.830 1.00 37.70  ? 701 HOH A O     1 
HETATM 4607 O  O     . HOH D 4 .   ? -14.381 26.691  -56.668 1.00 52.82  ? 702 HOH A O     1 
HETATM 4608 O  O     . HOH D 4 .   ? -31.928 5.491   -50.608 1.00 46.15  ? 703 HOH A O     1 
HETATM 4609 O  O     . HOH D 4 .   ? -21.080 20.616  -73.500 1.00 34.85  ? 704 HOH A O     1 
HETATM 4610 O  O     . HOH D 4 .   ? 12.151  41.952  -28.218 1.00 53.25  ? 705 HOH A O     1 
HETATM 4611 O  O     . HOH D 4 .   ? 18.701  20.323  -22.571 1.00 40.45  ? 706 HOH A O     1 
HETATM 4612 O  O     . HOH D 4 .   ? -19.584 32.734  -64.184 1.00 56.98  ? 707 HOH A O     1 
HETATM 4613 O  O     . HOH D 4 .   ? 7.563   29.400  -48.409 1.00 28.49  ? 708 HOH A O     1 
HETATM 4614 O  O     . HOH D 4 .   ? -19.208 26.896  -75.163 1.00 34.19  ? 709 HOH A O     1 
HETATM 4615 O  O     . HOH D 4 .   ? -28.924 -7.689  -60.676 1.00 32.82  ? 710 HOH A O     1 
HETATM 4616 O  O     . HOH D 4 .   ? -32.788 -7.560  -49.911 1.00 47.44  ? 711 HOH A O     1 
HETATM 4617 O  O     . HOH D 4 .   ? 10.616  37.672  -31.982 1.00 36.18  ? 712 HOH A O     1 
HETATM 4618 O  O     . HOH D 4 .   ? 21.753  36.643  -22.715 1.00 88.51  ? 713 HOH A O     1 
HETATM 4619 O  O     . HOH D 4 .   ? -25.161 20.695  -50.964 1.00 59.03  ? 714 HOH A O     1 
HETATM 4620 O  O     . HOH D 4 .   ? -28.504 16.518  -49.522 1.00 32.87  ? 715 HOH A O     1 
HETATM 4621 O  O     . HOH D 4 .   ? 5.339   11.668  -55.448 1.00 37.77  ? 716 HOH A O     1 
HETATM 4622 O  O     . HOH D 4 .   ? -6.939  32.871  -50.716 1.00 55.12  ? 717 HOH A O     1 
HETATM 4623 O  O     . HOH D 4 .   ? 9.048   28.353  -32.963 1.00 36.42  ? 718 HOH A O     1 
HETATM 4624 O  O     . HOH D 4 .   ? -26.339 -5.848  -53.944 1.00 41.10  ? 719 HOH A O     1 
HETATM 4625 O  O     . HOH D 4 .   ? -23.966 19.890  -58.586 1.00 51.34  ? 720 HOH A O     1 
HETATM 4626 O  O     . HOH D 4 .   ? -6.240  40.295  -42.843 1.00 32.49  ? 721 HOH A O     1 
HETATM 4627 O  O     . HOH D 4 .   ? -8.108  44.633  -33.437 1.00 39.89  ? 722 HOH A O     1 
HETATM 4628 O  O     . HOH D 4 .   ? -11.291 38.906  -32.275 1.00 55.93  ? 723 HOH A O     1 
HETATM 4629 O  O     . HOH D 4 .   ? -30.393 4.658   -55.132 1.00 29.50  ? 724 HOH A O     1 
HETATM 4630 O  O     . HOH D 4 .   ? -11.313 38.213  -37.056 1.00 33.37  ? 725 HOH A O     1 
HETATM 4631 O  O     . HOH D 4 .   ? 10.057  38.831  -42.733 1.00 31.71  ? 726 HOH A O     1 
HETATM 4632 O  O     . HOH D 4 .   ? 13.721  20.369  -22.036 1.00 44.63  ? 727 HOH A O     1 
HETATM 4633 O  O     . HOH D 4 .   ? -21.529 8.855   -71.610 1.00 66.94  ? 728 HOH A O     1 
HETATM 4634 O  O     . HOH D 4 .   ? 9.824   37.856  -38.924 1.00 39.29  ? 729 HOH A O     1 
HETATM 4635 O  O     . HOH D 4 .   ? -30.065 0.437   -66.534 1.00 57.64  ? 730 HOH A O     1 
HETATM 4636 O  O     . HOH D 4 .   ? -32.947 -4.050  -58.214 1.00 31.17  ? 731 HOH A O     1 
HETATM 4637 O  O     . HOH D 4 .   ? -29.256 23.569  -62.570 1.00 39.91  ? 732 HOH A O     1 
HETATM 4638 O  O     . HOH D 4 .   ? -11.761 25.478  -54.999 1.00 50.95  ? 733 HOH A O     1 
HETATM 4639 O  O     . HOH D 4 .   ? -27.462 -4.860  -61.626 1.00 39.16  ? 734 HOH A O     1 
HETATM 4640 O  O     . HOH D 4 .   ? -7.843  -12.059 -54.999 1.00 43.84  ? 735 HOH A O     1 
HETATM 4641 O  O     . HOH D 4 .   ? 3.094   7.841   -59.420 1.00 50.20  ? 736 HOH A O     1 
HETATM 4642 O  O     . HOH D 4 .   ? -32.005 7.303   -66.678 1.00 49.55  ? 737 HOH A O     1 
HETATM 4643 O  O     . HOH D 4 .   ? -30.415 24.895  -68.335 1.00 50.13  ? 738 HOH A O     1 
HETATM 4644 O  O     . HOH D 4 .   ? -13.067 38.411  -47.015 1.00 34.08  ? 739 HOH A O     1 
HETATM 4645 O  O     . HOH D 4 .   ? 4.971   41.403  -33.963 1.00 24.87  ? 740 HOH A O     1 
HETATM 4646 O  O     . HOH D 4 .   ? -26.363 13.348  -66.552 1.00 25.20  ? 741 HOH A O     1 
HETATM 4647 O  O     . HOH D 4 .   ? 10.170  40.774  -48.836 1.00 48.47  ? 742 HOH A O     1 
HETATM 4648 O  O     . HOH D 4 .   ? 2.365   20.236  -62.906 1.00 35.22  ? 743 HOH A O     1 
HETATM 4649 O  O     . HOH D 4 .   ? -35.560 -8.705  -54.461 1.00 25.60  ? 744 HOH A O     1 
HETATM 4650 O  O     . HOH D 4 .   ? 5.606   39.321  -48.356 1.00 36.01  ? 745 HOH A O     1 
HETATM 4651 O  O     . HOH D 4 .   ? -7.199  -4.034  -52.132 1.00 50.26  ? 746 HOH A O     1 
HETATM 4652 O  O     . HOH D 4 .   ? -9.398  41.681  -38.098 1.00 44.62  ? 747 HOH A O     1 
HETATM 4653 O  O     . HOH D 4 .   ? 5.742   11.010  -63.418 1.00 57.67  ? 748 HOH A O     1 
HETATM 4654 O  O     . HOH D 4 .   ? -22.240 17.866  -56.217 1.00 31.33  ? 749 HOH A O     1 
HETATM 4655 O  O     . HOH D 4 .   ? -12.793 24.952  -59.693 1.00 53.67  ? 750 HOH A O     1 
HETATM 4656 O  O     . HOH D 4 .   ? -3.237  -0.867  -49.031 1.00 46.26  ? 751 HOH A O     1 
HETATM 4657 O  O     . HOH D 4 .   ? 0.197   25.666  -58.890 1.00 38.90  ? 752 HOH A O     1 
HETATM 4658 O  O     . HOH D 4 .   ? -22.682 33.086  -35.555 1.00 37.76  ? 753 HOH A O     1 
HETATM 4659 O  O     . HOH D 4 .   ? -26.815 28.585  -70.382 1.00 67.07  ? 754 HOH A O     1 
HETATM 4660 O  O     . HOH D 4 .   ? -3.539  35.496  -50.722 1.00 51.64  ? 755 HOH A O     1 
HETATM 4661 O  O     . HOH D 4 .   ? -12.549 33.250  -46.826 1.00 44.06  ? 756 HOH A O     1 
HETATM 4662 O  O     . HOH D 4 .   ? -27.821 6.492   -55.748 1.00 26.07  ? 757 HOH A O     1 
HETATM 4663 O  O     . HOH D 4 .   ? -25.135 31.771  -33.313 1.00 50.41  ? 758 HOH A O     1 
HETATM 4664 O  O     . HOH D 4 .   ? -31.176 2.770   -56.740 1.00 24.57  ? 759 HOH A O     1 
HETATM 4665 O  O     . HOH D 4 .   ? -27.637 -8.034  -65.362 1.00 40.90  ? 760 HOH A O     1 
HETATM 4666 O  O     . HOH D 4 .   ? -22.097 11.840  -73.057 1.00 58.77  ? 761 HOH A O     1 
HETATM 4667 O  O     . HOH D 4 .   ? 8.532   38.942  -35.558 1.00 46.07  ? 762 HOH A O     1 
HETATM 4668 O  O     . HOH D 4 .   ? -4.476  -4.313  -50.700 1.00 33.30  ? 763 HOH A O     1 
HETATM 4669 O  O     . HOH D 4 .   ? -8.949  0.973   -38.217 1.00 53.26  ? 764 HOH A O     1 
HETATM 4670 O  O     . HOH D 4 .   ? 1.311   27.462  -57.121 1.00 51.29  ? 765 HOH A O     1 
HETATM 4671 O  O     . HOH D 4 .   ? -7.159  43.288  -38.734 1.00 51.08  ? 766 HOH A O     1 
HETATM 4672 O  O     . HOH D 4 .   ? -23.319 -5.137  -54.143 1.00 56.67  ? 767 HOH A O     1 
HETATM 4673 O  O     . HOH D 4 .   ? 2.374   1.763   -42.326 1.00 43.16  ? 768 HOH A O     1 
HETATM 4674 O  O     . HOH D 4 .   ? 8.213   29.254  -51.096 1.00 47.24  ? 769 HOH A O     1 
HETATM 4675 O  O     . HOH D 4 .   ? -3.857  39.146  -43.183 1.00 39.19  ? 770 HOH A O     1 
HETATM 4676 O  O     . HOH D 4 .   ? -22.320 -5.022  -63.450 1.00 33.60  ? 771 HOH A O     1 
HETATM 4677 O  O     . HOH D 4 .   ? 9.352   39.816  -41.046 1.00 50.52  ? 772 HOH A O     1 
HETATM 4678 O  O     . HOH D 4 .   ? -13.680 38.185  -35.613 1.00 54.06  ? 773 HOH A O     1 
HETATM 4679 O  O     . HOH D 4 .   ? -12.942 -7.475  -68.183 1.00 52.29  ? 774 HOH A O     1 
HETATM 4680 O  O     . HOH D 4 .   ? 9.371   19.160  -41.131 1.00 61.35  ? 775 HOH A O     1 
HETATM 4681 O  O     . HOH D 4 .   ? -31.158 3.339   -59.120 1.00 40.10  ? 776 HOH A O     1 
HETATM 4682 O  O     . HOH D 4 .   ? -29.357 19.323  -52.519 1.00 32.42  ? 777 HOH A O     1 
HETATM 4683 O  O     . HOH D 4 .   ? -16.817 -10.008 -63.029 1.00 55.00  ? 778 HOH A O     1 
HETATM 4684 O  O     . HOH D 4 .   ? -15.619 28.969  -48.925 1.00 60.62  ? 779 HOH A O     1 
HETATM 4685 O  O     . HOH D 4 .   ? 9.349   39.975  -37.789 1.00 55.49  ? 780 HOH A O     1 
HETATM 4686 O  O     . HOH D 4 .   ? -22.424 33.081  -61.929 1.00 53.28  ? 781 HOH A O     1 
HETATM 4687 O  O     . HOH D 4 .   ? -6.310  45.785  -37.022 1.00 48.68  ? 782 HOH A O     1 
HETATM 4688 O  O     . HOH D 4 .   ? -33.637 1.840   -56.886 1.00 35.27  ? 783 HOH A O     1 
HETATM 4689 O  O     . HOH D 4 .   ? -29.580 5.000   -60.258 1.00 51.39  ? 784 HOH A O     1 
HETATM 4690 O  O     . HOH D 4 .   ? -11.775 9.750   -24.044 1.00 48.91  ? 785 HOH A O     1 
HETATM 4691 O  O     . HOH D 4 .   ? -20.884 7.556   -34.918 1.00 52.07  ? 786 HOH A O     1 
HETATM 4692 O  O     . HOH D 4 .   ? -18.363 10.686  -66.855 1.00 26.40  ? 787 HOH A O     1 
HETATM 4693 O  O     . HOH D 4 .   ? -0.248  28.213  -52.453 1.00 26.80  ? 788 HOH A O     1 
HETATM 4694 O  O     . HOH D 4 .   ? -7.295  28.234  -41.746 1.00 26.89  ? 789 HOH A O     1 
HETATM 4695 O  O     . HOH D 4 .   ? -0.284  30.062  -54.271 1.00 40.33  ? 790 HOH A O     1 
HETATM 4696 O  O     . HOH D 4 .   ? -3.921  9.855   -67.644 1.00 37.33  ? 791 HOH A O     1 
HETATM 4697 O  O     . HOH D 4 .   ? -4.847  7.952   -39.336 1.00 45.46  ? 792 HOH A O     1 
HETATM 4698 O  O     . HOH D 4 .   ? 5.491   11.513  -48.776 1.00 37.74  ? 793 HOH A O     1 
HETATM 4699 O  O     . HOH D 4 .   ? -9.790  14.819  -31.733 1.00 47.19  ? 794 HOH A O     1 
HETATM 4700 O  O     . HOH D 4 .   ? 0.501   38.154  -44.866 1.00 53.68  ? 795 HOH A O     1 
HETATM 4701 O  O     . HOH D 4 .   ? -21.092 33.186  -26.454 1.00 40.32  ? 796 HOH A O     1 
HETATM 4702 O  O     . HOH D 4 .   ? -21.032 -3.391  -54.242 1.00 42.03  ? 797 HOH A O     1 
HETATM 4703 O  O     . HOH D 4 .   ? -12.043 9.866   -51.221 1.00 25.30  ? 798 HOH A O     1 
HETATM 4704 O  O     . HOH D 4 .   ? -28.867 28.230  -24.106 1.00 58.13  ? 799 HOH A O     1 
HETATM 4705 O  O     . HOH D 4 .   ? -4.464  31.331  -43.847 1.00 31.80  ? 800 HOH A O     1 
HETATM 4706 O  O     . HOH D 4 .   ? -31.345 0.823   -62.879 1.00 38.52  ? 801 HOH A O     1 
HETATM 4707 O  O     . HOH D 4 .   ? -7.814  18.574  -33.441 1.00 37.92  ? 802 HOH A O     1 
HETATM 4708 O  O     . HOH D 4 .   ? 4.457   22.388  -47.989 1.00 33.47  ? 803 HOH A O     1 
HETATM 4709 O  O     . HOH D 4 .   ? -20.592 1.785   -68.536 1.00 41.61  ? 804 HOH A O     1 
HETATM 4710 O  O     . HOH D 4 .   ? -5.424  29.344  -33.609 1.00 25.25  ? 805 HOH A O     1 
HETATM 4711 O  O     . HOH D 4 .   ? -7.630  27.555  -33.203 1.00 21.88  ? 806 HOH A O     1 
HETATM 4712 O  O     . HOH D 4 .   ? -2.530  22.682  -26.165 1.00 35.91  ? 807 HOH A O     1 
HETATM 4713 O  O     . HOH D 4 .   ? -9.781  0.687   -45.502 1.00 26.90  ? 808 HOH A O     1 
HETATM 4714 O  O     . HOH D 4 .   ? 0.832   18.771  -41.396 1.00 34.49  ? 809 HOH A O     1 
HETATM 4715 O  O     . HOH D 4 .   ? 3.844   16.168  -62.037 1.00 44.22  ? 810 HOH A O     1 
HETATM 4716 O  O     . HOH D 4 .   ? -16.202 6.287   -47.241 1.00 29.61  ? 811 HOH A O     1 
HETATM 4717 O  O     . HOH D 4 .   ? -11.611 23.750  -43.571 1.00 40.00  ? 812 HOH A O     1 
HETATM 4718 O  O     . HOH D 4 .   ? -4.325  33.939  -44.172 1.00 45.95  ? 813 HOH A O     1 
HETATM 4719 O  O     . HOH D 4 .   ? -22.267 6.961   -68.680 1.00 53.85  ? 814 HOH A O     1 
HETATM 4720 O  O     . HOH D 4 .   ? -17.860 29.309  -41.391 1.00 26.09  ? 815 HOH A O     1 
HETATM 4721 O  O     . HOH D 4 .   ? 20.150  39.842  -20.080 1.00 56.34  ? 816 HOH A O     1 
HETATM 4722 O  O     . HOH D 4 .   ? 5.518   18.964  -45.843 1.00 44.62  ? 817 HOH A O     1 
HETATM 4723 O  O     . HOH D 4 .   ? -11.750 13.513  -72.766 1.00 43.72  ? 818 HOH A O     1 
HETATM 4724 O  O     . HOH D 4 .   ? -2.264  7.050   -42.846 1.00 45.11  ? 819 HOH A O     1 
HETATM 4725 O  O     . HOH D 4 .   ? -17.698 -4.364  -53.319 1.00 39.07  ? 820 HOH A O     1 
HETATM 4726 O  O     . HOH D 4 .   ? -8.646  17.456  -38.819 1.00 38.72  ? 821 HOH A O     1 
HETATM 4727 O  O     . HOH D 4 .   ? 1.522   44.445  -40.817 1.00 31.10  ? 822 HOH A O     1 
HETATM 4728 O  O     . HOH D 4 .   ? -1.075  12.051  -67.029 1.00 44.41  ? 823 HOH A O     1 
HETATM 4729 O  O     . HOH D 4 .   ? 7.986   25.087  -46.625 1.00 56.82  ? 824 HOH A O     1 
HETATM 4730 O  O     . HOH D 4 .   ? 7.879   24.268  -22.791 1.00 51.58  ? 825 HOH A O     1 
HETATM 4731 O  O     . HOH D 4 .   ? -15.777 16.540  -50.928 1.00 53.23  ? 826 HOH A O     1 
HETATM 4732 O  O     . HOH D 4 .   ? -26.983 18.617  -50.989 1.00 38.59  ? 827 HOH A O     1 
HETATM 4733 O  O     . HOH D 4 .   ? -20.930 32.727  -73.370 1.00 55.88  ? 828 HOH A O     1 
HETATM 4734 O  O     . HOH D 4 .   ? -2.347  24.836  -17.104 1.00 44.79  ? 829 HOH A O     1 
HETATM 4735 O  O     . HOH D 4 .   ? -29.248 29.899  -28.687 1.00 58.37  ? 830 HOH A O     1 
HETATM 4736 O  O     . HOH D 4 .   ? 4.736   28.233  -23.610 1.00 49.96  ? 831 HOH A O     1 
HETATM 4737 O  O     . HOH D 4 .   ? -4.940  31.258  -55.334 1.00 41.58  ? 832 HOH A O     1 
HETATM 4738 O  O     . HOH D 4 .   ? -23.904 15.365  -27.351 1.00 47.71  ? 833 HOH A O     1 
HETATM 4739 O  O     . HOH D 4 .   ? -17.047 13.344  -51.709 1.00 50.08  ? 834 HOH A O     1 
HETATM 4740 O  O     . HOH D 4 .   ? -11.641 9.764   -70.564 1.00 41.76  ? 835 HOH A O     1 
HETATM 4741 O  O     . HOH D 4 .   ? -7.470  19.396  -30.922 1.00 36.71  ? 836 HOH A O     1 
HETATM 4742 O  O     . HOH D 4 .   ? -9.734  33.721  -21.723 1.00 42.82  ? 837 HOH A O     1 
HETATM 4743 O  O     . HOH D 4 .   ? -11.519 17.694  -38.196 1.00 44.23  ? 838 HOH A O     1 
HETATM 4744 O  O     . HOH D 4 .   ? 2.235   26.716  -52.025 1.00 41.14  ? 839 HOH A O     1 
HETATM 4745 O  O     . HOH D 4 .   ? 2.935   19.867  -39.557 1.00 38.10  ? 840 HOH A O     1 
HETATM 4746 O  O     . HOH D 4 .   ? -10.690 18.438  -49.307 1.00 22.85  ? 841 HOH A O     1 
HETATM 4747 O  O     . HOH D 4 .   ? -12.596 22.864  -51.041 1.00 46.69  ? 842 HOH A O     1 
HETATM 4748 O  O     . HOH D 4 .   ? -24.858 28.015  -34.428 1.00 55.94  ? 843 HOH A O     1 
HETATM 4749 O  O     . HOH D 4 .   ? 11.612  19.216  -9.191  1.00 49.33  ? 844 HOH A O     1 
HETATM 4750 O  O     . HOH D 4 .   ? -21.129 4.665   -72.029 1.00 48.27  ? 845 HOH A O     1 
HETATM 4751 O  O     . HOH D 4 .   ? -9.042  27.637  -45.789 1.00 46.47  ? 846 HOH A O     1 
HETATM 4752 O  O     . HOH D 4 .   ? -25.255 8.304   -28.753 1.00 51.95  ? 847 HOH A O     1 
HETATM 4753 O  O     . HOH D 4 .   ? -7.627  1.378   -68.943 1.00 49.83  ? 848 HOH A O     1 
HETATM 4754 O  O     . HOH D 4 .   ? -31.699 -5.253  -48.675 1.00 39.39  ? 849 HOH A O     1 
HETATM 4755 O  O     . HOH D 4 .   ? -2.458  1.870   -54.257 1.00 65.45  ? 850 HOH A O     1 
HETATM 4756 O  O     . HOH D 4 .   ? 15.153  7.993   -37.430 1.00 47.66  ? 851 HOH A O     1 
HETATM 4757 O  O     . HOH D 4 .   ? -16.960 6.495   -26.326 1.00 47.36  ? 852 HOH A O     1 
HETATM 4758 O  O     . HOH D 4 .   ? -9.925  29.447  -66.595 1.00 43.57  ? 853 HOH A O     1 
HETATM 4759 O  O     . HOH D 4 .   ? -4.077  22.294  -69.217 1.00 41.02  ? 854 HOH A O     1 
HETATM 4760 O  O     . HOH D 4 .   ? -7.476  27.634  -71.121 1.00 53.61  ? 855 HOH A O     1 
HETATM 4761 O  O     . HOH D 4 .   ? -10.648 35.392  -23.394 1.00 41.31  ? 856 HOH A O     1 
HETATM 4762 O  O     . HOH D 4 .   ? 6.468   38.954  -37.643 1.00 30.20  ? 857 HOH A O     1 
HETATM 4763 O  O     . HOH D 4 .   ? 4.594   40.600  -36.498 1.00 31.32  ? 858 HOH A O     1 
HETATM 4764 O  O     . HOH D 4 .   ? -13.379 20.472  -43.224 1.00 37.73  ? 859 HOH A O     1 
HETATM 4765 O  O     . HOH D 4 .   ? 2.907   23.323  -18.914 1.00 37.75  ? 860 HOH A O     1 
HETATM 4766 O  O     . HOH D 4 .   ? -11.549 23.440  -61.871 1.00 30.10  ? 861 HOH A O     1 
HETATM 4767 O  O     . HOH D 4 .   ? -25.044 4.571   -34.584 1.00 57.16  ? 862 HOH A O     1 
HETATM 4768 O  O     . HOH D 4 .   ? -11.106 7.366   -70.846 1.00 59.73  ? 863 HOH A O     1 
HETATM 4769 O  O     . HOH D 4 .   ? -1.300  9.522   -68.305 1.00 50.61  ? 864 HOH A O     1 
HETATM 4770 O  O     . HOH D 4 .   ? -8.552  27.440  -60.006 1.00 63.01  ? 865 HOH A O     1 
HETATM 4771 O  O     . HOH D 4 .   ? -5.370  26.744  -59.508 1.00 51.58  ? 866 HOH A O     1 
HETATM 4772 O  O     . HOH D 4 .   ? -7.961  12.944  -74.488 1.00 69.21  ? 867 HOH A O     1 
HETATM 4773 O  O     . HOH D 4 .   ? -7.003  10.697  -74.160 1.00 50.58  ? 868 HOH A O     1 
HETATM 4774 O  O     . HOH D 4 .   ? -7.302  28.348  -66.159 1.00 40.61  ? 869 HOH A O     1 
HETATM 4775 O  O     . HOH D 4 .   ? -32.212 2.156   -48.512 1.00 57.82  ? 870 HOH A O     1 
HETATM 4776 O  O     . HOH D 4 .   ? -12.603 37.196  -29.540 1.00 36.69  ? 871 HOH A O     1 
HETATM 4777 O  O     . HOH D 4 .   ? -17.745 25.468  -42.036 1.00 44.74  ? 872 HOH A O     1 
HETATM 4778 O  O     . HOH D 4 .   ? -4.542  5.159   -52.919 1.00 43.55  ? 873 HOH A O     1 
HETATM 4779 O  O     . HOH D 4 .   ? 0.267   35.080  -51.017 1.00 40.15  ? 874 HOH A O     1 
HETATM 4780 O  O     . HOH D 4 .   ? -14.822 18.611  -54.200 1.00 46.81  ? 875 HOH A O     1 
HETATM 4781 O  O     . HOH D 4 .   ? 23.450  18.058  -16.075 1.00 68.20  ? 876 HOH A O     1 
HETATM 4782 O  O     . HOH D 4 .   ? -5.254  16.675  -34.522 1.00 52.71  ? 877 HOH A O     1 
HETATM 4783 O  O     . HOH D 4 .   ? -7.549  29.361  -72.804 1.00 72.94  ? 878 HOH A O     1 
HETATM 4784 O  O     . HOH D 4 .   ? -25.554 13.947  -46.092 1.00 46.71  ? 879 HOH A O     1 
HETATM 4785 O  O     . HOH D 4 .   ? -5.742  24.617  -57.770 1.00 42.00  ? 880 HOH A O     1 
HETATM 4786 O  O     . HOH D 4 .   ? 27.970  32.696  -12.980 1.00 66.84  ? 881 HOH A O     1 
HETATM 4787 O  O     . HOH D 4 .   ? -17.012 40.655  -25.888 1.00 55.80  ? 882 HOH A O     1 
HETATM 4788 O  O     . HOH D 4 .   ? 6.858   26.631  -23.868 1.00 45.44  ? 883 HOH A O     1 
HETATM 4789 O  O     . HOH D 4 .   ? 14.461  14.921  -21.349 1.00 56.87  ? 884 HOH A O     1 
HETATM 4790 O  O     . HOH D 4 .   ? 6.989   26.700  -52.425 1.00 44.93  ? 885 HOH A O     1 
HETATM 4791 O  O     . HOH D 4 .   ? -3.258  17.084  -26.895 1.00 53.03  ? 886 HOH A O     1 
HETATM 4792 O  O     . HOH D 4 .   ? -17.736 15.452  -40.550 1.00 45.18  ? 887 HOH A O     1 
HETATM 4793 O  O     . HOH D 4 .   ? 10.954  6.881   -36.390 1.00 58.50  ? 888 HOH A O     1 
HETATM 4794 O  O     . HOH D 4 .   ? -12.825 2.039   -69.639 1.00 46.31  ? 889 HOH A O     1 
HETATM 4795 O  O     . HOH D 4 .   ? -13.499 -0.491  -68.095 1.00 57.81  ? 890 HOH A O     1 
HETATM 4796 O  O     . HOH D 4 .   ? -2.421  13.628  -72.188 1.00 71.80  ? 891 HOH A O     1 
HETATM 4797 O  O     . HOH D 4 .   ? -13.392 24.078  -53.179 1.00 47.72  ? 892 HOH A O     1 
HETATM 4798 O  O     . HOH D 4 .   ? -2.246  37.817  -27.193 1.00 60.04  ? 893 HOH A O     1 
HETATM 4799 O  O     . HOH D 4 .   ? 10.803  10.325  -43.348 1.00 48.53  ? 894 HOH A O     1 
HETATM 4800 O  O     . HOH D 4 .   ? 10.530  13.215  -28.593 1.00 58.23  ? 895 HOH A O     1 
HETATM 4801 O  O     . HOH D 4 .   ? -20.769 4.527   -69.121 1.00 33.65  ? 896 HOH A O     1 
HETATM 4802 O  O     . HOH D 4 .   ? -4.164  43.596  -29.498 1.00 55.91  ? 897 HOH A O     1 
HETATM 4803 O  O     . HOH D 4 .   ? -27.407 30.141  -32.771 1.00 54.90  ? 898 HOH A O     1 
HETATM 4804 O  O     . HOH D 4 .   ? 4.128   32.171  -29.649 1.00 50.49  ? 899 HOH A O     1 
HETATM 4805 O  O     . HOH D 4 .   ? -4.349  20.991  -19.185 1.00 50.84  ? 900 HOH A O     1 
HETATM 4806 O  O     . HOH D 4 .   ? -6.973  14.271  -32.483 1.00 65.23  ? 901 HOH A O     1 
HETATM 4807 O  O     . HOH D 4 .   ? -6.734  13.060  -30.147 1.00 56.56  ? 902 HOH A O     1 
HETATM 4808 O  O     . HOH D 4 .   ? 7.778   3.694   -41.824 1.00 37.13  ? 903 HOH A O     1 
HETATM 4809 O  O     . HOH D 4 .   ? -20.418 14.389  -41.775 1.00 47.70  ? 904 HOH A O     1 
HETATM 4810 O  O     . HOH D 4 .   ? -18.956 13.067  -40.592 1.00 48.40  ? 905 HOH A O     1 
HETATM 4811 O  O     . HOH D 4 .   ? -20.585 11.275  -41.097 1.00 46.84  ? 906 HOH A O     1 
HETATM 4812 O  O     . HOH D 4 .   ? -22.954 13.876  -38.289 1.00 50.58  ? 907 HOH A O     1 
HETATM 4813 O  O     . HOH D 4 .   ? -2.091  5.196   -36.113 1.00 66.77  ? 908 HOH A O     1 
HETATM 4814 O  O     . HOH D 4 .   ? 2.654   35.784  -50.281 1.00 43.80  ? 909 HOH A O     1 
HETATM 4815 O  O     . HOH D 4 .   ? 2.792   32.009  -57.239 1.00 57.66  ? 910 HOH A O     1 
HETATM 4816 O  O     . HOH D 4 .   ? 4.190   28.670  -54.003 1.00 54.71  ? 911 HOH A O     1 
HETATM 4817 O  O     . HOH D 4 .   ? -4.927  7.751   -68.843 1.00 49.97  ? 912 HOH A O     1 
HETATM 4818 O  O     . HOH D 4 .   ? -22.358 2.314   -71.887 1.00 46.85  ? 913 HOH A O     1 
HETATM 4819 O  O     . HOH D 4 .   ? 20.053  38.413  -17.797 1.00 65.80  ? 914 HOH A O     1 
HETATM 4820 O  O     . HOH D 4 .   ? -24.610 6.534   -42.840 1.00 46.26  ? 915 HOH A O     1 
HETATM 4821 O  O     . HOH D 4 .   ? -23.655 8.959   -42.469 1.00 45.47  ? 916 HOH A O     1 
HETATM 4822 O  O     . HOH D 4 .   ? -25.495 10.413  -44.472 1.00 53.09  ? 917 HOH A O     1 
HETATM 4823 O  O     . HOH D 4 .   ? 1.697   43.799  -38.397 1.00 48.03  ? 918 HOH A O     1 
HETATM 4824 O  O     . HOH D 4 .   ? -15.007 35.843  -34.125 1.00 39.68  ? 919 HOH A O     1 
HETATM 4825 O  O     . HOH D 4 .   ? -8.456  19.895  -45.610 1.00 56.49  ? 920 HOH A O     1 
HETATM 4826 O  O     . HOH D 4 .   ? -5.151  25.729  -61.901 1.00 42.94  ? 921 HOH A O     1 
HETATM 4827 O  O     . HOH D 4 .   ? 8.974   26.324  -51.222 1.00 55.67  ? 922 HOH A O     1 
HETATM 4828 O  O     . HOH D 4 .   ? 11.941  31.939  -23.472 1.00 47.62  ? 923 HOH A O     1 
HETATM 4829 O  O     . HOH D 4 .   ? 11.105  33.024  -25.585 1.00 52.53  ? 924 HOH A O     1 
HETATM 4830 O  O     . HOH D 4 .   ? 12.095  35.561  -26.107 1.00 46.68  ? 925 HOH A O     1 
HETATM 4831 O  O     . HOH D 4 .   ? -10.294 1.893   -70.413 1.00 48.41  ? 926 HOH A O     1 
HETATM 4832 O  O     . HOH D 4 .   ? 9.268   14.904  -31.140 1.00 56.63  ? 927 HOH A O     1 
HETATM 4833 O  O     . HOH D 4 .   ? -32.774 21.912  -36.180 1.00 56.88  ? 928 HOH A O     1 
HETATM 4834 O  O     . HOH D 4 .   ? -22.756 4.329   -31.834 1.00 57.51  ? 929 HOH A O     1 
HETATM 4835 O  O     . HOH D 4 .   ? 1.600   14.351  -37.088 1.00 30.82  ? 930 HOH A O     1 
HETATM 4836 O  O     . HOH D 4 .   ? -12.945 -6.961  -65.320 1.00 53.60  ? 931 HOH A O     1 
HETATM 4837 O  O     . HOH D 4 .   ? -27.815 5.385   -34.194 1.00 69.22  ? 932 HOH A O     1 
HETATM 4838 O  O     . HOH D 4 .   ? 4.086   18.907  -54.991 1.00 52.92  ? 933 HOH A O     1 
HETATM 4839 O  O     . HOH D 4 .   ? 5.978   18.882  -13.790 1.00 52.61  ? 934 HOH A O     1 
HETATM 4840 O  O     . HOH D 4 .   ? 14.160  38.140  -13.683 1.00 54.59  ? 935 HOH A O     1 
HETATM 4841 O  O     . HOH D 4 .   ? -3.375  16.949  -45.466 1.00 46.65  ? 936 HOH A O     1 
HETATM 4842 O  O     . HOH D 4 .   ? -23.504 13.598  -25.130 1.00 61.48  ? 937 HOH A O     1 
HETATM 4843 O  O     . HOH D 4 .   ? -23.533 16.664  -24.914 1.00 53.73  ? 938 HOH A O     1 
HETATM 4844 O  O     . HOH D 4 .   ? -4.619  14.391  -75.873 1.00 51.82  ? 939 HOH A O     1 
HETATM 4845 O  O     . HOH D 4 .   ? -32.160 0.499   -46.658 1.00 51.94  ? 940 HOH A O     1 
HETATM 4846 O  O     . HOH D 4 .   ? -14.678 18.633  -46.389 1.00 48.37  ? 941 HOH A O     1 
HETATM 4847 O  O     . HOH D 4 .   ? 6.853   32.031  -23.993 1.00 52.89  ? 942 HOH A O     1 
HETATM 4848 O  O     . HOH D 4 .   ? 8.296   28.840  -23.852 1.00 60.47  ? 943 HOH A O     1 
HETATM 4849 O  O     . HOH D 4 .   ? -7.735  15.002  -39.270 1.00 61.05  ? 944 HOH A O     1 
HETATM 4850 O  O     . HOH D 4 .   ? -2.011  8.748   -24.901 1.00 60.73  ? 945 HOH A O     1 
HETATM 4851 O  O     . HOH D 4 .   ? -11.646 25.184  -51.183 1.00 52.07  ? 946 HOH A O     1 
HETATM 4852 O  O     . HOH D 4 .   ? -5.757  25.883  -71.065 1.00 57.90  ? 947 HOH A O     1 
HETATM 4853 O  O     . HOH D 4 .   ? -29.964 8.588   -28.399 1.00 49.91  ? 948 HOH A O     1 
HETATM 4854 O  O     . HOH D 4 .   ? -2.784  39.696  -29.398 1.00 55.51  ? 949 HOH A O     1 
HETATM 4855 O  O     . HOH D 4 .   ? -22.348 4.508   -66.871 1.00 53.68  ? 950 HOH A O     1 
HETATM 4856 O  O     . HOH D 4 .   ? -12.164 17.588  -51.287 1.00 58.82  ? 951 HOH A O     1 
HETATM 4857 O  O     . HOH D 4 .   ? -4.374  25.307  -64.076 1.00 75.36  ? 952 HOH A O     1 
HETATM 4858 O  O     . HOH D 4 .   ? -13.753 27.127  -48.274 1.00 56.69  ? 953 HOH A O     1 
HETATM 4859 O  O     . HOH D 4 .   ? -18.891 7.010   -37.884 1.00 77.52  ? 954 HOH A O     1 
HETATM 4860 O  O     . HOH D 4 .   ? 6.628   16.732  -43.622 1.00 65.58  ? 955 HOH A O     1 
HETATM 4861 O  O     . HOH D 4 .   ? -20.131 8.511   -24.095 1.00 57.76  ? 956 HOH A O     1 
HETATM 4862 O  O     . HOH D 4 .   ? -9.143  33.814  -65.704 1.00 70.53  ? 957 HOH A O     1 
HETATM 4863 O  O     . HOH D 4 .   ? -6.839  31.089  -65.912 1.00 52.08  ? 958 HOH A O     1 
HETATM 4864 O  O     . HOH D 4 .   ? -23.250 7.259   -27.130 1.00 66.43  ? 959 HOH A O     1 
HETATM 4865 O  O     . HOH D 4 .   ? -10.406 13.647  -29.609 1.00 73.16  ? 960 HOH A O     1 
HETATM 4866 O  O     . HOH D 4 .   ? 7.837   4.347   -39.325 1.00 67.30  ? 961 HOH A O     1 
HETATM 4867 O  O     . HOH D 4 .   ? -10.037 30.488  -72.820 1.00 65.93  ? 962 HOH A O     1 
HETATM 4868 O  O     . HOH D 4 .   ? -9.436  19.118  -47.559 1.00 54.17  ? 963 HOH A O     1 
HETATM 4869 O  O     . HOH D 4 .   ? -3.055  23.408  -18.957 1.00 54.07  ? 964 HOH A O     1 
HETATM 4870 O  O     . HOH D 4 .   ? 5.328   33.459  -22.813 1.00 58.65  ? 965 HOH A O     1 
HETATM 4871 O  O     . HOH D 4 .   ? 12.371  11.299  -15.141 1.00 83.83  ? 966 HOH A O     1 
HETATM 4872 O  O     . HOH D 4 .   ? 12.365  15.246  -15.837 1.00 84.59  ? 967 HOH A O     1 
HETATM 4873 O  O     . HOH D 4 .   ? -16.488 36.267  -19.108 1.00 60.40  ? 968 HOH A O     1 
HETATM 4874 O  O     . HOH E 4 .   ? -18.801 18.496  -6.640  1.00 60.73  ? 101 HOH B O     1 
HETATM 4875 O  O     . HOH E 4 .   ? -13.802 0.389   -35.687 1.00 57.20  ? 102 HOH B O     1 
HETATM 4876 O  O     . HOH E 4 .   ? -13.868 -2.419  -40.548 1.00 44.71  ? 103 HOH B O     1 
HETATM 4877 O  O     . HOH E 4 .   ? -10.652 -1.494  -44.010 1.00 36.85  ? 104 HOH B O     1 
HETATM 4878 O  O     . HOH E 4 .   ? -7.132  2.548   -36.289 1.00 53.97  ? 105 HOH B O     1 
HETATM 4879 O  O     . HOH E 4 .   ? -13.372 34.753  -3.121  1.00 76.76  ? 106 HOH B O     1 
HETATM 4880 O  O     . HOH E 4 .   ? -17.095 5.706   -36.489 1.00 60.00  ? 107 HOH B O     1 
HETATM 4881 O  O     . HOH E 4 .   ? -18.179 3.687   -37.934 1.00 50.58  ? 108 HOH B O     1 
HETATM 4882 O  O     . HOH E 4 .   ? -19.251 2.684   -50.970 1.00 27.87  ? 109 HOH B O     1 
HETATM 4883 O  O     . HOH E 4 .   ? -20.924 9.516   -43.151 1.00 26.01  ? 110 HOH B O     1 
HETATM 4884 O  O     . HOH E 4 .   ? 3.979   18.758  -8.577  1.00 61.78  ? 111 HOH B O     1 
HETATM 4885 O  O     . HOH E 4 .   ? -23.514 -2.832  -48.452 1.00 42.42  ? 112 HOH B O     1 
HETATM 4886 O  O     . HOH E 4 .   ? -2.776  8.016   -37.219 1.00 57.57  ? 113 HOH B O     1 
HETATM 4887 O  O     . HOH E 4 .   ? -12.518 2.869   -35.875 1.00 50.30  ? 114 HOH B O     1 
HETATM 4888 O  O     . HOH E 4 .   ? -20.995 3.336   -41.880 1.00 41.36  ? 115 HOH B O     1 
HETATM 4889 O  O     . HOH E 4 .   ? -12.230 21.900  1.602   1.00 69.64  ? 116 HOH B O     1 
HETATM 4890 O  O     . HOH E 4 .   ? -23.319 -7.125  -47.536 1.00 47.84  ? 117 HOH B O     1 
HETATM 4891 O  O     . HOH E 4 .   ? -26.907 -9.349  -47.887 1.00 64.17  ? 118 HOH B O     1 
HETATM 4892 O  O     . HOH E 4 .   ? -9.788  26.563  -15.146 1.00 47.66  ? 119 HOH B O     1 
HETATM 4893 O  O     . HOH E 4 .   ? -9.509  21.532  -18.354 1.00 57.13  ? 120 HOH B O     1 
HETATM 4894 O  O     . HOH E 4 .   ? -13.438 18.826  -4.698  1.00 76.88  ? 121 HOH B O     1 
HETATM 4895 O  O     . HOH E 4 .   ? -19.573 6.695   -40.561 1.00 47.24  ? 122 HOH B O     1 
HETATM 4896 O  O     . HOH E 4 .   ? -11.631 34.280  1.364   1.00 62.38  ? 123 HOH B O     1 
HETATM 4897 O  O     . HOH E 4 .   ? -8.869  32.493  7.341   1.00 58.72  ? 124 HOH B O     1 
HETATM 4898 O  O     . HOH E 4 .   ? -10.339 40.933  -2.856  1.00 76.46  ? 125 HOH B O     1 
HETATM 4899 O  O     . HOH E 4 .   ? -14.614 39.918  -2.023  1.00 65.32  ? 126 HOH B O     1 
HETATM 4900 O  O     . HOH E 4 .   ? -12.531 6.098   -35.459 1.00 56.43  ? 127 HOH B O     1 
HETATM 4901 O  O     . HOH E 4 .   ? -14.406 13.178  -12.682 1.00 71.85  ? 128 HOH B O     1 
HETATM 4902 O  O     . HOH E 4 .   ? -2.270  7.258   -27.077 1.00 71.85  ? 129 HOH B O     1 
HETATM 4903 O  O     . HOH E 4 .   ? -12.701 20.281  -0.792  1.00 75.34  ? 130 HOH B O     1 
HETATM 4904 O  O     . HOH E 4 .   ? -12.734 17.988  -7.981  1.00 69.96  ? 131 HOH B O     1 
HETATM 4905 O  O     . HOH E 4 .   ? -20.540 1.927   -43.886 1.00 59.03  ? 132 HOH B O     1 
HETATM 4906 O  O     . HOH E 4 .   ? -9.708  40.118  6.559   1.00 67.33  ? 133 HOH B O     1 
HETATM 4907 O  O     . HOH E 4 .   ? -16.848 1.222   -36.961 1.00 41.13  ? 134 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  ALA 22  2   ?   ?   ?   A . n 
A 1 23  GLN 23  3   ?   ?   ?   A . n 
A 1 24  ALA 24  4   4   ALA ALA A . n 
A 1 25  GLU 25  5   5   GLU GLU A . n 
A 1 26  VAL 26  6   6   VAL VAL A . n 
A 1 27  TYR 27  7   7   TYR TYR A . n 
A 1 28  SER 28  8   8   SER SER A . n 
A 1 29  GLN 29  9   9   GLN GLN A . n 
A 1 30  GLU 30  10  10  GLU GLU A . n 
A 1 31  THR 31  11  11  THR THR A . n 
A 1 32  LEU 32  12  12  LEU LEU A . n 
A 1 33  ALA 33  13  13  ALA ALA A . n 
A 1 34  LYS 34  14  14  LYS LYS A . n 
A 1 35  GLN 35  15  15  GLN GLN A . n 
A 1 36  VAL 36  16  16  VAL VAL A . n 
A 1 37  LEU 37  17  17  LEU LEU A . n 
A 1 38  GLN 38  18  18  GLN GLN A . n 
A 1 39  GLU 39  19  19  GLU GLU A . n 
A 1 40  THR 40  20  20  THR THR A . n 
A 1 41  PHE 41  21  21  PHE PHE A . n 
A 1 42  GLY 42  22  22  GLY GLY A . n 
A 1 43  TYR 43  23  23  TYR TYR A . n 
A 1 44  GLN 44  24  24  GLN GLN A . n 
A 1 45  GLN 45  25  25  GLN GLN A . n 
A 1 46  PHE 46  26  26  PHE PHE A . n 
A 1 47  ARG 47  27  27  ARG ARG A . n 
A 1 48  PRO 48  28  28  PRO PRO A . n 
A 1 49  GLY 49  29  29  GLY GLY A . n 
A 1 50  GLN 50  30  30  GLN GLN A . n 
A 1 51  ALA 51  31  31  ALA ALA A . n 
A 1 52  THR 52  32  32  THR THR A . n 
A 1 53  ILE 53  33  33  ILE ILE A . n 
A 1 54  ILE 54  34  34  ILE ILE A . n 
A 1 55  ASP 55  35  35  ASP ASP A . n 
A 1 56  ALA 56  36  36  ALA ALA A . n 
A 1 57  VAL 57  37  37  VAL VAL A . n 
A 1 58  LEU 58  38  38  LEU LEU A . n 
A 1 59  GLU 59  39  39  GLU GLU A . n 
A 1 60  GLY 60  40  40  GLY GLY A . n 
A 1 61  ARG 61  41  41  ARG ARG A . n 
A 1 62  ASP 62  42  42  ASP ASP A . n 
A 1 63  CYS 63  43  43  CYS CYS A . n 
A 1 64  LEU 64  44  44  LEU LEU A . n 
A 1 65  VAL 65  45  45  VAL VAL A . n 
A 1 66  VAL 66  46  46  VAL VAL A . n 
A 1 67  MET 67  47  47  MET MET A . n 
A 1 68  PRO 68  48  48  PRO PRO A . n 
A 1 69  THR 69  49  49  THR THR A . n 
A 1 70  GLY 70  50  50  GLY GLY A . n 
A 1 71  GLY 71  51  51  GLY GLY A . n 
A 1 72  GLY 72  52  52  GLY GLY A . n 
A 1 73  LYS 73  53  53  LYS LYS A . n 
A 1 74  SER 74  54  54  SER SER A . n 
A 1 75  LEU 75  55  55  LEU LEU A . n 
A 1 76  CYS 76  56  56  CYS CYS A . n 
A 1 77  TYR 77  57  57  TYR TYR A . n 
A 1 78  GLN 78  58  58  GLN GLN A . n 
A 1 79  ILE 79  59  59  ILE ILE A . n 
A 1 80  PRO 80  60  60  PRO PRO A . n 
A 1 81  ALA 81  61  61  ALA ALA A . n 
A 1 82  LEU 82  62  62  LEU LEU A . n 
A 1 83  VAL 83  63  63  VAL VAL A . n 
A 1 84  LYS 84  64  64  LYS LYS A . n 
A 1 85  THR 85  65  65  THR THR A . n 
A 1 86  GLY 86  66  66  GLY GLY A . n 
A 1 87  LEU 87  67  67  LEU LEU A . n 
A 1 88  THR 88  68  68  THR THR A . n 
A 1 89  ILE 89  69  69  ILE ILE A . n 
A 1 90  VAL 90  70  70  VAL VAL A . n 
A 1 91  VAL 91  71  71  VAL VAL A . n 
A 1 92  SER 92  72  72  SER SER A . n 
A 1 93  PRO 93  73  73  PRO PRO A . n 
A 1 94  LEU 94  74  74  LEU LEU A . n 
A 1 95  ILE 95  75  75  ILE ILE A . n 
A 1 96  SER 96  76  76  SER SER A . n 
A 1 97  LEU 97  77  77  LEU LEU A . n 
A 1 98  MET 98  78  78  MET MET A . n 
A 1 99  LYS 99  79  79  LYS LYS A . n 
A 1 100 ASP 100 80  80  ASP ASP A . n 
A 1 101 GLN 101 81  81  GLN GLN A . n 
A 1 102 VAL 102 82  82  VAL VAL A . n 
A 1 103 ASP 103 83  83  ASP ASP A . n 
A 1 104 GLN 104 84  84  GLN GLN A . n 
A 1 105 LEU 105 85  85  LEU LEU A . n 
A 1 106 LEU 106 86  86  LEU LEU A . n 
A 1 107 ALA 107 87  87  ALA ALA A . n 
A 1 108 ASN 108 88  88  ASN ASN A . n 
A 1 109 GLY 109 89  89  GLY GLY A . n 
A 1 110 VAL 110 90  90  VAL VAL A . n 
A 1 111 ALA 111 91  91  ALA ALA A . n 
A 1 112 ALA 112 92  92  ALA ALA A . n 
A 1 113 ALA 113 93  93  ALA ALA A . n 
A 1 114 CYS 114 94  94  CYS CYS A . n 
A 1 115 LEU 115 95  95  LEU LEU A . n 
A 1 116 ASN 116 96  96  ASN ASN A . n 
A 1 117 SER 117 97  97  SER SER A . n 
A 1 118 THR 118 98  98  THR THR A . n 
A 1 119 GLN 119 99  99  GLN GLN A . n 
A 1 120 SER 120 100 100 SER SER A . n 
A 1 121 ARG 121 101 101 ARG ARG A . n 
A 1 122 GLU 122 102 102 GLU GLU A . n 
A 1 123 GLU 123 103 103 GLU GLU A . n 
A 1 124 GLN 124 104 104 GLN GLN A . n 
A 1 125 GLN 125 105 105 GLN GLN A . n 
A 1 126 ALA 126 106 106 ALA ALA A . n 
A 1 127 VAL 127 107 107 VAL VAL A . n 
A 1 128 LEU 128 108 108 LEU LEU A . n 
A 1 129 ALA 129 109 109 ALA ALA A . n 
A 1 130 GLY 130 110 110 GLY GLY A . n 
A 1 131 CYS 131 111 111 CYS CYS A . n 
A 1 132 ARG 132 112 112 ARG ARG A . n 
A 1 133 THR 133 113 113 THR THR A . n 
A 1 134 GLY 134 114 114 GLY GLY A . n 
A 1 135 GLN 135 115 115 GLN GLN A . n 
A 1 136 VAL 136 116 116 VAL VAL A . n 
A 1 137 ARG 137 117 117 ARG ARG A . n 
A 1 138 LEU 138 118 118 LEU LEU A . n 
A 1 139 LEU 139 119 119 LEU LEU A . n 
A 1 140 TYR 140 120 120 TYR TYR A . n 
A 1 141 ILE 141 121 121 ILE ILE A . n 
A 1 142 ALA 142 122 122 ALA ALA A . n 
A 1 143 PRO 143 123 123 PRO PRO A . n 
A 1 144 GLU 144 124 124 GLU GLU A . n 
A 1 145 ARG 145 125 125 ARG ARG A . n 
A 1 146 LEU 146 126 126 LEU LEU A . n 
A 1 147 MET 147 127 127 MET MET A . n 
A 1 148 MET 148 128 128 MET MET A . n 
A 1 149 ASP 149 129 129 ASP ASP A . n 
A 1 150 ASN 150 130 130 ASN ASN A . n 
A 1 151 PHE 151 131 131 PHE PHE A . n 
A 1 152 ILE 152 132 132 ILE ILE A . n 
A 1 153 ASP 153 133 133 ASP ASP A . n 
A 1 154 THR 154 134 134 THR THR A . n 
A 1 155 LEU 155 135 135 LEU LEU A . n 
A 1 156 GLY 156 136 136 GLY GLY A . n 
A 1 157 TYR 157 137 137 TYR TYR A . n 
A 1 158 TRP 158 138 138 TRP TRP A . n 
A 1 159 ASP 159 139 139 ASP ASP A . n 
A 1 160 LEU 160 140 140 LEU LEU A . n 
A 1 161 ALA 161 141 141 ALA ALA A . n 
A 1 162 MET 162 142 142 MET MET A . n 
A 1 163 VAL 163 143 143 VAL VAL A . n 
A 1 164 ALA 164 144 144 ALA ALA A . n 
A 1 165 VAL 165 145 145 VAL VAL A . n 
A 1 166 ASP 166 146 146 ASP ASP A . n 
A 1 167 GLU 167 147 147 GLU GLU A . n 
A 1 168 ALA 168 148 148 ALA ALA A . n 
A 1 169 HIS 169 149 149 HIS HIS A . n 
A 1 170 CYS 170 150 150 CYS CYS A . n 
A 1 171 ILE 171 151 151 ILE ILE A . n 
A 1 172 SER 172 152 152 SER SER A . n 
A 1 173 GLN 173 153 153 GLN GLN A . n 
A 1 174 TRP 174 154 154 TRP TRP A . n 
A 1 175 GLY 175 155 155 GLY GLY A . n 
A 1 176 HIS 176 156 156 HIS HIS A . n 
A 1 177 ASP 177 157 157 ASP ASP A . n 
A 1 178 PHE 178 158 158 PHE PHE A . n 
A 1 179 ARG 179 159 159 ARG ARG A . n 
A 1 180 PRO 180 160 160 PRO PRO A . n 
A 1 181 GLU 181 161 161 GLU GLU A . n 
A 1 182 TYR 182 162 162 TYR TYR A . n 
A 1 183 ALA 183 163 163 ALA ALA A . n 
A 1 184 ALA 184 164 164 ALA ALA A . n 
A 1 185 LEU 185 165 165 LEU LEU A . n 
A 1 186 GLY 186 166 166 GLY GLY A . n 
A 1 187 GLN 187 167 167 GLN GLN A . n 
A 1 188 LEU 188 168 168 LEU LEU A . n 
A 1 189 ARG 189 169 169 ARG ARG A . n 
A 1 190 ALA 190 170 170 ALA ALA A . n 
A 1 191 ARG 191 171 171 ARG ARG A . n 
A 1 192 PHE 192 172 172 PHE PHE A . n 
A 1 193 PRO 193 173 173 PRO PRO A . n 
A 1 194 ALA 194 174 174 ALA ALA A . n 
A 1 195 VAL 195 175 175 VAL VAL A . n 
A 1 196 PRO 196 176 176 PRO PRO A . n 
A 1 197 PHE 197 177 177 PHE PHE A . n 
A 1 198 MET 198 178 178 MET MET A . n 
A 1 199 ALA 199 179 179 ALA ALA A . n 
A 1 200 LEU 200 180 180 LEU LEU A . n 
A 1 201 THR 201 181 181 THR THR A . n 
A 1 202 ALA 202 182 182 ALA ALA A . n 
A 1 203 THR 203 183 183 THR THR A . n 
A 1 204 ALA 204 184 184 ALA ALA A . n 
A 1 205 ASP 205 185 185 ASP ASP A . n 
A 1 206 ASP 206 186 186 ASP ASP A . n 
A 1 207 THR 207 187 187 THR THR A . n 
A 1 208 THR 208 188 188 THR THR A . n 
A 1 209 ARG 209 189 189 ARG ARG A . n 
A 1 210 ARG 210 190 190 ARG ARG A . n 
A 1 211 ASP 211 191 191 ASP ASP A . n 
A 1 212 ILE 212 192 192 ILE ILE A . n 
A 1 213 VAL 213 193 193 VAL VAL A . n 
A 1 214 ARG 214 194 194 ARG ARG A . n 
A 1 215 LEU 215 195 195 LEU LEU A . n 
A 1 216 LEU 216 196 196 LEU LEU A . n 
A 1 217 GLY 217 197 197 GLY GLY A . n 
A 1 218 LEU 218 198 198 LEU LEU A . n 
A 1 219 ASP 219 199 199 ASP ASP A . n 
A 1 220 ASP 220 200 200 ASP ASP A . n 
A 1 221 PRO 221 201 201 PRO PRO A . n 
A 1 222 LEU 222 202 202 LEU LEU A . n 
A 1 223 ILE 223 203 203 ILE ILE A . n 
A 1 224 GLU 224 204 204 GLU GLU A . n 
A 1 225 ILE 225 205 205 ILE ILE A . n 
A 1 226 SER 226 206 206 SER SER A . n 
A 1 227 SER 227 207 207 SER SER A . n 
A 1 228 PHE 228 208 208 PHE PHE A . n 
A 1 229 ASP 229 209 209 ASP ASP A . n 
A 1 230 ARG 230 210 210 ARG ARG A . n 
A 1 231 PRO 231 211 211 PRO PRO A . n 
A 1 232 ASN 232 212 212 ASN ASN A . n 
A 1 233 ILE 233 213 213 ILE ILE A . n 
A 1 234 ARG 234 214 214 ARG ARG A . n 
A 1 235 TYR 235 215 215 TYR TYR A . n 
A 1 236 MET 236 216 216 MET MET A . n 
A 1 237 LEU 237 217 217 LEU LEU A . n 
A 1 238 MET 238 218 218 MET MET A . n 
A 1 239 GLU 239 219 219 GLU GLU A . n 
A 1 240 LYS 240 220 220 LYS LYS A . n 
A 1 241 PHE 241 221 221 PHE PHE A . n 
A 1 242 LYS 242 222 222 LYS LYS A . n 
A 1 243 PRO 243 223 223 PRO PRO A . n 
A 1 244 LEU 244 224 224 LEU LEU A . n 
A 1 245 ASP 245 225 225 ASP ASP A . n 
A 1 246 GLN 246 226 226 GLN GLN A . n 
A 1 247 LEU 247 227 227 LEU LEU A . n 
A 1 248 MET 248 228 228 MET MET A . n 
A 1 249 ARG 249 229 229 ARG ARG A . n 
A 1 250 TYR 250 230 230 TYR TYR A . n 
A 1 251 VAL 251 231 231 VAL VAL A . n 
A 1 252 GLN 252 232 232 GLN GLN A . n 
A 1 253 GLU 253 233 233 GLU GLU A . n 
A 1 254 GLN 254 234 234 GLN GLN A . n 
A 1 255 ARG 255 235 235 ARG ARG A . n 
A 1 256 GLY 256 236 236 GLY GLY A . n 
A 1 257 LYS 257 237 237 LYS LYS A . n 
A 1 258 SER 258 238 238 SER SER A . n 
A 1 259 GLY 259 239 239 GLY GLY A . n 
A 1 260 ILE 260 240 240 ILE ILE A . n 
A 1 261 ILE 261 241 241 ILE ILE A . n 
A 1 262 TYR 262 242 242 TYR TYR A . n 
A 1 263 CYS 263 243 243 CYS CYS A . n 
A 1 264 ASN 264 244 244 ASN ASN A . n 
A 1 265 SER 265 245 245 SER SER A . n 
A 1 266 ARG 266 246 246 ARG ARG A . n 
A 1 267 ALA 267 247 247 ALA ALA A . n 
A 1 268 LYS 268 248 248 LYS LYS A . n 
A 1 269 VAL 269 249 249 VAL VAL A . n 
A 1 270 GLU 270 250 250 GLU GLU A . n 
A 1 271 ASP 271 251 251 ASP ASP A . n 
A 1 272 THR 272 252 252 THR THR A . n 
A 1 273 ALA 273 253 253 ALA ALA A . n 
A 1 274 ALA 274 254 254 ALA ALA A . n 
A 1 275 ARG 275 255 255 ARG ARG A . n 
A 1 276 LEU 276 256 256 LEU LEU A . n 
A 1 277 GLN 277 257 257 GLN GLN A . n 
A 1 278 SER 278 258 258 SER SER A . n 
A 1 279 ARG 279 259 259 ARG ARG A . n 
A 1 280 GLY 280 260 260 GLY GLY A . n 
A 1 281 ILE 281 261 261 ILE ILE A . n 
A 1 282 SER 282 262 262 SER SER A . n 
A 1 283 ALA 283 263 263 ALA ALA A . n 
A 1 284 ALA 284 264 264 ALA ALA A . n 
A 1 285 ALA 285 265 265 ALA ALA A . n 
A 1 286 TYR 286 266 266 TYR TYR A . n 
A 1 287 HIS 287 267 267 HIS HIS A . n 
A 1 288 ALA 288 268 268 ALA ALA A . n 
A 1 289 GLY 289 269 269 GLY GLY A . n 
A 1 290 LEU 290 270 270 LEU LEU A . n 
A 1 291 GLU 291 271 271 GLU GLU A . n 
A 1 292 HIS 292 272 272 HIS HIS A . n 
A 1 293 GLU 293 273 273 GLU GLU A . n 
A 1 294 VAL 294 274 274 VAL VAL A . n 
A 1 295 ARG 295 275 275 ARG ARG A . n 
A 1 296 ALA 296 276 276 ALA ALA A . n 
A 1 297 SER 297 277 277 SER SER A . n 
A 1 298 VAL 298 278 278 VAL VAL A . n 
A 1 299 GLN 299 279 279 GLN GLN A . n 
A 1 300 GLU 300 280 280 GLU GLU A . n 
A 1 301 LYS 301 281 281 LYS LYS A . n 
A 1 302 PHE 302 282 282 PHE PHE A . n 
A 1 303 GLN 303 283 283 GLN GLN A . n 
A 1 304 ARG 304 284 284 ARG ARG A . n 
A 1 305 ASP 305 285 285 ASP ASP A . n 
A 1 306 ASP 306 286 286 ASP ASP A . n 
A 1 307 LEU 307 287 287 LEU LEU A . n 
A 1 308 GLN 308 288 288 GLN GLN A . n 
A 1 309 ILE 309 289 289 ILE ILE A . n 
A 1 310 VAL 310 290 290 VAL VAL A . n 
A 1 311 VAL 311 291 291 VAL VAL A . n 
A 1 312 ALA 312 292 292 ALA ALA A . n 
A 1 313 THR 313 293 293 THR THR A . n 
A 1 314 VAL 314 294 294 VAL VAL A . n 
A 1 315 ALA 315 295 295 ALA ALA A . n 
A 1 316 PHE 316 296 296 PHE PHE A . n 
A 1 317 GLY 317 297 297 GLY GLY A . n 
A 1 318 MET 318 298 298 MET MET A . n 
A 1 319 GLY 319 299 299 GLY GLY A . n 
A 1 320 ILE 320 300 300 ILE ILE A . n 
A 1 321 ASN 321 301 301 ASN ASN A . n 
A 1 322 LYS 322 302 302 LYS LYS A . n 
A 1 323 PRO 323 303 303 PRO PRO A . n 
A 1 324 ASN 324 304 304 ASN ASN A . n 
A 1 325 VAL 325 305 305 VAL VAL A . n 
A 1 326 ARG 326 306 306 ARG ARG A . n 
A 1 327 PHE 327 307 307 PHE PHE A . n 
A 1 328 VAL 328 308 308 VAL VAL A . n 
A 1 329 VAL 329 309 309 VAL VAL A . n 
A 1 330 HIS 330 310 310 HIS HIS A . n 
A 1 331 PHE 331 311 311 PHE PHE A . n 
A 1 332 ASP 332 312 312 ASP ASP A . n 
A 1 333 ILE 333 313 313 ILE ILE A . n 
A 1 334 PRO 334 314 314 PRO PRO A . n 
A 1 335 ARG 335 315 315 ARG ARG A . n 
A 1 336 ASN 336 316 316 ASN ASN A . n 
A 1 337 ILE 337 317 317 ILE ILE A . n 
A 1 338 GLU 338 318 318 GLU GLU A . n 
A 1 339 SER 339 319 319 SER SER A . n 
A 1 340 TYR 340 320 320 TYR TYR A . n 
A 1 341 TYR 341 321 321 TYR TYR A . n 
A 1 342 GLN 342 322 322 GLN GLN A . n 
A 1 343 GLU 343 323 323 GLU GLU A . n 
A 1 344 THR 344 324 324 THR THR A . n 
A 1 345 GLY 345 325 325 GLY GLY A . n 
A 1 346 ARG 346 326 326 ARG ARG A . n 
A 1 347 ALA 347 327 327 ALA ALA A . n 
A 1 348 GLY 348 328 328 GLY GLY A . n 
A 1 349 ARG 349 329 329 ARG ARG A . n 
A 1 350 ASP 350 330 330 ASP ASP A . n 
A 1 351 GLY 351 331 331 GLY GLY A . n 
A 1 352 LEU 352 332 332 LEU LEU A . n 
A 1 353 PRO 353 333 333 PRO PRO A . n 
A 1 354 ALA 354 334 334 ALA ALA A . n 
A 1 355 GLU 355 335 335 GLU GLU A . n 
A 1 356 ALA 356 336 336 ALA ALA A . n 
A 1 357 MET 357 337 337 MET MET A . n 
A 1 358 LEU 358 338 338 LEU LEU A . n 
A 1 359 PHE 359 339 339 PHE PHE A . n 
A 1 360 TYR 360 340 340 TYR TYR A . n 
A 1 361 ASP 361 341 341 ASP ASP A . n 
A 1 362 PRO 362 342 342 PRO PRO A . n 
A 1 363 ALA 363 343 343 ALA ALA A . n 
A 1 364 ASP 364 344 344 ASP ASP A . n 
A 1 365 MET 365 345 345 MET MET A . n 
A 1 366 ALA 366 346 346 ALA ALA A . n 
A 1 367 TRP 367 347 347 TRP TRP A . n 
A 1 368 LEU 368 348 348 LEU LEU A . n 
A 1 369 ARG 369 349 349 ARG ARG A . n 
A 1 370 ARG 370 350 350 ARG ARG A . n 
A 1 371 CYS 371 351 351 CYS CYS A . n 
A 1 372 LEU 372 352 352 LEU LEU A . n 
A 1 373 GLU 373 353 353 GLU GLU A . n 
A 1 374 GLU 374 354 354 GLU GLU A . n 
A 1 375 LYS 375 355 355 LYS LYS A . n 
A 1 376 ALA 376 356 356 ALA ALA A . n 
A 1 377 PRO 377 357 357 PRO PRO A . n 
A 1 378 GLY 378 358 358 GLY GLY A . n 
A 1 379 PRO 379 359 359 PRO PRO A . n 
A 1 380 LEU 380 360 360 LEU LEU A . n 
A 1 381 GLN 381 361 361 GLN GLN A . n 
A 1 382 ASP 382 362 362 ASP ASP A . n 
A 1 383 ILE 383 363 363 ILE ILE A . n 
A 1 384 GLU 384 364 364 GLU GLU A . n 
A 1 385 ARG 385 365 365 ARG ARG A . n 
A 1 386 HIS 386 366 366 HIS HIS A . n 
A 1 387 LYS 387 367 367 LYS LYS A . n 
A 1 388 LEU 388 368 368 LEU LEU A . n 
A 1 389 ASN 389 369 369 ASN ASN A . n 
A 1 390 ALA 390 370 370 ALA ALA A . n 
A 1 391 MET 391 371 371 MET MET A . n 
A 1 392 GLY 392 372 372 GLY GLY A . n 
A 1 393 ALA 393 373 373 ALA ALA A . n 
A 1 394 PHE 394 374 374 PHE PHE A . n 
A 1 395 ALA 395 375 375 ALA ALA A . n 
A 1 396 GLU 396 376 376 GLU GLU A . n 
A 1 397 ALA 397 377 377 ALA ALA A . n 
A 1 398 GLN 398 378 378 GLN GLN A . n 
A 1 399 THR 399 379 379 THR THR A . n 
A 1 400 CYS 400 380 380 CYS CYS A . n 
A 1 401 ARG 401 381 381 ARG ARG A . n 
A 1 402 ARG 402 382 382 ARG ARG A . n 
A 1 403 LEU 403 383 383 LEU LEU A . n 
A 1 404 VAL 404 384 384 VAL VAL A . n 
A 1 405 LEU 405 385 385 LEU LEU A . n 
A 1 406 LEU 406 386 386 LEU LEU A . n 
A 1 407 ASN 407 387 387 ASN ASN A . n 
A 1 408 TYR 408 388 388 TYR TYR A . n 
A 1 409 PHE 409 389 389 PHE PHE A . n 
A 1 410 GLY 410 390 390 GLY GLY A . n 
A 1 411 GLU 411 391 391 GLU GLU A . n 
A 1 412 GLY 412 392 392 GLY GLY A . n 
A 1 413 ARG 413 393 393 ARG ARG A . n 
A 1 414 GLN 414 394 394 GLN GLN A . n 
A 1 415 ALA 415 395 395 ALA ALA A . n 
A 1 416 PRO 416 396 396 PRO PRO A . n 
A 1 417 CYS 417 397 397 CYS CYS A . n 
A 1 418 GLY 418 398 398 GLY GLY A . n 
A 1 419 ASN 419 399 399 ASN ASN A . n 
A 1 420 CYS 420 400 400 CYS CYS A . n 
A 1 421 ASP 421 401 401 ASP ASP A . n 
A 1 422 ILE 422 402 402 ILE ILE A . n 
A 1 423 CYS 423 403 403 CYS CYS A . n 
A 1 424 LEU 424 404 404 LEU LEU A . n 
A 1 425 ASP 425 405 405 ASP ASP A . n 
A 1 426 PRO 426 406 406 PRO PRO A . n 
A 1 427 PRO 427 407 407 PRO PRO A . n 
A 1 428 ARG 428 408 408 ARG ARG A . n 
A 1 429 ARG 429 409 409 ARG ARG A . n 
A 1 430 TYR 430 410 410 TYR TYR A . n 
A 1 431 ASP 431 411 411 ASP ASP A . n 
A 1 432 GLY 432 412 412 GLY GLY A . n 
A 1 433 LEU 433 413 413 LEU LEU A . n 
A 1 434 VAL 434 414 414 VAL VAL A . n 
A 1 435 ASP 435 415 415 ASP ASP A . n 
A 1 436 ALA 436 416 416 ALA ALA A . n 
A 1 437 GLN 437 417 417 GLN GLN A . n 
A 1 438 LYS 438 418 418 LYS LYS A . n 
A 1 439 ALA 439 419 419 ALA ALA A . n 
A 1 440 LEU 440 420 420 LEU LEU A . n 
A 1 441 SER 441 421 421 SER SER A . n 
A 1 442 ALA 442 422 422 ALA ALA A . n 
A 1 443 ILE 443 423 423 ILE ILE A . n 
A 1 444 ALA 444 424 424 ALA ALA A . n 
A 1 445 ARG 445 425 425 ARG ARG A . n 
A 1 446 VAL 446 426 426 VAL VAL A . n 
A 1 447 GLU 447 427 427 GLU GLU A . n 
A 1 448 GLN 448 428 428 GLN GLN A . n 
A 1 449 ARG 449 429 429 ARG ARG A . n 
A 1 450 PHE 450 430 430 PHE PHE A . n 
A 1 451 GLY 451 431 431 GLY GLY A . n 
A 1 452 MET 452 432 432 MET MET A . n 
A 1 453 GLY 453 433 433 GLY GLY A . n 
A 1 454 TYR 454 434 434 TYR TYR A . n 
A 1 455 VAL 455 435 435 VAL VAL A . n 
A 1 456 VAL 456 436 436 VAL VAL A . n 
A 1 457 GLU 457 437 437 GLU GLU A . n 
A 1 458 VAL 458 438 438 VAL VAL A . n 
A 1 459 LEU 459 439 439 LEU LEU A . n 
A 1 460 ARG 460 440 440 ARG ARG A . n 
A 1 461 GLY 461 441 441 GLY GLY A . n 
A 1 462 ALA 462 442 442 ALA ALA A . n 
A 1 463 ASN 463 443 443 ASN ASN A . n 
A 1 464 ASN 464 444 444 ASN ASN A . n 
A 1 465 GLN 465 445 445 GLN GLN A . n 
A 1 466 ARG 466 446 446 ARG ARG A . n 
A 1 467 ILE 467 447 447 ILE ILE A . n 
A 1 468 ARG 468 448 448 ARG ARG A . n 
A 1 469 GLU 469 449 449 GLU GLU A . n 
A 1 470 LEU 470 450 450 LEU LEU A . n 
A 1 471 GLY 471 451 451 GLY GLY A . n 
A 1 472 HIS 472 452 452 HIS HIS A . n 
A 1 473 ASP 473 453 453 ASP ASP A . n 
A 1 474 LYS 474 454 454 LYS LYS A . n 
A 1 475 LEU 475 455 455 LEU LEU A . n 
A 1 476 LYS 476 456 456 LYS LYS A . n 
A 1 477 VAL 477 457 457 VAL VAL A . n 
A 1 478 TYR 478 458 458 TYR TYR A . n 
A 1 479 GLY 479 459 459 GLY GLY A . n 
A 1 480 ILE 480 460 460 ILE ILE A . n 
A 1 481 GLY 481 461 461 GLY GLY A . n 
A 1 482 ARG 482 462 462 ARG ARG A . n 
A 1 483 ASP 483 463 463 ASP ASP A . n 
A 1 484 GLN 484 464 464 GLN GLN A . n 
A 1 485 SER 485 465 465 SER SER A . n 
A 1 486 GLN 486 466 466 GLN GLN A . n 
A 1 487 GLU 487 467 467 GLU GLU A . n 
A 1 488 HIS 488 468 468 HIS HIS A . n 
A 1 489 TRP 489 469 469 TRP TRP A . n 
A 1 490 VAL 490 470 470 VAL VAL A . n 
A 1 491 SER 491 471 471 SER SER A . n 
A 1 492 VAL 492 472 472 VAL VAL A . n 
A 1 493 ILE 493 473 473 ILE ILE A . n 
A 1 494 ARG 494 474 474 ARG ARG A . n 
A 1 495 GLN 495 475 475 GLN GLN A . n 
A 1 496 LEU 496 476 476 LEU LEU A . n 
A 1 497 ILE 497 477 477 ILE ILE A . n 
A 1 498 HIS 498 478 478 HIS HIS A . n 
A 1 499 LEU 499 479 479 LEU LEU A . n 
A 1 500 GLY 500 480 480 GLY GLY A . n 
A 1 501 VAL 501 481 481 VAL VAL A . n 
A 1 502 VAL 502 482 482 VAL VAL A . n 
A 1 503 THR 503 483 483 THR THR A . n 
A 1 504 GLN 504 484 484 GLN GLN A . n 
A 1 505 ASN 505 485 485 ASN ASN A . n 
A 1 506 ILE 506 486 486 ILE ILE A . n 
A 1 507 ALA 507 487 487 ALA ALA A . n 
A 1 508 GLN 508 488 488 GLN GLN A . n 
A 1 509 HIS 509 489 489 HIS HIS A . n 
A 1 510 SER 510 490 490 SER SER A . n 
A 1 511 ALA 511 491 491 ALA ALA A . n 
A 1 512 LEU 512 492 492 LEU LEU A . n 
A 1 513 GLN 513 493 493 GLN GLN A . n 
A 1 514 LEU 514 494 494 LEU LEU A . n 
A 1 515 THR 515 495 495 THR THR A . n 
A 1 516 GLU 516 496 496 GLU GLU A . n 
A 1 517 ALA 517 497 497 ALA ALA A . n 
A 1 518 ALA 518 498 498 ALA ALA A . n 
A 1 519 ARG 519 499 499 ARG ARG A . n 
A 1 520 PRO 520 500 500 PRO PRO A . n 
A 1 521 PHE 521 501 501 PHE PHE A . n 
A 1 522 LEU 522 502 502 LEU LEU A . n 
A 1 523 ARG 523 503 503 ARG ARG A . n 
A 1 524 GLY 524 504 504 GLY GLY A . n 
A 1 525 GLU 525 505 505 GLU GLU A . n 
A 1 526 ALA 526 506 506 ALA ALA A . n 
A 1 527 PRO 527 507 507 PRO PRO A . n 
A 1 528 LEU 528 508 508 LEU LEU A . n 
A 1 529 MET 529 509 509 MET MET A . n 
A 1 530 LEU 530 510 510 LEU LEU A . n 
A 1 531 ALA 531 511 511 ALA ALA A . n 
A 1 532 VAL 532 512 512 VAL VAL A . n 
A 1 533 PRO 533 513 513 PRO PRO A . n 
A 1 534 ARG 534 514 514 ARG ARG A . n 
A 1 535 VAL 535 515 ?   ?   ?   A . n 
A 1 536 ALA 536 516 ?   ?   ?   A . n 
A 1 537 ALA 537 517 ?   ?   ?   A . n 
A 1 538 LEU 538 518 ?   ?   ?   A . n 
A 1 539 LYS 539 519 ?   ?   ?   A . n 
A 1 540 PRO 540 520 ?   ?   ?   A . n 
A 1 541 ARG 541 521 ?   ?   ?   A . n 
B 2 1   DC  1   1   ?   ?   ?   B . n 
B 2 2   DG  2   2   ?   ?   ?   B . n 
B 2 3   DG  3   3   3   DG  DG  B . n 
B 2 4   DT  4   4   4   DT  DT  B . n 
B 2 5   DA  5   5   5   DA  DA  B . n 
B 2 6   DG  6   6   6   DG  DG  B . n 
B 2 7   DA  7   7   7   DA  DA  B . n 
B 2 8   DA  8   8   8   DA  DA  B . n 
B 2 9   DT  9   9   9   DT  DT  B . n 
B 2 10  DT  10  10  10  DT  DT  B . n 
B 2 11  DG  11  11  11  DG  DG  B . n 
B 2 12  DT  12  12  ?   ?   ?   B . n 
B 2 13  DA  13  13  ?   ?   ?   B . n 
B 2 14  DA  14  14  14  DA  DA  B . n 
B 2 15  DA  15  15  15  DA  DA  B . n 
B 2 16  DA  16  16  16  DA  DA  B . n 
B 2 17  DT  17  17  17  DT  DT  B . n 
B 2 18  DT  18  18  18  DT  DT  B . n 
B 2 19  DC  19  19  19  DC  DC  B . n 
B 2 20  DT  20  20  20  DT  DT  B . n 
B 2 21  DA  21  21  21  DA  DA  B . n 
B 2 22  DC  22  22  22  DC  DC  B . n 
B 2 23  DC  23  23  23  DC  DC  B . n 
B 2 24  DG  24  24  24  DG  DG  B . n 
B 2 25  DG  25  25  25  DG  DG  B . n 
B 2 26  DT  26  26  26  DT  DT  B . n 
B 2 27  DG  27  27  27  DG  DG  B . n 
B 2 28  DC  28  28  28  DC  DC  B . n 
B 2 29  DC  29  29  29  DC  DC  B . n 
B 2 30  DT  30  30  30  DT  DT  B . n 
B 2 31  DT  31  31  31  DT  DT  B . n 
B 2 32  DA  32  32  32  DA  DA  B . n 
B 2 33  DC  33  33  33  DC  DC  B . n 
B 2 34  DT  34  34  ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 ZN  1   601 1   ZN  ZN  A . 
D 4 HOH 1   701 131 HOH HOH A . 
D 4 HOH 2   702 263 HOH HOH A . 
D 4 HOH 3   703 129 HOH HOH A . 
D 4 HOH 4   704 125 HOH HOH A . 
D 4 HOH 5   705 293 HOH HOH A . 
D 4 HOH 6   706 144 HOH HOH A . 
D 4 HOH 7   707 190 HOH HOH A . 
D 4 HOH 8   708 62  HOH HOH A . 
D 4 HOH 9   709 218 HOH HOH A . 
D 4 HOH 10  710 148 HOH HOH A . 
D 4 HOH 11  711 120 HOH HOH A . 
D 4 HOH 12  712 65  HOH HOH A . 
D 4 HOH 13  713 279 HOH HOH A . 
D 4 HOH 14  714 291 HOH HOH A . 
D 4 HOH 15  715 15  HOH HOH A . 
D 4 HOH 16  716 29  HOH HOH A . 
D 4 HOH 17  717 238 HOH HOH A . 
D 4 HOH 18  718 271 HOH HOH A . 
D 4 HOH 19  719 57  HOH HOH A . 
D 4 HOH 20  720 278 HOH HOH A . 
D 4 HOH 21  721 75  HOH HOH A . 
D 4 HOH 22  722 20  HOH HOH A . 
D 4 HOH 23  723 191 HOH HOH A . 
D 4 HOH 24  724 80  HOH HOH A . 
D 4 HOH 25  725 63  HOH HOH A . 
D 4 HOH 26  726 10  HOH HOH A . 
D 4 HOH 27  727 69  HOH HOH A . 
D 4 HOH 28  728 145 HOH HOH A . 
D 4 HOH 29  729 197 HOH HOH A . 
D 4 HOH 30  730 55  HOH HOH A . 
D 4 HOH 31  731 21  HOH HOH A . 
D 4 HOH 32  732 64  HOH HOH A . 
D 4 HOH 33  733 40  HOH HOH A . 
D 4 HOH 34  734 130 HOH HOH A . 
D 4 HOH 35  735 206 HOH HOH A . 
D 4 HOH 36  736 169 HOH HOH A . 
D 4 HOH 37  737 214 HOH HOH A . 
D 4 HOH 38  738 126 HOH HOH A . 
D 4 HOH 39  739 157 HOH HOH A . 
D 4 HOH 40  740 59  HOH HOH A . 
D 4 HOH 41  741 13  HOH HOH A . 
D 4 HOH 42  742 44  HOH HOH A . 
D 4 HOH 43  743 60  HOH HOH A . 
D 4 HOH 44  744 203 HOH HOH A . 
D 4 HOH 45  745 9   HOH HOH A . 
D 4 HOH 46  746 116 HOH HOH A . 
D 4 HOH 47  747 202 HOH HOH A . 
D 4 HOH 48  748 266 HOH HOH A . 
D 4 HOH 49  749 22  HOH HOH A . 
D 4 HOH 50  750 70  HOH HOH A . 
D 4 HOH 51  751 162 HOH HOH A . 
D 4 HOH 52  752 16  HOH HOH A . 
D 4 HOH 53  753 79  HOH HOH A . 
D 4 HOH 54  754 166 HOH HOH A . 
D 4 HOH 55  755 156 HOH HOH A . 
D 4 HOH 56  756 219 HOH HOH A . 
D 4 HOH 57  757 17  HOH HOH A . 
D 4 HOH 58  758 91  HOH HOH A . 
D 4 HOH 59  759 24  HOH HOH A . 
D 4 HOH 60  760 215 HOH HOH A . 
D 4 HOH 61  761 256 HOH HOH A . 
D 4 HOH 62  762 231 HOH HOH A . 
D 4 HOH 63  763 74  HOH HOH A . 
D 4 HOH 64  764 235 HOH HOH A . 
D 4 HOH 65  765 194 HOH HOH A . 
D 4 HOH 66  766 201 HOH HOH A . 
D 4 HOH 67  767 253 HOH HOH A . 
D 4 HOH 68  768 241 HOH HOH A . 
D 4 HOH 69  769 200 HOH HOH A . 
D 4 HOH 70  770 204 HOH HOH A . 
D 4 HOH 71  771 234 HOH HOH A . 
D 4 HOH 72  772 196 HOH HOH A . 
D 4 HOH 73  773 274 HOH HOH A . 
D 4 HOH 74  774 275 HOH HOH A . 
D 4 HOH 75  775 247 HOH HOH A . 
D 4 HOH 76  776 205 HOH HOH A . 
D 4 HOH 77  777 217 HOH HOH A . 
D 4 HOH 78  778 243 HOH HOH A . 
D 4 HOH 79  779 295 HOH HOH A . 
D 4 HOH 80  780 232 HOH HOH A . 
D 4 HOH 81  781 246 HOH HOH A . 
D 4 HOH 82  782 207 HOH HOH A . 
D 4 HOH 83  783 117 HOH HOH A . 
D 4 HOH 84  784 230 HOH HOH A . 
D 4 HOH 85  785 2   HOH HOH A . 
D 4 HOH 86  786 3   HOH HOH A . 
D 4 HOH 87  787 6   HOH HOH A . 
D 4 HOH 88  788 7   HOH HOH A . 
D 4 HOH 89  789 8   HOH HOH A . 
D 4 HOH 90  790 11  HOH HOH A . 
D 4 HOH 91  791 12  HOH HOH A . 
D 4 HOH 92  792 14  HOH HOH A . 
D 4 HOH 93  793 19  HOH HOH A . 
D 4 HOH 94  794 23  HOH HOH A . 
D 4 HOH 95  795 25  HOH HOH A . 
D 4 HOH 96  796 26  HOH HOH A . 
D 4 HOH 97  797 27  HOH HOH A . 
D 4 HOH 98  798 28  HOH HOH A . 
D 4 HOH 99  799 30  HOH HOH A . 
D 4 HOH 100 800 31  HOH HOH A . 
D 4 HOH 101 801 32  HOH HOH A . 
D 4 HOH 102 802 33  HOH HOH A . 
D 4 HOH 103 803 34  HOH HOH A . 
D 4 HOH 104 804 35  HOH HOH A . 
D 4 HOH 105 805 36  HOH HOH A . 
D 4 HOH 106 806 37  HOH HOH A . 
D 4 HOH 107 807 38  HOH HOH A . 
D 4 HOH 108 808 39  HOH HOH A . 
D 4 HOH 109 809 41  HOH HOH A . 
D 4 HOH 110 810 42  HOH HOH A . 
D 4 HOH 111 811 43  HOH HOH A . 
D 4 HOH 112 812 45  HOH HOH A . 
D 4 HOH 113 813 46  HOH HOH A . 
D 4 HOH 114 814 47  HOH HOH A . 
D 4 HOH 115 815 48  HOH HOH A . 
D 4 HOH 116 816 49  HOH HOH A . 
D 4 HOH 117 817 50  HOH HOH A . 
D 4 HOH 118 818 51  HOH HOH A . 
D 4 HOH 119 819 52  HOH HOH A . 
D 4 HOH 120 820 54  HOH HOH A . 
D 4 HOH 121 821 56  HOH HOH A . 
D 4 HOH 122 822 58  HOH HOH A . 
D 4 HOH 123 823 61  HOH HOH A . 
D 4 HOH 124 824 66  HOH HOH A . 
D 4 HOH 125 825 67  HOH HOH A . 
D 4 HOH 126 826 68  HOH HOH A . 
D 4 HOH 127 827 71  HOH HOH A . 
D 4 HOH 128 828 72  HOH HOH A . 
D 4 HOH 129 829 73  HOH HOH A . 
D 4 HOH 130 830 76  HOH HOH A . 
D 4 HOH 131 831 77  HOH HOH A . 
D 4 HOH 132 832 78  HOH HOH A . 
D 4 HOH 133 833 81  HOH HOH A . 
D 4 HOH 134 834 82  HOH HOH A . 
D 4 HOH 135 835 83  HOH HOH A . 
D 4 HOH 136 836 84  HOH HOH A . 
D 4 HOH 137 837 85  HOH HOH A . 
D 4 HOH 138 838 86  HOH HOH A . 
D 4 HOH 139 839 87  HOH HOH A . 
D 4 HOH 140 840 88  HOH HOH A . 
D 4 HOH 141 841 89  HOH HOH A . 
D 4 HOH 142 842 90  HOH HOH A . 
D 4 HOH 143 843 92  HOH HOH A . 
D 4 HOH 144 844 93  HOH HOH A . 
D 4 HOH 145 845 94  HOH HOH A . 
D 4 HOH 146 846 95  HOH HOH A . 
D 4 HOH 147 847 97  HOH HOH A . 
D 4 HOH 148 848 98  HOH HOH A . 
D 4 HOH 149 849 99  HOH HOH A . 
D 4 HOH 150 850 100 HOH HOH A . 
D 4 HOH 151 851 101 HOH HOH A . 
D 4 HOH 152 852 102 HOH HOH A . 
D 4 HOH 153 853 103 HOH HOH A . 
D 4 HOH 154 854 104 HOH HOH A . 
D 4 HOH 155 855 106 HOH HOH A . 
D 4 HOH 156 856 108 HOH HOH A . 
D 4 HOH 157 857 110 HOH HOH A . 
D 4 HOH 158 858 111 HOH HOH A . 
D 4 HOH 159 859 112 HOH HOH A . 
D 4 HOH 160 860 113 HOH HOH A . 
D 4 HOH 161 861 114 HOH HOH A . 
D 4 HOH 162 862 115 HOH HOH A . 
D 4 HOH 163 863 118 HOH HOH A . 
D 4 HOH 164 864 119 HOH HOH A . 
D 4 HOH 165 865 121 HOH HOH A . 
D 4 HOH 166 866 122 HOH HOH A . 
D 4 HOH 167 867 123 HOH HOH A . 
D 4 HOH 168 868 124 HOH HOH A . 
D 4 HOH 169 869 127 HOH HOH A . 
D 4 HOH 170 870 128 HOH HOH A . 
D 4 HOH 171 871 132 HOH HOH A . 
D 4 HOH 172 872 133 HOH HOH A . 
D 4 HOH 173 873 134 HOH HOH A . 
D 4 HOH 174 874 135 HOH HOH A . 
D 4 HOH 175 875 136 HOH HOH A . 
D 4 HOH 176 876 137 HOH HOH A . 
D 4 HOH 177 877 138 HOH HOH A . 
D 4 HOH 178 878 139 HOH HOH A . 
D 4 HOH 179 879 140 HOH HOH A . 
D 4 HOH 180 880 141 HOH HOH A . 
D 4 HOH 181 881 142 HOH HOH A . 
D 4 HOH 182 882 147 HOH HOH A . 
D 4 HOH 183 883 149 HOH HOH A . 
D 4 HOH 184 884 150 HOH HOH A . 
D 4 HOH 185 885 151 HOH HOH A . 
D 4 HOH 186 886 152 HOH HOH A . 
D 4 HOH 187 887 153 HOH HOH A . 
D 4 HOH 188 888 154 HOH HOH A . 
D 4 HOH 189 889 158 HOH HOH A . 
D 4 HOH 190 890 160 HOH HOH A . 
D 4 HOH 191 891 161 HOH HOH A . 
D 4 HOH 192 892 163 HOH HOH A . 
D 4 HOH 193 893 164 HOH HOH A . 
D 4 HOH 194 894 165 HOH HOH A . 
D 4 HOH 195 895 167 HOH HOH A . 
D 4 HOH 196 896 168 HOH HOH A . 
D 4 HOH 197 897 170 HOH HOH A . 
D 4 HOH 198 898 171 HOH HOH A . 
D 4 HOH 199 899 173 HOH HOH A . 
D 4 HOH 200 900 178 HOH HOH A . 
D 4 HOH 201 901 180 HOH HOH A . 
D 4 HOH 202 902 181 HOH HOH A . 
D 4 HOH 203 903 183 HOH HOH A . 
D 4 HOH 204 904 184 HOH HOH A . 
D 4 HOH 205 905 185 HOH HOH A . 
D 4 HOH 206 906 186 HOH HOH A . 
D 4 HOH 207 907 187 HOH HOH A . 
D 4 HOH 208 908 188 HOH HOH A . 
D 4 HOH 209 909 193 HOH HOH A . 
D 4 HOH 210 910 195 HOH HOH A . 
D 4 HOH 211 911 198 HOH HOH A . 
D 4 HOH 212 912 199 HOH HOH A . 
D 4 HOH 213 913 208 HOH HOH A . 
D 4 HOH 214 914 209 HOH HOH A . 
D 4 HOH 215 915 210 HOH HOH A . 
D 4 HOH 216 916 211 HOH HOH A . 
D 4 HOH 217 917 212 HOH HOH A . 
D 4 HOH 218 918 213 HOH HOH A . 
D 4 HOH 219 919 216 HOH HOH A . 
D 4 HOH 220 920 220 HOH HOH A . 
D 4 HOH 221 921 221 HOH HOH A . 
D 4 HOH 222 922 222 HOH HOH A . 
D 4 HOH 223 923 223 HOH HOH A . 
D 4 HOH 224 924 224 HOH HOH A . 
D 4 HOH 225 925 225 HOH HOH A . 
D 4 HOH 226 926 226 HOH HOH A . 
D 4 HOH 227 927 227 HOH HOH A . 
D 4 HOH 228 928 233 HOH HOH A . 
D 4 HOH 229 929 239 HOH HOH A . 
D 4 HOH 230 930 240 HOH HOH A . 
D 4 HOH 231 931 242 HOH HOH A . 
D 4 HOH 232 932 244 HOH HOH A . 
D 4 HOH 233 933 245 HOH HOH A . 
D 4 HOH 234 934 248 HOH HOH A . 
D 4 HOH 235 935 249 HOH HOH A . 
D 4 HOH 236 936 250 HOH HOH A . 
D 4 HOH 237 937 251 HOH HOH A . 
D 4 HOH 238 938 252 HOH HOH A . 
D 4 HOH 239 939 254 HOH HOH A . 
D 4 HOH 240 940 255 HOH HOH A . 
D 4 HOH 241 941 257 HOH HOH A . 
D 4 HOH 242 942 258 HOH HOH A . 
D 4 HOH 243 943 259 HOH HOH A . 
D 4 HOH 244 944 260 HOH HOH A . 
D 4 HOH 245 945 261 HOH HOH A . 
D 4 HOH 246 946 264 HOH HOH A . 
D 4 HOH 247 947 269 HOH HOH A . 
D 4 HOH 248 948 270 HOH HOH A . 
D 4 HOH 249 949 272 HOH HOH A . 
D 4 HOH 250 950 273 HOH HOH A . 
D 4 HOH 251 951 276 HOH HOH A . 
D 4 HOH 252 952 277 HOH HOH A . 
D 4 HOH 253 953 280 HOH HOH A . 
D 4 HOH 254 954 281 HOH HOH A . 
D 4 HOH 255 955 282 HOH HOH A . 
D 4 HOH 256 956 284 HOH HOH A . 
D 4 HOH 257 957 285 HOH HOH A . 
D 4 HOH 258 958 286 HOH HOH A . 
D 4 HOH 259 959 287 HOH HOH A . 
D 4 HOH 260 960 288 HOH HOH A . 
D 4 HOH 261 961 290 HOH HOH A . 
D 4 HOH 262 962 294 HOH HOH A . 
D 4 HOH 263 963 296 HOH HOH A . 
D 4 HOH 264 964 298 HOH HOH A . 
D 4 HOH 265 965 299 HOH HOH A . 
D 4 HOH 266 966 300 HOH HOH A . 
D 4 HOH 267 967 301 HOH HOH A . 
D 4 HOH 268 968 302 HOH HOH A . 
E 4 HOH 1   101 107 HOH HOH B . 
E 4 HOH 2   102 292 HOH HOH B . 
E 4 HOH 3   103 174 HOH HOH B . 
E 4 HOH 4   104 172 HOH HOH B . 
E 4 HOH 5   105 236 HOH HOH B . 
E 4 HOH 6   106 1   HOH HOH B . 
E 4 HOH 7   107 4   HOH HOH B . 
E 4 HOH 8   108 5   HOH HOH B . 
E 4 HOH 9   109 18  HOH HOH B . 
E 4 HOH 10  110 53  HOH HOH B . 
E 4 HOH 11  111 96  HOH HOH B . 
E 4 HOH 12  112 105 HOH HOH B . 
E 4 HOH 13  113 109 HOH HOH B . 
E 4 HOH 14  114 143 HOH HOH B . 
E 4 HOH 15  115 146 HOH HOH B . 
E 4 HOH 16  116 155 HOH HOH B . 
E 4 HOH 17  117 159 HOH HOH B . 
E 4 HOH 18  118 175 HOH HOH B . 
E 4 HOH 19  119 176 HOH HOH B . 
E 4 HOH 20  120 177 HOH HOH B . 
E 4 HOH 21  121 179 HOH HOH B . 
E 4 HOH 22  122 182 HOH HOH B . 
E 4 HOH 23  123 189 HOH HOH B . 
E 4 HOH 24  124 192 HOH HOH B . 
E 4 HOH 25  125 228 HOH HOH B . 
E 4 HOH 26  126 229 HOH HOH B . 
E 4 HOH 27  127 237 HOH HOH B . 
E 4 HOH 28  128 262 HOH HOH B . 
E 4 HOH 29  129 265 HOH HOH B . 
E 4 HOH 30  130 267 HOH HOH B . 
E 4 HOH 31  131 268 HOH HOH B . 
E 4 HOH 32  132 283 HOH HOH B . 
E 4 HOH 33  133 289 HOH HOH B . 
E 4 HOH 34  134 297 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3360  ? 
1 MORE         -28   ? 
1 'SSA (A^2)'  27360 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 400 ? A CYS 380 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 417 ? A CYS 397 ? 1_555 96.4  ? 
2 SG ? A CYS 400 ? A CYS 380 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 420 ? A CYS 400 ? 1_555 119.1 ? 
3 SG ? A CYS 417 ? A CYS 397 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 420 ? A CYS 400 ? 1_555 115.3 ? 
4 SG ? A CYS 400 ? A CYS 380 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 423 ? A CYS 403 ? 1_555 106.4 ? 
5 SG ? A CYS 417 ? A CYS 397 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 423 ? A CYS 403 ? 1_555 116.8 ? 
6 SG ? A CYS 420 ? A CYS 400 ? 1_555 ZN ? C ZN . ? A ZN 601 ? 1_555 SG ? A CYS 423 ? A CYS 403 ? 1_555 103.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-03-11 
2 'Structure model' 1 1 2015-03-25 
3 'Structure model' 1 2 2015-04-15 
4 'Structure model' 1 3 2015-04-22 
5 'Structure model' 1 4 2020-01-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Database references'        
4 5 'Structure model' 'Author supporting evidence' 
5 5 'Structure model' 'Database references'        
6 5 'Structure model' 'Derived calculations'       
7 5 'Structure model' Other                        
8 5 'Structure model' 'Source and taxonomy'        
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' citation              
2 5 'Structure model' entity_src_gen        
3 5 'Structure model' pdbx_audit_support    
4 5 'Structure model' pdbx_database_status  
5 5 'Structure model' pdbx_entity_src_syn   
6 5 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_citation.journal_id_CSD'                    
2 5 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
3 5 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
4 5 'Structure model' '_pdbx_entity_src_syn.pdbx_alt_source_flag'   
5 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   REFMAC 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                5.8.0071 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  A HOH 726 ? ? O A HOH 772 ? ? 2.08 
2 1 SG A CYS 56  ? ? O A HOH 861 ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 49  ? ? -74.97  -72.15 
2  1 ASP A 157 ? ? -148.08 -62.57 
3  1 ASP A 200 ? ? 32.05   60.76  
4  1 LYS A 222 ? ? -117.99 77.41  
5  1 ARG A 259 ? ? -69.82  6.91   
6  1 SER A 262 ? ? -65.34  95.53  
7  1 ASN A 301 ? ? -107.04 74.00  
8  1 ASN A 399 ? ? -148.36 52.78  
9  1 TYR A 458 ? ? -55.32  109.33 
10 1 GLN A 488 ? ? -106.11 64.70  
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 910 ? 6.79 . 
2 1 O ? B HOH 133 ? 8.33 . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1   
2  1 Y 1 A GLY -18 ? A GLY 2   
3  1 Y 1 A SER -17 ? A SER 3   
4  1 Y 1 A SER -16 ? A SER 4   
5  1 Y 1 A HIS -15 ? A HIS 5   
6  1 Y 1 A HIS -14 ? A HIS 6   
7  1 Y 1 A HIS -13 ? A HIS 7   
8  1 Y 1 A HIS -12 ? A HIS 8   
9  1 Y 1 A HIS -11 ? A HIS 9   
10 1 Y 1 A HIS -10 ? A HIS 10  
11 1 Y 1 A SER -9  ? A SER 11  
12 1 Y 1 A SER -8  ? A SER 12  
13 1 Y 1 A GLY -7  ? A GLY 13  
14 1 Y 1 A LEU -6  ? A LEU 14  
15 1 Y 1 A VAL -5  ? A VAL 15  
16 1 Y 1 A PRO -4  ? A PRO 16  
17 1 Y 1 A ARG -3  ? A ARG 17  
18 1 Y 1 A GLY -2  ? A GLY 18  
19 1 Y 1 A SER -1  ? A SER 19  
20 1 Y 1 A HIS 0   ? A HIS 20  
21 1 Y 1 A MET 1   ? A MET 21  
22 1 Y 1 A ALA 2   ? A ALA 22  
23 1 Y 1 A GLN 3   ? A GLN 23  
24 1 Y 1 A VAL 515 ? A VAL 535 
25 1 Y 1 A ALA 516 ? A ALA 536 
26 1 Y 1 A ALA 517 ? A ALA 537 
27 1 Y 1 A LEU 518 ? A LEU 538 
28 1 Y 1 A LYS 519 ? A LYS 539 
29 1 Y 1 A PRO 520 ? A PRO 540 
30 1 Y 1 A ARG 521 ? A ARG 541 
31 1 Y 1 B DC  1   ? B DC  1   
32 1 Y 1 B DG  2   ? B DG  2   
33 1 Y 1 B DT  12  ? B DT  12  
34 1 Y 1 B DA  13  ? B DA  13  
35 1 Y 1 B DT  34  ? B DT  34  
# 
_ndb_struct_conf_na.entry_id   4TMU 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 3  1_555 B DC 22 1_555 -0.503 -0.387 1.654  32.015 22.996  10.857 1 B_DG3:DC22_B  B 3  ? B 22 ? 19 1 
1 B DT 4  1_555 B DA 21 1_555 -0.329 -0.141 -0.245 -4.119 -7.288  -1.388 2 B_DT4:DA21_B  B 4  ? B 21 ? 20 1 
1 B DA 5  1_555 B DT 20 1_555 0.148  0.129  0.361  8.627  -13.862 9.121  3 B_DA5:DT20_B  B 5  ? B 20 ? 20 1 
1 B DG 6  1_555 B DC 19 1_555 0.124  0.119  0.040  7.531  -16.659 4.529  4 B_DG6:DC19_B  B 6  ? B 19 ? 19 1 
1 B DA 7  1_555 B DT 18 1_555 1.208  0.090  -0.677 6.366  -16.522 -5.609 5 B_DA7:DT18_B  B 7  ? B 18 ? 20 1 
1 B DA 8  1_555 B DT 17 1_555 0.172  -0.164 -0.438 1.011  -23.315 4.575  6 B_DA8:DT17_B  B 8  ? B 17 ? 20 1 
1 B DT 9  1_555 B DA 16 1_555 0.269  -0.119 0.137  -2.064 -20.496 7.284  7 B_DT9:DA16_B  B 9  ? B 16 ? 20 1 
1 B DT 10 1_555 B DA 15 1_555 0.241  0.128  0.055  -1.959 -12.101 9.757  8 B_DT10:DA15_B B 10 ? B 15 ? 20 1 
1 B DG 11 1_555 B DA 14 1_555 6.121  -3.199 1.927  10.488 -17.667 20.391 9 B_DG11:DA14_B B 11 ? B 14 ? 11 9 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 3  1_555 B DC 22 1_555 B DT 4  1_555 B DA 21 1_555 -0.912 -0.794 4.720 15.586 -9.577 39.065 0.273  3.452  4.160 -13.462 
-21.908 42.984 1 BB_DG3DT4:DA21DC22_BB   B 3  ? B 22 ? B 4  ? B 21 ? 
1 B DT 4  1_555 B DA 21 1_555 B DA 5  1_555 B DT 20 1_555 0.206  0.004  2.937 -7.007 17.526 29.663 -2.361 -1.289 2.459 30.640  
12.250  35.046 2 BB_DT4DA5:DT20DA21_BB   B 4  ? B 21 ? B 5  ? B 20 ? 
1 B DA 5  1_555 B DT 20 1_555 B DG 6  1_555 B DC 19 1_555 -0.527 0.398  3.342 1.409  0.114  32.536 0.690  1.189  3.318 0.203   
-2.514  32.565 3 BB_DA5DG6:DC19DT20_BB   B 5  ? B 20 ? B 6  ? B 19 ? 
1 B DG 6  1_555 B DC 19 1_555 B DA 7  1_555 B DT 18 1_555 -0.664 -0.072 3.286 3.966  2.018  44.201 -0.281 1.244  3.212 2.674   
-5.255  44.413 4 BB_DG6DA7:DT18DC19_BB   B 6  ? B 19 ? B 7  ? B 18 ? 
1 B DA 7  1_555 B DT 18 1_555 B DA 8  1_555 B DT 17 1_555 0.406  -0.371 3.303 -2.236 4.486  26.648 -1.920 -1.429 3.155 9.623   
4.796   27.107 5 BB_DA7DA8:DT17DT18_BB   B 7  ? B 18 ? B 8  ? B 17 ? 
1 B DA 8  1_555 B DT 17 1_555 B DT 9  1_555 B DA 16 1_555 0.434  -0.606 3.227 -4.339 -2.639 37.166 -0.602 -1.235 3.192 -4.117  
6.769   37.499 6 BB_DA8DT9:DA16DT17_BB   B 8  ? B 17 ? B 9  ? B 16 ? 
1 B DT 9  1_555 B DA 16 1_555 B DT 10 1_555 B DA 15 1_555 0.989  -0.203 3.185 4.136  -2.077 34.138 -0.022 -1.030 3.285 -3.517  
-7.005  34.441 7 BB_DT9DT10:DA15DA16_BB  B 9  ? B 16 ? B 10 ? B 15 ? 
1 B DT 10 1_555 B DA 15 1_555 B DG 11 1_555 B DA 14 1_555 0.967  3.039  3.596 2.582  13.142 71.214 2.061  -0.718 4.059 11.188  
-2.198  72.299 8 BB_DT10DG11:DA14DA15_BB B 10 ? B 15 ? B 11 ? B 14 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P41GM103399       1 
'Department of Energy (DOE, United States)'                                                'United States' DE-AC02-06CH11357 2 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM098885          3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'ZINC ION' ZN  
4 water      HOH 
#